2F1RA

Crystal structure of molybdopterin-guanine biosynthesis protein b (mobb)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
148
Chain Sequence
LILSIVGTSDSGKTTLITRMMPILRERGLRVAVVKRKDSWKIYNSGADVVIASPVKLAFIRRVSEEEGNDLDWIYERYLSDYDLVITEGFSKAGKDRIVVVKKPEEVEHFRQGRILAVVCDERVDGHKWFRRDEVERIAEFILSLLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords molybdopterin-guanine dinucleotide biosynthesis protein B (m
publication title Crystal structure of molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
rcsb
source organism Archaeoglobus fulgidus
total genus 47
structure length 148
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f1rA00
2PT7A 1ZAKA 5FOUA 2D2FA 4D6PA 5JEEA 2LKCA 3RS2A 3MG9A 3OF5A 4G3XA 3NH9A 4A0GA 4EKDA 4HB0A 2IS4A 4LJ4A 4Q1DA 3ZS9A 4PSAA 4M22A 3FMFA 3OZXA 5C2JB 1OIVA 4AKHA 2AL7A 4CEHA 3TNFA 3H2YA 1OXUA 4OHWA 2WJJA 1CR2A 3Q72A 2JDID 2CMKA 2HLDA 4PZZA 3B2EA 1QDEA 4M9ZA 5CK5A 4Q47A 3R20A 2QSZA 1A4RA 1R5BA 3R9IA 2GXQA 4Z1MA 2ZI4A 2WMOB 3THWA 3NTUA 4PQRA 3H1TA 1RW4A 3EIEA 1GDDA 2QMEA 3EA0A 4IEEA 2GETA 1OIXA 2IYSA 3X1DA 4Q21A 1N6LA 4GL2A 4URYR 3NBYC 3DKPA 3P4YA 1E2NA 1VMAA 2IEYA 3A1VA 3X1YA 1ELOA 2L0XA 5JFGA 5EQTA 1DE0A 1VTKA 1SHKA 1XPUA 4ZO4A 3LDAA 1SKYE 3M0EA 5JHHB 4QM6A 3GD7A 2F1HA 1DTSA 2ERYA 1KMQA 5EP2A 1XD2B 3CM0A 5JSZB 1S96A 4OHVA 5KSPA 1ETUA 2ZAOA 4D0GA 4LYHA 4Q9KA 1DAKA 3TW4A 3ICEA 3NBFA 2Q3MA 1NIJA 2ZIAA 1CF4A 1OFIA 1CIPA 4YMWA 4AYWA 4Q4HB 3NG1A 3B82A 4U5XA 2HF9A 4TMKA 2FDCA 1AGRA 1IN5A 1ZNZA 2RGDA 1UBFA 5CLLA 3A1WA 5AJYA 4P4TA 3L82B 4CEJA 3K0AB 3CIOA 1E9DA 2O0KA 3A8TA 3SQWA 4TL8A 4BRUA 2V1UA 3EA5A 2FZLA 4NYMR 3VU9B 3CR7A 3Q5DA 3G82C 1FOEB 1WP9A 1PLLA 4TWZA 2WWFA 3ZVLA 1E1QA 2CE2X 5BN5A 1COWA 4UXIA 4QNMA 1W0JD 1SVIA 5FL3A 2A2ZA 1GUAA 4MYHA 5JS7A 4C2TA 1KNQA 4MH0R 1KK3A 3I8XA 3IO3A 3FHOA 2ZR9A 1KI2A 3S1AA 1KMHA 1P2SA 1AZTA 2BBWA 3CW2A 4BLPA 1KI3A 2GNOA 1TL7C 3JVUA 5CITA 1UKEA 3A37A 4W7SA 5CYOA 1RKBA 4DT1B 2NG1A 4HI0E 4LYJA 1W4BA 2BJWA 5E7IA 1SVMA 2ZEJA 4P4SB 2QP4A 2IYQA 1BKDR 1G20E 2IT1A 2SHKA 4MRNA 4OK3A 3CX8A 3V9PA 1Z28A 2NO9A 2XJ9A 1KDRA 3N2IA 3K09C 4IVRA 1G8YA 4M1OA 2IK8A 1JR3D 3LX5A 4LCBA 1DAEA 5JHGB 2B21A 2VO1A 1FNMA 1TF7A 4PQFA 4BASA 4IKEA 4O2RA 4Q1EA 4RD6A 2ZI7A 1B23P 4ZKDA 1HA3A 2WIAA 5J40A 1OXTA 2VL7A 2FZ4A 3WRYC 4L16A 3FMOB 1P73A 2QT1A 3T1QA 4QHTA 4G5OA 5FTJA 5SZHB 4B6EA 1CU1A 2OAP1 3PR1A 3TAHA 5KPJA 3O8CA 3PUVA 4G5QA 4Q4LA 2IL1A 1IN6A 4OQFA 2NOAA 2WJIA 3KZ1E 4QHSA 2WMNB 4WXPA 3DM5A 1G1MA 1Z83A 5BN4A 4E03A 5J4HA 5FPSA 2GBLC 1K5DA 3ZQ6A 1DO2A 1MO6A 1VG8A 1KDPA 4BFZA 4F4CA 2EWVA 2ANBA 1BH2A 2BJVA 3CONA 2A5JA 2H1LA 4HLQB 2EFEB 1HE1C 3NIBA 4WOPA 5P21A 1G8HA 3RHFA 2C78A 4EFLA 5KSOA 4G5SA 3KTAB 3TSWA 5HE8A 1QHNA 3O8BA 4YLGA 2XXAA 2ATVA 1DELA 4JLJA 5G41A 1IN8A 2QAGB 1IOZA 4Q1CA 2ZYVX 2OCAA 1SKYB 1R0WA 2DCUA 1KK0A 4QXAA 1XBTA 2HCJB 3U3MA 4HUQA 3T15A 4DSOA 1OFHA 4NZYA 1DEKA 1E32A 1KO7A 3CH4B 2X2EA 3MD0A 2CDNA 1ZCAA 1E98A 2GA8A 3JZAA 3THOA 1CRPA 1XCPA 1KYIA 2BMJA 2R9VA 2G88A 2IUSA 4B35A 4RKFA 5JMTA 3ZYCA 2YINC 2F43A 3TLXA 2O8BB 2GK6A 3CB4A 4AKEA 1U81A 2GJKA 3SJBA 4FI3C 4Y0AA 1KI6A 4RD1A 3TIFA 3TR5A 1T0HB 1KZ7B 1MO5A 3MWYW 1N6NA 3BK7A 2CHGA 4ZIRB 3RDPA 2BKUA 4RZ3A 4F91B 1SVWA 1UEJA 4II7A 2EFHB 4PO9A 3EWAA 1G291 1ZM9A 3AF4A 3QF7A 4RZ2A 2OESA 5EXTA 4KFSA 4DIEA 1E94E 2A5FA 2X77A 4MRVA 2BV3A 4TMZA 1UAAA 4V0MA 1W36D 4LYFA 1LS6A 4QC2A 4A8JC 4O3MA 4LV8B 4S2EA 5FTNA 1GZSA 1W0JA 1H8ED 1CLUA 2J0UA 1XTRA 2NO1A 1U8AA 4B2LA 1EFRD 1KAOA 2VP0A 1E1RD 1G8PA 2AK2A 2GAOA 4IOKA 1KKLA 2QGZA 4NONA 3KJGA 3CRMA 1JB1A 1GRQA 3ONWA 3BB1A 1LVGA 1LFDB 4A6PA 1RPZA 3R9WA 3GJ7A 4LJ8A 2ODBA 2PH1A 4PHTA 3T5DA 3UMRA 5TMPA 4B2PA 4B34A 4PAQA 5TARA 4CZ2A 2IA5A 2W83A 4TT3A 1FW6A 4HYYA 421PA 2V3CC 1MV5A 2PZFA 3I4LA 2RH5A 2PT5A 1NSTA 4I1SA 1EFHA 4OI2A 1JR3A 1H8HD 4MGZR 1YZQA 4FCWA 2JGNA 5EXSA 4DLWA 3IKJA 1GAJA 1AN0A 5D3MB 1G8FA 3B1WA 2Q0HA 2MSDB 1Z0DA 1YKSA 2H17A 1Z2AA 2AWNA 2QTFA 5JRJA 2FGJA 2HXYA 1TQ6A 4H1VA 2ZR0A 4QGHA 3QXCA 5C1BA 1Q1QA 3AVOA 3KKPA 2DFKB 5GJVC 4E09A 3U2QA 3ADDA 1L4YA 1OKKD 4G5RA 2D06A 2GILA 2ZS8A 4JLNA 3VR5A 1II0A 1RVDA 4M9XA 3JZMA 3WP1B 4ZI3A 4MRRA 1P4SA 1UBEA 1NY6A 1MABA 3K8YA 4XSHA 5FI1B 5FOWA 2A3RA 3SJAA 4BFTA 4GI7A 1I4DD 3GJ3A 5FH9A 4LSGA 2ZE6A 2D74A 1G5TA 1NN5A 3K53A 2P0EA 2ZRJA 3PUZA 4JLAA 2F9LA 3FHCB 4NBSA 1E2LA 1FZQA 3Q7PA 1GRNA 2XEXA 4RD2A 4DDVA 1YQTA 3T34A 1ZJ6A 4QFMA 3I5XA 1Z5ZA 5A4JA 1CRQA 2RGAA 3FKQA 1G3MA 3OE7D 2QM7A 2GVDC 2VH5R 1WMSA 2VP6A 2YC2C 3E5HA 3X1WA 5KNDA 4PC7A 1WB9A 1UPTA 3RANA 1EX6A 2CVFA 3AF0A 2ZJ5A 2VA8A 2A5DA 3EW9A 4AI6A 1D5CA 3OFND 4RZXA 1Z22A 2BDTA 4NMMA 2OSBA 4BWYA 4ZCMA 5IRCD 1Z07A 1MO3A 3MWJA 4GP7A 4MITA 1YRBA 1OXXK 1II8B 4ZDIA 4A2QA 5DIFA 3CX7A 2GCOB 1ZW6A 4UJ3A 4WBSA 3WY9A 1E9AA 3RLFA 2CVHA 2BCGY 2A5YB 3I62A 1XZQA 1E2HA 3MSXA 4OKSA 4EJSC 4PFSA 4E07A 2WPDD 3CWQA 4W9MC 2BBOA 3KL4A 5J47A 1GILA 1DAIA 4DLXA 1OXVA 4K81B 2P3SA 2VSXA 1MT0A 3AKYA 4DCUA 1F2TA 1SVLA 221PA 3K70D 1SXJC 2GHIA 1KI1A 4L4UA 4OJKA 2I4IA 2H18A 1NL3A 1I4LD 2KE5A 4B71A 4QJ3A 2PJRA 3GLHB 1PUIA 2ZRLA 2AXNA 4C4PA 2Q3FA 4WIAA 1D2NA 2F9MA 4BRWA 4QBGB 1EFRA 4DCSA 1E1RA 1XP8A 1KJWA 4V02A 1GL7A 2ZU6A 2V9PA 4US0R 2ECKA 1N5KA 3O8RA 2Z4RA 1J70A 3CX6A 1ZM3A 2ZI9A 3A4LA 1AK2A 3T1VA 3UIEA 3REFA 4PPGA 1LNZA 4CIDA 4LBWA 2C77A 2QQEA 1PVOA 2FG5A 4TYNA 1BMFD 3BB4A 4IW3B 2GRJA 4IFEA 5C4GB 2C9CA 4BGDA 1H8HA 4KBFA 1QHHA 2G0NA 1XD2A 1DPFA 3T61A 4IOJA 4B3XA 1HH4A 2E87A 3AF2A 1GM5A 4NE2A 2Q21A 4HB4A 5A0FA 4B3GA 4BZQA 3MWLA 4Q7MB 1RZ3A 2RGGA 1KOFA 1AS0A 2C96A 1UEIA 3MCAA 4HAUA 4ERNA 4M21A 2J7KA 3LW7A 3D6TB 1A1VA 2WAXA 2Z6VA 5DSZA 3ASZA 4DWJA 2YYZA 1RRCA 2OG2A 4IVPA 1OKKA 1E0SA 5K8UA 4JLKA 4FN5A 4NYMQ 2YVUA 5DNYB 2H92A 2WWHA 3PUWA 4ZV4A 5B30A 1JJ7A 4XJXA 2AXPA 2G77B 3DL0A 3PEUA 1DAGA 2ZQ5A 3DMDA 1JALA 5FUXA 3OAAD 4A1FA 2RGXA 2WSSD 3LBHA 2BMEA 3QG5A 4TMTA 3CLVA 4U02A 4URZR 4L9WA 5H1YA 5CYPA 1D9ZA 3ZVNA 4K46A 3IILA 3Q85A 2LWIA 3HPRA 3RABA 1W4AA 1DO0A 1EG7A 3LO5A 1WXQA 2ZRAA 4XWAA 4B3FX 1R10A 3I61A 3ETLA 3B1VA 3OE7A 4B3DA 3UG7A 4MRPA 3RS0A 1TADA 2JJ2D 4KODA 2MSCB 4LV6A 3AVVA 4IRUB 5HE9A 1E6CA 1NVUQ 4JS0A 3D8BA 4NDZA 5L3QA 3U3JA 5SZKB 3PJRA 3RRNA 1PUJA 3LV8A 1XMVA 3B1YA 4Q5IA 1M1YE 1IY1A 4M0LA 3OFNA 1N6IA 4D4MA 3QIAA 1XWIA 3AVTA 1XZPA 1ZC4A 2RGNA 3QBVA 5L8VA 4CDGA 3LNCA 1ZNXA 1OFTA 2RB4A 1YR7A 2OUKA 1VPLA 4AD8A 2MMGA 4LY6A 3L8ZA 2ZJ8A 2BVNA 4PHFA 1HURA 3UG6A 2OLJA 3W8RA 2WPDA 2O8CB 4LRWA 2EQBA 3L0PA 1E2JA 2Y8EA 3KKOA 4B75A 4KXFB 2XTZA 5CB8A 1L8QA 1W46A 2B8TA 3NBXX 3QSYA 4KLNA 3UKDA 5LB2A 2ERXA 2DB3A 4RY2A 2ZRHA 4DXAA 4XH9B 2ZSEA 5DE3A 3SHFA 4EFMA 4BLRA 3QF4B 1W36C 3KFXA 5DLQC 4A82A 1AJEA 4M1MA 1E9FA 1XEWY 2D4HA 2XB4A 5CDFE 4D4LA 2IF2A 1XPRA 5IHPA 3ZH9B 2RMKA 2WBLC 1P60A 2VYFA 2ZVPX 4FCTA 2WWGA 1U98A 4CGZA 4M2LA 4NCKA 2ZPTX 4X8LA 4XTCS 1W5SA 4URVR 3U5ZB 4C0HA 3IO5A 3B60A 1XRJA 4HSEA 3SEAA 4DCTA 1Z47A 1CR1A 2BEKA 2JAQA 4KFRA 1VCNA 1NG9A 4C7OB 1BMFA 3CH5A 1G16A 2Q6TA 3KXKA 5DGXA 2NTYC 1G4UR 2DBYA 3EWSA 4OHXA 1W2HA 4YMUA 2AHOA 1ZM2A 1IXSB 2VF7A 3GJ0A 2FV8A 2YOHA 2DWPA 5JCZA 5C18A 3ZQJA 5BW8A 4MGIR 4O2LA 4B32A 3BS4A 1FQKA 3GLFE 2ZRPA 1HT1E 3AM1A 4LHZA 4LJ5A 5EE0A 2A78A 4IDNA 1HUQA 1HQYE 1UDWA 1DG3A 4G5GA 1DADA 3BFXA 3MGCA 3VR2A 3KB1A 4D0LB 2O5VA 2QGNA 3K9LA 4X8MA 1G19A 2NO7A 3ADKA 3OEHD 3CNNA 3KQKA 5KPDA 4QHYA 4AKIA 4MYTA 1A5TA 4QBFA 5K8IA 4OJQA 1NKSA 1J99A 3C5HA 3OAAA 1E79D 2WSSA 2R6DA 2XTMA 5KOYA 4PC3A 2NGRA 2QENA 2CLCX 4KVAA 3R7WB 5LPNA 4EFNA 3T5GA 4ABYA 5FPYA 4C9BA 1Q1ZA 4DCVA 4JSYA 2DWQA 2DY1A 3KX2A 1P75A 2PLRA 3SE0A 3KJIA 1G3RA 3CUEF 1F2UA 3IBGA 1NJGA 3M6AA 3EIHA 2JJ2A 2CL7X 4MA4A 3K0SA 2J7PD 5A5GA 2QORA 3I3SR 2CCGA 3VR3A 2W2VA 4UNNA 5F98A 1H65A 1N5IA 1RYFA 2KBFA 2IYVA 1Z06A 3SHWA 4C0QC 1SHZA 3FE2A 4AG6A 5KDDA 2QG6A 2O8FA 4Q19A 3B1ZA 5HPYB 1TU3A 3KJHA 1KK1A 1YVDA 3KDSE 2WWYA 1U94A 1U9IC 3D7MA 3U3RA 4PQYA 1ESMA 2GCPA 1N5JA 1AGPA 2CLDX 5D3MA 1XPOA 3IDQA 3GFPA 5JECA 1MR3F 4QRHA 5AJZA 1XDBA 2RCNA 5KHOC 4RFSA 1CJVC 2YZ2A 1Q1BA 2P6RA 4KSCA 1TF5A 4NCNA 3HU2A 1W0KD 2FSIA 2FPLA 3K09A 3WMEA 1OV4A 1KSGA 3ZVRA 3PCRB 4X8OA 4B74A 2NQ2C 4OL0A 4M1YA 1XTQA 1SKQA 1U0LA 3B9QA 1E2PA 4JVSB 2FSHA 2BMFA 2HXSA 3E1SA 2ZJBA 3GLGA 2R8RA 4U7DA 1J90A 3L43A 4AG5A 4LHXA 1IY2A 4B47A 3CPHA 2CJWB 2ZRIA 3U3KA 3DOEA 3E70C 1P2VA 4JLOA 2CL0X 2O0HA 4URXR 4HAXA 3BFKA 2V6JA 4IJMA 3GP8A 4GOJA 1OSNA 1M7HA 3P27A 1NBMD 1FX0B 1D6JA 1YR8A 5AUOB 4BZPA 2JLSA 2C8VA 3QKSA 2J87A 2IXGA 2MMCA 4ZDJA 1CJUC 1QHIA 1UKYA 1JPNA 2QPTA 1G3IA 1OW3B 1XEXA 3HYTA 4BFVA 4AY2A 2GBLA 3KB2A 4TZ6A 4CEIA 4DKXA 5JCPA 3P32A 3THYA 2HF8A 3KQHA 1ANKA 2ONKA 3NC0C 2IHYA 4KYUA 3RRMA 1KK2A 1KO4A 1WBBA 1FP6A 1SGWA 1XXHE 2F1JA 3LLMA 4LBZA 5FL7A 4FWTA 2KI5A 2N46A 3WYGA 4LV5B 1T91A 2GK7A 2OFWA 1M7BA 3TSZA 2PEYA 4R98A 3BC1A 2GZAA 4PC1A 5HZKA 4DEYA 1II8A 2IYXA 1Z0KA 2N42A 5KNCA 5TB5A 1Z6XA 1P2UA 3DVLA 3I1FA 4ZCLA 4XWKA 2HYIC 4Z8XA 2KB0A 3IEUA 3NDPA 2CHQA 4Q02A 3WHKA 1X86B 4TMWA 3O47A 1P9RA 4WZBE 3SR0A 1L2TA 1UKZA 3EPKA 4G0NA 1NMZA 4PANA 4DC9A 1N0WA 3OEHA 2XJ4A 2BKEA 3TVTA 2BM1A 1OT3A 3NHAA 4XVUA 4DDWA 1AKYA 1E79A 5AJXA 2IS6A 1R7RA 2HYDA 4F93B 2X19A 1YZTA 3GLHA 2WM9B 4M9QA 3WP0A 2E1RA 3QNUA 4TL7A 3AKDA 4D2IA 4MKFA 1CR0A 1G21E 3QKRB 1Z29A 3CNOA 1AS3A 2OE2A 1SXJD 2BBTA 1IBRA 1QG2A 3LAWA 3MRSA 4P33A 5F9HA 1JEEA 2J7PA 3BIFA 1Q21A 2UVQA 4A8JA 5KTYA 2JLWA 2PJZA 3IIKA 5E3HA 1Y63A 2ZSFA 1TQ4A 5JWHA 1A2KC 1X8KA 4W5WA 4US2R 3U4QA 3VKHA 3AKCA 1MO4A 1N6RA 3BRWD 1E2EA 1W44A 1Q22A 3AP2A 4IXNA 2QBYB 2RGEA 1Z6TA 3VHLB 3FHTA 3LA6A 5CJ2A 1RJ9A 4JBYA 4D26A 3EPHA 4RJLA 2WV9A 1K5GA 5TV2A 4A0HA 1QHGA 1KJYA 2ZI3A 4ZDWA 5JJLA 1US8A 2GJSA 3K0FB 1CKEA 3C14C 5UKDA 1W4RA 2C9YA 2JEOA 1W0KA 2VF8A 4NU0A 2IUUA 2V6IA 4GFDA 1X8LA 4BZXA 1G3QA 2JCSA 3LFUA 4NCJA 3NDBB 4W5JA 2ZYUX 5K8LA 1TPZA 5LBIA 5J4KA 4DVGA 4BUJA 4KITB 2WIBA 4XSGA 2A7QA 4WXRA 1QVRA 1UBGA 3QG1A 1C4OA 5DI3A 1D2EA 2OBNA 1UKVY 2WJYA 1NKTA 1NBMA 1PLJA 3EIQA 5KYKA 2QTVB 4AYTA 3GLIE 3A58B 4WA7A 3W6NA 3U44B 4TMVA 3EZ6A 1OH7A 3SBDA 1FTNA 4A0RA 3W34A 3QKUA 2OV2A 4TMXA 5EUQB 1EXMA 4ARZB 4R7ZA 1LF0A 1GG2A 1XCMA 2IYRA 2R62A 1EK0A 4KBGA 3TQCA 4XWOA 1XD9A 2JDIA 3IBYA 2IC5A 5JWOA 2J41A 1I4TD 1XXHB 4Q03A 3PEWA 1NY5A 4LHVA 1EFCA 4UQOA 5FOSA 2DFTA 3X2SA 3ND9A 3BB3A 1KHTA 2B8WA 1A82A 2HV8A 1GKIA 3EXAA 3HP1A 2VP5A 3RC8A 4TQAA 4ESHA 2WAYA 1ZD1A 3C16C 3N70A 3UWOA 4KYIB 2JASA 2IYUA 4C0SA 4B48A 2KJQA 3BERA 1VHLA 1IXZA 2QRNA 4TYPA 4BEBA 4UJ5A 1Z63A 3AF3A 2ZROA 2AD1A 1M34E 2OXCA 3BAFA 5HR5A 5GJCA 2FPMA 5CK4A 3RYTC 3SOPA 3BFVA 3AVQA 4KFUA 2ZUDA 3EZ2A 3SI7A 1DG1G 5FPTA 2BMDA 5DH9A 2R6FA 4ACBA 2GZHA 2HDNB 3I5YA 2BBSA 3C4JA 3FDIA 4HDOB 2QP9X 4TLCA 3TBKA 4EJSA 4LWZA 2REOA 4PXAA 5EP4A 2NO0A 1ZRHA 2XNDD 3HR8A 2AFHE 1JNYA 2AK3A 2NMVA 5AUQA 3AF1A 5DISB 4TLEA 1SXJA 1G8GA 2ZI6A 1XTSA 4LPSA 1TQDA 1ZIOA 4FMDF 3VX3A 1FFHA 4Q4JA 1OYWA 2G0TA 1NLYA 2B7BA 3RVBA 4GNKA 4DCNA 1S2MA 1W5TA 2F1RA 4RFVA 1RC8A 1M74A 1KTVA 4C2UA 2QNRA 4DLZA 1KY3A 4M9SA 4P32A 3LRPA 2VBCA 1R5OA 4S35A 2O8DA 5H70A 1UBCA 4KO8A 3QVUA 4EQ6A 4P4UA 3SU8A 4QG7A 3TQFA 1YE8A 1YR6A 1Q57A 4OI0A 1JXOA 5FOTA 1N6KA 2OLKA 3QOFA 2IS1A 1ZUHA 1NN0A 3QPUA 2PLFA 4TZ0A 4KLZA 4PO8A 3QBTA 5L3RA 4I4LA 4Q4AB 4HZUB 4XOIA 5F3WB 5HZHA 2LCFA 1NP6A 1GNPA 2YOGA 4NCHA 1OXSC 4TLAA 3I32A 4BFXA 1QRAA 1JQLB 1S9DA 3CF6R 3QEJA 2VP4A 4HLUC 1QHSA 2J9RA 4H1UA 4C30A 3CRRA 3GLIB 1U8ZA 1KO1A 2PCJA 3T1TA 3IEVA 4B43A 1OYYA 3LH5A 5IK2D 1KSFX 2V55B 2IWRA 3QVVA 4BPBA 1BS1A 2FFBA 3M1IA 4DLSA 3HWSA 5H8WA 4JL8A 5LDDC 1T3HA 4GOKA 3IHLA 4EIWA 5EZ5A 1KGDA 2GXAA 4FIDA 5KO2A 4N0EA 1S3GA 3AH8A 2BCJQ 4D25A 5FTLA 5F9FA 3LBNA 4A0FA 3B13B 4TL6A 1QVAA 4KFTA 2YOFA 4PSVA 4HB3A 4V0LA 5SZIA 3CNLA 1YZLA 1RYHA 2UZ3A 2AX4A 4DDUA 1P2TA 2H16A 3OEED 1Q20A 3FFAA 3FMIA 1U90A 2F3RA 2ZRKA 4ZDKA 1D8TA 4PC2A 5L3SA 1YZKA 3NH6A 2ZXUA 1QF9A 1EGAA 3LX8A 1OH8A 4IDQA 1U0JA 4CEHB 3K0CC 4JIMA 3WBJA 2P2LA 4M1KA 4Q48A 5DO9A 5B57C 4JLPA 1W49A 1N6OA 5AJVB 3PITA 3TE6A 5JLJA 3QKTA 3EX7C 2VPPA 1ESNA 2OILA 3LD9A 3RAPR 2JJ1D 5BWMA 2XAUA 4B44A 4HB2A 2FWRA 1RRFA 3DPUA 3CPJB 2Z5FA 3KKQA 4JVLA 5FR2A 2QE7D 2EFDB 4D81A 3P26A 3ADBA 3THWB 1XFAA 3ZS8A 1U0HC 3NVAA 2BEJA 3H0KA 4JVMA 3VR6A 3R9XA 4KSBA 1E2DA 1Z0IA 1Q3TA 1J8MF 1R2QA 1VIYA 4BLTA 3V00A 4D4KA 721PA 1RFLA 1XCGB 3WNDA 3DM9B 1A2BA 4QNRA 2ZRMA 4WVFA 1WE2A 1XB2A 1H8EA 1R4AA 3WNBA 4LJ9A 1G7RA 1NN1A 2J0VA 4KCGA 1XX6A 3O8DA 1T4GA 1MH1A 1Z08A 1GTVA 2QL6A 3QXSA 4NCIA 3MWKA 1N0UA 2IW3A 3T06B 1ZNWA 3UPUA 4TYWA 4Q1BA 3DZ8A 4YXWD 4Q18A 1CJTC 2CBZA 5FPHA 4DLTA 4QJ4A 3P1JA 5CJPA 2VSOA 3UATA 2IBMA 2QMOA 3QXXA 1ZUIA 4MKHA 1SVOA 2CNWD 4PR0A 4CEJB 2AN9A 2C5LA 1X3SA 2ZREA 2YWEA 2O8EB 4G1UC 5GVRA 5JSZA 3MMPA 3W8NA 2QY9A 3Q3JB 4C0JA 4F92B 4A92A 1DBSA 4LGMA 3T12A 2WJGA 4C0LA 3A1SA 2WOJA 4Q4HA 3TGPA 5FUWA 3C7KA 4XIGS 4JJKA 4V0ME 2F55A 1TTTA 2FA9A 5IK2A 4MUAA 1FMLA 1VCIA 2PMDA 1NJFA 1S4QA 3K0AA 3S1AB 3HJNA 1IAQA 5FPKA 2J45A 3BWDD 2CK3D 1KMHB 2GXSA 2J5XA 4X8HA 4NYJR 3BBPA 2YHSA 4NH0A 3VU9A 2IHBA 2ZS7A 3KKMA 2DHRA 2Z43A 2OCYC 4NYIR 2ZRCA 2YKGA 1Q12A 4N3NA 5EP1A 2AWOA 4JT2A 5JBQA 2C2HA 4IVQA 5CIQA 3ZIAD 2WTUA 1GKYA 2I1QA 1M7GA 3BXZA 4TLBA 4RCZA 4UNQA 2XZOA 1WCV1 3GFTA 1GRRA 3G5UA 2B92A 2XZLA 1HY3A 4G01B 3FWYA 1F6BA 4PHHA 4HDQB 3C15C 3QXHA 1KAGA 3L8YA 4KJZA 3FFBA 1F5NA 3OIWA 1T8UA 5L3VA 2NIPA 3K0EA 4LX0A 3OEEA 4DT1A 5EE1A 1E2KA 3K0FA 4P4SA 3KXLA 4JLDA 4P31A 1E96A 2QTHA 2X2FA 3A1UA 1OB5A 1P72A 1E2FA 5TVKA 2WJVA 1JECA 2FSGA 2J59A 1IM2A 3CBQA 1U9IA 1VG1A 5CM8B 4IDHA 3NWJA 1M2OB 2ORWA 2DR3A 2Q9AA 4QM7A 2HJGA 4AWXA 1TUIA 1FNNA 2IYYA 4EPXA 2ODEA 4PO1A 4B76A 3WBKA 3Q7QA 2HT1A 2QE7A 2G9NA 3FMPB 4LJ7A 2CCJA 3VR1A 1UJ2A 4GDFA 4ZPXA 3RC3A 3FOZA 1EESA 1Q3HA 4EPWA 4MGYR 3UK6A 1FL9A 3QJYA 1Z6AA 2R6GA 2Z0MA 4BFUA 2XXAB 3VNUA 4GZLA 1GFIA 3LW8A 4GP6A 1OFUX 1T3SA 4DLYA 3R8FA 4GMXA 4NL4H 1JAIA 4XD7D 4HUQB 3W90A 4NKRA 5DHAA 2EWWA 2GEUA 3MJRA 4BECA 2IF0A 1XTJA 2IUTA 1XXHA 2W6ID 4R71A 4MQBA 2GTPA 3BJIC 2IXEA 5J4YA 1AZSC 4AK9A 1W47A 1VYTA 4FW9A 2G3YA 2ZE8A 1G5RA 1YU9A 1KI8A 2CL6X 3KTAA 4A4DA 3THXB 2QN6A 2FU5C 4YXWA 1W1WA 3VHXA 5AUNB 2RKOA 1KSJA 1NVWQ 2ZI5A 3LQQA 2OHFA 5E7MA 2QAGA 5JWRA 1KI6B 3SDZA 2PX3A 3K9NA 1G17A 1II9A 2JLYA 4M8NE 3CRW1 2OCPA 1NVVR 3IQWA 4N0DA 5HCIA 2CNWA 1OHHD 4JKYA 3DDCA 1NLFA 3LVRE 3EZFA 1RRGA 4RVCA 6Q21A 3HU3A 3VQTA 4DLVA 1OH5A 1E2IA 4Q01A 5DI9A 1XJ0A 1G7SA 3LBIA 3X1ZA 1G5PA 1CJMA 3KXIA 2QMHA 1T5IA 2W00A 4MGKR 3ZGXA 2O8BA 1C1YA 3OIUA 4I81A 3I8SA 3GJ4A 1YRAA 5JRZA 3CZPA 4Z54A 3TH5A 4NHOA 2FSFA 3GEEA 2HLDD 2ORIA 4LHYA 2J0UB 4OHZA 4RD0A 2QSYA 3IHWA 3OIYA 3W6PA 4TTRA 4ZIRA 4QBIA 3SYLA 4Z1MD 2V8OA 4LDJA 4YMSA 4YC7A 2HEIA 3TRFA 4UNRA 3QPVA 5AK0A 2UKDA 2ZR7A 2ZRNA 3JVVA 4Q1AA 4YQFA 2X1VA 3LVQE 4JKIA 5FFMA 1FMJA 2C99A 1OPXA 1R6BX 4HATA 3CF2A 1G4AE 3ZIAA 1ZD9A 1FTSA 3SJCA 1TEXA 2GEVA 2WKPA 2YWGA 3SQXA 4L9SA 2YWHA 2VHUA 1AS2A 5CB6A 2VP9A 1NLZA 1ZU4A 5K8TA 1CBUA 1AIPA 1W7AA 1AM4D 2RGCA 3CF0A 4GMDA 2FOLA 4IHQA 4A6XA 1CULC 1M6NA 2CCKA 3X1XA 2OCBA 1G7TA 1U2RA 2OEPA 3CKLA 1SVSA 1CP2A 4Q9JA 2I3BA 3K9HA 1XMSA 2VHCA 1K8RA 2GESA 3RWOA 5EUMA 4BFYA 2YWFA 3AKEA 4AYXA 4DDTA 1G41A 2CE7A 1P9NA 1FQJA 1U99A 2XX3A 4Q9LA 2P5TB 2J0SA 3EARA 2A5GA 2VLIA 3KUCA 3HPQA 4Q4AA 1NI3A 1XD8A 3VAAA 3IPXA 4URUR 2ZJYA 1MABB 4DRZA 4LUCA 2W6JD 2GDJA 2B7CA 3BH7A 4XVRA 3HDTA 4B33A 3SYKA 4FMCF 4OK6A 3EPJA 1JI0A 2OBMA 4ON9A 1IXRC 1ZVQA 3QPWA 4FMBB 4DB4A 4PAOA 2RHDA 1VG9B 3OIVA 1QHXA 1KI7A 3UANA 3VKWA 5IDVA 2GEDA 3FKSD 2BHRA 2C98A 3B5JA 3H86A 4OBEA 5GVSA 2FFQA 3BH6A 2PZEA 5D3QA 2D3WA 2JATA 1EFUA 1VECA 2IS2A 3TW8B 5H68A 1J8YF 4TN1A 3ZD6A 4XD7A 3L0OA 3RS3A 4A9AA 1YHNA 5C46F 3EC1A 2OO7A 2W2TA 3FYHA 5M04A 2IYZA 2W6IA 4A2PA 1X8JA 3AVPA 4URWR 4AURA 1R5NA 1E99A 2ZYWX 3RS7A 5FBRB 1VKJA 1CTQA 2F3TA 2Q9BA 1M8PA 1WQ1R 3LXRA 2GJ8A 5EE3A 2V54A 1JXMA 2QAGC 2NZJA 5FBQB 3TKLA 5IF9A 4Q7KA 1XJQA 4P3YA 4F7WA 4TQ9A 5KNBA 3AVWA 1OIWA 1TU4A 1OHHA 2TMKA 3TJZA 1GNRA 5G53C 2G1KA 2QZ4A 3BOSA 5KSYA 1S1CA 2GVZC 1KI4A 1OF1A 5JZVA 1F2TB 2P67A 3ICQB 2GJAA 4DIDA 1VIAA 1E2GA 3B9PA 2REBA 3AUYA 4LJYA 3LXXA 3GLFB 3WYAA 1S8FA 2D62A 5CM9C 1W36B 1JBKA 2ZVQX 4ZKEA 2R65A 2VTKA 2ZSAA 2ODWA 3GJ8A 1VHTA 2GCOA 3PXGA 5DHFA 4CT4B 2C04A 5E4FA 1O3YA 2G1JA 3C5CA 1DVRA 2ZTSA 1XF9A 4JZKA 4BLOA 2YJTD 3B8HA 4KHZA 4RZUA 4GZMA 4BLSA 2QA5A 2H57A 3WXMA 1N6HA 1MKYA 3PQCA 3SS8A 1GIAA 1EWQA 3D31A 2YC4C 3RWMB 1R8SA 4DUGD 3UMSA 1A7JA 2ZJZA 4HLCA 1RRPA 4TLDA 2ZRDA 1T8TA 3EZ9A 4DSNA 1TAGA 4PX9A 2W0SA 2GF9A 3EC2A 3QI2A 1HYQA 3TVDA 3VMFA 4J0QA 821PA 1ZCBA 1OB2A 2FE4A 3OESA 3QUSA 1NMXA 1QHHB 5HTKA 4B3CA 3U7HB 2FMXA 2EVWX 2I1VB 2RAPA 2WHXA 4GT1A 3TR0A 1SZPA 5LD2B 3I92A 2FX3A 2P65A 4K8OA 3WMFA 4D0NA 3NC1C 3K1JA 2WWWA 3Q8XB 1NIPA 2JJ8A 4QOSA 4LJAA 5C4MA 3WMGA 1T0JB 4RD3A 4KVGA 3IUYA 2ANCA 3C41J 5F2EA 1XMIA 2DFLA 2EFGA 2ORVA 1KDTA 1N6PA 2WOOA 3BGWA 2GZDA 2O8EA 4MUBA 1ZYUA 2W6JA 1KZGB 3A1TA 3C8UA 3D3QA 3FGNA 1VYVA 1DARA 1XTKA 2ZITA 3L0SA 3PV0A 4FMDB 2QQ0A 2OBLA 5J5CA 4MYUA 1WDTA 1X1SA 2OM2A 4Q9HA 4ACAA 1E2QA 4JL5A 2ZETA 3DKVA 2BIFA 3FB4A 3FKSA 2J0QA 1NVXQ 1E9EA 1CS4C 2YNMA 4NYJQ 5FBLB 2FFHA 4LZZA 4NYIQ 2GWHA 1GL6A 1T5LA 5GADl 4HLUA 4QJ5A 2HCBA 2H5EA 2NPFA 1AQUA 4Q00A 5FBVB 1DAFA 1XTIA 1Z6GA 2AKYA 4TT3D 1T9HA 5L3QB 1UFQA 3SNHA 1VDZA 3N2EA 4L8GA 1E2MA 1DAMA 2F7SA 1J2JA 1HE8B 1N2CE 1ZM4A 4RSGA 4UXHA 5GJWC 1JAHA 1TX4B 4TSFD 4JSTA 1B0UA 2BOVA 2FFAA 3TUIC 4CW7A 1IJFA 3EG5A 4CF7A 3B6EA 1GWNA 1MRSA 2DFNA 4UNSA 3G0HA 3U6BA 4O0MA 4I1UA 1ZD8A 3PVSA 3T1OA 2ODNA 2EYQA 4YMTA 2PBRA 4Z51A 3CPEA 1E4VA 4H9GA 4DBLC 2O52A 1TEVA 2D2EA 3L2OB 2REXB 1G6HA 4GRAA 1CR4A 1R8QA 2F6RA 2VRWA 3FTQA 4QL3A 3K70B 4IDPA 1Z3IX 2ZE5A 4JLMA 1DOAA 4OI4A 4NPHA 3UWKA 1FP7A 2GAAA 2OT3B 5HCNA 3GLGE 2C95A 4OQNA 3GFOA 1LB1B 2X8AA 4TTQA 3RS5A 4EPVA 1RE0A 3NHBA 3P20A 5CIWA 3AVXA 2O8CA 4E5UA 3U60B 4MKGA 1ZINA 1NSFA 2XITA 3PEYA 2W0MA 4UKDA 4IEIA 1F3OA 1E9RA 2O0JA 3H84A 3TUJC 3K0CA 2JA1A 1QHYA 2RHMA 2W58A 2PMKA 1E0KA 4DUGA 1WBDA 5FOXA 4LOAA 1BIFA 3F0TA 1QZXA 3QF4A 2KBEA 1GNQA 4YDSA 1UM8A 2QRZA 1W48A 4D80A 3VNVA 2GKSA 2JLVA 3GMTA 3ECCA 3PG5A 4IXMA 2CHVA 3SZRA 1Z0AA 3QEOA 3VR4A 1PZNA 3CRQA 1S3SA 2R2AA 3VX4A 2P5SA 4P0TA 3THXA 4JBXA 1XEFA 2EW1A 3F8TA 4Z8YA 4AC9A 1S0UA 4YONB 1O87A 4PPFA 4KU4A 3L0IB 3U7GA 4FWIB 3AUXA 1NVVQ 3NEYA 2EYUA 3W3ZB 5JI3E 2OXRA 2ZAMA 4WZ6A 2J46A 4C7OA 2OAQ1 4EPTA 1TQ2A 2PL3A 5HKKD 1W4CA 3KFVA 5KUTA 5JJKA 2Q9CA 5TY0A 1G64A 2ZANA 2H8KA 4WAUA 8OHMA 3AP3A 1KI9A 3U61B 2EFCB 1ZMXA 1N25A 2QPOA 3IIJA 2GCNA 2XB2A 3HYRA 1HTWA 4MYCA 3M4YA 4LPKA 3ZZTA 2F1IA 1VCOA 3GLHE 4IDOA 3DOFA 1CJKC 4LK2A 4MDEA 1L4UA 5J4LA 2QMUA 4QBHA 3HU1A 2WJHA 3PUYA 4UXJA 3MLEA 1F2UB 4U00A 5EZ6B 4I1VA 1UF9A 5AUPB 1E9SA 5G40A 3KKNA 4UNPA 2V7QD 1XEWX 4US1R 3AEZA 2BWJA 2JLUA 1LY1A 3MAAC 4LI0A 1W2GA 4JJZA 1BO6A 1P7CA 3R7WA 3GQBA 2ONJA 2QP3A 2O8FB 2VP2A 4DSUA 3V4FA 3QENA 4IOMA 2XOKD 4TSFA 1G9XA 2XSZD 1NMYA 2FNAA 4Q1FA 2CLSA 4JLVA 4L5BA 3NKVA 4V0NA 4AKGA 2GF0A 3QE0A 4QKQA 3KQUA 2NZ8A 3SJZA 5DN6D 3ZD7A 4Q7JB 3A4MA 1YR9A 4N1AA 4FINA 5FI0B 4RFSB 3VTKA 3AP1A 3W3AA 5JS8A 3WNCA 2GXUA 5ELXA 4LBVA 3B7GA 2Z4SA 4PZLA 1EWRA 2NPIA 5FUYA 3GLGB 1J7KA 5EXPA 4OQMA 2B6HA 5FUVA 4QGFA 3U6KA 2VHTA 5JI2E 2BC9A 1R0ZA 3R8CA 1VG0B 4JBWA 3OHMA 3DO6A 4LJ6A 5CLQA 2FF7A 3TMKA 5B64A 5FOVA 2FH5B 3A36A 3Q5EA 1NBME 5LB4A 2JIZD 3QKSB 3ZVMA 1XNJA 1ZU5A 1KJZA 2WKRA 1LF5A 4HDCA 5FR1A 4M53A 5FTKA 1NRJB 2R44A 1XEXB 3GEHA 4CT5A 4XTRA 5G3ZA 2IYWA 5ANRB 4CEIB 5CDFA 1KO5A 1PJRA 1TNDA 3THYB 4ZI2A 2CJWA 4NP6A 3AV0B 2ZJOA 3BD9A 4JLBA 2P6UA 2XNDA 121PA 3ZDQA 3F3YA 1NN3A 4EDHA 2IYLD 5BN3A 1G3UA 1WRBA 4A36A 1FX0A 1I2DA 3I73A 4I1OA 5EJEA 1XMJA 4RCYA 2AD5A 3IGFA 3FPAA 1RIFA 3K9GA 4GPTA 2N1BA 3AB3A 3REGA 2G83A 2A9KA 4CYMA 1ZBDA 4EPRA 3AQ4A 4HEJA 3V4RA 1E0AA 2ZUBA 1L7VC 1PLKA 3CR8A 3AVUA 3SN6A 1R0YA 2QU8A 5HKKA 2J1LA 1JJVA 1Z0FA 4HAVA 3GJ5A 2VQSA 3RNLA 1DS6A 4RKEA 4KV9A 3SFVA 4Y0VA 3GLFA 3UXMA 3IQXA 5E95A 3SC3A 3GPLA 2R6AA 2FPKA 4TL9A 2VHJA 4C0AC 2HUPA 1XJCA 5BYJA 2DWOA 2BM0A 3DMNA 1YZUA 4JYCA 4NTZA 2CXXA 4QGAA 4TTPA 4OQLA 4EAQA 1E3MA 2OZEA 1P5ZB 1ZP6A 1EX7A 5TXGA 3WRXC 1JEDA 2AFIE 2V7QA 4ITRC 4A15A 1SXJE 1SULA 1Z2CA 4A8JB 4PTLA 5IT5A 2P6NA 3EAQA 1EFTA 3A6PC 1ZIPA 2ZS9A 5KSZA 2DYKA 2FJUA 3TK1A 1T3LA 4OYHA 3U4QB 1C9KA 2FGKA 2G6BA 1YJ5A 1HQCA 4F38A 2IWHA 2XOKA 4Q7LA 1OJLA 2XSZA 2ZSBA 2ZRGA 4PPNA 3QKRA 4M4SA 1RJ9B 3AGPA 3RRZA 2HT6A 5FTMA 1OH6A 1GL9B 1TF2A 3UMFA 4BEJA 3BH0A 5DN6A 3QY0A 1FUUA 1US8B 1N5LA 4V0OA 1BYIA 3GJXC 3IIMA 5AR1A 3ADCA 4PSKA 3CRVA 1N3BA 1FPMA 1IY0A 2QT0A 4CVNA 1OE0A 2MSEB 2ZRFA 2KWIA 5JEDA 1ZM7A 5B2ZA 3CZQA 1WA5A 5EP3A 3AVYA 2ZJAA 1CEEA 2QBYA 1WF3A 4MRSA 3ZZ0A 5EE5B 2D7DA 1JR3E 2LKDA 2WICA 2PEZA 2ZU0C 2IX3A 1G6OA 1QBKC 1GVNB 1NNEA 2XZPA 3PFIA 5BQ5A 1UDXA 1ZUNB 1BOFA 4LC0A 4LYAA 5KDOA 3FVQA 4R9UC 5DI3B 1P62B 4OK5A 4BFSA 4HAYA 2ZUCA 1IHUA 2V4ZA 1NF3A 3P4XA 4POAA 3RRYA 2FEMA 3F5FA 4HLDA 4DJTA 1JR6A 1FUKA 1KO8A 1VCMA 1ZNYA 2IYTA 4PPQA 3PIRA 5EE9A 4PZYA 2JIZA 3NBZC 1ONBA 5BXQC 2D7CA 3A4NA 5EXXA 4M1SA 3PUXA 3J81k 2OFXA 2QAJA 1SVKA 4ASUD 3ZJYA 4OHYA 1KSHA 2JJ1A 4GBMA 4DSTA 3BE4A 4PC6A 4HUTA 4DB2A 1XU4A 4L15A 4HZIA 4D4JA 3WYFA 1Q0UA 2Z83A 4YDHB 4ESVA 1IQPA 4YMVA 2QI9C 3U44A 3RS4A 2XGJA 1N0VC 5FBWB 4ARZA 1JPJA 1MRNA 4HAWA 1OLOA 2WWXA 3DEFA 5JJIA 3MUFA 2QEQA 1P9WA 3SBEA 4E22A 1NG1A 2UZIR 1HEIA 4FMCB 1E9CA 4JYBA 4CRWB 621PA 2ZM5A 3DHWC 4KAXA 5AWFC 4C0BA 2J3EA 4DEXA 1LTQA 2XNSA 1LS1A 5G3YA 1GSIA 1JQJC 1Y3AA 3HR7A 1BYUA 2F43B 1S1MA 1X1RA 1G18A 2JLXA 3TSOA 1R0XA 1G7CA 4PHGA 4W5HA 4EUNA 4BLQA 4Q66C 3T35A 1I2MA 4A2WA 4EJSB 4OQXA 1LW7A 1DAHA 1GP2A 3N5CA 2QROA 3BORA 5E7JA 4C0KA 2GJ9A 1AA9A 1AQYA 3PEVA 4RD4A 4DLRA 3VKGA 1IONA 1IN4A 4IOLA 5B58C 1P61B 1SXJB 3KUDA 3SYNA 4DLUA 4M1TA 3W5IA 2ASEA 2ATXA 1E4YA 2WSMA 2PX0A 2JLQA 3LWNA 3Q9LA 4Q4JB 3NEJA 4ILEA 1Z0JA 2WVJA 3MFYA 3E2IA 4C3ZA 5BYKA 1E0JA 4BE7B 2W2XA 3RSLA 1YZNA 3W5JA 1V5WA 1VYUA 4D82A 2VIIA 2O8DB 2R6CA 2QM8A 2CK3A 4EPYA 3EPLA 1D2MA 5FL7D 1CXZA 4EQ6B 1TUEA 1V43A 4V0KA 4TQUS 4R2HA 1GOTA 4XVQA 4BQSA 5LD2C 2K5UA 5TDHA 3CO5A 5J4VA 3LLUA 4PAMA 2WKQA 3H4MA 2C03A 3KJEA 5KU1A 3TUZC 2AR7A 4B73A 1LV7A 2CEAA 3VFDA 4JL6A 3ZZUA 4FXPA 1P6XA 1QG4A 2KSQA 3LQRA 2EU8A 1Z6YA 1E9BA 2PCLA 1GKUB 1KNXA 1ZC3A 2NO6A 1K6MA 2ZSDA 3B1XA 3EZ7A 4I99A 1IJEA 4Q9IA 3EASA 521PA 3PENA 3ND8A 3QQ5A 4B6FA 5SZJA 4HAZA 3W6OA 2RGBA 2FEOA 2C9OA 3W9YA 1KIMA 3MJHA 3GCGA 4LC1A 3KQNA 1GITA 3ZLJA 1F48A 4KI0A 4HZUA 4GSYA 3U7EB 4DHEA 1HT2E 4FD2A 1Z8FA 2ZE7A 2WWIA 3DZDA 4ASUA 3U7FB 4ZCIA 1E69A 1YZGA 2VSFA 3U3OA 4TYQA 1ODFA 2A30A 1E1QD 2XTNA 2JLRA 5KDLA 2HJVA 1X6VA 4B2IA 4DZZA 1COWD 2E9SA 5DYGA 3KQLA 3GLIA 2JLZA 1TMKA 1KDOA 3NXSA 5DYIA 3I72A 3TAUA 4R2IA 4BFWA 4WW0A 1IN7A 3SFZA 2ZRBA 2RGNC 4JT4A 1P3JA 1F60A 3CWZA 4IFBA 5AJWA 2FN4A 1T6NA 1SQ5A 4JMPA 1KY2A 1KKMA 2ZYTX 4F4JA 2QPAA 4OI1A 3RSOA 2IEZA 4FCVA 4TYYA 3GEIA 1AKEA 1S9HA 2VEDA 2YV5A 2AKAB 1HV8A 2H7VA 4QGGA 3B85A 3IPYA 2V1XA 5L3SB 1PV4A 2DPXA 2VHQA 3B78A 4M1WA 4JVNA 2OFOA 2Q3HA 4WZAE 1Q1EA 3LY5A 4LBYA 3GJ6A 4O25A 4MDFA 1D9XA 3QXJA 4AIIA 3K70C 1MOZA 4V03A 2IXFA 2ZJ2A 3ASYA 3WHLA 4LHWA 5GJBA 1U8YA 4MKIA 4GOXA 4F4IA 1UADA 3AGQA 2QUZA 2PZGA 4B3BA 1Q44A 2WZQA
chains in the Genus database with same CATH superfamily
1XI2A 2X4IA 1S2IA 2PT7A 3ONNA 1IWOA 4D9BA 3UJNA 2FWIA 4BVLA 5FOQA 2NYAA 3NYWA 4G3XA 4J16A 3CVJA 2OQVA 1C1XA 1QX4A 1RBMA 4HB0A 1Q77A 2Z98A 3AXSA 4OQ4A 4Q1DA 3ZC3A 4UUBA 4M22A 5EGNA 2BGJA 3JQAB 5FRDA 3G2IA 3OUUA 5KCZA 2Q5IA 1GGVA 1PJ4A 3KD3A 3UCXA 4HNUA 2JF0A 1CUGA 3TNDA 2XNKA 3FPBA 3HZOA 4OHWA 1SR8A 3I9FA 4QPNA 2WJJA 3PQ3A 2G17A 2HLDA 5THXA 3RIEA 3B2EA 3UJ3X 5CK5A 3K94A 1J21A 4QG3A 5K0LA 3PHCA 3R20A 5HIKA 4LXYA 2FWJA 4X6LA 3R9IA 5HHTA 3GXBA 1CT9A 1DIHA 1VKOA 1QWOA 4WRRA 4Z1MA 3ZU2A 1OASA 3ZXXA 1N7GA 2XWQA 3NTUA 1UMDB 3H1TA 4O29A 3EA0A 2HIMA 3STYA 5JDIA 1OIXA 2IYSA 3QLUC 4Q21A 2HR1A 1ENPA 1SAYA 1U0OC 3DMTA 4RUKA 1CLEA 3NBYC 1O7JA 1Y5IA 3X1YA 2DM6A 1OQAA 2WRZA 3V8QA 1VFNA 1ZQ9A 4DC0A 1SHKA 3WGMA 4RS3A 1T9DA 3E3LA 4BMOB 5DLDA 4JAVC 4QM6A 2AG8A 1RBYA 3CT6A 4J6FA 1DTSA 2ERYA 1SKBA 4NF2A 4DNPA 1XCBA 4EHIA 4F06A 2HDWA 3EVBA 5G0TA 4YLYA 5EP2A 1I24A 4WCDA 2EJUA 4DR7B 5L7WA 2YZ7A 2ZAYA 4R1UA 3DE6X 3BD8A 3EYWA 4OHVA 5F3DA 2HA7A 1LEHA 2ZAOA 4MTCA 4D0GA 2ON6A 3CLTD 5A6VA 1AB6A 3TW4A 9LDTA 4YDQA 4O4HF 1EIWA 1A9SA 2Q3MA 3RC2A 4M7OA 5E6RA 5DLEA 4P80A 3UAXA 4AYWA 4Q4HB 1PV2A 4MJLA 2EFYA 3LF2A 1AGRA 1ZNZA 4ANFA 1MW9X 4O4JA 1FVXA 2FTKE 2MHCA 3DYBA 4H16A 3C85A 4MV6A 4ZAXA 3M3DA 3VYUB 1X77A 1NJ2A 2QVYX 3GRRA 4BMYA 3F90A 1ODKA 3A1NA 4KQ6A 2FZVA 3GNSA 5KBYA 2QYTA 2RARA 2V1UA 4TMFA 1A4IA 1CK4A 1WZEA 3VC1A 2FZLA 3VU9B 2G63A 3F47A 3Q5DA 2FFRA 3G82C 4L2IB 2PNJA 1FOEB 1U3FA 1WP9A 4I8DA 3DHVA 3G13A 2AN5A 2VTDA 4AY3A 1JJBA 4U7TB 3D5TA 4NIMA 2HTFA 1YZYA 1EFVA 1U0RA 2VT3A 3MUNA 1AMNA 4H3SA 4P36A 2AR0A 3ISVA 1GUAA 2IGBA 5FL3A 2GB4A 3S8MA 1KNQA 4EVSA 4C2TA 1T13A 1WTCA 2WIGA 5IFLA 3PDWA 2X3FA 4G4JA 3IO3A 5ECYA 5CMLA 2BEWB 2ZR9A 4YRZA 4J90A 3DO5A 1P1RA 5AIAA 2FW0A 3SSNA 1JG6A 4I55F 4BHTA 1KI3A 2OMKA 3JVUA 1LSSA 1H2BA 4K6KA 3A37A 5CYOA 3S7ZA 3DBRA 4HI0E 1U8CB 1MAWA 4YQZA 2C83A 4ZVMA 5GMOA 4JP3A 5CA0F 2IYQA 1G20E 2ZWVA 5A4KA 2Y1KA 1USWA 4TV9A 5IC6A 3V4OA 4F56A 3H18A 3N2IA 3VZCA 4C4SA 9MHTA 1IQUA 4CLOA 1L5YA 2IK8A 2ZYIA 3K9BA 4WESA 1SHJA 5EJ5A 3LX5A 3OZDA 1L5WA 1REQB 2ENUA 2PGAA 2PJUA 3DEYX 2VO1A 5DEIA 3C1TA 2LR0A 4TXMA 1TF7A 1FRQA 1FYFA 2I55A 4Q3KA 4TVSA 4BASA 1Q0HA 2GPTA 4EBFA 3VU1A 1B23P 2OV6A 2RIRA 1TD9A 2HFJA 2WIAA 3GJSA 2VL7A 4NWIA 1JEQA 2FZ4A 4OXIA 3LL4A 3Q0TA 4A7PA 3FMOB 1IBMB 1DBQA 4EY8A 1Z2DA 1HO3A 2GN0A 4B6EA 1UZAA 1ZGZA 2OAP1 1XGKA 3HCBA 4G5QA 3IT1A 1AZWA 3F4LA 5I6DA 1UODA 3ZG6A 4G24A 3CLSD 3KZ1E 3RSFA 3DZKA 2WMNB 2GSDA 4WXPA 1RM4A 4RF3A 5C1IA 5BN4A 5JQGB 2R6ZA 4E03A 1PTJC 1VP9A 3E9YA 4QU8A 5KYVA 2FPGA 1DO2A 3ZQ6A 4BFZA 1KDPA 3QYPA 3VYSB 4F4CA 1A77A 2BUAA 1OLXA 1PR6A 2BJVA 4BDSA 2AYYA 2BGKA 1Y9AA 2A5JA 4I8XA 2AOVA 3G8AA 3ZGXA 9ABPA 5T3YA 1BQ4A 3D8HA 2OHGA 2GO7A 3G9XA 4MEJA 3WC4A 1YJQA 3BL5A 3L5KA 3PCTA 2ATVA 3GW8A 5DSTA 4I7EA 2G1UA 1E63A 3ZDXB 2QAGB 4YBZA 1ZKDA 2B69A 3MINB 3ZQUA 3UMYA 1K8QA 1KK0A 1U9ZA 4KIGA 3U3MA 3U0VA 6LDHA 4HUQA 5KNDD 1N1MA 4H60A 4OHRA 2OYCA 1KO7A 1MU0A 2X2EA 1TM1E 1ESZA 3COYA 2CDNA 4KI7A 1E98A 3THOA 5TPWB 3TB4A 3RYCB 1XCPA 1L5VA 3FCSB 4UFNA 2BMJA 5F4ZA 3UQYS 5E1BA 2Q5LA 1P0MA 1U7HA 2DJIA 3RHZA 4RKFA 3KWJA 3WRWA 1PKXA 2YINC 3ZYCA 3B3AA 1YQEA 4M9CA 4JOQA 1ZLYA 2XGGA 1FS4A 3D3JA 2O8BB 2Z8XA 4NFSA 2WTAA 1SA0B 2Q0SA 1JF8A 3BULA 1RLIA 2XUOA 4AKEA 4BCDA 3K32A 3TEFA 3A9RA 4QDJA 2EF1A 3KPJA 2A4MA 4RD1A 5ITSA 3CEMA 2B34A 5IZ4A 3OCWA 1WXWA 3NS7A 3OCCA 4FSXA 1MO5A 1UIMA 2AFRA 4L5JA 1M2GA 5CHYA 1DWQA 1FRZA 4J7XA 4HPJB 3WMXA 1UEJA 2XD4A 2XW6A 3F6BX 3KKZA 4OGGA 1PR2A 3BM5A 4W5QA 4ZU6X 4DLPA 1P1FA 3U3KA 3AF4A 3QF7A 1IULA 2Q4TA 3NKLA 1IOLA 3G5LA 4MLDA 5FLYA 1EDOA 1XKXA 5EXTA 2XXJA 4BKOA 2AOUA 3OHSX 2XRYA 4DIEA 2A5FA 4UU0A 1UAAA 2QZPA 4V0MA 3C5VA 4LYFA 2D2IA 1W36D 5F5NA 5A5EA 6REQA 4LV8B 4S2EA 5FTNA 4UHKA 2DUJA 4DBVO 4EL5A 1CLUA 1UAGA 4B2LA 4PSDA 2H5LA 4R8KA 2AK2A 2ETXA 2QGZA 2ID4A 3IAS1 3OPMA 4FOSA 3CRMA 1S3IA 5LMCA 1GRQA 1E8MA 3ONWA 4A6PA 2WM3A 4LJ8A 4MYSA 1PWEA 3T5DA 3UMRA 1I6WA 1AHNA 2JAUA 4YBRA 3G88A 5ADVA 5TARA 3HV2A 4ML3A 4C6TA 1V4BA 3B53X 3FGPA 3TZCA 1NE7A 4DOMA 3QEMA 3UICA 1YJAA 4LWOA 2OC9A 3HWWA 2NUAB 4KQEA 421PA 3ZWOA 1VJ1A 1DRUA 1P5JA 8MHTA 1VJDA 4D9CA 2Z08A 4WNAA 1YJ8A 4RKWA 3UPDA 2BKXA 3V2GA 4OI2A 1BX1A 3JQFC 4BQQA 5JZBA 1ONNA 3BYZA 4MGZR 2ZXFA 5IAGA 2O50A 5FWXB 3K6RA 1OTYA 4QUJA 3QWHA 5HBRA 4JI0B 5BR4A 1AN0A 2Q6IA 1T8WA 1Q7GA 3UT5A 4OQDA 3DOUA 5LOVF 1GHTA 1Z0DA 1X9HA 1YKSA 2X0DA 2Q3CA 4MNTA 3KCNA 2J48A 1QF6A 2BFAA 5ICMA 2JI4A 4ARBA 3MIZA 3HO8A 4REQB 1O5TA 5JRJA 1X7YB 5LZ7A 4QGHA 3QXCA 2VK2A 3DE2X 1Q1QA 4J7AA 3NDJA 4A8TA 4BB6A 1S89A 1N9GA 2YN2A 3O93A 4YCCA 3ADDA 1JFFA 1OKKD 1DB3A 4W7IA 2ODAA 2ZS8A 5ULLA 3WP1B 1II0A 3UXYA 3WXBA 2HADA 4DABA 2FI1A 4D74A 2PZLA 2V6GA 4ZYZA 1I3CA 3K8YA 2F8TA 1C8VB 5F76A 3QNWA 2EBUA 4KE6A 3OA0A 1KPGA 4YT8A 5FH9A 1EE1A 4HQ0A 1PFYA 2ZTHA 2WD7B 3WBFA 2WB4A 3GT7A 4IIUA 3U4DA 3K53A 1NN5A 3O8LA 1OAAA 4J0HA 5AI4A 3QA9A 1Z37A 2A1IA 2H3HA 4FWBA 3SXJA 1N33B 1UP7A 3FHCB 2YQ4A 4I50B 3L84A 4M8IA 3ZV6A 1U4NA 2C5HA 4K3UA 1FZQA 3AESA 3IIIA 1QZZA 2BI8A 3V1KA 1HLFA 2XEXA 5FPQA 1YQTA 5IAEA 1ZJ6A 3M70A 3T34A 4DDVA 3N2LA 3ZH2A 1Y9EA 2WE7A 5HEKA 2RGAA 1I6MA 2BGIA 1TRHA 1TM3E 3OE7D 3WGVA 4QGBA 1NXOA 2VH5R 4C88A 3S81A 4FIZA 3BD6A 4NI5A 4Z4CA 3IMFA 4NR0A 1K3TA 1E7MA 5KNDA 3M5DA 3NFRA 5CGZA 4LNUB 2Z1MA 1E18A 1UPTA 1EX6A 2XDAA 4XR4A 3RBXA 1FFEA 2X9LA 4K26A 3GP3A 3MTIA 1D3AA 4G1EB 2Q45A 4KL8S 1DBRA 3EK2A 3ITDA 3R23A 1E5DA 1ECCA 4YUYA 2PD3A 2R8YA 3OFND 4RZXA 1Z22A 2EX0A 4ZQIA 5KCMA 3WLHA 3NORA 2DSNA 2IY9A 3L5OA 1YRBA 2BMWA 2QRQA 3KT3A 3RTGA 1OXXK 3ACDA 4B3IA 1NI4A 5CCEA 1OT5A 4YJHA 4P93A 4KNWA 3AHGA 2PZMA 2QN9A 2GCOB 3IH5A 5BOSA 1YE5A 1E9AA 1PFKA 2SNIE 3EXEB 3I45A 3UAWA 5A4FS 2A5YB 3MJDA 1XZQA 3BWCA 4KB5A 5TGTA 1YGYA 4G9GA 2YV2A 3DBLA 4PFSA 2G0AA 5K0TA 2WSLA 3FW1A 4Y6RA 3BGSA 4IKPA 1MEOA 2YX1A 3S2YA 3KL4A 2JCGA 3UXHA 2FPSA 1DAIA 1YT5A 3C97A 1IAVA 3OCJA 2FR8A 4DLXA 1Q16A 2VSXA 1P4AA 3L40A 2VXOA 3Q6IA 3T7JA 4C4AA 2G4VA 3PPXA 5GQSA 4C5AA 3LHDA 2GHIA 4OJKA 1KVTA 1XTPA 3FSJX 3KLOA 2VAVA 2LRHA 3A1FA 3HK2A 2PJRA 1M76A 1PUIA 3RAFC 2H4XA 1D2NA 1FSFA 4RE5A 2F9MA 2WEKA 3JATB 2Q7DA 5EMJA 1MT3A 4DCSA 1GZUA 1TTPB 1XP8A 2HA3A 3NPMA 2ZYDA 4XEHA 3UWPA 5JBNA 1AKQA 1JLLB 2PU7A 2VJCA 2IY7A 1P0IA 3U13A 2XUKA 1U0EA 3SEQA 2HMAA 2C94A 2QXUA 1GNVA 2V9PA 1DV1A 3FUWA 4FMPA 1U4SA 4US0R 4CMCA 2Z4RA 1NR1A 3VGPA 1QTQA 1G4HA 2AYZA 1AK2A 3CNQS 2I80A 2V3WA 3D8SA 3L8HA 4JUIA 4OJTA 4PLZA 5LA6F 3REFA 3ZBUA 1J8QA 2PL9A 3PLRA 2QD5A 5TF0A 2C77A 2QQEA 3TZBA 2FG5A 4MXDA 5REQA 4IUDS 1Y3IA 4F8EA 4IW3B 1FLVA 2GRJA 4ZYXA 4HN9A 1JEJA 1WXXA 1JDTA 5C4GB 2GOYA 2O5CA 1TC1A 2HA2A 3JWPA 3KYIB 1M6HA 1WMBA 2GZ3A 5CTJA 5MFZA 3Q2KA 2LDXA 2ZDQA 1NTOA 2EBHX 2Q21A 4HB4A 2XCSB 1XZEA 4MQFA 1JIJA 3I2FA 4TSKA 3BE5A 2FSVA 4Y8VA 4NX2A 1KOFA 1ZKMA 4DMHA 4HAUA 5CFQA 2XYHA 4PY2A 4YI3A 1F51E 2C2ZA 2J7KA 3D8TA 3LW7A 4S1TA 2Z6VA 5C8XA 1RRCA 1GPAA 1AK9A 1NRXA 2GVNA 3HKDA 1OKKA 1E0SA 4N7JA 1VGRA 2YVUA 2C0CA 5JY1A 1YHZA 4KXXA 1HYEA 1PNTA 4ZV4A 3ACBA 5EKDA 3GFGA 2O7VA 4IMIB 3T7SA 2CF5A 2G77B 3DL0A 1K6XA 3PEUA 1ZH4A 5KNLA 1FJGB 1GUFA 2VA9A 4JK3A 2ZJFA 4IY1A 2PX6A 2RGXA 2WSSD 3TSYA 3INRA 1QG6A 3CLVA 3ANSA 3ESAA 1U1FA 4L9WA 4U02A 4D56A 2QZZA 3E2MA 4E08A 4ZK6A 5LP6B 3L1KA 5DZSA 4U7JA 4K46A 2XVYA 5C37A 2LWIA 3R75A 2YR0A 2PWAA 4ZEMA 3GOHA 1EG7A 2M6LA 1WXQA 4B3FX 4P4GA 4XWAA 1R10A 2EIHA 3ETLA 4AS2A 1AD2A 1T24A 4ZI3A 4AN4A 3I61A 3DWEX 1F06A 1TCCA 3OE7A 1U7OA 4WTOA 5DP1A 4D4IA 3V46A 1F1BA 2KM1A 2WF5A 2HCTA 4MRPA 3IVGA 4RF5A 5J63A 3RS0A 1N8TA 3OHPA 1K08A 4GPBA 3GLRA 2V96A 1E6CA 2Y05A 3A1EA 3OC0A 5HQ3A 4PGGA 3PE3A 4LX8A 5ALOA 3U3JA 4G1CA 1CD5A 4RHCA 2IU0A 4MUXA 3RRNA 4DV4B 1YF3A 3HZRA 4PWYA 5D3KA 4X84A 1IY1A 4YO8A 3OFNA 4D4MA 4L8VA 1QH8A 1J00A 1CY6A 3IOEA 3TLEA 3I3OA 1W93A 4B4VA 2F2TA 1RHQA 1ZC4A 3QBVA 4FFMA 2ZWAA 2RB4A 1YR7A 1IEVA 2QS9A 4OHMA 3UAVA 3ZTWA 3BF8A 4GW3A 2Y68A 4RDCA 3S2EA 4AD8A 3GFBA 4B40A 5TF4A 1KC3A 1RJFA 2O19A 1HURA 2OB2A 1TMGE 1V8FA 4A91A 4D8VA 1M1ZA 1BN7A 1U4OA 2PSFA 2OP1A 1T6XA 1ZD5A 2JVJA 3D3EA 1E2JA 4X6YA 3SP1A 3KKOA 2WPNA 1E4EA 1VYHA 3H5WA 1UINA 1YB7A 2FEXA 4KXFB 1NZJA 2CEKA 4IXWA 4JT9A 3SIPA 3EDQA 4E14A 1L8QA 3K0BA 4WVLA 3QSYA 1H4VB 4F3KA 3UKDA 4QE3A 4M7WA 5I48A 3I01A 1JTEA 4BVHA 4M0DA 4DJDC 3QKIA 3KFXA 3P9CA 4MAMA 1U0FA 2EX4A 1Y7PA 5AKEA 5EWJB 3VC3A 4HMOA 2WHEA 2X1HA 4EFKA 4OFBA 2OYRA 1TKAA 2AQKA 4MCAA 4ZGBA 1XPRA 3X1JA 1LWNA 4P92A 3BIXA 1QU3A 1F2DA 3B3FA 5D5PA 2VYFA 4AZ0A 3FIUA 3ROTA 2I2AA 1JSCA 2FRDA 3HVIA 4M2LA 4NCKA 4PFJA 4RAQA 4BV3A 3PTAA 6CHYA 4L28A 4NENA 5BR8B 1NOKA 4YPVA 4C0HA 5HTOA 3S3TA 4XQ0A 5TT1A 3IO5A 3SEAA 5CCBA 1Z47A 3MGGA 5DTJA 1V37A 1NG9A 1LPOA 3BILA 2WE8A 1QCDA 2PPLA 4MWBA 2XUHA 4CKCA 5KOIA 3KXKA 4GICA 5AHOA 1JI3A 1VE9A 2K7ZA 3GUVA 2WY2D 3TR6A 4GOMD 3EXG1 4FXOA 4WBNB 5JARA 2C82A 5AHRA 4EKEA 3IDOA 3NP9A 5HF9A 3ZN2A 4LSWA 4DV1B 1ZEMA 3QLUA 4IRMA 4B4OA 1HDCA 3H17A 4C22A 4FKZA 1DLJA 5BW8A 2PSJA 1YRQA 2IXTA 4B32A 3RJMA 4ENPA 1FSPA 1YS1X 1R6XA 2ZT7A 1ODTC 2XQJA 1O9BA 3DFKA 4IX1A 4JASB 4LHZA 1A9XA 4UBLA 1PWZA 4LJ5A 1K7YA 4TVBA 5EE0A 2NU8A 4AF8A 1JPVA 5K2OA 1EINA 1P0CA 3IRUA 1UDWA 1RABA 1X80B 3MGCA 2O4CA 4X8MA 2J08A 1UZMA 5IBCA 2NO7A 1U8EA 1PRYA 1KEEB 3GWZA 3KQKA 4QHYA 2PGIA 4QBFA 2DPGA 2R85A 4XYEA 4TTJA 4OJQA 3R7BA 3C5HA 2JIDA 5JSFA 2WSSA 5KOYA 1P4HA 5BVHA 1XZFA 3ZWMA 4PC3A 4ID3A 2QENA 2QLMA 3GQBB 2GDZA 2PKRA 3L0DA 1VPVA 5HP4A 3O3NB 1Q1ZA 3N8HA 3W2FA 2GNAA 2HHCA 4JSYA 4KGVA 5D87A 3I1YA 5DT2A 1PG2A 1XQWA 3CUEF 3NHKA 1JKJB 1NJGA 1C2YA 1PZGA 2FWNA 2YZKA 2NTEA 4QYIB 4ZZ2A 5WRFA 1YS4A 4HF7A 2OFPA 3C39A 3EAFA 3FRJA 4LG1A 1BX3A 3IVXA 3R0QA 3GCWA 1OC2A 3FPGA 2UYGA 1Z26A 3I3SR 4MKZA 3UAGA 3VR3A 4IUCS 5F98A 3JALA 1RYFA 1M2JA 5JIBA 5H4HA 2XXBA 3CC8A 5KDDA 5FYQA 4AG6A 4QX6A 1ISJA 2O8FA 1M83A 4W4TA 1G38A 2VJYA 3PNKA 2MYUA 2JBAA 4BO4A 1I7QB 3D7MA 3EAGA 3LYAA 5AOCA 5FBZA 5A3SA 3ZCRA 1ESMA 1AHIA 5E6UB 4G0MA 2OY0A 4DR1B 2GCPA 4QOGA 3AQIA 1XDSA 3O83A 1RLMA 4W8GA 2I3AA 2NM0A 3HKEA 3OX2A 4WE3A 5D3MA 5PNTA 1Q17A 4AP6A 4BB9A 3R0IA 1MR3F 3NVMB 4RIEA 3QTTA 3RIHA 3RJTA 3ZLUA 1OV6A 3ENWA 3OTGA 3LQ2A 5CLIA 2P6RA 3WL8A 1Z25A 4L8FA 1ZS9A 1TF5A 3CZ4A 4Y2TA 5FX2A 4M8SA 5CW1A 1JKFA 1OV4A 3UFXA 5NULA 2PTGA 1KSGA 5BP7A 4H77A 1W88A 1SELA 2HK7A 2XE7A 4YJ3F 5A9SB 2QD1A 4LDPA 4QFCA 2XY4A 2I2WA 4OUDB 4DTCA 4ND2A 3E1SA 3HR4A 3GLGA 1J90A 2JEZA 2WSYB 5B53A 4CIYA 3WRVA 1IY2A 2JRLA 4JWKA 4B47A 1U8FO 2P4QA 3DCYA 4YUWA 3NAZA 4TKZA 5FBHA 2O0HA 3BFKA 4IJMA 4NJOA 1B3BA 1V5FA 2YASA 2HH9A 1OSNA 5AICA 2PYDA 3TQRA 1M5TA 4BNZA 1FFYA 4RH3A 4RVUA 2CSXA 4BZPA 4MUGA 4QDTA 4GX0A 3TD9A 4EX6A 4DQVA 4CV3A 1CE8A 3BJMA 2MMCA 3I58A 3IPAA 4KXNA 4B2YA 3ND6A 4ZDJA 1FFXB 1USGA 1PTJA 4KRFA 4HDSA 4MKRA 4X00A 3K71B 1KMIY 4RK0A 1ISPA 3U1TA 3P32A 1CY1A 3DDNA 3THYA 3QXGA 2HF8A 2C5GA 1ANKA 2ONKA 2CVZA 3N2YA 3NC0C 4MV5A 4XX0B 5CDSA 7YASA 1F1JA 4N7RA 1PW7A 1PL8A 2V7WA 1FP6A 3NKFA 1SGWA 1QP4A 1XXHE 2X0JA 4ZMRA 1C29B 4FWTA 3F7OA 1SOWA 1YB2A 2QD2A 3LUHA 1T91A 3WYGA 2GK7A 2JKZA 1ZIDA 1BNCA 1U80A 1W73A 1X42A 2ZJ1A 2XQFA 1PF7E 4HXFB 4RLQA 4X6UA 5ALIA 1Z7WA 4NPAA 4ZT3A 4A5SA 4Z7QB 1WSAA 1FNSA 3M3PA 1MHPA 1II8A 4DEYA 3QX3A 2BEVB 4OU4A 1Z0KA 2N42A 3EXIB 5TB5A 4FHCA 4NZMA 1E6LA 4PGFA 2HYIC 1E4OA 3EEIA 2CBXA 5A9TA 2G82A 2BL4A 2PUWA 3IEUA 2DEUA 3MJVA 2FQWA 3RFTA 1VMIA 5DJ5A 1L5ZA 4BMPB 1QYWA 3I0NA 4DMFA 5JROA 1QVZA 3EPKA 1NMZA 5DCUA 1Z5WA 1K7XB 5CA1A 1N0WA 4DIMA 4PYIA 1XEAA 3DL4A 3LCRA 1KF0A 5HS6A 5EKSA 4XUEA 3TINA 3H75A 2CXPA 3NHAA 4F2WA 4DJAA 2HJSA 5B1DA 5EERA 4XVUA 1XL0A 1B1AA 3N58A 2WU0A 4BNYA 3GLHA 3H9QA 3N74A 3QNUA 4ZVTA 4FW8A 4YT5A 5AHXA 1KOLA 1S7CA 4D3ZA 3GGPA 3PR2B 4X1OA 3QKRB 1SC6A 2OZLA 1Z29A 2VDUE 3JYNA 3WISA 1USKA 2EAUA 3SLGA 3K15A 3L0CA 4EHHA 4H1TA 3MMNA 2BBTA 1IBRA 1KYQA 3H1EA 2BFBB 3FA2A 4P33A 4HG2A 4P22A 5EJIA 3K1AA 4CV1A 1JEEA 4D9KA 1EFPA 1Q21A 1URPA 2GLUA 2GASA 3F67A 1SUBA 2J67A 2PJZA 3N59A 2V0CA 2WAOA 1W25A 4JNKA 5DOVA 5JWHA 3ROKA 1X8KA 1EKXA 2ET6A 4HHEA 4MGHA 4R3UC 1M67A 1E2EA 3HFGA 2W22A 1Q22A 3HJBA 4UQLA 3R5FA 3SY8A 3VHLB 1HRDA 1OWMA 1WUKS 5D51S 4BNNA 2ST1A 3GGDA 1OBHA 3D8NA 4RJLA 2RI6A 1JHUA 3MRVA 4LWQA 1ENZA 2ZI3A 1GQRA 4FHEA 1C9EA 3RCBA 5JJLA 3PXCX 1NWHA 5EZYA 3NWBA 3QW2A 1GZDA 3DLPX 1MJFA 4WASA 2H29A 3DDUA 4AY4A 2FQQA 4WCFB 4F11A 3DLTA 3PXEA 3D6FA 1OU0A 2VQDA 2VF8A 2JEOA 1BVRA 3KQTA 3MTGA 3Q7EA 3IKMB 3JQFA 5AKXA 4CLDA 2A67A 3FOAA 3NDIA 4M1EA 5K8CA 3FUVA 2E1PA 1HT3A 3NDBB 1E3LA 2ZYUX 3GK3A 1KEUA 5HKLA 2H2IA 1UBUS 2M1XA 2XMGA 4Y2UA 5LBIA 4J3NA 1PP4A 3A10A 4RV9A 4BUJA 1MG5A 2ZIUB 2CLEB 1F6WA 3KWFA 4MTLA 5B7GA 4WXRA 1QVRA 1QP8A 4G5XA 4ZMSA 1CUHA 3QG1A 4BBJA 1S8NA 5DW3A 5TMBA 1BEZA 5AT1A 3U7JA 1GR0A 2OBNA 1UKVY 1NKTA 3LT1A 4B81A 1I7NA 5DVZA 3OQOA 2RHJA 4NESA 4EUFA 1Q3KA 4WA7A 3H1GA 4GPIB 5C8YA 2R7LA 2VPWA 1UM9A 3EGVA 3L9XA 3NTXA 1JPUA 4UZEA 3WLIA 4LHEA 4RSHA 1EXMA 4OJNA 3VZQA 2C9DA 2Q0XA 4Y6QA 2A94A 3W5CA 4N40A 2IYRA 3R77A 1GSHA 2HY7A 2NU7B 1XD9A 4FYYA 2OGUA 1E5QA 3IBYA 4RABA 5FV7A 2B25A 1IZZA 1SC9A 2FUEA 2X0KA 4CMEC 2JVKA 2Z8YA 1NY5A 3JAKA 4YAGA 2CNBA 1SQ6A 1W5EA 5DWVA 2J6HA 3T3MB 2DFTA 1YDFA 3CUKA 2DBZA 2HBYA 2B8WA 1A82A 4HNHA 4EUEA 2VEOA 1EVKA 1ZITA 1GKIA 2ZSJA 2BFNA 1T2VA 2C07A 1TLFA 2VP5A 3EZNA 4TQAA 3Q8MA 3HDHA 2P8JA 1T29A 4HX2A 2WAYA 3NU1A 4EG5A 4LZJA 4ER5A 2DH5A 3F46A 2P9CA 2G08A 5ALRA 4YY3B 1LA2A 3R5JA 3K5HA 5TC4A 2JASA 4WZBB 2KJQA 4B48A 2BSQA 1VHLA 1IXZA 3PKJA 4DBLE 3FCOA 4L74A 1MFZA 1RYDA 3OX3A 3CA8A 4YAEA 3OPYI 4KDEA 5GONA 5GGXA 1IATA 2OXCA 1K7CA 3QV1A 2FPMA 4ER3A 5CEJA 2X5JO 3EZ2A 3SI7A 5FPTA 2V4UA 1NONA 3RODA 1NXTA 3H6HA 3F3SA 2GZHA 2HDNB 2P5UA 2YZMA 3A06A 5AW8A 3OT5A 1N36B 4H3HB 4P8RA 3KZKA 4C4XA 2VZ8A 3KVYA 3TBKA 4OGKA 2FWBA 2REOA 3HACA 4LWZA 4PXAA 3AOGA 4CV2A 3QPAA 5EP4A 1G21B 2E4WA 2NO0A 3HR8A 1DU4A 3LU1A 4P7FA 3ADPA 2AK3A 2HCFA 3DC7A 3WL6A 2XKAA 5AUQA 2IPMA 1DIAA 5IJ9B 1XXLA 5DTRA 4N39A 3VR6D 2V59A 4AU1A 4B1FA 1YFZA 3LWBA 1CYDA 2CVOA 4LPSA 1QS0A 1TQDA 3NFYA 4H2DA 4FMDF 2RFLA 3JR3A 4XIJA 4XA8A 4NS1A 2OOSA 5PGMA 2VG8A 1BFUA 2B7BA 4LQDA 1CQWA 1SXIA 3WFIA 4GPZA 1W5TA 1MQ9A 2LZ0A 2P4EA 4BKQA 1P1JA 4DMMA 3FSGA 3JD1A 1P74A 4DLZA 2CXTA 4M9SA 1R5OA 5J2TB 1A7KA 3JD3A 1YDHA 3EBPA 4R9RA 3VPAA 4E88A 4QIHA 3MM4A 2ZJ7A 1RKXA 2WYVA 4I6EA 4P4UA 1QIFA 4P7GA 1J2EA 4PXSA 2H4ZA 3RFCA 1SQSA 4QG7A 2C0PA 3TQFA 5L53A 2A8YA 2B7LA 4OI0A 1Q57A 5A5VA 4M38A 2DETA 4IO0A 4QWWA 4MSUA 3AHEA 4JJ4A 3HBJA 1N6KA 3L1UA 4Z4IA 1Y98A 4DPLA 4AMYA 2QYOA 3ABQB 2V5VA 1NN0A 4PSCA 3BDIA 1EXDA 1EVZA 4UFPA 4Y9SA 2DPMA 1XA4A 2IU6A 3QBTA 3UWDA 3I1JA 4RWEA 4MIKA 1GRCA 2NSDA 1GEEA 5B55A 3MJCA 3GCDA 1XLVA 2H63A 5FWNA 5KTNA 5M34A 1GNPA 3SYRA 3PRJA 4R16A 1S9DA 4LZWA 3KR9A 3P0FA 2V03A 5LUBA 3V7WA 2VP4A 1ZXBA 2J9RA 4P82A 1YU6A 4FGWA 1P8AA 4XQGA 5AH0A 1R00A 3REQB 1U5BB 2IUFA 3PCXA 5LP6C 1JYEA 1Q0ZA 1TCAA 4CKEA 4N3GA 2UVDA 2BFEB 3U80A 3LLCA 2XMSA 5JG7A 3WJ7A 4D8WA 2FUKA 3N8DA 3INNA 5DMHA 1PKEA 1PR9A 4BPBA 3MJ4A 3PXBA 4L51A 1SUEA 1RBQA 1RRKA 4DLSA 5GOTA 3WGGA 4JL8A 1ZGGA 3JAWA 1SXGA 2RGYA 1UBKS 1TB4A 3BL6A 3GPCA 4XW2A 3BIJA 2V7TA 4BMNA 4E1AA 5LDDC 2R8PA 2ZVDA 3IHLA 4GOKA 4XCVA 5CDYA 3OLYA 1FDUA 3G2JA 4FIDA 4IGFA 4O5AA 5LU8A 2BCJQ 4D25A 5FTLA 3QU5A 3VNAA 4GWLA 2BRUC 5EMKA 3G17A 2JFOA 1VFPA 3LBNA 2FLWA 4A0FA 4K0KB 1QVAA 4ZJZA 1XMPA 4WX2B 1K97A 3LP8A 3OQMA 3OD1A 4QQ8A 2C59A 2D3TA 3BMCB 1J2TA 2H54A 3GLQA 1HEUA 2QLLA 1EGMB 3NP7A 1RYHA 3EXFA 4ZPJA 4RADA 4FSHA 2G5TA 4W8OA 2BTQA 4DMCA 4WJLA 1B8UA 1KU6A 3OEED 1Q20A 1WL8A 4QT0A 3USCS 4ALJA 1UJ5A 1XRNA 4FJ2A 4L6IA 4P5DA 4C7JA 1D8TA 4DPMA 5CB4B 3SIXA 1DX9A 1MOQA 1T8RA 1V4VA 2CDRA 1YZKA 2OHXA 2Q5QA 2QIOA 2R6HA 4HAIA 4J94A 1H85A 4UASA 3T0FA 3ZLVA 4F6RA 5AIBA 1LQUA 3BWMA 1P5FA 1QF9A 4JN6B 4A3SA 5JFOA 1BCSA 2FZWA 3QOYA 3ZWPA 1P1CA 1VMEA 3G9ZA 4Z53A 1EVEA 2QRVA 2VF5X 4IQFA 4ITVA 5C7YA 4JLPA 4MX8A 2G9RA 3HDQA 3PITA 5D00A 3WA6A 3NTOA 3WB1A 2OILA 3LD9A 5DX8A 5BWMA 2JFGA 2XAUA 1WULS 2ODTX 1PR0A 1D1TA 2QVLA 1RRFA 3PF9A 4HB2A 5FR2A 1EK5A 2SKCA 1HZZC 4NBUA 4BO5A 1SUPA 4MV0A 4HNGA 1UFOA 2OG1A 2V5AA 3ZJ5A 1MH9A 2I9PA 1XFAA 3ZS8A 1L4MA 4NZ9A 3VR6A 1NT2A 2NUPB 5ENDA 2NN3C 1Z0IA 1U31A 1UKBA 3UN1A 1JDPA 1VIYA 4YV0A 1T26A 2GK3A 3GGCA 1RFLA 3JU3A 4LF4B 1Y6ZA 4QNRA 4UHCA 1H4QA 1XB2A 5FB3A 3T94A 1W87A 4LJ9A 2J0VA 1OY1A 4QUBA 3C1AA 2Q4EA 1FUYB 4S1OA 2JKYA 3JSXA 3O8DA 1MH1A 2WW8A 3PSHA 5D6OA 1GDHA 3A32A 4U2GA 3MWKA 4F3CA 1SCAA 1UMDA 4EB0A 3G9QA 4URHA 2IITA 3DKKA 2FE1A 4ZO9A 4BYMA 4YEDA 1OWPA 3JASB 4ODIA 2OK7A 2WT4A 4XSVA 5DYYA 4L76A 1R0SA 3KE9A 3P1JA 4OGFA 3C6KA 5CJPA 1CNFA 5F4BA 3UATA 3VTAA 2BPOA 3BWBA 2IBMA 1PWYE 2EC5A 3DL2A 3FLMA 4L3OA 4PFKA 1Y3DE 4DG5A 4YCLA 3RFVA 2LPMA 2ZREA 5EIFA 4TS4A 3PJGA 1HTTA 2P7IA 1DT5A 3ON5A 4BNUA 3RT7A 1WCIB 2ZRQA 3I0ZA 4HBGA 1U11A 1ZICA 2F3UA 2F48A 3C0KA 4N3AA 3V34A 3DDHA 4YPOA 4F92B 2WYUA 1C9NA 1Y1TA 1NQWA 3KC2A 3LYHA 3I0MA 3R1IA 1UT5A 4LGMA 4MA5A 4YH1A 3A1SA 3GEDA 1TZCA 2EKDA 2GYWA 2P8SA 4Q4HA 2I65A 4BKUA 3OZTA 4WHMA 3C7KA 1A27A 2F55A 2D1YA 3ASUA 5IMSA 2FA9A 3AY6A 4BNFA 3Q8LA 1TTTA 4NMWA 2B4QA 2JFYA 2R25B 1FMLA 3O5AA 4JV5B 4YRFA 3DZJA 3FNFA 2WTEA 1PQYA 1IAQA 3E9QA 1KMHB 3RSQA 1WMEA 2QV0A 5C52B 1QDLB 4DL9A 2UV8A 3VU9A 1NUAA 4L2IA 4Z4FA 3QI7A 3KKMA 5K0FA 4NYIR 4UEOA 2X76A 4AW9A 1H1TA 1HYBA 3HP4A 1B6TA 3QE2A 4ALKA 5JBQA 2WTUA 4IVQA 3MQFA 2OZKA 1GKYA 1H42A 4U2EA 4ZD6A 3ZVKA 1EVLA 1MA0A 4G36A 5ALJA 4A27A 4PG8A 3LX6A 5KQPA 3FBTA 1MG0A 4PVDA 3A6KA 3GFTA 1GRRA 1RYBA 2XMCA 2GPWA 3JWEA 4TTVA 5C5EA 2ZM6B 2Y0CA 2D1FA 4G01B 1F6BA 5K8JB 3SZLA 3C45A 3QXHA 4MRMB 3L8YA 2ALJA 2FG6C 3HN2A 3WNVA 4NQRA 1SRQA 1Z2OX 3W77A 5IAOA 1A95A 2G06A 2NVBA 3MCUA 3K0EA 4LX0A 3OEEA 5C8VA 3B8EA 3LUPA 3OPNA 5EZQA 4DQDA 1A5BB 5CLFA 1E2KA 2Z8YM 3K0FA 5I7EA 1YA4A 4P31A 4MINA 1E96A 5FNVB 4LFAB 4FBGA 2X2FA 3WL3A 4CM9D 2QTBA 4FOPA 1GTMA 2FN9A 3NT2A 4RHTA 4CUZA 3GQVA 1TM2A 2WJVA 2FSGA 2WJ4A 3GC6A 2H9IA 3JTMA 1JE0A 2CW5A 4IDHA 2CFOA 1REQA 2E82A 2FQ1A 3NM5A 4C7MA 1R0KA 2EKQA 1LPAB 3NHMA 4RULA 2C7GA