2F1RA

Crystal structure of molybdopterin-guanine biosynthesis protein b (mobb)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
148
Chain Sequence
LILSIVGTSDSGKTTLITRMMPILRERGLRVAVVKRKDSWKIYNSGADVVIASPVKLAFIRRVSEEEGNDLDWIYERYLSDYDLVITEGFSKAGKDRIVVVKKPEEVEHFRQGRILAVVCDERVDGHKWFRRDEVERIAEFILSLLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords molybdopterin-guanine dinucleotide biosynthesis protein B (m
publication title Crystal structure of molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
rcsb
source organism Archaeoglobus fulgidus
molecule tags Biosynthetic protein
total genus 47
structure length 148
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f1rA00
3K0AB 1OXSC 3KZ1E 3QPUA 4GBMA 4YC7A 1WBDA 4Q7JB 5JFGA 4DCUA 4ARZB 3U5ZB 2ZTSA 5FUVA 1W2GA 2OE2A 1BIFA 3T1TA 4BFTA 1TEXA 4RZUA 521PA 2DFKB 1JAHA 3TRFA 2J7KA 2OESA 2ZYVX 1QVRA 4OQXA 5SZJA 5BN5A 2YC2C 4DLWA 3CONA 3TBKA 4B6FA 4PFSA 5LDDC 4JVMA 3K70B 3TW4A 4E5UA 1FMJA 1OPXA 2YC4C 2IEYA 4QNMA 5JJKA 1CR0A 1YZNA 4OI4A 1ZCBA 3F0TA 1Q22A 1T6NA 1UDXA 1XTKA 5EP2A 1KSFX 2BVNA 2CL0X 2Z83A 4EFMA 4FMDF 1E6CA 2JDID 1AKEA 2QI9C 3H0KA 4NHOA 3VR5A 1G4UR 2WIAA 2KBEA 1QG2A 4LY6A 2OAP1 1SXJE 1H8HD 4PC7A 1ZD1A 4E07A 3FPAA 3W6PA 1EX6A 2ZYUX 1GG2A 1LTQA 2WSSD 4TLEA 4BFSA 2XB4A 3OEED 3GLGA 5D3MB 3UPUA 1Q3TA 4YLGA 4CGZA 1UKEA 4Q9JA 5L3QA 4KCGA 1GSIA 5GVSA 4DSOA 4GZMA 3QQ5A 2QRZA 3MG9A 1U90A 1E1QA 4ZIRB 4V03A 1LVGA 3CBQA 1W0JA 1XTRA 1ZIOA 3WMFA 1OHHA 4LGMA 4URUR 3ZZTA 1HV8A 2B6HA 4FMCB 1ZIPA 1VCIA 2IK8A 2J0UA 4U5XA 1Z6AA 4ESHA 2YV5A 5TV2A 1L7VC 3FTQA 2YWHA 5J5CA 2G0NA 1NLFA 4KYIB 3ONWA 1I2MA 4B75A 1CJMA 1AN0A 4O2LA 4F91B 4V0LA 3AH8A 3CH5A 3OIWA 3WY9A 2IHYA 3TAHA 1FL9A 1XMVA 2GXQA 2XNDA 3SFZA 2VL7A 3ZZUA 1CF4A 3LBNA 3GEIA 1NKSA 4BZQA 1KAGA 2RGCA 3CRVA 1GM5A 1YQTA 2V8OA 4HDOB 3ZZ0A 3TGPA 1QDEA 1NSFA 1Z6GA 3R8FA 4CYMA 1N2CE 2QRNA 2Z0MA 2RH5A 2NPIA 1RJ9B 4EKDA 3DMNA 1CKEA 4QM6A 2IHBA 1YHNA 4Q5IA 2B8WA 1TL7C 5FL7A 3ZH9B 2QPTA 2ZQ5A 3THXB 2YNMA 3QXJA 1KZ7B 1U9IC 3R9XA 4IW3B 3E70C 1PVOA 3C15C 3QENA 5FUWA 5TMPA 1P3JA 2PEZA 3L8YA 2NO0A 2WOOA 3RSLA 1WB9A 2GBLA 4B3XA 4OBEA 1XEXA 4A92A 4I81A 2WWHA 2EWWA 2ANCA 1J70A 4FXPA 2Q3HA 3EZ9A 1KZGB 4WOPA 1M74A 1AIPA 1UKYA 3THWB 4CRWB 1TADA 4JVSB 5K8LA 4C3ZA 3K53A 3PITA 2QAGB 2ZETA 4AYXA 4MQBA 3OESA 3TE6A 2ZRPA 4G5SA 4A15A 1D8TA 4JLDA 1E2EA 5EQTA 1E79A 2DFNA 2GZHA 2ZUCA 4BE7B 4LJ5A 5GADl 5BYKA 2N42A 3EASA 4KODA 3ZVRA 2XGJA 3K70C 4DB2A 4WAUA 4Q4JA 1XCGB 4IVQA 2OCYC 3DZDA 1R8QA 2ZSDA 1FUUA 2QA5A 4KI0A 4OK5A 3PEUA 1P2VA 5FBRB 4AI6A 2A3RA 1DE0A 2P5TB 2LKCA 3LWNA 3QF4A 1G8PA 3CNNA 2ZSBA 4V0KA 4D0NA 2Y8EA 1D9XA 1V5WA 3B2EA 3NC0C 4PR0A 2Q6TA 3HWSA 2KBFA 3WXMA 4RZXA 4DLSA 1XB2A 1NN5A 1OKKA 2ZROA 4D0GA 3AF3A 1WF3A 2IT1A 3SN6A 3GEEA 4PAQA 4TYYA 1CJUC 1XRJA 3L0PA 1CXZA 1G7TA 2P5SA 2Z4SA 3IUYA 3PFIA 3R7WB 1DARA 3HPRA 2GEVA 4B3FX 1H8EA 2WAYA 3T12A 2CL6X 2H1LA 4W9MC 4ABYA 2LWIA 4CEJA 1DVRA 2J9RA 4Q47A 1AJEA 2OAQ1 2IUUA 4JLAA 3LLUA 3H4MA 4A36A 1XD2B 1EWRA 3ZIAD 1B0UA 5B2ZA 5EZ6B 1SVWA 5CLQA 3T15A 1J7KA 1G8YA 3CZPA 4XJXA 2ZRFA 4FINA 5FTJA 2N46A 2WWWA 1BYIA 2W6JD 5JCZA 5FOXA 1ZM7A 3D31A 3IHLA 3L0IB 4NCNA 4XTCS 2GZAA 2ZJAA 1U2RA 1KMQA 2IXEA 3QJYA 2FSGA 3PJRA 2W58A 1E2NA 2ODNA 2BBWA 1LNZA 2XITA 3LD9A 4LJ4A 3ZQJA 1AS3A 3A6PC 1ZM3A 3BB1A 4B3GA 2P67A 1FNNA 4WIAA 2O8EB 1GTVA 1KOFA 1W49A 4DCTA 4Q1CA 4FCTA 3V9PA 2CHVA 1T91A 3ASZA 5AR1A 2MSDB 1JNYA 2JJ8A 2GEDA 4AKIA 1W0KD 4JLOA 3W3ZB 4EIWA 3I72A 4YMVA 3WP0A 3FDIA 3KQUA 2QAJA 2R6DA 3LAWA 3LY5A 2R6CA 4LJ9A 3T34A 2FU5C 2C99A 3DPUA 1CU1A 4TMKA 2HF9A 4FWTA 1XPUA 4A8JB 5E7IA 5SZHB 3UATA 3BGWA 2IYTA 4QNRA 3DDCA 1MOZA 4JBWA 4KXFB 4W5JA 1G5PA 4QJ3A 2QQEA 5P21A 3GEHA 4LJAA 1E2JA 1JECA 3W3AA 3VKGA 1N6HA 4RVCA 1KI2A 5J47A 5JECA 5TB5A 1T5IA 2R8RA 5HZHA 3QVVA 3KQLA 2GCNA 2MSEB 2FEOA 3BFXA 3NC1C 1DAHA 3EW9A 2AKAB 5FI0B 1AQUA 2GAAA 1NI3A 2W2VA 2VRWA 2G77B 4HZIA 5JJIA 1RRGA 5KNCA 2JJ1D 4EPYA 3PEYA 1BMFA 4TMZA 4Q4AA 2ZI6A 1E2DA 1NN1A 3QXCA 1W2HA 5J4KA 3W6NA 4L9WA 4AG5A 4FWIB 3GLIA 3U4QA 4ZCMA 3B78A 4G3XA 3A4LA 2ZS8A 3TQCA 3B9PA 4X8HA 1SKYB 4ILEA 3B13B 2H18A 1KDRA 4DT1B 2D62A 2JCSA 2ZRCA 2Z43A 1G17A 3MLEA 4YMUA 1XXHE 3I1FA 1NY5A 5KSYA 4CEIA 1ZD9A 2FA9A 4M1OA 2OUKA 1XMJA 3LW7A 2ZU0C 4A2WA 3D3QA 1Q0UA 4GOKA 4LYAA 1GAJA 2QENA 4ZPXA 3SC3A 1ZINA 1P73A 2BEJA 3PUZA 4CW7A 1E9BA 1Q1ZA 1FOEB 1EG7A 3CO5A 4B74A 3ZS9A 1TU3A 2BM0A 3BC1A 3DOFA 4B48A 4HI0E 4JL6A 1IN5A 1D2MA 2PEYA 3KTAB 1XWIA 3U3MA 5HKKA 3DM5A 3A1SA 2EFCB 2YOFA 5AJXA 1UEJA 3UWOA 5AUNB 2RKOA 3BH6A 3EC1A 1KSHA 2O8EA 3TSOA 3OEHD 4TT3D 2J87A 1IXZA 1E96A 1KI9A 3UG7A 3I8SA 2QGZA 3T1QA 2QE7D 2BMDA 2XZOA 2DWQA 4KO8A 4M1SA 3SYNA 5CIQA 1KYIA 3KB2A 1EX7A 2QGNA 4RD2A 4XH9B 3N5CA 1AGPA 5G53C 3UXMA 1JPNA 4QG7A 3LXRA 1D6JA 821PA 4PAOA 1JR3A 3TLXA 5HZKA 2HXYA 4D25A 2C77A 3I8XA 3KXLA 3MCAA 3TNFA 2ZSFA 2HJVA 4Z1MA 1NP6A 1HT1E 2AWOA 2KJQA 4CIDA 1KDPA 1MO5A 1Z0AA 5DI3B 5C1BA 2WPDA 3AGPA 5JEDA 4G1UC 2EQBA 3TH5A 1GNQA 2IYXA 3MRSA 4A8JC 1ZM2A 4L8GA 5EXTA 4JT2A 3HPQA 1E0SA 1YZUA 1FPMA 4DJTA 1VCOA 1X3SA 3EG5A 3K09C 4ZI2A 4QGGA 4C0BA 2PZFA 1KO1A 2GAOA 1CR4A 2V3CC 5L3SB 4Q7MB 4JZKA 4JVNA 3KJHA 1PZNA 4URYR 4TWZA 3QKSA 5C4GB 4LWZA 5JBQA 2E1RA 4OI2A 2XAUA 1E9DA 3MFYA 3EWAA 3A1VA 4DEXA 3LH5A 2QPOA 2DWOA 2PH1A 4IDNA 5SZKB 1OT3A 3TSZA 1G9XA 4LX0A 1NRJB 3CRQA 1KI1A 1SVIA 4KLZA 1B23P 1VECA 1JALA 4HB2A 4YDSA 1MRNA 1J90A 2CK3A 4AG6A 3GLFE 3B1YA 3HYRA 4K81B 3QG1A 1Q12A 1LW7A 4XVRA 3KQKA 2D06A 1E1QD 4QHTA 3AF4A 4EQ6B 2QBYA 1W0JD 4MKGA 3ADBA 2D7CA 2EYUA 1UBCA 2R65A 4DDUA 1OHHD 1NVWQ 2P6UA 3LVRE 1RVDA 1T0HB 3WNBA 2H57A 2VSXA 2ORWA 1S1MA 4XOIA 4IKEA 4NCIA 3ZJYA 5J40A 1U8YA 3EZ6A 1KK0A 1DAFA 1OYWA 2NQ2C 2FMXA 1Q1EA 3K1JA 4X8LA 1GRRA 1Y3AA 5AUQA 3KJEA 2Q3MA 3I32A 3KTAA 2ZE5A 2YVUA 5EE5B 1JAIA 3K0FA 1RYHA 4R9UC 3P4XA 4FN5A 3VR4A 4ZKDA 2FGJA 2ZI4A 4UNPA 3AKEA 2AHOA 5DSZA 2FFBA 2IWRA 3QKTA 2E87A 2XNDD 3CRW1 2YWGA 3FGNA 2WJJA 3GCGA 2VYFA 1Q57A 3E2IA 1AZSC 4UNRA 1OB5A 3NH9A 3KJGA 1Q3HA 4EJSA 2V7QA 1P9WA 2W2XA 4P4TA 2MMGA 4NYMQ 1D9ZA 2GCOB 1E9CA 4M22A 2FEMA 2DB3A 4R7ZA 5FBLB 3RAPR 1T8TA 3ECCA 1CJVC 4UXIA 3DM9B 3LW8A 3RHFA 5D3QA 2WKRA 2OCPA 5FL7D 3H86A 3UMRA 2X1VA 2WICA 1WDTA 3B1WA 1II8B 5F3WB 1HYQA 2QMHA 4ZDIA 1A2BA 5KSPA 3NEYA 2NO9A 1HY3A 4URXR 4OHXA 4XWOA 2C03A 4DLXA 3QPVA 2B7BA 1CR1A 4YMWA 2BKEA 3GFOA 4FW9A 1SZPA 3D6TB 3MWKA 4JKYA 4LBZA 4ZI3A 4AYTA 1DOAA 3GLHE 4HLQB 4OHVA 2XJ9A 4PZZA 5K8IA 1E3MA 4TLBA 1S4QA 4LHVA 2KSQA 2Z5FA 1J99A 1G3IA 2ZS7A 1VG1A 5AUPB 5DH9A 5EE1A 5HR5A 3WP1B 1N5LA 2NPFA 4JLBA 1E79D 2OBLA 1U98A 3Q5EA 5IF9A 3GJXC 3GMTA 3ADKA 4HB3A 3TMKA 3MGCA 3PEVA 1OF1A 4TN1A 3NBZC 3ZYCA 4KSBA 4NYIQ 5KNBA 3VR1A 1Z0DA 4B2PA 1E9SA 3ZD7A 1ZNXA 3VR6A 4AKHA 2WHXA 2YZ2A 3KUDA 4CVNA 2LCFA 4S35A 2EFDB 4NCKA 4DCNA 1GOTA 2CMKA 2FPMA 1IN6A 4LC1A 4LHZA 5KDLA 1KI8A 3CRMA 1SXJA 3VX3A 5KHOC 2F6RA 2Z4RA 3R20A 3TVTA 3KB1A 2O0HA 3BS4A 1TMKA 3RWOA 5JEEA 1ESNA 1Q21A 4D80A 2VP4A 1SKYE 1KMHA 3FFAA 2YOHA 2CDNA 2HXSA 2NO7A 5JLJA 2O8FB 2IS2A 2ZUDA 1W5TA 1EFTA 3QUSA 4ZCLA 2O8CA 3JVUA 4B43A 3U44B 4R2HA 2ZE7A 2Z6VA 3F8TA 1KGDA 2A5FA 1H8ED 3PG5A 5CYPA 1G1MA 3G82C 1XTSA 2ODBA 3PEWA 3AVVA 4V0OA 1VYTA 3QBTA 4LYFA 3RVBA 4MKHA 2CNWA 3WYAA 4B34A 3VR2A 2X77A 2JATA 1GL9B 3VX4A 3A58B 3NIBA 1CBUA 2WVJA 2PCJA 4AIIA 4D26A 3UWKA 3THYA 4PSKA 2ATVA 3P4YA 2G9NA 3RC3A 1NBME 4NH0A 1ZP6A 1U0HC 3A4MA 3VFDA 4A2PA 4D82A 3VNUA 3NBFA 4LHYA 4DWJA 4C30A 2GCOA 2JLWA 1FX0B 3SBEA 3L0OA 4TL8A 1C4OA 2FV8A 4OQNA 3W5JA 4A6PA 4YMTA 2HYIC 1G19A 1WP9A 2QN6A 1SVSA 3K0EA 5JSZA 5EE0A 4BLRA 2JEOA 4LJ6A 3U7EB 4OYHA 4E09A 4HUQB 3FE2A 3IIJA 2FG5A 1EGAA 4GNKA 4Q00A 1NMYA 3RS5A 1XPRA 3CR7A 1GVNB 2ZRJA 5J4HA 2ZITA 3TUZC 2ASEA 1KKLA 3OEHA 3PV0A 4IRUB 2BBSA 4JT4A 4BFWA 1T3HA 4H1UA 1RPZA 3T5DA 2HCJB 3H2YA 1XCMA 3PXGA 4UNNA 2VH5R 3K9HA 1KDTA 4M4SA 5FR2A 4CT5A 5F9FA 3B6EA 1ZUIA 4QJ5A 2BCJQ 2I3BA 1YZKA 3KKQA 5GJVC 3RS7A 3WBKA 5H68A 1KDOA 2IUTA 1N6LA 3AF1A 2RAPA 1HQCA 5KUTA 4PX9A 2ANBA 1VDZA 2R9VA 2YWFA 3EA0A 4KV9A 4ON9A 1P62B 1Z8FA 3SE0A 2QEQA 3BB4A 4KBFA 1F6BA 3SFVA 3QXHA 3M6AA 4TZ6A 4GT1A 3KFVA 1MO6A 1NY6A 1AKYA 4J0QA 1P2UA 2BHRA 2WAXA 3CNLA 4QFMA 6Q21A 1BMFD 5EP4A 2ZRLA 1KJZA 1YR7A 3HDTA 2C95A 5FTMA 4KLNA 4CDGA 1XTJA 4PO1A 2ZRHA 4LZZA 5FPTA 3I5YA 3O8RA 4B44A 4P3YA 2H17A 5KTYA 3FWYA 2BC9A 2Q3FA 3PIRA 2XXAA 1W44A 3SDZA 4AKGA 5CK5A 5CDFE 2ZI7A 4S2EA 2GZDA 3SU8A 4B3BA 1RC8A 4YQFA 2DYKA 1S1CA 2JLZA 1JI0A 2ZI5A 2VP9A 3Q8XB 2VP5A 4LJYA 1XXHB 2GHIA 3CRRA 4L5BA 1IXSB 1VIYA 2E9SA 3QKRB 1P6XA 1N3BA 3A37A 1RYFA 4PC2A 3RRYA 3DO6A 2IA5A 3K9LA 4OJKA 3GJ4A 3BBPA 1TQ4A 3SZRA 2ZRIA 2P6RA 1KK3A 1FMLA 5C4MA 3PUVA 2G0TA 5CK4A 3LDAA 4GFDA 1K5GA 5E95A 4Y0VA 4RFSA 2PMKA 5HKKD 1J8YF 3VAAA 4I1SA 4KU4A 4PPFA 2OSBA 5EE9A 4MRPA 1FFHA 3IO5A 2VHUA 4OHYA 1GITA 1IN4A 4RZ3A 1OFIA 3T06B 2VBCA 4TLDA 2AK3A 4P4UA 4UNSA 1E99A 3PUYA 4O2RA 4DHEA 3ICQB 2IBMA 1JJ7A 1OFHA 1ZCAA 1G3RA 3LNCA 4PAMA 4A9AA 2C5LA 3IO3A 3GJ0A 1ANKA 1XZPA 1UF9A 3CWZA 1W46A 3H84A 3KQHA 3W9YA 1U9IA 4TMTA 1LB1B 1JR3D 4DDVA 2XB2A 4PPGA 4BPBA 2C9OA 3RS4A 1JB1A 1TPZA 4TSFA 4QM7A 4Q1EA 4Z1MD 4F4JA 1R6BX 2FJUA 1WCV1 2VO1A 4HB0A 4NYJR 1U8ZA 2F43B 3W6OA 4HEJA 2WTUA 2WPDD 2BOVA 1DADA 2EVWX 1VMAA 1OIVA 3U3JA 2O8BB 2YOGA 1V43A 1KI7A 5CJ2A 4A6XA 5CITA 1OW3B 1O87A 3K0AA 3BFVA 3BH7A 4NPHA 5LPNA 3L82B 1XFAA 5E3HA 2IS1A 3MSXA 1KK2A 2RCNA 3IEUA 2IX3A 1EFCA 4MDFA 4ARZA 2BEKA 3DOEA 2IC5A 2VLIA 1SHZA 5FOUA 2AKYA 5FUYA 1EESA 2HLDA 3PCRB 3V00A 5LD2B 2QP4A 2REXB 4TL9A 4HAUA 1M2OB 1T5LA 2W6IA 5FR1A 1LF5A 2JASA 1P75A 3SYKA 4DLRA 3M4YA 1E1RA 3AVOA 2GTPA 1YJ5A 2V1UA 3M0EA 4AD8A 1UBFA 1OH8A 2VP6A 1I2DA 3L2OB 4X8MA 3T35A 1YU9A 3AVXA 2CK3D 1QHNA 1NMXA 2GEUA 2RGGA 2BCGY 2F7SA 2JLQA 1FUKA 2JLVA 3P32A 3T1OA 5D3MA 4I1VA 4RCYA 4AK9A 1SULA 4HLUC 2PL3A 3HU1A 3GLFB 4TYWA 4RSGA 3AP2A 2D2FA 1HH4A 2WWXA 4ASUA 4ZIRA 3EAQA 3SYLA 3JZMA 1RKBA 5LB2A 1N6RA 1ZYUA 2F3RA 2O0JA 3BJIC 5H1YA 4C4PA 1G5RA 1CR2A 2RGEA 2JGNA 1L8QA 1NJFA 3BWDD 3GD7A 3B1VA 5AJWA 3DZ8A 4YDHB 3GJ6A 4CT4B 2R62A 1ZU4A 1TAGA 5E7MA 1RRPA 1T0JB 1CRQA 1MO3A 2P65A 2UZ3A 2ZVPX 4BUJA 4DZZA 1A2KC 1NLYA 1W4AA 2WBLC 4F7WA 1KNQA 1CP2A 1CS4C 2J1LA 1ZNZA 1TQ2A 4DKXA 3QNUA 4JIMA 1QG4A 1FTSA 4PHHA 3LVQE 1P72A 2AWNA 2QTFA 3K0CC 5LBIA 4MGZR 5DISB 1A4RA 3U7GA 3HJNA 2B8TA 1N6NA 2V7QD 3AP1A 1X1SA 4O25A 2NTYC 1JBKA 1N5KA 1IM2A 4URZR 3GLGE 2N1BA 2RHDA 2QMEA 1F2TB 3I92A 2CJWB 5F2EA 2J0SA 1YZQA 2H92A 4LOAA 3EZFA 1FW6A 3B9QA 1AGRA 1YZGA 1RJ9A 4B32A 5J4VA 1JQLB 4MKIA 4C0SA 3TJZA 3QIAA 2ZJOA 5FOVA 4Q66C 3G5UA 3THXA 1IQPA 2MSCB 4FMDB 4KAXA 3B5JA 1S3GA 1W5SA 4Q48A 2D7DA 4N3NA 2W0MA 4QRHA 2LKDA 3NKVA 4A0GA 3UIEA 2VHQA 2YKGA 1Z07A 1MABB 1XMSA 4WZBE 2AR7A 4DSTA 5EUQB 1JQJC 4C0QC 4NDZA 2FE4A 3THWA 3OF5A 1UDWA 5M04A 2XOKA 1G291 2FNAA 3GLHB 2QAGA 3HU3A 3LLMA 3LQQA 3X1XA 4DSNA 3C5HA 1ZJ6A 3CZQA 4AC9A 1FTNA 4Q03A 1DBSA 3OIUA 2O8DB 1T3LA 4KFSA 5LD2C 3CLVA 5E7JA 3U3RA 2C04A 4EFLA 1K5DA 1T8UA 2WWFA 1DG3A 2OG2A 5HTKA 4PPNA 1SXJD 1LF0A 2VTKA 3Q9LA 4JYCA 4Q9LA 1TUEA 4IOKA 4Q1AA 2PZGA 2HDNB 121PA 1II0A 1UAAA 4EAQA 1W48A 1E0JA 4WZAE 4NTZA 4RZ2A 3O8BA 4D81A 4L16A 1Q44A 4TQUS 3CPHA 1KI6B 1DTSA 2IS4A 1YR6A 4RKEA 4UXJA 3CR8A 3PUXA 4F4CA 3LO5A 4IOLA 1F3OA 4DEYA 4PQYA 2H7VA 3R7WA 2VF7A 3VHLB 2HJGA 2IF0A 3QSYA 4N0DA 5DYIA 4BLOA 2HCBA 3NXSA 3X2SA 1WRBA 4JLKA 2CNWD 1T9HA 2OCAA 3R8CA 5BQ5A 4TTPA 2CCGA 1W36D 3N2IA 2D4HA 1E2KA 4LBVA 4GRAA 4XSHA 1I4DD 1GL7A 2F1HA 4B6EA 5BN4A 2V6JA 4D4KA 1XD2A 4PC3A 3VHXA 2PMDA 1N0VC 2GF9A 2OO7A 3CF0A 2CHGA 2OCBA 4C0KA 4D0LB 4PO9A 1Z06A 1ZRHA 2F55A 2XX3A 3C7KA 2PJZA 4Z51A 4NCJA 2CJWA 4BLPA 4BECA 2A7QA 1GKYA 4EFNA 4PHFA 1E2GA 4Q4HB 5ANRB 2OBMA 1DAIA 1PLLA 2R6GA 4RD4A 3WBJA 5J4YA 4JSTA 1X8KA 2HF8A 5FL3A 4RD6A 1W4RA 1MO4A 1OXUA 2WWYA 2ZEJA 2EFEB 1QVAA 1SVLA 4MYHA 4QGHA 4ACBA 3FHTA 2F1JA 4GPTA 4UXHA 3KFXA 2AD5A 2QP9X 4IEIA 4GZLA 2BWJA 1G16A 3U2QA 3U60B 2XSZA 3EXAA 5F9HA 1NVUQ 1OB2A 4L15A 5CYOA 4DVGA 4A8JA 4B71A 1CIPA 1E98A 1R5BA 2CVFA 3PVSA 1NKTA 4LC0A 1KI4A 5AWFC 3BRWD 3K09A 3IQXA 5JS7A 3U3KA 1OLOA 1A82A 2ZRKA 1G21E 2O0KA 3IKJA 3P1JA 3AKDA 4LI0A 4NBSA 4NE2A 4RFVA 1KAOA 4RJLA 4GI7A 1PLJA 2ZUBA 1OH7A 4EPWA 2DFTA 3ETLA 1RRCA 1Z6XA 2XNSA 3QOFA 2CCJA 5HE8A 4AYWA 4ZDKA 4KYUA 5UKDA 1KTVA 3X1YA 4OJQA 2Q21A 4LCBA 2OLKA 4BFVA 1Z6TA 1ODFA 1JEDA 1UM8A 3EWSA 2OFOA 3ZS8A 4GSYA 4O0MA 1ZVQA 2IYWA 3BORA 3OAAA 2FPLA 1ZBDA 1NIJA 4NZYA 3REGA 5KDDA 2NO6A 4GMDA 4P4SB 4TYPA 4P0TA 5KPJA 1G64A 4BLQA 1BYUA 2YYZA 1TF2A 2ZAMA 4LBWA 1MRSA 2FPKA 2A2ZA 1E2PA 1DO2A 1YR8A 4LV8B 5LB4A 1GZSA 1G18A 3MWYW 4HUTA 3CX7A 4PSVA 1JXMA 4DT1A 3EIQA 4JS0A 1QHHB 3FMPB 5TVKA 3UK6A 3QXSA 2ZR7A 4NKRA 4MGYR 4C0LA 3U7HB 1P61B 2WJVA 5L3RA 3A4NA 2ZR9A 5DN6A 1R5OA 4NL4H 2HT6A 2WV9A 2DBYA 4HB4A 3WMEA 4BLSA 1G7CA 2JLSA 2IXFA 2A5JA 1XTQA 1Z3IX 2NZJA 2BMEA 2PBRA 3ZVLA 5A4JA 2WJGA 1XD9A 2PT5A 3MWLA 2DPXA 3IGFA 3KJIA 5EE3A 1HT2E 2G3YA 2ZYWX 4HAVA 3X1WA 1E9AA 3ASYA 4D4MA 3WNDA 1NBMA 3LX5A 2J46A 5G41A 5GJCA 4K46A 1EK0A 2V54A 4FCWA 4MDEA 3HR8A 2QQ0A 2V9PA 2PX3A 2F1IA 3GLIE 1UPTA 1L4UA 3THOA 4URWR 1W4CA 4Z8XA 1KSGA 3N2EA 2D74A 2V4ZA 2A5YB 5JHHB 1ZU5A 4HZUB 5K8TA 4JKIA 2JLYA 1DAGA 3KQNA 5BYJA 1FNMA 5K8UA 2GXAA 3FKQA 4KFUA 3GJ7A 1P5ZB 1QHIA 3VKWA 1BKDR 1YZTA 2ERYA 2V55B 2QORA 1R5NA 3DHWC 3PQCA 721PA 1VHLA 2YJTD 4B2LA 2F9MA 1US8B 5CIWA 5CB6A 3LRPA 3LV8A 4TSFD 3AQ4A 1YRAA 5B57C 1HE1C 3S1AB 1EFHA 3W90A 1IJFA 4BZPA 3GPLA 2FF7A 3CPJB 2EFGA 2VA8A 1YZLA 4QGFA 2OM2A 3BD9A 4M1WA 4ZKEA 4DRZA 1XEWY 3MMPA 1F2UB 5TY0A 4B35A 4QBGB 1CTQA 1U99A 4XVUA 5DI3A 1UKZA 2QT1A 4MRVA 1FQKA 2AFIE 4QGAA 5JMTA 1XCPA 3BERA 1UADA 4MUBA 1KO7A 1N5JA 1K6MA 4CEHB 1GKUB 4JL8A 4PXAA 5CJPA 1SGWA 5CLLA 1E2HA 4BWYA 2HLDD 2Q9CA 3P26A 4MYUA 1HTWA 1P9NA 1E2IA 1MT0A 1IBRA 1M1YE 2J41A 3LA6A 3UMFA 3K70D 1UBEA 1TF7A 4JYBA 2W6ID 5L3SA 5GVRA 4F4IA 1N0UA 3GJ5A 5G3YA 3GJ3A 1A1VA 1E1RD 2ZRDA 1G3UA 1WQ1R 4X8OA 3SJBA 4YXWA 3BOSA 5B64A 5EP3A 3QKUA 1JPJA 4PHGA 2WMNB 4NU0A 1QHSA 4DLYA 1XEFA 1FP7A 1Z28A 3RNLA 1NMZA 1XNJA 2QSYA 1UEIA 2GRJA 1G3QA 3EIHA 3MUFA 3L0SA 1NIPA 1ZM4A 5FUXA 1KO8A 3L43A 2VQSA 4FMCF 3SHWA 5BW8A 2AL7A 4BQSA 4BZXA 1GUAA 1E2FA 4QBIA 4AY2A 3NHAA 4A2QA 4ASUD 4IDOA 3WRXC 4EQ6A 3D8BA 1OIXA 2WM9B 3VU9B 4HYYA 1E0AA 4LV6A 3U6BA 1X1RA 1XF9A 2P0EA 3FFBA 3T1VA 1HQYE 1M7BA 4K8OA 4Q7KA 3RABA 3Q3JB 4M1KA 5H8WA 2HEIA 2WJYA 3NBYC 3WNCA 2IEZA 3WRYC 3I3SR 3IEVA 4DCVA 4HAYA 2JIZA 421PA 1YKSA 1VCNA 1MR3F 1Q1BA 4M21A 3IIMA 2GK7A 4Q21A 5DYGA 4TYQA 4W5WA 3RYTC 4V0ME 4H1VA 1XPOA 4KBGA 4HLCA 2F9LA 3NH6A 5FFMA 3VQTA 4DDWA 1SKQA 4XIGS 1XBTA 1NVXQ 2GESA 1KI3A 4C0JA 2B7CA 4MRNA 3IPYA 5C18A 2L0XA 2KE5A 3GFTA 4MGIR 3AV0B 1XTIA 1VG0B 1SQ5A 5FI1B 1E9RA 2DWPA 2FSHA 1R4AA 2PZEA 3AKCA 3O8CA 2JLUA 2VP2A 3EPKA 4M0LA 4PHTA 4PPQA 3REFA 2AX4A 4Q9IA 2ZI9A 1G8HA 3QVUA 4II7A 4A0FA 3HP1A 2UVQA 1R0XA 4G5OA 4PZYA 5DE3A 5EUMA 3GLGB 3MWJA 5L3QB 3IDQA 2ZI3A 1XEWX 1II8A 2ZJZA 1SHKA 3DEFA 5JI3E 1ESMA 2RGNC 1F2UA 4G5RA 2CL7X 4Q1FA 5KOYA 4G5GA 5B58C 2WSMA 1E9EA 2W0SA 4C0AC 2A78A 1KK1A 4JLPA 4DLVA 1GFIA 4OI0A 2NOAA 1G6OA 2QG6A 3WHKA 2J0UB 4OQLA 4M9SA 2XTNA 3RWMB 1E32A 2BV3A 2QMOA 4ZO4A 3C41J 2JAQA 1CLUA 2XOKD 2ZXUA 4NYMR 1OE0A 2BKUA 221PA 3Q72A 3FMOB 3WYFA 2AK2A 3QXXA 2C78A 2ATXA 3TAUA 3TW8B 3FHOA 1TUIA 4RD1A 4DUGA 4US0R 1G7SA 5H70A 2ORIA 2P2LA 4F92B 2CHQA 4JLVA 1YR9A 3FMIA 3D7MA 5JHGB 1IJEA 1NVVQ 1JEEA 2PLFA 3RRMA 1Z6YA 4JLNA 1O3YA 1VIAA 5AJVB 3T5GA 5JWHA 1M7HA 2JLRA 3TUJC 4P31A 5AUOB 5EXXA 5C2JB 2CCKA 1R7RA 2G1JA 1HUQA 1WXQA 3AP3A 2R6FA 3B85A 4B2IA 3SI7A 2UKDA 5BN3A 2R6AA 4OKSA 5A0FA 5JZVA 3Q7PA 2H8KA 2IYZA 5JS8A 2O8FA 3JVVA 2VHCA 3EARA 3IHWA 2JJ2A 2ZJ2A 1XEXB 3U44A 4IOMA 4DXAA 4Y0AA 1IY1A 1U81A 2QM8A 3IQWA 3TKLA 5KNDA 4IJMA 2NG1A 1ONBA 3W8NA 2WJHA 3KXIA 2OFXA 2ZR0A 3DL0A 1Z5ZA 3MJHA 1XP8A 2QL6A 3H1TA 3B7GA 2CE7A 3A36A 4NYIR 4KVGA 1WE2A 3C16C 3HU2A 3CM0A 1P60A 3P20A 3FYHA 4KSCA 1X8JA 4FD2A 1GDDA 4MGKR 4Q01A 2QNRA 4KJZA 1U0JA 3PR1A 3I62A 3TR0A 2FX3A 4WXPA 5ELXA 3E5HA 4KITB 4GL2A 3CX8A 1FX0A 5JI2E 1NLZA 2Q9BA 2WMOB 5A5GA 2ZJ8A 4Q4JB 3SNHA 2J0QA 1UKVY 1WMSA 1GRNA 2VHTA 3QI2A 4EPRA 2XZPA 3CPEA 1E2QA 2P3SA 1T4GA 5EXSA 1J8MF 1KKMA 1KSJA 3QF4B 3C14C 1KIMA 2WJIA 1N5IA 1RZ3A 1UJ2A 4HUQA 1VPLA 1G8GA 3A8TA 2RGDA 1S96A 2O52A 1P2TA 3AVWA 4AURA 3R9WA 1T3SA 2DY1A 4C2UA 2K5UA 2ZANA 1R10A 2XSZD 3EC2A 4QOSA 2XTZA 2OT3B 1IN7A 2J5XA 2IYUA 4WVFA 1BH2A 1ZUHA 4QJ4A 5FOTA 4DCSA 1DPFA 1C1YA 5JCPA 2OV2A 3UMSA 4CEJB 1I4TD 1E0KA 2V6IA 3QEJA 1OIWA 4UKDA 3UANA 2BMFA 3FKSA 2ZRAA 4IFEA 5FH9A 4NCHA 5EZ5A 2FSFA 3MAAC 3TK1A 5IK2A 2VSFA 3X1DA 2ONKA 3BK7A 1E9FA 4Q02A 2B21A 3T61A 2QY9A 3X1ZA 2QTVB 1G7RA 1U94A 4TTRA 5KO2A 1X86B 4V02A 4C7OB 5DO9A 1ZD8A 1OYYA 4B3CA 1M8PA 4IHQA 1VCMA 2OEPA 2IL1A 8OHMA 3OAAD 4I99A 3R9IA 4Q9KA 4UJ5A 2CE2X 1Z2CA 2ZREA 2NIPA 3AVQA 4A0RA 2XEXA 2W2TA 2QMUA 3AEZA 2GXSA 1OV4A 4MRSA 1W47A 4HLUA 3CIOA 1E69A 5JWRA 4D4JA 4XD7A 1SVMA 2EWVA 4QKQA 3CWQA 1NG9A 3AF2A 1Z29A 4LHWA 1VTKA 2QM7A 2C98A 4DLZA 3DKVA 1VHTA 2EW1A 1TQ6A 4ZDJA 5DN6D 4DIEA 4L4UA 3EA5A 1ZC4A 3J81k 4AKEA 2ZE8A 2GBLC 4LUCA 1S3SA 1NVVR 2CEAA 2REOA 5KSOA 5FBWB 1XXHA 1COWA 1OH6A 1N0WA 3KKNA 3QKRA 1QHXA 3IIKA 4OQMA 4PANA 3BFKA 1X8LA 1NJGA 2IXGA 2ONJA 2OXCA 2DR3A 3AB3A 3NDPA 1GWNA 2IYLD 1MV5A 1K8RA 2IUSA 1NBMD 1I4LD 4LJ7A 1LY1A 4RD3A 4ZCIA 2DFLA 3RRNA 3K0CA 2IYVA 3SEAA 1LV7A 1CEEA 2VPPA 4RKFA 1G8FA 3PUWA 2V1XA 2OXRA 4QBFA 2J7PA 1IXRC 2VP0A 4XTRA 4W5HA 4PSAA 3EZ7A 4Q4AB 4D2IA 4JBYA 2J59A 1DELA 2FH5B 3EPHA 1KO5A 2KI5A 4G0NA 4O3MA 3GLIB 1KJYA 3W34A 3U4QB 1QBKC 4I1UA 2ZRBA 3VKHA 4M53A 4OK6A 4JJZA 3ADCA 4PQRA 1KHTA 1L4YA 3FB4A 1GP2A 4FMBB 5JWOA 1IOZA 2IS6A 3AKYA 3CB4A 3A1WA 4JLMA 4Q1BA 1ZUNB 4XWKA 4DSUA 2TMKA 4EPTA 1F60A 2WKPA 2ERXA 4Z54A 3OE7A 3A1UA 1IN8A 3JZAA 2GNOA 4CEIB 4MITA 2CLSA 3SQXA 4QHYA 2FZLA 1PJRA 2AN9A 2F43A 2Q9AA 3KX2A 2FZ4A 2ZRMA 1HEIA 2EYQA 1BOFA 2OFWA 3RS3A 4OHWA 2O8BA 1W1WA 3SJAA 3AUXA 3ICEA 1S8FA 4Q9HA 5G40A 3BXZA 5FTLA 1GKIA 4ZV4A 3IBYA 4P33A 5F98A 3OFNA 4KFRA 3KKPA 4C7OA 3V4FA 1XMIA 1TQDA 4B33A 1OSNA 4AWXA 4ERNA 1FQJA 2ZM5A 2IYRA 1SVKA 2FWRA 1H65A 1VYUA 4LYHA 4QHSA 4RY2A 1KNXA 2ZSEA 3KKOA 1CJKC 1XZQA 2MMCA 2NMVA 3O8DA 3TR5A 4YXWD 2EFHB 1ZAKA 2ZIAA 1JJVA 3I73A 3NEJA 5B30A 4MA4A 2GXUA 4A0HA 4C2TA 3CKLA 3O47A 4TZ0A 2BBTA 1EWQA 1QF9A 2XJ4A 2ZRNA 4LYJA 1KJWA 1RIFA 1TEVA 4B3DA 2GJ9A 4H9GA 1VG8A 5KYKA 4DIDA 2J3EA 1OFTA 3WHLA 4R2IA 1GL6A 4LPSA 2J0VA 4Q18A 2X2FA 4WW0A 1DS6A 3HYTA 2QSZA 1EFRA 5EP1A 3W5IA 4BLTA 2EU8A 4WZ6A 1QHYA 3Q85A 3GLFA 1G6HA 5FBQB 3GQBA 4LHXA 3SHFA 2HT1A 2GJSA 2REBA 1G5TA 4Z8YA 2NZ8A 4JVLA 2X2EA 3TUIC 2JIZD 1Z0KA 3GFPA 3K9NA 5E4FA 1F5NA 3BIFA 4TLAA 4C9BA 1XJCA 2QAGC 4POAA 2PLRA 1VKJA 2ZPTX 5DIFA 3TQFA 5HPYB 2NGRA 2G88A 2P6NA 4UJ3A 4DLTA 3CH4B 3ZGXA 1GRQA 3WMGA 3EX7C 4U00A 1W7AA 2IF2A 2QT0A 1EXMA 1RW4A 2BDTA 2IYSA 2ZS9A 4PQFA 1D2NA 2C9CA 4TL7A 1G41A 4ACAA 4MRRA 4DDTA 3BH0A 1ZW6A 2ZVQX 4IVRA 5GJWC 1ELOA 2SHKA 1OH5A 2RMKA 2WZQA 3QKSB 4LV5B 5BXQC 3C8UA 3KKMA 1Z83A 2HUPA 2NO1A 3BE4A 1M6NA 2DHRA 1BS1A 3AUYA 4NMMA 3RANA 1TX4B 2VF8A 3M1IA 2GCPA 2AFHE 1LS1A 3AGQA 2JDIA 1CJTC 3AF0A 3B1XA 3LBHA 3L8ZA 3U3OA 1N6IA 3DKPA 1F2TA 1IONA 4D6PA 4GP6A 5KPDA 1JR6A 4OQFA 1H8HA 5CM8B 4M1YA 2I1QA 3TIFA 1Z0JA 4CF7A 1GILA 2WSSA 3OEEA 2QBYB 2PX0A 2WKQA 4TLCA 2G1KA 2RB4A 4KHZA 2OBNA 4LBYA 2FSIA 5HCNA 4XWAA 5AJZA 4Q7LA 1GIAA 2AXPA 1N6KA 4M1MA 4V0NA 2FGKA 3IBGA 1E4YA 3OZXA 3I4LA 3TSWA 1MABA 3AM1A 5FOWA 1LFDB 1NL3A 5AK0A 4GOJA 4JJKA 2YHSA 1EFUA 2ORVA 2QP3A 2FN4A 1E94E 2RGAA 3DMDA 1S2MA 2YWEA 4LJ8A 1VG9B 3Q7QA 4HAWA 3MJRA 4IVPA 4QBHA 1PUIA 2ZRGA 4EPXA 2ZJ5A 2ZSAA 3K0FB 4LSGA 2GVDC 1NN3A 3GLHA 2QZ4A 3RS0A 5IT5A 3VTKA 1HE8B 2CBZA 3CF2A 1Q1QA 1Z47A 3BAFA 1HURA 2ZE6A 4DUGD 4TL6A 5FOSA 1UFQA 2O8DA 4BASA 4EJSB 2VIIA 3G0HA 2YINC 4JL5A 2DCUA 4A4DA 3C5CA 4OK3A 2GA8A 2Q0HA 1L2TA 3E1SA 3GJ8A 3QG5A 1YRBA 4US1R 5CB8A 1ZMXA 3ZLJA 4BFXA 3AVTA 3FOZA 2AD1A 1E4VA 5FTKA 3CX6A 4U7DA 4N1AA 3HR7A 3U61B 1Z0IA 4M9XA 5DHFA 4I1OA 4E03A 2BJVA 2QTHA 4RCZA 3QPWA 1Q20A 3K9GA 2WWGA 4TQAA 4F93B 1KI6A 5EJEA 1E2LA 4WXRA 4BEJA 621PA 4HDQB 2JJ2D 3SBDA 3RLFA 4B73A 2GWHA 1PUJA 1AS2A 2ECKA 4MUAA 5TARA 1KO4A 4A82A 1TTTA 1S9HA 4RD0A 2RHMA 4GDFA 4N0EA 2H16A 4US2R 4QC2A 1C9KA 1P7CA 1TU4A 3OIVA 2WWIA 4GOXA 4TMVA 1YE8A 2GJ8A 3P27A 3OHMA 1P9RA 2BM1A 4HSEA 2WIBA 1MH1A 1S0UA 1SVOA 1XU4A 2A30A 2KWIA 4P32A 5FTNA 3ZVNA 5L8VA 1G4AE 4B47A 4V0MA 4IDPA 4D4LA 1DAMA 4OI1A 2IWHA 1N6OA 2J45A 2VSOA 4JBXA 2IW3A 1KY3A 4GMXA 5GJBA 1G20E 5TXGA 5FPYA 4PC1A 2X8AA 5KU1A 5DHAA 3EPLA 3ZQ6A 3SJZA 2C9YA 4M8NE 4Q4HA 3F3YA 1A7JA 1SXJB 3AVYA 3A1TA 1AM4D 4Q1DA 3IPXA 3FHCB 4IEEA 4C0HA 4R71A 5KSZA 4MH0R 5IRCD 3K8YA 2GKSA 1KMHB 3RC8A 2G6BA 1R0ZA 3DVLA 1P2SA 4UNQA 4PO8A 2O8CB 1WA5A 2HV8A 3B8HA 5EXPA 5FPHA 2PCLA 3RRZA 4NP6A 1IY0A 1JXOA 1R2QA 1DAKA 3OIYA 4XSGA 2CLCX 1DG1G 2BMJA 1A5TA 3KL4A 3KUCA 1M7GA 3ZDQA 4R98A 4URVR 2JLXA 1D5CA 3FKSD 3NWJA 1AA9A 3QY0A 4IDQA 1LS6A 1CRPA 1N6PA 2A5GA 1NG1A 5JRJA 4G01B 1NSTA 1W36B 4M2LA 3SOPA 3THYB 4IOJA 1Z2AA 4HAXA 5IK2D 5TDHA 4MYCA 1R8SA 2O5VA 4LPKA 1S9DA 4ESVA 3ZIAA 3IILA 3QE0A 4IXNA 3TVDA 5HE9A 4FCVA 1KY2A 3CW2A 4XVQA 3B1ZA 4YONB 2UZIR 4OHZA 4DLUA 1BO6A 1R0WA 3AVUA 2OHFA 5JSZB 2W6JA 2A5DA 2FOLA 4BRWA 4EJSC 3QBVA 3LFUA 3K0SA 4U02A 2JA1A 1XDBA 1RE0A 2KB0A 3ADDA 5C46F 2BIFA 4P4SA 1AK2A 2FFAA 5DGXA 2ODEA 3KDSE 3NDBB 4XD7D 1Y63A 3CNOA 1DAEA 1ZC3A 1AQYA 1XJ0A 1OXTA 1TF5A 1W0KA 2I1VB 4DBLC 1JR3E 4IDHA 4MKFA 1ZNWA 5DLQC 2F1RA 3NVAA 4LK2A 1QHHA 2OILA 2QPAA 1QZXA 1R0YA 2CVHA 3FMFA 2ODWA 2F3TA 2IYQA 2QU8A 3F5FA 4NONA 4WBSA 5CDFA 2A9KA 4FI3C 4EDHA 2CXXA 1COWD 2C2HA 2R2AA 3BB3A 4M9ZA 5DI9A 5SZIA 5CM9C 2BJWA 4YMSA 1ETUA 1ZM9A 3VNVA 3WYGA 4BFUA 4JSYA 4W7SA 2BBOA 2I4IA 4EUNA 5FPSA 5JRZA 4GP7A 1F48A 2X19A 2FFHA 4A1FA 1OXVA 1E2MA 2GK6A 1NN0A 3LQRA 1X6VA 1NF3A 4TMWA 4BFYA 5HCIA 3EIEA 2XTMA 3U6KA 3ZD6A 2C8VA 1FP6A 2J7PD 3QEOA 4JMPA 2C96A 4G5QA 4HAZA 1NNEA 1U0LA 2GJKA 4OL0A 3SQWA 3SS8A 2FDCA 3V4RA 1II9A 1XX6A 2JJ1A 1WBBA 2VHJA 5J4LA 2H5EA 4PC6A 1IHUA 1OKKD 2W00A 3LXXA 4HZUA 4HDCA 4LDJA 1Z22A 4Q4LA 1Z0FA 2R44A 2OZEA 1U8AA 2ZU6A 1HA3A 5FPKA 4EPVA 3I61A 1N25A 2GF0A 1J2JA 2GETA 2HYDA 1RFLA 1SXJC 3B82A 3RSOA 4DB4A 2XXAB 1FZQA 1US8A 4QXAA 3RDPA 2RGNA 4HLDA 1XJQA 5G3ZA 3SJCA 1XD8A 4CZ2A 4BRUA 4I4LA 4IFBA 2IYYA 3NBXX 3S1AA 3C4JA 1PV4A 3OE7D 2FFQA 3PENA 4DC9A 1GNRA 4TYNA 1P4SA 4BGDA 3AVPA 4M1TA 1Z08A 2GJAA 3SR0A 1YVDA 3UKDA 5IDVA 1GNPA 2RGXA 2GDJA 2WOJA 4PTLA 4BEBA 4BFZA 3QF7A 3EPJA 1MKYA 1DEKA 3U7FB 3Q5DA 4B76A 3RS2A 1VYVA 1AZTA 1W4BA 4CEHA 4LRWA 3OFND 5KDOA 2RGBA 1AS0A 4MYTA 4M9QA 4NYJQ 4ZDWA 3FVQA 1Z63A 2ZJYA 3UG6A 4RFSB 1PLKA 2D3WA 2GVZC 4FIDA 4Q19A 1W36C 1RRFA 2G83A 5JJLA 4KVAA 3VMFA 4TQ9A 5FBVB 1IAQA 1OXXK 2QUZA 3B60A 4HATA 3ND8A 1ZNYA 3ND9A 1OFUX 4QL3A 2W83A 2ZJBA 1OJLA 2PT7A 3LX8A 5L3VA 3VR3A 4IXMA 2VEDA 1D2EA 1G3MA 2GILA 4F38A 1IY2A 2D2EA 3W8RA 4L9SA 5AJYA 3LBIA 4WA7A 2ZYTX 4TT3A 3I5XA 3NTUA 1UBGA 1QHGA 3EZ2A 2QROA 3CF6R 2XZLA 3CUEF 4TMXA 1CULC 1TNDA 3NG1A 2QE7A 4E22A 4UQOA 1EFRD 3N70A 4JLJA 5BWMA 2PJRA 2AXNA 1DO0A 3KXKA 2CLDX 2B92A 3ZVMA 3VU9A 1QRAA 2ZAOA 3GP8A 4PZLA 4ITRC 3MD0A 5DNYB 1M34E 4TTQA 5IHPA 2OLJA 4KFTA 3NHBA
chains in the Genus database with same CATH superfamily
1B6TA 1OXSC 4GBMA 1WBDA 3QVJA 3A06A 5AKIA 3KAQA 1OWOA 1GQFA 3KAJA 4IQ4A 5LWHA 1BGXT 1W2GA 4MVJG 4MVWA 3T1TA 2FUCA 2NYRA 3U62A 4CG0A 2DFKB 4ETWA 2V5VA 3L8GA 3TRFA 2J7KA 5SZJA 1QVRA 4RIEA 2J08A 2YC2C 1Z68A 4PFSA 5EMKA 1RYNA 1FMJA 5AQEA 2YHUA 4E5UA 4YV7A 3BIXA 1QYDA 3E3OA 1WPXA 3LOPA 4OI4A 1UWCA 3F0TA 5AVOA 1JEAA 1SBNE 5EP2A 1QFJA 1XTKA 2CL0X 2BVNA 2OZVA 2VXOA 3QLEA 4FMDF 1XZNA 4IIJF 4J9VA 1AKEA 4NHOA 3VR5A 1GPNA 5IC4A 1G4UR 3RFUA 2WIAA 1JTVA 3O38A 5LVAA 2KBEA 1O6ZA 3HRKA 3SLGA 1SXJE 1ISRA 3OLZA 4QAJA 1SUEA 4UBNA 1YC5A 1B6RA 1EX6A 2P9GA 4Q3DA 1H22A 3KOWA 2WSSD 3OX2A 4QXQA 1UMDA 4BFSA 1Q3TA 1UKEA 5L3QA 4KAAA 1GSIA 4X71A 4DSOA 5GVSA 1OI4A 1RAFA 2OGZA 3TD9A 2QRZA 2XE8A 1QR2A 1HBJA 3MG9A 3NHFA 4XFKA 2QMZA 3GFRA 4NV0A 4V03A 5EPEA 3WOVA 3KD3A 1LVGA 4BUZA 3W5AA 1QTNA 4KXUA 3LFHA 4HEQA 1TAQA 3R1IA 3WMFA 1OMOA 1YQXA 4RE5A 1H2XA 1OHHA 3I6QA 4LGMA 5BUSA 5CA1A 3Q2IA 2E4XA 3IH5A 4ZVRA 3RU7A 4D45A 4PEVA 3NQ41 4C2BA 4U5XA 4DA6A 4J3FA 3HMQA 5KSWB 5TR9A 5ITSA 3ERCA 1Z17A 3TBFA 3PA6A 2VDLB 1QIEA 5J5CA 1H9CA 1WL8A 2G0NA 4UZSA 2VK8A 4Y0NA 4PGMA 4TKVB 3I2YX 4F04A 3HA2A 4B75A 3M5DA 3K9FC 4O2LA 4KN8A 4F91B 3HJAA 4V0LA 3PCTA 4LA4A 4LOIA 3HB1A 3WLTA 5BUCA 5AT1A 5AH0A 5AKHA 3SS9X 2WNHA 2R7LA 2VDWB 3HVRA 3T3EA 1K6XA 3AY6A 2GXQA 5ULLA 2HU7A 3SEQA 2FSVC 4M86A 1AXEA 1NAHA 2YUTA 4JIGA 3ZZUA 4B8ZA 2H7XA 3LBFA 3CRVA 2IY7A 2J3LA 2Q5IA 4KGZA 1V8ZA 1Z8HA 3TGPA 3FGOA 3G2JA 1NSFA 1H4VB 2C4NA 4GKVA 3R8FA 1WLYA 5M2QA 3DZFA 1ZNQO 1M0WA 4CCWA 1ZFNA 4XUCA 1E20A 1XK7A 4IHKA 2BFMA 1RACA 1H0RA 2HRBA 3GA7A 1RWVA 2AJDA 2B8WA 3A1FA 5AKGA 5IPFA 1P4HA 3W4JA 1Y7LA 4KE6A 1QYVA 3ZH9B 4NPAA 4G9BA 1QXSA 1WVIA 2OGUA 1JG2A 1N33B 3WGVA 2C7RA 3QENA 1PVOA 5FUWA 4WOBA 3IQZA 2E82A 4LY0A 4Q12A 4ZZ3A 5IT4A 2PEZA 3RSLA 2C2MA 2WD9A 3IOEA 4B3XA 1N5RA 4OBEA 2ZP1A 4UMEA 1IXKA 4A92A 2WWRA 2B30A 1EKXA 1CQXA 2WWHA 2EWWA 1FDSA 2ANCA 4LVOA 1Y4DE 2G63A 2I4TA 4J75A 3L4BA 2BR4A 2APJA 3A3NA 3BXOA 3A9WA 3DEHA 1AIPA 1Y81A 4FOLA 4IIGA 4M0DA 4JVSB 5JZSA 1NXWA 3IUNA 2FHSA 1YBAA 4EA8A 4C3ZA 1FTYA 1Z4JA 1LWOA 4PLFA 1PG0A 4F8EA 2IXTA 2E4UA 1T9KA 2ZRPA 4A15A 3ONNA 3ZE7A 4KE7A 2RKWA 1XF1A 2WUEA 5EQTA 1V3VA 2GZHA 3M70A 1YC2A 2I54A 3CCCA 5GADl 1KMMA 3E7XA 5MGNA 3ZVRA 2CHUA 3L8MA 5JVDF 3B3AA 3K70C 4G0QA 3RIYA 5FX2A 3RGGA 3WA6A 5KX5F 2X6RA 2RHOA 5B2EA 1R8QA 3M4NA 1FUUA 1G2IA 1NUTA 1UXJA 4KI0A 4PZCA 2F9FA 3ANXA 4OK5A 3WGKA 3FGPA 3PEUA 2X0JA 4DCPA 4CKCB 1DB3A 1PD1A 3PE4A 1VMIA 3F8SA 4HX9A 3RFXA 2IDMA 3WNVA 2Y2UA 3LWNA 5IBRA 3VO9A 1G8PA 3H17A 3DMPA 3GOHA 1ISIA 4XGQA 3VC1A 4ZOEA 3VZPA 3WGGA 3H9BA 5MN6A 1Z6PA 1D9XA 2IGTA 1TO6A 1A9ZA 1PZMA 2MT9A 3B2EA 3NC0C 3H16A 4PLVA 4PR0A 3RARA 3S7ZA 4DLSA 5KTSA 5D00A 3UAYA 5REQA 1XB2A 2ECQA 1BXGA 1PT8A 1A9XB 4CR8A 1WF3A 1IBLB 2JFVA 5E6RA 3RE1A 4LXHA 3F9IA 1J6UA 4PAQA 3L0PA 3WL7A 3NM5A 3PQFA 2VT7A 4G4SO 1G7TA 5DYTA 4L72A 4BZZA 2YV4A 5JJBA 2IH4A 2QRJA 2Z4SA 1A2QA 3K4HA 1DARA 1X7WB 2IEBA 3DAYA 4RY8A 3R7WB 3ROPA 5I4CA 1YCGA 2QMYA 1CVIA 2HOQA 2WAYA 3TI7A 1HL3A 3T12A 1QIJA 1BGWA 5IDXA 5HKLA 4YBRA 2GFIA 1E1MA 1L0BA 3TSAA 3WKAA 1JFSA 2XRZA 2QAIA 1DVRA 3D4OA 4Q1VA 2ZPUA 3IAS1 2O2JA 4C7JA 4TTVA 5H9VA 2CXPA 1PL7A 4R8VA 2ZBDA 1J8VA 5AKXA 3WG9A 4FDVA 1XO1A 5BN4B 1A96A 3VHXB 4D3FA 1HX7A 5D6OA 4FKBA 1B0UA 4YT5A 5B2ZA 4B3SB 3K1AA 3WAGA 3GGGA 1J7KA 3EGCA 2JW5A 3CZPA 4R4JA 3ZWAA 2ZRFA 4FINA 1XZLA 1N5MA 2C3YA 1TKRA 3JQPA 1GGHA 3IP1A 4M9RA 4U0KA 2W6JD 5ESRA 5IKXA 1RHKA 5JBNA 4NCNA 4XTCS 2ZVDA 3MCVA 1U2RA 2IXEA 2YXBA 4ONEA 4Y2JA 1U65A 1E2NA 2XITA 3WIVA 3ZQJA 1JR4A 2Z1NA 1UIMA 3LPLA 1ZM3A 5JO0A 4B3GA 1J2UA 2H06A 3WFZA 5AVJA 1FNNA 1GTVA 1KOFA 3DLIA 1E92A 3LG2A 2B99A 4OXRA 1YVEI 3RU2A 4O5AA 4FCTA 5K3SA 2H1HA 1KR5A 1T91A 1ORIA 2QL7A 3CZ5A 5AR1A 3VU0A 1QPZA 2GEDA 4EIWA 4U2EA 4WKNA 3ZLVA 2VQEB 2FKAA 2R6CA 2YWBA 4EZIA 3EEYA 3WWZA 4NJMA 3UJDA 4HRAA 4LJ9A 3T34A 1IBKB 1V9CA 2XI4A 4TMYA 2P91A 4AWAA 4RHYA 2B4AA 2GARA 5SY9A 3F9RA 1X9GA 1B6GA 4A8JB 3TNLA 4ENVA 2IHTA 4L28A 2PE5A 2OCGA 5BUZA 4HNGA 2H4FA 4KQCA 2IYTA 2SKDA 2QZZA 1Q0LA 4KXXA 3DDCA 4IRXA 3KEGA 4QWWA 3IKTA 1CLEA 4RPGA 1ND6A 1AB5A 3F74A 4W5JA 1G38A 3VKGA 3KOZA 2LV8A 3PNKA 4RVCA 3WLFA 5C32A 4MR9B 2Z30A 1Z15A 1JPUA 1NAIA 3V1LA 5CDUA 5EJ4A 1ZR4A 1VHWA 4Y2RA 2AUNA 4ZANA 3KQLA 5AM3A 1IB0A 3KUKA 2AE2A 2R8YA 2RHCA 3PPWA 2ID9A 3EYAA 3WYNA 3V4VB 3ZOZA 4FYJA 2GCIA 3F3KA 5E2IA 1JWAB 4MR8A 4LF8B 3FPFA 4EPYA 3PEYA 5KWIA 1PYGA 1NQ5A 3WWDA 2PUHA 3GLIA 2AYYA 2JI8A 2P9BA 4KXVA 5CM2Z 2JB9A 3A4LA 4R9NA 2XUAA 3SIPA 3F6CA 1KDRA 1UFVA 2JGDA 2W2LA 3HVIA 2LIVA 2D62A 2VZLA 3L7DA 4DT1B 4MW4A 5AHOA 3FD8A 2Z43A 1BMTA 4M46A 4AO6A 4CM3A 4D3SA 3GP5A 4YMUA 4JB8A 2P7IA 5AW6A 5I7VA 3TGWA 4PRKA 5EHZA 5KSYA 1IAVA 4PX2A 2HA5A 1O57A 4M1OA 3WGLA 3LT4A 1XGKA 3UGTA 4GOKA 1JKXA 1VE9A 4U8HA 3T3DA 4C03A 2QENA 4XLLA 3GGJA 4DR2B 2BT4A 2CHFA 3AY0A 3I58A 4EH1A 2BEJA 4BO7A 3U3DA 2PS9A 1E9BA 1RAEA 2I67A 3Q15C 2ECPA 3PVCA 5GPBA 2DRIA 3CS3A 4Q24A 4REQA 1AQJA 1DZIA 1EG7A 4Z1MA 1L4NA 4HR7A 4P7GA 2BM0A 1SOMA 1QM5A 2FETA 3LUFA 3ZCUA 4RA6B 1KWKA 3P0JA 1D2MA 1XCOA 4NXNB 3OICA 1ZD3A 1K27A 1XWIA 2VDQB 2GWRA 3G8YA 4OG2A 5I9TA 5HKKA 1UFKA 4UM5A 3A1SA 2EFCB 2YOFA 5K3CA 1Y7IA 3KVNA 3LC2O 4Z4EA 3IJ5A 3U7RA 2OQIA 1P81A 4Q7QA 3GWGA 1BSVA 1R27A 1Y98A 4HAOA 2C8JA 4YIKA 3KRTA 3OEHD 4IMJB 5EKTA 4AP6A 4TT3D 2P9QA 5ADWA 2PSDA 3FUXA 4P2BA 4QULA 2J87A 3AV3A 1E96A 1KU6A 1MB9A 1NI4A 1Y6QA 3E9DA 3DXXA 2R1ZA 3PQ5A 4BQOA 3ZWCA 4UOQA 5C8VA 3I8SA 3T1QA 1N78A 2I2XB 2QE7D 3GHHA 3I1YA 7ADHA 1CV2A 3SYNA 3VAYA 1ZRSA 5L40A 4RD2A 5JD4A 1AGPA 1EM8A 3GG9A 3N6VA 1JPNA 4QG7A 5DWDA 4XRGA 821PA 3PYLA 1JR3A 4UCWA 5HZKA 4IXWA 3I8XA 1N4DA 2XXBA 2ZSFA 5I9MA 2VJMB 4NNOA 3AX6A 3NAQA 3WKEA 3ELWA 3DF7A 1AQ6A 2PS0A 1KH3A 4ZT7A 3LRXA 4RLFA 2G8NA 5TLSA 1QIGA 2XT0A 4O4HB 3E1GA 1K97A 4WDQA 5ALMA 5JEDA 4G1UC 1JG4A 2I9PA 2EQBA 2X1LA 3TH5A 1YBHA 2IYXA 3MBKA 4G1EB 4LRYA 1NP7A 4L8GA 4PG7A 5EXTA 3HCFA 5I45A 1WDWB 7AT1A 2OGSA 2UUPA 3FUVA 3I6MA 4L4RA 3QLTA 1M2KA 1YZUA 3DOJA 5BQPA 4KFCA 4C0BA 4POOA 2PZFA 3FZGA 4MI1A 2OENG 2EGHA 3G2IA 4ISCA 3ZHUA 3WKBA 1SA0B 1KFKB 2BELA 3KJHA 4URYR 4Y2VA 2YBEA 4AQYB 4MWOA 4TWZA 2P4HX 3U4MA 3GW8A 1C30B 1PR2A 4BNLA 5BPHA 5JBQA 4B6RA 2XAUA 3MFYA 3LY8A 4W6ZA 2QJWA 2BGGA 3VR5D 1AKNA 1TLTA 2G80A 3MFQA 4NEHB 2QPOA 3GVCA 4HN2A 1OT3A 1G9XA 4LVCA 1NRJB 3L1KA 1X1EA 3EXEB 3SEZA 1PJ3A 4MEJA 1MJNA 5C1OA 3MIIA 1B23P 1PQYA 1UXGA 2XDWA 1P5FA 4MI9A 3S7TA 5JJ5A 1H1DA 2CK3A 1YNOA 4R54A 4DMLA 1Q95A 1EJ6A 3I64A 4UE2A 4BQRA 3KQKA 2CV2A 4L2IA 1ENZA 4HGOA 4ZOQI 4RELA 4RIFA 1XTBA 2TECE 3A28A 3KLOA 2EYUA 2R65A 1OHHD 4NECA 4NS1A 2QD1A 1SOVA 2P6UA 3AO0B 1T0HB 5KWEA 5FF9A 3KEQA 1GPJA 1WP4A 3AIMA 4ZV9A 5HF9A 1SXHA 3AERB 1OILA 2WWTA 4XOIA 1SZCA 3ENNA 3V97A 1EK2A 5LIPA 1XLTA 1D1TA 2C83A 3N2KA 1WR8A 2NQ2C 3RAGA 3W0LB 1Y3AA 3KJEA 1RM4A 2BFEA 1FFXB 2W11A 4L4SA 2RGWA 4RXTA 5K6AC 3EMDA 3VR4A 3NOQA 1EE9A 2BF7A 1QRRA 3O1IC 4X20B 1HTBA 3ECAA 3OZFA 4OCZA 4ZT4A 3KK0A 5EMLA 5DSZA 4MVJI 2Q29A 2J31A 2E87A 3QKTA 4GLJA 3WIDA 1YQGA 1B6SA 3HDYA 1UQUA 4UNRA 3DVSX 4UTPA 4MKZA 2X7XA 4F3TA 1GUDA 3C6YA 3OPYB 1X80A 1HDIA 2BFPA 3C70A 5JD3A 4U63A 4GKJB 4HH0A 3KQVA 3A2MA 4HCJA 5F33A 2RHRA 1E9CA 5E6UA 4HEHA 5LOVB 4R7ZA 5FBLB 3TINA 5HUQA 2A9QA 1P0PA 3DWFA 1NW4A 1IZ0A 1KXJA 1OC2A 1X1AA 3AR6A 3ECCA 4PAWA 3RFVA 2CVOA 3RHFA 2F00A 1A7AA 4ZTBA 3TLBA 2X1VA 1SD5A 4F3NA 3STUA 1UWLA 2C5EA 4LQDA 3EGWA 1FC0A 1B8UA 1HYQA 2ZIEA 5LUBA 4ZDIA 1I2AA 1U0OC 2AG8A 3UC5A 3NETA 2NO9A 4CKEB 1LPSA 1ULTA 4RAQA 3I9KA 3G9ZA 1YULA 3E61A 4DLXA 2XUIA 1B76A 3FYUC 3UFBA 3ZHRA 3MJFA 2GLUA 3GFOA 4FW9A 1DJLA 1F9EA 5AXAA 4W5RA 1B8VA 1SZPA 1MA3A 3CN9A 3DFKA 4N01A 4DR4B 3MWKA 4JKYA 1FXSA 2I71A 2Y92A 4LBZA 2C7VA 2XYRA 2WG1A 2G5CA 4KSYA 5ALUA 2V7XA 1EXNA 1P39A 4KWEA 4DABA 2P4SA 1QH8A 3VDQA 1PL8A 1H0HA 1E3JA 3PRHA 1DC4A 2ID4A 4TLBA 1KEVA 2EGGA 2KSQA 2Z5FA 1J99A 4KTVE 2ZDQA 3ZHCA 2MTBA 5BXYA 1SKAA 4MW0A 4OVKA 1F6WA 5DH9A 3T5CA 1MTZA 3WP1B 5KOIA 1N5LA 5K0FA 2C58A 1C3EA 3HB9A 2OG1A 5ED4A 1U98A 2XD9A 2CYCA 2RKBA 3Q5EA 4XJVA 5F12A 1WUYA 2NACA 3SVTA 3MGCA 2NXCA 5IXSA 2PGLA 3TNYA 3ZYCA 4LDRA 5CB4F 3PDWA 3E6AA 3QPAA 1M66A 1ENOA 4HFNA 2LCFA 4Y2UA 4S35A 2BISA 1PWXA 2O9JA 3FDJA 3KT3A 1KQGA 3D6UA 5KHOC 4AICA 2Z4RA 4I2NA 2ZBPA 3I2GA 4NU5A 4CQLA 4IXTA 3W5UA 2MSWA 3ZU3A 3KB1A 1CVLA 3BDIA 5DSXA 3VH1A 2AXQA 1P9OA 3RWOA 3DB2A 4GI5A 4A10A 2R1TB 4D80A 1W581 1VP9A 1NXVA 4FGSA 4NMLA 5C7IO 1KMHA 1LI7A 4KGVA 4BNNA 4B81A 1I0LA 3FYSA 2HXSA 2PSSA 5JLJA 5BSMA 2IS2A 1JYEA 3A6DA 3QUSA 5TT1A 3TNDA 5K0ZA 2WFLB 1NM5A 4M7RA 3U44B 1NMEA 1ORVA 2ZE7A 2P41A 1AMUA 1G2OA 5C7LO 2A5FA 3W7BA 4E13A 5IDWA 3RI3A 3NIDB 4I4TB 4N3BA 1UK8A 5CYPA 3WWCA 1GR0A 1XTSA 3SX0A 1SBHA 4JLUA 1O5OA 5FIUA 1VYTA 2XCOA 3KPWA 1EIZA 3PD7A 1XG5A 5CA0A 4E1AA 3ZE2B 3OZUA 3GNTA 3V1YA 4O0LA 3D5TA 4EO9A 2X77A 3JWHA 4AIIA 3A58B 5M34A 4D26A 1UBOS 4GVLA 4L1KA 2Q50A 5HDQA 3UWKA 3URMA 4PSKA 4J0JA 1HE3A 2C3UA 2G9NA 1F20A 4YPOA 2VAVA 5EJIA 3VNUA 4AG3A 5C37A 2X6TA 3ZGNA 1Z34A 1XIVA 3NBFA 2HV9A 2JHFA 1H23A 2G8LA 3L0OA 2QIPA 1I7PA 3LP5A 3CSSA 1G19A 2C94A 2V9ZA 3DZKA 4JDPA 2NXNA 5JS2A 4FILA 4KLAA 2IYEA 3U81A 3AW8A 5JSZA 4YAWA 1C1DB 5EE0A 3CLUC 3FTPA 3ZDRA 1SCNE 3EGIA 4Y7DA 3IIJA 3FFTA 4ZYLA 1H9AA 1KS9A 2Q6KA 4Z0HO 5TQ0B 2EEZA 1L5KA 4GNKA 3KFLA 1UXHA 1NMYA 3DXFA 3AR9A 4GVPA 4R1UA 3R40A 2W2QA 2RHTA 3GRPA 2BBSA 4P81A 1QE0A 1NQAO 3QE3A 4PLYA 4YTEA 4BQFA 1YT5A 3HWWA 1E61A 3SK0A 3H2YA 4K3UA 4TSRA 1OY1A 3T5DA 2D54A 4CTMA 3K9HA 2VN8A 5F9FA 3RQIA 3B6EA 3MWEB 4HVAA 1ATZA 1IYZA 2JH9A 4QJ5A 3L1IA 3RJZA 2NPOA 3OHPA 3KKQA 3RRFA 4H18A 4G5FA 2R5NA 4ZVKA 1ZWKA 4KAJA 1M33A 1CQJA 1SQ0A 5COAA 1RJEA 1D1SA 3QFSA 1TZBA 1U1IA 3NKFA 4M8KA 1VSTA 4KYTA 3BE6A 3O84A 1U3CA 4PY2A 3E2MA 4F4FA 3CR3C 4U2FA 5JCJA 3PHBE 1ZGJA 5KUTA 3RT9A 3ZNPA 1HSOA 2R9VA 3C4QA 1GPAA 1CZUA 4E5NA 4OYLA 4EYKA 3NHYA 5HOEA 2J30A 1Z8FA 1QF6A 1GL3A 1YI0A 3ILSA 3O82A 2OOKA 1Q11A 2DVMA 3BB4A 1YHZA 2PRIA 3OQIB 4KBFA 4IVNA 1B7GO 1GV0A 2B1RA 2J3HA 3EIFA 3I30X 2GHQA 3X43A 1PK7A 4V38A 1FUIA 3IULA 5AOBA 1DBQA 3RHSA 3RTCA 1VPWA 4YFVA 4QFMA 5DRYA 4OQEA 4RPJA 6Q21A 4FUQA 5JMWA 3QVMA 3FUUA 5DHRA 4DR6B 4DIUA 4J91A 3HDTA 1U9CA 1KR2A 1VJ0A 1ZD2P 2P9EA 3KVOA 4K86A 4CDGA 3OZEA 3PRJA 4LF6B 4MQEA 3VYSB 1V39A 3N5KA 3L6DA 1N34B 4BNWA 3CISA 1ISPA 1R6XA 3NHLA 1I7NA 4B44A 5KDDA 3EH1A 1BWPA 5AVWA 5LYYA 4OY3A 4WACA 1NVAA 1WXGA 2BC9A 3K1TA 2W2LD 1W75A 3PIRA 2F8LA 3ZKAA 2XXAA 2UVPA 2R7KA 3SDZA 4WX2B 5JFTA 3KT0A 3WL8A 4F5WA 3U09A 3HFGA 5CDFE 5LL6P 4CM5A 3HXQA 4AKGA 4RSHA 1L7DA 4LCEA 4P7JA 1NUHA 4PAGA 2HZBA 2ZTLA 2FN3A 1T2DA 1FDOA 1P1JA 1S1CA 3V7UA 3C7DB 5JALA 4ZZIA 4V2UA 1JI0A 4UBOA 1MX3A 2ZI5A 2X5OA 1TJPB 3PFHA 3I04M 1JHRA 2CLOB 3AR7A 1PKEA 3JQGA 5H81A 1EVJA 5CYFA 4PNZA 1I8TA 1RWBA 2XKBA 2BFDA 1C7JA 3BBPA 3KPVA 3WWPA 3U80A 4NCAA 3AI2A 4CKWB 3RODA 1OTHA 1RJFA 5DGTA 1XWFA 3GZTB 2BEVA 2G0TA 2ISQA 5CK4A 2O7SA 3JTMA 4FPXA 2WTBA 2R97A 2VI5A 5E95A 5HKKD 2PMKA 3FUWA 4H7IA 5AI4A 2H63A 4KU4A 4PPFA 3WLQA 2FSVA 3DZCA 4D3YA 4YRMA 1J2EA 5A0VA 1FFHA 5GMOA 3ABIA 2VHUA 3IO5A 3TXAA 4OHYA 4YJ2A 1IN4A 3QRWA 1OFIA 2PUGA 1H2AS 3FCCA 4K9KA 2CDAA 2JI9A 2UUCB 1O4WA 1E99A 5E3IA 4PU0A 4LOLA 5A3QA 2IBMA 1U28C 1DIHA 1NZFA 1FRVA 1G3RA 1ZHFA 3TB6A 4MMZB 4EZBA 4WFQA 3UGKA 3TGLA 4I8XA 3H5LA 3WMXA 2CNKA 1MNAA 3I0MA 1VJTA 1UJMA 2Y77A 1FLVA 3W9YA 4M49A 3EG9B 1UJ5A 1JR3D 3N2GB 1QQ7A 7YASA 4PPGA 5JZ9A 2C9OA 2YXEA 2ZYIA 3DV0A 4TSFA 5ARCA 1NW5A 1JX6A 2O7QA 2X8JB 3BE8A 5DWVA 4QM7A 3H0CA 1K7EB 4MW6A 1WCV1 2OR3A 3HXPA 4BNGA 1U9YA 3V80A 1A98A 1WSDA 3O90A 2F43B 3WLOA 1WSWA 3E9ZA 4DADA 5JC8A 2F8SA 4GBJA 2YOGA 1V43A 2JRCA 4S3MA 3BFVA 4NPHA 5LBTA 1V1MA 4QICA 1T29A 2OO5C 1THTA 2VT6A 5E3HA 1N9GA 2RCNA 1EFCA 3CVWA 3DOEA 4X94A 3LC0A 5E4TA 1LZLA 2VUTA 4CIWA 4QPDA 1EESA 2HLDA 4WESA 5F23A 3CLTC 5B58T 1CDZA 2YQZA 5F21A 1I5EA 1QX4A 1Z4OA 5BSFA 2MYNA 4TL9A 5LD2B 3JQ8B 1X87A 4WBNA 1M2OB 5GZ6A 3R0XA 2ZIWB 1ZGZA 3WB0A 2OCXA 3WLIA 4ZJPA 2D4AA 2QX7A 3SYKA 1XKQA 1GU1A 3DLBA 4I55A 2GTPA 2O4CA 4FDLA 2BGJA 2HA3A 3M0EA 4G07A 5AM1A 2I6XA 1TMYA 1Z5GA 2NZVG 2VP6A 2WU3A 3L2OB 2ACWA 3OOSA 4KX3A 4X8MA 2YXPX 3PQDA 5DV9A 1YBMA 1NXTA 2CK3D 4IUBS 4QDXA 5K3DA 5IDQA 1HG0A 4UBIA 4F3YA 4YLYA 3LA8A 1KC1A 1EUYA 3HG7A 4DAOA 2F7SA 1H5UA 4RKYA 2AFHA 2JLCA 2NU7B 3STYA 3U40A 3T1OA 1GNVA 2VWHA 3AR8A 4QELA 2XGMA 1JJAA 3A7EA 1SULA 4KXNA 4X3CA 3O95A 4K5QA 4MAFA 3VPAA 4YCSA 4QOGA 1IHDA 5BV2P 1VP3A 3V4OA 4FHCA 5IM4F 1JQAA 2FW9A 3EAQA 3L6EA 4MI6A 5LB2A 3SYLA 1J5EB 1ZVVA 3OO1A 3R3ZA 4C4PA 3KVVA 2Q5HA 3P9PA 1Z37A 3LUPA 3OLCX 3B2NA 4BU1A 1NJFA 1XLVA 5AJWA 4JUBA 4HNQA 4EG5A 1NW3A 1Q1AA 1ZN9A 4YDHB 3E2PA 4JEUA 1HDYA 1RRPA 1CRQA 2P65A 4EUSA 4GSKA 1L8AA 4BUJA 1PEAA 3VR4D 3NWBA 3PBKA 4MP6A 1J8QA 1RHUA 2WBLC 3KCNA 4PINA 4HN9A 3ZXXA 4H31A 1QIFA 3QNUA 4JIMA 1D2GA 5KWVA 1FTSA 1I3KA 2FP4B 2Q2OA 2VLBA 3HLTA 1TUGA 3R5TA 5T57A 1NDHA 2GM5A 1A4RA 2A0WA 2IUYA 2VAWA 3A3YA 3HJNA 2EQ5A 4DBZA 3K6SA 3DVRX 4YJFB 3DH0A 3EQ8A 3CY6A 3W2HA 1X1SA 3CLKA 2EAUA 1SBIA 2IYOA 1YQUA 3L4EA 4XRRA 5AO9A 2BE7A 1IM2A 1D7AA 3I28A 4RDIA 4URZR 5EY5B 4D0RA 2V7WA 1L4BA 2H2DA 4LFCB 1F2TB 3C3AA 5L7TA 2I4OA 1YA6A 4YRTA 1FW6A 3G68A 3H5RA 4I14A 4LZLA 4MUIA 5D3KA 1AGRA 2VTVA 2WQZA 1RJ9A 2Q5EA 2Q8NA 3HWRA 4YJ3B 1GXSA 2XDQB 2DG2A 3NBMA 5KI6A 5LP6B 4YI3A 1ZMOA 3LZCA 1EP2B 1FTWA 3CF4A 1P44A 2NNWB 1XDUA 1T2UA 2ZJOA 4AZ0A 4Z0NA 3KHSA 4PG6A 4BP1A 4J4HA 1LX6A 5C7OO 2AG0A 1ZMTA 5ER6A 4NICA 4OGLA 4Q48A 1X7YA 1L5FA 3NEAA 4IR7A 4N3NA 1VB3A 4ZOLF 3ZW9A 1T36A 1U0RA 3ZK9A 3CUYA 3LX6A 4A0GA 4CIAA 1RQXA 1WD7A 3OKPA 5HUJA 3BKXA 4OAOA 2X15A 2NU6B 3KHTA 3QSGA 2JIQA 1RHJA 4KQ2A 4WMLA 4WZBE 5J5VA 5BO5A 2EKDA 4FNMA 1U3UA 3CJQA 5EKXA 3LQ1A 2QQ5A 2VNKA 4ZODA 3VC3A 1NP3A 5EMHA 1F7UA 1OAOC 3H99A 2XMRA 2YVQA 1UDWA 2FUKA 4G24A 1G291 1H93A 1RZVA 2I55A 3PHGA 3Q6NA 2QAGA 4QD3A 2QQFA 4V3CA 4DSNA 4I6EA 1BCRA 1YCFA 2B2NA 4M89A 3GDGA 1QG0A 4A16A 4E33A 1R9MA 1QRUA 2WU8A 4FVTA 4LRTB 1D09A 1T3LA 5FEUA 3BF7A 1O5IA 5FQOA 5LMNB 3NGLA 2OHHA 2R79A 4CL8A 1XNQB 3PHLA 4NV1A 2P69A 1MJGM 2PKYX 2BI8A 2AIRA 1VI6A 2ONCA 2W4QA 4NOLA 1SWWA 4UAGA 4LIPD 1G20A 2FJ0A 4YHBA 4E2YA 3A3KA 1TUEA 5BSKA 1THMA 1Y3DE 2XH8A 1AKWA 1W93A 3M89A 1KJJA 2OORC 2PZGA 4IOKA 2L2QA 1CR6A 1Y5IA 4Q1AA 3FUCA 3V32A 5BWNA 1ZY2A 1II0A 4C5BA 4B85A 1W48A 1GZUA 1Y33E 2XQJA 4NOJA 2A59A 2GEJA 3EK2A 1KI6B 3KPJA 4PCLA 1DTSA 3BL8A 1YR6A 4XSVA 1W59A 1P2BA 3OUTA 4UXJA 5IBPA 2D13A 1XROA 3STXA 1BVYF 4UDXX 1LGYA 2B20A 4F4CA 2PO7A 3LO5A 1OWPA 5JFOA 4G0XA 2P2YA 2O07A 2G17A 3F47A 5AXDA 2H7VA 4UBLA 2IU0A 5J1SB 3VHLB 4QUJA 2LUOA 3LY9A 4X7BA 1RZUA 4N0DA 1LEHA 2FLKA 3X2SA 2EDCA 4YDRA 5JAPA 2OXIA 1KZ6A 2YMMA 4JLKA 5D2CA 3PSAA 4QYXA 2OCAA 4YUYA 2W22A 3UWSA 4DUPA 2ZUSA 4RKRA 1EA5A 1UC8A 2OZPA 3CH7A 2CCGA 4M8SA 1IK6A 4JI1B 4D98A 2DX7A 2QRHA 1DNPA 4LBVA 3STWA 1ECCA 5T8KC 3DT8A 1I6LA 1WXXA 2SNIE 3X2FA 1QOZA 1Z38A 3V3TA 2VDUE 4B6EA 1M75A 4I6GA 2OP0A 4BWGA 4D4KA 1YGYA 2CUNA 1XD2A 4F06A 1M54A 1MC4A 1PYOA 1N0VC 2NTVA 2YY5A 2GF9A 4GDMA 2CLMB 4L5CA 5D5QA 4F5DA 5K0EA 4BVHA 3CF0A 3RVKA 3J7AC 4D0LB 4BHTA 3MJCA 1Z06A 3GEPA 1FRZA 2CMFA 2X0IA 3C7KA 3PQEA 4PO9A 3KSDO 4WK2B 4NCJA 5A9TA 5FBHA 5GONF 2QNIA 3ZN2A 1GKYA 1U3VA 3DCJA 3D3JA 4PHFA 4UULA 4R0VA 5ANRB 3TIVA 2R6GA 3WBJA 5EIOA 3JQAA 2PO5A 4JSTA 3S81A 3C3YA 1X8KA 1EFLA 2C4VA 1BDIA 1QDLB 5T4HA 5FL3A 4G36A 3OU2A 1AN9A 4RD6A 3KEFA 1A9OA 2WWYA 4W1QA 4UCXA 2G7MC 1U0FA 1I3MA 2EFEB 4C20A 3DLPX 4JBIA 4MYHA 4I7EA 3C3BA 3EXIA 4EEKA 2XUDA 2ZT8A 3PQ7A 2WIJA 1NR7A 1MGOA 4IEIA 4GZLA 2QN8A 1OBHA 3DO5A 3D0KA 3CVVA 1G16A 5JUWA 3JQBC 4RA9A 1QH1A 1KY5A 3PGA1 1P9LA 1OB2A 3NDJA 4H17A 2ADFA 4NG4A 2QTLA 1VDMA 5A6SB 4BDTA 5H16A 3CF4G 1CIPA 4DZTA 2OHIA 4G84A 4LC0A 5JCJD 1V6AA 4LQ4A 4S04A 4YROA 4IDCA 1DRWA 1RHMA 3R3WA 2QI9F 2VUSA 3CCBA 3F1KA 3WGIA 3IQXA 3PDHA 1A82A 5CVCA 2EZ4A 2R47A 5C3UA 4PNHA 4PM4A 2O2IA 3P1JA 3AKDA 3UT6A 2NYAA 2XTAA 4LRQA 1QO7A 3WRWA 1C9MA 1FMTA 4ALKA 1OH7A 1MF7A 3GB9A 4L6IA 2DFTA 4ZVLA 1RWWA 2HIGA 2XNSA 4HRVA 3QOFA 2CCJA 4M7OA 3GLRA 3RKUA 3N8GA 5IABA 3JQFC 2B69A 3GFVA 3AHEA 4EY7A 3Q8LA 1AV6A 3X1YA 1LI4A 3GD5A 1LX7A 1K5PA 2AZXA 1PI3A 5E6SB 2Z04A 1Z6TA 4BFVA 1RYMA 3HO8A 1NWCA 4O0MA 2X0FA 3RFCA 3MAJA 1AMOA 3BORA 3OAAA 4PQGA 1J22A 4NZYA 1ZBDA 4XX1A 4WWHA 3TQSA 3NMUF 5CPFA 1CVRA 4P0TA 2K7ZA 1IOWA 4TVSA 3STTA 3ZU2A 4OHBA 2QR3A 1MRSA 2EF1A 1MOQA 2FPKA 2PWPA 4GF5A 1N8NA 1BVUA 3OURA 1VHJA 3BCSA 1WMEA 2VHZA 1JA9A 2XHEA 1USIA 3GJZA 2Z2JA 2CN1A 4JEHA 1RQLA 3CX7A 2EKLA 5DXFA 1YJQA 4JS0A 1JDBC 4XQEA 3SP1A 2ZIFA 3KQWA 4WEQA 1T2FA 1MEEA 1G9TA 3EVEA 1M1ZA 1M1XB 2XQGA 1JLSA 4EEXA 1YK1A 4IGIA 3TVYA 1GTSA 4RWEA 4NL4H 5CW1A 4ZVMA 4QX6A 2F2TA 3K9BA 3EF1A 4O4JB 1UK6A 1EFPB 4LTDA 3KEOA 4MWEA 2QZPA 4G0WA 4HDRB 5K6AA 1I0ZA 3RAFC 2BMEA 4G97A 4O33A 4WNCA 4A5SA 4HQ0A 1HFEL 3AZQA 2PT5A 3ANSA 2RJNA 2AEEA 1ISFA 1HT2E 2R7AA 2XZTA 1XCLA 2FDXA 5ECGC 1ADJA 5CVJA 5F73A 1E9AA 4MA0A 3ZV3A 3WNDA 4D4MA 4RTKA 3N7AA 2J46A 1TM4E 2FG6C 3ZZNA 5I7FA 3UMYA 2R4UA 3AW9A 5GJCA 5CXQA 2II6A 1SCDA 2CVZA 5DNWA 3ZDEA 3HR8A 4DQXA 5A4AA 5ABPA 3W5CA 1PWYE 4U7GA 1D3AA 1E62A 5JYDA 3F6BX 2O05A 4Z8XA 3EMVA 1RYDA 3KKEA 3N2EA 5JHHB 1NVTA 2XWQA 5K8TA 3D6AA 3KYCB 4DFDA 1Z6ZA 4EF6A 5BYJA 2JKVA 3I2HA 5TMBA 4IUYA 4GPD1 1J0EA 4YGYA 1QHIA 3VKWA 1YZTA 3EZGA 2Z3ZA 3ILVA 1R5NA 1VHLA 4PZDA 1L5VA 2F9MA 4B2LA 4O4LB 4TV9A 1UOEA 1US8B 5CIWA 2MSNA 5CB6A 3LRPA 4J76A 4LWQA 4TSFD 2XY4A 3T41A 3AQ4A 5B57C 1HM5A 2J9FA 3W90A 4BNMA 1PJ2A 3DAFA 3FYUA 3EGDB 5F7XA 1POWA 1BRMA 4DJ5X 1GQYA 3GFSA 1H69A 4PTZA 3L7KA 4QO7A 4RTPA 3I0NA 3W77A 3HXOA 3RTDA 3BD9A 3P9ZA 2VSQA 4TOIA 4DRZA 2I5PO 1XEWY 3G17A 3V8NA 4G2TA 4B35A 1IVYA 2WABA 1N7JA 1K4KA 1U99A 1YBFA 2OV8A 4X1IB 4IH4A 1KE2A 4MRVA 2AFIE 4MS4B 3WZ2A 3BERA 2JGAA 1KO7A 1N5JA 1VHDA 3P9NA 3ZE8A 1FYEA 1GKUB 3TF5A 1XZAA 1SGWA 2BHSA 3GRCA 4Z86A 2FI1A 2GYWA 4A27A 1E2HA 4CG1A 3T95A 5LN1A 2HLDD 3D5QA 1C0PA 1UZMA 4UQPA 2DPYA 4J8PA 3UHOA 2HRRA 4JI6B 4N0PA 3K70D 4LFBB 2VA9A 5KIAA 2HRDA 2OK7A 2Z9BA 3R3V