3UENA

Crystal structure of topbp1 brct4/5 domains
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
195
Chain Sequence
EGLFSQKSFLVLGFSNENESNIANIIKENAGKIMSLLSRTVADYAVVPLLGCEVEATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVISFSQCAGAEKESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 2-binding protein 1
publication title Structural insights into recognition of MDC1 by TopBP1 in DNA replication checkpoint control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 59
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3uenA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3uenA01
2HTFA 3L46A 4IFIA 3HUFA 1Z56C 1L7BA 1KZYC 1JNXX 2R1ZA 4U4AA 1OQAA 3AL3A 3T7IA 4Y18A 2WT8A 3SHTA 3PC8C 2VXCA 1T2VA 2M2IA 4JLUA 3PC8A 4ID3A 5ECGC 3PXDA 2VXBA 3QVGA 3QVGB 2NTEA 4Y2GA 3U3ZA 1T29A 1IN1A 1N5OX 3EF1A 1T2UA 3T1NA 2K6GA 3I0NA 3K0KA 3K16A 3PXEA 2E2WA 3PC7A 4OFBA 3KTFA 2AZMA 3SQDA 3SHVA 3PD7A 3HUEA 3OLCX 2DUNA 2EP8A 4BMCA 3AL2A 2D8MA 4BMDA 2K7FA 3PXBA 2ADOA 3UENA 1L0BA 1GZHB 4BU0A 2COUA 2COKA 4N40A 3K0HA 3FA2A 2COEA 2XNKA 3K05A 1CDZA 2LE0A 3PA6A 2EBUA 3EF0A 1T15A 3T7JA 3K15A 3L40A 3COJA 4XPZA 4IGKA 2INGX 4XQ0A 2ETXA 3JVEA 3II6X 3PXAA 2XNHA 3L41A 3PC6A 1Y98A 3SZMA 2EBWA 1IMOA 3I0MA 3T7KA 1WF6A 4BU1A 2JW5A 3UEOA 2L42A 3PXCX
chains in the Genus database with same CATH superfamily
1EQUA 2QM7A 1VDZA 1N5DA 2OLKA 2XYHA 3NGMA 1V6SA 5DP2A 3WYBA 1DL5A 4DLZA 2NO1A 2HADA 5HBGA 1FU8A 3OT5A 1Z18A 4PG6A 2ZUSA 5C7YA 3TKAA 1SVKA 1CLEA 3V97A 3UICA 2HXYA 4LOIA 2PZBA 2Y99A 3E3OA 1C4WA 1J07A 1XCOA 2IYAA 3FSEA 3HDYA 5HKBA 3QXCA 5IT0A 1Z56C 1I4TD 3EODA 4URWR 4RY8A 2G72A 3W5SA 3JALB 5TT1A 2WSIA 2QD4A 3AU8A 2XUQA 1IN8A 4M0KA 3DMRA 2OCLA 4DT1A 2FV8A 3KAKA 4E5SA 1KE1A 3NHSA 3FWKA 4KLRA 5JJKA 2XYGA 3G9UA 2VDMB 1IK6A 5I7RA 3DVQX 4FYPA 3DZHA 4HPXB 2JRCA 2J6IA 3CLUC 3FWYA 3H13A 3K8YA 3IO3A 4V0RA 2WB2A 1RFGE 4CM8A 3KELA 3L8HA 3G9QA 4PHFA 1L6IA 3DCYA 3OT4A 4NG5A 2GN4A 4Q7LA 5KOIA 5CXXA 2JHAA 4HDOB 3V8BA 2RHHA 3DTYA 1PR0A 1GRRA 2EWMA 4YCAA 4B3GA 1SWVA 2YIJA 4Z9AA 3NVKI 2X4LA 1AV7A 1R3DA 2OWEA 4WGFA 1VE7A 1FTQA 1A9RA 1GTZA 3CZ5A 5FULA 4LW8A 3SS7X 2REXB 3OQIB 5BMVA 2PJUA 3EMVA 4PAQA 3D7KA 3R7LA 4YRQA 3ZW8A 1GWNA 1RHJA 4GGMX 4PC6A 4DDUA 1RW4A 1KDTA 2ODQA 4LHYA 1AX9A 3BXPA 5FTMA 3NDRA 4OB7A 1L5OA 3VUFA 1JB1A 4OHVA 3ET5A 1NJ6A 4D57A 1LDYA 5EE1A 3V3TA 4Z53A 2ZR7A 3G9ZA 5AW8A 3FBGA 621PA 2G36A 4QDZA 5IUNC 3OI7A 1R3UA 1E79A 2G28A 4PYIA 2EERA 4IHJF 2X0NA 3QW4B 4TLMB 5AFSA 1N0HA 4AROA 1VE1A 1Z8HA 2N1MA 1SD2A 3I9OA 4KUEA 3B36A 1B41A 3CR7A 3IUBA 4GPEA 5KTMA 5CH3A 4KPUA 5NLLA 1CJBA 3VR3A 2CEAA 3GLHE 3OH8A 4ALIA 5IKEA 4LRQA 2MINA 3EGVA 1DO2A 1JLKA 1PS0A 3R09A 2PPVA 1G0NA 1PKXA 1IRXA 2R4UA 2IPNA 1U3UA 3EXEB 1G2OA 2CGEA 5AM1A 4B76A 3U6BA 2O8FB 5DBHX 4HOYA 4PZYA 4EB3A 1VXOA 3BZWA 3B6KA 2NZVG 3E9RA 2QT9A 4TTPA 1EAYA 1FA9A 1VSBA 1QZXA 2ZJ8A 1FLNA 4ZTUB 5ELLA 1QIMA 1DEAA 4MP3A 1X39A 4JKIA 1X9IA 3AUKA 1EINA 1GPJA 1TVCA 3C7TA 1E5DA 3GAFA 3W3AA 4HLNA 4QO7A 1PFUA 3L43A 1Q3KA 3QWAA 3WLQA 2VATA 5DLDA 3P0HA 1A82A 1RWOA 2R1UA 4DHEA 3NIWA 5KO2A 2XRYA 2CNBA 5IJ9B 2VYND 2WT9A 5FH9A 1N6HA 3KLBA 1EDZA 2JF0A 4HYYA 4EHBA 2V97A 3RC1A 4RV5A 1WW2A 3AEQA 4TYQA 2WHPB 5CPBA 1VKHA 4K9OA 1XJWA 1V25A 1Q2XA 4QSHA 5KTKA 1Y81A 2C5AA 2EFYA 2B8JA 2H4ZA 4MGKR 3PFGA 4KWHA 1I7SB 3DHWC 4BNDA 2OFPA 2AMFA 1SK8A 4HQNA 3RI3A 1WTCA 2ZUTA 1XAHA 3HU5A 4AMUA 4JVSB 3RSHA 5IWCA 3I37X 1U4SA 1G5FA 1JDBC 6LDHA 4K40A 2TMGA 3WGMA 4RD2A 2QQGA 4WCDA 1QVAA 1U0GA 3C8ZA 5TQ2B 1P74A 3GGPA 2P2GA 1G59A 3BDIA 2QTBA 3BN3A 1E61A 1C3LA 5FRDA 1L5HA 1QGED 4EG7A 5AT1A 5J3JA 4FLFA 4WECA 4IWXA 4E31A 2NU7A 3EXFA 5K8IA 1C1HA 2E0IA 2SCUB 3D5QA 2QK4A 3U09A 1NDUA 2FFBA 1OZGA 3EGIA 3JWPA 1HNWB 3JATA 4CMIA 2I1LA 2XWQA 3A4LA 3UHJA 1QCYA 4AN4A 3E3MA 2FEMA 4EH1A 2H4XA 2KE5A 4HGRA 1YR1A 2I8LA 2XVAA 4YI5A 1EEHA 3A6ZA 1WZIA 3HL4A 4V03A 1NIPA 5AVXA 2IHVA 5DYIA 3C3MA 1QZUA 2G80A 3M6AA 1EUYA 2PSDA 3KUKA 3MW8A 1WP9A 3OAAA 4PQFA 5EJAA 5F4ZA 5A7HA 5JQGA 1Y5RA 3L7MA 1NC1A 3BZUA 3FR7A 4DUPA 4O2BA 1GADO 1XZJA 1YR7A 1CUZA 2VZ8A 1EFTA 1PTKA 4IIFA 1SQSA 3T4UA 1ZJ5A 4B2PA 2GYYA 3DE0X 1KBQA 5AUNB 4YJHA 4V3BA 1T9KA 3FR8A 3RTAA 4PQYA 4OPMA 4Z9FA 2Z08A 1FEZA 2GZHA 2V98A 4US1R 1T4GA 4H60A 4A5OA 1XFDA 4UCQA 5FI1B 1RXWA 4J2HA 4B43A 3TGWA 1ODIA 2L2QA 2FYTA 4EY7A 3U62A 1YB6A 1EFRD 4HKTA 3NXKA 4LBVA 1JF8A 4RLQA 4AZ0B 1T8WA 2I8CA 5FPHA 3RSFA 2Q4BA 1VA5A 2ZBVA 3IGFA 3ZCSA 4I2NA 1YRAA 1UMCA 1X19A 3FJOA 3WSVA 1WVGA 2V58A 1E1KA 4KYIB 3A31A 4HNGA 5J5AA 1LDEA 5A2GA 4BLRA 2I4NA 2Z1MA 5COAA 4X8LA 1PNQA 3VPSA 1UAAA 2PZMA 5CAEA 4GHWA 2WIJA 2PE5A 1Z25A 1NMQA 2B4KA 4MR8A 1G8JA 3GVHA 2OK8A 4M1YA 4Y6LA 5K0FA 4TTQA 3W2IA 2FH5B 4LRTB 5SZHB 4X6LA 3QOXA 3ULKA 1QPBA 1U2RA 3HMKA 4QAQA 4RS4A 3DJFA 3THWA 1SCNE 5L95A 4Z2AA 3R76A 2ARKA 1EX7A 2C0PA 2QS9A 1ZESA 3DH0A 2NT3A 3HGQA 3OCCA 4GPBA 1N36B 4NBTA 3HYNA 1LV8A 3V2GA 3L41A 1TJ4A 2OO3A 4RS3A 1Y98A 1RYDA 1DBIA 4U2DA 4MVJP 4J49A 1SCUB 1T2DA 5FOVA 2XQJA 2YY7A 1EM8A 3NHKA 2RHRA 3ETHA 2A2ZA 1NZFA 1M8FA 1I4OA 3N70A 2HPZA 5KSOA 4J2OA 1NBME 3FOFC 1VPWA 1SZPA 1YIOA 4RWZA 5CH5A 3ZXYA 4RZHA 5AK0A 5JG7A 1RWXA 3SZLA 1RTKA 4I1RA 2QRVA 1G5TA 3ESXA 5CDSA 4YJ2F 3KT0A 5AUQA 4F7WA 2CDBA 1YC2A 3U17A 3T41A 3IXLA 3JPWA 1ZC4A 2JIZA 1SD1A 3DFKA 1OTYA 5C8ZA 4KOAA 4IDDA 4MS3A 1I6MA 1SPXA 4HNAA 4WN9A 1SBNE 3HGTA 3SU8A 3WQQA 1FFYA 3JZDA 3WHIA 3LA6A 4DILA 3IR6A 3CRRA 1MX5A 3ROFA 2OR3A 1I3LA 3OQHA 4FFMA 3SF8A 1GNLA 3ZDXB 4YH1A 3FSGA 1I1OA 1P5FA 2JKVA 3EQ8A 4K9SA 1E64A 3AR7A 3ORYA 2BFPA 3Q2KA 1GG8A 4KC0A 4R51A 2JJ1A 5AI5A 1RD4A 1UKYA 4UM9D 3NTUA 1SVWA 2HDHA 1ZJ6A 4UW9A 3L0SA 4F3KA 4KFSA 2A9QA 1US8A 3PCRB 2IXAA 4G37A 2F8SA 4BX2A 2J33A 1KNXA 2O9JA 5CGQB 5A06A 4U8GA 5HJ5A 1E1RA 2PRZA 3FNQA 3Q2OA 3K32A 5K8VA 2ATVA 1N9ZA 1N5JA 2FWNA 3ISJA 1PWEA 4X71A 3GRAA 2YXBA 1VDMA 3LSTA 5CXSA 1JHMA 1X8JA 5LLDA 3JZMA 3OLXA 4KXMA 3VNAA 4C6TA 1SBHA 1X8KA 4UUOA 4RORA 3BCRA 1YR3A 2QRHA 1L4EA 5ERXA 4G41A 2E3JA 5LP1A 3A05A 1SQFA 2NGRA 3NPMA 3QA9A 1Q50A 1Z36A 1E96A 3CV3A 1LQ2A 3EZXA 2XUHA 1N77A 2AOTA 2I0FA 4WESA 3AYXB 2OE2A 5EKTA 4Q7EA 1GPAA 3VZBA 2AE1A 1WNFA 3W1EA 1DIHA 4M9CA 3BSSA 4TGLA 1JR3E 1QLWA 1JHQA 1V6CA 3ZWOA 4TYYA 1YSCA 2UVQA 4GPTA 1SUWA 3UANA 3ADKA 3CUVA 1XDUA 2I55A 4ARZB 1F6DA 1C0KA 3CN7A 5B57C 4IGEA 1JS1X 4U9IS 5F3WB 2WPDA 3ILSA 4FFLA 3IOEA 4MVJE 3T5MA 2O8EB 1KMHB 3MYRA 2IEZA 2FEKA 2GD6A 5KQLA 1Y9DA 1E3WA 4IRUB 4CTJA 1CQXA 1MUUA 2C59A 3QG1A 1DE0A 5ECWA 4YJ3A 1U9JA 1ZITA 4RHYA 5J2TA 2GA9A 4F91B 1KI4A 1T4MA 4OQXA 1I3NA 4RSHA 3TQRA 1J0XO 1KQPA 1QTIA 1WBDA 2VOJA 3IAUA 2DCUA 4NIMA 4OLJA 3CC8A 4UPVA 5A6VA 1G6HA 3LCVB 4DNPA 3QBTA 4EECA 5KYNA 3JAMA 1A04A 1JKJA 1Y5NA 3IP7A 5EE9A 4DKJA 3S8MA 4GBED 4DDKA 7YASA 2NSLA 4DOMA 1RPTA 4BQIA 4LHVA 1EZ4A 5H68A 3AY7A 2YV4A 3IVMA 2SKDA 2WJ4A 5KQGA 1QLHA 1U31A 4LYJA 5CDYA 4I4TA 1MNQA 4JY7A 1YACA 3A36A 2X5JO 3F8WA 1ORHA 3ZU4A 4NBVA 4YLGA 4OK6A 5E7JA 3ITDA 2OT3B 3LZDA 3DE6X 5JSUA 3MN1A 2M6SA 1Y5LA 3I45A 4IFTA 4PHCA 4KPFC 2HBRA 3SX0A 4D3FA 2JI8A 4KVZA 4BVEA 1MA0A 5FADA 3GFVA 4O4IF 1YXMA 4MMZB 5AD1A 1D8AA 6Q21A 5JXWA 5J40A 3GFSA 1KMQA 3RVPA 4AYTA 1V9CA 3JD0A 2QSJA 3CZAA 5CB0A 1EQ2A 3KS9A 3FBTA 3RBAA 2VSYA 1PZGA 3Q5DA 2AG5A 3T35A 1L5QA 3CR8A 5F1KA 4DMFA 1UDCA 1DC8A 1M5UA 4KWTA 5AKYA 3TZCA 2EFCB 3OKCA 4QAJA 4F1KA 5HJ7A 4RTJA 3HNOA 2Q9AA 4P82A 5D51S 2VBGA 2CXUA 1JFFB 4HQOA 3ZHXA 2E7ZA 5A0VA 1CS0B 1KARA 4JUIA 4QOIA 4Y6QA 3VU9A 2B2NA 2RB5A 1PJCA 3FX2A 2ODTX 3G5MA 3MC1A 3EGOA 4N3BA 3AM1A 1HZZC 1E6CA 3FN4A 1OVGA 1FFGA 3BMNB 3FWHA 4RGVA 1MJHA 4RAOA 4XR4A 3Q7EA 3BG5A 1M2NA 2FCAA 4DN6A 4ZMRA 2C07A 2PIDA 3VPAA 1A88A 4O4LF 4ENSA 2YFHA 3IUJA 2XTJA 2XYPA 1DX6A 3BUSA 1VIMA 4LDAA 4TS3A 2ZSEA 2H07A 4TSKA 3ZEAA 3PUXA 1JDJA 5D86A 4OQMA 1CF9A 5GJWC 5KX5A 5JADA 4EKIA 4KODA 4XEUA 4A0HA 4FMCB 4PLTA 1W46A 1B2LA 2GZSA 4D0GA 2CB9A 1RWVA 4Z1MA 7GPBA 3HN7A 1P0PA 2H5LA 4DBZA 2DEUA 3AONB 3R4CA 3JR7A 5K3FA 4Q1AA 4MAAA 4C08A 4XWOA 5EQTA 2EJUA 1VI5A 4FJ1A 5FWXA 5K4AA 3ZNNA 5BN4A 1EFVA 3UC5A 2V3WA 4AX4A 4IJWA 2YXNA 4DNFA 2PT6A 2W6ZA 3INNA 3KEFA 2HSZA 4M38A 1QM5A 3RT9A 1ODLA 5CFRA 2NYAA 1WP4A 4IHQA 2ZP1A 4N0QA 1KQNA 5LP6F 2V4MA 2C7PA 1XDBA 3C3AA 3VVMA 3WB9A 1XTTA 3N53A 3AM3A 4GVPA 1Z2CA 1EJBA 2ZVDA 1NQWA 2P9FA 4ZU1X 1OXVA 3I09A 1G38A 1CNMA 3P9NA 3QITA 2XMQA 2OHIA 2YMPA 3GP3A 3QVLA 1WMSA 1P9OA 4FT2A 1IOLA 1EDOA 4LZWA 3TXXA 4PYNA 2XADA 4CF4A 3AVVA 3C6XA 1EFUA 1GP2A 5B55A 2PUVA 4QU5A 1BE0A 3WYCA 2AE2A 2F64A 1FMJA 3RJ5A 3HRHA 3RARA 1QCCA 2Q62A 3WO0A 1FXWA 2WIGA 4Q01A 1HPLA 3ZHUA 4MR9B 2BGWA 2LUOA 2XVZA 3ZU3A 3DBRA 4RK4A 1CYEA 2QNRA 2QTFA 1SIWA 1R12A 1WF6A 3A1NA 3OCWA 3E4CA 4M36A 4KXYA 1I6KA 3L9WA 1L4UA 1SBQA 2OV6A 1KDRA 4IFIA 4Y9DA 4CVNA 3L6EA 3ZCTA 4DM3A 5I4IA 2AZXA 5LYJB 4W8HA 4K0RA 2K4MA 5IN5A 1X0XA 3R6TA 4AB1A 3DLBA 2R4QA 1XRPA 3Q40A 1QV9A 3ML1A 1QHEA 4QWWA 4HDMA 3QSYA 4ZTBA 4OQLA 3W6OA 2QR3A 2H51A 3TQOA 5JFOA 3PGLA 4QUAA 3RSQA 3T0GA 1BVRA 2HDNB 3KQYA 2HPVA 1H1TA 4DNQA 1I4DD 3AR5A 2JEZA 4KLNA 4LC1A 2FMTA 3AK4A 1UAYA 3JQRA 5EMHA 4DLYA 3GGCA 3ZTWA 3SQWA 2F8TA 2R44A 3P0EA 4E6EA 5I5EA 4KACA 1XEWX 3ESRA 2PVCA 3WMWA 5HTKA 2RGYA 4H6WA 1L7AA 2D0IA 4BP8A 3RJTA 4L9RA 3ASYA 3AR4A 2DPYA 2FLVA 3O74A 4R1SA 4RAQA 5EG5A 5HCIA 1KRWA 1PTJC 4MARA 4PZ9A 1WBJB 5DNDA 1AIPA 4MYCA 2QD5A 1N2CA 3CUYA 2GYWA 3R24A 4HH4A 4HLDA 3T8YA 1NMYA 3FVRA 2MJLA 1K5GA 4JC8A 3MPUA 3WY9A 4WFQA 1VECA 2IHJA 3Q7IA 1P0CA 3RJ9A 4S0XA 3E2IA 1P1IA 3CMCO 4K9QA 4N7BA 4KH0A 1USWA 3U7QA 3ZWXA 4BJ3A 2I7VA 5K0LA 5JS2A 2WI8A 3GDWA 1MVOA 1Q83A 1K6MA 1SXHA 4ZQCB 5EXXA 3RU3A 3PL1A 1ZZEA 3DW1X 3A25A 3WRYC 1Z16A 1LCIA 2DM6A 3RVKA 3WR5A 3TBHA 4OHKA 1BJKA 4C04A 3GLRA 2WKQA 3OZXA 3S44A 2ILTA 2JVKA 8GPBA 5ADHA 3UJ9A 2GXUA 4MHOA 2GERA 5LUBA 1ZZGA 3CRVA 3H9GA 2AJBA 4D0LB 1V47A 4UBIA 1MB2A 4JQYA 4EHAA 1KQOA 2Q7OE 2VZ0A 1FSZA 4CF6A 2UZ4A 5LDDC 2O57A 2ECKA 3GRCA 2OAEA 3GXOA 1EE1A 3HPRA 2Y2UA 3RADC 4CDRA 3GVPA 1YDFA 2X8JB 3IUNA 1S3GA 2EQ5A 2OTCA 3CG4A 4HMPA 4B46A 3RF6A 2WTNA 2WBLC 2FQ1A 3E5HA 3KIPA 1PF7E 3HSYA 3REGA 1JEDA 1KVRA 5KNDH 2COEA 2BI7A 4FHFA 3IJ5A 3FTNA 1JHAA 1T0PA 2P3LA 3MEQA 1TU0A 3MT9A 4KO1S 2J31A 5C80A 3ZVLA 5JPCA 1FSPA 1J0DA 1SRQA 1PQ4A 2I3AA 3EULA 1TAHA 1MJGA 5LZ5A 4PG8A 1ML4A 1CQZA 3AFNA 5JRZA 3PDJA 2ZSDA 1R0LA 2ZCVA 4BV9A 5L4LA 3OEYA 3FNIA 2VJOA 4F60A 3FTEA 1I2BA 1TO2E 1OX4B 2BMVA 4RA6A 3U3MA 4ZJPA 1H6CA 2GBFA 1V5FA 3VISA 1XTVA 4LXQA 3HXOA 1ULZA 1Y5IA 1GUBA 1DJLA 2WUDA 5DTQA 1MAAA 4M76B 3VV2A 2PO5A 3RODA 3ZXSA 5BV1A 5H9WA 5IJZA 1EHIA 1IHDA 2WHXA 4U3JA 2CZCA 4Z3OA 1RI5A 2A6PA 1OASA 3CCCA 4P3NA 1UKVY 3GGDA 3Q0IA 4A2QA 4KQ9A 3QM1A 4KR0A 4KPEC 2OCIA 2RGBA 1J2TA 4GXRA 4LZNA 5E9WA 1NUUA 3I6BA 3L04A 4RKWA 4OATA 3ZDYB 1T8RA 4E5DA 4JV5B 5ICSA 5I48A 2AEFA 3MWKA 5TRTA 3LA8A 2ZT7A 3NHLA 1SU7A 4O6VA 4OM7A 2UUOA 2I34A 5I47A 3RC8A 3WBKA 3G5UA 3KXPA 4L4YA 5K3AA 1QOZA 4J4HA 4AO6A 1KFBB 4B3JA 2Y92A 1L7MA 3DOUA 2XZDA 1NF2A 2B5OA 2IEAA 4JC4A 5DRTA 4W8GA 5EI5A 3GCWA 3S2FA 3A6LA 4B81A 1NR5A 4E2ZA 5JJCA 5TLSA 1VLLA 1HSZA 1U0OC 1CR1A 2AB0A 4NV3A 4CKCB 5CJPA 3MVEA 1ZCZA 2XW6A 2ZBQA 4IAOA 4WXPA 2HBYA 2J59A 3CF4G 4FEEA 4LJYA 3A3YA 5LJIA 3FCAA 3E8SA 3V33A 3A1WA 5AM0A 2P79A 1R6BX 4U5QA 4OHUA 1J6UA 4M8KA 4YMSA 3WRWA 4RTKA 3W7VA 3CW9A 3PUHA 2N9UA 4Q66C 2ZZNA 1R8SA 1GGFA 1N9KA 3M9LA 3FWNA 1W1UA 1LI7A 1VJGA 2VYNA 4TRJA 4BQOA 4GT1A 2KQUA 4G0WA 3ZUPA 1V11B 4UFPA 1JSLA 2YWJA 4OLBA 2GNAA 2YR0A 4NICA 1T13A 3A37A 2J4DA 2HUNA 1H4TA 3I05A 4KRFA 2V0GA 5CP8A 2R7NA 3MMXA 4YT2A 1BW9B 3RYCA 1T29A 1YU6A 1M9NA 2C5GA 5DM1A 4A27A 3PEEA 3UMJA 4EI2A 3HVJA 4JCCA 4WWHA 4LGMA 3RWOA 1KOFA 3PR3A 1R0YA 2P62A 5LA6F 4EB8A 1BD4A 5JD6A 2C54A 1XD2A 1P18A 3S2GA 4F8EA 1MXFA 7AT1A 3MA0A 2WG0A 5ITVA 4YN3A 5JAQA 2P7IA 4TXJA 3KSAC 3ADOA 4XWTA 2WIKA 3B60A 2IE8A 3GL9A 1ORDA 3PJRA 2XJ9A 5L6MB 2DSNA 4LDNA 3BT7A 4D3SA 4BQFA 1C1DB 5JZSA 3LY8A 4ITVA 3R5FA 1P5ZB 4WXMA 2JJ8A 4UBMA 3HI6A 2VZEA 5FB3A 3D54D 1N0IA 3ZHOA 1CETA 3AEUB 3L0DA 3QLUC 5AYVA 4D3ZA 3UW1A 1M6WA 1DKNA 3R8FA 1N8NA 1XNJA 1UZLA 5ALQA 3BRSA 3GF4A 1GHTA 2CJXA 2IZ1A 3CGGA 3NIBA 3P52A 4IJ6A 5DH9A 3V48A 4A5SA 1JZTA 1M2FA 1XD9A 3G0OA 2R6CA 2XEDA 5FWDA 3FLMA 4NCKA 4UEJA 1M2OA 3G6KA 4M9SA 1BO6A 4LX0A 3T1VA 1Z06A 2QEQA 3FETA 3JV7A 1CP3A 5E4JA 1XDSA 1Y7TA 2P0YA 2P9EA 3LGAA 3P2MA 4QDUA 3K0FA 4ZXPA 4B6EA 3HO8A 4HNQA 1XZ8A 4QTYA 1FNMA 3OEHD 4UU7A 3UXYA 1CUUA 5U4QA 3TI7A 4ZDJA 5AVZA 3SJUA 2OHGA 1LSSA 5A4MS 4JT8A 2FJPA 5JBNA 3I6YA 3RS9A 4XJXA 1PS9A 1Z7EA 3QEMA 1Y6GA 3G68A 1PQWA 5TGDA 1FFEA 4DG5A 2HMAA 3HPQA 2AKEA 1F14A 3AZPA 1YS9A 3IUMA 5IXSA 3E5NA 1ORWA 3WJ2A 5A0TA 3PJGA 1LK0A 2V5AA 4GZLA 5C31A 4KN9S 1TKCA 2WF5A 3AHHA 4BKPA 1GDDA 2EBWA 1M1ZA 4PGGA 4WDRA 5DM70 4ROSA 2BGRA 2Q1SA 1IBCA 2E6KA 3U3OA 1RADA 2EFJA 5D3QA 1V43A 2OBFA 2DWCA 3Q3JB 3N5KA 2Q3FA 4IVQA 5I4KA 5H4GA 2JGNA 1JJIA 1ENZA 2ZI7A 4K28A 4ZYZA 2P0AA 2H1RA 2HTFA 2VJDA 2A9VA 4RE6A 1XVTA 1Y7LA 3ED1A 3EFBA 4HK4A 3R75A 3AHIA 3R7WB 4EKGA 4Z7NB 2P5YA 3E9NA 3HJHA 1GXSA 1BXZA 1RQLA 4Q3OA 1G8HA 2ADFA 4MIOA 1P29A 3KB1A 4CR8A 4DSAA 5KKCA 1CEEA 4U1RA 1EAMA 3GJ6A 3DV0B 3M81A 2ZE5A 3Q3GE 4RK7A 1LJ8A 1DT5A 3DHEA 2ZVJA 2WVJA 2VA9A 1UJCA 1A8HA 1J8DA 2HSJA 2ZSJA 3EVZA 1A98A 5E0OA 3NYWA 3ZW7A 3P1JA 2DZDA 3IUPA 4ISCA 1COWD 3L7NA 4BFTA 1RJ9B 5A5EA 5KOJA 4MQEB 2UYQA 4ZIRA 2SBTA 2O14A 3B89A 1VIDA 5AKXA 3H8WA 3AHDA 1IEWA 2C7BA 2RAVA 1TCCA 4AMVA 4JLUA 1QUEA 5AOVA 1E6EA 4QC2A 2W90A 4DR4B 4P7FA 4EZIA 1H6AA 2BFFA 1T1JA 2CVOA 1Z2AA 1Q6YA 2WPNA 2XKKA 4Y8VA 2CMGA 3F98A 1IJEA 2IYVA 2RK4A 1KSJA 2ZSHA 3CY6A 3A2MA 3HKBA 3MLBA 1SUAA 4JBLA 4JLBA 5HNKA 5A6SB 4H0NA 1ZISA 1UBEA 2F1HA 3CJRA 3DZGA 3HEAA 3JQBA 4WY8A 1QS0B 4WV3A 5T8KC 3U40A 2W2NA 1EFAA 3E1KA 1JPUA 2J5RA 2ZYRA 1YOBA 5AJWA 4ZMSA 1U0HC 2I66A 2J07A 4HG2A 4MB0A 1LPPA 1UPCA 4ZOLF 1OJ7A 4QFCA 2NV6A 5D87A 6ABPA 1TYAE 4BV3A 3BD7A 4D45A 4NZ9A 4DRYA 5KQMA 1G17A 4TRRA 2BCJQ 1NBHA 2JI6A 3JQ9A 3HBLA 4ZYVA 2H00A 4A3SA 2D2IA 3GVCA 4J1QA 3OUZA 1MBZA 1R9NA 2ZSFA 3P0RA 4LHEA 5HGXA 4L50A 4J91A 3B53X 1X92A 3U39A 2HT6A 3GZ4A 1G4AE 1P1HA 3PHIA 1DLJA 4I50F 3KLNA 1E0SA 1Z2NX 1GZ5A 1S2NA 4G0PA 4XUEA 3E18A 4GBMA 4XA8A 3TZEA 4CFZA 4PIPA 1BXGA 3IPRA 3L7DA 1HRDA 3ND7A 2PT5A 4LNUA 2ODEA 3P94A 3U7IA 3AESB 3ANTA 3KSZO 4N12A 4CCYA 1N5RA 3L8DA 1PR6A 4KVGA 1VYHA 1NJSA 2YDYA 5E0KB 4MO9A 5GP1A 3WKBA 4A92A 1NPTO 1FYXA 2FLKA 2IYRA 4W6ZA 3VMFA 4E2WA 2ZAYA 3PC3A 3WWZA 3A1TA 2CLMB 4PTYA 5CFLA 5IF9A 4R9SA 4CR6A 1HSOA 2N46A 2H0RA 4L4ZA 4F46A 3J81k 1Z63A 1HV8A 2XCLA 1OWPA 3OFND 1U3GA 4JLVA 4ZVOA 1W1IA 1I7NA 1YIAA 4Y1GA 5LMCA 1ZLYA 4RDHA 2I8AA 5LXTF 4PTLA 5BYKA 3WKEA 1U0NA 4IIJB 3WV5A 2P1DA 1LF5A 3M6FA 4RPGA 3P9CA 3MJVA 1D2AA 2BUCA 1T35A 3OKPA 3JCZA 4G25A 3HWX1 1XB2A 5ERGB 4D9FA 9GPBA 1A1VA 3GQVA 4CDGA 4B2IA 1YJAA 3PFBA 5ALOA 4E7OA 5M04A 2C2HA 3SYNA 2OQ2A 4LMAA 4TQUS 2VTBB 4AP6A 1G3QA 3HCWA 3HB4X 4YAEA 4BASA 1QFYA 4JLNA 1YRLA 2PD4A 3I9NA 4BJ5A 1R6XA 5LBUA 5HYVA 1PFYA 2VHXA 4ODIA 2ZREA 4NYMQ 1DELA 1U99A 4EMBA 1CFZA 2JFYA 4JLPA 4P08A 1TLLA 3SMVA 5IM4F 1EESA 3UUEA 4DYVA 2BTOA 5C4GB 1YA8A 3TD9A 1JQKA 3AFMA 1L7BA 1LLFA 3URMA 3ROMA 4ZWNA 1Q0PA 4KQ1A 5K8TA 1GUYA 3DMDA 3QUTA 3ZWYA 1V1MA 4REOA 3UT6A 1E0JA 1R9GA 3RC7A 2O8CA 4UKDA 5DHSA 1HURA 4WLFA 1IWPB 2OAP1 3EZLA 3IUSA 3KT6A 3RIGA 3RSSA 4URUR 4AUEA 4EDFA 4MROA 2C4TA 4XVUA 1QIFA 4N6GA 2YBEA 3HCFA 4QOGA 1CQWA 4DR1B 3DVSX 2PCLA 3BULA 3JVIA 4P7BA 1GQSA 3HR4A 3JX9A 1NBEA 3BWYA 5KOHB 3B38A 3QMWA 4FNGA 1RC8A 2VP0A 5EN4A 3D2AA 4V0KA 5AOCA 3UGJA 1JR4A 1NI4A 4WCFC 2QP4A 1QHFA 4ZAFA 4E2FA 4IWNA 3CUKA 4QPDA 4LHSA 2PH1A 4ZYWA 1QKIA 3EF3A 3V55A 1S7GA 1HG1A 2H4WA 4LOKA 1U5BA 1JDBB 3K0KA 3FPCA 2RFLA 2E1PA 1C0PA 2F43A 1CEQA 5B3AA 1CUDA 3RYIA 4PBTA 5B1YA 3DA8A 4UARA 2YIDA 2Z56A 4Y98A 2X7JA 1JNYA 2V54A 2VQ6A 4N5IX 1B1AA 2PTHA 1RMQA 3D8UA 2J3QA 1AQYA 3JAWB 3LLMA 4LV6A 4OMCA 3RIMA 3SQDA 3ZDFA 1OC2A 2YN4A 4DZTA 3FHCB 5DPMA 1WDTA 3PT9A 4RHFA 3UMBA 4OYLA 1D2MA 1CR2A 1IQ0A 1U2SA 2QLNA 1Y5MA 3KL2A 1FBNA 1SC1A 4Q7JB 1KORA 5D7BA 2AN4A 5JBIA 3LFTA 5AHXA 1DC7A 2CJFA 2ZSAA 1L8AA 2QVCA 1SH7A 1MG5A 2G07A 1X77A 5NULA 4OJYA 4MQMA 4A8HA 3SC3A 1AUQA 1SBZA 2QZJA 1C80A 1T24A 3HADA 2CXTA 4OJKA 2D3TA 2OBMA 2VQEB 1ITZA 3FPHA 4DIFA 1NGSA 4K88A 4OQFA 4IMRA 2J4FA 5CYFA 1K7CA 1KY4A 4JASB 2H7YA 1WXWA 3GFOA 2C5BA 3QVTA 2XUFA 1DINA 1XP5A 2BP7B 2YMLA 1CUHA 2JHFA 3L49A 1VMEA 4HQKA 4KWIA 1ETUA 1QQBA 2ABWA 4XFKA 1UQUA 1WKBA 2K2QB 1K5PA 1RLJA 4I3GA 4D8XA 1NIJA 3DZIA 5GVSA 1F48A 2PJDA 4JLKA 1TYEB 4RK0A 2ZQZA 3IEPA 4NZZA 4WLNA 2WYWA 5F2OA 2JCXA 2ORYA 4UHJA 4AG5A 3B1ZA 4F04A 4ZMBA 3G7UA 4J16A 4X91A 2P2NA 4POOA 3CLVA 1PR9A 4TQAA 1U28C 2ZCUA 1FVOA 1FJGB 1MENA 4D92A 1RYYA 1H2AS 3B51X 2QY6A 4R1NA 3TXYA 1TIBA 3L1KA 4JP8A 2ID9A 4X85A 5CU7A 4D8UA 2D5AA 2ISQA 5GIPE 3WLTA 3D1VA 4Y1RB 3ZZUA 3C7KA 3JTEA 4GNRA 4RBNA 2YN2A 3O7MA 3D7LA 5JJBA 1Y3CE 5JS1A 4MQBA 1ZI9A 2C4VA 2J3DA 2NUTB 2RSLA 3W3AH 4MW6A 5D01A 1G64A 4RYLA 4NYIQ 3AOEC 3UB3A 3VR6D 3VUEA 4QM7A 3S2YA 3WGLA 2M32A 1GKLA 1JU9A 1P8AA 4OYRA 5FJJA 3RRJA 2IUFA 3HDVA 5AJTA 3QV1A 1E3IA 1XZPA 2R6GA 2ZIEA 1MU0A 3IQEA 3FYUC 3DNMA 1QQTA 2UVPB 3BJZA 4B6FA 4CODB 5K0CA 4GGOA 1T26A 2HEGA 4ZVRA 5PGMA 3UMGA 1UF9A 3IT3A 2J45A 2PRYA 2D1QA 3OKAA 2QKYA 4X6XA 4PGFA 2QWXA 2VNIA 3JQAB 3BYZA 2MSWA 1CQIA 4XPIA 1EZZA 1XZFA 3QVGA 4JI3B 1RPAA 1YS6A 1YULA 2IXFA 2P1RA 4PGAA 3SBDA 4CKBA 2NMVA 3TZ6A 3U0VA 1V37A 3EIOA 4M6WA 1TXGA 1VIAA 3MJRA 3CVUA 3QBVA 4O59O 1CJVC 4DLVA 2Q5JA 3S2SA 1M0EA 4GKKB 4N49A 3SY8A 4IDCA 3RU7A 4K03A 2WG2A 2YHSA 4Q02A 2EKZA 1AHIA 1DKPA 2JKZA 4ZC1A 2X0FA 4EYGA 5K99A 1UDWA 2E1RA 1QNFA 4MX8A 1PIWA 3I53A 1JL3A 2QD1A 3L7LA 3NJ4A 3RDPA 4F7DA 1XMPA 4XH9B 2V1UA 3L18A 2F90A 2C8VA 3CTMA 4M1SA 4OHOA 2EOAA 1L4YA 4HYQA 2H7XA 2ZBEA 1OR8A 3AUXA 4TXNA 1VKZA 4JSTA 5F3DA 4RL6A 3K09C 4GLBA 3VNSA 3FHOA 1Y1RA 4WUTA 5KNBD 3OIUA 3AL0C 4QBTA 1NDHA 3JYQA 4ZXFA 1O3YA 3DEHA 2CMDA 1O4VA 1J8YF 1BYIA 5DV9A 4Q48A 3LPDA 3DB1A 3QLTA 1ONOA 3PJDA 3UM9A 4I4NA 4GVLA 4DTCA 1WCYA 3TIIA 1V8OA 2C8LA 2ZR0A 1VRVA 1WEHA 2PXCA 2COKA 2YJ5A 3VJMA 1KH1A 2W0SA 4GMGA 4JJFA 5ECDA 4ZVLA 1OYWA 4LWOA 3EDMA 3P45A 2RAPA 1X7XB 2QAJA 1Y3IA 1W36B 2O20A 2YQ5A 1KZ9A 3LJKA 4KK3A 1C0IA 2BR4A 3LK6A 3H4MA 4Q3EA 3FB1A 1ZEJA 3UFXA 3KLOA 3FMPB 3AY6A 4HJXA 1BEZA 3Q6NA 3A6DA 1OGJA 5ALDA 5LCXA 5I7HA 5IEBA 5ANRB 3EQZA 1J9EA 4AZ3B 3VU8A 2A0UA 2LP4Y 3ZV3A 4DC0A 5KJ6A 3J7TA 1FDWA 1TZ2A 4E07A 1NV9A 3KUXA 4LXHA 4F11A 4ZN6A 2BFEB 2PZEA 2YRWA 2ZAOA 2GRJA 3NIGB 1JIVA 1G291 4FFOA 2DUUA 1QMPA 1QGOA 1CUSA 2VT2A 3ND8A 4RLSA 4RZ3A 5CA1F 2O0LA 4TYPA 4E4TA 3MT7A 1BAPA 4MLCA 4NX2A 5A5VA 2G83A 1RWPA 2DWOA 3NORA 4G1MB 2GBLA 1GFSA 5B4UA 2Q5OA 5I8ZA 2W37A 3D81A 3FOCA 3FDFA 1NF8A 2XMGA 4ZK2A 5AVUA 4RQAA 3B8HA 3BXOA 1XZIA 4C7JA 1SC3A 2KW5A 4C05A 1G1MA 1GCAA 4B45A 4BJ6A 2P9HA 4M53A 1RYNA 2O2JA 3SP1A 4QEZA 3ZIAD 5JEEA 1GNQA 5J4LA 1T2CA 4XUCA 2DKOA 3UF0A 4TS1A 4WLOA 4M54A 3X3HA 4L2IB 3G2KA 1FB5A 3ZE0B 4Q05A 3NFRA 3IIKA 3PBKA 3U3XA 1W85A 3K5IA 3RIXA 3O8LA 4OUKX 4EZBA 3GLIB 2AV6A 2IDKA 4MUNA 3ER6A 5IXYA 4H7PA 4ER0A 3EOZA 5UKDA 1XMOB 2AH5A 4MWTA 4YJFA 2CLOB 3UJBA 3OT1A 5GV7A 2IT1A 4RX1A 4N41A 5CBKA 1NVGA 2HU5A 3BKXA 3C3KA 3OM1A 3QFRA 4C3OB 4O08A 1IWOA 5KYVA 3VM6A 4DJFC 1SUIA 2DR3A 1KJJA 4CETA 2DE0X 3PD1A 4GD3Q 2W42A 4NK5A 1L5GB 1JG1A 1DG3A 4FPXA 4EAAA 4CF3A 4YAGA 1ZGZA 4A1OA 1EK0A 1LPNA 3OQOA 3KJFA 3D5TA 1F38A 2CK3D 4EG3A 4LJ4A 1QORA 3QBDA 2W71A 2JH8A 3CNEA 3Q2IA 3WB1A 1JVBA 1HDGO 1U8ZA 3JRNA 3CZRA 2MHCA 4DDVA 5JU6A 1JHYA 3PUKA 2J0EA 3CSSA 4IIVA 2CD7A 5LQAA 1X1CA 5IJ0B 1EDEA 2EVWX 2WWWA 3ASZA 1D1QA 1QUFA 3DWIA 3IBGA 1X7HA 4HYEA 2DQ4A 3AIKA 4WA7A 1JJAA 5KEIA 3S8EA 4JL5A 1XLUA 1BMFD 1KFEB 2AN3A 3OZCA 3E53A 4Q24A 5K0BA 1JDNA 3ZNQA 1KTVA 1MP0A 4EHIA 4D4GA 2LWIA 2WWTA 4EHJA 4TV9A 2NOAA 1VL2A 4WXRA 2GAJA 3OKFA 3MAJA 1BA3A 1UOOA 3PD7A 1G1AA 3QU5A 5B1HA 4Q6BA 4XCVA 5A3SA 5HIMA 3GRRA 5KYUB 4JR1A 3A1UA 1A5AB 3VPGA 4KL8S 3E03A 4K5QA 3RAFC 4N7JA 3IP9A 2X15A 3FH0A 1JW9B 3LCRA 4LJ9A 1DTEA 2BFCB 2WQ7A 4FKMA 4OBBA 1TAGA 2JFOA 4KX5A 3SBEA 5C32A 1QRTA 4MVJM 4JB8A 4F93B 2PGOA 5IEJA 4FM9A 1FX0B 3UWOA 3EPPA 4NSNA 2YV5A 4TUYB 3BREA 2V7EA 4YECA 3IPCA 3RUPA 1W4ZA 5CB4F 4V0ME 1CUCA 3TLJA 5DTIA 5LQSA 1BHQ1 5A4KA 1JH8A 1LBHA 3G17A 4GVXA 2Q45A 2F62A 3GJ0A 2I9PA 4Q12A 4QE3A 2VBIA 2R6ZA 3FWPA 2HA5A 3PIRA 1KR2A 3CF0A 4NHOA 3L82B 4IOJA 4X93A 1YASA 2BL4A 2H9AA 3MZ0A 1E4YA 3G8YA 1IY9A 1AD2A 1T4CB 2VT7A 3FPAA 4IH1A 4QHYA 3VSCA 4MJ3A 5TIIA 1NI5A 4DCSA 2PG3A 2DFPA 2OLJA 2AA3A 2BGKA 4Y3UA 3W8NA 4EKEA 3PRJA 4HDNA 4WK6A 2QVGA 1UMKA 2JFBA 3E27A 2Q1XA 1B2RA 1HEUA 1XSEA 1N5IA 4A0GA 4CMGA 5IDQA 4AI6A 1ZO8A 1P39A 1XOIA 2FN9A 4U9UA 3D8BA 1N2ZA 3G7NA 3VH1A 1YHYA 3FKJA 3GD5A 2J7PA 3HMQA 5AW3A 2AI1A 2O3UA 3PFFA 1YGYA 2AK3A 5FD8A 4FWIB 3W6ZA 3F9CA 3CF6R 1NRIA 2QGFA 3RRFA 4FYHA 4IIXA 2YKGA 2FG5A 2UZ1B 5AVKA 1ACJA 2W83A 3PDCA 2AL7A 4AJ4A 3WGYA 3OEHA 1C3OB 1TUBA 2HLPA 1HT2E 4B5LA 3W5JA 1L3CA 1X2BA 5DI3A 3BHNA 1TPYA 2R2AA 3CPHA 3F74A 3R74A 1O54A 5B3JC 4P80A 2X4DA 5BWNA 4AJJA 2AFIB 3PX7A 1TAQA 4UNQA 1M10A 2XAAA 4KNWA 4PQGA 3WB2A 1JQLB 1YZ3A 5K4GA 4KWEA 3ZZTA 1TVKA 1KJ8A 1T6ZA 2FJUA 2HQSA 1Q2UA 2F3QA 2P35A 3GAAA 4O29A 4X84A 2FCRA 3BWBA 3H04A 1YUBA 3RRYA 2WTXA 2PS0A 3RFUA 3ZLBA 4A0FA 5BSHA 2R0QC 3I62A 1FFBA 3Q10A 1NVWQ 1Z74A 2CJWA 3SX4A 4TS4A 4D5GA 1C81A 3KJZA 1UADA 1XWWA 4R7ZA 4DQVA 4K1XA 5A7GA 2A84A 4W5HA 3NYIA 2VJYA 5T6MA 1YAJA 3RS8A 5ELXA 1QBKC 3CCFA 5IXJA 3DDZX 2CF5A 1C7EA 3LKZA 3R7AA 3NFYA 1XVUA 2ZW9A 2Q07A 4TLAA 4AWAA 5JAIA 4IG4A 1OBHA 5TPZD 2E49A 5C34B 4RELA 2ZJ0A 2NACA 5FOTA 1DUIA 2WMDA 3P9XA 1VG1A 1VHLA 2OBNA 4FNMA 5J2UF 3GJTA 2DG2A 3BXHA 4KQXA 5CVUA 1DX9A 1EGVB 4QL3A 5EIAA 3LMKA 4ENTA 1COWA 1OH5A 1ORVA 4MRMB 4BPRA 1DAPA 3GMIA 4YRDA 3IBYA 2LCFA 5GQSA 1N8SA 1DJNA 2R1VB 4OD0A 3V1KA 1DBPA 3LQ2A 3EBPA 3TSWA 3NHAA 2YV2A 3D8RA 3ENQA 2FMFA 3OICA 3W1VA 3F2IA 4FDLA 2HBZA 2AUMA 1PSDA 3TW0A 2P6UA 1C9YA 4J0GA 1BS1A 1EP3B 2I5PO 4X41A 1G3RA 1IVYA 3KSRA 3OECA 5AKJA 5FBHA 3T52A 5JVDA 3EG9A 2OECA 3H1PA 3P9RA 3UUFA 3TFOA 4PW0A 5BN3B 1U0BB 3FW1A 1N32B 3FA2A 2YUIA 3RR2A 2Z04A 5IM5A 3W9YA 1ABEA 1HFJA 1KBOA 3OZRA 4N8EA 3PWSA 1A4IA 5EJ4A 4PC1A 3UWMA 1GVNB 1I6LA 4M8IA 3S5JA 4BNGA 4F3NA 1B1CA 1IY8A 4YTEA 2PSFA 1QRUA 1B15A 4H6VA 2CBGA 1XYGA 1JBEA 2WU4A 3OUTA 1UXOA 2ET6A 1Q1QA 1L7VC 2FR8C 2W2KB 1DAKA 4ALNA 1IPEA 4YAJA 4H2DA 1PV4A 3O03A 4Z4GA 1K68A 4B1FA 1U11A 1GG9A 1YK0A 3VKWA 3B82A 2KLBA 3OWHA 4J0HA 1CKEA 2Z8ZA 2PNJA 3GEEA 2B0CA 2VH5R 2ZI4A 1UFVA 3JY6A 1E62A 1T9BA 3U44A 2ZJ4A 3PPWA 1JE0A 5CVJA 1JSRA 1BH2A 2FEWB 4RE5A 2XRZA 3ENVA 2AC2A 2R6AA 3P4UA 4WERA 4YJGA 4ZVKA 1M1YA 3QFHA 3L5OA 1T3ZA 5CRIA 2JLYA 3LL7A 1WEKA 2EKLA 4CV0A 1L1QA 5TARA 4II7A 4DEYA 3KPVA 4N6OA 1CX9B 4QVIA 5JHGB 4FTWA 3H5AA 3CX3A 821PA 5AP9A 5HRUA 1EUCA 1WMBA 5BV7A 5CEEA 4BXOA 4BS9A 1IMJA 1WHSA 4POAA 2OY0A 1WXDA 3NONA 3L1UA 3KAQA 3KAJA 4KQMA 3ROEA 3VYSB 5BW5A 3A2LA 2I2AA 3ICWA 2LR0A 4K9KA 4FI3F 2YWHA 4LJ5A 3DLHA 1CK4A 4LVCA 3AQ4A 5KYUA 4AZVA 1OT5A 1TM5E 4G8JA 4HQLA 3HR8A 5FJIA 2FU5C 1YTUA 1NFRA 4TVSA 4JODA 1GOTA 2EJCA 3I4LA 4ZDIA 1KZHA 4QUKA 1JEQB 3S1LA 1ZMRA 3NYQA 4RCYA 3D6MA 1H2HA 1HZZA 1O5IA 4I1UA 4DXAA 4UHBA 5ALZA 2B8WA 1RXUA 2QR2A 4QXRA 5L40A 4GZ5A 1EK6A 2B3TA 4QQNA 1KY2A 1A9XB 1KL7A 4KVAA 1W5BA 2BFOA 3VRHA 4OCZA 5HHTA 2ZYHA 3GFTA 2NM0A 2RIRA 3GAZA 3JD2A 3KJGA 4MWZA 4W9RA 3RVDA 5DOZA 4ES6A 1R0RE 1UWLA 5E95A 1OA0A 1BVYF 3K0EA 4NI5A 4RXMA 5G41A 1F1BA 3I01M 3ZD7A 2I87A 1WDKA 4HEJA 4BX0A 3IMEA 1PNTA 2NW6A 2HL6A 1JIIA 4R81A 3A11A 5CEJA 3JQ7B 4ZEWA 5AXCA 3V7UA 1IQRA 4AKTA 1FRZA 1JAYA 1QHYA 1P9NA 3P9IA 3PWZA 4HAUA 3JARB 5CDFE 1F8XA 1W4LA 2PWZA 1H8HD 4FQ8A 3JQGB 1NU6A 3HU3A 4RFVA 3T38A 4YI3A 3BH0A 5EFZA 3OPVA 4P0TA 1YI0A 2WINI 5BMVF 1I4WA 2WYOA 3UPDA 2BR5A 4B0OA 3TLKA 4LTDA 2K7ZA 2QPTA 1R4MB 1VLHA 4LRUA 2W2LD 2BI4A 3C41J 1TAUA 1K8ZB 2WG1A 3RE1A 4A26A 5JAOA 1YJQA 3KZCA 3UY4A 4EBBA 3VX3A 5I7OA 3KNZA 3UO8B 4V0OA 4LF4B 1RZ3A 2VOEA 7MHTA 1P2FA 4GR4A 2ZSBA 3DL0A 4Z3KA 2BUBA 3QUBA 4ZZ2A 2BM1A 5H59A 3GWGA 5T3YA 5C7IO 3TR5A 3SC2B 1VMAA 3QE3A 2BGLA 3B9PA 4R0NA 2MWMA 4MW5A 4JBXA 2W5UA 3FMFA 3IJPA 1IUPA 1J20A 2GBGA 2H7CA 2QI9C 4YMTA 5AVSA 2AFIA 3WHLA 5ICGA 3TAUA 4ATNA 1KZ1A 4ZYXA 3LDUA 4K6MA 4ZQEA 3UUGA 5FV7A 5HJ2A 4AS1A 3SJAA 1SUEA 1TTPB 4CUJA 4QRDA 1N8KA 4MYRA 2Y0DA 5LXTA 1P7CA 3E3LA 4IGFA 2CDNA 4Q39A 3GA0A 4BO5A 1QZTA 1UC8A 4E09A 4F9EA 2VDWB 4QX6A 4F6LA 5IDYA 4XYEA 5I01A 5DMXA 1RZRD 4RQBA 3C3CA 3N2NA 1MF7A 3C6QA 1PCXA 4G1VA 5D2CA 3TCKA 3FTCA 3ZDCA 2J46A 3FVVA 1W6RA 2EG9A 2IH2A 1R37A 2AS0A 2JC3A 4MPJA 4Y1EA 1JNXX 2CD9A 1QDUA 1XTRA 2QTVB 2WVAA 3AP1A 3L8FA 1TO1E 3X1KA 2H85A 3WISA 1LF0A 5EHIA 1E1DA 3NGLA 4NDZA 2XY4A 2ZJ5A 4WFKA 4G5FA 1VMIA 4NEGA 4NYJQ 5C46F 3NQ41 1U7WA 1MIHA 5AW4A 4B6GA 3K5HA 3AIIA 2XNCA 3B6IA 4JEUA 1A7UA 4M87A 2WA1A 1K6XA 1ZM9A 2VJAA 5FDFA 1JU3A 1SMKA 3DFIA 1KEKA 4BWFB 4KUHA 4R98A 5IBQA 2HN9A 4UU0A 4BQRA 4OAOA 1SBIA 4YO8A 3LNTA 5T4FA 1RT9A 3OQ1A 1MABA 2JH3A 2VBCA 1V8PA 3GK3A 3H2JA 4F2WA 1KEWA 1P7PA 5JNUA 2FN3A 2VSFA 1PTJA 4MP8A 1PE0A 3G7SA 1HE3A 5DNEA 3UV3A 3GRVA 4GZMA 3V8QA 1DRUA 3U4QB 4Q3AA 4Z4CA 2XMCA 3VR6A 2K6GA 1UAGA 4OUDA 3JWJA 2VAMA 4GWGA 2YWRA 2GQ0A 3AEKA 3SLRA 2D59A 4M55A 3VHXB 3F8TA 3PNMA 2GESA 3I0ZA 5KZMB 4F12A 4ID9A 5TQ0B 3STVA 4JT9A 4K9MA 5A1JA 3I9JA 4BMZA 2GI4A 3RKRA 4OAPA 1A9TA 2LTAA 1X1SA 3WRYA 1YCDA 3GUYA 2R1TA 1NE7A 2J08A 1VPTA 2WFLB 2Y1FA 3V4LA 5B37A 1WVMA 1XVLA 2EW1A 3HXLA 2GS9A 4HEHA 5GZ3A 1ZM3A 1JWLA 3VNRA 5LB2A 2BMWA 2W7TA 4Z54A 3ROQA 4O2BF 1SXIA 3QKSB 4TXLA 1JDUA 3OF3A 3ICOA 1I5RA 4QGHA 3I30X 1BDHA 4R84A 4TS9A 2PUAA 2FE4A 1FLVA 4RPLA 1H2WA 4GLLA 3THXA 1G8YA 4ZVTA 5HEKA 3FOZA 2FLWA 3AHGA 4RCZA 3JU3A 3NKLA 3VYTB 2OENG 4DE5A 4BNXA 2QZPA 2HA7A 1Q19A 3JAKB 1MGOA 1E4OA 2FNAA 3KOUA 1DI0A 3HEBA 3NUGA 4IDEA 5DLEA 3UH0A 4AJ2A 5J4HA 1Y1PA 4UHCA 3HFRA 3CNHA 3TLGA 3WYDA 3KFLA 4RV9A 1ZXBA 2B7LA 2PX5A 1K6JA 1PDOA 3IEXA 5DT2A 5CA0A 4CPDA 3TG8A 4HEA1 1X15A 4R71A 4MLPA 3Q1LA 3GHYA 4ZQBA 5ESRA 4ALMA 1YDEA 1XNGA 1KXJA 3HJGA 3I2FA 4I8DA 5KNBA 5ALKA 2QL9A 3CO0S 1ISJA 3ROGA 1DUVG 4R6WA 5LC1A 5DN6D 1OXTA 4AN1A 4N9WA 3DOIA 4HUQB 1U63A 3I6IA 2XCOA 1LLQA 4BMYA 1XR3A 2BISA 2X8WA 2IWRA 3WGKA 1ZD8A 1LPSA 2H59A 1K5HA 1MRZA 2XBLA 3LU1A 3RUAA 1OV6A 2J5QA 3LY9A 5CG1A 1RM4A 3LP6A 2D4AA 1DEKA 3AIOA 4KXWA 4B82A 1NV8A 4EPXA 4PZPA 1AKMA 3IUQA 3FG9A 2LV8A 5KTYA 1YVUA 2Z3VA 4LDPA 3L1VA 1KI2A 2IVFA 3A3PA 2ILVA 3PKIA 4IXTA 2PJZA 4P3OA 4HUTA 3K1TA 2B1RA 1N34B 3EGXA 3UAZA 4LWZA 1H0SA 4O4JB 1X7YA 2EQBA 1MQSA 2HSWA 4HMOA 4P8RA 3ZUGA 5MHTA 4C03A 4LVNA 2Z2XA 3LTNC 2ZI5A 4QULA 2H11A 1LVHA 2CNLA 2HK7A 1ADYA 1ESCA 2WD7B 2DFTA 4QHSA 4EA6A 4EJ6A 5FI5A 1TYZA 3K1ZA 1B3RA 1DAHA 2GKSA 3EIXA 4R40A 5BYBA 3T3PB 4D79A 5IC4A 1GN9A 4DWVA 1ZW1A 2OQIA 2FUEA 3IOYA 2F8LA 3KKEA 3D0KA 4NENA 4C3ZA 1NATA 4YRKA 3H99A 4GKVA 3D8SA 2KJQA 1HDXA 1DLIA 1V39A 2IGBA 2NTEA 5JCPA 5GY7A 1FW8A 1RXIA 5H81A 2Q8NA 2Y1EA 1U3FA 3S7ZA 1Z4LA 2HRDA 1Q1EA 5DISB 1CJMA 3B7GA 2JLRA 3JQGA 4ILKA 2Y1KA 2H6EA 3KG2A 4OGKA 1HG0A 3HKEA 4FFWA 1D9XA 4M7PA 1XL1A 2QM8A 4KV7A 2ERXA 1JWBB 4V24A 1TKBA 1U7TA 2Q5CA 3LT2A 1DMSA 3H75A 4AD8A 3LYLA 1BCRB 4CN8A 2D1YA 4F9FA 3CFYA 2RDMA 4MGYR 3IA7A 1HQDA 1V2GA 3GB9A 4EFKA 3JVVA 3KPJA 1H2RS 1SOMA 1TLFA 3DFFA 3EA0A 3P5BA 3L0PA 3QVJA 2OQVA 3U1TA 4CW7A 4E2YA 2VQFB 1WCIA 2GHTA 3LLCA 1YBHA 1C4OA 2R84A 4Y67A 3UVEA 4G1CA 5C3UA 1T10A 1LQUA 2CK3A 2NVWA 5BNZA 5CIYA 2ZUEA 5DEIA 3U4CA 1TW3A 2EP7A 2GFHA 3QLUA 1T8SA 2QTWB 1OWNA 3A1DA 1A27A 2Y1CA 1NW6A 3MTJA 3LRXA 3EDCA 3B3QA 4Z6KA 2CV2A 5C1BA 1D3AA 1M2VB 1XQ6A 2DFLA 3FFTA 4J1SA 1Z08A 3MWEA 5BURA 3ND5A 2B69A 1CY2A 3QEKA 4NVRA 3BB3A 1BMFA 4TT8A 5L45A 1OH6A 2OGTA 2C5LA 5F9FA 1PR3A 2O0JA 3QYFA 2PNFA 4X8MA 2E37A 2RHCA 2VDKB 2QUZA 2FZVA 4OXXA 2J4CA 3M3DA 3DC2A 3WLPA 4TPKA 4AG6A 1W76A 2GOYA 2G1PA 3BDAA 1SXGA 4DRXB 2XDAA 4QECA 1ESNA 4AJOA 2REOA 3Q7TA 5TGTA 3W04A 4OMDA 1ZAKA 2YJGA 1U7HA 3A3KA 1WCXA 4YMUA 4B7XA 3OLZA 3PCTA 3NWEA 4N3AA 3UJ3X 3EBLA 2A9PA 2V6BA 3E0XA 4MJLA 1MTZA 3KDAA 2X19A 2WVHA 4AJPA 3QNMA 4B7ZA 4A03A 4YJ3F 1Z38A 5J2TF 4I6JA 1D04A 5LZ7A 4AVYA 1NMEA 4YAFA 1JMYA 4AYWA 1OXSC 1U8XX 3A32A 3G2LA 2B37A 1PLKA 1OFVA 1ZYUA 2VAVA 3DD5A 2LD4A 3O75A 3ICVA 5ICMA 3AI1A 2FDRA 3F6CA 3WJ7A 3ISTA 3WIDA 1GYRA 1IXZA 2E18A 2FWRA 3AR2A 1OU0A 2XDWA 3EVEA 4UREA 4L1KA 1JFRA 5HE9A 1KK3A 2ZYSA 4TTIA 4DA8A 3TGPA 3U19A 3T0FA 8ADHA 1KDZA 2PCJA 4YIHA 3P0IA 2HJ9A 2P8JA 5LDGA 3F49S 2JHCA 1OGYA 3MYYA 4NC9A 1RHMA 2JLZA 1EDBA 1KJ9A 1BWRA 4GI1A 4QJIA 5EIFA 1I01A 4I4TF 1XV5A 2WQ6A 3GLIE 3O9MA 5ICFA 3RSZA 1ZK4A 1TZJA 3SAJA 4F9GA 1SZJG 1UC9A 2O8NA 1P4SA 4QRIA 3L0CA 5K6RA 1SVLA 4MLDA 4AY4A 5TMDA 3WL3A 3VOSA 1WUYA 1QBGA 1D4OA 1L5WA 2G1JA 2JD2A 2ZRCA 3CG0A 3ELDA 1OY1A 3QUCA 5GOTA 1E58A 521PA 4CL3A 3Q8XB 5J43A 4QU9A 3QP9A 1LLCA 1F8GA 3U16A 3R0VA 1J1ZA 3ZWNA 1P5RA 5AMXA 2ORWA 2EW2A 1DSSG 1NF9A 2NU9A 2V59A 4AJHA 1K3FA 4YR9A 2G70A 1CWUA 4HYTA 5DTMA 1T9ZA 5BUQA 1XXHB 1LSJA 3OCJA 3RABA 5JARA 1OD6A 5EZYA 3ZVNA 4IHJB 2WUVA 5E7MA 5T8KA 2I67A 5EINA 3TLCA 1PT8A 3LW8A 4FYIA 3IESA 2B1IA 2OZEA 1O87A 4GYKA 4PPQA 1WUHS 2WHQA 5TF0A 3GJRA 3FDJA 5AHRA 4QGFA 4ZT6A 4FSHA 1M2EA 3HQ4O 1RKQA 3I9FA 1QE3A 4A8JC 4QDOA 1XD8A 2FK7A 3FNGA 3LD9A 3GP5A 1ZUD1 3JVDA 3N2KA 3PE6A 4O1MA 5HMMA 2NPFA 4YPVA 1SXQA 1JI0A 2OV1A 2BELA 3C7DB 3JWGA 4ZQGA 2DUNA 4ZQIA 5AW7A 1W9HA 4Z3DA 4LXIA 2XBUA 3AERA 3B6EA 3TNLA 2B8NA 1XTKA 3P19A 2XWBF 4OQQA 1M0TA 2Z4SA 5ALTA 2XKBA 2VHEA 4TXMA 3OOJA 1ZXLA 3GMSA 3JZIA 4HNHA 3T06B 5KTTA 2BRUA 2Q1YA 3WYFA 4D5EA 1GZHB 5AUPB 1JT2A 1N6NA 4QODA 5CR9A 1CEXA 2AUTA 2EZ8A 5IYZA 5KX5F 5AW6A 1E9RA 3JQPA 3QWIA 5TPZA 1AS2A 3TIVA 2WTBA 1T0HB 1CVIA 2BTQA 4YA6A 2BBOA 1VKNA 3TSAA 3WYGA 4Z7OB 1EM6A 2XUOA 2G8NA 3K53A 5EE0A 4WXHA 4PGMA 3IAM1 3PQ6A 5C8VA 1T15A 2WABA 2D2EA 3I34X 3R7FA 1QP7A 5DYWA 2HHJA 2QE6A 1HORA 5I7FA 4X66B 2WAOA 2AK2A 5CMLA 2P3OA 2R8PA 3TL3A 1G9TA 4PINA 4C7KA 3GAMA 4PZDA 4YB8A 3RYHA 4E33A 1L4LA 5FNZA 2V6GA 1R64A 1BXRB 3A10A 2IC5A 4TKMA 2YHAA 4BLVA 5JEDA 2PX6A 2O1WA 3FDZB 3BF7A 2ZTHA 1SXJD 3IAFA 3BA1A 3OX1A 3QWFA 4G8BA 3QLEA 4INOA 4MXDA 2HHCA 3OQ6A 3PEYA 2IYQA 1PG2A 2ZYTX 5FBZA 4DRZA 3SKYA 1G6Q1 1T3HA 1HH4A 2DP4E 2JI9A 4M0LA 4OXKA 4PCUA 4CMCA 5KYTA 3FSJX 3G23A 1X87A 2XZPA 4FZRA 4H77A 4H4DA 1N2EA 2PZFA 2R6FA 4FHZA 2C1XA 2BFDA 2G0TA 2HC9A 3TLBA 4XCXA 3G2QA 4Q1DA 4LN1A 2B98A 2YRXA 3OX4A 1UOEA 2FW0A 2PGAA 3IJEB 3B52X 1UJ5A 1CDDA 1LWNA 1UK6A 1RS0A 1HQYE 2FSVC 1MJGM 5HE8A 2QN7A 1JEYB 2WDPA 3E7XA 1FXWF 2NQ8A 2XNSA 4RXTA 5E6SB 3ENWA 4HH1A 4JKOA 1VLQA 5AR1A 3K0AA 5KYWA 1GTRA 1A5SB 2JLCA 1FFWA 1M1NB 2CLIB 4ND4A 3VOBA 2WT8A 2FFRA 2GUWA 2Y4NA 1QYVA 1CVLA 3G8CA 1MT0A 4MWCA 1N6KA 4P84A 1LRLA 4V0LA 2GAIA 4JL8A 3JZAA 4Y0NA 5H3HA 4QARA 3HCPA 4XQ9A 5I9MA 3H2BA 2YYYA 3SVZA 1F2TB 1ZCJA 5BQOA 3PXDA 1W52X 2XODA 4PICA 3KQMA 3ZI4A 4WZBA 3FRJA 3HABA 2EF1A 2JZNA 2QZ9A 1JWAB 4WN3A 4AKIA 3O6VA 3STXA 3BILA 4JJEA 5CFPA 3PX2A 5FUXA 2VRWA 3RG8A 1NOJA 2FR1A 3U80A 1RRKA 2N3ZA 2AQHA 3C6MA 4JI1B 2QTGA 2YZ2A 1YA4A 1NJFA 1VIYA 3LUBA 4WCFA 3R40A 4JOBA 1UM9A 4FFBA 1AKWA 2BYTA 3I5UA 2IZZA 1G3UA 2EFGA 4BIIA 3RPEA 4YAIA 1ZMBA 1Y4ZA 3QVVA 2VEOA 4ZANA 3RVRA 4CIWA 3R5SA 1SVSA 3MJDA 4S0ZA 4WPGA 3VBEA 1E8MA 3ZBUA 4YMVA 5EJEA 3GBPA 2F59A 3M3HA 3X1WA 3E35A 4RZQA 4DMKA 2BHTA 5EQDA 3UW3A 1VBFA 5HOEA 1VL8A 4M88A 2A14A 3GDFA 2YHUA 2ZPTX 3E70C 3REQB 4EG0A 3GLFE 4JH0A 4TWAA 3RHSA 1RE1A 1E94E 1T0JB 1PFVA 2QVZX 4PYRA 4RKFA 3VGJA 1GGKA 5I4BA 2ZIXB 4PHHA 5BQPA 2IHNA 1OHHD 1L8LA 2FSGA 3T54A 3GFFA 1J06A 4FD2A 2R8EA 1YJCA 1P6QA 2OXFA 3IBFA 4HUJA 4ZDWA 2PY6A 4F1WA 4CF7A 2CT8A 2HJGA 5JWHA 3H7IA 4DQ0A 2D0OB 3CZPA 3ETLA 1PKEA 1HO3A 1MOZA 1SUFA 3KD2A 4DCMA 3V9AA 1M54A 1UKEA 1K7SN 3QI7A 4EFMA 1O5TA 1RXEA 4HNRA 1W35A 1ACMA 2GYVA 2Z5LA 3C14C 4UC0A 3EOBI 2V3VA 4DDTA 1FMLA 1JIQA 1GCIA 2CNDA 4EYOA 1IG0A 2DH6A 4QGAA 1SOAA 1KI7A 3NNDA 4RFSA 2GKOA 4E7PA 3S1SA 3RRBA 2I62A 4N0PA 1GPKA 4X9XA 5IANA 1DHRA 3Q3CA 4LQDA 4BE9A 1NA5A 2NV2B 2ZPAA 3VX4A 3KC2A 4GI2A 4CGZA 1HMPA 1NP7A 2DWPA 3ED5A 4FFDA 4OGWA 3HACA 3LC1O 2RGXA 3JD3A 4Y6GB 4UOQA 5DSTA 1Z6AA 4DEVA 4DM7A 4A6EA 4S24A 2VF7A 3PA8A 4G26A 4I14A 3RVOA 2J5XA 3DDOA 3M3PA 4IINA 4MPDA 1BRTA 4HZIA 4OSOA 2X9VA 1JJBA 1DB3A 1EGHA 3TQIA 1AA6A 2VDNB 2BPOA 3GXBA 3K6SA 2WE8A 1BVHA 3BK2A 2LRHA 3K0CA 1AZSC 1H8HA 3N05A 3ORQA 1ZGAA 2ZQ5A 1KVQA 2GO1A 1G3IA 1FTWA 3D4OA 3V34A 2OAQ1 4BN0A 1P73A 5KHAA 3UEOA 1WPRA 3F46A 4K9PA 5DWVA 4CLRB 2H06A 1OREA 3DZ8A 4C30A 3QFCA 3RBXA 3LWZA 3R7SA 2W2LA 4PHGA 1HE4A 2GRUA 3NPAA 3PT5A 5JAUA 1FDRA 4TKUB 1T8YA 5J9FA 5KIAA 3F47A 3FPFA 5IARA 4JOSA 2NU8B 4DR7B 3BWDD 5C53B 4L9AA 3UA3A 1E1NA 2OZLA 3K72B 1PGPA 1R6UA 1X7ZB 1EWVA 2QN8A 3TW6A 1R88A 2AOWA 3ZGZA 3EMBA 4H1VA 2X86A 4JYAB 2CMFA 3PZRA 2I4OA 3HHEA 5HIJA 3AOEA 4UVHA 4NH4A 1J25A 5HJEA 1P2UA 3L0BA 3LHDA 1XTSA 2JFHA 2GA8A 2XGMA 2NZJA 3BWEA 4KXFB 3L7KA 2J67A 1OYVA 1U9ZA 4XX0A 1HKUA 3LF2A 4YLYA 3EPJA 2C78A 3JQAD 4Y2JA 3KR2A 1WO8A 3FYUA 2PKCA 2XV1A 2NO9A 1JDSA 3HXTA 4JMLA 2Q28A 2GF2A 4MI3A 1NXTA 3KDSE 1JA1A 4K6CA 1FXSA 3KYCB 4JT4A 4I1PA 4PSKA 4YK7A 1RZRA 2J9XB 1IDOA 1BWPA 3M0EA 3NP7A 3R7BA 2O8DA 5DX1A 4AWBA 2BGGA 1JIUA 4PR0A 1T1RA 3IS3A 3AVOA 5AVWA 1ZCAA 4JEHA 3K3PA 3H8VA 3ENNA 1QX4A 4QVGA 4J9UE 1D4AA 4KDCA 3OIDA 3E9CA 4LHWA 1MJNA 4Q47A 2Q3JA 2Q3LA 2ZB8A 1YRYE 1JJFA 5FPPA 2C2BA 1U2PA 1E6LA 4M37A 4PO9A 3C3JA 3ZV6A 4FHEA 1NULA 2HV9A 3AFOA 3EXHB 3RBZA 3AJEA 2G40A 3WB0A 5H80A 2C94A 1XJ5A 1LQTA 1XT6A 2NZUG 3O0TA 4C0LA 4UBKA 3IDFA 1NVBA 1ZONA 3K09A 3IILA 1ID1A 3KK0A 4Z9XA 3VGPA 1G21A 1TUIA 4O2RA 3UQYS 3DOOA 1G7SA 4BYMA 2CLHB 1BXRA 4M99A 4NCIA 1JG2A 4DA6A 2IVZA 4CNQA 2AOVA 4CM4B 2HJSA 3O8OB 3WRXC 1UPBA 4OP3A 3V7YA 3FY4A 3GIWA 3O91A 2I2XB 1UXKA 1UBNA 1XMQB 4UMVA 5DDIP 1W36D 3QXSA 2WUFA 4IUYA 4RWEA 1CDZA 1V35A 4MV8A 1GQFA 3UCFA 5EPUA 2QRUA 3SICE 3O93A 1TK2A 1ZOPA 1FX1A 4LSZA 4WCVA 2FPUA 5JLJA 2R8BA 5ILQA 1E92A 5AVQA 1HA3A 4DBLE 1NRJB 2A5FA 5ARBA 5DNVA 1QC5B 4L75A 4QM6A 3TIFA 1ST2A 2AX3A 2IF0A 1F2UA 3M4JA 3DNFA 2A1TR 1A2QA 1JI3A 2WJJA 1KSGA 2BEVB 4EUSA 3M1YA 4RA9A 4RKRA 1D1SA 3PS9A 2I6UA 2EZUA 2WA2A 4J7XA 4ZD6A 4DB4A 1Z7BA 1E7YA 4MYDA 4RKQA 3PUZA 3FYCA 3CR3C 3EUFA 3BX1A 1CIJA 3CIOA 5HCNA 3W8FA 2VFAA 5CK5A 4EHLA 5L8VA 3FROA 2WJVA 1QAOA 3MM4A 1DXQA 4KJZA 3JR3A 1OB2A 4J29A 2HXGA 4DLPA 3M5WA 4M49A 4MR7A 4WK4B 3DPUA 3RRMA 3M2TA 1GA6A 1GRVA 1PR4A 1CY0A 4OQYA 5HQ3A 2FF7A 2IS1A 2GCGA 2XMRA 3ZZ0A 5D3MB 5JROA 4RJKA 4B75A 4DV0B 3QTTA 2VO1A 1E2JA 2ZYDA 2Y0BA 3QEJA 2GJ9A 4I9NA 4IV5A 3FTQA 2JBWA 4UHKA 3FRIA 5F1YA 2QMEA 1YQ9A 4ZC8A 5KVQA 5DLQC 2PRIA 4CKYA 1GG5A 4O4LB 2YN0A 3TLXA 3ASUA 2RARA 2WJGA 2CEKA 2GK6A 2YASA 4WZAA 5DN6A 1AS0A 2KSQA 1LTQA 2CWDA 10MHA 3JQ8A 1NT2A 2FRDA 4HXGA 2J3LA 3UUWA 3EWSA 4DMGA 3L6BA 4BNZA 3BB1A 4QYIB 5LQRA 3KM0A 3RGWS 2O7VA 2FZWA 1TLTA 2OG2A 3IQDB 2Q21A 1PRYA 4LDQA 3HY4A 1NASA 1YS2X 2ZJZA 3U3ZA 2E5LB 1IDN1 4N8DA 2DLNA 1IEVA 2FRXA 1R5BA 1JAXA 4WT7A 4KXNA 3X2SA 4UXIA 5KJFA 2Q6OA 3U4DA 3TRKA 1CVRA 2OXTA 3AETB 3N2LA 3DLTA 3D43A 2NUAB 4WOBA 4OX9B 1VPLA 1H6DA 2P9ZA 4F9TA 1QH8A 3W2EA 1OCEA 4MS1B 1H85A 4EJFA 5TT0A 4R3WA 3RF7A 1H4SA 3SX2A 2WF6A 3CVJA 3GIDA 5EYPA 3RVQA 1IEQA 2MIIA 5BT9A 2J9FA 3KWFA 3O4GA 5C1IA 2UKDA 1JAZA 1YQWA 4OJNA 4RKEA 3UV7A 2X1LA 5DT9A 3OLCX 3V7FA 2G76A 4GUDA 3TYXA 1IZYA 1C2YA 3S1AB 3H7AA 3IP5A 3WGNA 1SKUA 3SHWA 3WV4A 4DJJA 5KYGA 1DGQA 1V2HE 3AHEA 4HWSA 3DTVA 3PFKA 4EI7A 4PGHA 5C3MA 1GNTA 1IFXA 4TL8A 4Q1EA 1GZVA 1FUYB 4W5RA 2AUNA 3V1NA 3IQHX 3K70B 4B85A 3L84A 1X9HA 2YWCA 2BFBA 3QU2A 5EXTA 5B1SA 5BR1A 2PBRA 1N92A 1Y63A 5DGCA 2O59A 1EB8A 2ZBPA 2JAOA 4JYMA 5E1OA 4BU0A 3IE2A 2RH8A 2BKVA 3DAHA 4MI6A 5IABA 4U6QA 3CRQA 3K0HA 4ZFNA 1FYWA 1PL7A 2XE4A 3WIUA 1OMOA 1ORIA 2YWGA 1BN6A 2WILA 1TA9A 1QU3A 3U7GA 1E3DA 3EXAA 1ZRNA 1A8QA 2C8KA 3M6LA 2G4CA 1WUTA 2RJ3A 2JCGA 3GT3A 3LBHA 1Y7HA 4L15A 4Q4HA 9ABPA 5KVVA 2GZMA 4ACAA 1JHVA 1H0KA 1BC5A 3LYUA 4REQB 2WM8A 3SZOA 2CNWD 3LDGA 3HO1A 2VQDA 4X6UA 1X7ZA 1A5BB 3DBVO 1ACLA 1C3XA 4RACA 2PZJA 4EX7A 3C5CA 4EVIA 2GN6A 1Q0LA 3F71A 3ZJ5A 1SJ9A 1T36B 5FLXA 3AO0B 4UU8A 1KZ6A 2JGDA 5EJ8A 2DHEA 3WL6A 4CQMB 3HCBA 3QQPA 4AIIA 3L93A 3ELYA 4OL0A 3ADPA 1OJLA 3AU9A 3CURA 3DXFA 3F0TA 4RDIA 4R01A 3RFFA 1AUOA 4ETNA 2QN1A 1PBTA 2QTAA 1QGUB 4PCVA 2BGIA 4JKYA 4JJKA 3O9VA 1ZI8A 3P2KA 4YRFA 5KAPA 4BNMA 1DWUA 5JWOA 2PUCA 1NFFA 4R05A 1Q7GA 5ALGA 4F6RA 2H29A 4ED9A 4B4VA 3NGXA 3AV3A 5KHOC 2P30A 3ZWCA 4UTRA 1KQGA 4EMSA 3QWBA 4KAAA 5E6UB 1THGA 3DBHA 3H11A 3NG1A 2FZ4A 3QRWA 5SYNA 1FFDA 2PSHA 2W2MA 3B2EA 1SEPA 1D0SA 1MH9A 1SKAA 1M72A 1X2EA 4KIUA 4RZSA 1MVLA 2O2ZA 4XVHA 5B3JA 2ATXA 4DTIA 3NAZA 4EK9A 4YXWD 1SRRA 1JBQA 3RC9A 3HUDA 4X1IA 2FKAA 4DG8A 1C9JA 3EX7C 4O4HA 3SHTA 4B3CA 1UP6A 5CK4A 1QHHB 1Z4KA 2TS1A 3BICA 3KFVA 5H5JA 2EHDA 3M34A 4DWOA 1KIMA 3C6BA 4PFSA 2DAPA 2VAXA 3FKQA 4Q4LA 4DY4A 4EY6A 4OYYA 2QAGB 4C2UA 1C2TA 2NXJA 2ZJYA 3IXMA 4YRNA 2W70A 5G0SA 4EG5A 3HV0A 3CKYA 1LSUA 1W59A 4DWWA 1J0EA 1H5NA 1XI2A 3HCRA 3O94A 4HSEA 4KSYA 5LOVA 1C8LA 2PS3A 3FUWA 3O4HA 4ASUA 1U6KA 3GVIA 1LD3A 4XFDA 3H4IA 4Q9NA 2VHVA 4ZP1A 3EXG2 5DB4A 4DSUA 4R1LA 1CNFA 2XVMA 1BGWA 1ZICA 1TJYA 3FLAA 4G4IA 5M7EA 1KSFX 2F00A 4BGIA 2O5RA 3GEDA 1Z5OA 1K0UA 5CBPB 1NKVA 1QHGA 1QRRA 2GNOA 3EIQA 3OP4A 4B73A 1WSDA 4C87A 3KUDA 2ZRDA 2FR0A 2J6HA 1T6NA 1T1GA 1UFRA 4TROA 1A7JA 3QKRA 1J00A 3HA5A 2O2CA 3UTCA 1DWOA 4WADA 2G08A 4BLQA 4D43A 3UH1A 3URKA 4GYJA 3AEXA 3WBFA 2V5VA 4HTAA 1XCLA 5EPOA 3VDRA 1VL1A 2B34A 2D8MA 1NUPA 1R0SA 2WJ3A 2WU1A 3KCNA 3L07A 3I72A 5CLLA 4LMBA 5G1PA 4NE7A 4P9NA 4G4SO 1GL9B 1BVUA 4R8LA 2ZM6B 3H19A 2B5WA 5AVYA 2XHEA 3HKCA 2CV1A 5K01A 2ZWIA 2FFHA 4FZVA 5KYXA 4WBNA 1IJFA 5ALXA 1GTL1 3D7NA 4HDRA 4U2EA 4AW9A 4BATA 4LC0A 3IMFA 3FCXA 4D80A 2DHRA 1SEVA 2FWAA 4FOPA 3BH7A 2QVBA 2CL0X 4AC9A 4IKEA 2DFKB 3GWZA 4NHEA 5DXJA 4AIRA 3WKCA 3WK6A 3D8TA 2HYIC 2JFWA 1ID8A 1I2MA 4Q37A 1SIBE 2RJOA 3D6AA 3IP3A 3ZK7A 4I99A 2QQ5A 4PQRA 2O6HA 3MJHA 4CMEC 5TC4A 4HH0A 1Z45A 3BIWA 1OW3B 1SCAA 2ZTSA 3NOXA 1MPXA 4L57A 5BVHB 2B94A 2HZ7A 1TK9A 1R4NB 2NLOA 3AILA 4Q4JB 3C70A 1Q3HA 1ZXXA 5I5GA 4QTXA 4EKNB 1NXQA 1XRMA 4EA9A 1FQKA 1YIDA 2ACEA 4RPKA 1X1RA 2CFOA 3WSTA 4BU1A 4QDTA 6GPBA 2IS6A 3N28A 5LQKA 2IU3A 4QYIA 2JAPA 1P6UA 1XA4A 2FDXA 2Z1NA 3BKWA 4N1AA 4E30A 1FQOA 4DFDA 3R6WA 1JYSA 3A6HA 4NG4A 4UZEA 3N74A 3EFOB 5G3ZA 4GM4A 4D6YA 4YRGA 3KQHA 3DBLA 3D6VA 4MK4A 4ZU3A 5J4YA 4W5WA 5I9NA 2B9VA 5JASA 3OQBA 1RBYA 4BLOA 5I7VA 1A9ZA 3COWA 3N5CA 1EVEA 1Q95A 1E2MA 2ECFA 3ODGA 5EWMB 2D7CA 5L7TA 2FPPA 3AETA 1Z26A 4PIVA 2ZETA 5TMBA 4Z9YA 1O2DA 2JAQA 3SXPA 3GYBA 4F38A 3DO6A 3TSOA 4BRSA 2H5IA 4X1KA 1TJNA 5LA6B 1SXJA 1DC4A 4QJ3A 4CTOA 1C29B 1JHUA 2VYVD 4X7RA 1SR8A 1TQ8A 4MZXA 3FBWA 5JXGA 3DKVA 3M33A 1IONA 1QXSA 2R7KA 4GC9A 4GMHA 1JR6A 4ARCA 2ZWPA 2BVNA 2WJ6A 1LC3A 2IQ5A 4PQEA 5JCJD 4JYBA 4DCCA 4G0NA 3ROZA 3C3WA 3OCUA 2IQIA 2C4KA 5D6NA 5HF9A 1SCDA 4EA8A 1JHDA 1V7QA 5IAGA 4UEWA 3LP8A 4QO8A 3TZBA 4MVWA 2W6OA 3W5DA 2ZJAA 1GUDA 4GZ3A 3T99A 2QRLA 4Y2QA 2J6CA 4UBJA 1G4UR 1G5RA 3KQWA 3QU7A 1UK8A 4TLCA 1W88B 5ARCA 2GD2A 2C3MA 1XXHE 1W73A 4JNKA 3ZLUA 2R8YA 5G4KB 1E5QA 2CF6A 3UPUA 3ROKA 3E22B 2HWWA 3MCUA 4RVDA 5AQEA 4NFYA 1X1DA 5JRJA 4QJ5A 5D00A 4D0RA 2H16A 4M9XA 3GHHA 3VR6H 4G0UA 1TECE 2WIFA 3DVLA 5LUAA 2IV3A 3CO5A 4H7FA 3NAQA 3CSDA 3T7CA 2B4AA 2XECA 4U2GA 5BSUA 1DBSA 4B34A 2QBYB 2JA2A 1VLVA 4LNAA 3QEOA 1OILA 1DAGA 3C8UA 4N5NA 3WHKA 4CIBA 2CKMA 2PL3A 2O0MA 2YVQA 2V5UA 4NCAA 5FOQA 1RMTA 2HLNA 2R86A 4OKNA 2SICE 4N3CA 1LX7A 2VPYA 2NUPB 2HO4A 5EZSA 1P6XA 3C97A 3N76A 1HYQA 3EN0A 4LE0A 4ZVSA 4E21A 5KU1A 4E5VA 1G16A 1KI1A 1KU6A 2MYUA 1HDEA 2VSQA 4V1CA 2P5UA 5CLJA 5LQDA 1XZCA 2DVMA 3OZEA 4KVFA 3WNVA 2AEMA 4B80A 5CFOA 4P36A 2BF7A 2Z0MA 4G5XA 1O08A 4C89A 1PU2A 5K3SA 4CL2A 3FNEA 4KYVA 1SVOA 2VDRB 5E6UA 2XE8A 4BV2A 4DARA 3ZDBA 1YO6A 2H0AA 2XMDA 3BE5A 3G0CA 3LUGA 1TEVA 1U2DC 1GEGA 4JC5A 3H18A 3CVYA 4L5BA 1FMCA 1OHHA 5GAJA 2C0QA 2Q3MA 2VAPA 3G0GA 3UKDA 3B3AA 2G77B 5T5QA 2GK4A 1Y6ZA 3KVOA 3EA5A 1KU0A 4DYHA 2G8LA 4KN8A 4KGXA 4P4NA 2Z57A 1X38A 5K3DA 3TRIA 4B8YA 2V9PA 4FZ3A 4CT5A 5B7PA 3W6UA 4D9CA 5KNBH 3CNBA 1L7DA 4KUGA 2W4QA 5CIWA 1JKXA 3CH7A 2PL5A 3OBIA 1H94A 1FP1D 1NUSA 4LSGA 4HO1X 3T5GA 1XA3A 4TM8A 4IQ0A 4G5YA 3NLLA 3R9XB 3EY4A 3O8QB 1K86A 1T6BY 2PQ6A 3RSOA 2O7RA 3BGOS 3KT8A 4AF8A 5IAAA 2YX1A 3BXFA 1EJ2A 3F1LA 1AZWA 1OQAA 3L7BA 4KK4A 1T6YA 3TZHA 4CM1A 2Y0EA 3IQIX 4PE5B 7REQA 3BTOA 1Z8NA 3R77A 4Z0HO 3PTLA 2R79A 2VH2A 2E85A 3B3FA 2AWOA 1U4OA 4ZOLB 1EG7A 1FP4A 3WS7A 3FPSA 2LDXA 2GZDA 1K9SA 1G3MA 1X1TA 2ZE6A 4JI0B 1EWYA 5HX7A 2REQA 3MNFA 4F56A 3W05A 1R0WA 5DXAA 4QPZA 4ND5A 4QXAA 2EKBA 1GRNA 2Z8XA 2JDID 2I99A 4FWTA 5FAXA 2A4KA 4I50B 3LUHA 4W8OA 3TDNA 2F3RA 1G0OA 4D8WA 2AT1A 2J6BA 4H7EA 4OQDA 3A7EA 3UHFA 3D4BA 3GP8A 1A0OA 1QGZA 3DZCA 2NVUB 3VXKA 1W96A 3WDSA 2A8YA 4FBGA 3AWIA 3FFWA 3ACBA 1NMSA 4B4WA 4EO4A 3KO8A 1U7DA 1W34A 4P38A 5GVRA 3UB4A 2WR8A 3IP8A 4ZPXA 3RFTA 5EMJA 1O03A 1NQTA 3PXEA 1WLYA 3HDQA 2ZS8A 4F5ZA 1IY2A 1UK7A 2CUNA 4W1SA 5KJCA 2MSCB 3Q11A 3AKYA 2IEIA 3KKQA 4D9JA 1ODSA 4J0IA 2Q99A 3CZ9A 1Q1AA 5KS2A 3WZ2A 2BWJA 4OHYA 3SPXA 4BBPA 2DERA 1X80A 3BH6A 3WWYA 1SC9A 4C1BA 1ABBA 1G7CA 3EZ9A 5LN1A 4NV0A 1V5IA 1KMCA 2F4NA 3FPKA 3GQBB 1S8OA 3QMVA 4Q4JA 3UJPA 5LXTB 1Y8ZA 2VRBA <