2F1RA

Crystal structure of molybdopterin-guanine biosynthesis protein b (mobb)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
148
Chain Sequence
LILSIVGTSDSGKTTLITRMMPILRERGLRVAVVKRKDSWKIYNSGADVVIASPVKLAFIRRVSEEEGNDLDWIYERYLSDYDLVITEGFSKAGKDRIVVVKKPEEVEHFRQGRILAVVCDERVDGHKWFRRDEVERIAEFILSLLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords molybdopterin-guanine dinucleotide biosynthesis protein B (m
publication title Crystal structure of molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
rcsb
source organism Archaeoglobus fulgidus
molecule tags Biosynthetic protein
total genus 47
structure length 148
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f1rA00
4JLOA 3QEOA 4DRZA 5J5CA 4K8OA 4A8JB 1KI6A 2JA1A 1N5JA 2IYXA 3WMGA 2IS2A 5KSPA 1Z2CA 3QXJA 2H57A 1M7GA 2XSZD 1JECA 2YKGA 1LTQA 3NHAA 3BH7A 1SXJE 1UDXA 1XPUA 1R0WA 1ZD8A 2J9RA 1BMFD 1N6PA 3G5UA 1G41A 2FSHA 4O0MA 2Q3MA 4A6XA 2RKOA 4JLNA 1LFDB 2J7PA 2BWJA 3GP8A 4RVCA 1CJUC 4AKGA 5CK5A 2WWWA 1FUKA 2UZIR 2NPIA 4CYMA 4A0FA 4M1TA 2Z4RA 3B82A 2NMVA 2ZPTX 4M9SA 4NYIQ 4FWTA 4DIDA 3WHLA 3PUVA 5JSZA 3NTUA 4CVNA 2J7KA 1E79D 3LQRA 2QM8A 2TMKA 4UQOA 4QHSA 4WIAA 4JS0A 3T12A 2ZUDA 1G3MA 2CK3D 5L3SB 3UG6A 5IHPA 2QPTA 1W0KD 1W44A 4LV6A 4M9QA 1OH7A 1HY3A 3EZ2A 3L8YA 3LLUA 3FHTA 1AZTA 4S2EA 2XITA 4P4TA 4LSGA 5TB5A 3WRXC 4J0QA 2VHJA 2QSZA 3VNVA 1K5GA 4B3DA 3EAQA 5C4GB 1Z83A 1IXZA 2ECKA 1IM2A 2HLDD 2V6IA 2V1XA 2XEXA 1YQTA 4WAUA 3ZVMA 1MKYA 5FL7A 2J45A 3MFYA 3KZ1E 2HT1A 2P6UA 2FOLA 2O8EA 4HLUC 1YVDA 1ZNXA 5C4MA 4BEJA 2DYKA 5KTYA 3BGWA 2RB4A 4FN5A 2VP0A 1R2QA 1ZNZA 4NP6A 2BCJQ 3OE7D 4RD6A 2BM1A 2OCYC 2W2TA 3W90A 1KKLA 1IY0A 3NBXX 1AQUA 1JQJC 2CJWB 1VIAA 2VSFA 3AGPA 2JLYA 3HR8A 2Z0MA 3LA6A 1VCNA 3U3JA 1X6VA 1XTKA 3CUEF 3QG5A 3GFTA 4GL2A 3KTAB 3VR6A 3NBFA 1AA9A 1E2EA 3X1YA 4A0GA 3I92A 2G0TA 1YR6A 1R0XA 1GNRA 3GJ3A 4Q1CA 4Q48A 5KOYA 3QUSA 1JAHA 1ZBDA 4Z8XA 1NMZA 4TSFA 5IDVA 2YC2C 5FOSA 2C9YA 1ZVQA 1KZGB 4RD0A 1ANKA 1WA5A 1Z0KA 2Q9CA 1DAFA 4WOPA 3MWLA 4P0TA 1XD2B 1QHXA 2YWHA 1Q1ZA 3PEUA 3W9YA 3LW8A 4JKIA 3SYKA 2WJHA 4XWOA 2BDTA 3DO6A 2CBZA 2JLZA 4C0HA 2FN4A 3S1AA 4XWAA 3EPHA 1OH8A 3LXRA 2ZI9A 4OHXA 2D2FA 2A9KA 3TQFA 2RGDA 2QBYB 1NY5A 1P2SA 3KJHA 3QXXA 4RSGA 2ZUBA 3IPYA 1BH2A 1G17A 2BMFA 1TNDA 3CRW1 1BO6A 1M34E 3CNNA 3CX8A 4TLDA 5GADl 1XJQA 1IQPA 3PUWA 2QN6A 4DHEA 4DDWA 1V5WA 1XXHB 4BEBA 3NBYC 4EFNA 5CM9C 4JLDA 3IIMA 4Q9IA 2IEYA 1PLLA 1NKTA 2B8WA 2DCUA 1L7VC 3TSZA 1KMHB 2WPDA 2ZS7A 1AQYA 2NTYC 4NHOA 2GK6A 3RS2A 4LHYA 2GZDA 1J7KA 2VL7A 2QG6A 1KK1A 1NVWQ 1R0YA 1RRFA 2ZI5A 3AVOA 4LPKA 2OZEA 1W46A 3OF5A 4B2LA 3NC1C 4JLMA 4JZKA 1Q20A 3KB1A 5JCPA 4M9ZA 1X8JA 3X1DA 5HCNA 1GITA 4DIEA 4EPRA 1Z29A 1XF9A 1IXRC 5IT5A 2FPKA 5L3VA 5AUNB 2C98A 1KYIA 4M0LA 3V9PA 1FTNA 2GVDC 2G9NA 2JLVA 2O8DA 3A1WA 1OPXA 2J7PD 3U3OA 3PG5A 5B30A 4EKDA 1GG2A 2WAXA 1ETUA 4HZUA 4URWR 4ESVA 4JBYA 2KI5A 2ZI3A 1D2EA 4V0NA 2ZANA 1NJFA 2X8AA 4CEJB 5G53C 1NLZA 4Q00A 1W49A 4D26A 1Q1EA 1G19A 4TZ6A 2P67A 1G9XA 2ZRKA 4XSHA 1NSTA 2DFKB 2ODEA 4L16A 4ERNA 5EZ6B 5F9HA 1I4LD 1E2MA 2QAGC 2Z5FA 3QI2A 5B2ZA 1SVOA 4D4KA 2HYIC 721PA 3H84A 2LKCA 5CB6A 1GTVA 1J2JA 1HUQA 4DSTA 2G0NA 5DE3A 3R9WA 2FFHA 1ZIOA 4X8HA 1LW7A 1II8B 5DN6A 3GLHB 2G83A 1E32A 1U90A 3U3RA 3R7WA 5TY0A 4YMWA 5EZ5A 1OW3B 3T1QA 3HYRA 1E2JA 5FL7D 5H1YA 3MSXA 3P20A 1XXHE 4HI0E 1J90A 3T1VA 5DI3B 2O8FA 1VCMA 1FQJA 3BB4A 2BJVA 4K81B 5JJLA 1G6HA 1N6KA 1XEXB 5BN3A 3T34A 1WDTA 3D7MA 4A9AA 3OIYA 4OQXA 1VG9B 2FU5C 3U44A 2GF9A 4LI0A 4EPVA 2NOAA 3KKMA 1XNJA 5HPYB 4JMPA 1JR3A 1CF4A 1NJGA 1TTTA 4GSYA 4U5XA 4LHWA 3VR3A 2WAYA 3THXA 4Z8YA 4XSGA 2KSQA 2PT7A 4Q66C 2MSCB 4LJ4A 2OAP1 2GWHA 2X19A 2VSOA 3QOFA 3VTKA 3K8YA 4JYCA 4TSFD 1OB2A 3F3YA 4F92B 4QHTA 5KU1A 1AKEA 1ZM2A 3CKLA 3NEYA 1RJ9B 4RKFA 3KQHA 3ZZ0A 4HAWA 4MRPA 4CGZA 3ASYA 3FYHA 3VKWA 2QUZA 2J0VA 3K09C 5BW8A 4Q1DA 5KNDA 4RZUA 1Q1BA 3QKSB 3AUYA 4A92A 4I81A 4DCNA 4PO8A 3AVYA 2KBEA 4E09A 2IHYA 2OEPA 5HE8A 4BLRA 2C99A 4KI0A 2UZ3A 4HUTA 2ZSFA 2IWHA 4BUJA 1KSGA 3Q72A 2ZYTX 5H70A 3U7GA 4IVQA 4PZLA 3QXCA 3RC3A 2RMKA 2O8BB 4OK3A 3X1ZA 4QGFA 1I4TD 3ADCA 5FH9A 3EXAA 2XTNA 2N1BA 1FX0A 4IJMA 3GLHE 3B1VA 4OJQA 1Y63A 2BM0A 2R2AA 4Q7JB 4JKYA 2NO6A 1QZXA 1R7RA 1UBFA 4X8LA 2GKSA 4LYJA 4UNRA 4WA7A 1F2UB 5JHHB 1SVIA 1P62B 2R65A 3Q7QA 4MKIA 3K0EA 2WPDD 1EXMA 4N1AA 4PQYA 4P31A 1CR4A 4PC2A 3WBKA 1YKSA 4OK5A 3REGA 3RS4A 4B6FA 2YOHA 1E9BA 2YJTD 4JLPA 3RS3A 4QHYA 4JVMA 4TL8A 4NDZA 4V0ME 3AM1A 4UKDA 2R6DA 2QY9A 3PEWA 3CRRA 3T1TA 2F9LA 1M1YE 4IVPA 2B7CA 3NVAA 3DHWC 1CIPA 2Q21A 4FMCF 4OQLA 4F38A 5JBQA 3B60A 4NBSA 4IHQA 2QNRA 3HPRA 5E7IA 1ONBA 4Z54A 1U8ZA 3RYTC 5FUVA 3AVWA 3E5HA 2CVFA 4NYJR 4Q1BA 5F3WB 2FDCA 3EPKA 4LX0A 1SQ5A 4Q1AA 1G16A 2PMKA 3WY9A 5FBLB 4P33A 2AD5A 2ASEA 1UEJA 3IBYA 3AKCA 4BPBA 4LBVA 1RRCA 1RIFA 1JPJA 2ZREA 1ZUHA 3C5HA 1Z6YA 1NKSA 2H92A 1AN0A 3NG1A 3CPJB 5DO9A 5A4JA 1NMXA 1NBMA 2VTKA 2ZSBA 3SFVA 2UVQA 3FFBA 4NYMR 2DHRA 2E87A 4XWKA 5DN6D 4JT4A 2CL6X 4B73A 2BBSA 2V1UA 4US0R 2PT5A 1GZSA 3L2OB 3NH6A 1N2CE 3KJGA 8OHMA 1N6HA 2BEKA 3T5GA 2EFGA 2QRZA 1KAOA 2OV2A 3Q9LA 3CPHA 2GCNA 5FOUA 2V7QA 4OBEA 2X2FA 1FP6A 3B7GA 4WZAE 3WMEA 2WTUA 3KDSE 2NO1A 1L2TA 3FFAA 1RZ3A 1W4CA 2ZIAA 4PZYA 1JR3D 3EZFA 4Q1EA 4QGHA 1KKMA 3CF2A 5L8VA 2B8TA 3ZJYA 5DHFA 2ONJA 5JMTA 2RGGA 3SC3A 2NO7A 3P32A 3DPUA 1ZP6A 4OI0A 4TYNA 4XOIA 3CX7A 4CT4B 4FMBB 4F93B 2VSXA 4G1UC 4TMKA 1ZC4A 2CLSA 1HH4A 1T6NA 4Y0VA 5LBIA 5BN5A 1W4AA 1U0HC 3DZ8A 4NCKA 3TSOA 5FFMA 1NN3A 4DDTA 5HZKA 1YRBA 2ZE6A 4G5RA 5CB8A 1ZU4A 3IO5A 3B1YA 4NYIR 2ZJ8A 2G88A 3LH5A 5AUOB 1EK0A 3AF4A 4MDEA 5D3MB 4B76A 5KYKA 1Z6GA 3MWKA 3IBGA 4L9SA 2K5UA 4DCTA 3RWMB 1P61B 4QGAA 1N25A 4ZIRA 4QGGA 4R71A 3QJYA 5L3RA 1LF0A 2IUTA 1Z6XA 3HP1A 4JLAA 4N0EA 4D0GA 1OJLA 3MUFA 1RPZA 4OI2A 2UKDA 1BS1A 4KYIB 1Q21A 3QSYA 3C41J 4AKIA 2ZAOA 5G41A 4Q18A 2FJUA 4UXHA 3SBDA 1V43A 3M6AA 2ZRBA 4PO1A 5GVRA 3E70C 2R6CA 1XEFA 1W5SA 2ZETA 3NDBB 3P1JA 3EA0A 3MG9A 1TEXA 3W5IA 2HF8A 2ZRDA 2BMDA 2WJGA 3I4LA 4M1YA 4OYHA 4PHFA 2MSEB 1KI7A 4I1UA 1IN7A 2FEMA 4X8OA 3CW2A 1E69A 3ZIAA 3O8CA 3VKHA 4OHYA 1E0AA 5EE0A 3GEEA 2BVNA 1OFHA 1E9DA 1NSFA 1MABA 4DC9A 4DLXA 3QF4A 4DZZA 2C9OA 1WXQA 3CNLA 1CJMA 2ANCA 3BFKA 4D4LA 5DIFA 4C0BA 4DCVA 2QT0A 1M8PA 4M21A 2NQ2C 1Q44A 1E94E 2IYUA 4DT1A 1W4RA 5AJWA 1QDEA 3B9PA 1II9A 4MH0R 3AVQA 3IO3A 1DAIA 3ND8A 3BORA 4YC7A 2RCNA 5JJIA 5KDOA 2W2XA 1DO0A 3E2IA 2OSBA 2JEOA 1GNQA 4LC1A 3RVBA 1QG4A 2G77B 3DOEA 1G5PA 2WZQA 1HURA 2OESA 2MMGA 1II0A 3EIQA 1AJEA 3PUYA 2IXFA 4O2LA 4OL0A 4D81A 5K8UA 3AV0B 5SZJA 3D3QA 3S1AB 2A2ZA 1NBMD 3LX8A 2XXAA 3EARA 3NBZC 5FTLA 2WM9B 2B92A 1VG0B 4HZIA 4Q4LA 2QP4A 3FKSA 4FCWA 1OXUA 4GOJA 2DWOA 4HB0A 4RFSA 2WWGA 2YVUA 2JLRA 2BHRA 2F9MA 4MGIR 5LPNA 3BFXA 4D82A 2ZXUA 4C0SA 1TMKA 4RD3A 3LWNA 2D7DA 1G5TA 2KJQA 1XD9A 3EW9A 4AK9A 3UXMA 2V7QD 5JS8A 2WJYA 1S4QA 3HR7A 2J41A 2ZYUX 1LVGA 3OHMA 4GP6A 2GCOB 1R8QA 3LX5A 1KDRA 1OH6A 3CPEA 2ZRCA 3TUZC 3LRPA 4JJZA 2H8KA 2F1JA 4PZZA 2N46A 3QF7A 3W5JA 1VYUA 1GKYA 3C4JA 1N0UA 3UMRA 1SVLA 1T9HA 2AFIE 2IHBA 3G82C 3GPLA 1FFHA 5JRJA 4MYTA 3IILA 3H0KA 1PUIA 3EPJA 2A30A 4V0LA 3KQUA 3THOA 1D9ZA 1W47A 2WVJA 2IW3A 3SN6A 1PVOA 3KQKA 3MAAC 1G7CA 2RGAA 421PA 2O8DB 3X2SA 2P5SA 4YMUA 2LKDA 2F3TA 1YR8A 2GETA 3K0FB 3Q5EA 4FMDB 5EP2A 1IHUA 4FIDA 3DMNA 3U61B 1MO4A 3E1SA 1CTQA 4D2IA 1CULC 2AWNA 5JZVA 3GLFA 4EPYA 3QG1A 1NVVQ 5EE5B 1Q3TA 4Q21A 4URVR 4HB4A 4QXAA 2IYTA 4AIIA 2VP4A 3ADKA 4AD8A 3LV8A 3L8ZA 4LV8B 3ZVLA 1CEEA 1CR0A 4P4SB 1NG1A 3GJ5A 2H5EA 4MYUA 1DAEA 2ZJZA 1XPOA 2IK8A 1WRBA 5J4HA 2CHGA 4YDSA 4NCNA 1ESMA 1GL7A 2DB3A 2P6RA 4ZO4A 1XP8A 1UKEA 1ZRHA 3JZMA 1NF3A 1Q3HA 2OCBA 1TEVA 4M22A 3IKJA 3ZIAD 2G3YA 3BD9A 2WJVA 3K0AB 3ZS8A 1OFIA 1Z47A 3IPXA 1E9CA 1GUAA 3GFPA 4Q4HA 5IK2A 2GJ9A 3T5DA 1U94A 1CBUA 1YR9A 3ZQ6A 3TW8B 2OXCA 1VG8A 4AC9A 3B6EA 4B34A 1YZGA 3LAWA 4IOMA 4C30A 5BQ5A 3MJRA 3O8BA 1Y3AA 5FPKA 4JT2A 1JQLB 3TUJC 621PA 3WBJA 1YZNA 4M4SA 3GFOA 2W00A 1S1CA 2QORA 1KI1A 2W6IA 1TQ2A 2W6JA 3UANA 4DSOA 3THXB 1P75A 1GWNA 2BOVA 1XMVA 1NG9A 1EFHA 121PA 1ZM3A 4X8MA 4DB2A 2VBCA 4MRRA 4PAMA 1J99A 5GJWC 3VX3A 3PXGA 4KBFA 2VP2A 2X77A 4F4IA 3AB3A 3GEIA 4B2PA 1JR6A 5E95A 4JLVA 5EP4A 3THYA 1XPRA 1CU1A 3TAUA 4TYYA 2I4IA 2WIBA 4B33A 3ADBA 1LY1A 1TX4B 1P5ZB 1Z3IX 4LGMA 2I3BA 5F98A 2JJ2A 2RGNA 2VF8A 2QTVB 1P2UA 2JLQA 2PEYA 4BFYA 1HE8B 3FKSD 1CS4C 4V03A 4DLSA 4RD2A 3K9LA 2R6AA 2ZM5A 5FPHA 1U8YA 1A5TA 1EESA 5SZHB 3AP3A 5GJCA 1DAMA 1N5KA 5DLQC 2ZROA 5FR1A 3F5FA 4IFBA 1MR3F 1DPFA 1YE8A 1CLUA 2IYYA 1KI2A 1ZM9A 3SBEA 4I1VA 2BBOA 2FWRA 1E9FA 4GOKA 2PX3A 1L4YA 1XD8A 2VPPA 2ZEJA 2IWRA 2CVHA 4B3GA 3TE6A 4W5JA 1JXMA 1W2GA 5GVSA 3T61A 3TQCA 1E9AA 4CDGA 1TAGA 4US2R 3O8RA 2IXGA 2RAPA 4UXIA 2W58A 2QPOA 1FTSA 3W6PA 2GJAA 4C7OA 4WXPA 1L4UA 2QI9C 2Q9AA 5BYKA 1KO8A 1N6IA 2QT1A 2OHFA 4LDJA 2BC9A 3VR5A 4XD7A 3UPUA 2GXAA 4PHHA 2XOKA 3CH5A 3MWJA 4UNNA 5G3ZA 2NO0A 2ZSEA 2R8RA 2ODNA 1YHNA 3CF6R 1C4OA 1G21E 1CR1A 4OJKA 3I8SA 3REFA 2VEDA 4M53A 5KPDA 3R9IA 2CEAA 1G8PA 4G5SA 1KK2A 2C8VA 3NH9A 4TN1A 2LCFA 5FPYA 2ZU0C 3A1UA 2GVZC 3ETLA 3AUXA 3ASZA 5CLLA 1N0WA 2VHTA 1N3BA 3BAFA 4DBLC 4A1FA 4DLRA 1E6CA 4MRSA 3M0EA 3DOFA 1IY1A 4FW9A 2EFCB 3L0PA 2CL7X 3QPWA 4AYWA 4XH9B 3VR4A 3TGPA 4LZZA 2ZVPX 3U7FB 1E2LA 521PA 2WMOB 2QAGB 3C7KA 1U0JA 5HTKA 1W36D 2QSYA 2C5LA 2GBLA 1NN0A 3MJHA 1HYQA 1GP2A 4HLCA 2ORWA 3NEJA 4TL9A 2OG2A 2QL6A 4DDVA 4CF7A 1Z0IA 1KTVA 3GEHA 3UATA 4CW7A 1US8A 5DI9A 1Z8FA 5FUWA 1XCMA 2IX3A 5CDFA 4LPSA 1N6LA 1D8TA 4BFTA 4WW0A 3GLGA 1U9IC 2EU8A 5AJXA 1QHNA 1BYUA 2EWVA 1JPNA 5FOWA 2ZRIA 5KPJA 4B3FX 1VIYA 5IF9A 1TU3A 1F5NA 5IK2D 1KO5A 4PC3A 2J0UA 2FF7A 2FG5A 4MITA 2HCJB 4G5OA 3OEEA 1OV4A 4LHXA 2QP3A 4Y0AA 1IN4A 1UPTA 2F55A 2QM7A 2AK2A 4G3XA 3VR2A 2Z83A 3N70A 2IL1A 3AVUA 3ZD7A 1AIPA 2RHMA 2PZEA 2W6ID 4DLTA 2W6JD 2DY1A 2IXEA 1S3SA 1N5IA 1Z2AA 3DM9B 4PQFA 2AK3A 3T1OA 1ZM7A 3D31A 1EFCA 3N2EA 4RD4A 2NG1A 2XZOA 2ZYVX 4GT1A 1E2IA 5DSZA 5EE1A 1NI3A 5AJVB 3ICQB 4H1VA 3VU9B 4OK6A 1E2HA 1G8HA 1Z0AA 2GRJA 4ILEA 4TWZA 3JVVA 3ZH9B 5CLQA 2CCKA 3H86A 4QG7A 3VX4A 2GXUA 5SZIA 4I1SA 5KSYA 2IUUA 2ZUCA 2V3CC 2HXYA 4HAUA 3N2IA 4MA4A 4GNKA 4IW3B 4RCZA 2R6GA 1TF2A 2JJ2D 3PUZA 4ZPXA 3UWOA 3SU8A 3FMIA 1W48A 2EWWA 2QMUA 3KKQA 2O0HA 2QROA 1P2VA 3TVDA 2DR3A 2ZS8A 4C0AC 2O52A 4ZIRB 1XTJA 2JJ1A 1KSHA 3ND9A 2DWPA 2PLFA 1NVUQ 4IOJA 1R5NA 1MRNA 1Z28A 2BKUA 2J59A 4H9GA 3FMOB 1MO6A 4GMXA 2RGCA 2QE7A 4YXWA 2I1QA 2O0JA 4KCGA 4R9UC 3WXMA 1NBME 3PFIA 3F8TA 4B6EA 1XMJA 2WWXA 5GJVC 3WMFA 1YZTA 4MGYR 1SXJA 4B71A 1TF5A 4YMTA 1Q1QA 4O2RA 2Z4SA 3TMKA 2WIAA 3Q3JB 1FPMA 1Q0UA 1MO5A 3AF0A 2ZI6A 5HR5A 3K9HA 4TYPA 3AGQA 2AL7A 5FOTA 3GLIA 4DEXA 2BCGY 1OIXA 4QC2A 3B85A 3I5YA 1TPZA 1UDWA 5AR1A 5HKKA 3RDPA 1ZU5A 4Q4AB 2XGJA 1EWQA 4D0LB 4BZPA 3QF4B 4Q9KA 4XD7D 1HE1C 1GDDA 4CEHB 2XOKD 4Q7MB 2VYFA 2H1LA 1JJVA 5EXSA 3TR5A 1ZW6A 1UBCA 5HZHA 5EUMA 3THWB 3BFVA 4TQUS 1UM8A 3I1FA 1Z6AA 2ORVA 2VP6A 4LUCA 4E03A 1SVKA 5EE9A 2WMNB 2WKQA 2OO7A 1J8MF 5C1BA 1DBSA 5FUYA 5C2JB 3RS0A 3PENA 5EXTA 3HYTA 1HT1E 1PLJA 1E3MA 4I4LA 4M1WA 4F91B 5IRCD 1NNEA 1QG2A 4AYTA 4PC7A 1PLKA 3LVQE 3WNCA 4Q7KA 4PHGA 5FTMA 1N6RA 4HDOB 4MRVA 2XTMA 4POAA 4E5UA 3SJCA 1XBTA 1H8EA 2C95A 821PA 1CR2A 2JLSA 1WE2A 1S9HA 2XZLA 3RAPR 3J81k 2XXAB 3JZAA 1H8HA 1R5OA 4ESHA 4JVLA 5J4YA 1LB1B 4JLKA 4D80A 1KAGA 1D9XA 1ZUIA 2RH5A 3ZZUA 4A8JA 3AVTA 4QNMA 4E07A 3KUDA 2PX0A 3PV0A 5LD2B 3FMFA 4WBSA 3W34A 4EPTA 2V55B 4B3XA 1QHYA 2KBFA 1YR7A 1HT2E 3RRMA 2IS4A 1SKYB 2B7BA 4A0RA 3CZPA 4TQ9A 4KITB 2QQ0A 3EC2A 3CO5A 1OHHA 3TBKA 3HJNA 2VRWA 1T0JB 1ZINA 2YC4C 4EJSA 2P65A 3OEED 1N6OA 2OFWA 2V54A 1QHSA 5KDLA 1KGDA 2AFHE 4WZBE 3O8DA 5TXGA 1XTSA 1ZCAA 1UKVY 1G8FA 3A1TA 4C0QC 5HE9A 3B9QA 2REBA 4KYUA 2GESA 4PC1A 1LF5A 2A3RA 3FVQA 3U60B 3TIFA 2FZLA 4GOXA 2V9PA 4PQRA 2JLUA 1HA3A 2D3WA 4EUNA 2EFDB 2XTZA 1KZ7B 4KFRA 1DELA 1HV8A 2VLIA 4I99A 4EQ6B 1ZIPA 2X1VA 1GL9B 2WSMA 3DM5A 3T06B 4DSUA 1JBKA 2Y8EA 1UKZA 4AG5A 4QKQA 4KBGA 2GZHA 4JIMA 4F4JA 1G3IA 2OFXA 1S1MA 1T5LA 1NVVR 1UKYA 4CEIB 4R7ZA 1T4GA 3SHFA 2EW1A 1S3GA 3B8HA 1D6JA 2ONKA 2HCBA 4HDCA 2F43B 3K70D 3QVVA 2HF9A 4DUGA 4A2WA 2DBYA 5L3QB 4ARZB 4CRWB 3BE4A 1JALA 3GLFB 1KNQA 2JJ1D 3LQQA 5H8WA 4LJ6A 2VO1A 1T3LA 3W6NA 2IYLD 4D25A 1IONA 2ZJAA 4PTLA 1OSNA 1SVWA 4TTQA 2JASA 4D6PA 1E99A 2FEOA 1G3UA 3M1IA 2QE7D 4YXWD 3AF2A 1U8AA 2EFHB 1EWRA 4JJKA 2YNMA 1NN5A 2CJWA 2CMKA 3K0CC 3CF0A 1SXJD 3VHXA 2ZJYA 3A58B 1O87A 2ZQ5A 4Q4JB 4PO9A 4RZ3A 3LD9A 5LD2C 4TYWA 1S9DA 3WNBA 4PPNA 1SKYE 3IIJA 2ATVA 5G40A 3U3MA 1KI8A 4NKRA 1P73A 1DEKA 2GK7A 2YV5A 5HKKD 4LBYA 2WJIA 2ZRFA 1G20E 2O8CB 3EIEA 3TW4A 3ZS9A 4BQSA 1OFUX 3EASA 3BOSA 2YOFA 2VQSA 3B13B 2IUSA 3T35A 2V6JA 4W9MC 1LS6A 1XTRA 2O0KA 3IDQA 4Q01A 3KFXA 3UK6A 3SHWA 2QBYA 1VDZA 4LBWA 3G0HA 4JBXA 2F3RA 2OCAA 4BWYA 1OH5A 3R9XA 3LNCA 1T3HA 1KSFX 2CL0X 4A82A 3TKLA 1KI6B 1WBBA 5EP3A 4B48A 1K5DA 2ZE7A 3CRMA 3W8NA 1E9SA 1TUEA 4P3YA 1HQCA 4RKEA 2QU8A 4KVGA 3KKOA 2Q0HA 1IN8A 2C04A 2XJ9A 1H8ED 1KMHA 3CWQA 2VHQA 3OIWA 4ZDKA 5J4VA 3IQWA 1D5CA 4Q03A 1H8HD 3GLFE 3QPUA 4NCIA 3NIBA 1XU4A 2L0XA 3FHCB 4QJ5A 1A7JA 5FPTA 4MDFA 2OAQ1 2E1RA 1E4YA 1S0UA 3NC0C 1SZPA 2WKRA 5GJBA 5FTJA 2VHUA 5AJZA 5JSZB 4DLZA 4EPXA 1SVMA 2QPAA 3IHLA 1XB2A 2EFEB 1OHHD 3U4QA 2D74A 4P32A 5J4LA 4OI4A 2ZU6A 1P3JA 4HATA 4MYHA 1BOFA 3H1TA 4Z1MA 4BFUA 4E22A 1FOEB 2F1RA 5JWOA 3U5ZB 1T3SA 4TMTA 4IDQA 1G7SA 3B2EA 2XB2A 1COWA 1AK2A 3I3SR 1CXZA 4CEJA 4PC6A 3TAHA 4KV9A 2CE7A 2IS1A 2O8EB 4ZI3A 3LBIA 2AWOA 4QM7A 5BXQC 2ODBA 3EZ6A 1GM5A 1E0JA 2F1IA 2N42A 4IXNA 4NTZA 1X8KA 4RD1A 4AYXA 1KJZA 4QBGB 1DAKA 2OM2A 3L0IB 1II8A 3QE0A 4NCHA 1E9RA 3A1VA 2H18A 2R44A 3GMTA 4NH0A 3KXIA 3ZLJA 3WRYC 1PUJA 2YINC 2WICA 3UKDA 1T91A 1NIPA 3BB3A 2NZ8A 3W3ZB 3I32A 5DI3A 4DUGD 5FI0B 5JS7A 4LOAA 1QHIA 1GRRA 1FW6A 2ZRJA 4KLZA 2J3EA 4KJZA 4JSYA 1GNPA 4HSEA 1XEWY 4WVFA 1DADA 4WZ6A 2DWQA 4BASA 4V0KA 2GJKA 4UNPA 4FI3C 1KNXA 2ZJOA 1N5LA 4XVUA 1DAHA 4QJ3A 2RGNC 1G8GA 3SYLA 5B64A 2YWGA 4AKEA 4QJ4A 2P0EA 4QM6A 3QIAA 2P6NA 3KKPA 2A7QA 4JL5A 1EFTA 2FPMA 3I8XA 3GLGB 2ZE5A 1Z0DA 3ZQJA 2QEQA 5FTNA 2H17A 1F6BA 2FPLA 4EAQA 1UJ2A 3QENA 1G4AE 4QFMA 3EA5A 1N6NA 1M7BA 1ELOA 2QMHA 2FMXA 2IYWA 3IEUA 1CJKC 1VECA 1E2FA 1F3OA 1S2MA 2J0UB 3GJ4A 5LB2A 5EXPA 1DS6A 5KSZA 1QVAA 5P21A 4ACBA 2C96A 3SJAA 2C77A 3PITA 3SJZA 2H7VA 1G18A 1W0JA 2IF0A 2A5YB 1YRAA 2JATA 1GRQA 4ON9A 4LBZA 3TVTA 3FPAA 1XJCA 2ZYWX 4HLQB 1F2TA 1NP6A 1YZKA 4HAYA 2AX4A 3O47A 2O8BA 2WV9A 1E1QA 3P4XA 4QOSA 1Q22A 1WF3A 2YWEA 1YZUA 3OFNA 4GP7A 2G1KA 1KK0A 4W5HA 5C46F 3B78A 2GXSA 4U02A 3A36A 2WSSA 1XZQA 4C3ZA 4BLSA 2RGBA 4A36A 3QY0A 2VHCA 3ZDQA 1DG3A 2D4HA 5JEEA 3KXKA 1F2UA 4TMWA 2OLJA 3VAAA 4NE2A 1NN1A 3MCAA 2BMEA 4RJLA 2W0MA 2PBRA 5AK0A 3PCRB 1FUUA 1E1RA 1G3QA 3M4YA 1Z6TA 2PLRA 3AQ4A 4HZUB 4P4UA 1SVSA 4JL6A 3B1XA 3I61A 4ZDIA 3RSLA 3UG7A 1DO2A 3KKNA 4FD2A 3U2QA 2R62A 2HDNB 1X8LA 3WYGA 5KO2A 4GPTA 2DPXA 5CIQA 1L8QA 1QVRA 1QHHA 3LFUA 3BWDD 2GBLC 3DZDA 2GCPA 2WWIA 4MRNA 1WQ1R 4KO8A 5DYGA 4NPHA 3SS8A 3CBQA 4CT5A 4Z1MD 4PAOA 2FFAA 3GLGE 3BK7A 1OXSC 1GIAA 3TRFA 1EGAA 1IXSB 2D06A 3NKVA 1DE0A 3K1JA 3ZZTA 3GLIB 3R7WB 4LK2A 1COWD 2DFLA 2IC5A 3EIHA 4IDHA 2BIFA 1GILA 3CRVA 3P27A 3A8TA 4HDQB 4XJXA 1ZAKA 2BEJA 4ACAA 1A82A 2A5GA 1E96A 4B3BA 2WOJA 2O8FB 4IDPA 2ZRHA 3U7HB 2GF0A 4MGKR 4M9XA 4CZ2A 1WB9A 3PQCA 2Z43A 4Q19A 3U44B 4KODA 1OIWA 1LV7A 1AGPA 3GD7A 4OHVA 2OBNA 3LVRE 2XJ4A 1GKIA 4ZCIA 1FNNA 2AHOA 3CWZA 5KNCA 3DVLA 5KUTA 1KMQA 2Q3FA 2ODWA 3AKYA 4TT3A 5K8IA 3RABA 3HWSA 2D7CA 3EZ9A 3FKQA 1VG1A 2A5JA 1WBDA 4LHZA 4R2IA 3SR0A 1JEEA 1X86B 3FGNA 1JNYA 1UBGA 1XMSA 1CP2A 2HJVA 1M7HA 2CLCX 1G8YA 1KHTA 4BRWA 2QMOA 2EVWX 3W6OA 2ATXA 4B44A 5EJEA 4MKGA 3NWJA 1KK3A 3WNDA 1FMLA 1EFRA 1E98A 4FXPA 1PZNA 5TDHA 2AXPA 1FZQA 4PSVA 2LWIA 1IJEA 5K8LA 2AXNA 3TSWA 3T15A 6Q21A 1R5BA 2W0SA 4GZMA 1MOZA 3JVUA 1MT0A 2QA5A 4OKSA 2IA5A 1KI4A 1J8YF 3Q7PA 4BFSA 1W2HA 4HUQA 2FGJA 1SXJC 1FX0B 1VYVA 4HAXA 4IEIA 4EJSB 4ASUA 3AEZA 1X1SA 3GLIE 5KHOC 4GZLA 1P9RA 3LO5A 5ANRB 4ZV4A 5D3MA 5FL3A 3ADDA 2MMCA 4ZDJA 5HCIA 2XNSA 5A0FA 2ZTSA 2IYQA 1W0JD 3R20A 1G7TA 5DNYB 1S8FA 3LLMA 4IVRA 1IN5A 4UJ5A 3SQWA 1XMIA 2OUKA 2REOA 1Z08A 2QGZA 4MKHA 4V0OA 2ZVQX 4ZCLA 3K9GA 4EFMA 1XTIA 1JXOA 3ECCA 3KL4A 3GJ0A 4DCUA 2EYQA 2IS6A 1ZD9A 1E1QD 3RANA 1E2DA 1U81A 3OFND 3RHFA 4YONB 1JR3E 2VP9A 3WHKA 2C2HA 4R98A 3I5XA 4A0HA 2WSSD 5TVKA 2GA8A 3RRNA 4DKXA 5JEDA 3MWYW 3TK1A 2YWFA 4S35A 4C9BA 3QKRA 1XX6A 3LDAA 5FR2A 1PJRA 1P9NA 3CZQA 2VH5R 1E1RD 2ZRNA 2GDJA 2QAJA 2FH5B 4B35A 3C14C 3EC1A 3BS4A 3HDTA 3K9NA 3WP0A 2J0QA 1TQDA 3H2YA 2AN9A 2A5FA 5A5GA 1M74A 3Q8XB 2B6HA 1VCOA 4B75A 2EYUA 2PH1A 5EUQB 4AY2A 1OKKA 4B47A 3RSOA 2ERYA 2WBLC 3BRWD 2G1JA 4JYBA 4K46A 5H68A 5JFGA 3UMSA 2FA9A 4LY6A 3WYAA 2HV8A 3PEYA 2IYSA 4QBFA 2QMEA 2IYRA 3H4MA 4JL8A 4KFUA 4A8JC 3KQLA 2YYZA 4OQMA 1E9EA 3BXZA 5CYOA 4W7SA 2NGRA 1U98A 1IAQA 1RYFA 1WP9A 3AKEA 1PV4A 1T8TA 2OBLA 1G64A 4KLNA 2ZSDA 4C0LA 1MO3A 2C78A 2GILA 3GCGA 2WHXA 4O25A 2RHDA 2C03A 4A4DA 4EJSC 2IYVA 4G0NA 1F60A 2FZ4A 4L5BA 4M1OA 4TTRA 5UKDA 4FMDF 1P9WA 2ZJBA 2PEZA 4TMXA 3NXSA 1U2RA 1I4DD 3AP2A 3BIFA 3Q5DA 5CIWA 3LY5A 1VHLA 2CXXA 4GRAA 4IFEA 4FMCB 1P72A 2HXSA 1G1MA 1AKYA 1J70A 1VTKA 1EX7A 1GRNA 3LBNA 1ZJ6A 4TT3D 1R4AA 2GAOA 2HT6A 1M2OB 4C2UA 1OXXK 1XRJA 1RYHA 3EWSA 2JLWA 4OHWA 2IEZA 5J40A 2WWYA 2ZAMA 1GSIA 2KWIA 3OEHA 3BBPA 4OQNA 3B1ZA 2JAQA 1AS0A 4M1MA 4A15A 4DJTA 1BYIA 1XFAA 3KJIA 3VMFA 1YZLA 3I72A 2GCOA 3GJXC 4Q7LA 3NHBA 1KDPA 4TMZA 2Q3HA 3B5JA 3FB4A 4YLGA 5AWFC 2BBTA 1EFRD 2OFOA 1KO7A 5DGXA 1K6MA 3SI7A 4D4MA 2FSIA 4ITRC 5JWHA 3V4FA 3ICEA 5E3HA 2AKAB 4M1KA 1OLOA 1YZQA 3KXLA 1UBEA 3L0SA 2OE2A 4TTPA 3VHLB 4B74A 2WWHA 2JLXA 3UMFA 4C4PA 2XX3A 1OB5A 4KSBA 3U4QB 1U99A 3QPVA 1Z0JA 1I2DA 4O3MA 4BZQA 4ASUD 4L4UA 2OT3B 3K0FA 3CONA 4URZR 4PR0A 2A5DA 5FTKA 4DSNA 1VHTA 4NU0A 4C0KA 4LHVA 1RW4A 1CJVC 4IRUB 2FE4A 3FWYA 4UXJA 3MMPA 4BLOA 4BECA 4IKEA 3FMPB 5CJPA 1IOZA 4DWJA 1FQKA 3AF3A 3MLEA 4NL4H 2BBWA 4IXMA 4URYR 1IY2A 1AGRA 2AD1A 1MABB 3MGCA 4LRWA 1DARA 1N0VC 4IOLA 4P4SA 2XZPA 5K8TA 4LJYA 3CB4A 1O3YA 2HYDA 4JBWA 2P3SA 1H65A 1CJTC 4PANA 3AF1A 1Q12A 1RFLA 3KB2A 3QKTA 4LCBA 1KIMA 4QL3A 3RS5A 2JCSA 3QKUA 3A1SA 1RE0A 1MRSA 4DT1B 5TMPA 4ABYA 1P60A 2GHIA 3P4YA 1HEIA 3K0AA 2V8OA 1P2TA 3CM0A 4I1OA 3UWKA 4HAZA 1XCGB 3DKVA 1T8UA 1TL7C 4HLUA 4OQFA 1ZMXA 4L9WA 1S96A 1ZM4A 4N0DA 4DLVA 2HUPA 2OCPA 1Z22A 1RRGA 1AZSC 1OKKD 4DDUA 1RVDA 1VCIA 4JLBA 1ZYUA 2Z6VA 2PL3A 4MQBA 3RRZA 4ZKDA 2IF2A 4HLDA 2KE5A 1D2NA 3CNOA 4C0JA 2QP9X 2ZJ2A 4PX9A 3VR1A 4URXR 3DKPA 1G291 3B1WA 4XIGS 4Q47A 4TQAA 3HU3A 1KJYA 2HEIA 2I1VB 4TYQA 4UJ3A 2CE2X 4A6PA 1JAIA 2ZRPA 1GAJA 2JIZA 4RFSB 4PXAA 3FOZA 4PPQA 4U00A 4HB2A 5KNBA 2C9CA 1C9KA 1Z07A 4IEEA 5EQTA 3QBTA 1NY6A 4LJ9A 3FDIA 4R2HA 1UAAA 1D2MA 2CHVA 3QVUA 2FNAA 4GI7A 4B3CA 3HU1A 2ZRMA 1KDOA 1KI3A 4NCJA 2GXQA 1R0ZA 3CR7A 4Q1FA 4BGDA 2PJRA 5DHAA 3OESA 2GZAA 3IGFA 4AG6A 2ZI7A 4D0NA 4URUR 1VKJA 4JVSB 2ZS9A 4EFLA 5J47A 5JECA 5SZKB 3EX7C 4QBIA 2DFTA 1TQ4A 1W1WA 4N3NA 4RZ2A 4Q9LA 1ZC3A 3IUYA 4XTRA 3SDZA 5JHGB 1CRPA 3MRSA 1ZNYA 1ZUNB 4TMVA 4MKFA 4BLQA 1F2TB 1U9IA 5CITA 4Q02A 5CM8B 3C16C 4PAQA 3F0TA 2ANBA 2Q6TA 3ONWA 5B58C 1E2GA 3ZD6A 1EX6A 1AS2A 1ODFA 3NDPA 4Q5IA 3OEHD 5AJYA 5JLJA 3CLVA 4Q9HA 1ZD1A 4ZCMA 3R8CA 2ZITA 1SHKA 2WOOA 3IQXA 4UNSA 3KFVA 1G7RA 3RC8A 1IBRA 5C18A 1ZNWA 2PJZA 3BB1A 5FBWB 1NLFA 2VP5A 2QRNA 2O5VA 4G01B 1U0LA 5DYIA 4F7WA 3BH0A 2CCGA 3AH8A 4M8NE 3U7EB 4Q9JA 4M2LA 4B2IA 1DG1G 4KHZA 1NRJB 2W83A 5DH9A 3IIKA 2D62A 1NVXQ 4JLJA 2AR7A 3SJBA 1QHHB 2IBMA 4AURA 5CYPA 1W36B 2BMJA 5JI3E 1FL9A 1OXVA 2J87A 2XB4A 3PIRA 3KTAA 3KX2A 2ZSAA 3VQTA 3W8RA 4BFWA 2V4ZA 4KVAA 4XVQA 2F1HA 1UADA 4DXAA 5L3SA 4C2TA 5M04A 2ZRGA 1JI0A 3SQXA 1NL3A 2FFQA 4HYYA 4JVNA 4IDOA 3GJ7A 4US1R 1XD2A 2FSFA 4ZDWA 3R8FA 4AWXA 4LJ8A 1TADA 1LNZA 2QAGA 2SHKA 1Z06A 2DFNA 4Q4HB 1NLYA 2VIIA 3RRYA 1OE0A 2PMDA 2QTFA 4HAVA 4PPGA 3I62A 1AS3A 1OYWA 3EZ7A 3V4RA 1G5RA 3GJ6A 4V02A 5ELXA 3OAAA 3SEAA 2WKPA 1WCV1 4DLYA 3PR1A 4LYHA 1Z0FA 1B23P 1B0UA 5BN4A 4GDFA 3QEJA 4BE7B 1DVRA 3ZYCA 3D8BA 1SULA 2MSDB 3FE2A 4ZI2A 1XXHA 4BLPA 2GJ8A 1XTQA 5BWMA 4NONA 3THYB 4AI6A 4YDHB 2WJJA 5CK4A 2NO9A 5E4FA 5FI1B 5AUPB 2J0SA 1FNMA 4TLAA 1A2KC 5CJ2A 3RLFA 1K8RA 3LXXA 3SNHA 4TZ0A 5FPSA 3L0OA 1E0KA 3WYFA 3KUCA 4KAXA 4EDHA 1A2BA 2BKEA 4GFDA 4MYCA 2NPFA 3KQNA 5JWRA 4BZXA 3AVXA 1EG7A 3TUIC 2JIZD 4LV5B 4CIDA 4XTCS 5EE3A 1M6NA 4Z51A 3VU9A 4FCVA 2FGKA 5FUXA 1OFTA 3PVSA 4GBMA 4PSKA 2XNDA 2FX3A 3X1XA 1KI9A 2P2LA 1W36C 1TUIA 1Z5ZA 5EXXA 3U6KA 4HUQB 3VKGA 2BV3A 1T0HB 3Q85A 3CIOA 3K09A 1KOFA 3HU2A 5FOXA 3X1WA 5JRZA 5J4KA 3BC1A 3OIUA 4OHZA 1R6BX 4TL6A 3AVPA 3OZXA 5D3QA 1E2KA 4BFXA 2H16A 3VNUA 4BLTA 3DL0A 1GOTA 1QHGA 2Q9BA 4B43A 3BERA 1OYYA 3PJRA 2CNWA 1XJ0A 2B21A 3AKDA 3QBVA 1MV5A 2ZE8A 3PUXA 3TR0A 1DTSA 3L43A 3N5CA 3AP1A 2JDIA 5B57C 4C7OB 2BJWA 3CH4B 1SHZA 3PEVA 1TU4A 1LS1A 1FMJA 1ZCBA 5FBQB 4B32A 4A2QA 2CCJA 3RNLA 3TNFA 1G3RA 2GJSA 5LDDC 3V00A 5EP1A 2J46A 4TLEA 3GLHA 3TH5A 1OT3A 3QKRB 1W5TA 1X3SA 3EWAA 3IHWA 3ZGXA 2ZR7A 1OXTA 3TJZA 3A4NA 2XAUA 2W2VA 3QXSA 2X2EA 4G5GA 5AUQA 4Q4AA 1WMSA 3CRQA 1XEXA 4KXFB 4EIWA 3C5CA 3RS7A 1KO4A 4LC0A 5E7MA 3DMDA 4U7DA 4CEHA 1ESNA 1SKQA 4PHTA 4V0MA 1VPLA 4PSAA 1UEIA 4ZKEA 2PCLA 2J1LA 4QNRA 1IJFA 5E7JA 1QBKC 3C15C 3THWA 2FFBA 3FTQA 2QTHA 3A37A 2OLKA 1Z63A 2ZI4A 1YJ5A 4BRUA 1R8SA 1US8B 3SZRA 4RZXA 3AVVA 4NZYA 4W5WA 1MH1A 2NZJA 1E2NA 1F48A 1P4SA 1G4UR 4A2PA 1AM4D 2XSZA 2G6BA 1I2MA 4LWZA 2AKYA 1GFIA 1RJ9A 3D6TB 1TQ6A 3ZVNA 1P6XA 4IDNA 4RCYA 5KDDA 1BMFA 1P7CA 4II7A 3DDCA 4JSTA 3SOPA 3EG5A 1RRPA 5F2EA 3K0CA 4BFZA 3QKSA 3TLXA 1DOAA 1KO1A 5LB4A 3EPLA 3CX6A 1GL6A 5G3YA 5FBVB 2PCJA 1GVNB 1UF9A 1FP7A 2ZR9A 1NMYA 2NIPA 4HB3A 1JJ7A 3VFDA 3OAAD 2E9SA 1X1RA 2IYZA 2GNOA 3SE0A 4WXRA 1E79A 2F7SA 2HJGA 3BJIC 2ORIA 4DCSA 4DLWA 2PZFA 4QRHA 2CK3A 1W0KA 1HTWA 1A4RA 1HQYE 2IT1A 4TLBA 1XZPA 2WWFA 5FOVA 4F4CA 3RWOA 1VYTA 2ZRLA 4IOKA 2RGXA 2CLDX 2HLDA 4MGZR 3QXHA 4KU4A 2KB0A 1TF7A 2GEVA 3KJEA 4LJ5A 2VF7A 3K0SA 3K70B 4TLCA 1XEWX 1CRQA 3GJ8A 4YMSA 2QENA 3OIVA 5FBRB 4LJAA 4EQ6A 4G5QA 4DLUA 4FINA 3OE7A 1T5IA 1BIFA 1DAGA 2GEUA 2XNDD 2ZRAA 4LJ7A 1KDTA 5BYJA 2J5XA 3GQBA 3K53A 1EFUA 3ZVRA 3FHOA 2JGNA 1KJWA 1E0SA 1E2PA 1SXJB 4CEIA 1SGWA 2CHQA 3DEFA 5CDFE 2R9VA 5KSOA 2A78A 1GKUB 1UFQA 1R10A 2F43A 4TL7A 2OXRA 2ZR0A 3SFZA 4ARZA 5L3QA 2REXB 3U6BA 2P5TB 3MD0A 2CNWD 4EPWA 1W7AA 3LW7A 3A6PC 4LYFA 2YHSA 2GAAA 4FWIB 4YQFA 1C1YA 4M1SA 4PPFA 2ERXA 2YOGA 4NYJQ 1BKDR 1XWIA 2D2EA 1E4VA 2JDID 4KFSA 2EQBA 2PZGA 2OILA 3L82B 4PFSA 4DEYA 5TV2A 3LBHA 2CDNA 5TARA 3SYNA 4KFTA 2JJ8A 1JEDA 1E2QA 3A4MA 4RY2A 1YU9A 4XVRA 2OBMA 1G6OA 2GTPA 3C8UA 1A1VA 4Q4JA 4DVGA 4L15A 2RGEA 4OI1A 2YZ2A 5F9FA 1QF9A 4BFVA 4FCTA 1CKEA 4UNQA 2FV8A 2QQEA 1OIVA 2QZ4A 4LYAA 4L8GA 5JCZA 3QQ5A 1KSJA 1KY3A 1JB1A 1W4BA 3P26A 3U3KA 3QNUA 4GMDA 5DISB 5JI2E 4RFVA 3BH6A 4NYMQ 4YMVA 4D4JA 1Q57A 2GEDA 3IEVA 2O8CA 2QGNA 1RC8A 3WP1B 4AKHA 4QBHA 221PA 3HPQA 1RKBA 2ZJ5A 3CR8A 1QRAA 3I73A 1IN6A 1OF1A 3UIEA 4DB4A 4KSCA 2FSGA 4MUBA 3A4LA 4NMMA 3W3AA 4MUAA 5JJKA 1KY2A 1NIJA 4H1UA 1VMAA 2VA8A 2F6RA 1XDBA 4HEJA 3K70C 2R6FA 1XCPA
chains in the Genus database with same CATH superfamily
2GPBA 4JLOA 1OTXA 4K8OA 2ZT5A 3PC3A 1PQWA 2JA1A 2IYXA 4I4TA 4TZKA 3ZK7A 1HFEL 2XQKA 1U0EA 2XSZD 4DJDC 1JECA 2ZIXA 3BTUA 1TECE 3FNEA 1P9OA 3IRVA 3EQ9A 3BH7A 3T9BA 1F6DA 4B3HA 5KYXB 3FOAA 3KBOA 1HI9A 1M1UA 4PYMA 1ZD8A 5HMMA 1BMFD 1N6PA 4JWKA 1JBEA 2FSHA 4YMLA 5NULA 4JLNA 5AKXA 3PHIA 3U7QA 4HDAA 4LYDA 3AHDA 3YASA 2X3FA 2PZ8A 1FUKA 2UZIR 3BPSA 2JB9A 1VPTA 2NPIA 3L8GA 1G60A 2O3JA 4H60A 4M1TA 4ZZ2A 4XYLA 5TF4A 3RFFA 2NMVA 2R97A 1FFCA 2ZPTX 1GPJA 3GEMA 2B5OA 5L4SA 2PJUA 4WHMA 1DQSA 1E79D 5FUQA 1U9JA 2QM8A 5EKXA 4UQOA 5CURA 4YRGA 1B42A 2I76A 4A7PA 2XIQA 4JS0A 3GPCA 1NDUA 3T12A 5LNK6 3ZU6A 3COVA 1FTWA 3CVWA 1D07A 3OJ0A 5BQFA 3O4FA 3PI6A 4LV6A 1HY3A 4JT8A 5CXSA 3ZY4A 2I2FA 3RHSA 3FHTA 5J5AA 3SC4A 4S2EA 4V1CB 1PFKA 3DFFA 4M9RA 3AHJA 2QLJA 5TB5A 3GRYA 4QOEA 1K5GA 2GA9A 4K9QA 3TZLA 1JKJB 2W6QA 1Z83A 2ECKA 3JARA 2VJQA 1Z5NA 2PKQP 3ZVMA 1BXGB 4BVBA 2ZT8A 3K3PA 3N0RA 5FL7A 2CC2A 2FOLA 2BHTA 2O8EA 3PTAA 1ZNXA 4IFTA 5FO0A 3V4OA 1OGYA 3PZBA 2VTDA 2SECE 2IUEA 2ACWA 3EGDA 2VJOA 1I6LA 4F85A 4JJAA 3DCIA 3O95A 4CCWA 4NP6A 1L3IA 4KO1S 1TO2E 4DPMA 4OQZA 1IBKB 2OECA 3R3HA 2NX2A 3A6EA 3AR9A 3L1HA 3L79A 3W90A 1KKLA 1LRJA 1QCCA 4S12A 1OU4A 2JHPA 3QSGA 4HXYA 2CJWB 1JQJC 4BUCA 1EB8A 2QIOA 2JLYA 2F90A 1AQLA 5JISA 1XZKA 4QDZA 1XMOB 1X6VA 1XTKA 3CUEF 3KPWA 3GFTA 4K86A 2I6TA 3KTAB 3VHXB 4GL2A 1IH8A 1DJOA 1T15A 1YAJA 3TE7A 3A9RA 3H9BA 2YV4A 4BEVA 2PGOA 1Q7CA 3G8AA 2X9GA 4A0GA 5AVXA 4FXOA 1DSSG 1XZCA 1YR6A 3OT4A 4U7GA 4BTLA 5KOYA 3OX3A 3S8EA 4X9XA 1JAHA 1FSZA 1ZBDA 4C22A 3PJFA 2YC2C 4D43A 1DRJA 4IUDS 4Y1FA 1DAOA 1ANKA 1Z0KA 3OOJA 1M9NA 4WOPA 3RSFA 1XTZA 4UU8A 4ERXA 1GKLA 3E3MA 3HJRA 1L4LA 5EFOA 1YQEA 3ZHUA 1PHRA 3CLSD 1B0PA 3ENQA 3LW8A 4JKIA 3SYKA 4F8JA 2WJHA 3GRCA 2CBZA 4GYKA 1U31A 3D8NA 5JXGA 2XAAA 1C8KA 1XKXA 3RK0A 2BKVA 2F3UA 3BTSA 1LPPA 2ONCA 4TZTA 4BGVA 3O3MB 1JHUA 4D0SA 3I1JA 4I5EA 4K26A 1CETA 4M6WA 3G0OA 1Y4ZA 1B8VA 4IAOA 2P91A 3U7RA 2XLCA 2E4XA 3KJHA 3N39C 4RSGA 2BFCB 4LWQA 3IPYA 3G17A 1QSGA 1M2VB 4HSGA 1BO6A 1M34E 3B53X 3CX8A 4U7FA 3O4IA 1YTLA 1IQPA 2EBWA 3SLGA 1YWGO 2QN6A 4DHEA 4ZHSA 1CYEA 4DDWA 2JIQA 1KDZA 3PC4A 3NBYC 4CLOB 3PQ4A 5JD5A 5F73A 1UC9A 1YB4A 4YMGA 2ZSJA 1P4RA 3NO4A 1WXHA 1Y81A 1PFUA 1VI5A 4KXNA 3FX2A 1LUAA 3IX7A 3W3AD 1PJAA 3WLKX 2NTYC 1K68A 4J0DA 1V16A 4N5DA 4YAFA 5FF9A 4HWGA 4YAJA 1VC2A 4AZTA 3M5CA 3DTVD 3Q6MA 3C6QA 3VMMA 4WCFC 3HGMA 3LIPA 4B2LA 1W46A 3KTOA 4F72A 1C0IA 4KTTE 2VI5A 4XJTA 1L1QA 5JCPA 3TZCA 1SXIA 4M9ZA 1OX4B 3LDGA 4JJIA 3X1DA 4DILA 1KMMA 4YUXA 4F97A 1VIMA 4M7RA 3KQTA 4KMSA 2ERCA 5JZOA 1XF9A 1IXRC 5L3VA 2GN2A 4G41A 3NJ8A 3MWFA 4WASA 1DC7A 2GVDC 2G9NA 2PV7A 2JLVA 3A1WA 1OPXA 2J7PD 2OBFA 3OT1A 2X0EA 3PG5A 4X6YA 5H3HA 4ATNA 5B30A 1PWXA 3DBIA 1O94C 5H9WA 4DM3A 2K7FA 1ETUA 2Z6UA 1JRLA 4URWR 5D2CA 2VDPB 3AONB 4JBYA 3KVOA 1TCCA 2ZI3A 2DUWA 1D2EA 2UZ1A 4KOEC 4ARUA 1E6LA 4KQWA 5G53C 1K6EA 1J49A 4IHKA 1GQSA 4E2YA 4M54A 5F9HA 2FYTA 5B1YA 5EZ6B 2WUDA 2A0KA 3FSGA 3QI2A 3N28A 1NSYA 5B2ZA 1E6WA 2HYIC 3H84A 2LKCA 3KCQA 3WL6A 5CB6A 2P90A 4MQ5A 1M6YA 5EIEA 1HZJA 3RV3A 3DLHA 2P1ZA 1J2JA 4EA7A 1D0VA 1MMFB 1ZIOA 2IJGX 1LW7A 1IWBB 2JI6A 3I2JA 5DN6A 1AQ6A 2GARA 1MZVA 1ID1A 2GPJA 4JEIA 3T0IA 3U3RA 4ER0A 4FONA 3UMCA 5IABA 1LLDA 5TY0A 4IP0A 1C4WA 2Z09A 4LSZA 3T1QA 4DMCA 3OFJA 4KI7A 3QELA 4Y6PA 2G9VA 4HI0E 3TOCA 5ITZA 5LQDA 4H6WA 1FSPA 2O05A 1WY7A 3WX0A 1J90A 3TNYA 5DI3B 3ENNA 2O8FA 1MO2A 1PJCA 5ECYA 3CNEA 5HM8A 4K81B 2EDAA 1G6HA 1XEXB 3I9JA 5BN3A 3T34A 1KAHA 3G1TA 1VG9B 3VNAA 4WY5A 4M0CA 3VOAA 1CHNA 2IP2A 1THTA 3AU9A 4LKRA 5BYAA 1OLSB 1Z4LA 3K9CA 1R12A 1JR3A 1Y9ZA 2J6CA 3PTLA 2QJFA 4I4IA 4GSYA 5IC4A 2WAAA 1J24A 3AR5A 1NOKA 3VR3A 5HJEA 3H0EA 3OCWA 3THXA 4OGGA 1JHOA 4WUTA 2ZYSA 3AU8A 4HR7A 3TQRA 5M29A 1PJ3A 3V8NA 2MSCB 1DB3A 2EWMA 1RWKA 2NXJA 2P9BA 3F7MA 4LJ4A 4RF3A 3W9SA 2RGUA 3QOFA 5C4IA 4YY3B 4DTCA 2RIRA 1ONOA 2Y1LA 3F3YA 2PXHA 3KZXA 4IIBA 4ZVUA 5CEFA 5KU1A 1KEVA 4MA0A 3RKUA 4LZLA 1RJ9B 1WCIA 4HAWA 1MENA 2CLIB 3BIWA 1LDGA 2GK3A 1AZWA 2XUQA 4RA9B 3ASYA 4ZFNA 4BRSA 3BVPA 2QUZA 3WDMA 1NR5A 4D97A 4Q1DA 4DDHA 4KXLA 4ZOLB 2WUWE 1P18A 5BWBA 5KJFA 3QKSB 4FC6A 1LI5A 4Z99A 4RPGA 4A92A 5IXJA 1EDZA 5DCUA 3VPAA 4EY8A 1M0EA 4RPHA 2W6NA 5FWNA 4M89A 4MR7A 2OEPA 3KKEA 3GDWA 4Y3UA 5TR9A 4HUTA 2GB4A 3E7DA 4MHOA 4HEQA 2YHIB 4XR4A 1KSGA 3Q72A 2ZYTX 3QWAA 2XTJA 3N8DA 2W98A 1JLLB 4MW1A 4QWWA 4AT1A 1EFVA 1YFLA 4EEXA 2X76A 2X58A 3MJDA 4OK3A 4PZCA 3I9NA 3GFSA 4KQGA 4QGFA 4WACA 1WY5A 3ADCA 2O19A 2XTNA 1I51A 2N1BA 3GLHE 1C2YA 1GUFA 4NJOA 1B6RA 3AM4A 3NWPA 3H17A 4OU4A 2CZQA 4Q7JB 4BEWA 2NO6A 1QZXA 1R7RA 2P8JA 4RTNA 2WYVA 3O3NB 1YJBA 3BIOA 4LYJA 4UNRA 1S2OA 4BKRA 4FS8A 1K9SA 2JGDA 3C3KA 1UJNA 3EXIA 3Q7QA 4WZAB 1PYDA 2QRGA 1PNRA 1E8NA 3WAGA 1CR4A 2H0AA 2KPOA 3JALA 1JDSA 1YKSA 4OK5A 1C30B 1UBJS 2C2OA 3REGA 4JXKA 3U1TA 2Z3WA 1E9BA 3OPYI 3DNFA 1FMCA 4W9NC 1WCXA 2PKWA 4J0CA 3RS3A 1WPRA 2XWSA 3GVIA 3PXXA 4QHYA 4JVMA 4F2HA 4V0ME 1YUNA 5KJ1A 1QQTA 5ICFA 4F71A 3DAFA 4DPKA 2F9LA 1L7QA 4O3FA 2VCEA 1ODSA 2MSNA 1X7YB 2ZUSA 3E7PA 4MLCA 3AEUB 3GQBB 3ZWXA 1ISSA 3MWGA 4HJRA 5JBQA 5KB3A 2INGX 2JCVA 4OB6A 1ONBA 1QX3A 2ZYRA 3E9CA 3OQJA 3W4JA 3ETNA 5ALDA 3LCVB 1VRCA 3AVWA 3O1JC 1AUOA 3NYQA 1OA1A 1Z4JA 3U0BA 1THZA 1SQ5A 1OCEA 1KQFA 3HXTA 2DBRA 2E49A 1YH3A 4TTTS 4IIDA 4RPLA 5AI9A 4J7CA 2I4LA 1UEJA 2H1RA 1YA4A 4ZANA 3KC2A 3SYMA 1JPJA 2GN8A 4PLVA 2BFEA 1LZKA 3C5HA 1Z6YA 1NKSA 1K8YB 2H92A 4RVSA 1RQ7A 2IITA 2VJCA 1K86A 1FTYA 1K92A 3WLAA 3NMUF 2FZVA 2W6CX 4L8FA 1NMXA 1IEXA 2BLLA 2QRJA 2VTKA 4FKMA 4MW4A 3WIVA 3ZX5A 5BOSA 2DHRA 5CLJA 4GBGA 2XCOA 3TM5A 3PD7A 2ONZA 1Q7TA 4PYOA 2IZ1A 3ZZTA 2PH5A 2JIRA 4JUFA 1DTWA 1N6HA 4LFBB 2OWEA 2Q5IA 2ZB4A 3BWYA 4MV9A 3F3KA 3PYLA 5JOQA 2H2AA 4REQA 3E9EA 1QZUA 2Y6VA 1K0FA 2IGTA 2OCDA 1QAMA 2FOXA 3AT1A 4PRLA 2JI4A 2X2FA 1FP6A 1GUDA 2WR8A 3JZFA 4FYWA 2LXNA 3JYQA 5IKOA 1X1TA 1L4EA 4PZYA 4QGHA 1KKMA 4L51A 3NS7A 5L8VA 2B8TA 1DC3A 5CXUA 3DBLA 4X1KA 4NFHA 2ONJA 3FAZA 4LKOA 3IQGX 2A3NA 2C4TA 1GQFA 3RT1A 4G37A 2NO7A 4JJFA 3OOYA 4LWPA 4X91A 3HO1A 1QTQA 4KK3A 4DMKA 2OV8A 3I64A 5B7PA 2QQFA 3ZZ1A 4KIGA 1M5RA 2VSXA 4G1UC 2EX1A 2FWBA 2PUTA 3HRIA 4TMKA 2ZCVA 3VZSA 5JYEA 2CBGA 5K51A 5LBIA 3VOTA 3DE1X 3DZ8A 4RENA 5LYJF 5LZ9A 3WGGA 4NCKA 1UQRA 4GWGA 3IMFA 2Z08A 5HZKA 4G5RA 1EXVA 1DFGA 1E5TA 4DABA 4W8GA 3DR3A 4N5MA 5KNDD 1O6BA 2G88A 3LH5A 1I14A 2XUJA 4BVHA 2XUOA 5D3MB 1JHAA 4B76A 4UMDA 3WO0A 1WDKA 3MWKA 4L9SA 5JO9A 3VVBA 2P9EA 3FUVA 2R3SA 3O8QA 5TMDA 1Y6RA 3OO1A 3QJYA 5L3RA 1LF0A 1MLDA 1QLHA 1W5BA 2BELA 4J2HA 2AUTA 2WWTA 1OJLA 3GXOA 2FP3A 1Q84A 2QXUA 3MUFA 3FUWA 4NNOA 5C8XA 5PNTA 3HJAA 4Y0NA 2FPSA 4Y6LA 3E27A 5G41A 4Q18A 5L53A 4WXHA 1DKNA 3WTBA 1E3TA 2ZRBA 4RGQA 3FZGA 1QU2A 1LX7A 1J9ZA 4MK4A 3O75A 3I9V6 2ZETA 2HB6A 4KAFA 3MG9A 1O8CA 3W5IA 2ZRDA 1UFOA 3I4LA 5KOHA 5TPWA 2W2LD 3WI7A 1CY1A 1Q6YA 2GBIA 1EJ2A 4EKNB 1D0SA 3HKDB 3KOWA 4FLEA 2PUJA 3EIWA 1NI4B 3O8CA 3IVCA 3WZLA 5DOVA 3A31A 3L92A 3WB2A 1LC3A 4OHYA 1DRWA 2FZGA 2HA0A 2O8VA 4CLRB 4ZCPA 3G23A 5B2FA 3ZGZA 3VJKA 2I7CA 1KJ9A 2C9OA 2YYSA 3BXGA 2ANCA 3BFKA 4FKBA 1WP4A 1GZ5A 1XN1A 5DIFA 4C0BA 4EAAA 5HRAA 3M6LA 1Z6ZA 2AR0A 2QT0A 4EGSA 1G6Q1 4UPEA 2C7RA 2A0WA 5LYJA 2G1AA 2BHNA 2WYWA 2RARA 3TI9A 1M8PA 3EDRA 2VUIB 3CZAA 3CY6A 4P7FA 4Y2GA 5FI3A 1T36A 3PICA 5ULLA 3U5TA 3D5QA 1XKLA 2E37A 3GBVA 1QDEA 1BXRB 3GGPA 3L01A 4MH0R 1W76A 3IO3A 1AU9A 1DAIA 1T13A 2PS9A 2Z2ZA 3CC8A 2CHEA 4WLVA 5KDOA 2W2XA 4AJNA 3MEQA 4P5DA 2JVJA 3A25A 4G09A 4L8YA 4EW2A 4BO7A 5I45A 3LQ2A 1E3EA 2O50A 5KWVA 2G77B 4O8CA 3O83A 4EY3A 4LDZA 1SQFA 5BSEA 1W87A 4G85A 1AJEA 1RXEA 4OL0A 2TMGA 1R9NA 5KQMA 4HGNA 1BQEA 3R3ZA 5SZJA 2G7ZA 3S1AB 4JNCA 1NBMD 2EFJA 3T3IA 3EARA 4FSXA 2RHLA 3F5DA 3HXPA 2O48X 3JTMA 3FNFA 4HZIA 4Q4LA 2I6SA 4WTOA 1OXUA 4KN5A 5JT1A 2Q6IA 1Z4MA 4Y2UA 4K0KB 2RKBA 1NYQA 2FW9A 2C3YA 3LECA 4NNJA 3IBTA 2YVUA 2Z95A 2PRYA 5CA1F 1ABBA 1Q83A 5DHQA 4KEAA 5LQRA 1TCVA 2WUGA 4D8TA 3HKCA 4DA0A 5A5EA 1N2ZA 4M1ZA 5IJAA 1R0SA 1YRQA 3ANMA 3W3AH 1G5TA 3W5BA 2UYGA 3TEMA 3MINA 1XRMA 4BV2A 4ZI5A 5FULA 4AY3A 2VK2A 2DWUA 3TD9A 3VNRA 4OH1A 2QUKA 5AFSA 1G20A 4HADA 3II6X 1JLMA 2WUFA 4W7IA 4OFWA 2JRLA 4QUGA 4RHUA 5D00A 4Z9FA 2V97A 2J41A 2ZYUX 1LVGA 3PFHA 3RFXA 5F1KA 3MGBA 1K63A 3OJOA 4FOTA 1NVKA 2GTIA 1D2AA 3A4VA 5HFAA 1QFYA 1OH6A 4MVJD 4ZYXA 5E9AA 1LFAA 2FPOA 3DBHA 3RJZA 2FZEA 3SZ3A 3QF7A 3G0IA 1E1CA 2QN2A 1N0UA 2CFIA 2AFIE 2F9FA 3NTXA 2B2CA 2BR5A 5DHUA 3WLTA 2PO7A 4EFDA 1R66A 2NZ2A 2M2IA 2R8EA 2J3MA 3H0KA 3F3SA 1T8SA 5JCJA 3S40A 3HO6A 5LP1A 1AMUA 3KQUA 3THOA 1D9ZA 4CKWB 3KD3A 5LUAA 4EI8A 1KFEB 2E6KA 1BCSA 3AL2A 2QV0A 3MGGA 3MAAC 1EK2A 2G80A 5FB3A 4BJ6A 1DKUA 2P5SA 1C3XA 1YR8A 3E5RA 2JLAA 1DIAA 3BSFA 4HMOA 2M6LA 3DMNA 4F2GA 4D2IA 4AN0A 3I2FA 2AWNA 4L9AA 2A1TS 2G72A 3A32A 4JJEA 1QM5A 4IQ8A 4R05A 5JZVA 1KU6A 3D9QX 2HADA 4JJ6A 5CVJA 3ETGA 5EE5B 3GWZA 4BMOB 4P2GA 1YR1A 4HB4A 5F3RA 5CA1A 2Z57A 3PI7A 5JQGF 1CDDA 5AVRA 3D8HA 3QVGB 3WB1A 2AG8A 1ZVVA 1BDIA 4LXQA 4LZWA 5JE8A 1CR0A 3AWIA 2H5EA 3JQCA 3TLKA 1V6AA 2ID8A 4YAWA 2AJDA 4B40A 1WRBA 3D7RA 2GHQA 1YT5A 2CY0A 3KUUA 3P5SA 2CHGA 4FNGA 1EVLA 4KPGA 1JZSA 1HF3A 3RTDA 2VEOA 1ZI9A 1ESMA 1W88A 1EUDA 4AJHA 4ZO4A 1XP8A 1UWCA 1Q3HA 2OCBA 1HYEA 4M22A 3ZS8A 3AHIA 4PSDA 5BUQA 1NVEA 4Q4HA 3T5DA 3HCRA 3ZQ6A 5C5IA 1VG8A 2IIQA 2VNKA 3B6EA 3NDRA 4WK6A 3LAWA 4C30A 3A9SA 4KNVA 4ENUA 5AVKA 2G4VA 5FPKA 1I3CA 4PG7A 3VSAA 3TUJC 3WBJA 1PNQA 3IAEA 4M76B 5DNUA 3E22B 3OQ6A 4RVGA 2VQ3A 3GCDA 1S1CA 5C8VA 4PS0A 2YVQA 3KZCA 5EHXA 4B2YA 5DLYA 1YJAA 1OQAA 1TQ2A 1TO6A 3EQ6A 4DSOA 3NHMA 5AKGA 4F6RA 2AXEA 2VBCA 2ZSUA 1CUVA 1T5DX 3C3BA 4GQAA 3EULA 4KBFA 4DJAA 1SBNE 1VLHA 1T8RA 4DV3B 3UKJA 4B2PA 1P80A 2F3SA 2PZBA 2YW9A 1BFUA 1CU1A 2WZBA 3GDOA 4S1NA 5EMJA 5JD3A 5EPUA 4ZV9A 3WG9A 1H1TA 1XWWA 2W2OA 4C06A 1BGVA 1TX4B 3TLEA 5JQGA 4KPEC 3UC9A 4RCVA 1UOPA 2BGKA 1Y6FA 4WJLA 4QUBA 2O2EA 1T2CA 3PNPA 4K05A 2Z58A 2PEYA 1V1MA 1SCAA 3N5KA 4JELA 2XYHA 5B2EA 2IY9A 3VYTB 2DFPA 1ZKMA 2PRKA 2W4QA 2QTAA 2DFDA 1NVAA 3GRFA 3N2KB 3O03A 1DX4A 1XHLA 3DYVA 3P2IA 4S04A 4RIEA 4O2BB 3R2JA 1DAMA 3PE6A 3EGIA 5A4DA 4F84A 1MA0A 2YBDA 3L49A 1U5BA 3T7RA 3OKCA 4AM8A 4EVSA 4XVCA 4OKNA 2X3YA 5IFKA 2UYHA 4PZPA 3IAFA 1FDTA 1X87A 5AHKA 3FDJA 2GO7A 4X20A 1XPJA 2BBOA 1KVRA 4KZKA 2JKZA 3ASUA 2ZB7A 4JX8A 5ALUA 3W2TA 5K6AA 5I8ZA 1FFXA 1VBNA 2PX3A 4JDUA 4MV3A 3T1NA 3HRKA 1C5KA 2H8GA 4PVDA 4KUEA 1UUFA 1ZA2A 3SC2A 1F0KA 3NRJA 3TE6A 3VTZA 3MYYA 3OH8A 1JXMA 1W2GA 4J16C 2WE7A 4TYMA 1P4GA 4L8WB 1GXSA 4KB5A 3PVCA 5KVSA 3M3HA 1IHXA 3BHNA 3WSVA 2RAPA 3GMDA 5AJUA 4UXIA 3D3NA 1DJLA 4YJHB 3W6PA 2GJAA 1CY6A 2QI9C 1E1DA 4AMYA 1VB5A 2I3AA 2YMQA 4H4CA 3H75A 1E2BA 1Z2OX 2OHFA 2BC9A 3BD7A 3UPUA 2GXAA 4UCXA 1JU3A 3CH5A 3MWJA 3WGNA 4UNNA 2QY6A 4II2A 1JL3A 1I0ZA 4EJ2A 3PEEA 1YHNA 2IZOA 3BGSA 3GA0A 5JSUA 5JVDB 1ZXLA 1LRLA 2GO1A 4OJKA 3VSCA 4O4HA 2NUBA 4YMIA 1JU4A 1C8LA 3KO8A 3LPDA 1W5FA 3L6RA 1X7WA 3G1UA 3LKBA 1I01A 3JQFA 5DLPA 5FPQA 4DBLE 1JSRA 5BSFA 5HVNA 1GPWB 5FPYA 3OLXA 3PJGA 4I08A 4ZZ0A 3A1UA 2GVZC 3ETLA 4NPCA 3ASZA 1FB5A 1N0WA 3BAFA 1N3BA 3FWHA 5J59A 3W79A 4RWZA 1OPRA 2FLVA 3K35A 3NRCA 2IIBA 2X40A 1L6RA 2QMYA 3JQEA 3ZWOA 1E6EA 2FUNB 1ENYA 2CL7X 3QHAA 4HNHA 5I7HA 1WDWB 4UDXX 5I47A 2XRMA 4HAIA 5LIRA 3HCAA 4LZZA 3TGPA 2YN2A 3U7FB 1E2LA 2FPWA 4CDNA 3E18A 1U2PA 521PA 1EUZA 2QAGB 1V5EA 4LRXA 4CFSA 4RK0A 2QSYA 1HYQA 1GP2A 2F2TA 3UEOA 4N41A 1IHYA 1DT5A 2FW6A 3AJEA 3NEJA 4TL9A 3GGSA 3ZDEA 2H2FA 4BQOA 5A5VA 3WLFA 2ENWA 3AEXA 3PGVA 3UBTA 4QXMA 3I1IA 1US8A 2SCUB 2CB0A 3EE6A 3FTPA 2TS1A 4HS4A 1E3QA 1RM0A 4WEOA 1C3JA 1Z8FA 5E4JA 3K1AA 5FUWA 3F96A 2YH2A 3VU8A 1D8TA 4I8DA 4P1ZA 2XCSB 4R8MA 4WW0A 1IOWA 2PMBA 1U9IC 1YDWA 2EU8A 3BJZA 3FZYA 3QEMA 2NAPA 4EZBA 1BYUA 2WD9A 2EWVA 4L02A 4EL5A 5CG2A 5FOWA 4F6CA 3FMVA 3C8DA 3VNQA 3H6HA 1TU3A 2Y66A 5IK2D 1J09A 2Y1DA 1BFKA 1O54A 5JYCA 3WLIA 3ZV6A 4BVJA 2I62A 4ZVVA 3OT5A 4XM0A 4A6DA 4Q39A 4MEJA 4Y0AA 3OZBA 5EKDA 3FZEA 1UH5A 1K66A 3IE2A 3K6SB 4JJ8A 2QM7A 1DIBA 1A5SB 1RI3A 3C7CB 2P4EA 3PVZA 4G0ZA 5G2OA 3WQHA 2AN5A 3AVUA 1DBRA 1QO0D 4F06A 1YASA 5H83A 1SELA 4DLTA 1Z8NA 4OD0A 3VXKA 3OA0A 2OD9A 3EJWA 1Z2AA 2C0QA 3BF8A 3UAYA 1AO0A 2B7LA 3TX2A 2NG1A 4J0IA 1NYRA 5MN5A 2C7OA 3ZLUA 3EPRA 1GPH1 5KNDH 1YJCA 3JWHA 5ALYA 2XUKA 3I2GA 4HZGA 3GIWA 5CVUA 2HA6A 3RC7A 4FD3A 3VJMA 2FEAA 5TQ0B 1RSZA 4P84A 1SJ9A 4TWZA 3ZKAA 3ZH9B 5CLQA 4II3A 2Q27A 2VG8A 3H86A 4WH0A 1Y34E 1E3LA 5SZIA 2VPYA 2NW6A 2B8EA 4ZAGA 2NP7A 1PWEA 4IWNA 3I12A 2Q99A 4NVRA 1FIUA 2HXYA 4FFBA 3N2IA 4MA4A 4GNKA 3KPUA 4IW3B 2R6GA 4ZPXA 4JI7B 5K01A 1PVDA 1HSZA 1T35A 3OIDA 2O0HA 4RF2A 2QROA 1K1EA 1WAMA 2VTBA 1PTJC 1JNXX 1A3CA 3HXKA 4UDOA 5F5XA 4ZIRB 2J6BA 1KSHA 3KVYA 4IOJA 1S2IA 1R5NA 1UAYA 1X7ZB 3G89A 4GWLA 1OY1A 1U8CB 2BKUA 4YROA 4A26A 2FETA 3GBSA 1IG3A 1Q0SA 2QE7A 2JHFA 2O0JA 4YXWA 3WXMA 1MQ8B 4FS3A 2G5GX 3LRTA 1GCUA 4KQHA 3F8TA 5JAQA 1XMJA 4B6EA 4C1NA 3I39X 4HGQA 4ZYLA 2H2WA 3WYCA 1DI0A 2A35A 5GJVC 3FMGA 3EISA 4BTVA 4EZEA 2C00A 1H2HA 1R64A 1WB4A 2XWPA 3FPBA 2A0FA 3EY4A 3IVMA 3K4PA 2P69A 3LBFA 4CMIA 1J33A 1Z4QA 4O2RA 2Z4SA 3RJTA 1RRKA 1I3LA 4Q6WA 4C7VA 1N8SA 3B38A 3KALA 1Q0UA 3AF0A 3HDYA 2AL7A 4H15A 4OATA 4B09A 3R0IA 1G0NA 1U11A 2BCGY 4YRFA 1OIXA 5T4FA 3ZKWB 3ZW8A 4DEXA 5E9QA 4RBNA 2AEEA 2CXSA 3NASA 3B85A 4ZVLA 2ZDGA 2P1DA 1IUPA 2PUGA 4XXHA 1JR4A 2X5KO 4J1NA 1QTNA 4G0QA 4DDKA 3PWTA 3U0VA 3QLVC 1O97D 2DGDA 4Q4AB 1YTUA 4ZT5A 2VS1A 3W2GA 1ZD5A 3KKKA 4IUCS 4MR8B 3JRNA 1AV7A 3KSMA 1PRYA 4ZYVA 1YOVA 1WB6A 5J2TB 1O4WA 4CEHB 4PX5A 1RC0A 1RI2A 3N2GA 1A8SA 4LFCB 4E5DA 3ADOA 4R31A 1F1BA 3TR5A 5BR1A 3AUJB 1QU3A 2OZKA 3FB1A 3RYIB 1F8UA 1USVA 5B7QA 1Z6AA 1DU4A 3KCNA 4HX5A 4E03A 1SVKA 1KEPA 4UCFA 4QVKA 3STWA 2XUZA 5C2JB 1HT1E 3LP8A 4F86A 1QONA 4I4LA 4F91B 3EG9A 3RUPA 2BGWA 1NQAO 3C98A 2E2WA 2M6RA 2PANA 3LVQE 3ZE6A 1IXKA 1XAIA 5E1DA 3VR4D 4A03A 4BLOA 1Z4IA 1CE8A 3HB7A 3EVZA 4B6SA 3IDFA 3UXEA 3H87A 1VZ3A 2ID7A 3RAPR 1PS8A 3J81k 3RKSA 1H8HA 4PLHA 1T4CA 3LKVA 1LB1B 2PSSA 4P0PB 1MEJA 4RULA 4JLKA 1EWYA 4QECA 1KAGA 1MA3A 1SR8A 3CYFA 2PVSA 4GEGA 4HXFB 4QARA 2HMSA 4KACA 4QNMA 3AVTA 2PX0A 3M6WA 3WTCA 3WISA 4E3WA 5DK4A 1ZW1A 1DUVG 3W34A 2I65A 2V55B 1SQ6A 4XDHA 1YR7A 3U4AA 1BH6A 3VDNB 4N76A 1ZZEA 1HT2E 2XT6A 5B6IA 5I9BA 1ZK0A 3O2SB 5EHGA 3RQSA 1W29A 5A7HA 3HB1A 3N8HA 5HDBB 4JCOA 2IS4A 4A0RA 2QQ0A 2Z6AA 3CB2A 2JFXA 2VRWA 4MVJH 2PUDA 3TOVA 4ROSA 1SG0A 2P65A 3DA8A 4G9EA 5LBUA 5TS2A 3MTJA 1QKIA 3OEED 3PGMA 4J1SA 4C6SA 1SCJA 2V54A 4RHYA 5G1PA 1EVIA 2C59A 2HGZA 3AL3A 2AFHE 4IGIA 2BAGA 1T2AA 4ALJA 3AXSA 3DE6X 2UYQA 3O8DA 2ZW9A 2WSIA 3B6KA 3KOUA 3Q40A 1QGAA 1TW2A 3WQQA 1HZZC 3GUCA 3A1TA 1LGYA 4C0QC 4MS3A 2ZIUB 2Y4OA 4WI1A 1LF5A 5FXMA 3U60B 2ROQA 3FBTA 1AGXA 3B2QA 4BFCA 4KN6A 1E1YA 2FZLA 4A0QA 4CMBA 1T2FA 4PQRA 2JJYA 4EUSA 4HNSA 5JSHA 4FOLA 1B16A 2LUOA 2FQXA 4MW5A 3STVA 4AULA 4BNDB 4UQLA 3UPTA 2O7VA 5L3SA 4G0VA 3HJFA 4QNNA 1DQPA 2VDWA 1GL9B 1M34A 3T06B 1GTL1 5EJMA 1QGOA 3CVVA 2NQTA 3IELA 2CMDA 5EC8A 5DM4A 4HEA1 2B4RO 3CVUA 4Z4IA 1U3GA 2HNKA 1G3IA 3EMKA 4M36A 4FYVA 3DVSX 4UBMA 1UKYA 1TZBA 4XEHA 4DWWA 5BT9A 5I5EA 3ZEAA 1A69A 5F7ZA 4GQIA 1P33A 3BE6A 4B83A 1UZNA 2GR9A 1D6JA 4A1OA 3RCBA 1GLGA 4HDCA 4OY3A 1L5SA 1QV6A 1INLA 2HF9A 3VVMA 4A2WA 1AMNA 2VUTA 5L3QB 5JCOA 1JALA 2P11A 5TPZA 4EY4A 2R84A 4LJ6A 4I46A 1SHTX 4MV8A 3RSZA 2YUIA 2ZJAA 1OSNA 3MTQA 4HQ0A 4RL4A 3UGKA 4AMGA 5I3CA 2Z9BA 1E99A 1P6UA 2H2GA 3IURA 3M1IA 4JX9A 4XCXA 1QPGA 4G5FA 1EWRA 4WK0B 3U4HA 4E32A 2NSLA 1Z7BA 2W42A 3TSAA 3D81A 4TWAA 1A9RA 1YZVA 2OSVA 2DQZA 2PVCA 1M0SA 4IIYA 4KXMA 4QFDA 2R85A 2ZJ1A 5F9MA 1OZAA 2WYUA 3H97A 3T9EA 1TTQB 1EWVA 4L08A 1KEEA 4XOUA 3IMEA 2WU3A 1U7ZA 3C3YA 2WT4A 4M1EA 1F0PA 3BCRA 1FP4A 2VDLB 2MJLA 3LD9A 2O4CA 3K1YA 4TYWA 3F4LA 3FGPA 3W04A 3WNBA 2ZSIA 5BNIA 7ABPA 4UBIA 4AROA 5BW4A 1NKVA 5E4YA 3U3MA 1WU7A 2B82A 4UFPA 4G56A 1RZRA 5AW4A 4TMYA 2IY8A 3TD6A 2DSTA 3V33A 4BS9A 4BCBA 5HKKD 2WJIA 1GYQA 4ER6A 5B4TA 3OCJA 3VUEA 4TQGA 1J0CA 1UOEA 2W6OA 4BQSA 1DIOB 3DFIA 2I9PA 2G8NA 3OMLA 3P45A 2O2ZA 1CT9A 3ZU3A 5FV4A 3GRUA 5KTRA 3IEIA 2X23A 2DPYA 1ZK3A 1KAQA 3AJ8A 2CKMA 1Q1AA 2QBYA 3G0HA 5D7NA 3PLNA 2PA0A 2AYXA 2F3RA 2OCAA 4QQNA 4BWYA 1EUYA 3LT1A 2ILTA 4X1IA 3BZUA 4AS3A 3G49A 4HV4A 3EFBA 1CVLA 4TVKA 3HCOA 2CL0X 5KKCA 2O54A 3HCCA 3R4VA 5EN4A 4YAUA 2HK8A 3O1LA 2ZBGA 4NS4A 1WBBA 1TA0A 1WV0A 4QDKA 5ALQA 5AVWA 2VF4X 4AUKA 2R8BA 2ZIXB 2NV2B 3HYCA 1TUEA 2HDWA 3IS3A 3HJCA 1HQCA 1L5OA 3HWWA 4EM6A 2J9GA 2WABA 1MAUA 3FZNA 4KL8S 1NHWA 3KKOA 3VOSA 4PRYA 2C04A 1VSVA 4Z4HA 1KMHA 2BISA 3DGFC 2Y0CA 4LZAA 1ISRA 2Q0QA 1XLVA 2FE1A 3AO0B 1D5CA 1RYMA 3IQWA 5DBEX 3LQFA 3U7QB 1RNLA 4H18A 3GLFE 5LR6A 2MU1A 5EWLB 3RVJA 4NCIA 4HTFB 1E6KA 3LCRA 2Y05A 3PQ8A 1S5PA 4QUEA 3SHTA 1M8JA 3H1BA 3V7NA 2YRXA 2BGLA 2E1RA 5KYYA 1SZPA 4FNAA 2GBCA 5KWSA 1WVGA 5FTJA 4NI5A 2YZGA 2NYAA 3B7PA 4FYPA 3KYDB 4HDRA 3REOA 3RIXA 2QG4A 4GI1A 4FE7A 5F7XA 3M6IA 1EM6A 1GSOA 3CVOA 3GO4A 2P9ZA 2HIGA 3DV2A 5M3BA 2ZATA 1SVMA 3JD1A 1QUEA 3IJPA 5KEIA 2C3MA 1E62A 2EFEB 1G59A 5LDGA 3U4QA 1U4NA 2GBPA 4PTYA 1N2IA 4P32A 3UCXA 5A4MS 5A3SA 4YUYA 1CZHA 3H1TA 2MSLA 3VTFA 4C05A 2F1RA 3X1JA 2WG0A 1T3SA 3EC7A 3RF7A 4R5MA 1GYRA 1RLOA 1SURA 4W5RA 3T7EA 1JFSA 4O2AB 1JLSA 3UN1A 4AWBA 2PMCA 3I3SR 1CXZA 3JARB 4CEJA 1G1AA 2QM3A 4MWSA 4RU1A 4AJEA 1NASA 5JNTA 3HYNA 5K0ZA 1J0XO 5IWAB 4AQYB 1DC5A 1E61A 3FTCA 3IDAA 2IS1A 2O8EB 3URMA 1Z5VA 2P41A 5SY9A 1UT5A 4QM7A 1ZIYA 2PWYA 4QQFA 3DD1A 5THQA 2CF5A 1PV2A 2O3RA 3E4DA 4CLEA 4PFQA 2I6FA 2Q2OA 4BZZA 4IXNA 2R66A 4NTZA 4RD1A 2CB9A 2PN1A 2OM2A 3GHHA 1X3LA 4YRAA 5CCDA 3D3KA 5CG1A 5ICGA 4GKJB 2IE0A 3FETA 3QE0A 5DCWA 4EGAA 1EM8B 4N48A 4BNKA 1C3LA 3PE4A 4M49A 3A1VA 4AJOA 2X0NA 1PZMA 3NHKA 3C87A 3OFKA 4B84A 5L4LA 2WICA 2G08A 3RSCA 1T91A 2WIGA 2J9FA 4QTXA 1RWOA 3RNOA 4XLTA 4CR6A 4X24A 4HP8A 3D0RA 3ZBTA 2XCLA 4KLCA 4LOAA 1FW6A 3BWXA 5HXAA 1O96A 1O5TA 4GPEA 4JSYA 1Z17A 1GNPA 3VSDA 2QB5A 1SCBA 4MPRA 3BGOS 4V0KA 2TMDA 2GJKA 4FI3