2F1RA

Crystal structure of molybdopterin-guanine biosynthesis protein b (mobb)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
148
Chain Sequence
LILSIVGTSDSGKTTLITRMMPILRERGLRVAVVKRKDSWKIYNSGADVVIASPVKLAFIRRVSEEEGNDLDWIYERYLSDYDLVITEGFSKAGKDRIVVVKKPEEVEHFRQGRILAVVCDERVDGHKWFRRDEVERIAEFILSLLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
rcsb
source organism Archaeoglobus fulgidus
molecule tags Biosynthetic protein
molecule keywords molybdopterin-guanine dinucleotide biosynthesis protein B (m
total genus 47
structure length 148
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f1rA00
4BRUA 3QF4B 4XSGA 2AR7A 3DVLA 1FL9A 3OEEA 1KY2A 3NHBA 4FIDA 3ZZTA 2G1JA 2WWHA 3HP1A 2EFGA 2IW3A 3FPAA 3AF2A 4NPHA 1NKSA 4ON9A 1ZD1A 2RKOA 2RGNC 2BJVA 4HSEA 3FMIA 2IYTA 1MO5A 3N2EA 2DYKA 1VYUA 2WKRA 4IFBA 4QFMA 4RY2A 5IHPA 2ZJ8A 2NO7A 4C0HA 3QSYA 2YOFA 2PLRA 4FCVA 4TYNA 2BMFA 4DLRA 4FWIB 2IXGA 2NPIA 3T34A 5JJLA 2IYVA 2CJWA 3R20A 1WMSA 3QXJA 2QRNA 3K09C 2GXQA 3RAPR 3RVBA 4CT5A 1L4UA 4B32A 2FU5C 3RSLA 2YKGA 4G5SA 3MWJA 2VEDA 3RS5A 1ZM9A 5C2JB 4B44A 4X8OA 1UJ2A 2HF9A 4BLSA 4PSVA 3EPHA 4ACBA 4MGIR 2VO1A 1KJYA 2NTYC 5C18A 4IOJA 1J2JA 2WKQA 3L8YA 1NBMA 3EZ7A 3MGCA 5A4JA 1COWD 4C0AC 2C99A 1RYFA 3BJIC 4R71A 4B3CA 4NTZA 3UK6A 1T8UA 1DG3A 5KDDA 1XP8A 1N6KA 4FW9A 4KAXA 3QNUA 1KJWA 1W36D 4CGZA 1G7SA 3RS3A 3PEWA 1R6BX 4KHZA 2F6RA 2YZ2A 4OQXA 4XSHA 3VAAA 4B3GA 3PUXA 2R6AA 1FP7A 3EC2A 2Q3HA 5JWRA 2BV3A 2RCNA 4OJQA 5FTKA 4BASA 4Q1EA 4M21A 2H5EA 5JFGA 1SVSA 3BH6A 4NYJQ 2LWIA 2GJSA 4QBGB 1ZBDA 3GCGA 4G5OA 3EASA 2IUUA 2XGJA 4O3MA 1ZU5A 3U5ZB 1G19A 5BYJA 1R8QA 4F4IA 4LYJA 1XPOA 5FR2A 2GCOB 1G5TA 4IOKA 2PJRA 1F2UB 2PL3A 1W0KA 1JB1A 2H8KA 1MH1A 2ASEA 4TQAA 2FE4A 1N5JA 2QPAA 3UIEA 2C95A 4AYTA 1ZCBA 2OLKA 1GZSA 2QTVB 1XRJA 1S1CA 2GCOA 2WPDA 1XDBA 4A4DA 1OFIA 3GLFB 2Q9AA 3KQLA 3IBYA 1Q1ZA 4X8LA 1Z6GA 2AFIE 4QJ3A 2JJ8A 4TTPA 1BS1A 3WMFA 5LB2A 1U2RA 5EXSA 3OF5A 3KJEA 3WNDA 3WYGA 4Z8XA 4DSOA 5CITA 1FW6A 4H9GA 1PLJA 4ZCLA 1UDWA 4OHYA 4DEXA 4EKDA 4Q9LA 3NBXX 1GOTA 5FI1B 1QG4A 4HEJA 4TMTA 3QUSA 4EUNA 5FBVB 1RKBA 5KHOC 3BFVA 2ZUBA 4LJ9A 5JZVA 4YDSA 3THYB 2IS1A 1U0LA 3CNOA 2WAYA 2UKDA 4OQLA 1GP2A 5DH9A 3GJ5A 1CXZA 1RYHA 2QAJA 2WHXA 2C5LA 2FJUA 4C0QC 3W5IA 2ERXA 3MMPA 1GITA 4B2PA 1U9IA 2J3EA 1ETUA 3RWMB 3T06B 3CUEF 2IS4A 1G8HA 2GA8A 1YR8A 5FBQB 4EPYA 1UAAA 1YZUA 3ZQJA 1JQLB 4MGKR 4FWTA 3ZD6A 3EIHA 2ZRBA 5FUYA 2QP9X 4B43A 4JLKA 4LUCA 1VIYA 3VNUA 4TZ0A 2ZSBA 1OIXA 4P32A 4PC3A 4UNSA 2ZVPX 3FOZA 1OH5A 4C2UA 3GLIA 4G3XA 1VHTA 1TF5A 1ZNWA 1K6MA 3AEZA 1A5TA 3L0SA 3L0IB 2IYRA 4JL8A 3KUCA 1QHIA 3VU9A 2IYSA 2VF8A 1RPZA 5H8WA 1WF3A 2NO6A 3CR8A 4M1OA 3GQBA 4HATA 2P6RA 1GRNA 1ZVQA 3FMPB 4LYHA 3IIJA 3U3JA 1E4YA 4NCKA 1XWIA 4QL3A 621PA 4M2LA 2Q9BA 4E09A 2REBA 4Q48A 5E7JA 4HB0A 1VECA 3BFKA 3MJRA 2OO7A 2VHUA 3AVVA 1QVRA 3AVYA 3THWB 4C0LA 1SZPA 1JR3A 1GL7A 2QL6A 4K81B 5JEEA 2A5JA 2VP9A 2QA5A 2ZSEA 1L8QA 1NVVQ 3ZS8A 3EIEA 5G3ZA 3D3QA 3I73A 3T5DA 3PIRA 2FSFA 3BBPA 3QE0A 4IEEA 3A1TA 3ICQB 5FPHA 2VIIA 2DWQA 1JQJC 1IN7A 1FMLA 1G7RA 3DZ8A 3MUFA 4UNNA 3SJAA 3AVUA 4DLVA 2ZR7A 4HAYA 3AQ4A 1NRJB 1LY1A 1W2GA 2ZSAA 4KVAA 5EE1A 5FBRB 3NKVA 4Q47A 2J46A 2CCJA 5D3MA 2D74A 5JHHB 3CBQA 3CNNA 3K0EA 3ZVLA 5KSYA 1YZTA 3I92A 1A4RA 3O8RA 4I1VA 1N6HA 1W1WA 1Z08A 2RH5A 2QTFA 3N2IA 4H1VA 1KMQA 1EX6A 4W9MC 3KJHA 1G18A 3LBNA 2W6ID 5DI3B 2W2TA 1NY5A 4YXWD 1ZW6A 4Q4AB 3MWYW 3QOFA 2W83A 5HR5A 4UNPA 1KDRA 5HPYB 1CBUA 4S2EA 1E9RA 5H68A 2P5SA 1YR7A 4TMKA 1OIVA 2G83A 3M0EA 1T3LA 1G291 4CZ2A 4MYTA 3QG5A 1DOAA 1FNMA 3GJ6A 2A30A 3UG6A 3LAWA 4US1R 3ND8A 4KFTA 4HYYA 3QPVA 4Q66C 1LB1B 3GP8A 1CJUC 1SGWA 4BQSA 3AB3A 4Q4JB 3CWQA 4UQOA 2PZGA 4WXRA 1WDTA 2QMHA 4ESVA 1Z0IA 4G0NA 2IX3A 1OYYA 3BB3A 5G40A 2WJVA 1K8RA 4WAUA 3LDAA 2ZE6A 1II8A 4BWYA 2FNAA 3W5JA 2QMEA 1S4QA 4QG7A 3TRFA 1XFAA 4B75A 1AGPA 2A5DA 3SE0A 5TARA 3SJBA 4DLSA 1I2DA 3NEYA 2XSZA 1E2KA 4G5RA 3OFNA 4NE2A 3B7GA 5FTJA 3SHWA 1WB9A 4GL2A 2P0EA 3BORA 3HR8A 1W4BA 2BWJA 2KWIA 4PXAA 2OZEA 3I62A 1D9XA 3P4YA 1JJ7A 5C4MA 3UWKA 2WJGA 1TUEA 2ZE8A 5LDDC 3ADBA 1KK1A 3A1SA 2W6IA 3X2SA 2CHQA 4Q1FA 2YWEA 3PEUA 5KTYA 4EPVA 2O5VA 1KSGA 1TQ2A 721PA 4TQ9A 3CZPA 3EW9A 4TTQA 1IOZA 2F1IA 1U0HC 3W3AA 2P65A 4AI6A 5FUWA 1N5IA 3L0PA 4RFSA 3CRQA 2B21A 1JAIA 2PCJA 2RHDA 2VRWA 1IN6A 1KSJA 1RFLA 1LV7A 1JAHA 3FGNA 3P4XA 1XMVA 4OI4A 4Q18A 3FVQA 4JVSB 1FX0B 3LXRA 3AGQA 5E3HA 1UBEA 3H1TA 4XD7D 4BRWA 4N0DA 3K0FB 3EA0A 3GJ7A 4HAXA 4G5QA 4LY6A 3QI2A 2O0KA 4KO8A 1A2BA 2I4IA 3THYA 2ZJBA 3SN6A 1J70A 1WQ1R 4RZ3A 2PH1A 1M6NA 1TU3A 1Y3AA 1MR3F 3U44B 5DN6D 3QENA 2FZLA 2QZ4A 1OXXK 2QSYA 5DNYB 1SKQA 3B1WA 4PX9A 2IYLD 1GVNB 1HYQA 3GEEA 3NDPA 2J7PD 3NTUA 3AF4A 4BLQA 1UEJA 5AUOB 4GNKA 2G0NA 3JVUA 3AVXA 5KDLA 3PENA 4PSKA 3RWOA 2B8TA 1GTVA 1T8TA 1UKEA 3TBKA 4MRRA 5EJEA 3TSWA 4DB4A 2F55A 3FB4A 4QBIA 2OG2A 4PAQA 1E2GA 2BCJQ 2ZU0C 5JRZA 3F3YA 2CMKA 4OK5A 1KAGA 5HTKA 3B85A 3FKSD 1X3SA 2BCGY 3RABA 4C0JA 4ZIRA 4B48A 2BJWA 5KNBA 4TLBA 3Q8XB 2WWYA 3KDSE 4OQFA 2ZEJA 4IDNA 5FBWB 1XD9A 4RJLA 3ZZUA 1ESMA 3UPUA 2UZIR 2WWWA 4RCZA 1P6XA 4JT4A 4RCYA 2W2VA 2IXEA 1TTTA 5LB4A 3GLHA 1UKYA 4F38A 4NONA 1MOZA 1E96A 2B6HA 4M9ZA 4AURA 1W36B 4PPFA 3L8ZA 2OM2A 4DSUA 5DYGA 2BMJA 2NQ2C 3MCAA 4JS0A 2ZS8A 4QBHA 1H8HA 2IC5A 2QN6A 4Q21A 3SJZA 4KXFB 4IVQA 4BZPA 221PA 1DO2A 2JA1A 1Q21A 1TQ4A 421PA 1ZYUA 4UKDA 3AH8A 1ZM3A 4O2LA 4TYWA 1NLZA 3CPJB 1P2TA 3DOFA 3TK1A 5AJVB 1AA9A 2B8WA 2JJ2A 3CF6R 2D4HA 5KU1A 4L5BA 1S9DA 4GZLA 2C96A 1V5WA 3IBGA 5CLLA 5J4YA 4RD1A 4OHVA 1NN3A 2Z43A 1VDZA 1P61B 2J59A 1TMKA 1YZQA 3PCRB 4C2TA 1CJVC 521PA 3WNCA 2CJWB 3L43A 4EIWA 3ICEA 2ZS7A 1VG9B 1WA5A 4LYAA 4NCJA 4GMDA 3B60A 1XEXB 4HAWA 2VP4A 3QQ5A 2PBRA 4PO9A 5GVRA 1R10A 2JJ1A 3FE2A 5F3WB 2CL6X 4JZKA 4B3BA 2ZRPA 3X1XA 3CPHA 4UJ3A 4PQRA 4MRSA 1T91A 2X2EA 3CM0A 1KI7A 1ZJ6A 3U4QB 4Q5IA 5IK2A 2X77A 3C5HA 2IL1A 4RD2A 2A78A 2L0XA 2AX4A 2RGNA 2V6IA 2WKPA 2ZREA 5CM8B 1S3SA 3KTAA 2ZJ5A 5IK2D 2OBNA 3BC1A 2X19A 2VBCA 821PA 4ASUD 1VPLA 2FN4A 4UXHA 4JL5A 4BUJA 5FBLB 1VIAA 3DM5A 3SQWA 3AP1A 2JIZD 3QEJA 4MYUA 3LWNA 4W5HA 2EYQA 2WTUA 1ZC4A 4KLZA 1KNQA 1ZP6A 3SDZA 3S1AB 3I4LA 3EIQA 3U3KA 3QXHA 1GL9B 4ZDJA 2D7CA 2E9SA 1P7CA 3LQQA 1BMFD 1QHHB 1M74A 1V43A 1FPMA 3WHLA 4AYXA 5J5CA 2A5GA 3NC1C 1Z2CA 1W49A 4YMVA 2VSXA 3OE7D 1W48A 3LQRA 1S8FA 1CJMA 1G9XA 1OHHA 2VYFA 3X1WA 4XOIA 5C4GB 3QXXA 1LTQA 3RSOA 3U4QA 5DI9A 1MO4A 4RZXA 1R7RA 1NG9A 3ASYA 1AIPA 4NYJR 3VHLB 5L3QB 3DO6A 1I2MA 3LXXA 4PZZA 4NDZA 5DGXA 1CKEA 2LKDA 1DTSA 5ANRB 4WXPA 3D31A 1ZD9A 2GZAA 4Q4HB 2ZJZA 4LC0A 4DCUA 5B2ZA 3Q5DA 5FPTA 4GPTA 5EP4A 2I1VB 1Z28A 1D2NA 3DMDA 4P4TA 1WBBA 1S1MA 2BHRA 1KK0A 2JEOA 2XTZA 1W5SA 2FPMA 3CH4B 4M0LA 3TGPA 2ZRGA 2BM0A 5CLQA 2XNDD 4U00A 4LJAA 4YDHB 3P20A 4FMBB 1P2VA 4N0EA 1FTSA 4ZPXA 3ZVRA 2CLSA 4IDQA 4MH0R 5CDFE 1D9ZA 1X8KA 2XITA 3BRWD 2YOHA 4F4CA 4UJ5A 3HU3A 4HB4A 1W4AA 4L16A 1KMHA 3PEVA 3R7WB 1IONA 3M1IA 2GCPA 3P27A 1WXQA 2O8FA 4DRZA 3K0AA 1TX4B 1FOEB 1W5TA 1JJVA 1GNRA 2OCAA 4D0LB 2GJKA 2WIAA 5K8IA 1NVUQ 1VYVA 2J7KA 1N6RA 1XX6A 4QC2A 5BN4A 2KJQA 2XTNA 2W00A 2RGXA 4JT2A 4RD6A 1NF3A 2CNWA 3E1SA 3W6NA 2O8DB 4TT3A 5BN3A 2DWPA 1OIWA 2OBLA 2YWHA 2C9YA 3AKCA 4QM7A 4WBSA 2CL7X 3R9WA 4DIDA 2VHJA 4HAVA 1G7TA 5AUPB 1HQYE 3MFYA 4FN5A 3GLFA 1DAKA 1TU4A 3IPXA 3PVSA 4JLOA 3SBEA 3I8SA 1ZIPA 2NZ8A 1ZM7A 2RGGA 2KB0A 2H17A 1JR6A 2ZJOA 1NJFA 4EJSA 3BS4A 4P4SB 4PQFA 2XB2A 3K0SA 1NJGA 2O8EA 1XEWY 2GEDA 2B7BA 2IYXA 1G3RA 4LZZA 1R8SA 5KPDA 2OILA 3HWSA 1JECA 3F0TA 1T0HB 2AD1A 2FPLA 3SNHA 3QBVA 3H2YA 2RGBA 3KKPA 2J0UA 2JATA 1Z6XA 4PC1A 3T15A 2HYIC 1SVWA 3GLGE 2IWRA 1G6OA 2QGZA 3DPUA 4A92A 5TVKA 1JPNA 2IXFA 1E1RD 4Q03A 4NMMA 5JRJA 5LBIA 1GRQA 2PMKA 2MSCB 4EAQA 4AKIA 3LBHA 4PSAA 1QHYA 2GF0A 3UATA 4Q9JA 2IWHA 5D3MB 3A1VA 4RSGA 4FCTA 2ODNA 3EPJA 2QP4A 3RRMA 3K9NA 2GJ8A 2WWIA 2RGDA 4FD2A 4Q7KA 4LBYA 1BH2A 1KI6A 4XTRA 3TVDA 2D3WA 4NZYA 3V9PA 2PMDA 2ZAMA 3GLFE 3LVQE 2FG5A 1XPRA 1M1YE 1E0JA 1BYIA 3B1ZA 4CW7A 4D80A 3H86A 4FMCB 2QMOA 2O8BB 4LYFA 1FZQA 5AUNB 3Q7QA 5KPJA 4TYPA 3ECCA 1Z63A 2VP2A 1G4UR 4R98A 4HZUA 5F9HA 2ONJA 4ESHA 4KVGA 4PPQA 4AKHA 3QXCA 2QRZA 2JLYA 3VFDA 1QHSA 1E9CA 2C9CA 1NG1A 4WZAE 4TLEA 1IQPA 4L15A 4Z8YA 4AK9A 2XNDA 2AKYA 5C1BA 4AYWA 2OCPA 2QG6A 4TL6A 1P9WA 2FX3A 2V1UA 1AKYA 3IDQA 1E1QA 1SULA 1QVAA 1FQKA 1WRBA 3H0KA 5K8TA 5G53C 4U5XA 2XZLA 1UPTA 3AUXA 1KSHA 3NBZC 4JLAA 1F60A 1LW7A 5EZ5A 1AJEA 4V0NA 3B9PA 3LLMA 5CYOA 1IBRA 2GXUA 1ZUIA 5TDHA 4QGHA 4RD0A 1R5OA 1AQUA 1W4RA 4Q4HA 2ZRAA 1EFUA 3PEYA 1AZSC 5FPSA 2N46A 1TEXA 4JMPA 1XMJA 1ZUNB 1FQJA 2ZI3A 2FV8A 2QY9A 3ZGXA 1OE0A 1JXMA 3ETLA 1NN5A 2WV9A 3CRRA 3F5FA 4DLYA 5FOVA 4EQ6A 1J90A 4FI3C 4KBFA 1E0KA 2KSQA 2AN9A 3VTKA 2GXAA 4WZBE 2A5FA 5EXTA 1XTQA 4QGFA 3KB1A 2IF2A 4QHTA 3WNBA 2WOJA 4JBYA 2ZANA 2XB4A 4XVQA 4EQ6B 5EP2A 2IBMA 3U7EB 4YMUA 1FP6A 2CE7A 1GM5A 3BK7A 1NBMD 1DADA 4YMTA 1Z8FA 3ZS9A 2FGKA 1R2QA 3RS2A 1HY3A 1CULC 1GUAA 1X86B 4TMWA 3PXGA 1FNNA 4PZLA 3GJXC 4YONB 3DMNA 1OPXA 4TLCA 3W34A 3IEUA 3KQUA 2PCLA 2Q3MA 4LBVA 3Q3JB 4C7OB 4EPXA 4LPSA 3O47A 3K53A 1AGRA 1CIPA 5KNCA 2CLCX 4TL7A 2WBLC 1R0WA 4PAMA 3AF0A 3LRPA 1RVDA 1RRPA 4B74A 2QBYA 4LRWA 1CR0A 3ZVNA 5CM9C 1SXJE 2IHYA 2QEQA 1T5IA 2QSZA 1ZUHA 1NKTA 1XU4A 2NOAA 4HUQA 3KFVA 2QQ0A 1Q57A 3WYFA 1N6IA 4POAA 2BC9A 3LVRE 1J8YF 1UKZA 4IW3B 3PJRA 1JBKA 1KDTA 3DKPA 4H1UA 1GKIA 4PC2A 2DWOA 3LA6A 2V3CC 4YMWA 2FOLA 4JVNA 1XEXA 5JI3E 3V00A 2AWNA 2ONKA 5SZJA 3RRNA 2V7QA 2GJAA 2ODWA 4URZR 2Z6VA 4P0TA 1G1MA 1R0YA 2R2AA 3E70C 2GHIA 4P3YA 2PZFA 4KSCA 5DE3A 1HH4A 5K8UA 1ELOA 1GAJA 2OFOA 2CEAA 3U61B 3OE7A 4A2WA 4V0MA 4TL9A 2CVFA 1US8B 1QZXA 2XAUA 3TR5A 1U8YA 1E2HA 2HV8A 2ODEA 1Q0UA 5IF9A 1T6NA 4IXMA 4A0RA 1Z47A 3THXB 1VCOA 2R44A 1AS3A 1YZNA 1E32A 4U7DA 2OEPA 3K70B 2XJ4A 1D6JA 3L2OB 1KO4A 2ZI9A 3T1TA 2Q6TA 1ZU4A 1MRSA 3R8FA 2IEYA 1ZNZA 1F48A 2IA5A 1G3QA 3NXSA 1XD2A 2XOKA 1XJQA 1K5GA 4TSFD 3VR2A 3K9LA 4RFSB 1FUKA 2G3YA 2J7PA 3TSZA 1UEIA 3J81k 1CEEA 2V4ZA 2ZQ5A 2QBYB 5GADl 2GEVA 2OSBA 2ANCA 2WZQA 4XWAA 2JLSA 1Q20A 2EFHB 3LO5A 1YHNA 1E9SA 2F3RA 5EE5B 5GJWC 1P75A 1E98A 2ZUCA 3CNLA 1E69A 3EWAA 3KL4A 3KUDA 4ZIRB 4TL8A 1OKKA 4O25A 4TTRA 3TLXA 5BXQC 3DZDA 5HE9A 3QF4A 1PVOA 3QKUA 1U90A 1NNEA 4EFNA 4B2LA 3QG1A 4NCIA 4Q1BA 2XZPA 3REFA 3MSXA 4BLOA 5FTLA 3D6TB 1VCIA 2O8FB 5JS8A 2BVNA 4Z1MD 1P60A 3TE6A 3RC8A 2DBYA 3C15C 4PR0A 5J40A 5KOYA 2WVJA 1GDDA 3K9HA 1NBME 4NYIQ 4P33A 4W5JA 3V4FA 5L3RA 2VA8A 3C16C 4O2RA 4JIMA 5CIQA 1AN0A 3BB1A 3SYKA 4DLWA 3P1JA 1Q3HA 4KJZA 1B0UA 3LW8A 4I81A 1BMFA 1GKUB 1R0XA 5HKKA 2GXSA 2YC4C 3WMEA 5DISB 4L9WA 2FEMA 1N5LA 4JL6A 5FL7A 3CF2A 4LX0A 1VCNA 4K46A 4ZI2A 1GILA 1YVDA 4HDQB 1SXJB 1YRBA 4LV6A 2FA9A 3DDCA 4CF7A 3GEIA 2JLRA 4ASUA 4Q19A 4LHXA 5P21A 1W44A 3V4RA 4JLNA 1E9DA 2Z4RA 3H84A 4OHXA 2JLWA 5IRCD 1OFUX 5B64A 5FL7D 2IYWA 1QHHA 1EFTA 1N6PA 1G3IA 3EC1A 5SZIA 121PA 4EFMA 5L3QA 2RHMA 2ZYUX 3OIUA 2JLUA 1TNDA 1XTSA 2C98A 1KJZA 4HLDA 1A2KC 3QKSB 4MKFA 5DI3A 2J1LA 4B35A 2H18A 1Q1EA 2QTHA 4JVMA 4LCBA 3MJHA 2AWOA 1N0WA 4G01B 1JR3E 4US0R 4DUGA 1OV4A 1Z0AA 1OXSC 2CCKA 3EZFA 3KKQA 5KNDA 4LK2A 3KQHA 4NKRA 2F9MA 3OEHD 4HAUA 3KXIA 2CHGA 3VR5A 1T3SA 4B76A 3UMFA 1UM8A 3QJYA 4DUGD 4FMDB 4MA4A 4MGYR 4TQUS 1XTIA 2OE2A 4M9SA 4HLQB 1RZ3A 3EWSA 4QGAA 4DKXA 2DFNA 2H7VA 5HKKD 2VSFA 3RRZA 4FCWA 4IKEA 2PJZA 4I99A 1WE2A 3CONA 4IXNA 1P9NA 1EWQA 1G8PA 2NO0A 1D2MA 2F7SA 4GSYA 2N1BA 1IM2A 2OAQ1 1T5LA 4CDGA 1C1YA 1IHUA 1TL7C 4IVPA 4RFVA 2O8CA 3R9XA 3REGA 1JEEA 1XB2A 1Q1QA 2ZRFA 3ADDA 5G3YA 4RKEA 2P6NA 3FMFA 2AL7A 1CLUA 1JEDA 3LH5A 3T1OA 5F2EA 4O0MA 4JLJA 4Q01A 3IQWA 4QGGA 2ZR9A 1KO1A 3U2QA 1C9KA 1GWNA 4F93B 2PT5A 2AXNA 1E9FA 3B1VA 1O87A 2CVHA 1Z83A 1ZRHA 5IDVA 2JDIA 3K70D 5DO9A 2P3SA 5HE8A 4CVNA 2AK3A 1M7GA 5FR1A 4P4UA 3QVVA 1UDXA 2KE5A 1M34E 2AFHE 2ZRHA 2ZE5A 1IJFA 1LF5A 2BMEA 4BFTA 3X1DA 1JALA 2R6FA 2R62A 2ZRKA 2BBOA 1RRFA 4LV8B 3CRMA 2HT1A 4AG5A 4GOKA 5KSPA 1UBGA 4TSFA 3OEHA 1OH6A 4L9SA 2QQEA 1T9HA 3VX4A 3ZDQA 1YR9A 4R7ZA 2ZRNA 5JBQA 3IHLA 1Z29A 2VH5R 3QKRA 2O8CB 2CHVA 1U0JA 2WM9B 3B5JA 1QBKC 2BMDA 2EWWA 2TMKA 1KKMA 2HCBA 3TUIC 1IN4A 4PHTA 1KI3A 2X2FA 2XSZD 1P2UA 2G0TA 2GTPA 2GWHA 4NL4H 1FUUA 2ANBA 3GLIE 1G5PA 3CRVA 4Q9IA 2ZYWX 2O8EB 4X8HA 1KI1A 2QM7A 4I1OA 4MYCA 2HJVA 3FKQA 3SFVA 3CX7A 1IXSB 5EQTA 4OL0A 3U3RA 1XXHB 1N0UA 3GFPA 4ZKDA 1KO7A 4DCVA 2AD5A 2XOKD 2JLZA 3CF0A 2OXCA 1Z6YA 3AKDA 4QM6A 3TAUA 1OLOA 3BIFA 4PPNA 2ZRIA 3SJCA 2Z83A 2X1VA 3AP2A 2HYDA 1JNYA 1IY2A 2VSOA 4LSGA 3A4MA 1PUJA 2LCFA 3E5HA 1ZNXA 3QKSA 1ODFA 2CE2X 3AP3A 1KMHB 5J4KA 1L7VC 3EZ6A 4PHHA 5FOUA 2GETA 5DIFA 2YWGA 4A82A 3K9GA 2ZI7A 3TUZC 5EE0A 4NU0A 1TF7A 1S9HA 1JXOA 1XMSA 2F43A 1FMJA 1G16A 1S2MA 4F4JA 1CJTC 1Z07A 1Z0DA 4JKIA 1YRAA 2P6UA 1W0KD 1DO0A 1ONBA 4M1SA 3QVUA 5FFMA 4IOLA 3OIYA 3OESA 3QY0A 4KI0A 3QKRB 3KQNA 3U7HB 4URXR 3SHFA 2OV2A 4CIDA 2ZXUA 1G8FA 1YKSA 4XVRA 1XTKA 2CK3A 4Q9KA 4L8GA 3ASZA 1XXHE 2C2HA 1HEIA 4GZMA 4HB2A 4P31A 5AJXA 1XCMA 4HZUB 1NSTA 3B78A 4LHYA 3RC3A 1VTKA 1NVVR 2RAPA 3G82C 2DY1A 1WP9A 4LC1A 4HZIA 1SHKA 1N6NA 3X1ZA 1DAHA 2O8BA 3A6PC 3PV0A 1VG0B 1WCV1 4CEHA 3KZ1E 3C4JA 3U3MA 1QF9A 2ODBA 2BOVA 3Q72A 3U60B 3F8TA 1G4AE 2FSIA 3RNLA 5GJBA 2O8DA 2JJ1D 2F1JA 2O0JA 5J4HA 2HLDA 1DAFA 2IF0A 5AJWA 4II7A 3BB4A 1ZM2A 2ORVA 1D8TA 2GKSA 2QROA 4LJ7A 1XJCA 4HUTA 2WAXA 4OQMA 2QORA 5FOXA 4AIIA 2WSSA 4AG6A 2QP3A 8OHMA 1E79D 1BO6A 2W6JD 3GMTA 2NG1A 4AKGA 1LS6A 4MGZR 1SVIA 3VU9B 1EXMA 4A36A 3UXMA 4ZKEA 2WSSD 4A0GA 1E94E 1FFHA 2EFDB 3CIOA 4D4LA 4TMZA 4D0NA 1DVRA 2XEXA 1B23P 1G8GA 1YQTA 1Q3TA 4N1AA 2V8OA 4M9QA 2LKCA 4YMSA 4C3ZA 3PFIA 1I4TD 5EE9A 3TKLA 4DZZA 4M1MA 3PG5A 3LY5A 5H70A 2PX3A 2HLDD 1A1VA 2OESA 1PZNA 2B7CA 4DC9A 4XWOA 1NL3A 3WY9A 4HDCA 3HPRA 1E99A 1U81A 2GK6A 3SC3A 1EESA 3ZIAD 1E2PA 4LHVA 4JJKA 2Q3FA 1P2SA 2ORIA 5D3QA 1E2JA 1OJLA 4EPWA 2Z4SA 2R9VA 3NHAA 1RC8A 1RE0A 5LD2C 2C77A 1NN1A 3KKOA 3OAAA 2G88A 4IFEA 2CL0X 4EFLA 2OUKA 5EXPA 3LX8A 2HXYA 3SOPA 2IS6A 4Q4JA 2C9OA 3K70C 4P4SA 3BAFA 3SYNA 2IUSA 2CLDX 4GOXA 5KO2A 2JGNA 1SVOA 3DL0A 2J5XA 4IRUB 1Z6TA 1BKDR 3MRSA 3VR6A 4Q00A 4DLZA 3GLHE 2OHFA 4HUQB 2Z0MA 5JCZA 2WMOB 4MRVA 1PV4A 4GOJA 1HV8A 1RW4A 2BEJA 4DLXA 3DOEA 5GJCA 4JLVA 4CEIB 1E2FA 1YJ5A 4E03A 4DB2A 1KKLA 4LJ8A 1GIAA 2H16A 2ORWA 1XCGB 3A58B 3BGWA 3A36A 2FMXA 2I3BA 2GAOA 4LBWA 3WP0A 1VHLA 1SVLA 3PUWA 1IJEA 4I1SA 1SXJD 2RMKA 3AVTA 3P32A 2CK3D 3VX3A 4JBWA 4Q02A 4ZV4A 3K0CA 3W6OA 3T1VA 4WZ6A 2W0SA 3U3OA 2NMVA 3EZ9A 5SZHB 4BFXA 4I4LA 2F3TA 5HCNA 1A7JA 3K0AB 1YZKA 3CW2A 2CXXA 3FHOA 2FFBA 1KI6B 2ZU6A 3AKYA 1W47A 2G77B 4OI0A 4RZUA 1NY6A 4A8JA 1CR4A 4OHZA 2FFQA 2YOGA 3AVQA 1KHTA 4XD7A 4A6PA 2HUPA 1G3UA 4DCTA 3C5CA 1CTQA 1KTVA 4JJZA 1M8PA 3QF7A 1N2CE 1Q1BA 1XTRA 2GZHA 3KB2A 1IAQA 2ZRDA 1Z0FA 1XD2B 2CNWD 2FEOA 3O8BA 4FXPA 4GBMA 4E5UA 2OAP1 2MSEB 3AKEA 3VR4A 2V7QD 1LVGA 4F7WA 1QHXA 4MKGA 5A5GA 4BZQA 1X6VA 1J8MF 4PHFA 4BFSA 5KDOA 3EPLA 3KKMA 4TLAA 2FSGA 5L3VA 1MABA 5BN5A 1VYTA 2C03A 2GRJA 3NH9A 5TXGA 2C8VA 3PUVA 3A4LA 2JLQA 3MG9A 1E2MA 2XX3A 5FOSA 3T35A 3TVTA 4GDFA 1QHNA 1E2NA 2HDNB 2R65A 3GJ0A 5CB6A 3W9YA 1SXJA 4BFUA 3SBDA 4PTLA 4BGDA 2OCBA 3BH7A 4B6FA 1XZPA 1G6HA 1SKYB 1Z6AA 2IEZA 3ADCA 2QUZA 3RYTC 2ZTSA 4DT1B 4S35A 4MYHA 1KI9A 4HDOB 4RD3A 3HPQA 2YNMA 4V0ME 3GLHB 5FTMA 2VHTA 3W90A 2OBMA 1IXZA 4D4JA 1AS0A 2VPPA 5FTNA 3LBIA 1R5BA 2REXB 3U6BA 2W2XA 3SR0A 3I61A 4C9BA 2RGCA 4IDHA 3SS8A 2QAGC 1TAGA 4F92B 1Z22A 5GVSA 2FH5B 3NBFA 1TQDA 4MRPA 4DEYA 4KODA 3TR0A 3DKVA 5AJZA 3OZXA 3FFBA 3GD7A 2MMGA 2DHRA 5KYKA 2ZRMA 2GESA 4OI1A 2ZJYA 2WJJA 3FHCB 2HF8A 2VQSA 3NEJA 4NCHA 4GP7A 1LNZA 5CJPA 3TJZA 1AM4D 1NI3A 2HXSA 2YC2C 4LDJA 4KBGA 2GCNA 4CEJA 3GEHA 3QIAA 3K1JA 4G1UC 3RANA 1EFHA 2BM1A 4B3FX 1NIPA 4BLRA 4QJ5A 3T5GA 1CJKC 3G0HA 2W58A 2ZYTX 3AF1A 4PQYA 2G6BA 1T0JB 4UNQA 3R8CA 2GJ9A 1CP2A 4WVFA 3FYHA 1X8JA 5H1YA 1JR3D 2PT7A 1XZQA 4OKSA 5JLJA 1D2EA 1GNQA 2P5TB 3MD0A 4TLDA 1NSFA 3KXKA 4V0LA 2QENA 2CBZA 3IKJA 4IDOA 4Y0AA 1SVKA 2GVDC 1Y63A 2JDID 1E2IA 3IILA 1PUIA 2HCJB 2DB3A 1I4DD 3FFAA 1XJ0A 3NG1A 4FMDF 4IVRA 5HCIA 2JASA 1NLFA 1ZMXA 4GI7A 4LJ6A 4W7SA 1BIFA 1X1SA 1GFIA 4A8JB 3TSOA 5FI0B 3RS0A 1J99A 1OKKD 4Q9HA 2IYQA 1SXJC 4MDFA 2DFLA 3OFND 2ZIAA 3M6AA 3CB4A 1H8EA 3A1UA 4BPBA 1IXRC 4WA7A 1EFRA 1CRPA 1OB2A 4HB3A 3JVVA 3K0FA 4KSBA 4M22A 4QNRA 3RLFA 4ZI3A 2EFEB 2WICA 1U99A 3I8XA 4IEIA 3LW7A 3UMSA 1OFTA 2D2EA 1ESNA 2XTMA 2E87A 4M8NE 5E95A 5JWHA 4KU4A 4JLDA 2ZJAA 3K0CC 1G21E 1ZCAA 4Y0VA 4A1FA 1VKJA 3UG7A 4A0FA 3WHKA 2ZRLA 3WXMA 1U98A 1L4YA 4JKYA 2QI9C 4BZXA 3U7GA 5CK5A 2UVQA 4U02A 4TMXA 1E9AA 1KI4A 2ZI5A 4M1TA 4NYIR 1RJ9A 2G1KA 3T61A 3G5UA 3CPEA 1NN0A 4PHGA 2W0MA 2GK7A 1E79A 3SZRA 4DCNA 2ATXA 2BEKA 3QXSA 1H65A 3W6PA 4ZDKA 2V1XA 2QAGB 3H4MA 3L82B 3T1QA 1CF4A 4Z1MA 4ZO4A 4Q7MB 4OQNA 4TYQA 1R5NA 1H8ED 4TMVA 3WBJA 4DXAA 3ZVMA 3B9QA 4Q1CA 1HE8B 5BYKA 3BFXA 1DAGA 2D06A 2IK8A 1N6OA 1H8HD 4FMCF 4E07A 4KFRA 1KZGB 4B6EA 1DG1G 5CB8A 4OK3A 2Y8EA 2VP6A 3BWDD 1PLLA 5FOTA 4J0QA 4QXAA 3PITA 1UBFA 5EE3A 1EGAA 2DPXA 2R6CA 3CO5A 3CX8A 1PJRA 1DAEA 4LJ5A 4NYMR 5FUXA 4B34A 2CDNA 3BXZA 4BLTA 5CYPA 1KK2A 4PC6A 3BD9A 2GEUA 4M9XA 1SHZA 5M04A 3ZYCA 4Z51A 3I72A 3Q5EA 3TMKA 1AK2A 4OJKA 1EK0A 1GRRA 1FX0A 1KDOA 3RHFA 5C46F 1HT2E 4MKIA 5L3SB 3SQXA 4B71A 5DYIA 1JI0A 2RGAA 3OIVA 4C0KA 1XPUA 3QBTA 1EG7A 3AGPA 2GVZC 3KTAB 3T12A 2D62A 1TQ6A 3W8NA 3FTQA 2VHCA 3NIBA 1WBDA 4GFDA 1P73A 2KBFA 1RJ9B 3NBYC 1CU1A 1PLKA 1HE1C 2QE7D 4JBXA 3SYLA 2WJHA 3NWJA 1W7AA 1OHHD 3GLGB 5CJ2A 2H1LA 2OFWA 3B8HA 1JPJA 2BKEA 1E6CA 3IGFA 4D81A 1BOFA 4UXIA 3WBKA 3VKHA 4XTCS 1S3GA 5TMPA 2OXRA 2IYYA 4C30A 3OHMA 2ZYVX 1M2OB 2PEZA 1F2UA 2J45A 4IJMA 2V54A 2EYUA 4D25A 1E2QA 2VTKA 1OT3A 2NO1A 1SVMA 3LX5A 4MDEA 4B2IA 3B2EA 3WRYC 1DPFA 3ZIAA 1ZINA 3BH0A 2WWFA 3EX7C 4CT4B 4PO1A 4DLUA 4XH9B 5EUMA 4A9AA 1Z3IX 5BW8A 4B3DA 3TIFA 4LBZA 1W0JA 4M4SA 2VL7A 3I3SR 5JCPA 5HZKA 1IY1A 3TH5A 5AJYA 2WSMA 4MKHA 1HQCA 3OEED 4ARZA 1P62B 4QOSA 4NYMQ 1N3BA 4CEHB 2BKUA 1ZM4A 3SEAA 3GFTA 3I32A 2YJTD 3FKSA 5L8VA 2AKAB 5CDFA 1LF0A 4HLUC 1G17A 1IN5A 4R2IA 3D8BA 2WWGA 4IOMA 2BBSA 4NP6A 3TAHA 5SZKB 1OH8A 3FMOB 4MUBA 3K09A 4BFYA 1FTNA 3PUYA 3TW8B 2J0UB 2ZAOA 1OF1A 1OH7A 1DE0A 2YINC 1T3HA 3UWOA 1XEFA 3KKNA 2N42A 1DBSA 2ZE7A 3RS7A 1IY0A 3WP1B 4X8MA 2A7QA 1U9IC 2IS2A 2P67A 4WW0A 1DARA 1U8ZA 4BEBA 3RS4A 1YZGA 1G5RA 4XWKA 2ZI4A 2RGEA 2ZITA 1QRAA 4TWZA 2ECKA 3VR1A 4N3NA 4DDWA 2VF7A 2HEIA 4PZYA 3ADKA 1OYWA 2UZ3A 3FWYA 1BYUA 4YXWA 2K5UA 4ABYA 2FFAA 3JZAA 2QMUA 4V0KA 2GBLC 2Q0HA 4DLTA 4LHZA 3TQFA 2AHOA 4DVGA 3THWA 2A9KA 1KO5A 1KO8A 4BE7B 2MSDB 4MITA 1E1RA 1LFDB 3GFOA 1GKYA 3GLGA 1K5DA 4PFSA 2P2LA 1W4CA 1MT0A 3VQTA 1KY3A 1TUIA 2NPFA 2IHBA 5ELXA 1F5NA 3VKGA 3N5CA 1J7KA 1E1QD 1KIMA 1VG1A 2QPTA 2ZVQX 4PPGA 3P26A 5AWFC 4BFVA 1X8LA 5FUVA 1CRQA 3LNCA 3MWKA 3O8DA 5JJKA 1XXHA 3HR7A 2BDTA 3A4NA 3IO3A 4ARZB 2BBTA 4F91B 2DR3A 3GJ8A 3IIMA 2W6JA 4RKFA 4PAOA 2RB4A 1G41A 4W5WA 4URVR 1F6BA 3Q85A 1N0VC 1OXUA 1NMZA 1R0ZA 1KGDA 2FPKA 1I4LD 1Q44A 4WOPA 3X1YA 1KNXA 4DSNA 2SHKA 3CR7A 5TY0A 4C0BA 1C4OA 2A5YB 4V0OA 5HZHA 5E7MA 2QT0A 2J9RA 4LV5B 5UKDA 2V6JA 3KX2A 3M4YA 2QNRA 2EU8A 3HYTA 4Q4AA 3WMGA 5LPNA 4UXJA 4DHEA 3SU8A 1YR6A 2F1RA 3CWZA 4M1YA 3AV0B 4LWZA 5FPKA 4QHSA 5EZ6B 3KJGA 4D82A 6Q21A 1E9EA 2GNOA 4EDHA 2ZRJA 3B1XA 1G3MA 2FFHA 4ZDIA 4JSYA 4RZ2A 2FDCA 1D5CA 1RRCA 4MUAA 1XMIA 2XJ9A 1M7HA 2QT1A 4ZCIA 1XNJA 2JLXA 2EWVA 2WMNB 1EFCA 1XCPA 4TZ6A 1S0UA 4B3XA 1EX7A 1P3JA 2J0VA 3LV8A 3AF3A 1E2LA 2WPDD 3KFXA 4JSTA 1ANKA 2Q21A 1MKYA 2CCGA 2REOA 4Z54A 4L4UA 3I5YA 4KYUA 2B92A 4M1KA 2V55B 3GJ3A 2I1QA 5EXXA 3NH6A 5AUQA 1P4SA 1ZNYA 3O8CA 3FHTA 1OB5A 1Z0JA 4AWXA 3I5XA 3AVOA 4PC7A 1VCMA 1RRGA 2NZJA 4C7OA 1OSNA 1CR1A 4UNRA 4FINA 5TV2A 3VHXA 2R8RA 5JHGB 5JEDA 5FPYA 4C4PA 4CRWB 5G41A 2VP5A 1CS4C 2EQBA 4BEJA 4RVCA 4D26A 4NBSA 1OW3B 4E22A 2E1RA 2ZM5A 4QRHA 5E4FA 1E2DA 1T4GA 2JJ2D 4JLPA 2C78A 4K8OA 4DBLC 4BLPA 1KK3A 1OXTA 3NVAA 1YU9A 4KCGA 4OBEA 4QJ4A 3GLIB 3ND9A 3ZD7A 1N6LA 2ZUDA 3C7KA 5F98A 5CK4A 2FWRA 5AK0A 4KFUA 3CZQA 2D7DA 4CEIA 2ZETA 3B13B 4URWR 3E2IA 3MLEA 5FL3A 1E0SA 4D4MA 3U6KA 2ZR0A 3HYRA 2FZ4A 4MQBA 2NIPA 3AVWA 2NGRA 5DSZA 3EAQA 5EP1A 1Z5ZA 2BIFA 5JJIA 2ERYA 3QPUA 4LJ4A 4JYBA 3PUZA 1A82A 1SKYE 1X1RA 1DS6A 1W46A 5FH9A 3UANA 2QPOA 1N5KA 2IYUA 3UKDA 4EPTA 2AXPA 3MWLA 4HAZA 4D2IA 2JAQA 2QM8A 2R6GA 1KSFX 2GAAA 2D2FA 2H92A 1CR2A 1TADA 2A3RA 2NO9A 2Z5FA 5KUTA 4WIAA 3VMFA 2OFXA 3LLUA 4ACAA 2J41A 2WJIA 5F9FA 1EWRA 2V9PA 4DJTA 3AVPA 3WRXC 5JMTA 5BWMA 4B33A 3L0OA 3B82A 2OLJA 4HLUA 5CIWA 2J0SA 1HUQA 1OFHA 1IN8A 4NHOA 3U44A 2IUTA 4AKEA 2JIZA 3KQKA 1KI2A 3QKTA 1KAOA 4EJSB 2IT1A 4BFZA 4ITRC 2QGNA 3RDPA 3TNFA 4A0HA 4OK6A 2GDJA 5JS7A 2BBWA 3W3ZB 1COWA 3ZQ6A 4EJSC 2DCUA 3EG5A 3EZ2A 4OYHA 4Q7JB 4DSTA 3QEOA 1P9RA 4QHYA 5FOWA 1E2EA 2HJGA 1AS2A 4MRNA 2F9LA 1U8AA 3N70A 3R9IA 3ZJYA 2J87A 4GRAA 4AC9A 1HURA 5DLQC 2FF7A 4CEJB 4ZDWA 4D6PA 1YZLA 3IUYA 2YV5A 2VLIA 4Q7LA 5JI2E 3NC0C 1VG8A 2EFCB 4URUR 3OAAD 4LOAA 3C41J 3CX6A 1AKEA 1RIFA 3FDIA 3TUJC 5BQ5A 5IT5A 1EFRD 1MO6A 2G9NA 3GJ4A 2AK2A 3PQCA 4CYMA 4KLNA 2ZROA 2VP0A 3DHWC 3JZMA 1E0AA 4OHWA 1E4VA 4YLGA 2ZSFA 1QDEA 1II8B 2WJYA 3KJIA 4BECA 3LD9A 4HLCA 4Q1DA 3LFUA 5J4VA 1UBCA 3EXAA 4GMXA 3TW4A 4B47A 3GPLA 1Z0KA 1NVWQ 2JCSA 4ILEA 2XXAB 4TT3D 1Z06A 4D0GA 4PANA 3ZH9B 2ZJ2A 4TYYA 2PX0A 1KDPA 2VHQA 3A1WA 4DDVA 1GSIA 1MABB 2O0HA 1HA3A 1G8YA 5DHAA 4RD4A 4GT1A 4XVUA 4OI2A 1UKVY 2WWXA 3IIKA 4JLMA 1II0A 4XIGS 1P72A 3ZLJA 5DHFA 3Q7PA 1DELA 3ONWA 3B1YA 3EARA 5B57C 2ZS9A 1LS1A 2DFTA 1Z2AA 3CKLA 4JVLA 2JLVA 1TF2A 3IQXA 1NIJA 3THXA 2XXAA 4KV9A 1L2TA 1XF9A 4EPRA 1MV5A 3IEVA 1AQYA 4B73A 1UF9A 1M7BA 2R6DA 5KSZA 2EVWX 1UFQA 4IDPA 1US8A 3VNVA 1MRNA 3PR1A 3DM9B 4US2R 2YHSA 3C14C 3VR3A 1S96A 3ZZ0A 1P5ZB 5J47A 1DAIA 5JWOA 3OIWA 4AY2A 2PEYA 2ZSDA 1NP6A 4DDTA 4ZCMA 3S1AA 3IO5A 3K8YA 2O52A 4R9UC 5GJVC 1W36C 4LPKA 4IHQA 4NCNA 3Q9LA 1KOFA 1ZC3A 4G5GA 4DDUA 2MMCA 2XZOA 5KSOA 2OT3B 4R2HA 4A8JC 1G7CA 1QHGA 3SFZA 2GZDA 2ZPTX 2ZRCA 4V03A 3W8RA 4DT1A 1GNPA 3KXLA 5TB5A 1NVXQ 4JLBA 1DEKA 1II9A 2FGJA 3R7WA 3VKWA 2PLFA 3BOSA 2J0QA 4ERNA 3MAAC 4YC7A 1XTJA 3AM1A 2C04A 4LGMA 2WIBA 2FSHA 3U7FB 4JYCA 1QG2A 5JECA 4Q4LA 1SQ5A 2KI5A 2QE7A 1HT1E 5DN6A 1N25A 4GP6A 1TPZA 4KFSA 5EP3A 5LD2B 3CLVA 2YYZA 3HU1A 4A2QA 4I1UA 4QNMA 4D4KA 1XBTA 2GILA 1Q12A 5AR1A 4QBFA 4DIEA 1W0JD 4LI0A 1F2TB 1XD8A 3CRW1 3CH5A 4AD8A 1ZD8A 3RRYA 2YWFA 1KI8A 4M53A 1VMAA 1GL6A 4DWJA 5K8LA 4PO8A 4YQFA 1MO3A 3AUYA 1E9BA 5B30A 3EPKA 3NDBB 3SI7A 1DAMA 3WYAA 1UADA 4TN1A 2F1HA 3B6EA 5L3SA 2DFKB 2ATVA 1GG2A 2A2ZA 1HTWA 1YE8A 3DEFA 1F3OA 4KYIB 2QU8A 5J4LA 4QKQA 3IPYA 1NMYA 2Q9CA 3A8TA 3A37A 3BERA 3HJNA 4KITB 1G20E 1F2TA 1NMXA 4HI0E 4Q1AA 2XNSA 3IHWA 2GBLA 3HDTA 4URYR 3UMRA 3QPWA 5EUQB 2OCYC 1TEVA 3D7MA 4A6XA 4BFWA 1XEWX 4V02A 1Q22A 2ZI6A 4LHWA 4NH0A 2QAGA 3I1FA 4C0SA 4LJYA 2WOOA 4XJXA 5JSZB 5B58C 3BE4A 1G64A 2F43B 3TQCA 2IYZA 1U94A 1ZIOA 2EW1A 4M1WA 2PZEA 4A15A 1R4AA 1OXVA 3THOA 5E7IA 3C8UA 1KZ7B 2H57A 2KBEA 3HU2A 2HT6A 4A2PA 2YVUA 1ZAKA 1KYIA 3EA5A 1AZTA 1NLYA 2X8AA 5A0FA 1E3MA 5JSZA 1W2HA 2GF9A 4DCSA 1O3YA
chains in the Genus database with same CATH superfamily
4BRUA 4XSGA 3MUOA 2Z8ZA 4IH4A 1M34B 1NATA 1U7XA 2DP4E 5JXWA 3EJWA 4RYDA 3NHBA 5KAMA 2XUPA 3AF5A 4YJHA 1PR2A 3ZZTA 1JIQA 1SBYA 3HP1A 1SZJG 1Z8DA 2EFGA 1AZLA 3H1GA 3O4JA 3FPAA 1JEAA 3N2YA 4J16A 1DOHA 2OP0A 3C87A 2BFFA 3L8GA 1S8OA 1UPCA 3R5TA 3VYWA 4F71A 1JG3A 2AZXA 3FMIA 3L92A 3TSYA 4DS3A 1MO5A 3K6KA 3Q98A 2M6RA 1XLTC 2CXQA 1GLGA 2QYSA 2WT4A 3OSUA 4C0HA 1SURA 1E3WB 4HQFA 1QG0A 3OHSX 1MW9X 3OQJA 3PX3A 2BMFA 4DLRA 1RABA 1DWOA 7ABPA 3WQHA 3BE8A 3CS3A 2POQX 2CJWA 3M1YA 5FA6A 1V37A 3WWZA 4AMUA 2P9HA 2GXQA 3RAPR 3RVBA 2X86A 1XA0A 2FWAA 2QVZX 4G5SA 1WMFA 4WK2B 2OOSA 3RS5A 1ZM9A 1UAYA 4TKUB 2HF9A 1D0IA 1SBTA 2POCA 4FZVA 4NG5A 4OUDB 2IEAA 4UU8A 4G67A 2PX4A 4ACBA 1LPNA 4FBGA 2NTYC 2V0GA 4KLCA 4IDAA 1MA3A 3ILVA 1J2JA 2H06A 3N39C 4O8ZA 5C18A 4JKOA 3L7CA 2EV9A 4TRNA 4C04A 5IVDA 4R71A 1SQFA 4G4JA 4N8EA 3C39A 4EHIA 4B6GA 1TIBA 3UK6A 1T8UA 4R8VA 3IQFA 5FYDA 3LT2A 1C9EA 4G26A 5SYAA 5KDDA 1N6KA 4CIBA 4FW9A 3K20A 3MGAA 1Y0BA 2OECA 3TNLA 5JSKA 3ZY5A 1W36D 2FEXA 3LLCA 2C2YA 2O3QA 1R6BX 2F6RA 4XSHA 3VAAA 1KEUA 2ST1A 1XZJA 3M4JA 2VDMB 3LWBA 3WLIA 5FTKA 3GFQA 3PJGA 4OJQA 5BSUA 3R0VA 4BASA 4EHFA 1A8QA 3ZXIA 1IAVA 1DXOA 1GG9A 1GR1A 3WV5A 1NXPA 2HWUA 5J43A 1U4SA 4TM7A 4X92A 1M6YA 4G89A 1XZCA 2X0NA 1J2TA 4LYJA 2BI8A 2FW6A 3LGAA 2IHZA 4IOKA 4L3VA 3SC6A 4FZRA 5LDGA 1F2UB 1RRKA 3EEBA 1Y1QA 3T54A 3Q0IA 4MHSA 1VE3A 1JB1A 3D6NB 2J5KA 3ABSB 1MH1A 1RPTA 4R69A 3ZGNA 3STYA 3SD7A 4J0KA 1N5JA 2RH8A 2Q27A 4XGRA 1DFHA 2QPAA 3UIEA 4CMHA 3PUJA 4FYVA 2QTVB 2QD4A 1S1CA 1L7PA 2WPDA 2KPOA 3L7OA 5FI3A 1B2LA 2FWBA 3GLFB 1JU3A 5BSEA 1MAAA 2Q9AA 3ZYZA 5A9SA 1QYRA 1LX7A 2AW5A 3I76A 3KQLA 2XRYA 4CV2A 3UJ3X 5LBTA 4N12A 1U8UA 4FLMA 4QJ3A 2OK8A 1ZSYA 4OTZA 1T6BY 3ECSA 1EE2A 3KJEA 5LOVF 1IPHA 5DBEX 4Z8XA 4YRQA 4MQMA 5K51A 4WCFB 3GFFA 4B40A 4DSOA 4DGQA 2J9ZB 2BYTA 3I52A 4U8HA 2NO4A 3TD6A 3NANA 4OHYA 4CV3A 4DE5A 4EKDA 3NBXX 5CMLA 5FI1B 5KHOC 1QG4A 3H19A 4HEJA 5FBVB 2TMGA 3B53X 3MERA 2ZUBA 3W8EA 5JZVA 1FFGA 5KS2A 5EZSA 5KTTA 3VYTB 3CNOA 5IUKC 1POWA 1Q16A 2XUIA 4B3JA 5DH9A 4YIKA 1N2IA 2QZZA 2A6PA 2CB9A 4QYMA 1DQSA 2QAJA 2C5LA 4P83A 2FRXA 3OCJA 1OA1A 3NAQA 3Q1KA 1ZOIA 3PLAE 1VRCA 5BVGB 1X74A 1DIGA 2JFGA 1GITA 3GEDA 3L1KA 3RBVA 4D4IA 3PVCA 1U9IA 4FDVA 1Y8AA 3TECE 5AVZA 3RE1A 1DQZA 3RWMB 3T06B 5DRYA 1M2WA 1G8HA 2IYPA 3T3MB 3NUZA 4UU0A 2DVMA 4EPYA 1UAAA 1YZUA 4UVEA 1JQLB 2C4MA 2X7XA 2YFYA 1WTAA 4CTMA 4IIEA 1S3IA 4JLKA 4LUCA 1PZXA 4I6EA 3U80A 2OHOA 4M0UA 2ZSBA 2J6IA 3B3JA 2C4WA 3M3HA 1NUUA 2X40A 2ZVPX 4HHEA 3FOZA 1OH5A 1E8NA 1PJTA 4MQEB 2Z95A 4PAGA 1VHTA 3VXKA 3AW8A 4X95A 2XMSA 3QUQA 2J4FA 2Z5VA 4FFOA 3L0IB 2HRZA 4EZEA 3FWKA 3F9IA 1RWKA 2VPQA 3BUSA 4FYHA 5EQDA 1F8YA 2DQKA 1N75A 4CIYA 4XM1A 4M1OA 5EJ6A 3LUGA 1GRNA 2P6RA 1TI7A 3FMPB 3MCTA 4W6QA 4R1OA 4DC0A 5DM4A 4NCKA 3U3JA 1XWIA 1BQ3A 4E09A 3EMBA 1EDDA 4CM4B 8ATCA 5AQ1A 1MD9A 4HB0A 1VECA 2PG3A 6PFKA 1MX5A 1QVRA 2RKWA 3G7UA 1UBLS 1A2OA 5IJ9B 2Y99A 3FYUB 5KJEA 5JEEA 4ZVLA 1RHKA 2ZSEA 1LFAA 5AIAA 4J3JA 3KG2A 1EDZA 3PIRA 2YASA 3D64A 2PS0A 1ZMRA 2H2AA 3A1TA 2VIIA 1TKBA 2X3UA 4L9RA 3MUFA 4DR7B 3VC7A 3AR9A 3C1OA 4RLSA 4UNNA 1U0FA 4Y2SA 2PSSA 3AQ4A 3SJAA 4DLVA 3AVUA 1KEEA 3WWCA 5IVPA 2MSNA 1I6MA 4Z4CA 2VDWB 2J3IA 4JYMA 1X7WB 4TUYA 5D3MA 4W9MC 2CLMB 1E5XA 4J0GA 3CNNA 2IZ1A 4BVLA 3M2TA 4R16A 3ZVLA 5KSYA 1ZESA 1PKEA 2CYBA 4XASA 3I92A 4D56A 2YS6A 1XV5A 3O8RA 1JJFA 4RPJA 1Z08A 2WSIA 2H7XA 1TOAA 2VZ8A 3VZSA 1KMQA 3KD2A 2Q1SA 3KJHA 2NUAA 3IUPA 3LBNA 4QRDA 3UXYA 3IJPA 4XWTA 1ZW6A 3HFGA 2DGDA 2HJWA 3QOFA 3OPQA 4IV5A 4OMDA 4XR4A 3ZQKA 3M82A 4MWZA 1KDRA 5HPYB 3OICA 4Q3LA 4B4DA 3HE3A 2C8JA 2P5SA 3ETJA 3STTA 3OPNA 1OIVA 2G83A 2A9PA 2R6JA 1NYQA 3M0EA 3AEUB 4CZ2A 3AM4A 1XA3A 3GJ6A 4DADA 2P79A 4YQZA 2P40A 4YAFA 1TVKA 5TS2A 4US1R 4K9RA 4KFTA 4OXKA 4PLCA 4HYYA 4XWYA 5EAIA 3GP8A 1ADYA 1OGYA 1PZFA 3VDXA 5EVJA 1NTRA 5I4BA 1N36B 3UH1A 4Q4JB 4D9FA 3WQQA 1B14A 1ZD3A 3DOJA 2PHZA 1Y33E 4QPZA 4YJKA 3C1TA 3ZXUB 4G0NA 2R0QC 2C7PA 1KZ6A 2CVZA 2QG9A 3K2EA 2MINA 4I3FA 5G40A 2QVCA 4BVBA 2WJVA 1G55A 3JWIA 3LDAA 3LGXA 4HJRA 5E3IA 2FNAA 3DBVO 1FFAA 2QMEA 3GXBA 1WD5A 7MDHA 3DDNA 1FDVA 4KAJA 5TARA 5HRCA 2O54A 3H9CA 1EDEA 1I2DA 4R1SA 2I3GA 2IVZA 5AQEA 2QUKA 1E2KA 3KPYA 5FTJA 3SHWA 3VTAA 4HEA1 1DUIA 4DV5B 4BFLA 2XKAA 3L3BA 5CH3A 1M73E 4D79A 2P0EA 4RVOA 4MPJA 4F8EA 5A5EA 3O9ZA 5IP5A 3T6KA 3V4ZA 3AUKA 1U7ZA 1SZDA 3BSWA 2BGRA 1SKBA 2OAEA 5FF9A 4BQIA 1JJ7A 1FP4B 1ONNA 1CNFA 4L3WA 1OTHA 4FHGA 2WJGA 2ZE8A 2AJCA 3NETA 5E6RA 4DXDA 1KRHA 4PX3A 1KK1A 4ZOLA 2W6IA 3ADBA 2CHQA 2VDOB 4Q1FA 4M55A 1R4MB 3QJGA 4RESA 2W2MA 4RQTA 2CHFA 1KSGA 1TQ2A 3EW9A 4TTQA 5AXCA 3BRQA 1JZQA 4N41A 4NMLA 5JMOA 3ESRA 4IKOA 2DHQA 2VT3A 4P0PB 4AI6A 3L0PA 4RFSA 2B21A 2V9ZA 3NTOA 4OXXA 4AM8A 1JAIA 2NU6A 2PCJA 4FGZA 1IN6A 1TUBB 1RFLA 4X66B 2X76A 1JAHA 4X20A 3ZHSA 4J8PA 4R1UA 1H05A 3L18A 1UH5A 5E3HA 3HWRA 1UBEA 4UBJA 1ZH2A 3UAYA 1E4EA 4XD7D 2SCUA 3RK4A 4UHEA 3OQNA 1LNSA 3OOHA 4HAXA 5F4BA 3GN1A 3WLRA 1F2DA 1WPXA 2GD6A 2WIGA 5IPFA 3VM6A 1VL1A 4KO8A 3L7IA 1CIVA 3SN6A 3THYA 4RZ3A 4CMGA 4DF3A 1QWOA 1PS9A 1USKA 1GN9A 3JQ8A 2WG1A 1WKBA 3QENA 2FZLA 2QZ4A 1H69A 4ICIA 2KYRA 2YUTA 3TOSA 3UV6A 4DIOA 1GVNB 3ZCVA 4P9NA 3E22B 3GEEA 1QKKA 3ME5A 1EUQA 4NH4A 3NEAA 3NTUA 4LGYA 2J67A 2O2XA 5A7GA 2D2VA 2DTEA 3UF0A 3GB9A 1BCRB 2QR3A 5JNTA 1ISFA 5CT8A 2F8SA 4QA9A 2HO4A 4GNKA 2GD0A 1KP3A 3AVXA 3JVUA 1EFVA 2QD3A 3QMWA 4L57A 4BMPB 3PENA 3I9LA 2GAFA 3T3OA 2HNKA 2VK8A 1G8MA 2B8TA 3B1KA 3DE7X 3RWOA 1UKEA 4JGGA 5EJEA 3AHIA 3P9KA 4MRRA 3LUCA 1PEKE 2JHAA 3FB4A 4QBIA 4QUBA 3ZHOA 4BIIA 2BLLA 3BA1A 1SO8A 1YK0A 3G2MA 4OH7A 4EDFA 2YWJA 1WY5A 4Y1RA 2O3SA 4A2CA 3UMYA 4G5YA 3OOSA 3NQ41 1ZGHA 2BKAA 1KYYA 4CQLA 3L4BC 3FKSD 4L72A 1SFRA 1X3SA 1N57A 1FFYA 4EYEA 4ZYTA 2NTEA 3ZCRA 3L6BA 1P0PA 3IEKA 4IQ4A 2AN1A 3A9RA 4OQFA 3UHJA 3HDQA 2XODA 2CD7A 4BQEA 5KWJA 3ANXA 4FP9A 4RJLA 4MHTA 4QASA 2UZIR 2VJNA 1FF9A 1V16B 1JKFA 4JT4A 4OM8A 2W2VA 4DCGA 2IXEA 4OGFA 4NSNA 5LB4A 1UEXC 3EQ8A 4J2OA 1UKYA 2PX6A 2VNJA 3WYDA 1MOZA 3TRIA 3W8FA 4FYXA 4DMHA 3AJ8A 2Q0XA 4W8GA 2NZYA 4QU0A 4B4VA 4F8JA 5I7EA 4KWHA 3CTMA 2BMJA 2CVQA 4MQ4A 1PTJC 3MCAA 3CLRC 2ZS8A 4BVEA 2IC5A 1THGA 3ZNQA 3HRHA 4D74A 4N9WA 1EUCA 2RHGB 4WKCA 4RH0A 4WI1A 3A4VA 1NX6A 1Q5PA 2XMCA 2HL6A 5DASA 3VGPA 1G8AA 1X7XA 3NNSA 3CURA 4UKDA 1H42A 2H11A 3V1YA 4RTKA 1GFSA 1IEXA 2BM9A 3MINA 3IBSA 4FILA 3TK1A 4G2NA 2Q3CA 4F9TA 5IDQA 1O6FA 4H15A 2B8WA 2D4HA 3EW7A 4MJLA 1GZ7A 2LXNA 4INZA 5KU1A 3TIXB 2OWDA 4NCAA 3R0QA 5C51B 3K9FC 1PFYA 3FUCA 1UFKA 3KWFA 3O3OB 1KP9A 4FEEA 4FE7A 1P61B 3BYZA 4JENA 1HI9A 4QO7A 1PF7E 4DV7B 1Z34A 3I2FA 4LMAA 521PA 1ZS9A 2RK3A 4Y1EA 4CCAA 4NCJA 4LYAA 2ZTVA 3DVSX 3OQOA 4UW9A 4Z3OA 2W2PA 3GWZA 4HAWA 3WGLA 1XZFA 4ENRA 1HORA 2JJ1A 3FE2A 3WLPA 1EJ6A 4LCEA 4C6HA 1NOKA 1SG0A 4I1PA 1I2CA 3G7NA 1VGVA 3ZJUA 2Z56A 4FJ0A 2JW5A 3H17A 3A1CA 3CPHA 5JAQA 3PDIB 2GFIA 1T91A 4KHPB 2RAUA 1KP2A 2GOYA 4II3A 1ZJ6A 4XYGA 3U4QB 1JT2A 2R8OA 3R3HA 2ZUVA 4Q5IA 5IK2A 3TEFA 3PGVA 3V3KA 5JVDF 4MRAA 2WTAA 1QZUA 1PJZA 1Z82A 2L0XA 2AX4A 3P71T 2N47A 2V6IA 4XQGA 5CM8B 4GF5A 4ZMRA 3W2IA 1W1UA 3DG9A 3BWMA 4DHWA 3BC1A 4EK9A 3J80A 821PA 3RGWS 4IICA 1TZ2A 2FN4A 1OR8A 3H9EO 2J3HA 3DM5A 3SQWA 1MORA 3AP1A 2O2IA 3P8ZA 3LWNA 1RU3A 2B98A 2Q7DA 1NQUA 1LBEA 3ITKA 5H3HA 2WTUA 3DDSA 1ZC4A 4I55A 4BMXA 4LFBB 4IFTA 3S70A 3ZKAA 3N74A 4JP1A 2AN4A 3MK31 4MQEA 3SDZA 4O4JF 3QXHA 4MP6A 4EW2A 1I1QB 4YLEA 4ZDJA 1OZAA 2E9SA 2EF0A 1BMFD 2EX1A 3JWEA 1D8AA 3WHLA 1IRIA 2W6QA 2Y66A 2HNBA 2G28A 3F6PA 3NC1C 2RE8A 3QITA 4RF5A 2OBBA 1W48A 3RVJA 1S8FA 1TGYA 1G9XA 3D6MA 3B9BA 13PKA 3KQSA 4YRGA 5B2EA 1X2EA 3OWXA 3ZV3A 1LTQA 1R6XA 7MHTA 3RSOA 1FUIA 4S1TA 2C59A 2BAGA 4RZXA 4KJXA 1J1ZA 2Q5OA 1XYYA 4L95C 1ZH0A 2E6UX 3VHLB 3FDZB 1MH9A 2PAFA 4RF4A 1XZGA 1I2MA 4IZOA 1D2GA 4GLFA 4NDZA 1REQA 2LKDA 4ZOAA 1E3LA 3JD0A 1DTSA 4BTEA 4D9NA 4MV8A 4WXPA 3D31A 3M8KA 5JCXA 1JIUA 2HV9A 1ZD9A 4O8CA 1B76A 4RKYA 2A59A 4JQYA 2BFDA 1SCDA 3HY4A 1SC4A 3KQPA 4GPTA 1AMNA 3OZEA 5K20A 4L3OA 1U7DA 1D2NA 5ER9A 3P2MA 2FLKA 3W5DA 4WCFA 3MTQA 2CNNA 4DUYB 1WBBA 1S1MA 3UWDA 1IZZA 5KQGA 2X1LA 4QEDA 1W5SA 4OLAA 1Z7YA 3CH4B 4M0LA 1R0LA 1F7VA 3IBTA 2W11A 3HUDA 1LH0A 2ZJ0A 2G82A 2N75A 1CX9B 4ZPXA 2WG0A 4MSUA 5AHWA 2M9MA 2AMVA 3HBMA 2FPPA 4R0NA 4IDQA 3UGTA 4E5KA 2B9EA 4FFNA 2W7TA 3G6WA 2C7OA 4XE5A 1N7HA 1YRWA 2JGEA 2YVLA 3G2PA 2CWWA 3QTBA 4G37A 2VUHB 3U48A 2Y4NA 3DT9A 2H1RA 4KQKA 4AWBA 4DOMA 4I7EA 3K71B 1O6CA 3M1IA 2GCPA 1MB9A 1GLVA 2B4YA 5K6TA 1WXQA 3L1JA 1NDQA 2RJNA 2XB8A 1J23A 2WD7B 1KVSA 3HN7A 1JJVA 1GNRA 2NO5A 4C5AA 2OCAA 1V4BA 4YLYA 1M2GA 3C3MA 5CW1A 3VDRA 3HUFA 5CA0F 3OF3A 1VIMA 1S2OA 2GZ2A 1N6RA 5G4LA 2JARA 5CLIA 5BN4A 3DTVA 1LLUA 2W00A 3IE2A 1MB0A 4LISA 4FM9A 1KJ8A 1JQKA 3A4IA 1YQQA 1WKCA 4PNHA 3U16A 2GWRA 2OD2A 2GAIA 3WMRA 3K16A 3RODA 3DE2X 2XLBA 1IATA 2DWPA 4X54A 4KPYA 3O4FA 3OQIA 1KYVA 1Y1TA 3TSCA 1DEAA 3KJZA 1A50B 4HAVA 1U2ZA 2VDLB 3Q2IA 3MFYA 1XRSB 1MENA 3S2FA 2QTCA 3I8SA 5JCOC 1T0UA 1CYDA 3N7TA 1JR6A 2ZJOA 3I9NA 5B1EA 1UC8A 2C5HA 3D4BA 3JXEA 2O14A 4PTZA 3QPCA 3RB8A 3OZBA 2O8EA 4BP1A 2QTAA 5B4VA 2J8ZA 5J2UB 3S2YA 3U9LA 2WR8A 1XEWY 3WFIA 3DBRA 4RTLA 4J2TA 3WGVA 3U19A 1SUWA 1WPGA 4IZIA 2OZKA 2EZUA 3MVEA 1UC9A 4CKCB 5DLEA 2NZUG 1QNLA 2Z4TA 4KC0A 4LZZA 1E20A 1S8NA 4EG1A 3HWSA 4FTWA 1TZKA 2WFMA 5A9RA 1T0HB 4WK4B 3SNHA 1FDUA 2J0UA 1H6CA 4KQCA 2JATA 3IHTA 2G4CA 1C7IA 2ZPAA 4PC1A 2PZ8A 1U65A 1J0CA 1K9VF 2VXCA 2X3FA 1NI4A 4Z7JA 1CV2A 1CUVA 4OOFA 4CKCA 4KQMA 2GGSA 1POXA 2FX2A 3FVWA 3QE4A 4EW6A 1ECJA 3AG6A 2PUEA 2AEMA 1YBHA 5FJIA 5JRJA 3CVOA 3ETEA 2GBCA 1UP6A 3AK4A 2FQYA 2MSCB 2P77A 1H3EA 1WXXA 2DWCA 4EAQA 3NOVA 4AKIA 3LBHA 4I5EA 4PSAA 2GF0A 3TE7A 1H0KA 1SQ0A 2B1GA 2DPLA 2C84A 4Q9JA 1OREA 1J4AA 2WT9A 4S05A 5IARA 1K86A 1MP0A 2ZR8A 2QP4A 3G88A 3K9NA 4MVYA 2C83A 1PZEA 4XCXA 1RYNA 4LBYA 1BH2A 2HX1A 3UUGA 4AS1A 2PMDA 4BJ1A 2XWPA 2D7JA 3A06A 3LVQE 5F77A 4EKNB 1DJOA 1V7PC 3ANLA 1M1YE 3NBQA 4RIFA 4NR0A 5BSTA 4GPIB 4L4XA 4PBSA 1D1QA 4NCBA 1KARA 3I64A 4WOKA 3W5HA 4FMCB 2IZOA 2OCIA 1P9OA 2QMOA 2VF2A 3PVZA 3KVVA 4MVJP 1FZQA 3RTDA 3WJ1A 2VYVA 5KPJA 3D6AA 1D4AA 1Z4QA 3COYA 1U3UA 2GZSA 3M5WA 4R98A 5K4AA 4HZUA 3VPFA 4Z7NB 5IN4A 2G4LA 2G71A 4FS3A 1P81A 4IJVA 4OREX 2FPSA 5CHYA 4BEVA 4CDMA 1M76A 4TV8B 4PPQA 2BEWA 3AT1A 3FZGA 2JLYA 3VFDA 2XQIA 1O58A 4N0MA 1JB9A 1NG1A 2XWQA 5EMLA 2P4SA 3JQGB 4P84A 4UD2A 3WWPA 2H1CA 1RCFA 2FB9A 4Z8YA 2XNDA 4AK9A 2JNWA 3H99A 1ARZA 3JQQA 1WUIS 2BFMA 4PFKA 3X0DA 1ZHFA 5JI3E 3IDQA 4ENVA 1F38A 1P7VA 4RC9A 4XWGA 3BHIA 1Z5GA 3O90A 5K8TA 5TJHA 5G53C 4XB6B 3BF7A 4EB0A 1KSHA 4EG4A 3T1HB 2M2IA 4RMHA 1W94A 5FJJA 1AJEA 3WLMA 4MO2A 1T1IA 1KQ3A 3HLKA 4RHUA 4DA9A 5ALVA 2GXUA 1NMQA 4NAHA 1R5OA 2Q0QA 3NTLA 1Y4AE 1HWYA 2XMRA 5JCJA 2WK1A 3PXCX 3E5RA 1XNGA 2ZWPA 2J48A 1EFUA 4RK0A 1KU0A 5FPSA 2Q1YA 4DSZA 1L3BA 3AHDA 1F6WA 2OV6A 1HK7A 1XMJA 2UV8A 1LQTA 2FV8A 2QY9A 2YX1A 4LXUA 5LQUA 2I4LA 1J90A 4KBFA 5CTJA 1WOMA 1NU6A 1KEZA 4KUGA 3F5DA 4FD3A 2CC2A 5K8CA 4WZBE 5ITSA 2X9NA 3PWKA 5EXTA 3QFFA 3I37X 4OHPA 1HXHA 1RKVA 3MJSA 4GVPA 2F59A 4KX5A 2IV7A 4QRIA 5FTWA 2IF2A 4IUCS 2V5AA 3PL5A 2FPUA 4QHTA 5I4KA 2WOJA 1IJKA 2I8LA 2G67A 2YJ3A 3B3GA 1IYZA 3DPSA 1YDMA 2QVYX 4XVQA 1XYVA 1SOUA 3U7EB 1FP6A 1RWPA 2R4TA 1GG5A 2Q3BA 3BK7A 1E60A 2O2DA 3F97A 3GA5A 3DD1A 1C3OA 5U1PA 4GYYA 4JXXA 5JSQA 1FTWA 3I6IA 5TF0A 3RS2A 3IA2A 5E0OA 1QGZA 4AG3A 2WFLA 3D6FA 3ELWA 4ODIA 1M2FA 5EMHA 3B1FA 2D1RA 2BKLA 2OHHA 3LECA 3IEUA 3LCJA 4TLCA 4MVJH 2NU9B 3VSAA 4LBVA 3Q3JB 1MC5A 1PE0A 2AUMA 1NVEA 4PHCA 4CG3A 1AGRA 5CP8A 5KNCA 2R11A 2YZGA 2HJRA 2ROQA 2WBLC 2AOTB 5LOVA 3D4OA 4DV2B 2XMPA 1Y1LA 3LRPA 1RVDA 4B74A 4MUYA 1TCBA 4KR2A 2HW8A 4I1YA 4GX2A 1SXJE 2GPSA 2QSZA 3L77A 4PLTA 1XU4A 3UT5A 3L6UA 3WYFA 3RYFA 4CFYA 3LVRE 4PG6A 4FKBA 3S28A 3M1AA 1EE1A 3AEKA 4XXHA 3PJRA 3PXAA 3QUAA 3G2HA 1E0DA 4JUIA 4OEHA 4M8LA 4IIGA 4YXFA 1YR2A 5K01A 2O7NA 1FXSA 2W8BA 2QSUA 1JWAB 3V8EA 5M7EA 1ITZA 3MIIA 4YJ3B 4MRMA 3V00A 2ONKA 5SZJA 3RRNA 2V7QA 2E4XA 2ODWA 3I2HA 4TWJA 3GVXA 4P0TA 5JO0A 3U4CA 3N2KB 3E70C 1TCUA 3M6IA 5EWMA 1HH4A 4K9QA 1ELOA 1GAJA 2ZBVA 2CEAA 3MS4A 1ULHA 1DDOA 1AO3A 3D59A 1ZN8A 3OE7A 3PF9A 4ZWNA 4GPD1 4DPLA 4ZZ3A 5B7PA 2C4KA 3PQ8A 2Y68A 3D1LA 4ZREA 2XNKA 3WZLA 2DKOA 1RI2A 3RFXA 5A0TA 1UOOA 2HV8A 1JHUA 1TJNA 5A02A 2FLVA 1Q0UA 3EFOB 1G2IA 1T6NA 5IF9A 2ERCA 3BTUA 1IEQA 2INGX 3NVMB 1UMCA 2R44A 1DX6A 3OLWA 1LDYA 1U2GC 5CFRA 3LDHA 1T0BA 3H5NA 3RSQA 3V6LA 2W6MA 2CVOA 2XJ4A 4U7DA 3K70B 1KFEB 2WTMA 3DMPA 3KL2A 4XB1A 1TU0A 2X14A 3AJAA 4CFSA 2EBHX 1G3QA 3A9VA 2GZ1A 3ES9A 5E4TA 1YRQA 3WLKX 1TTQB 3DLPX 4DLPA 4I4TF 3K9LA 4KRYA 1EX1A 5CIYA 3FTCA 4BZWA 2G3YA 1V5IA 4LE0A 4K7JA 1PGQA 5JH7A 1AF4A 2R1UA 2ZQ5A 5GADl 2GEVA 1VL8A 1N0IA 4BE4A 1PR5A 4TXNA 3BQMB 1YS2X 2JLSA 1P0IA 1ZGBA 1S7CA 3DTYA 4I19A 3V7UA 2F3RA 4QYTA 4UVHA 2LVBA 5GJWC 1HFJA 1P75A 1QZ3A 2JF0A 3DS8A 1E98A 2ZUCA 5AVRA 3CNLA 3I6BA 3EWAA 1OD6A 3FKJA 1RLIA 5HE9A 1FFEA 3LKBA 1U90A 2WD9A 1BDMA 3OTGA 5IEJA 4BGEA 1KZYC 3IMGA 5D86A 2R7MA 4UVGA 2XZPA 4ZQCB 1M2VB 1EK5A 4LS3A 5JS8A 3UWSA 1OWNA 1L5MA 3IX7A 1L5FA 1P60A 3ENKA 3JWPA 1LU9A 4KE6A 1UQRA 3TE6A 5LNK6 5J40A 4E7PA 3UB2A 3RAFC 5LDHA 1NBME 4P33A 2R2GA 1FVFA 1QP7A 2P6MA 5FLKA 2ZJ1A 5L3RA 1GPLA 3KBOA 4G9BA 4O2RA 5CIQA 1T3GA 2ETXA 3TLGB 1Q3HA 4AN1A 1TGVA 3LW8A 3T7TA 1BMFA 1D0SA 1GKUB 5EMMA 1R0RE 4JUFA 5FAXA 5DSTA 1E3QA 1YQGA 1Z5OA 4P3OA 1I14A 2LBPA 4NEGA 1AY0A 3QM1A 4DA7A 5AT1A 3TGWA 2NTJA 4RVHA 5K3SA 2ZUUA 5L7TA 4H3SA 2YBDA 1RDFA 1GGKA 1M8GA 2I3ZA 3UT0A 4JA0A 4NMWA 1GV1A 3IP5A 2WY2D 3LX4A 2VJOA 3GEIA 1TZBA 5DGIA 3V4RA 2X0FA 4UARA 5CNMA 4QG3A 4LQLA 2Z4RA 5CCEA 1FXWF 1IVNA 1KFKB 3J81A 5KMGB 4ALMA 1QGOA 4QO8A 4PN7A 4EFMA 1BD3A 4AMBA 3DLAA 3AMVA 2OYSA 1G0OA 3E53A 3OT5A 4ES6A 4Z9AA 1TUGA 4MV1A 4XEUA 1VBFA 4ZALA 3ODPA 5LU8A 3Q3EA 3QKSB 1V2GA 4MKFA 4Y2JA 5EQJB 4I0WB 5JAPA 1PT7A 2IDMA 5H82A 3M6VA 4US0R 2Z3VA 1O8BA 2AT1A 3WLFA 4N49A 2CUTA 2CCKA 3IL2A 1GPNA 4GMFA 1KHHA 4FFBA 5LXTA 4IG9A 1NQAO 2W4MA 1A5AB 4LK2A 3WI7A 2C4UA 2O1XA 3O3NB 5KNDA 5T7BA 3PX7A 4ZN6A 2F9MA 2GKGA 3P9SA 1L4EA 4G5XA 2COUA 3CNEA 3OOJA 3IT1A 1R6DA 1I1HA 5IWCA 5LJIA 3GDWA 3KUKA 1FEZA 2OYCA 3VOBA 5JQWA 3KQHA 3OFKA 2IEDA 2R66A 3PZBA 4DUGD 1H0RA 4MA4A 4O2AF 5L4NA 2OMEA 4Z4HA 2GTIA 3VNBA 4YX9A 1V8FA 5LFAA 1ISPA 3KVRA 3BK2A 2EBFX 4QGAA 3RBZA 2DFNA 5JYDA 5C1DA 2VSFA 4CIXA 1WPRA 1E8DA 4I99A 1P7PA 3N0RA 1P9NA 1EWQA 4D1YA 2HF7A 1NUAA 4N5IX 4URFA 1BMDA 3NT4A 1SXIA 2IIVA 2N1BA 1IM2A 2PRJA 4GSYA 4FYJA 4IVPA 4JFAA 1P1CA 4BQQA 2VQ6A 3UJBA 5EOVA 3IEXA 4BFCA 1W25A 4CG0A 4KLRA 2BF4A 4LVCA 4UOQA 3L04A 2RD2A 1ZWKA 3REQA 5IXSA 1G2QA 5F2EA 1ODSA 2Z08A 2GBIA 2JKYA 1X70A 4YACA 5E9WA 1OY1A 1CHDA 2ZR9A 2VQEB 3TNDA 3HLYA 3ZW8A 2GPNA 4IF4A 1E9FA 4C0WA 3B1VA 4D92A 1MV8A 2FHPA 1R27A 2CVHA 1ZRHA 3GLSA 3P9PA 4PV7A 5CX4A 5HA5A 4KOEC 2A84A 3HG7A 5DO9A 3KYJB 1IBMB 1IRXA 3H1FA 5CUQA 1SBZA 2AK3A 4CVNA 1I4OA 2ZT6A 2WZCA 4P4UA 2PA0A 1BW9A 1J5XA 4M7OA 1M34E 4U9IS 3RIEA 4PYJA 1LF5A 3IV6A 2BMEA 4MPRA 4MCJA 1JALA 5IJWA 2R62A 5E1OA 4LV8B 3IDOA 3CRMA 4L8LA 2HT1A 3ANTA 4OH1A 4GOKA 1E18A 3G23A 4MCHA 4ZOCA 3VO1A 3DBIA 1Y3HA 2XGOA 4ME6A 3JR7A 1OH6A 1YIAA 5ALNA 3QOYA 1T9HA 4LDAA 3AUSA 2EDAA 3QEKA 3T9DA 2ZRNA 2DUUA 4B5KA 1Z29A 4DQUA 3AU8A 4PXYA 1X1AA 1JU9A 1UBNA 4XA8A 2A9OA 2BMDA 2L42A 2EWWA 1H4VB 3TUIC 1U3TA 2VUTA 4INAA 5DPMA 2YIMA 1HMPA 3FI0A 3EIOA 1IN4A 1PQWA 4IGEA 4ND6A 3LBYA 3PTZA 5FWAA 4BU1A 4H6PA 3WQBA 4YRZA 2AJTA 2G0TA 1SD5A 1V5EA 1ENPA 2A92A 2GWHA 2I4OA 1FUUA 2CN1A 4NL4H 4RA6B 5CRIA 5IU6A 3IDAA 2CUZA 2I2CA 1QPGA 3ONVA 1KOJA 2WJ3A 3GVCA 4GP9A 1ORTA 1Y5MA 1YT5A 2NYUA 2ZRQA 3N86A 5JCOA 4EY6A 2NAPA 3M5PA 1XNRB 1SIUA 4MYCA 2Y1CA 3FKQA 4H6WA 4R1MA 1PR0A 1FFXB 5B7GA 4IGKA 2WKWA 3RUCA 2IE0A 4OL0A 3GPCA 4IF6A 3U3RA 3GLQA 1QYDA 4DCVA 4E6PA 2GM5A 3I2GA 3TKAA 1Z6YA 4N7BA 1DBQA 4QUDA 4N8DA 1RQPA 1P2GA 3PHCA 2NZXA 4GEKA 1O0CA 2WJ6A 4RGVA 4DNOA 4NBNA 3X44A 3E3LA 3QVOA 4D7AA 4GX0A 3SJCA 2RBGA 1Q7RA 1NX9A 4HWOA 5BQPA 5ADWA 4DUZB 3ETHA 3AP2A 4P5EA 2HYDA 1JNYA 3HCDA 3AUTA 4LSGA 3E5HA 3O1LA 3QKSA 1OFVA 1ODFA 1FFBA 5HXAA 2CE2X 1QG6A 1L7VC 4ZCRA 4QUGA 4MKRA 4FZJA 1Q0QA 4Z3KA 1NAIA 1CZLA 3FG9A 5K6RA 3R8XA 5JNSA 1V9CA 1RAEA 3NFRA 4YPFA 3THRA 1O0SA 4F4JA 1VIDA 1DV1A 1WIWA 2OKCA 3BA6A 2VZEA 4NFLA 1P6UA 1PBNA 4JKIA 5LNK1 2YRXA 4P36A 2WUFA 3OIFA 5AKZA 1GL3A 2EKZA 2X41A 2OGTA 2YY6A 3WJAA 2OFFA 4OGLA 1ONBA 4MYSA 3OUTA 3QVUA 1DDIA 5EKDA 3D5EA 3NC4A 1W35A 3OESA 1M9NA 4P7GA 4DYDA 5THQA 1A7UA 3PBKA 4QTXA 2KS6A 2ZXUA 4RTPA 3OT4A 4H7IA 4BIMA 4PNZA 3BULA 4HN9A 4PZ0A 3GPIA 3BCHA 5JAIA 3AOGA 3AY3A 3WADA 3FLAA 4FYPA 5DHRA 5TLSA 3HTXA 1V7CA 4V2IA 4TXJA 1XXHE 4NBKA 2C97A 2J6HA 2ODQA 1OLUB 2X8JB 4GZMA 4P31A 5AJXA 5LYJB 1DLIA 1NVAA 4GGMX 3U4AA 5E1BA 2BMWA 4HTFB 3HBLA 2BEWB 4QWMA 4WDQA 3L7AA 3GT3A 3PV0A 2FK7A 1KIFA 4CIVA 3U3MA 1QDLB 3AWIA 4IG4A 2ODBA 2GZMA 4ZQBA 3RK0A 3F8TA 1ZISA 1G4AE 2MYUA 3U60B 2IYOA 2O8DA 1K0FA 4UFNA 1AKVA 4F3TA 4GS5A 3A9UA 2O7SA 1DAFA 4UCFA 4OCZA 2HJ9A 3BXEA 2VUIB 5AJWA 2QTVA 4AP5A 5FBZA 5I7SA 1FSPA 5JJ5A 3M9WA 3LFTA 1QBGA 2FYTA 4OQMA 2QORA 5F76A 4YUYA 5BV1A 4JBHA 4AG6A 1A9TA 3WB0A 2DAPA 2QP3A 4FSHA 4P0QB 8OHMA 5ALJA 3GMTA 4CKEB 4ZRMA 4P3PA 2ZIGA 4D98A 3KNZA 1UK7A 1SVIA 4QQNA 4YJDA 1EXMA 1P0FA 1TIPA 1JEYB 4Z7OB 2O57A 4WNIA 5B4UA 2Q4EA 5FFNA 2YICA 4IHJF 1E94E 3OM8A 1JYEA 1XT6A 2OO3A 2FUG1 2PPVA 1G8GA 1FXUA 1Q3TA 3PCXA 4G0UA 3K32A 4L5YA 4XSVA 3HWX1 1I4TD 4WHMA 3U7QB 1YS6A 2PL1A 1NXWA 1QDUA 1TQHA 2WJPA 1TD1A 5EIHA 3U26A 1A1VA 3MJEA 4ZZ1A 2B7CA 4DC9A 1XL1A 1ESZA 5BUSA 1KEKA 1WULS 1TRKA 1U81A 4M8IA 3O94A 2QUJA 2AQHA 3LXUX 5J23A 4GWKA 1FYXA 5HW0A 3C5EA 1QF6A 2W2LA 2ORIA 1S6YA 4RK5A 5BQOA 3CVYA 1E2JA 1OJLA 2P9CA 1E3EA 3LT1A 4IDBA 4J76A 3T41A 1OJ7A 5LXTF 3PFFA 2I2WA 1N3YA 2B4TO 3AEQA 4OUDA 5LUBA 2ENUA 3OAAA 1IWPB 2CL0X 2OUKA 4MW6A 3LX8A 2O2CA 4EHDA 3SOPA 1DRWA 4JJ6A 2IS6A 4CWAA 3AEKB 3DF7A 3N2GA 2XHZA 3FGPA 4JASB 3UUWA 3ZWKA 5HX7A 2H63A 3BAFA