3UENA

Crystal structure of topbp1 brct4/5 domains
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
195
Chain Sequence
b'EGLFSQKSFLVLGFSNENESNIANIIKENAGKIMSLLSRTVADYAVVPLLGCEVEATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVISFSQCAGAEKESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 2-binding protein 1
publication title Structural insights into recognition of MDC1 by TopBP1 in DNA replication checkpoint control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 59
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3uenA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3uenA01
3UEOA 4OFBA 3SQDA 3HUFA 3OLCX 4IGKA 2M2IA 2K7FA 3FA2A 3T7IA 1L0BA 3K15A 2LE0A 3U3ZA 2ETXA 4N40A 3EF1A 3L41A 2WT8A 3PD7A 3SHVA 3KTFA 3HUEA 4BMCA 1T29A 2E2WA 1T15A 2L42A 2INGX 1L7BA 1Y98A 2COUA 1JNXX 3T7JA 3UENA 3COJA 4BMDA 4JLUA 4XPZA 1KZYC 3PC8C 3L46A 1IN1A 3PC6A 3L40A 2EBUA 2K6GA 2VXBA 1WF6A 2AZMA 3EF0A 1Z56C 2DUNA 2VXCA 2ADOA 3PC8A 4XQ0A 3PXEA 4IFIA 3PXDA 2JW5A 2XNKA 3PXBA 3K16A 2COEA 2D8MA 1IMOA 3SZMA 3K0HA 3PXCX 3SHTA 1T2VA 2HTFA 2XNHA 3T1NA 4BU1A 2NTEA 1OQAA 2EP8A 1T2UA 3JVEA 3T7KA 3K05A 3AL3A 2R1ZA 3QVGB 5ECGC 4U4AA 3PXAA 4Y2GA 3QVGA 3PC7A 3I0MA 1GZHB 3II6X 4Y18A 3I0NA 3PA6A 1N5OX 1CDZA 2COKA 4BU0A 3K0KA 2EBWA 4ID3A 3AL2A
chains in the Genus database with same CATH superfamily
2O3SA 2AEMA 4OO3A 3AEYA 3B1FA 3AXTA 3ZU3A 4MV6A 2JCXA 3D7KA 2OP0A 4IOLA 1ZRNA 4LJ9A 5JT1A 1HE8B 3H6GA 4QEZA 3UFBA 4GBJA 1CX9B 3QIAA 2AUNA 4RKWA 5B7NA 3IT2A 3Q3EA 1E77A 1CUXA 1QRSA 4D0SA 1UIRA 4AZSA 1CJMA 2UVDA 5ALXA 4CGYA 2XD9A 2MIIA 1BD3A 4C0JA 5JNTA 1NR7A 1O97D 4YP1A 1S8AA 1KRHA 2CMHA 1ZNXA 3JQAA 4WE3A 3WIUA 3M5WA 5TQ0A 4QM7A 3ZIAD 5KYYB 2XYVA 1UBFA 3OFKA 3DDOA 2VOJA 4AYXA 3Q3IA 1V6SA 3ZU4A 2Y6UA 1AG9A 3FVRA 1V1JA 1CRLA 2R7AA 1BE8A 3DD1A 4OQEA 5FLEX 4WFJA 3H5OA 3H05A 4QJIA 4ZTBA 2H5LA 4S3MA 4C87A 3ZBPA 1PD0A 1ZH6A 4JYPA 4XW2A 5ILQA 2JJMA 3TLBA 2PBFA 5DOZA 1CS0B 3WGIA 4N01A 1P9NA 5SICE 5IMSA 4I8IA 5CCEA 3GP3A 1MA3A 4OHKA 1L7VC 3NHWA 3R0VA 1G98A 1Y3BE 1AMNA 1T4DA 1QJ4A 2PR2A 4YEDA 2F43B 1P1FA 2C4TA 3VO2A 2WHXA 3I2GA 5JJLA 2AN5A 5DTQA 3LZCA 4TSRA 5GONB 3W7AA 2QORA 3NKLA 7YASA 1KJWA 1EYZA 3DVSX 2FEKA 2OKGA 3BAFA 4TMKA 5HF6A 1PTJA 2XOEA 4GBMA 3C7AA 3T3PB 1WB4A 4G0MA 4CRWB 4AQYB 2Q45A 3PGA1 4D6PA 4ZA2A 9GPBA 3BAZA 3E7FA 4HDKB 2PMDA 4J1NA 1PYGA 3GH3A 3NIDB 4HWSA 5HIAA 1OGIA 3R6TA 4QUDA 5CT6A 3ZZMA 4TWJA 1B00A 1J42A 4EKYA 5HS4A 5LWQA 1VSVA 3LXUX 1OW3B 3MD0A 2XEXA 2FN4A 4YMIA 1T2UA 5JYEA 3GRAA 4OJKA 1PRYA 4I3HA 3BREA 3CW9A 3HVKA 2XQIA 4JC8A 1NA5A 2NX2A 5FUWA 4YIKA 3P9PA 1T9BA 1W52X 3ITDA 2AIRA 4MS1A 4G84A 4XM1A 2W71A 1JG2A 1BRMA 3NGXA 1KY4A 4PPQA 4M0DA 3HCCA 1Z8NA 4Y6QA 1O89A 1SKAA 2Y92A 3MWLA 3M6AA 1RZUA 3TKLA 1K8ZB 2OCPA 4YMLA 3W8DA 2RHBA 4Q03A 1W49A 1YBHA 5BNZA 3KSZO 1TC1A 3OOEA 3U6KA 3RC8A 2EDAA 3EIQA 1Z5UA 2DR0A 1FBTA 4GI7A 4Q19A 1AHIA 3AF1A 4PO8A 2QQGA 5CITA 5LBIA 2HH9A 1TE2A 2EF0A 2XKAA 1W1UA 2BTQA 2O3QA 2ZYVX 1E2HA 1GGHA 3HSYA 3KR0A 4YRFA 4FDTA 4ZYVA 5K6TA 3G0DA 4M0PA 4MUBA 3SX0A 3MWGA 2X15A 2OFOA 3UEOA 3KOUA 4J0IA 3BGWA 2BM1A 4XD7D 5AI8A 2CHQA 3OLCX 4KH1A 1Y7IA 1ADYA 4D9CA 2BN4A 3DL7A 3GAZA 4N8DA 5BYAA 2QYOA 4IWNA 5IBCA 2ZSIA 3P2JA 2G1PA 4L76A 3OIYA 4IEEA 1ZN8A 1IBKB 2HWKA 3EPJA 4HMOA 2CCKA 2HDNB 2J3MA 3CO5A 1KVSA 4EQ6B 3MK31 2C9OA 2HHLA 1B2RA 4HLNA 5E3HA 2Z8ZA 2O7SA 1DP4A 3QLUA 1FZQA 4C4YA 4JJIA 4M89A 4IIFA 5JBIA 1UDBA 3AFMA 2ODAA 3SC2B 4C4OA 5JZ9A 3AVWA 3NJ8A 3NP7A 3WLQA 4XDZA 5E6SB 4WZAE 4OAQA 2B83A 2JH3A 4PN3A 5HSGA 1RYEA 2R751 1GCAA 2IP2A 1N8KA 4MZXA 5CG1A 1Q7TA 3LBIA 3I1JA 1I5RA 2HK7A 1Q57A 4QGHA 1J6UA 1JPVA 4BTEA 5JSUA 5JZSA 1JG4A 2AOWA 4WY2A 1JLLA 4B3FX 3I73A 4GOXA 4PS1A 4EUHA 4F7WA 2XIQA 1FQJA 2F3QA 5FPSA 3BB4A 2C00A 4BN4A 1X1SA 4EB6A 3PC8A 221PA 4ZOEA 5IAJA 4FKZA 4XX0B 2PU7A 3V3KA 4BUZA 5M04A 4WK6A 1BJRE 1ST2A 1T6ZA 2NYUA 4B8YA 1YR7A 1Z8HA 2OD7A 4TYWA 1IHUA 2O3JA 3G79A 4UVGA 5JS7A 5FTKA 5DBHX 1FIUA 1S0UA 4KTTE 2IZ6A 4E5KA 3GLHA 3M6WA 1N0WA 4JBHA 1KZ4A 4UBJA 5CDFE 1R6DA 2P11A 4HLUC 4HQNA 4YP9A 5K0SA 2LUOA 2V7QA 2CEAA 1LTKA 5IJZA 3AKEA 1V3TA 2PKQO 1GPDG 1GRVA 1POWA 3BHNA 2ET6A 2X2PA 5IC5A 3VAZA 4ZJPA 2I7TA 5FWYA 3PFIA 1RC0A 1Z29A 1F6BA 4HEQA 4B6EA 1PDOA 4O4HB 5TQJA 1KMCA 2R4QA 4MVYA 3KEOA 5CB6A 4OD0A 4WNYA 4DNPA 1YR9A 5IAGA 4LYGA 1D0SA 4Q7KA 1QFMA 1PK7A 2BKXA 4AL4A 1ZVQA 4A0HA 2XY4A 4D46A 3V00A 4MWTA 4J7UA 1PD1A 3ZLBA 3ABRB 3PDIA 1HTWA 4D9FA 2YFKA 5CDUA 2W9XA 4HB4A 2GK4A 3ZW9A 2ZJ1A 2GT1A 4DNXA 5EIWA 2ZWAA 2FPIB 2D1RA 1G9XA 1P2UA 3OUUA 4KVZA 4BVAA 4Q47A 1QXSA 1J97A 3F6RA 3KYCB 3FJ1A 1B43A 4EUSA 3TFOA 1X6VA 2J41A 3G9TA 5TMBA 5LYJA 1QP4A 1FF9A 2ZXUA 2YXBA 2DM6A 1WHTB 3MOSA 4W7HA 4HYEA 5IN4A 5M34A 1PR3A 2WFMA 5KVQA 1WMSA 1AS0A 1JEJA 2XUIA 3HEBA 5DTIA 4I55F 2G5TA 2IIVA 3AL2A 2QUBA 4F9FA 5EWLB 4ALKA 4HN4B 1OXXK 3ENWA 2PFKA 2VSYA 5JE8A 3FVVA 4K9QA 3B5JA 4PQYA 1CB0A 3FNIA 4JI5B 4PEVA 5K8TA 2O8BA 4OQNA 1MO4A 4RK4A 1GAEO 3WKEA 5DNWA 4LGMA 1JV2B 1DC4A 4P1ZA 3MBIA 3NB0A 4J07A 2E4AA 4QXQA 421PA 3B7PA 3L06A 1L6IA 1W5AA 3UANA 3F7TA 4IXTA 2HF7A 5JWHA 5HZMA 1BWSA 3GAMA 1U2PA 3U3ZA 2V7BA 4BCBA 5B57C 3FBGA 3K0CC 4RZXA 3M4JA 4RQUA 3T1OA 4U2BA 3PD7A 4OJNA 4HY3A 1GFZA 2ZK7A 1L5QA 2GAJA 1C9NA 2OCIA 3N2YA 2GAOA 4JP5A 5DOVA 3MQ4A 1QK4A 4P58A 4QG7A 2EP7A 1L8XA 2INGX 4N0PA 1ZW1A 1A5SB 4FYXA 2JFUA 2PRSA 1R8QA 3O1LA 3LL4A 4D98A 2FSFA 2FSPA 1BVUA 1ZMTA 4OHWA 2BFFB 3MQ2A 2ERYA 4YRAA 2GVDC 4Z7QB 1H2WA 4D8YA 2VDKB 5JY6A 2GSDA 1KO8A 4DR2B 1VPLA 2HY7A 4D9EA 2JGIA 3DL2A 3KHSA 4UNPA 5I9SA 3H18A 4S24A 4BO8A 3EC7A 3K8YA 5L3SB 4Z86A 1E2EA 2VRNA 1C3VA 3WNZA 4HQFA 5I7RA 2O54A 3WK4A 3N6XA 4WLEA 4FOLA 2FDCA 1J9ZA 3I32A 1DUSA 4JEUA 3WR5A 2H4HA 4ZK2A 1ZGCA 4RF4A 4JX9A 3KJGA 4BO6A 1XRJA 1NSYA 2ADOA 2G67A 3I9V6 4TV9B 1O7JA 4LFCB 3CLUD 1N9KA 2WE8A 2X1VA 4Z1OA 1B16A 3TTXA 3H17A 3MTQA 4OHVA 4XB2A 3UH0A 3DE7X 3BD7A 3LZDA 1WDKA 3IOBA 1FUEA 3FSJX 5TGDA 1HXHA 5COQA 1EBFA 3JQBA 2FLWA 5IPFA 2CUZA 1PW7A 3RVSA 1RQ7A 1PT7A 3B52X 1KK2A 3FFAA 2WYVA 4QDTA 4RL4A 4BASA 3REQA 4P3YA 1C4KA 2ZI7A 4OUDB 4U2GA 1THZA 1VLZA 2GJSA 2BUAA 1KEPA 3AZOA 2IYPA 3DE2X 4GOND 2R8OA 5HRAA 2ISQA 2ID7A 1VHTA 5KWVA 2EZ8A 3A1EA 4JQSA 1E1CB 3Q7PA 3WGJA 4LYDA 4B79A 1VLLA 1GITA 4I4TF 3FMGA 4FW8A 4OIMA 5TJHA 2ADMA 1U4NA 2HMTA 2YRXA 1HF3A 4Q37A 5FPHA 4GRDA 4WFQA 3R44A 3MA0A 4NBSA 1ELOA 1QTRA 3AY0A 3ZJ4A 2WTMA 1S9HA 2QRNA 3B9RA 3FH0A 4GWLA 3TQIA 1HYHA 4M83A 4YJHB 3M6UA 2GQ0A 3K6JA 4DCMA 4E5VA 3RSHA 4KIJA 5BQ3A 2XYRA 1M5UA 1GUBA 3R0ZA 1RAAA 3LY7A 4YBRA 3FDJA 1SXHA 2AOUA 3MELA 1N3LA 2A0XA 4K5QA 5ELMA 4EVSA 5DN6A 1NUPA 1FXWF 3V7FA 4F3TA 3I8SA 3PEFA 4N65A 1XTKA 4RV4A 1GZHB 1PR1A 3WRYA 1L7NA 2J7KA 4NFSA 3TKAA 3FZNA 3PPWA 2JAUA 2VTVA 1LI7A 1SBHA 3ZBUA 9MHTA 1JR3E 1SOWA 1ISSA 1FS5A 3OJFA 4RHCA 3EUFA 4KJXA 1E2GA 2C5SA 3G1UA 4IINA 1VI6A 1QHYA 1VI5A 2W0SA 2QAGB 1L7AA 2RC5A 5D6NA 5MN6A 4LMBA 1Z63A 2ZE5A 3MT8A 3RS5A 5COAA 3GLIA 1UZNA 2B1GA 1W44A 4IDOA 1UMDA 2R1TA 3AEQA 3W5UA 1U6IA 2ODBA 3NUQA 1E58A 3PPVA 5EJ7A 2YJTD 3FPKA 4NU5A 1J8VA 3N2GA 3UWKA 1G291 1ZX1A 5EE5B 2PX4A 4K9MA 4L51A 3QFHA 5K8LA 1G8MA 1GKLA 2QYTA 4MQEA 5DGTA 4D5GA 5AVJA 2VQFB 3EQ2A 5D3QA 4AS3A 1YZNA 1LY1A 4PNZA 1MT0A 2BMAA 4OHMA 1UANA 4TKLA 3O8RA 2TS1A 1OXBB 4LWOA 3ZWPA 3U3DA 2H1WA 4K1XA 4F4UA 3W5SA 3RIYA 2VDUE 4O4JF 2JHCA 2EHJA 4IKEA 1TEZA 2QDKA 3MCUA 4AUNA 1J5PA 4YRZA 1H69A 1L1RA 1U6KA 1U98A 2FW9A 4CM9D 4UFPA 1J8MF 1NXVA 1QVRA 2HIHA 4YX9A 5HTOA 1KFCB 4YPOA 1WUTA 1XA0A 5LP6C 1ISHA 1YCFA 3CJQA 3CSUA 2XUZA 1FXUA 4N8SA 3JWHA 4MUMA 1XRSB 1KQNA 1QFXA 3PQ2A 1M1ZA 1CYDA 4D3XA 1Z7YA 3L7JA 3H4MA 4M9ZA 3TZKA 2C3YA 2EJUA 3V1YA 4MARA 2P1RA 2Q8QA 5AKIA 1FPMA 4R2WA 4NC9A 1V1RA 4TVOA 3R3WA 3MTJA 5A3VA 1QYRA 4ZKEA 5IJ9A 1JJVA 5K3FA 4UAJA 4L16A 4IDQA 3I1IA 1UAYA 2RIRA 1FFSA 1XRMA 2HLDA 2JCGA 5TPWA 1F1BA 2XB4A 3TW4A 1C7EA 2Q0QA 3IKLA 5IWCA 2ID8A 3TWOA 4QXPA 4PZDA 2Q2VA 1IVYA 3HWX1 1IMOA 1JSLA 2BBTA 3I6MA 1RHQA 3ONWA 3IQXA 2YJNA 1AKRA 2VDLB 1TGVA 3KJIA 3REFA 1XMSA 3RANA 1DADA 1W5FA 3QU4A 4WLOA 3G89A 1YVUA 3HYNA 1I1HA 3SMVA 1FSGA 1A9ZA 1RMQA 3GVIA 3OQJA 2IF0A 4HPWA 3U80A 4CUZA 3FNQA 3SJ7A 4ALJA 2YICA 1I7PA 1HDZA 5D1HA 3W90A 1KU6A 3EXHC 3H2GA 4FKMA 4M1EA 2R6FA 1NGSA 3N8GA 3BMCA 1WU7A 2PZAA 3HJUA 1UKBA 4QRIA 3UXMA 4E4TA 3V5NA 4ZYXA 3NIGB 1RCUA 1G9SA 3CPEA 1HDXA 4QARA 3HXKA 3JZFA 4CL0A 2ZJ5A 3OY7A 5CGQB 4FHDA 1MW9X 4QOIA 5AJTA 1XFDA 3EPPA 1XZLA 2WSMA 4TMWA 4PC7A 3WV4A 5LL6P 4TWIA 1UBNA 3A1CA 5FNVB 8LDHA 4BO7A 4NCBA 4BBAA 1RZRA 1Q20A 2QBYB 1E2MA 2YKGA 4LRSB 3WICA 1BE6A 5EZ6B 4LWQA 4MW0A 1J5EB 5D7BA 3WGNA 5FWXA 3EEIA 1MOZA 4UDXX 3A9RA 4Q9DA 3NH9A 1ZGJA 3EGWA 2XCUA 3ZQUA 4GC5A 4DT1A 3QSGA 4JR1A 4RVGA 2XDQB 1ICEA 1KJIA 1UXKA 2AK3A 4G9GA 2Y68A 4CCAA 1EUZA 5IEJA 3VTFA 1C4OA 1YS1X 1QH9A 3S2UA 3V34A 1MX3A 3RD5A 3SEQA 5B7PA 1WJGA 4MULA 1YAJA 2PKRA 3OCVA 1EK1A 1I3OA 4NYIQ 1FYWA 1NBAA 2GXQA 3QBDA 1JHDA 1HYBA 1E8MA 3QXGA 2DULA 3BSSA 5B3KA 1M2OB 4J16C 2PVSA 3CPHA 4EGQA 4PHCA 1ODJA 1O0BA 1P77A 1HOTA 1SIBE 4BWVA 3HKBA 1N8NA 4KQ6A 3DV0A 3JAWA 5JCPA 3ZQ6A 2COUA 3N8IA 5BWBA 2GPBA 1HLFA 1PJBA 3JD2A 1XNHA 1S2IA 3KJZA 4DBLE 3COJA 2YVKA 3ESYA 1U99A 3RSFA 2W6QA 3ZE9A 4OQQA 4DM7A 1TZKA 4IHJB 2PGOA 2GB4A 5L4LA 4Y9SA 1ULUA 3BF7A 3U7HB 1JIJA 4AMYA 4CMIB 3I4LA 3CT4A 2QMUA 3ND9A 1A96A 2ZZKA 4PC3A 5E2AA 2G1JA 1UPBA 3KK0A 2GFHA 4MHSA 3UPTA 1I36A 2ZSKA 1R4MB 4ILKA 1SC1A 3V8VA 1XJQA 2VDMB 5CD9A 1UMBB 3KB8A 5CD1A 4IW3B 2QD3A 3WK7A 5KOYA 2Z9DA 4RTPA 2O06A 4M4SA 4JQYA 2OFXA 4YT4A 3GLFA 2ZP1A 1W47A 4OLJA 3UAZA 3CVXA 2H2FA 3AVTA 3M4NA 1D4ZA 3HA2A 5DWQA 2RBGA 5LZ4A 3LOUA 5MGNA 2IZZA 2PNJA 5AVWA 4YJGB 1NNI1 2WMYA 2GN0A 3S2IA 5ELXA 1GA1A 5A2QA 5IH3A 3I2KA 2YV3A 3S1AA 1K08A 3I52A 4KVFA 1YKFA 1HDYA 1ZONA 3IKVA 5KJCA 1T2VA 1ZXLA 3WQQA 4P2GA 4FDAA 3B5EA 4GSYA 3PUHA 4POAA 3L8YA 2GS9A 4Q34A 3LQKA 2O2GA 3ONVA 5D8DA 4NX2A 5DMHA 1XTSA 5ITSA 4V02A 2ATVA 1X1AA 4QHYA 5DX8A 2HQOA 3HNRA 4ADSG 1QIHA 1OHHA 2BFDA 3AC0A 3SSNA 4RTMA 1G5RA 3OQNA 3TB6A 2W7TA 1AH2A 4NH4A 3IRUA 1QBGA 4KN6A 1KY3A 4PW0A 3DEAA 3LOPA 2VHCA 2NXEA 3GO4A 3UJ8A 1QE3A 2VO1A 4OB7A 1MZVA 4RJTA 2XYGA 2QR2A 4PGGA 1RT9A 3GJTA 2V3CC 3OT1A 2C5HA 1NOKA 3TXAA 1K86A 2Q46A 2HNKA 3PEWA 3AUXA 2XKJE 4QATA 4HDOB 2W42A 4G1MB 1F3LA 4OJYA 5AHXA 4I50A 4EECA 3AIOA 4NU0A 4F12A 1DWQA 4AS2A 3L4KA 4L72A 4IDNA 1FFHA 3H1PA 5CH8A 4YMUA 4NZNA 4X8MA 1T1RA 3IP5A 5BSGA 3KWJA 3UMJA 3IBCA 1Y3IA 3WYEA 5ERYA 3I76A 2A9VA 1Y6QA 3S2GA 4JP1A 4LKOA 4OFBA 4EO7A 1KKLA 3P0EA 2IL1A 2C98A 3VDQA 3HBLA 4EB0A 2EVWX 3GEHA 4AO7A 4IFBA 1WM1A 1ZL2A 2RGAA 1RRKA 1E0SA 3OPYI 5LIRA 5JTTA 3E8SA 3IAM6 1NQTA 3OFVA 3PUXA 4C7KA 1UDAA 4JOCA 2GEDA 3PKZA 3PWKA 2EFGA 4F1JA 2RHTA 4C6RA 5KVCA 3OX4A 3IBTA 2J6CA 1VSUA 1YVDA 3WSVA 3GT0A 2ZS8A 3OCYA 4YY3B 2DAPA 1UOPA 3I8OA 4WKGA 2QVZX 2M6SA 3PNPA 3WS7A 4CHGA 3SR3A 1X7XB 1SXJE 3L4BA 4GOOD 1ZM4A 1XVIA 5C1IA 1PJ2A 4IHAA 5KSYA 3Q3JB 2ZI3A 3SLRA 1EFKA 2IHJA 1JHYA 4HWOA 2DTDA 4CI0B 1FTQA 2BSAA 2QROA 2I8AA 3EZ7A 4G0YA 4OQYA 4TYMA 4E4YA 1G4AE 1LBEA 3TAHA 2A58A 5G4KA 1XAGA 4Y2RA 3M0EA 4FLFA 3M2TA 3I83A 4HQ0A 3EG5A 2ESRA 4XR9A 4ZVNA 4E12A 2HYDA 5FRDA 2RB4A 2AVNA 1QB8A 3D3QA 4UOZA 1ESCA 2BR4A 2XGSA 2AZMA 2YVUA 4L5JA 5UKDA 1EGAA 4PF1A 4WBSA 4ZOCA 8ATCA 3DG9A 5GJWC 1Z6TA 1VG8A 1VIYA 4HOYA 4BXOB 2JGDA 5LDHA 4KR7A 5AHWA 1N6RA 4BIIA 2Q5EA 2NXWA 2NNLD 3FUVA 1KYZA 5JATA 1G66A 1RWVA 4KMSA 2IV3A 3N70A 1B1AA 1GRRA 1M8KA 5F3WB 2HCBA 3T3OA 2B4KA 5KYXA 1V5EA 5BUCA 5L6LB 2FETA 3CR3C 4K0KB 3JQAD 4LC1A 4EZEA 4FEGA 1VMEA 2ICAA 5C35A 2H1FA 2A9KA 2ZBGA 4UPEA 1RPAA 1H9CA 3I37X 3A6HA 1KNQA 2WJIA 4CM8B 3WAGA 1A5ZA 1U3TA 2VBFA 3GCXA 3L0YA 2Q3CA 3EVFA 4XDHA 3VH1A 3GLVA 4F72A 5JWRA 4GDFA 1PFYA 3AYZB 3L1KA 2ARKA 3B6EA 2HV8A 3T7AA 1KI7A 3CZMA 3RSZA 5FUMA 4R8KA 3BFJA 4F4CA 1P8JA 4WDRA 1CERA 3WLTA 3E9RA 1TNDA 4PQGA 1PDWA 4F84A 1X80A 2AN9A 2IXAA 3HB9A 3M1AA 2QD4A 3SAJA 3UA3A 3WYAA 2PTGA 3KO8A 5K2MA 2I6FA 4LJKA 4S0XA 3FPHA 5H9VA 4FDVA 4UJ3A 1RTTA 1OA1A 1SA0A 1B74A 1SPBS 1Z7EA 4NL4H 4PRLA 1CDDA 1JQ3A 1W5BA 2RAPA 1BVRA 1M33A 1J33A 1WXFA 2P40A 3C3XA 1R8SA 2B20A 1GILA 5CW2A 1H6BA 5D3ZA 5IKOA 4MVJI 2CUNA 5HJEA 4F92B 5IT9A 2RGRA 4XOUA 4D81A 3AESA 2GILA 3T3MB 1X7WB 3GI1A 3SXUB 3RFUA 4XVHA 3ZGYA 1RWNA 4GPIB 4RZHA 2Q21A 2X4IA 5KAMA 2QRVA 2JC3A 3M82A 2VVTA 5U1PA 3AWIA 4UBNA 3GCZA 4F04A 4UUBA 1W9MA 3WLFA 1I14A 2E1PA 2FMXA 2J7PA 3DYVA 3LUJA 4XVRA 2HX1A 2WABA 3QEMB 4MSUA 5EJAA 1V6AA 4CMKA 1JQBA 3K2EA 7GPBA 5ESRA 3VMFA 2X8JB 1UKEA 2WIAA 1AQLA 4CG3A 1L7RA 3I2FA 3VR2D 2H1IA 4KFCA 3C3YA 3I04A 1R37A 3I6YA 3UN1A 1FNSA 2HOQA 1SBZA 1QKKA 3V4FA 4K7JA 1ORDA 3IC5A 5IN5A 4ZAWA 4WZAB 4AM8A 4DBZA 5J23A 2BHNA 3F0TA 3LX8A 5ANRB 4F4JA 3Q85A 1MGPA 1UBKS 5KO2A 1D9ZA 4IUBS 2NUPA 2Z5LA 4MPJA 6Q21A 2HYIC 5LC1A 1Z6XA 1LJLA 4OF4A 4DRYA 5KYNA 2F4VB 1FFDA 1IATA 5AKYA 3BCRA 2JFVA 5DCUA 4XFDA 2C4WA 4TXLA 3V55A 4URXR 5HQ3B 3G49A 3UK6A 4KVGA 1ZZGA 4NTZA 2H08A 3CX3A 3UGTA 2EP5A 2RHCA 1E3SA 3ZYZA 5BRAA 5HKAA 4I3FA 5K1ZA 2F3SA 2WZQA 1DV1A 1WPRA 1J0BA 1KF0A 1R5NA 3QQPA 4RLFA 1AUXA 3LW8A 4FGUA 4RELA 4YCJA 4JB2A 5ARDA 3JVUA 4RK7A 5FFFA 3AF3A 4W5JA 3LUCA 4HDSA 3EVNA 4MZDA 5SY4A 1E6CA 1THMA 4Q12A 2MYNA 2Q5QA 1WCV1 2DCUA 1DC7A 3FPCA 3IBSA 3LYLA 4HSEA 4LCBA 4MIEA 3IO3A 4Q5IA 1UXJA 1TLLA 3ZHOA 2RONA 4DQDA 1NQWA 2PVCA 4V3BA 4LC0A 1W4RA 2HU2A 1IIRA 4MWCA 5I7WA 1KP9A 1NPTO 3JD1A 1EU1A 2R47A 3DUFB 1FDWA 1ZU4A 4QYMA 3V80A 1E1KA 3EG9B 4EUFA 4ZJUA 3WYCA 2FPSA 1XWWA 1MENA 2PO7A 2FEAA 4MYCA 4M88A 3TAUA 5E3JA 5KVSA 1N6LA 4B3TB 4DCNA 1INLA 1CTQA 2WVGA 4H7HA 4N3AA 4UHBA 4TN1A 2QG9A 4N39A 1NX6A 1VJ5A 3WMWA 4RA6A 2FPPA 1ZI8A 4U2FA 1TPZA 1Q14A 4OJMX 2FUKA 1OI7A 2I78A 5K3FB 2V6IA 3LUHA 2OLEA 1ONNA 2K4MA 5ILOA 2I3DA 3O26A 1AGYA 4QJ4A 3SCZA 1KXJA 3LY5A 4JJEA 1HDOA 4KCGA 5JOQA 5K4AA 3NHKA 3K53A 5B3JC 5G1NA 1UPTA 1BQEA 1DQPA 1YONA 4Y9RA 5TARA 1RKVA 1T9GS 3LP5A 3LXMA 2OOSA 3CZCA 3H2HA 4RY0A 5REQA 1FP1D 2XF2A 3K9FC 5MFZA 2WF7A 1J4AA 3MWDA 4H15A 4W99A 4ZT6A 1N2XA 3MC1A 1IH8A 2Q1TA 5AW1A 1UFVA 5FFNA 3ZZNA 6REQA 5IJWA 3TNJA 3OMLA 1G41A 1DOHA 3PP8A 1PBTA 3S3TA 3ASUA 3LQ2A 3S28A 2ISSD 2FKAA 1U7OA 2MJLA 3TM5A 3TJZA 3DQQA 1DQRA 1AZSC 5LP1A 1EIWA 1XMQB 4UBIA 2FI1A 5CNIA 3KLNA 5SY6A 3IKTA 5K5EA 3IX7A 4Y2UA 1FQOA 4ZVOA 3ZQJA 2PBRA 3PWZA 4XH9B 2ZSEA 4LVOA 1A2QA 4Z4FA 5HG0A 4KFUA 4I1OA 3HL0A 2NT4A 3BE6A 2HMUA 2PZBA 4FVTA 4G2NA 2GJ9A 5I9IA 2V7QD 4TWBA 4C0LA 4CDRA 2VT2A 3WWEA 1BAPA 2VJDA 3PNOA 4HB0A 1NQVA 4OXRA 2VEDA 5K6RA 3C4JA 4RS3A 5AOBA 3EQZA 4GLJA 3RRNA 4F6CA 1SXPA 4Q48A 2DFLA 2N3ZA 1SBCA 3D59A 1RPNA 1YZ3A 2R97A 5JFTA 1XEWX 1NOIA 3AM3A 4P93A 4O0MA 4PTLA 5JNWA 2ZULA 3CRRA 3OLXA 4HAZA 1A1SA 2FSHA 4NVRA 5BSVA 3AFGA 3RTDA 4MPRA 1X1DA 4XR4A 4LA4A 5CDYA 1TMYA 2UVQA 3T4XA 1P1HA 3EE6A 3U1VA 3FWNA 4YH1A 3BQ9A 5HFJA 3T7JA 5TPZA 3AIKA 1P6QA 4Z1MA 4KGDA 1DBWA 3D4LA 3KXIA 4ZYYA 1Q5PA 1NVXQ 2SICE 4PBTA 2IYEA 3MINB 4CLHA 1NR1A 1I9GA 5LKRA 4G41A 3UHAA 4RY9A 1N6NA 4AZTA 2VWPA 4IO0A 1XA3A 5BP7A 3BRCA 1O08A 2ZIVB 4MUFA 3HNPA 1QOPB 3GQVA 3NETA 3PC3A 1JG6A 1SK9A 2OCBA 1JKJA 2AMYA 5KU1A 1D2AA 4L1KA 2FAXA 4GLOA 5JPDA 1NNEA 4PZAA 1FDUA 2RHMA 1QG6A 5BR1A 2BR5A 3OQHA 2X9LA 3FNGA 1TKRA 2VHYA 3OQMA 5BV0A 1MAAA 2WF8A 4XYLA 3L5KA 5DIZA 5ALVA 3DYBA 3RK0A 2AJ8A 5IJXA 2PZFA 1QLHA 3H87A 1Z4NA 3AEKB 5A7FA 3OQOA 3B1XA 2NYVA 4WCFA 2ERXA 1RJ9A 2FRVA 3P19A 4KQEA 4ZT3A 1RQLA 4HDCA 3KKZA 1QDUA 2G8LA 2V98A 4NE9A 1D09A 2UVPA 1JEQA 5EERA 4G4SO 4MUKA 4YDSA 5I7FA 3W6PA 4JB8A 1U28A 4JI3B 2Z4RA 5LYJF 1AT1A 1MJNA 3JQFC 5CNMA 3UNXA 2ZJFA 2CBZA 3AF2A 3AI3A 1JIUA 3OLYA 4KPGA 1B0AA 4B5LA 4F5YA 3MSCA 3JV7A 2GO1A 4FFVA 5F1OA 2C5BA 3KOYA 5IXSA 2H1LA 1BHJA 2ZRKA 4XIFA 4IDCA 4KODA 4XB6B 3ZCSA 3E82A 1CK4A 2GEVA 2WD9A 4PX5A 3LLVA 4DLAA 1CP2A 1U2TA 4K6CA 4C7BA 2WFLA 4XWKA 2OXCA 3TFQA 3TQFA 5ER9A 2D2IA 2GCOA 2IIBA 4UNQA 2I76A 4XRGA 1B8NA 1UPCA 2NUAA 4M7PA 1CVIA 2RSLA 3LT2A 3QOYA 1FDOA 3IA2A 2F3UA 2AFHA 4P7JA 5G1OA 2FGJA 3LQFA 4KIUA 2P35A 4GU5A 1PYDA 5JEDA 5LSAA 1AGXA 3VU1A 2VP4A 2GETA 1CUEA 2UXCB 5IBPA 1IVNA 1ZVKA 3H3FA 4H3HB 5F4BA 2P9JA 5ALOA 1Y3CE 4EHFA 1JSXA 1JYSA 2XUQA 4XKJA 5IEBA 2PGXA 3CVUA 1QP7A 3STUA 3UOGA 1L1FA 4CIXA 2PJUA 5TMEA 1LPBB 2Q07A 1QYWA 2Q6VA 1ZN2A 4KI7A 1P0CA 4CUKA 1LLDA 4YUAA 4LF4B 2FP3A 3F2IA 2GZ1A 3CINA 2EWWA 3KC2A 4MJ7A 4OUKX 2RHHA 4G23A 3KDPA 2PLRA 4OQXA 2C84A 5GADl 2X3YA 4F5EA 4AKHA 2IPXA 3AVOA 1UMCA 3K20A 1NWCA 2XB2A 4UZEA 4TZKA 1XCJA 3OP4A 1VP3A 4JLDA 1P1KA 2MWMA 5IAEA 4G2TA 5IP5A 3U3RA 1ECBA 4O2AA 2W2PA 3OJWA 1G4UR 3WYGA 2YN4A 4ACBA 5DEOA 1I24A 3FCYA 4WUVA 3B9BA 3M6MD 5GOTA 1YGPA 2RCYA 3HDQA 3D3NA 1KI8A 3IUEA 5DN6D 2G63A 1VJRA 1BSVA 3ETCA 1FW8A 1ZOOA 4D42A 4EKIA 1DZIA 1WXWA 4Q9NA 2WYHA 3KWMA 3R24A 3UB2A 1YD7A 3WQRA 2FOIA 4OXNA 1ZJZA 3X43A 1Q3HA 5EE1A 3T52A 4TMZA 2O8FB 2C9YA 3CBQA 2I3GA 4I5DA 1QH1A 3W8EA 2CDRA 5AW3A 5JSQA 3I09A 1D2GA 1G6HA 1N7IA 3UC9A 2JEOA 2O7RA 2R11A 3GVHA 2AS0A 3QVLA 5E2IA 5FUYA 4E0BA 1UDRA 4NICA 1YFKA 1LC0A 2IPMA 4PPNA 4Y1RB 4MVJE 5KSWB 3NM6B 1KP2A 5A0TA 1W59A 2IEGA 1UBJS 1V71A 1Y8RA 2XQGA 4D4KA 1QIEA 2MSCB 2W93A 2QI9C 2PZ8A 4YWHA 3ISTA 4EFLA 3FDFA 1L4LA 1P75A 3N86A 4RHYA 3NQ41 3FCAA 1UBSB 2W2KA 4H1UA 4EVQA 2JLVA 2JGFA 1UFQA 2B0JA 3IOCA 3SS9X 1I94B 1QHHA 3AW9A 3BT7A 2DQSA 5EIAA 5CXXA 3HCEA 3HHPA 4QELA 3DO6A 3SFTA 4EELA 1FX1A 3CSDA 2OAEA 4I4TB 3MJRA 3I30X 4GZ5A 3KD3A 1BMDA 1SULA 1TPYA 1MFPA 5DBOA 4QSHA 2NVOA 2GZ2A 3A28A 3ICPA 3VKUA 5EJ4A 3NWOA 4PZPA 1SCNE 2XCLA 2P2SA 2ZT6A 3JVEA 3Q9LA 4FHGA 4HL6A 1EP3B 2VDWB 3QBTA 2A78A 3ANYB 4P5EA 5HUHA 4GKAA 1DWPA 1LJ8A 4E11A 2O9JA 1RWBA 4MYRA 5DTJA 1IHYA 3TNFA 4BNTA 3OCXA 1XMOB 1K8QA 3M6XA 2W48A 3KV3O 3A1FA 4V24A 3NTQA 4GWKA 5B1EA 3X1WA 2YH2A 1YJBA 2R8RA 3O5AA 1KBQA 4KXYA 4ZCSA 3TS1A 4JXXA 4DV5B 2P6RA 5LOVB 2QVBA 4H3VA 1LPMA 2QLMA 3C6YA 4ZHSA 5C0OE 3ROTA 2BHSA 3LUKA 4DMFA 4LNUB 2AG8A 4RDIA 3SE7A 4NR0A 3QVOA 4YWJA 3B1WA 3FHJA 5B53A 4A82A 2GSWA 2R00A 1E9FA 1JZQA 4HR7A 1NQUA 1UFOA 1Z0DA 5EWJA 3WLKX 3KLBA 4J0FA 5CLFA 4BLTA 1Z8DA 2ZW9A 3K9BA 2BHLA 1TCVA 2XAUA 3NJRA 5DHUA 5DV9A 1JQDA 4TSFA 3QX3A 4KGVA 3MMZA 2CZCA 3X1DA 5JS6A 2D6FA 1QHGA 1IY0A 4FGWA 2MHCA 4M1WA 2OGZA 3H1FA 4RD4A 3LKZA 5AR1A 1GGNA 1Z2OX 1L3BA 4CV3A 3R0QA 4K9DA 4X20B 4D9BA 4PG7A 2WY2D 2AWOA 1VYVA 1B73A 1WMFA 3DLIA 4HDNA 5DWVA 2OK7A 5EJMA 4Q7QA 4P86A 2PPLA 3J7AC 3GJ8A 2P65A 3ADBA 1L5LA 4KB5A 4Q1AA 2I4RA 1E1RD 1OLSB 4GNRA 4KQHA 1ZVVA 1MP0A 5LZ7A 1R3DA 3RS2A 3TOCA 4XTCS 3H11B 3WIDA 4MQUA 3FBWA 4COKA 3AR4A 1KFKB 2ZVQX 3PUIA 3ZK9A 5KNDA 4ND8B 4AO8A 3VPBA 3DULA 4U7GA 3ZX4A 3AFNA 3AKZA 3ZZTA 3GNLA 1R64A 2GYVA 5DLYA 4CM7A 4FFLA 3DVAA 4COOA 3DZFA 4NZOA 2QTCA 1C30A 3HO6A 3DOEA 2O4CA 2BMJA 5G1PA 2C31A 2POQX 4EF6A 3SG0A 1P0QA 1E6WA 5IDQA 5AI5A 2FFRA 1GD1O 3F3SA 4WEOA 3FTCA 5INTA 5K0TA 5HA5A 1N2IA 4OREX 1WXQA 4KDCA 3A3NA 3SSOA 3EVGA 3U7QB 5FUVA 3QY9A 3JRNA 1GM5A 1BU5A 4XPIB 1ODFA 5EJ5A 3TLAA 2AMVA 1KU0A 1I3CA 3SC4A 1UC5B 2WM2A 3KTDA 3SXPA 1VJTA 3Q7TA 1P73A 1WR8A 1P91A 3ER6A 4KV7A 4TQ9A 2YWFA 4RETA 5KHAA 5DIFA 1W75A 2DWCA 5DGDA 3ZNQA 3BWEA 3VR5H 2ZUBA 1U04A 1IUPA 1C4WA 3DDSA 4FGLA 1EUQA 4HZIA 2QTVA 2RI1A 4DIEA 2Y4NA 4LQDA 4NOMA 2JD2A 3I58A 1EDOA 5CT4A 3TIXB 4ISCA 4HDMB 5IU6A 2WR8A 4URZR 5KTRA 2D74A 3IJPA 4QOJA 4AF7A 4OA5A 2VNIA 1Q0TA 3U3OA 4PLPA 2XMGA 5EHXA 1DXQA 3FYTA 4TMFA 3CB2A 3NFYA 4LHSA 2DJIA 3UXHA 3RC2A 3W5CA 1SD2A 1KDYA 1DJLA 3RAEC 4RANA 1Z0UA 2O5VA 2RGGA 5EPOA 4MYSA 3E3MA 3CZAA 1QC5A 2HM7A 2MSDB 4II3A 2Y8EA 4K9RA 2XWBF 2Z1NA 3QPCA 3K9HA 2K2WA 3DFZA 3Q6IA 3RS9A 3TSYA 2V54A 5BV1A 4PLYA 1XC7A 2XMSA 4YRPA 3UWDA 1H94A 2FLKA 4PX3A 1XKXA 5FYDA 3JW8A 4DQVA 5ED4A 2XZLA 5EQFA 1T8RA 2H6EA 5D85A 4DCUA 5KTSA 5IANA 1PNTA 1EWRA 3HV2A 1TQ8A 3Q15C 3OCZA 1RJWA 1KJQA 4JLNA 4K1LA 4Q93A 4UTZA 3HSSA 5FI0B 4YFVA 1ONSA 1S8OA 2EQAA 1J0AA 4LZZA 5C8DA 2F8TA 3MLEA 5EYPA 2QRJA 4J2TA 1EE9A 1GNRA 2CKDA 2FCAA 3BCSA 1Y1KE 4KQ2A 5CYFA 3U37A 2ZYSA 1WNFA 4B71A 3HVIA 3LVBA 1X15A 2HJSA 1F8GA 3C48A 2ORWA 5ALRA 3QSYA 5EP3A 3O4JA 1QS0B 2HIAA 2C5AA 2NGRA 3U0VA 1EUDB 2PQ6A 3B20A 1DFHA 1RADA 1PJTA 1VL1A 4R05A 2ZSBA 3NCTA 4XYBA 2H0RA 1GVHA 3RLIA 2OMKA 2XE4A 1JXQA 4ER5A 4GX2A 5LVAA 2DKFA 2PD6A 4N12A 3HUFA 3QXHA 3T3HA 2DWUA 4N5LA 2LGJA 1SY7A 2QJWA 3LRXA 4S1TA 1MLDA 2GBGA 3KVNA 2MCFA 4GKJB 4RD2A 3IR7A 4NEGA 4DLTA 2JAPA 1XFAA 1F3OA 3BUSA 4HH1A 1C1XA 2I66A 3T38A 3QUBA 1MPTA 1P4RA 3KR2A 5FTJA 5LIPA 2YIMA 4AXXA 5CLLA 5JU6A 1OTHA 2XUJA 2J9FA 2OV3A 4EARA 5B55A 2DQZA 1HPLA 1CUVA 4JQCA 4QWMA 2ZSUA 4PCLA 4PWZA 4YCAA 4CM4B 4QDOA 3IP7A 3KELA 1AK2A 1JU3A 4I4CA 1P1IA 4IIYA 3I92A 2FG5A 5LA6B 1JHOA 2ZWMA 3K9CA 4L74A 3C6MA 3GRYA 1VC2A 3ROEA 3NBXX 2C2ZA 1ZJ4A 2R85A 3H0KA 5HXAA 4EYGA 1NZDA 4JJ4A 4Q3LA 5KNBA 3BMOA 4KVAA 1CE8A 1JW9B 3CQ9A 4D0LB 1PVVA 1W5EA 1A9PA 3D2AA 2XLBA 2FVYA 1IOWA 2R60A 4GFDA 4LJ8A 5ES3A 1NG9A 2QS9A 1U3WA 4DPKA 3W9SA 4W5RA 4XIGS 3S81A 4NECA 2V0CA 5TE9A 3L40A 4FYVA 2VHQA 5IJ0B 4IPTA 3EBLA 4JD5A 3M9LA 4I9FA 4AQ7A 1RVV1 4YTEA 1RI5A 3GCGA 1IK6A 3JTMA 3UV3A 4TX1A 1R0XA 1WPXA 2OXEA 1JHPA 3BK7A 3JASB 4DPLA 5KOHA 8GPBA 2PAFA 2GCGA 2ZIFA 3IR6A 3UT5B 2WBLC 3M89A 1CNFA 1T91A 4RZ3A 1FTSA 1DCMA 2PH7A 3AERB 5T5QA 2C99A 3BRQA 4CDGA 6PFKA 5IC4A 3GLUA 3LA8A 2PX6A 3AU9A 2VT7A 1S2OA 2IY9A 3ZV3A 5AVZA 1IG0A 3DA8A 3VR4A 2HMAA 1C8BA 5TY0A 5DXFA 4I50F 2XXBA 1UDXA 2JI9A 4N0QA 3BG5A 4BL5A 3ISJA 3PDUA 1UXGA 3QTBA 3X2SA 3NPMA 3MT7A 2VK1A 1C0EA 2X5OA 3PIIA 4KR0A 4OQMA 2EGUA 4RQAA 4UHJA 5JCZA 4YRMA 2DJ5A 3D4NA 3RUIA 1Q74A 3IB3A 5I3CA 2FQXA 5DB4A 3LSTA 3W3AD 2XH8A 1G55A 2Q8NA 4FGKA 4X6XA 1XL1A 5JVDA 2BM0A 3VNQA 4ZZ3A 4FMDF 1NDUA 2X8LA 4C89A 5LR6A 1S89A 4PU0A 4TLMB 4LIPD 2ZU6A 2Z09A 1MF7A 4XLTA 3TH5A 5K3OA 4D96A 4XWWA 4FHCA 3HM2A 3PG5A 4H4CA 4UC0A 1ZN9A 1WP4A 3LCRA 3V7WA 4NOKA 3KPYA 3SNHA 4BVKA 2GDJA 1YHZA 3A4VA 3T3IA 3ELWA 1YQEA 1P18A 1GKIA 4EA9A 1ZC4A 4FPXA 4U3JB 2FK8A 2PH3A 3L4EA 1JFVA 2ZT5A 4KEAA 2WAYA 2IFTA 2XCTB 1BX1A 1NLFA 3AUYA 3M6LA 2Y66A 4YJ3B 3RIMA 3O7MA 1Y8AA 3UZUA 4FSXA 3D4BA 2PV0A 4RKRA 1T9AA 1XVVA 5BOSB 1QX4A 1FUYB 1JU9A 1T35A 4LDRA 1JIVA 2JFBA 2AYXA 3HP4A 2CWWA 2MINB 5EGSA 1WL8A 5AK3A 5EZYB 1F2UB 4W8HA 1DAOA 3FPGA 4JA2A 1G6KA 3PL1A 5KJ6A 2LTAA 5ALTA 1VHWA 3DMYA 1W5SA 4X1KB 5K8JB 4F3YA 2BFMA 5JAMA 4JJKA 3LM8A 1Q0LA 1WIWA 2B4TO 3LHDA 3EGDA 4MQMA 2C82A 2I80A 1I3LA 4ITVA 4X9XA 3W4IA 4ESEA 1HNZB 1GN8A 5B7GA 2VJCA 1A7KA 1U0GA 2X9NA 5BT9A 5EXEA 3TEFA 3PD0A 4ZT5A 1XRLA 1Z9BA 4BNGA 3RUHA 4B8WA 4FI3C 1Y98A 2YL2A 4JJAA 2P9EA 3I34X 1E5LA 3OEHA 4FHEA 2PWBA 1EUCB 4IWYA 4OV6B 3SJZA 1RPTA 5G0TA 5AW7A 3WLOA 1DEAA 2ZETA 2NG1A 3LK7A 4IJWA 2HA4A 5GJVC 1FQWA 2EJTA 2JATA 2P77A 3EDYA 2FK7A 3OT5A 3S5JA 3TYXA 1E6EA 3VSDA 3MAJA 1NJFA 3AJRA 3FGOA 5HCUA 3WIOA 5HPYB 4WERA 1QH8A 4DJEC 1CZKA 4NS1A 4LAFA 4BNIA 2XUGA 3SZLA 3R7SA 1LDYA 1TVKB 3FETA 3WG9A 4RM2A 2JVJA 5DK4A 3KQYA 4KFTA 5EVCA 3WBKA 2OEPA 3HU3A 3C39A 4YJ2A 2RGUA 3B48A 1TT5A 2EBHX 3GRVA 2J7PD 4F38A 4HGPA 1D04A 3MUEA 3QLEA 4TWZA 1BDHA 4D4HA 2O8NA 4L08A 1Z13A 2YMLA 3EXEA 3N8NA 3HKCB 3ONEA 4LPSA 3SOZA 1EP1B 4CKBA 2ZUDA 3QEJA 3OA0A 4XIIA 2PZJA 4J1SA 1YDFA 3UJ9A 4G65A 5EE9A 2JNWA 3IULA 4YRKA 1AF4A 4NP6A 5BOVA 1U7PA 1V11A 1Y1TA 3N2IA 1U4OA 2P27A 3N7AA 1OH5A 4B6QA 4WWHA 1RWMA 2X0JA 4PG4A 3FD8A 4PLVA 3I04M 3NHFA 4HFRA 5C5DA 4OH1A 4K05A 5JH7B 3S2EA 2QGZA 3WQHA 1YFLA 3IEKA 3NANA 2QP4A 3PEUA 4NBRA 1SRQA 4FBMA 3W1VA 2GXAA 3L04A 4JKYA 2NV6A 4BP9A 2QQ5A 2NQTA 2XMCA 3KQHA 3KQLA 1ZAYA 2NZVG 2VL7A 4AF8A 1FJGB 1MW8X 4W9RA 1PJCA 1RHJA 3A1SA 3AFIA 3SF8A 5DU2A 3RS4A 1P2TA 4XQ9A 2HMYB 1PUJA 1W48A 3I28A 3WFIA 1NVVR 3IP3A 4G37A 2FW1A 4C6SA 4V1CA 5J2TA 2R1ZA 1P4JA 1M8GA 3VC7A 4X1YB 4NOLA 3WGQA 4KUHA 5HOQA 5J2UB 1KJJA 1P80A 3AP3A 4V3CA 3C3WA 1AS2A 3LC1O 3OOSA 3C6BA 4HGNA 1NM5C 2NSYA 2OD2A 2PNFA 1G21A 2WIDA 3LGXA 4OL9A 2AFIB 1A5BB 1WKBA 1VYTA 3DWIA 4BBPA 4CVNA 5CA1A 5AHRA 3DEKA 1UC4B 4YXWD 3AV0B 1XXHA 4KWCA 4CLEA 3NC1C 2XA2A 3HXPA 1RXEA 4BBZA 2BHTA 4AJ2A 1M6WA 2Q4EA 2WU4A 4Z6KA 3IALA 3CIFA 1KAQA 4Z9BA 1YCDA 4MO2A 3DM9B 3L43A 3QLJA 4GGMX 4MLPA 2CLSA 5CT5A 2DX7A 4Y6OA 3FDZA 3BGVA 4EDHA 4JMLA 4DRXB 2Z58A 1QQAA 3R5TA 4LYHA 1HRDA 1U2DC 1G5FA 4U0JA 3E2IA 2IZ0A 5DEIA 1GZ3A 1JGTA 3PFCA 3PGXA 1KK1A 4QVKA 3WL3A 3R6WA 3RHFA 3RAFC 3K35A 4IHKA 1FSZA 1LQUA 2O48X 4R41A 2MMGA 4GLFA 3IE0A 3CUWA 3FROA 1T3SA 2OGWA 2Y77A 3ASVA 3C8UA 2B34A 3G9QA 2Z1DA 4IEIA 1C0IA 2Y0PA 3LT0A 5AICA 4RCYA 3GEDA 4N0EA 4PZZA 2X9VA 3WLMA 3S1SA 4ZVQA 2E48A 2QSYA 3F1LA 1F6WA 2IEIA 1U0TA 4MRNA 4IL5A 2CCGA 3O74A 1FLNA 2X86A 3HUUA 3PNMA 4R54A 3I0ZA 4P81A 3RF6A 3HCPA 4Q24A 3ZV5A 1JIQA 1EFHA 3QXJA 4JY7A 2ZE7A 4EAQA 3V33A 3P1JA 1KEVA 4ARZA 3FNEA 4G0QA 5K0NA 3X2EA 1XDBA 3C6QA 1RYYA 3SHOA 4M9QA 3UY4A 2WLTA 2RHGB 4AZWA 2FJPA 2AOTB 5GWXA 2IU6A 2DLNA 1FCJA 4I46A 5JW6A 2WZDA 3K73O 2AJDA 5K3DA 3TXYA 2ZRFA 2VJKA 2QGFA 2FFJA 3GNQA 1ZFNA 1QH0A 2OL4A 3GZ4A 1MVLA 3AF4A 4BQQA 1Y1LA 1KAMA 1R88A 1BQ4A 1T8TA 4Z0HO 4CF3A 4LF7B 2NP6A 4YV2A 5BSEA 1HKUA 3SZUA 2R2AA 2DECA 4FFMA 4H3KB 2ZATA 5E9WA 5NULA 1C80A 4DHWA 1ZKMA 4ZIRA 5J43A 3RW9A 3AMVA 3OPYB 4LVNA 2D5AA 1CR1A 3EPRA 3BE4A 5G53C 3RH0A 3VU8A 4EEZA 5IKEA 2F3TA 2UZ0A 2ZTSA 2GD6A 3A27A 1LK0A 2VBGA 2ZRMA 1VL5A 3RT9A 5AFSA 4UTNA 3K09A 3L7OA 3UMYA 4P4SA 2PUHA 3H3JA 3IQZA 2X1MA 3CX7A 4ROSA 2ZTVA 3IVAA 3K0HA 4UULA 4A0FA 1SUCA 2JH8A 3A1WA 2VZLA 3OEEA 4UCQA 4CQNA 2XMBA 3PVZA 2IIQA 1DQZA 2M98A 3IPYA 1ZIDA 3N6RA 3ZDCA 3VSAA 2HRQA 4A6EA 1DEXA 2CFOA 3TTSA 1L4FA 2GZAA 2XNDD 5HM6A 1HTBA 2O2JA 4DXHA 3IXMA 5AJHA 3LTNC 4EEXA 1ZD3A 2N42A 3K5WA 4TROA 1VCNA 4C2TA 1P0IA 4BNXA 3UVEA 2UZ1B 2P78A 3TFWA 2WIGA 1JL3A 4IZHA 3AINA 1HZJA 3G7SA 2XCSB 2PM8A 1FEZA 2B25A 1NLZA 3BK2A 4YP7A 5IKXA 1WW3A 2B8EA 3BN3A 5IDYA 1WPGA 1I0ZA 2E4ZA 1U0NA 2PT9A 2Y1OA 4NBKA 4GM1A 3V4OA 3WGHA 4CV2A 1O0CA 1C1YA 2AT1A 3ORRA 3FCXA 5LQNA 3B13B 3ZCTA 1USUA 3HFSA 3P9CA 1LLUA 3PCRB 5DSTA 5AVVA 4DMHA 3DFMA 1LQ2A 4NZMA 3RVNA 4ZDJA 1TRKA 3EXIA 2NXNA 3GD7A 1TECE 1S2DA 2NUBA 2VRBA 3N1UA 2HCFA 3L7AA 5J5CA 1NBEA 2E5WA 2JS7A 1IN8A 1JALA 1FTNA 1RI1A 4BO4A 4NRDA 4NYJQ 4R4JA 4KK4A 4MUAA 1KE1A 1GIAA 1XD8A 4CXMA 4GMDA 4H31A 4HEA6 1HNNA 1JB9A 2OFFA 1HDCA 5AQ1A 4I5EA 2ZJBA 4PTZA 3K9GA 3HU1A 3Q10A 5FBQB 3RSCA 3LFHA 3RNOA 3T1YB 1ZH2A 1VB5A 1JVSA 1NFQA 4EPXA 4V0NA 3ANMA 3T5DA 1EQAA 5FUXA 2Z6QA 3R8XA 1HSOA 1P5HA 3GOHA 2CB0A 3JCZA 3QUTA 4A2QA 1EBUA 2E2WA 4S12A 4CZ2A 4E5DA 4IXNA 2Q49A 4HGZA 1M2NA 4GOLD 5T3UA 1COZA 3ME5A 4RADA 2RKBA 3GRKA 1U7WA 3ZWBA 4JGGA 5K0ZA 3ERCA 2OV4A 3OZFA 1U2SA 4NWIA 4L4RA 4TM7A 3A9WA 3KWLA 4TKVB 2WHYA 3MIZA 3HADA 2JAXA 3ZCPA 4U6QA 2CF5A 4U9UA 3PK0A 4CQJA 5A4IS 1I9CA 3H13A 3S2SA 1SQGA 2C58A 4M21A 3LC7O 1G42A 3TIVA 1CD5A 4F2GA 4DWWA 4RPHA 1FTYA 3M49A 3AETA 1Z2DA 1ML4A 2Q7OE 4YCNA 3FCCA 3D0KA 4NV1A 4N47A 5E9JA 4BZWA 5A4KA 2J59A 4G5QA 1C8VB 4TMXA 1RQGA 3PUKA 3STYA 4IZOA 1M73E 1U7XA 3PDIB 4UCXA 2ZJYA 5GP1A 2FPRA 4AYTA 2PMFA 2P3QA 5I7VA 3EC2A 3F6SA 4UOQA 1Z5ZA 1YQTA 2KS6A 4QXMA 5GV7A 1V8DA 4Y0AA 4C14A 4D45A 5E6UA 1T5SA 2HIGA 3IQDB 5K9ZA 1BROA 1JAXA 4IKPA 2BSQA 3ADCA 1OZHA 3DXZA 1AKUA 3KVVA 4C43A 3OQVA 2P4SA 3TW8B 1WABA 2X7JA 3U6BA 5L8VA 3NRBA 5DHQA 4H0NA 1DUIA 1IQ0A 2I4OA 2MOKA 3BWMA 2LPMA 1UZUA 3Q8XB 5LUAA 1O6BA 3U48A 4A6XA 2O8BB 1BXRA 3IMFA 3IJEB 2EF1A 1WV1A 4MEBA 2O07A 3TO5A 4MW7A 3V1MA 2PRIA 3EDQA 2HW8A 1QFSA 3ER8A 5ECGC 2PGNA 4B3GA 1VCMA 1D6SA 3K1ZA 3BA1A 4X54A 2X58A 4WN3A 2YWXA 3PNSA 4ZHQA 2EERA 3RI3A 2I9KA 2FZCA 2XRYA 5I47A 1ZDMA 4F91B 4BFTA 1AV7A 2XQVA 1LNSA 3TLZA 1ULAA 2ZTMA 4DCVA 4LF8B 4L27A 2G8NA 1WG8A 4O2AF 1BS2A 4QFDA 1JB1A 2G4LA 4BZQA 2DFNA 1CDZA 2PUWA 4I1SA 3OFND 2DMRA 1WE2A 1Z75A 1IUNA 3GJ0A 4YB8A 5HP4A 4RIGA 5FTMA 3UFXA 4R7ZA 2NZYA 3GZJA 5EFZA 3L05A 1OXUA 2XWJI 3NOVA 2QJOA 5DTMA 3QEBZ 1N0HA 3AUKA 2VZ9A 3SDZA 3UA4A 3ZZUA 4F2HA 4DR7B 2X6QA 1TXGA 1LI4A 3WGZA 4K86A 4B75A 5HM8A 2JHGA 3L6CA 3SYMA 5H16A 3GJSA 2E4YA 4P0PB 4C2AA 5TX7A 5KWEA 1H8EA 4KQCA 3DOJA 1U3UA 1V48A 1YDWA 5C3MA 3QE0A 4FU0A 2PJRA 5H82A 2YZNA 4PZCA 4D3DA 5IAOA 5DGCA 4FUQA 1MB4A 3EGEA 3W2TA 3ER9A 1CDEA 3SIXA 1SWWA 3GOQA 2VCHA 1NIJA 4CU2A 5JMOA 3H9JA 4HN9A 3LK6A 1DSSG 3P27A 5FBVB 1NLUA 2GGSA 2ZI6A 4JS0A 4BEWA 1V5FA 4FE4A 4GIBA 4INAA 4DEXA 2ODEA 4AXBA 2P4QA 4U1RA 4B8ZA 3D6UA 3OTWA 4UJ5A 2GZHA 1M34E 3LKDA 4IV5A 1GNSA 4W7SA 3SSMA 4ZI7A 3L0BA 3P94A 2A33A 2XGOA 2IRWA 1YB4A 3HRIA 4JUIA 2I29A 2WC1A 2H18A 3DMTA 4WLFA 1Z83A 3ZCQA 2QM3A 5I4BA 2WVHA 3QXXA 1UEXC 3LDGA 1JE1A 4FMCF 4MCIA 2AXQA 2PXCA 4Y67A 1BMFA 5EE0A 1GCOA 3Q7EA 1Z56C 2AC4A 2CNOA 3MD9A 1H3EA 1DAKA 1QJCA 2Q1UA 1HE2A 3FPAA 3A6LA 4RPKA 1EK6A 1YACA 2HC9A 4BFZA 2IYSA 4CNBA 3T4UA 4RQTA 4IVPA 1FNDA 1R0SA 1RNLA 1JDBC 3K30A 2JGAA 5M7EA 3RKUA 1V5WA 3QYAA 4O4IA 1NE7A 5D86A 2VDNB 4ZU3A 4MRPA 1UKAA 4UUOA 3TK1A 4MI9A 2DXIA 5IVKA 4JI2B 2VBCA 3NAMA 4L73A 1CR4A 2IUTA 3QF4B 4EF5A 5K0BA 2ZJ4A 3E23A 2IPNA 2I1QA 2DY0A 3PUZA 3SMQA 4ZYZA 5BYJA 4RAQA 4AX8A 4NCHA 3DTVA 4HGRA 5J4YA 3GLIB 2ZPAA 4J9UE 3UGQA 2Q8PA 4J0QA 5K0CA 4FDMA 3E7DA 2H54A 4C2UA 2EYUA 3WE7A 2VF7A 4CPDA 1O87A 1IJFA 2X76A 4C3ZA 5KYUB 2UXBB 2H7YA 2O23A 3BHIA 2FEWB 1E3MA 2Z5VA 4RPGA 1R27A 2D59A 4WRRA 5CB8A 3PXAA 1I7NA 1YJQA 4P2BA 1LPSA 2VSFA 1KBZA 1NXQA 3BCHA 5LQMA 1Y1SA 1PEKE 4J49A 4OLHA 1IN5A 4Q3KA 5JAOA 5H3CA 2WMDA 4NG4A 4BFVA 5I9LA 4JXZA 2R1VB 1LPAB 1U0HC 5EZSA 1PHRA 4BQOA 1W7AA 1U8ZA 1ZD9A 1Z06A 3OA2A 3U9TA 1EHCA 3ITEA 3N7TA 4REQA 5KTYA 3EQ7A 1N2CA 2G07A 2WQZA 2FSVA 1AO3A 5GM1A 4W9NC 5EJEA 1RHMA 2R7NA 1KOLA 3FOBA 3WDLA 4BLWA 1ZSVA 3H9QA 2OWDA 4QYIB 4U6SA 1EBBA 5HZGA 1UQTA 3SBXA 3NHUA 1TIBA 2UV8A 4DNFA 2DBZA 2OKCA 4LOHA 1NIPA 3AP1A 3GAAA 2HA2A 2AX3A 1ICIA 4O29A 4JN6B 2PXHA 1YRBA 2YBEA 1HFJA 3G2HA 4JHXA 3UJAA 3NTLA 4EPVA 1SEVA 1E7QA 4TUYB 2GJKA 5LQUA 1S3FA 4IJQA 4A2PA 3NJ4A 4FLEA 2E5LB 1PR4A 2JFOA 3KJHA 2L18A 4X94A 2J9RA 2Q27A 3V4ZA 3AXSA 1R2QA 5B7QA 4MQFB 5EXXA 1TEXA 1OI2A 1A2KC 3V8BA 4ZANA 2BGRA 5HQJA 1IZ8A 1MXFA 2JGMA 3D8NA 3L5OA 4R1LA 1Y6GA 5KYYA 1FE8A 4DA8A 2OK8A 4G8DA 3SE0A 3DCJA 3PYXA 1Y34E 4C5BA 4E2WA 2FWRA 4E6EA 3GU3A 3GCWA 3W2FA 5H8WA 4S05A 3ZWDA 2NO1A 3TZCA 1EVJA 1GGMA 4PICA 2BLLA 3K72B 4Q1VA 1BCSB 5JY1A 5LMUB 2BF7A 3EUEA 3CU5A 3R0XA 1X7HA 3ZVNA 1XOIA 3F1KA 4D8VA 5DM0A 3WLHA 4JUAA 5A0VA 1JPUA 1LRJA 4LDJA 5T3YA 2F43A 2G4VA 2GNAA 3OD5A 1Z5NA 3OIUA 4GPAA 1VCHA 1U9ZA 3BXHA 3QU9A 1UBCA 4RA9B 5GONA 5JG7A 1B41A 3D6AA 3PTZA 4NESA 4R2XA 5DYYA 3IPRA 3TQHA 1P9OA 2IHZA 4ZAVA 5TT1A 2R5FA 3ZDFA 4CKXA 2NUTB 5BURA 2XGJA 3ZCRA 2RAVA 2NSDA 4G5GA 5FBHA 4EHBA 1MHTA 1L5OA 1QP0A 5FWXB 5EUMA 1E5TA 5EVJA 2X7HA 4QBFA 1UXIA 2OBMA 3X2FA 4HNSA 4HDKA 3VR3A 1GGJA 2PWYA 5KNBD 4ND5A 3U7RA 3QOXA 4HVAA 1GZ7A 1H3NA 2X5XA 4IOMA 2FMHA 2HWYA 4GMHA 3O4RA 3U3MA 3H99A 2RHWA 2PMKA 2I65A 4WPGA 3MYYA 1OI4A 1NNUA 2VYCA 4BO5A 2JJ2A 4WOBA 4FONA 5LLTA 4JI4B 5JRDS 1YVPA 4IO1A 5IBRA 4PCUA 3HHEA 4C08A 1G5QA 5EIHA 3W3ZB 2NN3C 1CC1S 4HAVA 3HY3A 2IXEA 1UP6A 5B64A 2IYTA 1EJ2A 3NDIA 3OURA 3A6ZA 1QRAA 1LA2A 1OUMA 1ACJA 2HGSA 2H4XA 3FI9A 1T3HA 3UATA 1NVUQ 1SHZA 2F1RA 2IOYA 3HXTA 3IDFA 3MTAA 4Q3DA 3MJEA 4F71A 4YROA 3WMFA 4Y2HA 1UDWA 4ZXPA 2Y0BA 3LWZA 1EJ0A 2PLNA 4M1SA 3E18A 4UUPA 3TTUA 3VR4D 3A1VA 2R66A 4AKEA 2XE8A 1PQ4A 1XTQA 2B2CA 2QDXA 3KAPA 4AN4A 3F78A 4BNVA 1K7EB 3ANTA 3EASA 4N3BA 4OFZA 1GYRA 3MZ0A 5HTKA 3TNDA 3WHIA 3WA7A 3BD8A 2ZAGA 3RTCA 2FGKA 3JQDA 3WLRA 1NW4A 4IVNA 3DEYX 1VKJA 4EFMA 4WESB 1MJFA 2WFZA 3SP1A 1J20A 2HJHA 6YASA 2IGBA 2GZRA 4MWOA 2J5KA 3S68A 3L4SO 1T4CB 2IE8A 2OGTA 3HFRA 2W4QA 2ZCUA 2WUFA 2P4UA 3B6MA 1EWKA 4YUYA 4YMTA 1KJNA 3LHKA 3O8LA 4GZ6A 3VBCA 1TEVA 1XCGB 3I2IA 4PNEA 3S1AB 4PM4A 1Z34A 3NH6A 2FPGB 3RVMA 4Z9AA 2VH2A 1TK2A 4M49A 1YR6A 5DSZA 1ISFA 2QPTA 3EGCA 3SC2A 4BGUA 4RTSA 2VN8A 3GCDA 5I9MA 4Y9TA 4DSAA 5E6SA 5LP6B 1WBJB 1Z6GA 1QRDA 1ZRMA 4F2PA 1WAMA 3IIMA 4BAUA 1UJNA 3U5ZB 4R2KA 1YZLA 2BFDB 4DT1B 1WLYA 4GXRA 3OP1A 3D02A 1G1MA 3W9UA 3H5LA 3OE4A 1KOJA 2QU8A 4PBRA 5EQDA 3VPXA 3T4EA 2J1LA 1K97A 3QGMA 2Q4TA 4OGKA 3S40A 4EATA 3KPUA 4OBEA 4C0XA 5ENZA 2I0FA 1DL5A 2JK1A 2DTEA 2DUWA 3MERA 5JVDF 3K70D 3HXQA 3ETGA 3LUFA 3WL5A 5L3VA 4KLZA 3R41A 2VP0A 1IQPA 1PU2A 3HYSA 5EPEA 3NXKA 2JRCA 4X93A 1EI9A 3H9EO 2QY9A 2YWJA 4IH1A 1ZN7A 1OY1A 4OEHA 4XX0A 3AM4A 3DDNA 1T5IA 4RMJA 3SYNA 2J0UA 5EGNA 3UW1A 3ZHZA 3GEMA 1IXKA 2OYSA 4PC6A 4RXTA 5ALLA 1P29A 1RE0A 3I6IA 3O83A 1SCIA 1X9HA 4FXOA 1T2EA 4LSGA 4PHGA 3OEHD 2B3DA 4MPPA 2RHLA 4WLVA 1A88A 3KZKA 1Y9EA 3TD6A 4ZTUB 1MQ8B 1SBTA 4M8KA 4PV7A 4GKKB 2QT0A 2HUPA 5HFAA 3LLMA 1OKKD 1CIPA 3LT4A 2A3RA 4JR2A 4HVTA 2JCBA 4ZODA 1ZGGA 4E30A 2AZTA 4PYRA 1VSBA 3MJTA 4Y1GA 3P9QA 1N1GA 4HH4A 4MGKR 1CHNA 1EX9A 3GXOA 1LDGA 4O4HA 4N3CA 3EXHB 5DCYA 2O0KA 4M53A 5ALZA 3A58B 4Q6WA 2O0LA 3MJCA 1RI3A 4L9SA 4DY4A 5CHYA 5JWOA 1YI0A 4Z0PA 3OQ6A 4B85A 1U1GA 3EWIA 5IUNC 1F5NA 4YYZA 2JH9A 1L7PA 4ZC8A 1ETUA 4G0UA 2IT1A 1JFFB 1OAOC 1OWMA 4II7A 4DLNA 1X77A 3EDCA 4GXQA 4KQXA 2WIFA 4R0NA 4R68A 3Q0IA 4C3VA 1CEYA 2FPIA 2LW7A 4PCVA 2V6MA 2YTZA 3RC3A 3KYCA 4F96A 2APJA 5B6PA 3EHDA 1RIIA 3EY9A 2B5VA 4TM8A 2O05A 5T7BA 3PYMA 2D4HA 2EBWA 1WBBA 1A8HA 1RKUA 1J2TA 1KY5A 3DO8A 4JVLA 4WFKA 5BR8B 1ZIXA 3GDFA 1D6NA 2WWIA 3QVJA 1QFYA 3ORQA 3L7BA 4X85A 5JDCA 2H4FA 2BCEA 1R74A 4C7OA 3GA5A 3MWYW 5EWLA 4HJRA 1M6VA 6LDHA 3ZDZB 5BWCA 2PD4A 1NF3A 3IP1A 4YASA 3ZK7A 1ENPA 3FR8A 4B45A 5C7YA 1W36D 1XF1A 1Y4AE 2AMFA 3SYRA 3QVMA 3ZJUA 1YTLA 1NPYA 2ORED 3Q7SA 1ABFA 1U7TA 2VYVD 1T0HB 4N5MA 3GJYA 4DNOA 4ZCIA 3RTAA 2V7UA 3TRFA 1H9BA 1G8PA 2YZ2A 1RPJA 1OU0A 2A94A 2Q3EA 4UM9D 2IBMA 4YJ2F 5CVCA 4V0QA 1XHEA 2BF4A 3LJKA 4CMEC 3VSBA 4UHHA 3WLAA 3UK0A 5BV2P 5KPJA 1IBRA 2C7PA 1YZKA 2AZDA 4EG6A 2W2XA 3NEPX 2QPOA 5HIJA 4BV8A 3Q8LA 2L0XA 1VI2A 4Y7CA 1AOXA 1NSFA 3JQ7B 3QU7A 4P4GA 4EW2A 3TE7A 4RY2A 5JJCA 3V3TA 2XRMA 1W0JA 4CL3A 3JATB 4FOPA 1SVUA 2B36A 3FLMA 2BTOA 4M6WB 4WMLA 3X1YA 3HP7A 1EKXA 3S29A 1XR3A 1BJKA 3BGSA 3DUWA 4RF3A 4RF5A 1LCIA 1DKPA 1UADA 2BFFA 2BHRA 3PKJA 4A16A 3V4VB 4XYGA 1I4DD 2QX4A 3MM4A 5K0FA 3M33A 3PC2A 1NMYA 2REQB 4I6EA 4C76A 5EZQA 1OSNA 4V0MA 1MABB 4HZGA 2R79A 3ZH2A 4FM9A 3WQSB 1V7CA 2UYYA 1ORIA 5FBWB 4E21A 4AZ0A 2I2FA 2CFIA 5KOJB 1JG3A 5L3SA 1A4UA 1NVFA 1YGYA 2KMLA 1IOVA 4RK0A 5BNIA 4FWTA 3CF0A 3JYOA 3VTAA 1UFRA 5CDTA 4RO0A 1QO0D 3ULKA 1X7DA 1OXKB 2QNIA 3Q1KA 4TV9A 4ERNA 4LZLA 1Y5RA 3FNRA 4ND1A 3U16A 5EJGA 2F1HA 4EDFA 5CA1F 1N2BA 1LB1B 1RBQA 1YT5A 2COEA 2CVQA 3GRUA 3LAWA 3NVDA 3SSAA 3ZE1B 2QUZA 2QAJA 3CH5A 1ZUWA 2WDZA 3KFXA 4WNCA 3A7EA 9LDBA 1E2DA 5FEUA 1FUUA 1IHDA 3DR5A 3DV2A 1XJ0A 1EFVA 1X9IA 4Y7DA 4OUDA 1SUPA 5D5QA 3VV2A 1U9JA 4NFLA 2XCRB 4D56A 4AJ4A 2NXJA 3L8GA 5CA0F 3IP6A 4I0WB 1WA5A 4O0LA 5P21A 4BMXA 4TKZA 1E1CA 721PA 2YW2A 5LU8A 3FLAA 3SEZA 3VBEA 3CEHA 3N8KA 1C8LA 1TUEA 1SQ0A 4PTYA 3IAUA 5HJ2A 3CG4A 1NDQA 2BGMA 3AG6A 3C8MA 4BVHA 4CI9A 1GG9A 1UC8A 4XTRA 4BGDA 2M6LA 4KHPB 1PZGA 4RORA 4YJHA 1IBMB 3RYCB 2FFHA 4K9LA 3UMSA 1RVDA 1IPFA 4UUAA 1H5NA 3PX3A 1AHPA 3C5WP 2PZLA 4B7ZA 3JQ9C 3S6JA 2LKDA 2V03A 4N3GA 4TXNA 2VUSA 1G9TA 2XCIA 2DH6A 4LHEA 4E1AA 3X44A 1YI1A 1GZ4A 2VHVA 5JMWA 3IRVA 4JA0A 2PKWA 2PPVA 3M5CA 4O4LB 1CQZA 4OSPA 2H51A 4H3SA 4II2A 1A9OA 2WAMA 4XGIA 3WK6A 3VNRA 3W2IA 3RADC 5G02A 1YZUA 3SDBA 3F4LA 2ZT7A 3QKSB 4OL0A 4ETNA 4HDSB 4LI3X 3G7NA 3QHQA 3O3MB 5EMNA 1LKZA 2QAGA 3OEED 3OE5A 3VPCA 4EY4A 1XCLA 2JI8A 2QN8A 4HNQA 3K9LA 4R2HA 4HNTA 3G5MA 1N2GA 1Q95A 1TEHA 5GTDA 5T6BA 4GUDA 1G5PA 3O8QB 4KP7A 1OB2A 2FR0A 2P6NA 2UDPA 3NC0C 1V3UA 4I8XA 4PANA 1M67A 3ZWAA 1EG7A 2JCVA 3GLRA 2I34A 3WZMA 4ENQA 1KHHA 4KHZA 1N34B 1QV7A 4TXMA 2O7NA 1LSOA 4RK5A 3VZDA 5AO9A 4CF6A 1J21A 1GAQA 2UYOA 4MAMA 3DKKA 1T5LA 1CP3A 3ZXYA 3R5JA 3QJ5A 4N6GA 3TQSA 1KYYA 3WYNA 1O96B 2PKQP 1GPKA 4FZVA 3DBRB 3UC5A 3KOZA 1FC0A 3PR1A 3WAKA 2RK4A 1OWOA 2Q5OA 4D5EA 1HQKA 2EG5A 5L3RA 4YPVA 5B2FA 3PGMA 4EO4A 3K5PA 10MHA 2I7VA 3C1TA 3A32A 3I8XA 1SCUB 3KLMX 4PLWA 4J0CA 4MW1A 3CCFA 4TPKA 4GWGA 5CVDA 4YRNA 4ZOQI 4G07A 2ZJZA 1G8FA 1JLKA 1B4DA 1W85B 3C97A 2PUGA 1V26A 2R6CA 4JV5B 3OI7A 2Y1XA 2G17A 4YVFA 1JIXA 4G5YA 3N8HA 1TC2A 1II0A 2AJBA 4M1OA 2VRWA 4R84A 3FCSB 5KQPA 2VSNA 1O6ZA 4LDAA 4J6FA 4MV9A 4WK2B 5HCNA 1G20E 4BX2A 4PHHA 3ZDYB 4C6TB 2ORYA 4DG9A 1L5NA 2B7BA 1M2VB 7AT1A 2H00A 3MTGA 2ZTUA 3HB5X 5CJPA 4G9BA 2IS6A 4ARAA 4BUCA 5C3UA 1IWBB 3I05A 4ITRC 4JL8A 3QP9A 1KEKA 2C4UA 3ROGA 4C04A 5T4HA 3QVTA 4AJLA 4BRWA 4OKIA 3ZGNA 1CUZA 1EQUA 2ZIEA 4GP7A 1ESZA 3B36A 4JC0A 3DPIA 2V9ZA 3PBKA 3H2IA 3JALB 3FUXA 2Y0EA 4KQGA 3RTGA 5T8KC 3SQWA 2I33A 2LP4Y 4EP1A 3R5XA 5IG2A 4BV3A 4QBIA 2ZYIA 3CEPB 2FWIA 4GSLA 1BEUB 2BJHA 1ZISA 2F67A 1KJ8A 4UKDA 4KAFA 4B4DA 4G1CA 3CTMA 1A4XA 1TTHA 3A05A 1BDBA 4UHFA 1NP7A 1PJ8A 1ZIOA 2A9JA 3QX8A 5EWMA 5H81A 5JASA 1A9XA 1V6CA 4AJEA 1IAQA 4JXKA 2D0IA 4XYEA 1Z0FA 3RWOA 3U9LA 2ZUSA 3A6GA 3OO1A 2ADFA 3GLHE 4NZ9A 1VFNA 1QANA 1ID1A 1KJYA 3BIFA 3TJMA 4A7PA 3ZEAA 3BIWA 5JHHB 4TL7A 5FR2A 3EIFA 4Q18A 4GL2A 3KLPX 1UOQA 2JAQA 2XGGA 4LSMA 5BVHA 4B0PA 4Q05A 2C2MA 2QBYA 1GU0A 1ZLYA 3Q2OA 1T2FA 2ZE8A 5CAEA 4MR7B 3TZBA 4U8GA 3LWBA 4TN5A 1JTVA 1SWVA 1Q22A 4EK9A 1YVRA 1HX7A 3D5EA 2WM9B 1NYQA 3X1XA 1JKJB 2H4JA 3Q7QA 4A10A 5IRCD 2PH5A 3B3AA 4BJ6A 3KFVA 1WZNA 2XDQA 3D6JA 4IP0A 5KYVA 5J5VA 1WDTA 1N5KA 1ZCJA 3BOSA 4OMUA 3OIFA 2EJCA 1DQSA 4OK5A 1P61B 4LJAA 4KR2A 4H4EA 4K40A 1EWVA 2M6KA 2Q0XA 3EXG2 2R86A 3KJFA 3R2JA 2FXVA 3F74A 2A5GA 3RIEA 3KQKA 3GEEA 1Z4PX 4UPVA 2DBYA 3QV1A 3UHJA 3CH7A 3GYBA 1Z15A 1RXUA 1VZ3A 2PWPA 2V65A 1M2OA 3DC2A 4MKZA 5H83A 5JNUA 4Q7LA 4C06A 4XDYA 2JFGA 1JAYA 3EZ9A 2ZJ7A 2WDPA 2YXDA 3NT4A 2QE7D 4JLUA 4WNIA 3EZXA 2A3NA 5AVOA 3WK9A 4BJHB 5I7EA 4YT2A 4GBGA 1W4CA 4LZNA 4PRZA 1N36B 3T54A 3RRBA 2QVYX 1E7YA 1FMLA 3RYTC 2QJTA 4E5PA 4ER6A 2RCNA 1VLVA 1K0FA 2AK2A 3ZXIA 5GVSA 3QVKA 1QF9A 2ZIUB 3E8MA 5FQNA 3T7EA 1X0VA 1JQKA 1H66A 2C7GA 5LXTF 3QF7A 2YNMA 2QA5A 3HCAA 4MWDA 5JEEA 3LP6A 3CCCA 3IUJA 3P9KA 4CMIA 4XWYA 4PYQA 1CVLA 4MROA 2CD9A 5FHRA 1TTPB 2ILVA 3WO0A 3N6VA 1F8XA 1U8TA 5CEFA 4AIIA 2Q5JA 1YTUA 1HQCA 5FDFA 4ZJZA 1JS1X 1R4MA 2YHIB 3L8HA 4TZTA 3OKAA 1E60A 1MOSA 1UMBA 3HU5A 4UM5A 1MRNA 2RBEA 5DFAA 1SG6A 521PA 2DYKA 1PEAA 2G06A 1UPXA 1SHLA 3UUWA 1NN0A 1Q0RA 3JPYA 2R8BA 4RFVA 2ATXA 4QT4A 1MU0A 2PU5A 4M46A 4V0RA 1IU9A 1P17A 3QBEA 1NW5A 3F5QA 1GU1A 4F5DA 1J07A 4D4GA 4ZYUA 4DAOA 2CLHB 4YGXB 4RD0A 3UAVA 4B17A 4MCAA 2H2AA 1VE5A 3EIXA 4YJGA 2EV9A 5B1DA 4G0WA 2IYRA 2ONKA 2P41A 1GRCA 1GPBA 1Z17A 4Q7MB 1CQJB 3UB4A 2VJYA 3T3GA 1ECFA 5PNTA 2AG0A 2CLCX 2HSWA 4OA8A 4QFBA 2IH2A 1LU9A 3KB6A 3LY8A 5BORA 3WSWA 3E0QA 1QONA 1N6KA 1XMIA 2BE7A 2LZ0A 4E03A 1R12A 1ORWA 4JDUA 3E9EA 2AVDA 5DYTA 4A0QA 1RM4A 3LO8A 1ORVA 2GJ4A 3ZI7A 1DJNA 1E2NA 3A4NA 3TEJA 4AY2A 1D8AA 3LPAA 3OD1A 1BMFD 4QTTB 2VQSA 1R5BA 3UM9A 1CWUA 4BNWA 4DSUA 1RQRA 2QUKA 2ZRQA 1M2JA 5F98A 3RQSA 4OXYA 3FM9A 2X2FA 1JQLB 1Y5IA 3HFJA 4MUEA 2UZ4A 4I1YA 4NOJA 3IAXA 1AD2A 4QKQA 4R5HA 5BSFA 2OUKA 1CQIB 4FOOA 4PYLA 5TVGA 1NRXA 3CR7A 3N05A 1DPFA 2GHQA 2QIOA 1CY1A 4R8MA 5E8RA 4DMLA 5CXQA 4G1UC 4PSCA 5K6AA 3OZWA 1G17A 1TM5E 4F86A 2R6ZA 2CJPA 3TQTA 1OD6A 1LGYA 1KYWA 4NE7A 1IN6A 4H7JA 4KZKA 1ZJWA 3CNEA 2GFQA 1JA9A 2R6JA 4QO8A 4XIYA 5AM5A 4E51A 1AIPA 1XUOA 2C9ZA 5BSKA 3PTAA 4EA6A 4ZI7F 1J8YF 4PG6A 4Q1EA 3E61A 3CBGA 4M0CA 5CK4A 1CJUC 4UBMA 5FOTA 4Z2YA 3ZWOA 1D1PA 4HMQA 3SYTA 4F93B 2CFSA 1Y8RB 3GEBA 2W43A 3KVYA 1NXTA 4TT3A 2HIMA 2HGZA 2OQIA 5E9AA 4MX8A 3CH4B 1PGPA 4H16A 1R0BA 1EK0A 1FDRA 3ZS9A 4PAQA 1JR2A 4CTKA 1SU8A 2D5CA 1IONA 1QIIA 2ZTHA 3L93A 5C51B 2A67A 2Z9BA 2AKEA 4W1RA 1ONOA 5KKAA 3K70C 5J3JA 5ECDA 1MA0A 3LGSA 2P90A 3PRYA 2ZZNA 3DOIA 4KH0A 2IEBA 3DTYA 1A4IA 3KFLA 5THKA 1KSJA 1R18A 1U3CA 1GGFA 1LXCA 3F9RA 3IHKA 5AKGA 4E5MA 4O4IF 3O9VA 1O8CA 1TVEA 1X7XA 1TKCA 3IB6A 4IJ5A 2JFWA 4JZKA 4XCXA 2DRIA 5G3ZA 2PJDA 4ZQHA 3GYGA 3ZY4A 4Z4QA 3BWCA 3OZCA 3OHPA 2BRUA 4NENB 3N2KB 1DOAA 1S9DA 2ZI5A 1AKYA 2MT9A 1BG6A 1C3EA 1JDPA 1ZKDA 2VXOA 3ESCA 1WMEA 4WXMA 4ANFA 3H3XA 2C78A 4FMBB 1E2UA 1GZSA 4XCVA 3SJUA 4EYQA 1TKBA 4JJ7A 5LQCA 3DE1X 3LLUA 1ORRA 1KH2A 2ZBPA 3ROZA 4C0HA 1Z39A 2I6XA 1GA6A 2X13A 3PSAA 5IWAB 3RTEA 5EXPA 4OYHA 1DG3A 3WDKA 3VZSA 3EGOA 3O6VA 1TUBB 1ZWKA 3WZLA 3D6HA 3QNMA 1E4OA 1GNLA 3N76A 4O1HA 1EVIA 1NJ1A 2F9MA 2BELA 1XO1A 4FB4A 4BXOA 3R5HA 3DHWC 1NLMA 2VAPA 4FIZA 1M1UA 2VP9A 2YOFA 3KU1A 1E66A 3WKAA 4BJ3A 4Q21A 2ZBVA 2AUMA 1MO5A 2ZI9A 2PUTA 4EKDA 4Z2AA 2Q1YA 3AOEC 4Z8XA 3VYVA 3I4CA 5SYMA 4EZIA 2YZ7A 2JHAA 4XVQA 3DHVA 4CM8A 4YUVA 1DAPA 2J0EA 1NPDA 1S96A 2QVLA 1E3WB 4L4ZA 2JAHA 1I4WA 4N0DA 1POXA 2C59A 2EL7A 5A5EA 1MG5A 1Y9AA 4N5NA 2CV0A 4QULA 1ODIA 2XXJA 3OSUA 4JVOA 4UE3S 1WXXA 1IHXA 2QY6A 1H5QA 1PX0A 1GQSA 3U4AA 1YE3A 3LHIA 3R8FA 5IZCA 4OX9B 4IG9A 3UOWA 3GHHA 1AJEA 3K0FB 1QAOA 3ZWNA 3QVWA 2XBLA 4BMYA 5I45A 3L9WA 2I6SA 1LBSA 1UWVA 4HRAA 5DYIA 4OAPA 3VU0A 2GZ3A 2F1IA 4LG1A 4LZOA 2ZQ5A 1R8XA 3BULA 1CJCA 3DEZA 3DYIA 4V39A 1DLIA 3FNHA 1JIKA 1E9DA 4XOIA 4GOKA 4Z7JA 1NT2A 3NIWA 1M6EX 2GN6A 3E22A 1D03A 5G40A 4ASUA 4ZI3A 4B3DA 2W2LD 5A4JA 3DQPA 3PQ8A 2VTBA 4YV1A 4A0RA 1Z4IA 4OBBA 1X7WA 5HE8A 2BPOA 2G5PA 3ES9A 3IUYA 3SXUA 1V9SA 4WECA 4Q1FA 3TLXA 5EIFA 1ACLA 4WUTA 3R7BA 3ZZ1A 2Z2JA 3TBKA 4BLVA 2PANA 2P0EA 3VR3D 3WDMA 1GEGA 4PIVA 2CMFA 7ADHA 1TVCA 5JRJA 5KNDH 2IVFA 3HXOA 2DT5A 2J9YB 1N9GB 1X8XA 3AKCA 3QEMA 1XNGA 4I2NA 4HG2A 5AK6A 4HWGA 1XK7A 1E5VA 1PF7E 2HCRA 2X8JA 1LSSA 2C5LA 4RVSA 3VGJA 5BUSA 5KTTA 4WJZA 1KWGA 2JJ2D 5FV4A 5FYQA 1M0TA