1NKVA

X-ray structure of yjhp from e.coli northeast structural genomics research consortium (nesg) target er13
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
245
structure length
245
Chain Sequence
PRIFTISESEHRIHNPFTEEKYATLGRVLRMKPGTRILDLGSGSGEMLCTWARDHGITGTGIDMSSLFTAQAKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAGGFAGAEELLAQSLKPGGIMLIGEPYWRQLPATEEIAQACGVSSTSDFLTLPGLVGAFDDLGYDVVEMVLADQEGWDRYEAAKWLTMRRWLEANPDDDFAAEVRAELNIAPKRYVTYARECFGWGVFALIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN yjhP
publication title X-RAY STRUCTURE OF YJHP FROM E.COLI NORTHEAST STRUCTURAL GENOMICS RESEARCH CONSORTIUM (NESG) TARGET ER13
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 73
structure length 245
sequence length 245
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nkvA00
3PX3A 4GOOD 3PTAA 1T43A 1DL5A 1RI3A 2AN5A 1VP3A 3SVZA 4DZRA 3B89A 2IBSA 2P35A 5KS2A 2ZIGA 5K8VA 3NDIA 3QOXA 2PT9A 5ERGB 4XUEA 4RTSA 2ZZMA 1KP9A 3KQYA 5FULA 1AQJA 3UZUA 4CXMA 2VZ9A 4FGZA 4P7KA 4ER5A 3I5UA 3G89A 5CVDA 1TPYA 3E7PA 2PT6A 3E05A 3M6WA 1JG1A 2ZW9A 4WVLA 2IPXA 2DPMA 2JHPA 3IYLW 4LWOA 2OYRA 3UBTA 1JQ3A 4HC4A 1D2GA 2IDJA 1I9GA 3HCBA 1FP2A 2P3OA 4PYOA 1XJ5A 1YZHA 2EJUA 2ZBPA 1AF7A 3AXSA 4NECA 4M38A 3TM5A 4X41A 4AZVA 4YMHA 5LQUA 4OX9Y 1AV6A 2YXLA 4P58A 3M6XA 2PBFA 2Q41A 3JWJA 2IH4A 1VPTA 4GQBA 3P97A 1VL5A 3E23A 3A27A 4QTTB 1NW5A 3JWHA 3KPWA 5EIWA 4RTJA 2FCAA 4FR0A 1QYRA 3FYCA 3NJRA 1EQAA 3HNRA 3G5TA 4POOA 1XDZA 5K0CA 2ZLBA 4FP9A 2ZIFA 4V0QA 4P7FA 4YMGA 2GLUA 1KYZA 2LD4A 3FYDA 3LHDA 2HMYB 4C07A 5DXJA 4YV0A 5LQAA 2C7RA 1EAMA 3NVMB 3DLIA 1VP9A 1NT2A 1BC5A 3EVEA 5EIFA 4ER0A 2VS1A 2OBFA 3DR5A 2ZTHA 2GH1A 3VC1A 2OY0A 1M6EX 1NBHA 2AOWA 1R8XA 3A4TA 3EVGA 4DMGA 5C0OE 3OU7A 1INLA 1PJZA 2BR5A 1L3CA 3PT9A 4RTOA 2ZBRA 2C7QA 1N2XA 4KVZA 1HMYA 4R6XA 5LSAA 4GOND 3HEMA 5K0NA 2P41A 3BWCA 5K09A 5EG5A 5E1DA 4LWPA 1B42A 3SX0A 4E31A 4AZSA 5F2NA 5LQNA 1WY7A 2C7PA 1VBFA 3C3YA 4BP1A 3BXOA 5DX0A 3KR2A 3LX6A 4YUVA 1P91A 1VLMA 2FK8A 4C4AA 4YUXA 3BWMA 1UWVA 3A25A 2PLWA 4KW7A 4OBXA 5CVJA 5GM1A 1XXLA 2VDUE 2Z6QA 2ONYA 3HCCA 3OE4A 3FTCA 3KQSA 4E30A 5FQNA 2Y1XA 3DXZA 3E8SA 4Z2YA 3A7DA 5K05A 3FPFA 3IHTA 2AS0A 5IH3A 3KU1A 4XUCA 3GWZA 2YR0A 4PNEA 4CKCA 4RTMA 1L9KA 3ANXA 3UJ7A 2C7OA 3B7PA 5DLYA 1NV9A 5CD1A 3EVAA 4CWAA 2VP3A 2PXXA 4OA8A 1VIDA 3QOWA 5U4XA 3SM3A 3HA3A 3HA7A 4QPPA 3EEYA 1RI2A 2AOUA 2HR1A 3FPHA 3PB3A 4PYLA 4V0RA 2PY6A 3O7WA 5DM0A 3EVFA 5E9JA 1JQEA 3DULA 2P3LA 2AZTA 1NV8A 3KHKA 3I64A 2ZZNA 3VSEA 2YUIA 3PFHA 3F4KA 2PGXA 3MB5A 1BOOA 2PXCA 5GIOE 2IBTA 4YUYA 5BW4A 4HGZA 3MGGA 4GC9A 4OQDA 1I1NA 5FHRA 3HCDA 2N47A 2KW5A 5FQOA 3SSMA 4E2YA 4DKJA 1JTEA 2XVAA 2B25A 1NW8A 3GDHA 4IV8A 4A6EA 4QVKA 1IXKA 2ESRA 3CKKA 2BZGA 3TKYA 2ERCA 4HGYA 4HRAA 3B5IA 4EKIA 3VYWA 5HEKA 3MERA 1SUSA 5HZMA 4PWYA 1H1DA 3O4FA 3EVCA 2AVNA 3ELYA 3P71T 4IWNA 3FUWA 2UYOA 5BW5A 3CVOA 3GGDA 1V39A 3CGGA 2FPOA 3FPEA 3GU3A 4HG2A 3UJ8A 4CKBA 5C9ZA 5ICEA 3GRYA 5CM2Z 3UJAA 5GINE 2P3QA 4O29A 2DULA 4C06A 3M33A 2NXNA 3P2IA 4R6WA 3BGIA 1YUBA 4Y30A 5K03A 1QAQA 4RVGA 5E9WA 1VE3A 1WZNA 3DXYA 3G8BA 4MHTA 5DPMA 2PWYA 5DRTA 2ORED 4AX8A 3BGDA 4P7JA 4F85A 4HH4A 3IV6A 3KQWA 2IH5A 5MHTA 4CKEA 3HVJA 4RX1A 3B3FA 5FTWA 3SXJA 1G6Q1 2PVCA 4MTLA 4IV0A 4RV9A 2JJQA 2EJTA 4QDJA 3EGIA 3IEIA 5HIJA 5D1NA 3FUXA 5KYGA 3LBYA 2CKDA 5FUBA 1FJXA 2QE6A 3G7UA 3UJ6A 3PFGA 4E33A 2OZVA 1F3LA 3HTXA 2NYUA 2K4MA 5FWAA 3SSNA 4C05A 5EKUA 3DP7A 5DXAA 5EOVA 1SKMA 4C03A 1QANA 3MAGA 3MTIA 2NXJA 3DMGA 4FT2A 3SMQA 2NNWB 5DRYA 3LCCA 3T0IA 4OA5A 4E32A 3G8AA 1G60A 3I9FA 3Q7EA 4F84A 3ER8A 4BLUA 2O07A 2B2CA 1I4WA 1X1CA 2BM9A 5EMKA 3T7RA 1FP1D 3BUSA 5DM4A 1YFJA 3AY0A 1KXZA 4L7VA 1NW3A 2G70A 4WXHA 1N7JA 4FS8A 2OXTA 4EMSA 3AWIA 2PSSA 1BKYA 2QYOA 5DM2A 3VC2A 3LDGA 2O05A 5F2OA 2H00A 3NWBA 2ZWVA 3EVZA 2NXCA 3GO4A 5FA8A 1Q0TA 1R74A 2QY6A 3BZBA 3GRZA 4X61A 4XUDA 1M0EA 2PWPA 2PX2A 3P2EA 2PV0A 5E1BA 5K0JA 1SQGA 2H11A 3FPGA 5DTRA 3PVCA 2YXEA 3HVKA 3UJCA 4PCAA 5CVUA 3TOSA 2P7HA 1UIRA 5E9QA 3M6UA 2GB4A 2HWKA 2B78A 5HIMA 3OE5A 1M6YA 3SSOA 1BHJA 4MIKA 4R8SA 3UWPA 4DQ0A 5LQKA 2I9KA 2G8NA 2WA1A 2PKWA 2P40A 3KQVA 5K01A 4EKGA 4YV2A 1AQIA 3OU2A 5T6BA 1KYWA 2FHPA 3V8VA 3KR9A 4M37A 4FSDA 3EVDA 3PLAE 3AJDA 3T7TA 1X1AA 2E5WA 1R00A 3V97A 2WK1A 3LSTA 1XVAA 3OFJA 3GRRA 4KDRA 1WXWA 3FRIA 4P7GA 1PRYA 3UJDA 4X63A 4QTUB 3DMHA 1TW3A 4QQNA 4PCLA 2ZIEA 3G88A 3OZTA 2YVLA 3FUUA 3HVHA 2G71A 9MHTA 3OZRA 2GAFA 1MJFA 1KR5A 4QPNA 2QM3A 5EHIA 3RODA 5DTQA 3RIEA 3MCZA 3UFBA 4RWZA 1JTFA 4DM3A 4EVIA 3DXXA 4AZTA 3LKDA 4YUWA 5HIIA 1YB2A 4RVDA 5KQRA 4HSGA 5CCBA 5HIKA 2GA9A 3PS9A 2BR4A 1ORIA 4KRGA 1L1EA 2OPBA 3G2OA 4GOLD 2AN4A 3LDUA 4IKPA 4KIGA 4PYQA 4RTQA 5K0EA 7MHTA 1ZKDA 3KQQA 1P39A 3A26A 2IDKA 1X1DA 3GCZA 4YUZA 4H0NA 2AOTA 2VDWA 4RVFA 5FADA 2QRVA 3GJYA 5HFJA 5T67A 3GIWA 1WS6A 3C6MA 1NW6A 2HV9A 1JSXA 3CJTA 1HNNA 3KPUA 3P2KA 5GOZA 2I62A 3BKWA 4KIFA 4PGGA 4PIMA 5E8JA 1ORHA 1RI4A 2PX5A 3CJRA 4PINA 5M5BA 2IH2A 4HTFA 5IKMA 4ER6A 1TW2A 2VDVE 2XVMA 1DUSA 2P8JA 4PYMA 5CVEA 3TQSA 4BY9E 1O9HA 3HCEA 5EVJA 3U81A 3I53A 4QQKA 4X1OA 5ICFA 1ZQ9A 3DUWA 3UJ9A 2Z6UA 5EPEA 1UFKA 2O57A 1Y8CA 1SG9A 5B1SA 4FT4A 3KPJA 2EFJA 3BKXA 4GF5A 3M70A 5JR3A 3R0QA 4FSXA 5DSXA 3EGEA 4AUKA 5CUQA 1EIZA 2IGTA 5EGSA 3REOA 4U7PB 5DTMA 3EMBA 2AOUB 4R05A 3EVBA 2R3SA 5D1HA 1EJ6A 2JHCA 3FUTA 3GRVA 5JUWA 1JQDA 4LECA 3HCAA 1RJGA 4ER3A 1NBIA 8MHTA 2AN3A 3GNLA 3M6VA 4RTNA 1RI5A 1JSZA 5FCDA 1L3BA 4GBED 4DCGA 5HILA 2R6ZA 1ZHFA 2ZULA 2V7EA 3G2PA 4OBWA 4G56A 3P9KA 1G38A 5K0BA 3I58A 4PYKA 3QV2A 3LDFA 2ZWAA 1EG2A 4Y2HA 2WA2A 5EMJA 3HP7A 2HTEA 3K6RA 3NDJA 5EZSA 2AOXA 1KPHA 2B9EA 4E2ZA 3TLJA 3ER9A 5DM1A 2PJDA 3TM4A 3LL7A 5G02A 3PX2A 3TPZA 2UZ4A 5GWXA 3DTNA 4C08A 1X19A 5EZQA 3OCJA 2AVDA 5EEHA 3R3HA 3OPNA 1YF3A 5T64A 2JH9A 2NXEA 2IIPA 3P9CA 5FWDA 2XYVA 1U2ZA 1XDUA 3GRUA 5LQCA 3C3PA 3FTDA 3MQ2A 3GXOA 2P7IA 2O06A 4CTJA 1X1BA 2G72A 3HA5A 3KQMA 5K0FA 5DT2A 5E8RA 3T7SA 4E2WA 3H2BA 3K0BA 2CWWA 2EG5A 3BWBA 4M36A 4QVGA 3THSA 2XYQA 4DCMA 3LCVB 1XDSA 3C6KA 2ZFUA 3KQPA 2XBMA 5EHGA 1F38A 2OB2A 3DOUA 3NW9A 3HVIA 3SGLA 2JHAA 2FRXA 1FBNA 3BWYA 3MHTA 3CC8A 4ER7A 3P9NA 2YTZA 3KQOA 3LKZA 1P1BA 3FPJA 3ME5A 3A7EA 4LG1A 4BP3A 1EJ0A 5E1MA 1YZ3A 2ZZKA 3OZSA 5EMMA 5GP1A 1O54A 3FTEA 1N7IA 3ID6C 1G55A 3LECA 4K6MA 5DX1A 3LPMA 3G2QA 3LGAA 4PGHA 3DLCA 2PX4A 2IFTA 2XYRA 3G2MA 3LBFA 5DSTA 4F86A 2CL5A 2Z6AA 4OQEA 1Z3CA 2I6GA 1RJFA 4U7TB 3X0DA 3HCFA 1D2CA 3BT7A 1OR8A 2ZVJA 3P9IA 4ZTBA 1D2HA 1XCJA 2NP7A 4XCXA 3EMDA 5H02A 1FPQA 2PX8A 3ERCA 5K0LA 1VQ1A 2V74B 2CMHA 3M4XA 2CMGA 3KPYA 3ORHA 1NE2A 1XCLA 4PIPA 5P8WA 3THRA 2EX4A 3WSTA 4RTRA 3EEOA 1WXXA 3R6TA 5E1OA 4EQZA 5KQSA 1KPIA 2Y1WA 4BLWA 2BM8A 4GOMD 3OFKA 1JG4A 1RJDA 1ZGJA 3NWEA 4RSRA 2G1PA 3ELDA 4RTLA 1G8SA 1ZG3A 3TR6A 4BLVA 3HM2A 5EQJB 1XTPA 3TRKA 4C04A 4A6DA 2O0LA 2FYTA 3B3GA 2H1RA 4RTKA 1R18A 1DCTA 4CTKA 3LCUA 5EC8A 5CIYA 5C1IA 1IM8A 4PONA 5E2AA 3C0KA 2OB1A 5HOQA 4PYNA 3ELUA 3OU6A 3BGVA 1SQFA 4EK9A 1MHTA 5LQRA 2GS9A 2JG3A 1G8AA 2B3TA 5DWQA 4PYIA 1R6AA 2IP2A 2YQZA 3MTEA 10MHA 4DF3A 5ICCA 3KR0A 1JR4A 4RVHA 3NVKI 2AOVA 5FHQA 3TMAA 3D2LA 3FTFA 4E2XA 1O9GA 2BR3A 5K0GA 5DX8A 4KWCA 1ZGAA 5BXYA 4DA4A 3UJBA 2I7CA 3CCFA 2ZCJA 1NKVA 3AXTA 2ZBQA 3FRHA 5EMLA 3SR4A 1RJEA 3R9XB 4E70A 3S68A 3TKAA 1JG2A 3KKZA 1KHHA 5EKXA 2A14A 4PYJA 1YFLA 3MCTA 3CBGA 3RW9A 4YV1A 1Q0SA 2FK7A 2BH2A 5GIPE 3NMUF 3L8DA 4GEKA 5FA5A 5E2BA 4QDKA 3Q87B 4GUAA 2NP6A 1NW7A 1QAMA 1R8YA 2YX1A 4MWZA 4ISCA 3DH0A 4GC5A 1SUIA 2F8LA 4RTPA 1L3IA 3NTVA 2YXDA 3KPVA 2ZSUA 3P8ZA 3G5LA 2P1DA 2PXAA 5GM2A 3JWIA 3CJQA 3EPPA 5CCXA 3B3JA 5F2KA 5CVVA 3JWGA 5KVAA 2AOTB 2ADMA 1QAOA 2QRVB 4AZWA 2UYHA 1KPGA 4M7RA 3O31A 4R8RA 5ICGA 2OO3A 4JXJA 3TFWA 3FUVA 1JG3A 3FZGA 4MQ4A 5EEGA 3UA4A 2UYCA 4B17A 1WG8A 2UYQA 3DMFA 4ATNA 2HNKA 5LQJA 4HTFB 2AR0A 4KDCA 2GPYA 2ONZA 4FZVA 1IY9A 1SVUA 3KQTA 1P1CA 2JH8A 2OKCA 3R24A 4X60A 3UA3A 5BP7A 5LR6A 1RI1A 1KIAA 3ELWA 1QZZA 3KR1A 4RYLA 3EGVA 4UOEA
chains in the Genus database with same CATH superfamily
2Y0CA 4RVNA 3OHPA 3ZW8A 1VL1A 3V55A 3RIMA 3VHXB 1MJHA 2ZRIA 5BY2A 2ZYUX 1W9MA 4U7FA 3WX0A 4C4YA 4ABTA 1EK5A 2R0QC 2BEWA 2V9CA 3LNTA 4QYSA 1E64A 4RTSA 4MK4A 1RKVA 3GEPA 4IAOA 2Z6AA 4JB2A 4TKUA 5BQOA 3QYAA 1TF7A 2ORVA 3ILSA 4FGZA 5NULA 4Q3KA 4ENQA 1I9CA 1GTJ1 1S2OA 2I7VA 1PGOA 2JJ2A 1JH8A 1S7GA 2PT6A 3EXG2 3M6WA 4HWTA 5A4MS 3R44A 4MUBA 2JFYA 2O3TA 3EZYA 2H31A 4FINA 3FVTA 4CUKA 1MB9A 1JQ3A 3K0CC 3ADDA 4BO0A 4FMCF 1FZQA 4QNNA 1Q0RA 4MQUA 4QBKA 2G1UA 4PYOA 4UOQA 5BYJA 2QUZA 3BXHA 2B92A 3A4IA 2OE2A 2W11A 3AXSA 4BB5A 2LDBA 3RS5A 1W5SA 2BBSA 2FXVA 1P0FA 1URPA 4R3NA 5F73A 1R5JA 1PBTA 2PBFA 1AE1A 2VDQB 3N70A 3UHAA 4C0HA 1B8NA 2BSXA 3IKLA 4GQBA 3FCEA 4TL8A 1D1TA 5C3MA 3F5DA 5M34A 3KHUA 3O93A 1TT5A 5JISA 3RFCA 3RJMA 4BQPA 1NW5A 3R3YA 4NMLA 5CHEA 1OB5A 1DAHA 2F64A 1JBEA 2WF7A 4C21A 4QOEA 3WMRA 5A4AA 5IT0A 3PR1A 1RWPA 3HNRA 1WE2A 5BNZA 3HBJA 3TOCA 3EOBI 4ZO6A 1KYZA 3EZ2A 1BRTA 2RB4A 2QIOA 1XGKA 5LQAA 4WCFC 5AW1A 4CGZA 2I4OA 3AIIA 2X5KO 2LKCA 2FFJA 3OMLA 4DIKA 2WY2D 1EBBA 1C81A 2P9BA 1SBNE 5DCYA 4ERNA 2VHJA 1E6LA 1M6EX 3A4TA 3L7LA 4PZ0A 3STYA 2FFQA 3A10A 3RVKA 2C7QA 3RC2A 2X9LA 3OZIA 2DG2A 5LYYA 2VFAA 3L7MA 5LWHA 2IZ7A 1J33A 3EB9A 2WWTA 5FI0B 4G0MA 3AVPA 4Y9SA 1Z4PX 1BDJA 3LBNA 3S2FA 3GARA 4DSOA 1E5QA 3NIBA 4XFDA 2X0FA 1QG2A 5JSUA 4O2BF 3UFXB 2FLWA 2V7UA 3KLNA 4G2TA 4KX5A 5DYNA 3FWKA 1E32A 5EIBC 4AP6A 1Z5GA 2QD4A 5ITSA 3GX1A 3PIIA 3QP9A 3ZR4B 1VBMA 3ZQ4A 4DGSA 1T9GR 5IJWA 5LFAA 3PEFA 3L7JA 4YRGA 1W7AA 2NU7A 3MNFA 3R5TA 1HDRA 4KWHA 3NH9A 3W9BA 4XFKA 3VVBA 2QE7D 1SN7A 2XB2A 3FOCA 1Z68A 4X64B 3KYBA 3L06A 2BCGY 2P2GA 3B6ZA 2YIDA 1E1RA 4RO0A 2HFKA 2QU7A 2MMCA 1GPUA 3LPAA 4MW9A 5EPUA 4J0GA 1T24A 4GI1A 4UTNA 2DPHA 3NUZA 2ODEA 2ZOSA 3BORA 1L4HA 3BXPA 1NP6A 3HA7A 1XRQA 4JKYA 2HR1A 3TI9A 3GDFA 1NY5A 2VSOA 2C1ZA 4J2OA 1KBOA 1LS1A 3O90A 3AEQB 3QKRA 2JFPA 5D85A 3WLHA 3LCRA 4EG4A 2ZJ7A 3D5EA 1P7ZA 1V8ZA 2EFCB 4PS1A 1JQEA 3I2JA 5E9JA 1CCWA 1L7PA 3NDRA 1YVPA 1SVNA 4CU5A 2A0UA 1HTTA 1W85A 2X40A 3EIFA 4LXIA 4PC2A 1WBJB 3S44A 4DJTA 5IAAA 2P9YA 4EAAA 1X74A 5JDCA 1KZ9A 3HP4A 3AR6A 4M6WA 4RADA 3VNRA 5AVOA 4IH4A 3M3HA 1Q2UA 4DJDC 1RHJA 3UHJA 4G8CA 3HJHA 3WGJA 1PSWA 2FSSA 3P0IA 3M7IA 3N2KA 3LXMA 4O4JA 1C9YA 4UDYX 4BL5A 1F2UB 3QMPA 1MW8X 1JG6A 2KS6A 4GLJA 1L7AA 3EVCA 2IUSA 3IP3A 3P71T 4ZJUA 2UYOA 1TKRA 4G01B 4I4IA 1THZA 4TKVB 4AYXA 1L5HB 4LDJA 3PQ4A 1E6WA 2XUPA 3FY4A 4JP2A 3I2FA 3RQIA 1G1MA 2YZGA 2EAUA 1EFPB 4KO3S 4EHDA 4AY6A 1JR3D 1WV0A 3K92A 1P44A 4LYHA 1RADA 2OOSA 2XUKA 4K6FA 5HDBB 3PWKA 3O5AA 3QHAA 3HI4A 4EF6A 2O5CA 1T9AA 2O3SA 2RBKA 1K5DA 4G0XA 3G13A 4OFWA 4LBZA 4XWGA 5ALFA 3WMFA 4XD7D 1QYCA 3H2YA 3WG9A 3Q0IA 1IOVA 4M9ZA 2HJHA 4RX1A 3WBBA 4B0PA 4FK8A 2NYVA 4YYZA 2ZJAA 3IPRA 4Q3OA 4FHGA 5H16A 5KDDA 4A26A 1MT0A 2FN8A 2PL5A 4IV0A 2HW8A 1DTWB 2AI3A 1TKBA 4FWBA 4BVEA 3IEIA 4DLRA 2YKGA 4B3DA 5CA0B 4BXOB 3GD7A 4J8PA 5FUBA 3ESCA 3E22B 2BMEA 1KMHB 3WXMA 3X3HA 3FWHA 3GLGE 1IL0A 1KO7A 3ZWBA 4C0XA 1UFVA 1Y6JA 3E9MA 5DXAA 3GCDA 4PLFA 3MT0A 1A1VA 4RZIA 2Z2YA 2PIDA 1RBQA 4KE6A 4A8PA 3PR3A 3GZJA 4KNYA 1CEYA 3ZNOA 5AQ1A 1E9VA 3D59A 4V2IA 2JIZD 3Q7EA 1CULC 3WADA 4DMFA 3Q8LA 4KO8A 4GMKA 5EP3A 1I4WA 2BM9A 3V8PA 3BUSA 1PWXA 3EGWA 5HR5A 1VC2A 3MIIA 1T5SA 3FGOA 3FJYA 3LPNA 3VZPA 1FLNA 1E1QA 1IUOA 1BWPA 2WP8J 4A03A 4HFMA 4FS8A 4MEJA 4C0QC 1H5NA 1TA9A 3AWIA 4JP1A 4R0NA 2DQSA 2VOJA 1T2AA 2L17A 2RGYA 2QRKA 3WGMA 3EVZA 2ATIA 3GO4A 5IT5A 1GUFA 2Z9CA 3RS9A 1WD7A 3WLFA 4PC6A 3DT6A 4MWEA 521PA 2FNAA 5J2TA 4URFA 1AHPA 3QWHA 1XMVA 5BUQA 4LAFA 4LRYA 1UKEA 4F3NA 1L4GA 5FH9A 4ZJPA 5IP5A 3ZJUA 5EE0A 1LSOA 3IQIX 3K8YA 3OTIA 3BMOA 3MTQA 5IHPA 4J1TA 2W42A 3BFJA 1GAWA 3O03A 4Q4LA 5TXGA 1SCIA 3H17A 1L0BA 2DQZA 3D2AA 2H5LA 2R6DA 1M8PA 2Z4SA 3EASA 4E15A 3QXXA 3TTYA 5JU6A 4PAWA 5KNBD 1JLHA 3IO5A 1AUQA 4YGXB 3CH4B 3L93A 1WU7A 3G0BA 1A7JA 3KFXA 5CW1A 4DARA 1SD2A 3L6OO 3VZBA 1K6XA 4ND6A 3ZHZA 1HDOA 4JGIA 4YCLA 1JE1A 1SBIA 1CQXA 5C37A 2YZKA 2GBIA 3RYFB 1K8XB 2VBFA 5C1DA 1QPGA 3DR3A 6NULA 1YCGA 3TLYA 3OIGA 1X1QA 1Z56C 3DLTA 3H5OA 2Q5JA 4WLFA 3PNOA 4IG9A 3IE1A 2G71A 2Y4OA 4ZCMA 5CG2A 1NKSA 1UM8A 1FTNA 4J1SA 5E6SB 3AVUA 2X1HA 3SLRA 3U80A 4AUNA 4DDTA 2OBLA 5DTQA 1ZWKA 3W3AH 1S8FA 3DFUA 4BFCA 2UUCB 1XROA 1RVDA 1EK1A 2I6SA 4YCSA 2YJ3A 1R0KA 3KOYA 4EPTA 4KO1S 1M33A 3MOGA 4I50B 4MQFB 4CIWA 4CHGA 1IPHA 2OAGA 2B21A 4WXEA 1THTA 5AM0A 4EY8A 3HVRA 2UXDB 3TZCA 5JYBA 2D5LA 4LZZA 3HLYA 4C0LA 4YMVA 4S1NA 3A4YA 3IIKA 4FPXA 5HM6A 2PZKA 3CRMA 5EXXA 4A4DA 3ASZA 2AW5A 1V1MB 4PIMA 3SYNA 3UQZA 4EPYA 3D02A 4E1BA 1E9AA 3HU3A 2BFDA 1KZHA 1Y3CE 1XE3A 3USCS 1O5IA 1E3SA 4OJMX 4MZXA 1XTSA 4OSEA 2VP6A 1R15A 3FWNA 2QD2A 3UQYS 3KLMX 4F3TA 2X8AA 1X87A 4GZ5A 3RTEA 3A3PA 1M7BA 2O1WA 1VLLA 1E0DA 1UFKA 2E1PA 1P2TA 1JHPA 2GPJA 4KLZA 4R1OA 3TLMA 2WIJA 3IRVA 3WP0A 4EUFA 1BX0A 4A5OA 4RLFA 5ALYA 4I6EA 2IGTA 3X1MA 3K9QO 4DQVA 1Z62A 2V6IA 3EN0A 1ZLYA 4RZ3A 3AZQA 4R05A 3FNEA 3IE0A 3U39A 8AT1A 4UU1A 1A04A 1IONA 1UJ6A 4UHKA 4ENVA 1DKUA 4BRUA 2QT9A 2O3RA 3V34A 2BFBA 1XEXA 5GZ1A 4Y6SA 1VB3A 2XT0A 3RKSA 1AQNA 4Z3OA 3F49S 1MRNA 4GUDA 1KQGA 2WYUA 3B3QA 3G2PA 1MO2A 2BEVA 1Q5PA 3R40A 4CTKA 4RIFA 4JUDX 3HCRA 2RGDA 4JVNA 2H7YA 4UJ5A 1NYLA 2QP3A 4L6AA 1CU1A 1XXHE 3ABOB 3ENKA 5EZSA 4JI6B 4B2PA 4DVGA 1WVGA 1Z0IA 3GUCA 2FR1A 5DM1A 3AHCA 1EBUA 1FTGA 4DDKA 4D0SA 1NJ8A 1V9SA 3CNEA 5ECGC 4TYMA 3RRBA 1DDGA 1AUOA 1M2VA 1X19A 2NNLD 4FXOA 5FORA 3FZNA 1ZD5A 3PTZA 5A3JA 2V4MA 3GJ7A 4NCIA 2R7AA 1P1KA 2EBUA 3LP8A 4HX9A 1SIBE 2O7VA 1M0SA 1ODTC 3GLHA 1PW7A 3P9CA 5AJHA 4C3VA 3ABRB 1ZOLA 2C78A 2C5GA 2C3UA 4L2IB 1CRWG 1GRQA 1KORA 2P7IA 2WU3A 1PYOA 3QVXA 4G24A 3KKKA 4WZAE 2A5JA 3UM9A 5E8RA 2HUNA 5K0FA 3TH5A 3KYDA 4W1RA 3EULA 4R8LA 5I7EA 4NS4A 4RU1A 1SCUB 2JFBA 2CCGA 3ET5A 4LY6A 4ND1A 5AHKA 4D56A 5A04A 1OFUA 4QJ4A 2XBMA 1K8QA 4D3XA 2IYVA 1J8MF 2A30A 2XDWA 1MRSA 1QC5A 3BJMA 1V7ZA 4NPCA 3UANA 3ZH9B 4CVNA 3BWYA 2O8CB 4TROA 3KTAA 1I3MA 1NBMD 1QH9A 2ZI4A 3ME5A 3ZK7A 4EY3A 3KSUA 4OHCA 5AXCA 2IS4A 1BQEA 5SZKB 4YMWA 3A6KA 1L9XA 1TVKA 4PBRA 1X7WA 2B2XA 4I1YA 1YCDA 4EUNA 3B7GA 3STHA 2P6MA 1RPNA 4IGIA 4F86A 3BXEA 1XMOB 5DSTA 4ROSA 2IUUA 2ZR9A 1EK0A 1KI8A 1Z3CA 3L8GA 1ISJA 1X7DA 4I19A 3UAOA 3KUCA 2FUG6 4F4UA 3RS7A 1N3LA 1ZR4A 3WQBA 3FA2A 1OC2A 1Z08A 1U0HC 1QRDA 2VHCA 1IN7A 3ZCTA 4WDQA 7MDHA 4CR8A 3UUFA 2C2XA 3EXEA 4OK3A 1B41A 4L6IA 1NX9A 2PRIA 4EQ6A 1XCLA 2AQIA 2WF9A 4DJJA 1YQEA 4Z1MD 4FFWA 4UUQA 2Z04A 3EBLA 1XP5A 2ONJA 5JYEA 1M2OA 4RF4A 1KYTA 2W83A 4I4TA 4X8OA 4XM1A 1OZAA 4MKHA 3DFIA 2I34A 4NRDA 4TZTA 4LE2A 1M34A 4HTAA 3RC3A 4DYHA 1MNQA 4YAKA 3H2ZA 5KTPA 5YASA 3ABSB 2Q5LA 2O0LA 4FXPA 4Q18A 4OXKA 5D5PA 1B74A 5C80A 4HRYA 3BICA 4RFSB 5E2AA 4RY8A 1GCOA 2Q5EA 2OB1A 5HOQA 2VP4A 2B82A 4I1VA 4ZEXA 3BGVA 3OWXA 3JARB 2XMDA 1WUTA 3LA8A 1FUEA 3IPAA 4LDAA 4RSHA 1MD9A 3EC1A 1YR7A 3IAXA 1H9CA 2CXOA 1JR4A 1M6NA 5EHQA 3E3AA 1Y7TA 4BV2A 2B7CA 2XDYA 4D2IA 4ZIRA 2XQJA 5LNK6 4FGWA 2IUFA 2GK4A 2Q2OA 1PTJC 2WHRA 4D0RA 1XZCA 4FGUA 4R9VA 2XQFA 3TSYA 4F3RA 1NLYA 5JZVA 1GN8A 2GILA 2XMBA 1RKQA 1IJFA 2A59A 3O38A 3H5LA 1XZ8A 4KSYA 2ADOA 3B6KA 1GPWB 1KFJB 2QD5A 3CBGA 5EMNA 3WLQA 4ASUA 4WBNF 3PWZA 1ZW6A 3O74A 1SFRA 3DBRB 3HRKA 4LUCA 4OFZA 1UXHA 4JQOA 5DBGA 3LUHA 5E2BA 5HW0A 1YKFA 4JXXA 1VHLA 2RIPA 3U2QA 4BNWA 4FR5A 1YS9A 2XD9A 1JLRA 1C29B 2Q21A 4YO8A 4ZO9A 5KOHA 4AZ0A 4K3VA 1US8B 1Z7YA 4P4LA 2VRCD 5BN1A 1FW6A 5B7GA 4L50A 2NO4A 3F90A 4LX8A 1YZYA 3ANNA 3KPVA 3N7AA 1QKJA 2RARA 3KV3O 3QWIA 2GRAA 4H3VA 4MJXA 1X77A 4GSLA 2Y9PB 4FBLA 4B8WA 2X0KA 2YINC 3CRW1 3ITEA 5KVAA 3KYIB 3H6KA 5BR4A 2OHGA 5D87A 3RLIA 5JAIA 4JT4A 1BWRA 3ESYA 3MXOA 1C7JA 5JWRA 4KACA 3HXOA 5E0OA 5CXUA 3B12A 2JCBA 1X86B 4QHTA 3COPA 3HUTA 3O4VA 3PI6A 4ATNA 5BQPA 1N7GA 1OLSA 2ZQ5A 1MG0A 4ES6A 4OQ4A 5E7QA 1W5BA 4E12A 3E8MA 5AFSA 4RXUA 4NARA 3IXMA 4I1IA 4CLRA 4U0JA 2C97A 5LR6A 4PGFA 1FC0A 5ALDA 4O1IA 5IVPA 1BRMA 4ZVOA 4RYLA 3CE9A 4TS3A 2Z4TA 3IUNA 2QXTA 2FJUA 3BM5A 3PDCA 3D6JA 4F1WA 2AD1A 2OUKA 3JQFC 2ZKIA 3ZN2A 2ID4A 2J9FB 4LDZA 1KF0A 1QLWA 1E5DA 4V1CA 3OF5A 1GNRA 3H3JA 1MDBA 1EFTA 4FNOA 1NP7A 7AT1A 5LZ2A 5DNEA 3ORSA 1EVIA 4OVKA 2OILA 4I8XA 2DQKA 3UZUA 1DQNA 3SXUB 1MNAA 1OCEA 3ETGA 4TGLA 4CXMA 1C1YA 4MJ3A 2IS1A 3E7PA 3LUGA 3E05A 2ORIA 4WVLA 2I4IA 3W0LB 5KJ6A 5DFAA 2P9TA 3CFYA 5F7OA 1L4UA 1NNI1 3FGNA 1VYHA 2YJTD 1NJ2A 4PIVA 5CLIA 1FNCA 1TU0A 2B7BA 4OATA 5HZHA 4ZC1A 1GDTA 1OPRA 2G4CA 2L2QA 1PV2A 3MWFA 3S4YA 4U7DA 3HADA 4LYGA 5C7LO 4DMMA 2KLBA 1DKNA 1GOTA 1NU8A 5BNFA 4CJXA 3EX7C 2WF5A 2ZIXA 4B33A 1CY2A 1U80A 1TC2A 2QM7A 3AFOA 3C4JA 5EIBD 3KPWA 4M54A 3LUKA 3M6IA 2NU6B 4FX2A 5KSYA 1IJBA 2J08A 3PJDA 1UBLS 2APJA 3KX2A 1SUPA 2GCIA 2LIPA 4YJGA 2IE0A 2ZLBA 4BGEA 2OGUA 1B0AA 2UZIR 3I9KA 5DZSA 2WHPA 3LHDA 1CB7A 2WYHA 3K8OE 3CF4G 1GL9B 1Y5LA 1YQWA 3N7UA 5AVKA 2VNKA 1J9GA 1H66A 3B36A 2ZB2A 4BMNA 2VS1A 1CUHA 1UPXA 3RNOA 1MLDA 2ZSBA 1QE5A 1HT2E 2J5RA 2ZDQA 4HN4B 4KR3A 1SCKA 4G81A 1QGUA 4Y6GB 3KV1A 4J16A 4UBKA 3W78A 4NDNE 5KSOA 1K08A 3D54D 2FWBA 2HFJA 4OHRA 4OH7A 4XASA 2P41A 1D8TA 4H4DA 1LBEA 4OQMA 4CEIA 1LF5A 4G1EB 1O94A 4OYLA 1GQ2A 3CPEA 1KI6B 1OFUX 3FYUB 3EPRA 2OLKA 2OESA 4W9NA 3U17A 4D0NA 5ADVA 3EPJA 2ZIAA 2VT6A 3DNPA 1GG5A 2HO5A 3GMSA 3R4VA 1HLDA 3DV9A 3QITA 4OKSA 5GM1A 1ZC4A 3F3KA 3U9TA 2Q1SA 3UXEA 1YQ9A 4BJHB 5FQNA 4HH1A 2BHSA 2HXYA 4G8JA 1NNUA 3NFYA 4GP7A 2W43A 4PNZA 3DVQX 1JALA 5EMHA 1JMYA 2PRZA 2QRZA 3B5EA 3RS4A 5B12A 4WWHA 2YR0A 2OM6A 4B7UA 4MVJA 2D2VA 5ECDA 3JQDA 2ISSD 3I45A 3VV2A 3CNQS 3FLAA 4H27A 3H9EO 4QPPA 3KQUA 4C76A 3Q15C 3ZDDA 1H2XA 2GZ2A 1OA1A 1U7TA 2RK4A 5AKKA 1AMNA 3AEKA 1CC1S 4MV4A 2PKQO 4YS6A 2A5DA 4LDPA 2FZ5A 3S29A 1OFHA 3BEDA 2IW1A 4YXWA 4TL7A 3W1WA 1SXGA 5A06A 1HEIA 3FHTA 3G7SA 3ML1A 1RC0A 4HGZA 4ZCRA 4M7WA 3NZEA 2RHCA 4QAQA 2N47A 2IU4A 1IHDA 3GZ4A 2FH5B 4WOJA 3F5MA 4TLBA 4RQTA 4D5EA 4EHNA 4X62B 1VBNA 4CDGA 1H4SA 3DQPA 3GJTA 1L5WA 5TMBA 3K0AA 4IZOA 1HE4A 1K98A 1NF9A 4CF4A 3UHPA 1DRKA 4BVHA 4Q4JA 1JDJA 3NEAA 5EAIA 4OKNA 4RL6A 4ZRDA 5TJ9A 5L3QB 1RZRA 2EYUA 2H1OA 3A4VA 3L3BA 2DX7A 1A4RA 3KJHA 5ER6A 3OCCA 3C5EA 5LP6C 1JZQA 1V7CA 2IYXA 5DP1A 4O02B 4XYEA 4X44A 3BRSA 1EGHA 2HXGA 4DV6B 3BDVA 5E9WA 1OLOA 3EUWA 4PF1A 2A0YA 2HF2A 2Z6VA 3DXYA 3GT4A 1V7PC 1GSOA 3QUCA 4LQCA 4D9NA 4GL2A 1M2GA 2Z95A 1ADBA 3MELA 4LCEA 4P7JA 4TPKA 3E4CA 3JU3A 2CUKA 3GG2A 4HH4A 4ZV9A 3UJHA 5D6OA 2GD1O 3WWPA 1GSIA 1FK8A 4HDSA 1HOTA 3FSGA 2XD4A 4KJZA 4CDMA 2B20A 4HHEA 3MA0A 1IY8A 1KK3A 4JZKA 1KK2A 2JI6A 5J2UA 2AYZA 1PU2A 1QFSA 2ZBGA 4MWBA 5HS4A 1FMLA 2FZGA 2I80A 2ISQA 3K73O 4Y9TA 1CR6A 1LU9A 3EGIA 2DRIA 3HS3A 4KXXA 5DV9A 3WK7A 4ZZ3A 2CKDA 3U3DA 2QE6A 3SHOA 1GQFA 2WJWA 3V8QA 1NLZA 2I78A 3I9JA 4F45A 4DIEA 1UMKA 1I14A 1JI3A 3JZAA 1JDNA 2K4MA 1NVBA 1ZJ5A 2G3YA 4FIZA 4M76B 1BN7A 4Q4AA 1BDIA 2Q9BA 5BSUA 4C03A 1YHYA 5JZ9A 5BRNA 1XJQA 4Q9AA 3ZW7A 1K8ZB 3SMQA 4ZEWA 4NF2A 1VDMA 5AUOB 1JLSA 1ESEA 2LPMA 3TSOA 4BU1A 2O07A 2O5RA 3BE6A 3MMSA 4LHVA 5EJ6A 3IQFA 3ZD6A 5DYTA 4WK6A 1CY7A 2W6CX 3WRXA 1ISHA 2QS9A 1UMDA 3RQSA 2WYVA 1AM4D 3PVZA 4FYYA 3EPHA 1GJRA 2HCRA 3WWOA 1RQGA 2AFRA 2ZSFA 1XI2A 3LXXA 1MU0A 1Q0QA 1PFYA 2WB2A 1AKQA 4CM4A 2ZRKA 1E7SA 5F2OA 2X4GA 4F60A 3NWBA 2NUAB 2XRFA 1E5XA 2AHOA 2DPYA 2HIHA 3NOQA 4JS0A 1WX1A 2EEZA 2BJHA 2R87A 1XWFA 1WXDA 2J9ZB 3W7VA 4ARBA 3QXHA 4JLKA 4B8YA 2JFUA 1AQUA 2FWAA 2IT1A 2E2WA 2Q50A 1UIRA 3AKZA 1UZNA 4XWTA 2OFOA 3KSZO 5CEJA 2ATCA 2Z9DA 4LRTB 4R83A 4HV4A 5JQWA 1MAWA 1SMKA 3ODGA 3MWKA 1IG3A 1LSSA 3SQLA 4J3JA 4M37A 1D2AA 1HORA 5ESXA 2LCQA 3FIUA 4PFKA 3T1QA 1D4ZA 1LNSA 3HBAA 3NBKA 3AJDA 2RSLA 3OLWA 5DGHA 4ALNA 3QHPA 3GJ0A 1JR3E 1ULBA 1YC5A 2FN7A 1DS6A 1OGYA 4UM7A 2XCTB 3TW4A 3GRRA 5CMLA 3X1DA 4BB9A 1C7ZA 1E8DA 3HHEA 3W5IA 2QR5A 1XEFA 1L5LA 1XKXA 4QTUB 4E4TA 1W5AA 1A9PA 2CJWA 2PYIA 3H4IA 2I2DA 3UWSA 1ZVKA 2Q3EA 3AF6A 9MHTA 2WB4A 4FDVA 3DF7A 3WYAA 2QUJA 2D13A 2PZBA 1P4GA 4E5MA 3IEKA 2WUFA 4OPMA 4RVDA 4PM4A 5AK3A 3WJ2A 4N1AA 2QRQA 4CF3A 4ZOEA 4W9MC 1P1IA 4LNUA 4FOLA 4Q16A 4YCMA 2A5GA 3WO0A 5CVTA 1R1DA 4FBGA 3ND9A 3MAAC 4MRSA 4GG1A 1XXHB 1PN3A 4FFDA 4YCDA 1YCHA 2V58A 2AOTA 5HFJA 1XNQB 1WCXA 1XWWA 3PXAA 2FPUA 3GIWA 4ONEA 3UJNA 3N1UA 4BO9A 2R66A 4F5DA 1I1OA 4Z9BA 2WWWA 1O6CA 2ZREA 1S7CA 4JVLA 3TZEA 1N3IA 2QLTA 2XJ4A 3P5BA 1HLPA 3ZU2A 5HJ7A 3FYHA 4JBWA 4UPEA 4YUAA 2MJLA 1ZM7A 4OSPA 3OP1A 1HDYA 1BKSB 2B1QA 3JQ9A 2GZMA 3HBMA 4KIJA 1C3VA 4G1UC 1YB7A 3QIVA 2O3UA 5IDVA 5C7OO 4F96A 5DSXA 4EVQA 5JYCA 3NTLA 5CUQA 4KH0A 3GP8A 4WY2A 1Q92A 1B16A 5NLLA 3VHXA 3D6FA 1Z0AA 1N1DA 3WK9A 2QLNA 2IOYA 4L0MA 1RJGA 1IRIA 1PZNA 3KG2A 3PA6A 3TVYA 4NCAA 3MMPA 4BZQA 4BLQA 1QO0D 4KXQA 2NLOA 3PHBE 1KEVA 1RW4A 1V6AA 1XFAA 5UKDA 1ZD9A 3PD1A 2WIDA 3FPLA 4JBXA 4M46A 3QV2A 3GLIB 2D1YA 3FKQA 2GPBA 3LDFA 1YA6A 1HUQA 5IBQA 3IUPA 5AJZA 3QPCA 4LHSA 2B9EA 4IZ6A 4DQLA 1IXZA 2NXWA 1HR0B 1TI7A 2RAUA 4KOAA 2UZ4A 3E5HA 5F1YA 4KB5A 4OQNA 1V4BA 2PGJA 3OCJA 3WLJA 5H4GA 3HWWA 2JD0A 3PNYA 1JXAA 4GPAA 4IV5A 2BFOA 1USIA 2HCBA 3IESA 5EWLB 1CTQA 3TL6A 4U3JB 4CMCA 1QIMA 2EX1A 3ZIAD 1IXSB 4DG5A 1E2MA 4BQNA 3JZFA 5LQCA 4M1QA 2F3TA 4B6FA 4CEHB 4XVUA 2COKA 4ZJZA 3ZG6A 3ZW9A 1C9KA 1P7YA 1WXHA 1XQ6A 4HQFA 1Z82A 3LFTA 4GX0A 2R8ZA 3PEEA 4TZKA 1C9NA 4DABA 3WQQA 5E0KB 1SQ6A 2D74A 2TMYA 4MHOA 2OB2A 2ODWA 2X3YA 1BU8A 1U2GC 1WDKA 4JLWA 1ORVA 1CRZA 3SGLA 2OZKA 2VAMA 3RK4A 3QELB 2P2YA 3PNSA 1XYYA 3LKZA 4HQNA 5H81A 3EW9A 4HSEA 4Q7EA 2P67A 1F0KA 1WZEA 2A2ZA 3KWMA 4ENUA 3FTEA 2V4ZA 4M0MA 2C83A 1ZVQA 3KKQA 4M0FA 4TV9A 1U11A 3D8SA 5HUHA 2XYRA 4Z2AA 4YREA 2J6HA 4LC1A 5A4IS 5B58C 1J23A 3IURA 2XEXA 4B3FX 2R8EA 2IV2X 3UFXA 1HEYA 3L8CA 1ZJYA 2FMIA 2JB9A 1EMDA 1QYWA 3ULKA 4NV0A 3E9NA 3N75A 5B1EA 4HQ0A 1L5KA 2JAHA 4M4SA 1UXGA 5IXSA 2JLWA 1O95C 2V7TA 3B2EA 2OCIA 3E61A 3FNQA 3ERCA 5JAPA 1DKPA 3W3AD 1NE2A 2GNOA 3KAJA 3MYYA 3E7FA 1EFDN 2ZK7A 4I2NA 4R81A 4YGYA 3P7MA 4RJJA 4YAOA 5KQSA 2BM8A 4Q7QA 3L46A 5LIPA 1NJFA 4D82A 1LLDA 1IB6A 2IEGA 3HLKA 5FUYA 1T91A 2HHJA 2UZ0A 3GEGA 2J33A 1ZDMA 1ZG3A 1DSSG 3MVEA 1L5GB 4BP9A 2JS7A 4OI4A 1MO6A 1JDBB 3BYZA 2WRZA 1DCFA 1DCTA 2Y6VA 3DV2A 1LLCA 2XB9A 3C70A 3M6FA 4UNNA 1BIFA 1IM5A 3F6SA 3AEQA 1YKGA 3E7XA 3EG5A 3GEEA 3K0HA 4UVDA 1CRLA 2WJJA 1P5HA 4H6XA 1GPMA 2CBZA 4HB2A 2UAGA 2WTNA 2C5LA 4TLMB 2ZCUA 1IY0A 1QYIA 4L9SA 3RH0A 3MOIA 3RAFC 4FFRA 4GMHA 1IBLB 1WR8A 1ULHA 2B8JA 2V9PA 4MB0A 4OQZA 2OO5C 3N0VA 4XOUA 3PIDA 1J56A 1VMKA 1XCBA 2O2CA 4AY2A 3L0DA 1AGNA 1KK1A 2D1TA 2PKXA 4NDZA 2H5EA 2KQUA 2Q3MA 4H3KB 4URVR 1F2UA 2ZBQA 3CG4A 1Z06A 3UV7A 4C4ZA 2PTHA 1I4EB 3DL4A 3S68A 4NEGA 1G20B 1J5EB 1YFLA 4HNVA 1FDTA 4XX1A 3S8YA 4TKVA 3WFZA 2JZOA 3CEMA 4K6KA 1MQSA 5GIPE 2FQYA 3K0SA 4WCVA 5TDHA 2RAVA 4FKBA 2O50A 4BFXA 3RABA 1EFPA 1E98A 2E4AA 4N0PA 2VPIA 5FP0A 5FOVA 2XRZA 4MWZA 5IARA 3S1LA 1I2BA 4ZVPA 1G5PA 3FXAA 2XMSA 3CN7A 3HEAA 3LUDA 5I6DA 3NBYC 1E2PA 1NBME 2AUNA 1L3IA 2G6TA 2I1WA 3JD2A 3M5DA 4Y1GA 5T4FA 1LS6A 1CB0A 1BE1A 1MC1A 4EATA 4JJ7A 4RJLA 5MN5A 5FBHA 1JFSA 2VK2A 3ISVA 2V8BA 3VPXA 4I4LA 1RPTA 2ID7A 4LYAA 4PQFA 4KQEA 1Y42X 5BT8A 2OO3A 1PK8A 3SHWA 1DTWA 2O5EA 4JYCA 2A7XA 1NNLA 3BF7A 4C14A 4RMGA 3NIWA 5CA0A 4GZ6A 4BXOA 1QHYA 3WBJA 1JHUA 1OOEA 3E22A 1XZBA 1KMHA 2MR6A 4HTFB 2GWRA 5JEDA 5IDQA 1D7OA 4FZVA 2FN3A 5E6RB 4QU5A 4TTQA 3H87A 4PLHA 3UA3A 4AO6A 2VQDA 2QT1A 4YLEA 1E99A 3MPOA 3U48A 4J6FA 3EZXA 4TV8F 2ZTSA 2JJ1A 1TD1A 2X19A 4UCWA 4Y2PA 3VJMA 3OCXA 4ZEOA 1UAAA 4GR4A 3Q7TA 4N4AA 4ZANA 2NUTB 2P9QA 2X4DA 2C7GA 3DUFB 3FKJA 2WG2A 1NRXA 3K5WA 4CKBB 4CV1A 5A7FA 2VLIA 3M1LA 1Z13A 4DR3B 1ZJ4A 3KL4A 2XUHA 3B89A 3OZ7A 2J67A 8GPBA 1VKNA 4JELA 3LZCA 4K6HA 3CH5A 2QN7A 1P73A 4XUEA 4XFJA 4MUYA 4JUFA 4DC0A 5M7EA 2H16A 3CCCA 3I09A 4AWBA 3NBQA 4V0KA 1Z8FA 2H4WA 3W77A 5KSPA 5SICE 4MWGA 2ZIVB 1BFKA 3H9BA 1WUKS 4I1SA 4IZIA 5B1DA 3ROEA 1EHYA 4ZK6A 4PLTA 5BPHA 4D9IA 2RGNC 4DYVA 1P75A 1FSPA 1MBZA 2Q99A 1EIWA 3A8TA 4GBGA 4QLAA 4RMNA 3DLBA 1ZM9A 3GRKA 5KC9A 2F7SA 4UHEA 4WZ6A 2EJUA 2ZBPA 1HMPA 4PO8A 3H1BA 4GVLA 4GZLA 2C57A 4EWLA 2IH4A 1I7NA 1VA4A 1EHCA 2EJBA 3JVIA 4ZQGA 5TLSA 3ORQA 3MMNA 4YRKA 2RBGA 4HI0E 3PPWA 3TZKA 5BMVB 3NJRA 1SXPA 2O8BB 2MSLA 1ZAKA 2NWQA 2A9OA 2QLFA 2NX2A 2VI5A 4HQKA 4W5HA 2OWEA 4NH4A 1L1RA 4FC7A 1YK1A 1HZZC 2V6BA 5AM1A 1VRCA 3FGZA 4ODIA 3RYFA 3WDKA 2QTAA 1EAMA 2G9ZA 2HH9A 3IV9A 3PLNA 5BYAA 4N0EA 3E53A 3UH0A 1L7OA 1R3DA 1T0BA 3A2LA 5C8ZA 1X1EA 2QAGC 3DR5A 4FCVA 5CXSA 2VJAA 1JEJA 2JAPA 3OEHA 2SCUB 3SZOA 1WV1A 1HTBA 2DXIA 2Y1CA 3RC9A 4N5HX 3UT6A 1TM7E 1VXOA 2F3SA 1Q3HA 2HA4A 4AIRA 2W2LA 4RK7A 3IDSA 2K2WA 2POQX 1QK3A 3IHWA 3NHWA 3EBOA 3L7AA 1U8EA 2QUAA 4UHHA 3MLAA 3AFHA 1B42A 3RBVA 3H42B 2PX0A 4I50A 4MQFA 3OT1A 2C5HA 1R10A 2GSWA 2J3MA 2J9RA 3RR2A 1P0PA 1E3TA 5DX0A 4BNKA 4M1ZA 2JH3A 1RYYA 2SICE 3ICWA 3L6RA 4JODA 4QM7A 4ND4A 3NGMA 4L51A 2IYPA 3RARA 3F8TA 3BB4A 3LLSA 3EA4A 4ND8B 4DCJA 4KV9A 4NULA 1V1MA 4Z0HO 1T8WA 5CDUA 5GY7A 2DVMA 2PBRA 3DDUA 3DXZA 1I8TA 5CIWA 4OHPA 4JI8B 5K05A 4UREA 4BP8A 3MILA 3MJVA 2CXSA 5FTJA 3HDYA 1NPTO 1GM5A 1ESNA 3NALA 3CPJB 4XSGA 4J0JA 1M5UA 4YRJA 1I24A 4MKFA 1J21A 3AL2A 2I2XB 4AU1A 1W0CA 2VQ3A 2QMUA 4CNQA 1HETA 1VIDA 1E2BA 4LVNA 1U5CA 1WUIS 1IIBA 1WWKA 2PWAA 2YN2A 3EEYA 4KAFA 1K3TA 3HWRA 3U4HA 1TVCA 3C5WP 3PB3A 3F8SA 3BSYA 3K5PA 1NUPA 1S8OA 3K4PA 1KS9A 1U98A 4DV4B 1SAYA 2P3LA 4A92A 4TVSA 2IZOA 3CUYA 2OZLB 3F3YA 3TZBA 2HSWA 5P21A 5DN6D 1ZOOA 1JFFB 1UCFA 2PXCA 1AKRA 3I2GA 1OWNA 4WKOA 5ED0A 3Q12A 2QM0A 4LZLA 4ZRNA 1DJLA 1F20A 1TQ8A 1UBOS 2ZYVX 1MA0A 4R98A 2D0IA 2AMYA 3EOZA 4D92A 3GP5A 5JHHB 5B36A 4IYRA 4EI9A 2ZBEA 1NLFA 3CLVA 1VKHA 1FSGA 3UB4A 1YSCA 4LJ5A 1ZXLA 4FFNA 4YP6A 1PJRA 3IB3A 1HDEA 3OLCX 2Z8ZA 1CJTC 4YK7A 4EGJA 4PZYA 2C3MA 2WSIA 3MJDA 4IDPA 1GPH1 2B61A 4MHSA 2W2KB 1KGDA 1NIJA 4OGLA 5BW5A 1P19A 3TFQA 2EATA 3IMFA 2O8FB 3WKDA 3QVGB 4EYQA 5JZOA 2DFDA 3T5AA 1F51E 4RIGA 2P3QA 2QD3A 3IDOA 1E62A 1PT8A 2DBVO 3A06A 4O29A 3ZCVA 4KODA 2XQIA 2D6FA 3FBTA 2GF0A 4UHDA 1XEWX 3H0KA 3IJ5A 4L2IA 4BAGA 3DMDA 3ZI0A 4JSTA 5IVDA 4EW2A 5C34B 1F4LA 3NM6B 4YJ2B 5JIBA 1KHTA 4NE9A 4UASA 2RKOA 2RK6A 3IV6A 3MFQA 2OO7A 3KQWA 1SCUA 1TUBB 3QJ5A 3PKIA 1OGIA 2GPSA 2RAPA 4P81A 3PQ8A 4H7PA 5LXTF 3REQB 4RD1A 3V4OA 2VAVA 2WQ6A 5MHTA 4B6JA 3OOJA 2MWMA 1EFAA 2O8CA 2E4XA 1DQSA 4RELA 4GKBA 4Z3DA 4ECAA 3RC7A 5EUMA 3N2YA 1UJBA 2PYDA 4KQMA 2PWZA 3WLLA 2VJPA 3I6IA 4TSFA 1EUDB 1T3SA 1SXQA 3QFRA 2WVAA 4KL8S 3ZOKA 4F2HA 4F6CA 1YVEI 2HCTA 3AP3A 1O77A 1UKYA 2GM3A 4Q05A 2NVUB 5HK8A 2D5IA 1FQKA 5EOVA 3WYFA 4P83A 4EY7A 2D4HA 2J3QA 2Z9BA 4XGQA 3R3VA 4CYMA 3TCNA 5BOVA 3I2HA 2C2GA 4KRYA 1C7EA 3IUMA 2DSTA 4ZVVA 5C4GB 2QXUA 5CNIA 3T0GA 3D7RA 5HE8A 3RSGA 3KIPA 1CIPA 1XF9A 2YZNA 3RU7A 3ZWDA 3FDJA 3RTGA 3K4HA 4L7VA 1FXUA 3FVRA 4YC7A 1BS9A 1DQPA 1ADJA 2EIHA 2OXTA 1A8IA 2IYTA 4HXFB 2WHQA 4H17A 5AT1A 2RGBA 4WUVA 1O6GA 4WZZA 4X45A 5AW7A 3W6UA 2ENUA 2FSHA 4J2HA 3QSGA 4QO7A 3N2NA 1PSZA 3S2UA 4EX7A 1EXDA 2O2GA 2R5FA 1EP2B 2PGLA 4UU8A 3WGIA 4LFBB 3EYWA 4AXBA 3LYHA 1E5VA 2HX1A 3HHPA 1FBTA 3HN7A 4B4OA 4RFSA 1YJXA 3Q3EA 5FA6A 3HVKA 2AMFA 5F12A 5JAQA 4BVKA 1GN9A 1GRVA 2P9ZA 2RH4A 3HLTA 4PCAA 4PHGA 2VJLA 1GV1A 4RDXA 3S1SA 1F6DA 3JARA 3KEQA 1DJMA 4R8SA 2I2FA 5F21A 5MFZA 3ADOA 2DGDA 4EA6A 2XAAA 4EKGA 2AXEA 3PEYA 1JYFA 1JAYA 2IYSA 2P0EA 3KR9A 5EJ2A 1HY3A 3EVDA 1YE5A 4FSDA 4MARA 3UWKA 4QFDA 1H0SA 3OD1A 5JPCA 2AKYA 3SDZA 4FCCA 2E5WA 5JJLA 1K1EA 4EPXA 5ETJA 5TPZA 3PC2A 3Q7QA 4X63A 4CG2A 4QQNA 3K30A 2HJGA 3L77A 5M3BA 4C20A 3FUUA 2KYRA 3DBRA 1A8PA 1M2KA 4D9CA 1H0HA 3S2IA 3EGCA 3TGLA 421PA 1A5SB 2RHGB 5JS7A 2FHSA 3V6LA 1NQOA 4I55F 3DZCA 3EXIB 1PUXA 1VSTA 1KEEB 1US8A 4WKPA 1N0VC 2QBYB 1E20A 3T5GA 4YT2A 3CUTA 3F2VA 4G5QA 1E1MA 3TIFA 4KIGA 2QL6A 1L7EA 3A6GA 4M87A 2VPPA 4OFBA 3CM0A 2CDBA 2HMAA 1P39A 5C5CA 1DWOA 2W2XA 3A26A 2X8WA 2VP2A 3B13B 3TDMA 4BB6A 3GJYA 1W34A 2NU8B 3J7TA 3EIXA 4FJ1A 1M74A 1VIYA 3LY5A 5CLLA 5ERXA 1NMYA 5I9IA 1PLKA 1Y7PA 4FS3A 2XNHA 3OA2A 1G4HA 3IP7A 4UBNA 4LISA 5A0TA 3HACA 2XVMA 4FDLA 3V1NA 2XW6A 3MJSA 8LDHA 1Z8DA 1FFDA 1RLMA 2XNDA 2ISCA 3EZNA 5JSQA 2ZWOA 2HRRA 4PXAA 5CGZA 2BGJA 1G0NA 4I0WB 4YRRA 3SHQA 4D0GA 4ZK2A 1VE9A 1NVAA 4X65B 3O3CA 3OUTA 3DPSA 5CT5A 1TYEB 4DSTA 3EF0A 4J94A 3W5AA 4P3OA 3HXTA 4QYMA 2J9FA 2NTJA 3EVBA 2R3SA 3KT8A 3GRVA 2IK8A 2R6AA 1XMPA 3I9V6 4PTZA 3OQIB 3BXGA 1Q1BA 3ACDA 5IBRA 4PZDA 4D98A 2VHZA 4EFMA 1WW8A 2IGBA 4PX9A 2ZCVA 1EXVA 2W58A 4EEKA 4ZI7B 4HAOA 3SXUA 4JLJA 3FCSB 3KAQA 3L1IA 3L6CA 4YEDA 4GKJB 1ESCA 2ODPA 1ZHFA 1SCAA 3LLCA 4ZPXA 5K3CA 3AVTA 5HA5A 1UZLA 3ZWVA 5A9TA 3VR3A 1LK5A 1YTLA 4Q34A 5HDQA 2X2FA 1WBDA 3ZCPA 5CT4A 5KYXA 3ENVA 1FPMA 2F3QA 2H1SA 2CHQA 4RF5A 2B36A 1SKBA 2BMJA 5FB3A 1RAEA 1LQTA 4V0LA 2DOKA 2FETA 3ZLUA 1BGXT 1HYEA 1G8FA 1NC1A 1ORDA 2QMQA 2QN2A 3A0RB 2GAAA 3CSDA 1SIUA 3Q1KA 3M4YA 1TYZA 1TZ2A 1JWAB 2PUJA 5JZMA 4E13A 5A9SB 5EZQA 1ULSA 2WZDA 5B3JC 4G5OA 1MOSA 2ZSHA 3IO3A 4MQ6A 3H9QA 3LKVA 2CLLB 3TSWA 2DY0A 3OOEA 1ONSA 1ZMRA 2QPOA 1V9LA 1OXTA 4Q02A 1T1EA 4NSNA 2NU6A 1O95D 3KVOA 1EEXB 4G07A 2CL6X 2AG1A 4FDMA 3U3KA 2BF4A 2DUMA 4OYHA 4JJ8A 3L9WA 4C30A 1E9FA 2MSEB 4KAAA 3JQRA 5F64A 4F9TA 4PNPA 3ABZA 1ZKMA 1GTMA 2VA9A 1CZRA 1SPBS 1J4AA 1PEDA 2QM8A 2Y1KA 2ZS9A 2BD0A 1P2UA 2XDAA 2XQKA 1JQJC 3KK0A 3MT7A 1VPLA 2CFOA 2IU3A 4WK2B 4HNHA 4WADA 5I45A 3RIXA 5JAZA 4RACA 2FB9A 2Z0MA 2Q8PA 3DOFA 1GZHB 3ZBPA 2R8RA 3IBGA 1BA2A 5ENZA 2O52A 4RKRA 3RJTA 3AY3A 1HYQA 4WFIA 1ST3A 3NB0A 1KI6A 2WUEA 2QX9A 3FYUA 2YW9A 5DASA 2XZDA 3AHGA 5TEWA 3OCWA 1RJFA 1QFMA 5TGTA 4FSHA 1O5OA 3FPCA 4GFDA 3TRJA 2BTEA 1TZBA 4TLDA 1XCMA 2ZRDA 3TR5A 3G82C 4WSOA 1F4VA 1FTQA 1OXMA 2QMYA 3D7LA 2ILVA 4FKZA 1IY2A 3MMZA 3UGTA 4EGSA 1G4AE 3TN7A 5AVYA 3HYCA 5JNTA 4UBLA 1PUJA 3UGJA 2C07A 3QVSA 5BWBA 1ECBA 1EDBA 3CX3A 3OE7D 4PIPA 4R2IA 2GF2A 3YASA 5L45A 1POXA 1H6AA 1RAAA 2OV4A 3U62A 1HO3A 1N5KA 1RJDA 2DPGA 3AF0A 4QXOA 1E3MA 1BE8A 4P84A 4L16A 3RS3A 1OWPA 2GJSA 1ST2A 3KZ1E 4D8WA 2XXAB 1K0FA 4EARA 3QW4B 3TIVA 4A6DA 5C5EA 2P69A 3QFTA 3OOWA 5K4GA 2DECA 2WMDA 4L27A 3TNFA 3OFNA 3C0KA 3IULA 1ZK2A 2ERXA 3ZNPA 3JYLA 3DOJA 5BRJA 1M83A 2F9FA 1NC3A 1U0TA 1X7GA 1QMPA 2VP9A 1N2JA 5ALTA 4KUEA 1PQWA 2P6UA 3W8FA 3HY6A 5JD6A 5TX7A 1QFYA 3F98A 1RRFA 3H18A 1YB1A 3F9IA 2ZRCA 4ZZIA 3CEAA 3KR0A 4EZEA 5DM60 3B1XA 1N57A 3TZHA 1N1GA 1PJTA 3LBIA 1SU7A 2VDJA 3VPBA 2FWIA 2C3PA 3ZIDA 3DTYA 3PGA1 4D6YA 4QGSA 5KPDA 3N3AC 2VCHA 2JCGA 4Q1FA 1CUSA 1T4CB 3A3YA 1QK5A 5FNVB 5LBUA 3AXTA 3HGQA 3STXA 1VYVA 1AK2A 5HCUA 2ORYA 4NV1A 5L3QA 1N5RA 3OM9A 3UKOA 4ZAVA 3G9QA 3QYJA 4GMGA 4X93A 4FEAA 1JECA 2PLAA 5FFNA 2BGMA 4G09A 5JCJD 2VZLA 4ND3A 1U1FA 3JQBC 4KTVE 2WPNA 5JNLA 2VDKB 1ETUA 2DPXA 1XNGA 2JVIA 2ZYHA 3ITDA 4G5HA 1YQGA 2HLNA 2X5NA 2W90A 1DXQA 3EIWA 2F8LA 3NC4A 4QBTA 1PR5A 3ZI7A 2DR3A 2FEXA 1YB6A 3H8WA 1NHWA 4QOIA 5JCXA 2NO6A 3UTDA 5CP8A 5GM2A 1F12A 4C7JA 3RRJA 1B73A 1Y1KE 2LDXA 2VDWB 3L0OA 1I5OA 2VHUA 1D1SA 1I7PA 3N0WA 5A02A 5CDFE 3LOQA 1COWD 3KB8A 1QF6A 2PZMA 4M53A 4ZU1X 4AJKA 1UBEA 5K3OA 1JIVA 2XI4A 3FZGA 4V3CA 2VYFA 2VPQA 4C7KA 4NY1A 4MPDA 1IHXA 4E6PA 1ZJJA 2ZTUA 1Y6RA 2QDXA 1SVUA 2IKQA 3E1KA 1KI2A 3HO8A 2IHKA 2PMBA 4RVCA 2VDMB 3ZHUA 1DCKA 2BKEA 3U44B 2ZJ5A 1EDOA 4UAUA 4H18A 4DZRA 4AL4A 4EB3A 2R5WA 2WDPA 4EUSA 1FS5A 1QB8A 5LU9A 4IKEA 5CFZA 2ZUFA 4FMCB 4K5QA 2ZSIA 2C4WA 5DK6A 4YN3A 2ZIGA 3BIOA 3K0FB 3LF2A 4M1OA 1K06A 5TF4A 2ZZMA 2EFHB 1HSZA 1N0IA 4GM1A 1H2AS 5FULA 1PBNA 4Z8XA 2AX4A 2F67A 1AUXA 2GMWA 3DQQA 4TTPA 3I5UA 2JRCA 4OU5A 5GVSA 3T4EA 1A4IA 3IUBA 2NUAA 1JG1A 2Y6UA 2ZVPX 4FWTA 3QX9A 2DPMA 4L78A 2O2XA 1OIWA 4LDQA 4YX9A 3SE7A 3B60A 5FL7A 5JZSA 1DBQA 3B6MA 2B6HA 1LD3A 1XZLA 1HWYA 1M72A 3KVNA 3UJ3X 1NQWA 1NL3A 5DBIA 4JUAA 3UMGA 1X2EA 1ZC3A 1FL9A 4FFBB 3R77A 3TSZA 1ND6A 3R23A 5DF1A 4HCJA 1RHKA 4DZZA 3WB9A 2N42A 4MUAA 2EZ9A 5K6TA 3KXIA 4ZVLA 4ZOCA 4WCFB 3TPFA 3ND5A 2A0KA 3EXHC 3Q7SA 2NUPB 4ZVKA 1R88A 3O2NA 1X9GA 2CLEB 2EERA 3UYLA 5KDOA 1TEHA 1ZL2A 3DLIA 4FDAA 3QXGA 4HOYA 3SCZA 4ZCTA 4ER0A 1VFPA 1G19A 2GFHA 3LYUA 4O2BB 4JB3A 2WKWA 4BO2A 1XDWA 5FWXB 4NXMB 3IOMA 2GEBA 5C5DA 2WT4A 1MTZA 4W7HA 4H3HB 3PT9A 1HYHA 1N9KA 3ZLJA 4BCCA 4BGDA 3CLKA 1TF5A 1VBKA 4XEHA 3HEMA 1YJ5A 2A5YB 2B1JA 1U4OA 2B1RA 2ZGVA 4A15A 2V6GA 3NC0C 1E8NA 2N0SA 4LJ4A 1VL0A 3T5TA 3BQMB 4BP1A 4BQEA 1VZ3A 1SA0A 1XXHA 2WM8A 2WOJA 1MGPA 4N40A 3WIUA 2BZ0A 3AH8A 2JLZA 5IJ0B 4DXHA 1O6BA 5DLQC 4OBXA 2HDOA 2IXGA 2OCBA 2ERYA 4YAGA 1W52X 5ELXA 3R8XA 4KBFA 3IILA 1MXHA 4L4UA 3F5SA 3QU4A 2CF5A 2VPXA 3E8SA 4Z2YA 3U16A 2P4EA 2EGHA 3HO6A 3TECE 5AVXA 1J1ZA 5JNVA 2ES4A 4JMPA 3RVBA 1GUAA 1J2YA 2F3RA 3G59A 4K3UA 4V02A 1E1RD 4KKVA 3DAFA 4WFQA 2FCRA 5KHLB 3HP1A 5DGIA 1OLUB 1W30A 1JIIA 5BVHB 2CV2A 4X84A 1FYFA 4KXMA 3EVAA 4PQYA 4JJIA 2Y0BA 4IQ8A 2GDJA 4P08A 3GGGA 4NU6A 4D4LA 5JXHA 1L5MA 2RGCA 3D8BA 4B7CA 4DMCA 2X5JO 3UAWA 3DHWC 3DCJA 4K9LA 2FPPB 4KUGA 2HY7A 3SYLA 1YU6A 2LVBA 3HPQA 3AERA 1QE0A 5AD1A 1A2QA 4OHKA 4W5OA 3VSEA 2ZBDA 3M4JA 5JFTA 3MB5A 3QE9Y 1C30B 2QR2A 1F7UA 1D6SA 2IVZA 5I7OA 2AJ8A 2ZB3A 2KHZA 2RHWA 4GC9A 3GLIA 2PUAA 4G5FA 4DQKA 2UZ1B 3BIWA 2ZSDA 3W4KA 4W1QA 1NXSA 4AF6A 1GP2A 4FMBB 4ZAZA 2VTBB 5I01A 4XDGA 1T0HB 3B5IA 1RACA 1L2TA 4BVAA 2DHEA 2JDIA 5FUVA 3WTBA 1W93A 1K6EA 2P75A 1ZNYA 2B5WA 2VO1A 3A1TA 4HMPA 4JC8A 3OIFA 4YT8A 1JEOA 2VHWA 2RH8A 1F6WA 3IA2A 1A1SA 2GD0A 3BL8A 4JK3A 3JAKB 5BO5A 3JWPA 4DPKA 3ILHA 4GMFA 1Z4LA 1P1HA 3UJAA 4U3JA 4IPTA 4V1CI 3UENA 3D4PA 4Y2GA 3M33A 4XM0A 3IXQA 3WWDA 3LQYA 1LPOA 3Q9NA 4Q47A 3MBKA 3VR5H 1KGSA 3TQRA 3SC3A 3WLEA 4Q3AA 5HGJA 1FF9A 4CEHA 1D07A 4II2A 1SHLA 1A69A 4LKOA 4BE7B 4WZBE 4AJ2A 2DT8A 4PZAA 3UWMA 1E7WA 3ODPA 4Y7CA 3B3FA 2HBZA 3PFWO 1J5PA 1KMIY 4A23A 1ZOSA 4AIIA 1XT6A 2QEQA 3A36A 3QELA 1QVRA 4I4CA 1KO8A 2J87A 1HFWA 2CVZA 5ERYA 1KIFA 5MN4A 4LMRA 5F7ZA 3D7NA 4E33A 1TQHA 1NI5A 4MMXB 5F9MA 3TNDA 2JFZA 3KSRA 1Y5IA 3TGPA 2Q49A 3AF2A 3ETHA 1T8SA 5AKLA 3L1VA 3JASB 2GPWA 1C1HA 3SX2A 3ITKA 4NZYA 3FH0A 2J4FA 2XWQA 3ROQA 5B3LA 4P35A 4D6XA 2O2SA 3I9FA 1T9KA 2YZ7A 4NOKA 1NVVQ 1QIHA 1U8CB 3EZLA 3USZA 1PO7A 3C41J 4TTAA 2GAIA 3BHNA 4JZYA 5FLEX 4Q9NA 2VHXA 3IAM1 1FRNA 1W0JD 1Y4DE 4MV0A 5K2MA 4ARVA 3L43A 4P3NA 3LT0A 5JDIA 1QHHB 2W37A 1N7JA 1DXYA 3DYBA 2IXFA 1XZDA 3S81A 1XPOA 3Q9LA 4XYBA 1NN1A 2JHFA 4OJYA 5DM2A 4IMPA 2H54A 3CX4A 1NZDA 2R4QA 1AZWA 5F7XA 3KEMA 4NX2A 1KEZA 1DKMA 3PC6A 3Q3JB 3DCIA 1Y3BE 2FE4A 1Z29A 5ALOA 1P77A 4KGZA 3Q88A 3HI6A 3BFPA 2CXHA 3KEOA 2ENWA 5E1BA 1SQGA 3KWLA 3FPGA 5CB6A 2ONKA 4EIWA 1RWKA 2HB6A 1T4GA 3PCTA 4GGPA 1T25A 2WJ3A 1M1YB 5AKXA 2GB4A 4P3XA 1UMBB 1CUZA 2GBFA 1CY1A 5I5EA 2ZSKA 4MIKA 3VNBA 1Z07A 3VU9B 5K4HA 2P40A 5K01A 4WY5A 3GVXA 3OU2A 5T6BA 2PXHA 2WV7A 1GFIA 5D6NA 1LTQA 1FVFA 2WVGA 3F5FA 3NJ4A 4MWDA 1MV8A 4AY4A 1DAGA 3T7TA 4MI6A 1C0PA 4NR0A 4XJXA 3SU8A 4DUGA 1GCGA 2PA0A 5LD2C 1G20A 2QN9A 4RWEA 4QDUA 2X0JA 1IVNA 4Q01A 2GM9A 5T8KA 3PCXA 1FMTA 1NDUA 1YZLA 1IWBB 1IE3A 1ODCA 3LJKA 3Q72A 1NMQA 3DBLB 5EZ6B 1YR6A 3VR1A 5EQTA 2G4LA 5IVHA 1Z6AA 1YB2A 2GTIA 3T9FA 4MLCA 4MYSA 3RD5A 5DBHX 5KINB 3FNFA 3KXDA 3RSCA 1JHDA 2ON6A 3QE0A 3AUXA 3LDUA 4MV3A 4URWR 3FD8A 4WVFA 1Z5OA 2C8VA 2IDKA 4NXNB 2UUOA 4HNAA 3Q5DA 5L40A 3ETNA 4EHAA 4MV5A 3KPUA 4QARA 4BFUA 4MDFA 3UMMA 4QX6A 1EGQA 3BKWA 1O96B 2V7XA 2GJKA 2JLRA 3C87A 1HF3A 2JAXA 4N18A 4BKOA 4LOKA 1JHQA 1L1FA 3LGXA 4HTFA 3GFTA 2VDVE 4GWKA 1DUSA 3WGGA 2B98A 4BY9E 4G26A 3TQSA 5E6RA 3FJOA 1C0LA 4KNWA 2RHDA 1Q7CA 2H4FA 3UJ9A 2ZI3A 3G6WA 5JZBA 2QD1A 1UAGA 3H05A 5BN4B 5F23A 3V8RA 1SC6A 1V41E 4QG7A 5JR3A 2GKSA 1V48A 3DUFA 2NUTA 3TCKA 3IQWA 3BB3A 3B6JA 3F6PA 4AJNA 3RKUA 1Y7IA 2PGOA 5L3VA 4TOIA 3UO8B 1QDUA 3VR2D 4AKIA 3IIEA 2AZ4A 3LMKA 4P54A 3ZWQA 5BYKA 4J4TA 2CHGA 1KSGA 5DK4A 1L3BA 3T5BA 2EZUA 3H1TA 2R6ZA 5BWLA 3MGKA 1U8YA 2C4KA 4X0EA 2RGGA 3MRXA 4IEEA 2J8ZA 2BZSA 4OBEA 1GR0A 1PFUA 1W9HA 2JFHA 3RVDA 3VAZA 1P6XA 3TL2A 2ZRJA 3FFWA 2WA2A 1NVFA 3KYJB 2VNJA 3FF4A 3K6RA 3V6MA 2XIJA 3CA8A 3NDJA 3H6HA 1OF1A 3IIMA 5DKFA 1DOHA 3K7EA 3BMXA 3IJEB 4OYRA 5G02A 1YE8A 5E4YA 3VR0A 4D3ZA 3GMTA 4CMEA 3QYPA 4FR2A 4Y2SA 2RJ3A 5K1ZA 4C08A 1KJYA 1RLIA 2B2NA 3K9LA 3KVVA 3L8ZA 3X1WA 1CNFA 2RHTA 3NHPA 3PJGA 3H75A 3R3HA 4KO2S 2G09A 4M55A 3OVMA 4B6EA 3FLEA 4W9RA 3N2IA 2IIPA 1AN0A 1KTIA 2XYVA 3BGWA 1QWOA 3C43A 4CMKA 1C50A 3ZY6A 3EQ9A 4RHTA 3C3PA 2VUHB 1SWVA 2I4LA 5BMVA 2O8BA 5DP2A 3C7AA 3GXOA 4HDCA 2O06A 3A37A 2JCXA 4UAVA 1N75A 1YAJA 2AI2A 3EZFA 4F38A 3ZHRA 2EG5A 1M7GA 4AICA 3DG9A 4O5AA 3FYSA 2HRZA 1XTZA 2R5NA 4IOLA 2IP1A 4G4SP 1OH5A 1U3DA 3E9QA 5ITZA 1KAEA 1LFDB 4DMRA 1T9ZA 4NBVA 4W63A 2IX9A 2SCUA 3C45A 2BKUA 4XIIA 2NAPA 3AM4A 5L6LB 2BGUA 4G6ZA 3C3EA 3CZ4A 1IAQA 4XVHA 2CK3A 1VJCA 2JEYA 1YZ3A 4YPFA 3AKDA 5EKSA 2GUWA 1XYVA 3DEAA 3H3FA 2C99A 1W1WA 2YZMA 3JPWA 4R0VA 1X94A 4WY8A 5EZYF 4TN1A 1BAPA 4E22A 1SUDA 5DO9A 1KO5A 1QQTA 3UK0A 1U2RA 3DLCA 3JSAA 3VH1A 3ZHOA 4A27A 3VSBA 5KYWB 3P4YA 3KUXA 3QQPA 2FZCA 2E49A 4OHXA 4RENA 2J09A 1PFGA 1HC7A 1U3FA 2UZ3A 3LXRA 2FXIA 4MUMA 2A92A 2PCJA 1HE3A 1E4OA 1IN8A 1UFRA 1OJ7A 1WD5A 3G7NA 4HO1X 4ND8A 3VI3B 3T34A 3OCVA 1P7CA 1U3VA 2QYTA 1VQ1A 4ZA2A 1NRWA 2J59A 1GFWA 2YYAA 2MMGA 3JQ6A 3IUQA 3WLRA 2ACWA 3IBSA 4CCAA 1BDMA 5IKPA 3U31A 4BYGA 2QAIA 2W2MA 3NH6A 3V32A 1ZGJA 3NWEA 4HRVA 2G1PA 4JLAA 4MWTA 5EUQB 3K3PA 2NO0A 1G8SA 3C3WA 4C0AC 1YOBA 1F8XA 4R2WA 1X1SA 1K68A 4JLDA 1EG7A 1SC3A 3TTXA 1S2NA 1J90A 2XODA 5EC8A 1IM8A 1EWTA 1M8JA 2FMFA 2P1RA 4PONA 3TSCA 3WIDA 2WWIA 3IELA 4NCJA 3LUJA 3GROA 4U63A 2C42A 3JQAB 1Z17A 1RBZA 3TYXA 5DWQA 2B3TA 2OZLA 3ZHQA 1L5QA 4PYIA 1C8VB 1OUMA 5F9HA 2J3JA 4RPGA 1JSCA 1JFFA 1RLOA 3QKWA 2ZATA 1XQWA 4TKLA 3KLBA 2X8BA 3V00A 3HK2A 4XWWA 1Z16A 2OFPA 2KI5A 5FOUA 2I3ZA 1ZZEA 2BR3A 3IT1A 1MX1A 3DC7A 3OLVA 3SM9A 5K0GA 2QE7A 2R1VB 3QG1A 3C4QA 3DBIA 2GN4A 5AKEA 1E6UA 3GOHA 2XUZA 4MRRA 4U2DA 4ZZ1A 1MENA 2H3EA 3RE1A 3TKAA 1GGJA 5DNDA 5D7BA 3U4GA 3UXMA 4A6XA 3WLMA 1DFIA 2W2KA 4JWTA 4N47A 4ASUD 3AR3A 4YRFA 1VGRA 3CUVA 2O59A 1ORWA 3V1KA 4DLVA 5AW2A 3QVGA 2OCKA 4E46A 1YQXA 3Q87B 2C9ZA 5K6AC 1IN4A 1B4DA 4C2AA 3OZWA 2IC5A 4TMVA 1G7SA 4JEIA 3BULA 1WPXA 2VJBA 1CR0A 2F1KA 5HFAA 1F2VA 1YB4A 4D4MA 5BSWA 4RTPA 4XWYA 1UC5B 3KLPX 4V24A 4KRFA 2KX7A 2PL3A 3FZYA 4MS3B 3HJBA 1YBMA 3UB3A 1TUBA 2R25B 2FDRA 1NZJA 3REQA 4B76A 1QYVA 4PW0A 3AI2A 3V3KA 1YI8A 4DV7B 1QAOA 2AR9A 4KN5A 2UYHA 3WRYC 4AP9A 4F7DA 5JQGF 1AO3A 3CHYA 1RFLA 3H5WA 1VI5A 2XWSA 3PGXA 4ABYA 3JAWB 2AN1A 1MEOA 1SXJE 1Y89A 4J0CA 1T35A 3OKFA 2WHXA 4Q48A 3GUZA 2HNKA 1EUDA 3U0VA 5FLKA 4MEAA 1JDUA 1G42A 2HF9A 2HHCA 2ONZA 4GICA 1ZONA 2VYQA 2UUAB 2NVUA 3TTUA 1MB0A 5T3UA 4Q66C 2QTVB 3ELWA 3H04A 4Q9JA 2BHNA 2V03A 1FS6A 1JR3A 1UC8A 2PRYA 3AIKA 3K31A 1IBKB 3RRFA 1PYDA 4KR2A 2A35A 3ONDA 3PX3A 1GKIA 2WUGA 3N2GB 1LUAA 1KE1A 4JA2A 1RPJA 3WL4A 4W5QA 1WU8A 2ZJ0A 3ET4A 4F4CA 4PSUA 3W1VA 4DA0A 5DGTA 2NYAA 4XD7A 2E4WA 2HRBA 3U3MA 4BCBA 1HG0A 3H0CA 1KC1A 1C8LA 1CF2O 3C8HA 2W6JD 1YZVA 3PC4A 3CEPB 4B4DA 4RZQA 1FSFA 2IXEA 4PX3A 5BWNA 2WW8A 1TQ4A 1QTNA 1Z15A 2IXBA 2P9EA 3CNHA 4WKBA 2AFIE 1THMA 4N8DA 5HF9A 3DHYA 2P77A 3IA7A 3O4JA 2GN6A 3OECA 1WSWA 2SKCA 4HC4A 4YRZA 1I9GA 4M9SA 4OXYA 3R7BA 1Z2AA 5I47A 1IZYA 3WK5A 1J42A 4QJ3A 3HE3A 3L6DA 5LQUA 3B6IA 1NRJB 3M6XA 2I76A 1N6KA 3MYRA 3LX8A 4B87A 4F91B 2QTMA 2PD4A 2JIZA 1VL5A 4EG0A 1L8LA 4Z51A 3A27A 1PE0A 2BMAA 3CEJA 1O9BA 2FCAA 2I6XA 3PJFA 1P3JA 5IFKA 2YASA 4UD6A 5CDYA 3ZTWA 1WO8A 5ED4A 3AEUB 2QJRA 1PWEA 4XCQA 3ANMA 3EG9B 3U7QB 3JTMA 3U6KA 4WTOA 1UFQA 1NP3A 4YMIA 4ZZ2A 5DXJA 5D2CA 3CH7A 3OX4A 4OLFA 3ZXSA 1PJCA 1QOPB 1KJWA 1DBSA 4PV7A 3T9DA 1U2PA 4U0KA 3UGKA 1SK8A 4MCHA 2C4MA 4GXTA 2CGEA 5TR9A 4J91A 1PX2A 1PJ2A 4WCDA 4KVZA 4Z0PA 2ZRGA 3NBFA 5FF9A 3OFSA 1KEEA 2RGWA 1QOQB 4M0UA 2EP7A 2WNIA 3C39A 3CNOA 1G5RA 3E9ZA 3HGTA 5TS3A 4CFSA 5E3IA 4ARUA 2Q7DA 4I1PA 2PUBA 5EI5A 1RHUA 2XOEA 5KNBA 1QZXA 1E92A 3O2QB 2FK8A 1OXKB 2WJVA 2QP4A 4I8IA 1G3IA 2FMXA 1R0ZA 2XX3A 2NU8A 2FU5C 4AS3A 4UCFA 4BEWA 1A9RA 1DIOB 4LGCA 1U5AA 1GZ3A 4TYYA 1NLMA 5C5IA 3IIJA 3KQSA 5CJPA 1N7HA 1MOPA 2X22A 4IIFA 5EP2A 1MJGA 3C14C 3A7DA 3RVQA 1UOEA 3FCAA 3LLUA 1J7JA 3KAPA 2GM5A 1RM3A 2HIGA 4XUCA 4DWOA 2VYCA 4UM9D 3F7NA 3X1JA 5EN4A 1J8QA 3TMYA 2AQ8A 1BVRA 1M1NB 5ARBA 5B55A 6AT1A 4OHYA 1T9HA 2OK8A 3PDIB 3T1OA 4J75A 2HBQA 4OA8A 1TQ2A 1HV8A 3QOWA 4LF6B 2P5TB 2OUIA 4LK2A 2C54A 1DXHA 5JCPA 1QG0A 5ICSA 5F51A 4PYLA 2QX6A 3OQIA 4FD2A 2R2GA 4MKZA 2F48A 3CMMA 1WB4A 2Q5QA 5IX8A 5G2OA 2AGVA 3I64A 2CLMB 3BBPA 4ZI7A 3VU1A 2JGLA 3URKA 2HA0A 4LY3A 3ZZ1A 1O97C 4TYQA 1UWKA 4YR9A 3K9BA 3D6MA 4WXPA 5CCXA 4RJIA 2PPLA 2ZE8A 2VQFB 1Y34E 5L3SB 2NOAA 3HQ4O 2CD7A 4JSYA 2HRCA 3CU5A 2NAFA 2VRWA 5TQVA 3AF1A 3D3JA 3HDJA 4OHUA 3S0JA 3WKEA 1F8FA 1N5OX 3QK7A 3WAKA 1X3SA 4JNKA 4BTEA 5LP6B 2Q4OA 5A9SA 1PLJA 3IDQA 3ZXIA 4X54A 4E7OA 4YCNA 2ZPAA 4M7OA 4NHEA 5TARA 1Z8HA 2WABA 3N8IA 4N5IX 5IZCC 3U13A 3IVCA 3BHJA 2IHJA 3TZ6A 2BFEA 1ZMTA 3CRVA 1EHIA 3O8DA 1MAHA 1QAQA 2UVDA 1WZNA 1KI3A 3LY8A 5G1PA 3IMGA 4CCYB 1IVYA 8ATCA 2O14A 3HN2A 2PWYA 4N41A 2P6NA 4IDNA 5LN1A 3PR2B 4KZKA 3AG6A 2NZYA 2GYUA 4H7IA 4F5ZA 2VDLB 2YIVX 3SX4A 4IR7A 3KT0A 1UOQA 5G0VA 4IDAA 4N54A 3NHSA 4F2PA 2CYCA 4ZVNA 5C81A 1LLQA 3ZV4A 1DPGA 1VL6A 4K6OA 1CUVA 1S8NA 1E3EA 4XSVA 2BAGA 2N9UA 3F71A 3SKVA 3VBCA 4CBVA 4EY6A 5DH9A 4UZSA 2COEA 3I9LA 3LBYA 2XJ9A 4L8VA 3N8KA 1FYVA 4Q15A 2OVFA 4IDFA 2F1RA 4MW7A 1WUJS 1Y82A 1TFRA 2IPMA 4EO7A 1TCVA 3S5UA 4C7OB 2BIFA 2CZGA 4KYVA 1U28A 3IAAA 2H9YA 4OMFG 2N75A 2NYRA 3RHFA