2F1RA

Crystal structure of molybdopterin-guanine biosynthesis protein b (mobb)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
148
Chain Sequence
b'LILSIVGTSDSGKTTLITRMMPILRERGLRVAVVKRKDSWKIYNSGADVVIASPVKLAFIRRVSEEEGNDLDWIYERYLSDYDLVITEGFSKAGKDRIVVVKKPEEVEHFRQGRILAVVCDERVDGHKWFRRDEVERIAEFILSLLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords molybdopterin-guanine dinucleotide biosynthesis protein B (m
publication title Crystal structure of molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
rcsb
source organism Archaeoglobus fulgidus
molecule tags Biosynthetic protein
total genus 47
structure length 148
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03205 MobB Molybdopterin guanine dinucleotide synthesis protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f1rA00
1FPMA 1DAGA 4M0LA 4B75A 5BXQC 2FZLA 2F43B 2F6RA 4I1SA 3VQTA 4DT1B 1E2DA 5J5CA 3LQQA 4DDWA 1G9XA 5JCPA 4N1AA 2QMUA 2GEDA 4UJ5A 5DN6A 1NLYA 2WWHA 3ADKA 3FTQA 4TQ9A 4US1R 1QG2A 1VKJA 2OESA 3WRYC 1O3YA 2HCBA 4LI0A 4DLXA 1US8A 5C4GB 3ZGXA 5SZJA 5J47A 2QM8A 3GJ3A 3G5UA 2Z4SA 2CHVA 4TL6A 4P3YA 5KDLA 4KITB 3GEIA 1GAJA 4JVLA 3DM9B 3DZ8A 1EGAA 1XWIA 4ZCMA 4DSUA 3VKHA 1Z22A 3B85A 4OK6A 2IYWA 2C99A 1SULA 4IOJA 5EQTA 2C5LA 1L8QA 1SVIA 1E99A 4IDOA 3IGFA 1NVWQ 1ESNA 2EYQA 2NO0A 3FWYA 3DZDA 3HU1A 1P3JA 3RABA 3RS7A 3MJRA 1HTWA 5B30A 1NVXQ 3P20A 3WHKA 4UXJA 1P6XA 4B3DA 1YZTA 1R10A 1NJFA 5FTJA 4LCBA 1G5TA 1T0JB 5SZIA 1G16A 1DAEA 4UNSA 4CVNA 4URVR 1H65A 1VHTA 2CCJA 2ORWA 2XTNA 421PA 4LJ9A 4RD2A 2G9NA 3R9WA 2QSYA 4C4PA 1EG7A 1FMLA 3SYNA 1XP8A 4I1OA 5TY0A 2AK3A 4H9GA 3OIWA 1BYIA 1UPTA 4B48A 1JEDA 4BASA 2O8CA 4B44A 1ZVQA 4X8LA 1Z63A 2NZ8A 3K8YA 2YYZA 4KBFA 5AJZA 4BFYA 1GKUB 4U7DA 1M74A 1Q22A 5ELXA 1HH4A 3IPYA 4WXPA 4QM6A 3X1XA 4XWAA 3CRMA 1ZNWA 1YZKA 1ZM9A 1KJWA 3ZJYA 1XMIA 1OJLA 2JA1A 1D2EA 1RE0A 2NO6A 1A2BA 1KK1A 1NKSA 1W4AA 4V0KA 4PC3A 1FTNA 4ABYA 2BJWA 5GJBA 1MH1A 2A30A 2J46A 1GRNA 2QAJA 2FN4A 3KJIA 4JLDA 1P2UA 1SVSA 2IS1A 4EPYA 3LXRA 4PC1A 1CR4A 4XH9B 5FOXA 4ZI3A 2BOVA 1CJMA 4PQYA 1GKYA 5IHPA 1NMZA 4KJZA 2ZRJA 1AIPA 1F2UB 4Q4LA 4TLAA 4ZDWA 5J4HA 1BO6A 4EFLA 3PVSA 3LBHA 1GZSA 1G64A 1XTRA 2R6FA 1VG0B 5CJPA 2QSZA 2AXPA 4PQRA 3GLHA 3ND9A 1XEFA 4IW3B 2W2VA 2WZQA 1AS3A 5JEDA 4LJYA 3V9PA 1XEWX 2QGZA 1RW4A 3C5CA 1HE8B 1P4SA 5AWFC 1E9CA 1KDRA 1LFDB 4E07A 1WRBA 4FMDF 2PT7A 1NF3A 3UG6A 5GVRA 1QRAA 3VAAA 4BLQA 4CEHB 3M4YA 2DR3A 3OIUA 4LZZA 3WYFA 3OEEA 3PEUA 4PHGA 1W36C 2A5GA 2ZYUX 3FMPB 1UJ2A 4IDQA 2F1IA 2REOA 4G5GA 4IOKA 4RSGA 3X1WA 3Q85A 2CCKA 2DCUA 4C9BA 1XD9A 4EPRA 4OHYA 3KTAB 1MO3A 3QVVA 4MKHA 3ZZTA 2WOJA 1FX0B 2AK2A 4ESHA 3AVWA 3FGNA 4O2RA 4R2HA 2VSOA 2ZROA 5CLLA 2ZJYA 2GK6A 2BV3A 3SFVA 4MRSA 2GWHA 3V4FA 4QM7A 4B33A 4MRRA 5DI3A 1D9XA 1XTIA 4TLDA 1KO1A 3FPAA 3RANA 3AB3A 1D2MA 4Z8XA 2FFBA 3PIRA 1YU9A 2MSEB 2PZFA 2W0MA 4FD2A 4QGFA 1P2VA 4B3XA 2KWIA 5F98A 5JJLA 4ZKDA 2CLCX 3K9HA 5BW8A 3GLIA 2RB4A 3K70C 4QJ4A 3IIJA 3FHTA 3GLGB 4ZIRB 2NPFA 2J87A 4RD3A 1XPUA 1MKYA 2NO7A 3MWJA 1EWRA 2HXSA 4XD7A 1R5NA 1Z6YA 4EPWA 2V1UA 3I5YA 4LBVA 2F55A 2F9LA 1BMFD 5JWHA 4P4TA 1G3RA 1QF9A 1LF0A 1CR0A 3C8UA 3PUVA 3PEVA 2QT0A 1KK3A 1NY5A 3TMKA 2QM7A 4OHWA 1HURA 5FOTA 1W5TA 3W6NA 2JLYA 2XNDA 3QPWA 1IHUA 2XZOA 3NKVA 5DGXA 1E6CA 1ODFA 1GM5A 2F3RA 5B64A 1U8YA 2CHGA 2H17A 2PX3A 1OXSC 1ZU4A 3K0FA 5KTYA 4A0HA 1RRFA 4M1MA 5FBQB 4MKFA 1Q44A 1AS2A 2NMVA 1U9IC 1A7JA 1NVVR 2IEYA 4PZYA 4LYHA 1CLUA 3BH6A 4XVUA 5DSZA 3NDPA 1S3GA 4NE2A 3MD0A 3KDSE 4F92B 2CXXA 4OK5A 4U02A 2PMDA 2WSSD 3MWLA 4S2EA 5HZHA 3QENA 2WWFA 4TMVA 4JBXA 1HA3A 5FPSA 3VU9A 3HYTA 2AWNA 5G3ZA 3SU8A 3QPUA 4DXAA 1WBDA 2ZREA 3L0OA 2HEIA 3P4XA 4Q1FA 2D3WA 1E4YA 2IX3A 2ZIAA 2QPAA 1U98A 2GXUA 2EFEB 3OF5A 1XU4A 5KSPA 5LDDC 1US8B 2YWGA 1KI6A 3KX2A 4EFMA 4XWKA 1UFQA 1XPOA 5KUTA 4KXFB 1AZTA 3DVLA 1H8ED 3MSXA 2ODNA 2KBFA 2JJ8A 2ZANA 4WW0A 1GWNA 5TV2A 2ZS8A 5DO9A 5TMPA 2EU8A 1EX6A 3QKRA 5H70A 4YMWA 1P9WA 2HCJB 5JHGB 3UMRA 4AYWA 4WVFA 1BMFA 1KI7A 1G8GA 3QQ5A 4WIAA 3L8YA 2ZSFA 4GSYA 2JLQA 4G3XA 4CT4B 4XWOA 2QE7D 1MO5A 2PLFA 4Q4JA 4NCNA 4XVRA 3WNDA 3U3KA 5E4FA 3Q9LA 4Q1EA 2YOFA 4HAXA 3BIFA 1Y63A 4DKXA 2ZI9A 4PX9A 4RCYA 4QGGA 3UWOA 4D25A 2AKYA 4NYIR 4RKFA 1CJVC 2P6UA 1XBTA 1E9FA 3B6EA 3CO5A 2OXRA 2WWIA 2ONJA 2ZYWX 3LBIA 3REFA 2MMCA 1G19A 4TLBA 3ZIAD 1OXXK 1R0XA 4D2IA 1VYTA 3CNOA 4G5SA 4YDSA 2NTYC 4JIMA 4GT1A 1U0LA 2O8CB 4F91B 2WWYA 2GRJA 1UKZA 3SYKA 1WXQA 5H1YA 1CJTC 2E9SA 3ADBA 2CK3A 3S1AA 3PQCA 2HYDA 4R2IA 3NH6A 1S3SA 1OKKD 1XMJA 2G1KA 1DVRA 1OT3A 3QXHA 1G1MA 5LB2A 3W3ZB 3TUZC 4KSBA 2C96A 2FOLA 3KUCA 3RWOA 4Q7KA 3ZVMA 1AS0A 1GNRA 1NY6A 3L0PA 3DO6A 2X19A 1O87A 1VPLA 4L15A 1T4GA 4FI3C 1PV4A 1WQ1R 2OE2A 1BYUA 4I1UA 3VNUA 3DEFA 1P9RA 1LF5A 3QG1A 4GOKA 1IBRA 3EPKA 1LY1A 2HJGA 2LCFA 2FG5A 3T1OA 2Z0MA 2BBTA 2OAQ1 4V0OA 3C41J 5DI9A 5TDHA 4N0DA 4LHVA 4FWTA 1XTSA 1ESMA 1T5IA 4HYYA 1OV4A 4P4UA 1JPJA 4QHTA 3U7FB 1ZUNB 2XZPA 1GNPA 3NXSA 5DYIA 3GLHB 2D2EA 2DHRA 1B23P 1JXOA 2QMHA 1QHNA 1W36D 1Q20A 3K53A 1E79D 3ONWA 2QAGC 5FTMA 5TVKA 3CM0A 4M9XA 2FFQA 4IEIA 2C9OA 4TQUS 3GJ4A 1KMQA 1MO6A 3LY5A 3V4RA 4XTRA 4RFVA 4M22A 2JDID 3LD9A 4A1FA 5JBQA 1G5RA 4JVSB 3PUXA 2WAXA 1DO2A 4M9ZA 3RSOA 3BFXA 3AEZA 2IS4A 3RWMB 3ZZUA 4Q48A 5CJ2A 1XNJA 2BBOA 1G291 3OZXA 3U5ZB 3I1FA 3WY9A 1XX6A 2UVQA 2AL7A 2GCOA 1OKKA 4GRAA 1AN0A 3RDPA 221PA 1GRQA 2P3SA 4TMZA 4A2WA 5FBWB 3C7KA 5B2ZA 2Z4RA 1KAOA 1KK0A 2OFOA 5E7IA 4B43A 1MRNA 2GTPA 3QEOA 4N0EA 3U44A 2V8OA 1C4OA 3K70D 2JEOA 1WBBA 3SQWA 1CEEA 4TL7A 4RD1A 2ZM5A 3EWSA 4WOPA 2IWHA 1R6BX 4TMWA 4AWXA 4B73A 3VX3A 1KO7A 3CF6R 4Q7LA 4TT3D 3RHFA 3RS5A 3M1IA 3PV0A 4L4UA 2JAQA 4NYJQ 2ZETA 2ZRFA 2VSXA 3FFBA 3QE0A 4OQXA 4HB3A 4U5XA 2ZJ2A 1A4RA 3UWKA 4Q66C 5LPNA 2HF8A 3K0CA 1DEKA 4GP6A 1ZM4A 3Q5EA 4L8GA 2K5UA 2W83A 4QHSA 4TYQA 1R4AA 5FUYA 2WM9B 2JLWA 1SVWA 4POAA 4BPBA 3F8TA 3Q7PA 1GP2A 2A5JA 2D4HA 3QXCA 2RGXA 2OSBA 1ZMXA 1ZNYA 4W5WA 3AVXA 2QENA 2CNWD 2JDIA 1Q3HA 4ZDIA 3TNFA 2TMKA 1N5KA 2CL7X 3B13B 3IHWA 4GZLA 4TYPA 5IK2A 1CS4C 2A7QA 3LVQE 1FUKA 1OH7A 1NN5A 2OBNA 5KSYA 3CRQA 3NBYC 2WICA 1G6OA 4PHFA 5C2JB 2ZRMA 3TSWA 2CE2X 1T3SA 5JMTA 2NZJA 4K8OA 3OEHD 3P32A 1D8TA 4NDZA 1Q1EA 3K0FB 2ASEA 1XPRA 1NJGA 4AIIA 2RHDA 4W5HA 4TTQA 1ZW6A 2V54A 2GBLA 2J7PD 2BC9A 4LHWA 5EXTA 1EXMA 3NVAA 5EUQB 2WJIA 4Y0AA 4C0QC 4P0TA 2I1QA 2BKUA 4LYAA 2Q0HA 2O8BB 2BMJA 3VNVA 1FNMA 4M1SA 3ZQJA 4LSGA 4B2PA 3RNLA 4FN5A 1KSGA 3VU9B 4KVAA 1N6KA 2IXEA 1COWA 1HQYE 5LD2C 1YZLA 1G7CA 4TT3A 3AF2A 2RHMA 4LK2A 5FTLA 1YE8A 4D4JA 3M0EA 5FOWA 1KI6B 2IBMA 4A8JC 1PUIA 2ERXA 1C1YA 1G8FA 3O8BA 3SNHA 1SKYE 1OPXA 1OXTA 1HE1C 2AD5A 4NZYA 1E2MA 2A9KA 3D7MA 4RD0A 1KO8A 2RGNA 3IO3A 3QKRB 4MGYR 1J90A 1W4RA 4C30A 2BCGY 1GIAA 2GK7A 4Q5IA 2GHIA 4B6FA 1W0JD 4EJSA 3EPLA 1ZCAA 1NSTA 3N5CA 4R98A 4Y0VA 4M1OA 5FI0B 2IHBA 1U9IA 3EZ9A 4TL8A 5AJYA 2ZI3A 3AKYA 5BWMA 4Q4JB 2OLKA 2IF2A 2ZUBA 4FCTA 3VR6A 4I99A 3OEHA 5BQ5A 4DLSA 1OB5A 1YR9A 4CEHA 5JLJA 2SHKA 1PZNA 5KHOC 1FZQA 3Q7QA 2CHQA 2VA8A 4QC2A 2AN9A 1KI1A 2J7PA 2GDJA 1DTSA 5FUXA 4ASUD 3ZVNA 3U61B 4JBYA 1U99A 2H57A 3UKDA 1WE2A 2ZVQX 5P21A 5FOVA 4RZUA 1G8HA 1U8ZA 2UZ3A 2UKDA 2Q6TA 1WCV1 1YQTA 4NTZA 4QRHA 1FW6A 3EIHA 3HWSA 4NYMQ 4C2TA 3D3QA 1VIAA 3LDAA 2QT1A 4GP7A 1ELOA 5CIQA 3S1AB 2PLRA 1KTVA 4MUBA 4HAZA 1SKQA 2QMEA 2GETA 2NIPA 4ON9A 1TMKA 1ZIPA 1E9RA 4XOIA 1EFCA 3CF0A 5DYGA 2IL1A 4Q9LA 3DMNA 4IXNA 2HXYA 4OYHA 4PQFA 3WBKA 1DO0A 2C78A 1XJCA 4MKGA 5JWRA 4JZKA 4B34A 2ZXUA 4QOSA 1OIVA 4ZCLA 1Q1QA 1QBKC 1XZQA 3BBPA 4MRPA 4F93B 2G83A 2ZJZA 5JECA 2V4ZA 2X1VA 4KU4A 2GJ8A 4ZIRA 2ZRHA 3P1JA 1GRRA 3DDCA 1XTKA 1IOZA 4DLTA 2X77A 4TMXA 4JBWA 3ADCA 2V6IA 1MR3F 1M6NA 5LBIA 4GOJA 4B2LA 1KKLA 2EFGA 2I4IA 5CITA 4A2PA 2QA5A 1TQ4A 1KY3A 2GILA 3C16C 1DAMA 1E2JA 1UBFA 4Q1DA 2YINC 4CEIA 4ASUA 3L82B 4JLMA 2YWFA 4LPSA 2WJGA 2J3EA 4II7A 3VR3A 3RC3A 1TQ6A 3PENA 5JI3E 4OQLA 1W1WA 2AWOA 3HP1A 5F9HA 3Q5DA 3ETLA 4OJKA 1RRPA 1SXJC 2O8EA 4C0LA 4NBSA 4DB2A 4B3CA 2BM1A 3I8SA 3CZQA 1OHHD 2CEAA 3P4YA 2R65A 2N42A 3K09C 4Q9IA 4DZZA 1F60A 1DOAA 4AKEA 2GCOB 3SR0A 4HB4A 3TRFA 4NCHA 5UKDA 2FA9A 4R71A 3E1SA 4G0NA 4BFVA 4ACBA 4E09A 2BEJA 2VP6A 4DDUA 2ZPTX 1IAQA 2J45A 3NDBB 1M7HA 2JJ1D 2AFIE 1Z0AA 4PHTA 2DY1A 4OQNA 1KMHA 3U44B 5FBRB 2ZR9A 3KB2A 5JS7A 4P32A 1Q0UA 1NLZA 2FEOA 2ZQ5A 1CU1A 1YKSA 3GPLA 2JJ2D 2VYFA 4AYTA 5JI2E 2YJTD 4G5OA 1IXZA 1S8FA 1ZC4A 4X8OA 4ESVA 1UF9A 5FBLB 1GL7A 2J5XA 4LGMA 3BORA 3U2QA 1LTQA 2WAYA 3CKLA 5TARA 4URYR 2CL0X 3KJGA 4ZO4A 4ACAA 4B3GA 1G18A 3ASZA 3IIKA 1E1RA 1G4AE 4LC0A 5CLQA 3U6BA 2JIZD 4GPTA 4MA4A 1OFIA 2AR7A 3FMFA 2Q21A 3DKPA 5EE3A 3CPHA 3RAPR 3EW9A 4KAXA 2C9YA 5FL7A 2VHCA 1GKIA 2PZGA 2OLJA 1N6IA 3AF1A 4JLOA 2RMKA 4M1YA 5DE3A 3X1ZA 3EPJA 2EFHB 2H18A 4DIDA 3GJ5A 3LBNA 1T8TA 2O8FA 4HAYA 4TQAA 1JALA 5HCIA 2D74A 2V7QD 1LS6A 1R8SA 3TKLA 3IQXA 2EYUA 3W6OA 3SYLA 3FMIA 3VR5A 3RS2A 1ZAKA 2QL6A 3CRW1 2GJAA 3KQHA 4XSHA 4L9WA 2ZJ8A 1NSFA 1P72A 2OCYC 1JQJC 2V6JA 3T61A 5CYOA 2JJ1A 1DAFA 1ZIOA 2V9PA 4NKRA 4XIGS 2A5DA 1Z2AA 3ZD6A 2OXCA 3QOFA 4HAVA 3AUYA 3PXGA 5KDOA 3SJCA 2ODBA 1E2EA 1N6HA 3QKUA 3K70B 5C1BA 1D9ZA 4YMTA 3LAWA 3T15A 1AKYA 2YVUA 4LHZA 2RGDA 4Z51A 4RFSB 4WZBE 3TSZA 4F7WA 4I81A 4LJ7A 4JSYA 4IXMA 1DE0A 5CIWA 2ZI7A 1KI4A 3GJ7A 4IVPA 4URWR 4M1KA 5EXPA 1VECA 2GZDA 2GNOA 2HF9A 2GVZC 4K46A 1E4VA 3RRMA 3WP1B 1AK2A 4MGIR 3SDZA 1U8AA 4JL5A 3K1JA 1X1SA 2JIZA 1K5DA 2CLDX 4NH0A 2ZJBA 1JAHA 1KJZA 3MFYA 4QBHA 3A1VA 4WBSA 2ERYA 3T12A 4EJSB 2IEZA 1E9BA 3K9NA 5AUNB 5JEEA 2V55B 2RGEA 1FQJA 3QKSA 3THYA 4B76A 1JNYA 2ZVPX 3R7WB 2R44A 3EASA 2Z5FA 5A4JA 1XXHB 2RGAA 1IN6A 2V7QA 4BLRA 4UQOA 3A37A 4HI0E 3ASYA 4ZI2A 1YRBA 4JVNA 5CK5A 1E1QD 1QDEA 2OT3B 4XVQA 2KB0A 4YLGA 1TPZA 1IN5A 5B57C 3SOPA 1OIWA 5J4VA 5CK4A 2B8WA 2GXSA 3BFVA 4MYTA 2CVFA 4A82A 1RYHA 4KHZA 3EZFA 2GF0A 1KZGB 4JYBA 4LJ5A 4MQBA 4RZXA 4Z54A 3EXAA 2A5FA 2HUPA 3GJXC 1JJ7A 4B3BA 2H92A 1TQ2A 4B35A 3HU3A 1YVDA 3WMFA 3BS4A 2OHFA 3T5DA 1SGWA 3U7GA 1XXHE 3EPHA 2BBWA 4DBLC 5EE1A 3PJRA 4F4IA 1T6NA 3FE2A 2P65A 3B9QA 4IVQA 1X86B 3CUEF 4IEEA 3H0KA 4PZLA 1E94E 3BAFA 2C04A 3WYAA 1M1YE 1SHKA 1E2FA 4Q9HA 3LV8A 1JR3E 4F4JA 3LNCA 2KBEA 3SZRA 3IHLA 2HLDD 3I72A 2EWWA 1KI8A 2E1RA 2IYTA 3AGPA 4JT2A 3RS0A 3TSOA 4C0SA 1NG9A 1L7VC 3TW8B 4JMPA 2GEUA 4GL2A 1ZU5A 3UPUA 1NLFA 1U81A 2ZU6A 4PO9A 2X8AA 3ZYCA 1E0KA 1VG8A 3T06B 2FV8A 2Y8EA 3QG5A 4DEXA 1NIJA 4LC1A 1SZPA 1WDTA 4IJMA 4DSNA 1KI9A 621PA 2O8DA 1EFUA 4IVRA 1D6JA 1E1QA 3N2EA 2QTVB 3G0HA 1E2GA 4QG7A 3FKQA 4BFZA 4C0JA 4LJAA 1DAHA 4RD4A 4DSTA 2REXB 2MSCB 4TZ6A 5AJWA 4CEIB 1UEJA 1NRJB 3KQKA 4ITRC 1J8YF 2QQ0A 2F1RA 1RRCA 1NKTA 4PPGA 5KNDA 4J0QA 5D3QA 1G5PA 4UXIA 3W5JA 1FOEB 2W58A 5CDFE 1FFHA 3AP3A 1IXSB 2O8EB 3NEYA 2ATXA 3B1ZA 1UDWA 2RCNA 1YR7A 4M2LA 4R9UC 5HCNA 3AVQA 1S1MA 2O8BA 2ZI4A 2D7DA 4BLTA 4LX0A 2OBLA 3CX6A 4JYCA 5IDVA 1MRSA 1QHHA 2QPOA 2RGGA 1LB1B 4AC9A 2VP2A 2ZR7A 3BH7A 5L8VA 4IFBA 1G3UA 4FW9A 1AKEA 1BS1A 3BC1A 3IBYA 5JCZA 4WZAE 4L9SA 3KXLA 1KMHB 4NU0A 4BE7B 1N3BA 2FZ4A 2DFNA 5SZHB 3K9LA 1VTKA 3QPVA 5IRCD 3EX7C 5DISB 1GTVA 4PAMA 2OILA 1QHXA 4HAUA 5EUMA 5DNYB 3CNNA 3TQCA 2G1JA 1U90A 2JLVA 1Z0FA 2IC5A 2IYVA 5E3HA 2FGKA 2R6DA 3EG5A 4US0R 2G6BA 121PA 4BUJA 2WKQA 1M34E 3TK1A 1GNQA 1OB2A 3GFTA 2PEZA 3IILA 2FX3A 5EE0A 1P5ZB 3TLXA 3O47A 5C18A 5A5GA 5FTKA 4LJ8A 2R9VA 5FFMA 2VQSA 3OAAD 5C4MA 3QNUA 4NYJR 1Y3AA 4JKIA 4M1TA 2QP9X 1IN8A 2F7SA 1BH2A 4OI1A 3QBTA 4DIEA 3R9IA 1CKEA 5HKKD 3HDTA 2GJ9A 2QEQA 2CL6X 3R9XA 2RAPA 3B2EA 2GZHA 3O8DA 2O8FB 2LKDA 3C15C 4M1WA 5J40A 3I62A 3ICQB 1EWQA 3HPRA 2PX0A 2WMNB 5E7MA 4D82A 1R2QA 1Z47A 4LYFA 4Q7MB 1P62B 2BKEA 4QGHA 1G6HA 2WSSA 4D4LA 2OAP1 3BB4A 5BYJA 2G0NA 3C4JA 3BB1A 2IYXA 3MWKA 1XD8A 2HJVA 3GJ6A 4JLPA 4BRUA 1CP2A 3DMDA 1NN0A 1PUJA 4BFWA 1NP6A 2FPMA 4AKIA 1PLLA 2BM0A 5FR1A 5SZKB 3SHFA 1S9DA 1VYUA 1WMSA 4TYYA 4MDFA 1JAIA 3TE6A 3KQNA 1H8EA 2AD1A 2V3CC 1Z0JA 1NL3A 1AGRA 4D0LB 4QNMA 3NC0C 1M8PA 2IHYA 1T5LA 2DB3A 2ZU0C 2E87A 1T8UA 3WNBA 4C0HA 4TYWA 4QKQA 4V03A 1Z06A 3B1XA 1VHLA 1W4CA 2A2ZA 1KSFX 4D6PA 3H84A 2QUZA 2FFAA 2J59A 4IKEA 2YC2C 1A1VA 2QE7A 4QXAA 1CJKC 5EP2A 3OAAA 2F3TA 2VEDA 5HPYB 1XTJA 5L3SA 1OW3B 4DLZA 2IYZA 3VKWA 4HUQA 1E2HA 1VCNA 3NG1A 4EQ6A 3QVUA 2GF9A 3PCRB 5HKKA 2P5TB 3VHLB 3QKSB 3THYB 2ZYVX 4AK9A 3AVPA 1W48A 2HDNB 2WJJA 4UNPA 3A4NA 3NBXX 3KZ1E 1TTTA 2GKSA 2CJWA 3ZIAA 5IT5A 1ZD1A 4PANA 1Z08A 1QHSA 2BDTA 3GCGA 3W5IA 2HV8A 3ZDQA 3GJ0A 1E3MA 2C77A 2Q3FA 1Z3IX 4C0KA 4B32A 1ZNZA 1IQPA 3NIBA 4M4SA 1G7RA 1R7RA 1X3SA 4D0NA 1UM8A 3LW8A 2DPXA 3LLMA 3MJHA 4KYIB 2Z83A 5G41A 3ZQ6A 1OH8A 5EE9A 2BVNA 3B9PA 2VF7A 4N3NA 5HE8A 2OG2A 1DAKA 4E22A 1X8LA 4FMBB 1TNDA 2IYUA 4IHQA 2IT1A 2O52A 1E9SA 1T9HA 3EWAA 5TXGA 1BIFA 2FSIA 1E2IA 2CCGA 2IW3A 3KJHA 3QJYA 3SS8A 5AK0A 1IN4A 5K8LA 1RJ9A 2QP3A 5FH9A 4RZ3A 1E2LA 3B1VA 3MAAC 3D31A 1EK0A 5KSOA 5E7JA 2AX4A 1KDPA 5KOYA 3RC8A 2FJUA 3CR7A 5GVSA 1X6VA 4M9QA 4BEBA 2W6JD 3WNCA 4NHOA 1QZXA 2BBSA 3TAUA 2G77B 4HZUB 3QUSA 3X2SA 3W8RA 3EA0A 1DG3A 1T91A 4EPVA 2ANBA 5FI1B 2PZEA 2O0JA 1IN7A 3SC3A 4HDQB 2WIAA 2I3BA 2WV9A 1Z83A 4MITA 3KXIA 3UK6A 4DVGA 1E79A 3VR4A 3KQUA 3SJAA 2VH5R 5KNBA 3MG9A 4EUNA 3TUJC 1X1RA 2AKAB 4IRUB 2P67A 4D4MA 5TB5A 4Q21A 1G20E 1KGDA 2PL3A 4QL3A 3MGCA 2IUUA 2O8DB 4JL8A 4NONA 2XXAA 2H1LA 3CRVA 3SE0A 2JLXA 1Z07A 5J4KA 4KCGA 2J9RA 1P75A 1JI0A 4KFSA 5GJVC 2BMDA 3IO5A 4OKSA 1BOFA 2X2FA 4MYHA 2D62A 1FP7A 4FMCB 4AY2A 4E03A 2FSGA 1I2MA 1SKYB 1TF2A 4Q03A 5FPTA 2PH1A 2J0VA 1YZUA 1KYIA 3C14C 1ZBDA 3E5HA 1JR3D 4P33A 4PO1A 5JRZA 2ZRCA 3EIEA 4BECA 3AM1A 3AVVA 3W3AA 2IXFA 3I61A 4PFSA 4DLWA 4EIWA 1M7BA 2FF7A 2CMKA 2OCAA 3T5GA 4A0GA 2GXAA 1SVKA 1QHHB 3EZ6A 4NP6A 2YNMA 3BOSA 3VFDA 1VG9B 1G8YA 2JLSA 3OE7D 4OQMA 5F9FA 2ZEJA 3QI2A 2OUKA 4IOMA 1W2GA 4RFSA 4AYXA 2FPKA 5JSZA 2ZSAA 4BEJA 821PA 2W6JA 1CR1A 2FSHA 3KKMA 1K6MA 2GJKA 4K81B 2C2HA 1JQLB 3BWDD 1XF9A 2VLIA 5BN4A 3ICEA 4EFNA 4TZ0A 4M53A 3BE4A 1AGPA 2IS6A 2REBA 2XX3A 3KJEA 3BH0A 1XJQA 3DOFA 3VR2A 3A36A 1N5LA 1EFHA 4QBIA 1S9HA 2VP0A 4R7ZA 1G4UR 1GFIA 1PLKA 4MGKR 4OI2A 5EP4A 4BQSA 4ARZA 1HV8A 1TEXA 1ZC3A 3AUXA 4Z1MD 2Q9AA 3CPJB 3KFVA 4DCSA 2CNWA 1WA5A 3A58B 1GOTA 4Q4AB 2OO7A 1G3IA 1KI3A 4FCWA 4WAUA 5K8IA 2ZAMA 1RZ3A 4MKIA 4A9AA 2A78A 4HDCA 3KUDA 3R7WA 5CB6A 3ZS9A 1XXHA 3HU2A 3AGQA 5HR5A 2OCPA 1FNNA 2QN6A 5JWOA 4A36A 4KLZA 1YR8A 4Q1AA 4UNQA 4XJXA 1U2RA 6Q21A 2QBYA 1YJ5A 4W9MC 1UADA 5FBVB 3UANA 4W5JA 4RCZA 1FQKA 1JR3A 2VF8A 1S2MA 1ZP6A 3E70C 3ZH9B 5K8UA 1A5TA 2XSZD 2RKOA 3DPUA 3U3MA 1UEIA 3NBFA 1C9KA 1Q57A 3SFZA 2IXGA 1GL6A 4OI0A 1NN1A 4KV9A 4JL6A 5HE9A 1OF1A 1SXJE 2A3RA 3W90A 2ZSBA 5F3WB 2X2EA 4RZ2A 2JLUA 4DUGD 1I4LD 1KK2A 2O5VA 2VO1A 5FTNA 1WF3A 5EJEA 2EFCB 1J7KA 4IDNA 3QF4A 1P2TA 1ZD9A 5G40A 4TMTA 4LDJA 4HLUC 3RVBA 3QSYA 4LPKA 4PC7A 1N25A 3GMTA 3HPQA 2NOAA 1Z6TA 2VHJA 1ZUIA 1KO5A 3LWNA 4EPXA 4XSGA 3L43A 5GJWC 4DC9A 1HUQA 1OH5A 2WSMA 4ILEA 5CM8B 1W0JA 2ZS7A 5CDFA 4BLSA 4Z1MA 4YDHB 5AJVB 3EAQA 2RH5A 4Q1BA 2Z43A 2H5EA 4YMVA 3PEYA 2QU8A 2DYKA 1W47A 1MO4A 1DS6A 1ZCBA 4LBWA 2J0UB 3IDQA 5FUVA 2NO1A 3F3YA 4URZR 1U0JA 5DN6D 5L3SB 1S4QA 5L3RA 4WA7A 3LO5A 4HUQB 5AUOB 5KDDA 1GVNB 4EQ6B 2J0SA 1CRQA 2CVHA 1X8JA 2WJVA 1VDZA 4X8MA 4UKDA 2O0KA 2R8RA 3B5JA 2YC4C 2BWJA 1XB2A 1TF5A 3CNLA 2ZE5A 3VR1A 3WHLA 2VIIA 5H8WA 1E0AA 2CJWB 2BMFA 2F1HA 3GQBA 2IA5A 3MCAA 1TAGA 1OYWA 4DEYA 2ODWA 3IEUA 2WJYA 2P6RA 4PC2A 4EPTA 2RGCA 5G53C 5J4LA 2F9MA 3EZ7A 3SQXA 1KDOA 2DWQA 4AG5A 2EQBA 3BJIC 1P73A 1TUEA 1AZSC 2VHQA 2VPPA 3PFIA 4NL4H 2WKPA 4Z8YA 4OL0A 3ZVRA 5KPJA 3UATA 2YV5A 3GEHA 4Q02A 1FP6A 1XCGB 2C03A 1FUUA 3FHCB 5L3QA 1UKEA 4TTPA 1E9EA 1T0HB 3RRNA 1SVOA 2FE4A 2WJHA 1E0SA 1OXUA 1RFLA 3U3OA 2JLZA 1T3LA 5DH9A 1RJ9B 1ZJ6A 1XFAA 3HR7A 3Q3JB 1HY3A 2L0XA 3LXXA 4F38A 2QAGA 4US2R 5D3MB 2ZSEA 1WP9A 1ZNXA 4YXWD 3UMFA 3QXXA 4LHXA 5AJXA 1Z5ZA 2G88A 2HT6A 2QY9A 4CDGA 3VMFA 3QXSA 1J70A 4LUCA 4QBFA 4L5BA 4TWZA 4YONB 1JB1A 3PITA 5BN3A 3K0AB 2OV2A 4FMCF 3SN6A 4MYCA 2NPIA 1W36B 3QEJA 4Q47A 5JZVA 3AP2A 2ZRBA 4JLKA 1QVRA 2XTZA 4OQFA 4PSKA 3LA6A 2ZJAA 4Q00A 3RS3A 3H1TA 1F2TA 3GFOA 4HUTA 3GLFA 1I4TD 5JJKA 3PUWA 3FKSD 2XXAB 5JFGA 1ZRHA 3RYTC 2WPDD 3CZPA 3RSLA 3A6PC 3BERA 4LBZA 3AF4A 1CXZA 3BK7A 4WXRA 4PTLA 2QTHA 3U60B 1OHHA 2IUTA 2ANCA 3DOEA 1T3HA 3IBGA 1Z0IA 2GCNA 3ZS8A 4S35A 4OHVA 3QF7A 4DHEA 1F6BA 1KSJA 1W49A 3FVQA 4KLNA 1V43A 2XJ9A 3D6TB 4Q4HA 1SQ5A 3C5HA 1CIPA 1CJUC 2BJVA 3H2YA 2W2XA 4PAQA 4Q1CA 5FL3A 1Q1BA 2O0HA 1KOFA 4TN1A 5B58C 2B21A 2VRWA 4HB2A 2ZS9A 3KL4A 1JPNA 3AVYA 5HZKA 1IJFA 2W00A 1HQCA 1KNXA 3VKGA 3CWQA 1XEXA 4O2LA 5M04A 2GCPA 1TUIA 3O8CA 4DB4A 3KB1A 4LHYA 3T1QA 2JJ2A 1TL7C 1R0ZA 1G7TA 4YXWA 4AD8A 1Z6XA 1G8PA 5JSZB 5KPDA 1XD2A 3R8FA 2QRNA 3FDIA 4PXAA 3OEED 2QTFA 4LJ4A 4MH0R 1Z8FA 4O0MA 4B74A 4C2UA 1ZINA 4FCVA 3TVDA 2EVWX 3PEWA 3TUIC 2ZJ5A 3CRRA 4YC7A 4ARZB 1OFUX 2VHUA 3CPEA 2PMKA 3CR8A 2IF0A 3FYHA 5DIFA 1RIFA 3DL0A 1S1CA 5AR1A 2GVDC 3JVVA 3FKSA 4DWJA 1I4DD 2WPDA 2DFTA 1N6RA 3LQRA 4OHZA 2ONKA 3M6AA 5JRJA 4JLVA 3NTUA 4PPFA 3T1VA 1E2PA 5DLQC 1N6PA 3CF2A 3U4QA 3NHBA 2QBYB 4WZ6A 4E5UA 1PJRA 2XNSA 1ZM3A 1P2SA 2D2FA 3NHAA 3X1DA 2KJQA 1VMAA 4A0FA 1W2HA 3TQFA 2CBZA 2R6AA 1E2NA 5A0FA 2PJZA 2FGJA 3BXZA 1J2JA 4A8JA 4AG6A 4DCUA 4P4SB 2FNAA 2XAUA 4OK3A 4XD7D 1II8A 1IXRC 2OM2A 2FH5B 2W6ID 1DELA 4JLAA 4V0MA 3TR0A 4HDOB 1VCIA 1VCOA 4JSTA 1Q12A 3LFUA 2P6NA 4DCTA 1CULC 2CE7A 3IPXA 3SI7A 3W9YA 3K0CC 3OIVA 4JKYA 3JVUA 4QGAA 5ANRB 3W34A 3QF4B 2XGJA 4Q9KA 4CW7A 1QVAA 2XNDD 1OFTA 1IY2A 3AP1A 3ECCA 3REGA 1UAAA 2KE5A 1UKVY 4AURA 4H1VA 3RRYA 3SHWA 5BN5A 2IS2A 3L0SA 3HJNA 4IFEA 4B2IA 2IYLD 2G0TA 2NO9A 3G82C 5J4YA 1ANKA 4GMXA 3VHXA 4YQFA 3VTKA 4HZUA 3FOZA 1NMXA 4O3MA 3ZVLA 2J7KA 3CH5A 5HTKA 3RRZA 2IK8A 4B47A 1U0HC 2GA8A 3DHWC 2QPTA 5GJCA 1G17A 1XDBA 5AUQA 4QFMA 4QHYA 3CLVA 2IUSA 2VP5A 3TBKA 2YOGA 1OLOA 2GBLC 3R8CA 4MDEA 4BFTA 1MV5A 1SXJD 2XITA 3LH5A 4Q01A 4BZXA 2UZIR 4KO8A 3RS4A 4V02A 3OFND 3PUYA 1Z0KA 1HYQA 1ZD8A 3U7HB 2ATVA 1AM4D 5EP3A 4EAQA 3WYGA 2QZ4A 2BIFA 1L4UA 2YZ2A 4F4CA 1NMYA 4BFXA 2C95A 4L16A 4HLUA 2AFHE 4ZCIA 1Q3TA 1UKYA 5KU1A 1R0WA 2W6IA 5EXXA 4LRWA 2B7BA 4OHXA 2ZR0A 4HATA 1H8HD 1TU4A 3A1WA 2CLSA 1QHYA 3QKTA 3CX7A 1NBME 4ERNA 1JR6A 3Q72A 1L4YA 4HZIA 2VSFA 1N6OA 2G3YA 4FIDA 1P9NA 5KNCA 1PVOA 1XZPA 3I3SR 2RGNC 2YKGA 3QBVA 4KI0A 2C8VA 4NCJA 3LVRE 2LWIA 2IYYA 2Q9BA 1XTQA 3THOA 1XMVA 5L3QB 2XB2A 3KFXA 3TVTA 3SJZA 4KFTA 1RC8A 1EFTA 4GFDA 4EJSC 4M9SA 4Q7JB 4UJ3A 1A2KC 3WBJA 3KKPA 1G3QA 3GLGE 3TGPA 2HLDA 2FWRA 1LW7A 2VP4A 2D7CA 3F5FA 4LJ6A 4DLRA 5LB4A 2QAGB 3V00A 2WKRA 5KSZA 4C7OB 1II0A 4QNRA 3TW4A 1KJYA 1CBUA 4ZDJA 2FU5C 4M21A 3N2IA 1DAIA 1AJEA 2ODEA 4LY6A 3FMOB 2CK3D 3BRWD 4BRWA 1JXMA 3NH9A 1N6LA 4NPHA 3LW7A 4DCVA 2JGNA 1II9A 3AKEA 2VL7A 3K9GA 4KFRA 4YMSA 2DWPA 4Q4AA 1GILA 3SBDA 1SXJA 1W5SA 3UIEA 1WB9A 1E96A 1NG1A 1E69A 4O25A 4KFUA 4BLPA 2Q3MA 2KI5A 3K09A 3OFNA 4LBYA 1A82A 3ZD7A 3A1UA 3BGWA 3W6PA 2PT5A 2EW1A 3GLFB 1F2TB 2F1JA 2QNRA 4IDPA 3MUFA 1NI3A 2R6GA 5GADl 4KBGA 1PLJA 3WMEA 3KKOA 2H7VA 2IYQA 1XCPA 1NNEA 3WMGA 2VBCA 2Z6VA 1H8HA 2B7CA 1MABA 1RKBA 2YOHA 4FINA 1R5OA 1K8RA 1IM2A 2WWWA 4HAWA 4I1VA 4FXPA 3N70A 4LV6A 2IWRA 4BLOA 4CYMA 1GITA 3U6KA 3OHMA 4Q4HB 4KYUA 4CZ2A 3TIFA 1UBGA 1KHTA 4DSOA 8OHMA 4TSFD 3AV0B 3A4MA 5FR2A 1Q1ZA 4W7SA 2ZTSA 4BWYA 1KAGA 4A0RA 1W46A 3ADDA 1E32A 1I2DA 3JZAA 4CEJA 2BHRA 4KSCA 2ORVA 2QQEA 1XEXB 4M8NE 1G3MA 2B6HA 3GLFE 3KXKA 2PCJA 1N0WA 3NC1C 1DARA 1EFRD 5FOUA 3R20A 1VIYA 1AQYA 2OCBA 1AQUA 1E0JA 1XD2B 3X1YA 4B71A 1W0KD 4P31A 4H1UA 4PHHA 1IJEA 3SJBA 4OJQA 4C0AC 1RYFA 2ZRGA 5CYPA 2LKCA 3CONA 2DBYA 1SVMA 3TAHA 2JASA 2AXNA 2NG1A 5JHHB 3T34A 4D81A 1XJ0A 2I1VB 2J0UA 1D5CA 1E9DA 5G3YA 2DWOA 3CBQA 3CH4B 3KQLA 1ZYUA 4JLNA 4A15A 3MWYW 4MRNA 4DLVA 3B1YA 1CTQA 4QJ5A 1QHIA 2PCLA 4UXHA 3A1TA 4LOAA 4B6EA 4EKDA 5FOSA 3T1TA 3IQWA 4HLCA 1J8MF 3ZLJA 3PUZA 3IIMA 1RRGA 4ZDKA 4BZPA 4ZKEA 1KY2A 1YZQA 3THXA 3U4QB 2DFLA 1AA9A 2ECKA 4Q9JA 3BB3A 1TU3A 3I92A 1DPFA 1YZNA 2ZRLA 5KYKA 4OI4A 2QORA 5LD2B 4PAOA 1E98A 2NGRA 3AVOA 4G1UC 4NCKA 3DKVA 1ONBA 1KZ7B 2RGBA 3DM5A 2J1LA 2FEMA 3EZ2A 4TSFA 3THWA 4A8JB 2ORIA 1XRJA 1D2NA 3SBEA 1II8B 3HYRA 1NVVQ 1YZGA 4D80A 2OZEA 1P7CA 1CRPA 3F0TA 3LLUA 5IF9A 5L3VA 2B92A 3OESA 2W0SA 1EFRA 3I32A 1CR2A 1YRAA 1E2KA 2D06A 4GMDA 2XOKD 2Q3HA 4FWIB 4G5QA 3BD9A 1XCMA 1OH6A 1RVDA 1F48A 3Q8XB 4HLDA 2GAOA 5IK2D 3CX8A 2QI9C 3GJ8A 1L2TA 1W0KA 4JVMA 4D0GA 5K8TA 3L2OB 1TADA 3EARA 3K0SA 3B7GA 1F3OA 2J0QA 4TLEA 1NN3A 1SVLA 3QY0A 4JS0A 2B8TA 2N1BA 4NYMR 4PZZA 5D3MA 3O8RA 1CF4A 5EP1A 3EC2A 1IONA 3LX8A 2F43A 2JATA 1EESA 1N0UA 3GLHE 1GDDA 3NEJA 4DT1A 2NQ2C 4A92A 1JJVA 3I5XA 3EA5A 1JBKA 2WVJA 2FSFA 2BMEA 2ZUCA 4TTRA 2P0EA 1EX7A 1G41A 3K0AA 2ZE6A 4Q18A 1N5JA 4RKEA 2QGNA 1KIMA 3I4LA 4V0ME 5FUWA 2WTUA 2HT1A 3AVTA 4XTCS 3GD7A 4HLQB 1GL9B 2OFXA 4I4LA 5C46F 4RD6A 3MLEA 2HYIC 5DI3B 1KSHA 4JT4A 1R8QA 1COWD 2W2TA 4JJZA 1YHNA 721PA 4LV8B 2FDCA 3AF3A 2P5SA 4PO8A 3L8ZA 3P27A 2WMOB 3D8BA 5FPKA 1Z28A 4JLBA 1HT1E 3T35A 1MOZA 4RVCA 2ZUDA 1KI2A 3I73A 4NYIQ 1V5WA 4MUAA 3IUYA 1W44A 3BFKA 2QP4A 4PSVA 1BKDR 3FFAA 1TEVA 1W4BA 2WHXA 4TMKA 2ZRIA 2ZI5A 1LV7A 4PC6A 2QMOA 1P60A 1FMJA 1IY0A 2XOKA 4BFUA 3OIYA 1RPZA 2EFDB 4DLYA 1GSIA 3MMPA 4U00A 1X8KA 2N46A 1B0UA 4NCIA 3FB4A 2ZRPA 2FMXA 1ZM2A 3A4LA 2YHSA 4GNKA 4HEJA 3AH8A 1DBSA 4DLUA 5FPHA 1W7AA 3KKNA 5EZ6B 1HEIA 3AQ4A 4A2QA 2FPLA 1IY1A 2Q9CA 3GLIE 4V0NA 3GP8A 1VCMA 2VP9A 4URUR 3CB4A 4BGDA 2YWEA 2YWHA 2XTMA 4AI6A 4PR0A 1OIXA 2CDNA 2P2LA 1FTSA 4BFSA 5EZ5A 2WBLC 2MSDB 4HB0A 1R0YA 3AKDA 2BCJQ 3L0IB 5DHAA 4AKGA 1P61B 4YMUA 3AF0A 2XB4A 4V0LA 3TJZA 2ZE7A 4JJKA 3B78A 2C98A 1OYYA 3ND8A 1JECA 2GESA 4G5RA 2ZE8A 3H86A 4PPNA 2ZSDA 4GDFA 3U7EB 3IEVA 1SXJB 2XZLA 2ZRDA 4ZPXA 2VHTA 4MGZR 1NBMD 1S0UA 1DADA 3K0EA 5EE5B 3B8HA 4PSAA 1Z2CA 2OFWA 2ZI6A 1F2UA 1R5BA 3P26A 4CRWB 4PPQA 1OE0A 3FHOA 3CIOA 5JJIA 5DHFA 2R62A 3TR5A 4CT5A 3A1SA 5CB8A 4URXR 2WWXA 3UMSA 3NWJA 3B82A 3PR1A 4DDVA 1MABB 2C9CA 2BEKA 1N5IA 1VYVA 1XMSA 2AHOA 2PJRA 4KVGA 4KODA 4P4SA 4DDTA 3QIAA 4UNNA 4C3ZA 3GLIB 1VG1A 2WWGA 2GZAA 1FL9A 2VTKA 5FPYA 2IYSA 4DJTA 1OSNA 4LWZA 3OE7A 3PG5A 1LVGA 2OBMA 1UBCA 3U3JA 1N2CE 4GZMA 2J41A 5E95A 4TYNA 1GG2A 3A8TA 1J99A 1KKMA 1E9AA 3CW2A 3MRSA 1OXVA 2H16A 2KSQA 2WIBA 3I8XA 4TLCA 1DG1G 1Z6GA 2JCSA 5F2EA 4CEJB 2ZJOA 2R6CA 1MT0A 3LX5A 2A5YB 4LV5B 3W8NA 3WXMA 4CF7A 1XEWY 4JLJA 5KO2A 4RJLA 4AKHA 2ZAOA 4GBMA 4DCNA 1UDXA 2OEPA 4QBGB 2JLRA 2ZRAA 1OFHA 4CGZA 3KTAA 4QJ3A 1G7SA 4GI7A 4Q19A 1FX0A 1UBEA 3IKJA 5H68A 1U94A 4A6PA 2ZRKA 1F5NA 2ZRNA 2ZITA 4HSEA 4EDHA 4FMDB 3U3RA 1M7GA 2WOOA 5EXSA 2QROA 2ZYTX 3GEEA 3B1WA 3E2IA 4IDHA 4RY2A 4A6XA 2GXQA 4D4KA 3CWZA 2V1XA 1NBMA 3WP0A 1JEEA 4NMMA 1YR6A 1ETUA 1LS1A 1NVUQ 1ZUHA 5CM9C 4ZV4A 4TL9A 4B3FX 1TQDA 1KDTA 4C0BA 1QHGA 1NIPA 1K5GA 5JS8A 3H4MA 3SEAA 2H8KA 521PA 2EWVA 2QRZA 1TX4B 2QG6A 1LNZA 1KO4A 1KNQA 1E2QA 3VX4A 2PBRA 4X8HA 3J81k 2GEVA 3ZZ0A 3GLGA 1GUAA 2XSZA 3THXB 2GJSA 1SHZA 1M2OB 1Z29A 2DFKB 4MRVA 4D26A 3EIQA 1TF7A 1QG4A 2PEYA 3LRPA 4IOLA 3AVUA 4G01B 4BZQA 1Z6AA 3UG7A 3AKCA 5AUPB 3THWB 1E1RD 4UNRA 1N0VC 4DUGA 4DRZA 2MMGA 4CIDA 2IYRA 3TH5A 3EC1A 3UXMA 1Z0DA 2XJ4A 3B60A 1N6NA 2GAAA 5FL7D 3WRXC 3KKQA 3JZMA 3RLFA 1HT2E 1Q21A 4LYJA 1S96A 4MYUA 5BYKA 3QXJA 4OBEA 1G21E 2FFHA 2XEXA 3HR8A 3NBZC 3GFPA 1ZM7A 4GOXA 2R2AA 4C7OA 4A4DA
chains in the Genus database with same CATH superfamily
1FPMA 3MK31 3DTVD 4M0LA 4Y2HA 4NK4A 3H9JA 4XWYA 3ESYA 3WX0A 4B75A 4ECAA 3NHPA 5BXQC 1DU4A 4I1SA 5CYGA 1EFLA 3HDGA 3LQQA 5FWAA 1AUOA 5ILQA 1TAHA 3MUEA 4BOYA 1FP1D 2X5XA 1JTFA 3FOWA 4EZEA 1GZ6A 1NLYA 3ADKA 4KEAA 4P6VF 4JI2B 4B2YA 1V5FA 1VKJA 1YNSA 2OESA 3G8DA 1HDYA 3JSAA 1A8PA 3KXPA 1ZZEA 3MJVA 3WRYC 2PAFA 3I42A 1UMBB 4DLXA 1RJWA 3OMXA 1KFCB 4AS1A 5HM8A 3CX4A 1N7GA 1SPBS 5LZ2A 4RY8A 1VM6A 4FYXA 2H9YA 1KIAA 2A9RA 4WKPA 5LL6P 3BXPA 3VTZA 1UIMA 2IZ6A 4JVLA 3A4YA 3R23A 4YI5A 2VS1A 1V7ZA 2NU7B 2PGJA 1Z22A 1HMPA 4R81A 4DR7B 1R6UA 1YFKA 2X8WA 1FFBA 4FFVA 5BR4A 3ZWNA 3F98A 3PU6A 1E99A 2NUBA 4IDOA 1NVWQ 1RYYA 5DNDA 1ESNA 1GPWB 2H4JA 2EYQA 1GLNA 3FWYA 4XX0B 3RJMA 2QVCA 3VH2A 5JW6A 1EA5A 4BKRA 2B9EA 5B30A 3O4IA 4DR6B 2PHZA 4XYMA 4LY9A 2FPSA 3IB3A 2AQ8A 5K6AA 1T35A 4F3KA 1YZTA 3OE1A 2D8AA 5F5XA 2V6FA 4YMLA 2G80A 3N0XA 2HHJA 1NJFA 4QU8A 3UC5A 2WU1A 2L82A 2R1TB 3FFXA 5JS1A 3FOCA 5M29A 1I6MA 3TZEA 5KHAA 5SZIA 3QE2A 1DAEA 1RC0A 1GUDA 4URVR 1JI3A 1H65A 2GH1A 2CCJA 2HU2A 1NYQA 2ORWA 3L0YA 2LZ0A 4V3BA 5EWMB 4C7BA 4MV3A 2BI8A 5FHQA 5AKEA 1P1HA 3SAJA 5FWXA 1O94A 3G0CA 3Q1LA 3WQQA 1M6YA 4DJFC 1K06A 2WE8A 1ZVQA 3PFCA 4H59A 4X8LA 1TIKA 3SY8A 2ONZA 4NFLA 1U9CA 4LQCA 1CY7A 1QKJA 4BFYA 2H1HA 1GKUB 1T25A 2Q5JA 2Z9BA 1M2KA 1AHNA 1Q22A 1Z82A 3PDIA 1IMJA 1V9SA 4WXPA 4ZRMA 3PX7A 4QM6A 3CRMA 2PX8A 3BXXA 1A7KA 1CUUA 1B93A 3C8MA 3FPKA 3IAM6 1JLKA 3KYBA 4DJAA 3ZGLA 1Q0ZA 1R6TA 4EL5A 3JR7A 3PFHA 2JA1A 2VF4X 4YHHB 4CTOA 2NO6A 1A2BA 1NM5A 3KQPA 2XODA 2BJWA 4CIAA 4OHCA 2YVKA 4PU0A 2ECQA 4ZTBA 2OYCA 2R79A 1MH1A 4OO3A 2EHDA 1ULUA 3R7DA 2J46A 4Q34A 1T9GR 1NWCA 1P2UA 1G9TA 2X42A 4GM0A 4X54A 1SVSA 3C6ZA 3STTA 6LDHA 1WU7A 2Q1UA 5EPUA 2IS1A 1LBEA 3NEPX 1WPQA 3AUAA 1RTKA 4R1LA 2XNJA 5FOXA 1TUGA 1CJMA 4KPEC 4INZA 3VV3A 3WYCA 1YIAA 4HN9A 3OC6A 1JG6A 3SZ3A 3PP8A 4OL9A 5B36A 4GYYA 4EFLA 1G64A 1XTRA 3TW0A 1P0CA 2HQSA 1K6XA 3RTGA 3ICPA 1VLHA 3BSWA 2K7FA 3HUTA 2E1PA 2CKDA 2WZQA 3G9UA 3E23A 2Q3LA 3N3AC 1XEWX 3PFKA 2REQA 1ODCA 3QFRA 1MZPA 1B7GO 1QV7A 3WGHA 5AWFC 2QTNA 3PGA1 3CPSA 4V1CB 1LFDB 3ML1A 4E07A 2VJPA 4RMHA 2J9GA 4FMDF 1HK7A 1P0IA 3X2FA 2E6KA 2P4EA 3EDOA 1RNLA 5EPEA 1JEYB 2NTEA 4ENTA 1JIUA 1R0SA 1RPAA 1RQNA 1UBNA 2IYFA 2OHVA 2WG2A 3NBAA 1WXHA 1NVMB 4PHGA 4UREA 1W85A 4ZANA 2JFZA 2I6QA 2Y71A 2F1IA 2JFPA 4MR9B 4PGAA 4RSGA 4UM7A 3RM3A 5M5BA 4BYGA 1WUYA 4MQLA 4MVYA 2DQKA 3IMGA 3S2IA 1NYTA 3NJ4A 3T7EA 3IBCA 5JU6A 2YHIA 1ECGA 1EG2A 1Q7EA 4F2HA 4XCQA 4YCMA 5JY1A 1MO3A 4EUKA 1MIOA 2WOJA 3HVIA 2AK2A 2FQQA 5AVYA 3F7TA 2OCDA 1YWGO 3RVJA 3AVWA 2GBGA 2OVFA 4TRRA 1FTQA 4D6XA 2A4KA 4F12A 3U9SA 3TD2A 3NIGB 2ZROA 3LMKA 1C7IA 4H4CA 1LC0A 3AUUA 1MVOA 2BV3A 4FYMA 4ZAYA 3SFVA 4MRSA 3FH0A 3JQEA 3G2HA 1FXUA 4BVLA 2W7TA 4MRRA 2PU7A 3WR5A 1XTIA 4J94A 2YHUA 4NZOA 1M5UA 2IHJA 3GBVA 4OXKA 5I47A 1FSPA 4EVRA 3GVIA 5K0NA 5LIRA 1SU8A 3PIRA 4CQLA 4MUHA 4FD2A 2RONA 5F98A 3BL6A 3VH1A 3VNBA 1BRMA 1FDTA 3LT0A 1SXGA 3FUUA 1XA0A 3RYFA 4I2VA 4AWBA 5CCEA 3Q8MA 1M2VA 3ABQB 1BXRA 1EU1A 2B7LA 3OUZA 5BW8A 3A4TA 3MYRA 3A3NA 3GLGB 4ZIRB 2NPFA 1UT8A 1XPUA 1MKYA 4LXIA 4L5CA 2C2KA 2HAEA 2NO7A 5KTKA 4YQEA 2V1UA 1H2XA 3NRJA 2MWMA 2QQGA 1I5OA 5JXJA 3H11B 2F55A 2F9LA 3VDXA 1BMFD 1I0IA 1R4NB 1CETA 1G3RA 1QF9A 2XLBA 4PZ0A 1CR0A 1UXKA 4BB9A 1ZVKA 3TF5A 3F9RA 2PA0A 2NU6A 3ACBA 3EEIA 3DT6A 2ID8A 3C3DA 4HGPA 5KKAA 3W6NA 2ZT5A 2X8JA 3OKPA 3ANXA 4F8JA 2ZYGA 3COVA 5A62A 4YJ2F 1B74A 1IZZA 3L79A 4KTTE 4WHMA 5JZMA 2LNDA 2PX3A 3A1CA 1OXSC 1NQUA 1ZU4A 3INTA 2IOFA 5BSUA 3CCFA 2TMDA 1BZYA 3I4CA 4JR0A 4M1MA 4RKWA 1AS2A 4QUEA 3DZGA 3SYRA 4UEJA 3BH6A 4IR7A 1GFWA 3EQ2A 3OFJA 2X9QA 4NE2A 1RI1A 4OSOA 4F92B 4I8DA 4Z4QA 2PMDA 4M9UA 5M34A 3GRCA 3PHJA 2QX4A 1N3LA 3J7TA 1A9XA 1P39A 4P82A 5CFMA 3U4CA 1ARZA 5FPSA 1PYGA 2DH6A 3HYTA 3VU9A 4Y30A 1L4GA 3QBJA 2PAAA 3R5KA 1ZISA 2ZREA 3P4XA 4M76B 3SU8A 3JQAD 3LTNC 4FFBA 5AKXA 4ZAXA 2JBHA 4U2EA 3RODA 2E5WA 3BWEA 1M67A 3GPBA 1QGDA 1O6BA 1U98A 2EFEB 3PX2A 1VL1A 2W2NA 5LDDC 4DPLA 1K92A 2Q46A 1KI6A 5LLTA 1OA1A 2RI6A 2GPNA 4IIUA 3WO0A 1T8PA 5JQGF 1NW8A 3DVLA 2XE4A 3BVPA 3OKAA 4RTLA 1AC5A 2AOTA 1MN6A 1ZRNA 1F38A 2CZCA 2ZANA 3IUNA 3N1UA 2BT4A 5FLEX 2ZS8A 2OFFA 4D8WA 5DO9A 5B7PA 1TU0A 2DR2A 3G7UA 1B0PA 4E7OA 4OHUA 1DZIA 5CG2A 2OECA 4N5HX 3WKEA 4BDSA 3UMRA 3G0IA 4WVFA 3RWBA 1BMFA 2I4LA 2IX9A 1BTOA 4WIAA 3OTQA 2PXHA 4RTJA 4GSYA 1C4XA 1PJSA 3ZWBA 2JLQA 3UAXA 1Y1SA 2VT2A 2QR5A 1JILA 3BL5A 3MFQA 1RYNA 1ORHA 1Z4NA 3MGGA 4XVRA 1A8QA 5LJLA 2BELA 2ZFUA 1FEZA 4XUDA 3Q9LA 3UT5A 1KQ3A 4NU8X 5TF4A 1NNUA 4R83A 4PGFA 1Y63A 5BO5A 2ZI9A 1T9DA 3F6EX 4UHBA 4RCYA 2V5AA 3ROPA 3LNTA 1SQSA 1C0KA 4G23A 2ZJ3A 5IKMA 4U7HA 1CJVC 1NVAA 1DDIA 1PFGA 4BO5A 4ZYTA 1QYIA 1X9HA 3DBRA 5IXJA 3OFVA 4FIZA 2J48A 3OQHA 3JYHA 2FSUA 1QH0A 3GBSA 5FWXB 1YRWA 1M2HA 3M1YA 1L8XA 1U2EA 2NTYC 1Q3KA 3QUBA 4YDSA 5HRCA 2WWYA 2GRJA 4J1SA 3KPYA 1UKZA 3ZWDA 4ENWA 2ACWA 1SCUB 4DYDA 1WXQA 2VJAA 1PV1A 2Y0EA 1BEUB 1Y8AA 3GT7A 3I04A 4WT7A 3V4ZA 1ZAYA 1VLZA 2Z3VA 3ADBA 1LQTA 1V6AA 3PDIB 4R2IA 2VSNA 1RAHA 2R11A 1NP3A 2I7XA 1OKKD 1QYXA 3DE4X 3FHJA 3WA6A 2HEGA 1WPRA 2P40A 3B3FA 4DWOA 5IUJC 2EJBA 2J4CA 3F4BA 3FCUB 4G9BA 3KIPA 1FP2A 2IGTA 3ZY3A 4L95C 2FOLA 3G5TA 3KUCA 4Y2QA 2X9VA 3Q1KA 4C6TA 3DOIA 2G8NA 3RWOA 2HRCA 1JAYA 5FLKA 1S5PA 2CDRA 5F35A 2X19A 4DOMA 4HV4A 2FPIA 1JHXA 1XQVA 5I5EA 4FI3C 1WQ1R 3N7AA 4N47A 4I1UA 3DEFA 5CH8A 4KOAA 4N5MA 4OQDA 1BDHA 3CKMA 2AG1A 1TEHA 5CXSA 4IRMA 2HJGA 1H6DA 3UUFA 1WY5A 3FDXA 4RH0A 3T1OA 3PPWA 4TWJA 1T36A 2QDXA 4V0OA 4WGFA 1JR2A 1ENOA 2D00A 2JAPA 1KAMA 2JI4A 4PEVA 4KQFA 2NLOA 2OORA 4PICA 1XTSA 1T5IA 3K5PA 5EIFA 2R84A 3GNLA 1OV4A 3TLKA 4MW0A 4H1HA 4C3VA 1GNPA 3NXSA 3DEKA 3QWFA 2D2EA 3IV7A 1J97A 2ID7A 3BF7A 3RVLA 2ESRA 1QHNA 1Q20A 3K53A 1E79D 1IAVA 2REQB 3AY7A 4QQKA 3OX4A 5FTMA 3CM0A 5TVKA 4AECA 5J2TA 5JE8A 4YPVA 3W5BA 5DX1A 3BXOA 2RJ3A 3GJ4A 4RANA 4LKRA 3DZFA 5JBQA 2VPYA 2ZUSA 4B3IA 2GBPA 2AJDA 1QAOA 2WAXA 1TK2A 4P36A 1DO2A 2CMDA 4M9ZA 3ZV3A 1KKUA 3CUSA 1LI5A 4QJBA 4QQRA 4JODA 4DR3B 1G291 5BUZA 1MGPA 2IV7A 2OA0A 3Q3CA 4B40A 4MV8A 2KM1A 3SF0A 5GY7A 5L4NA 2AN1A 4W4TA 1X7GA 2Q5QA 5ICEA 4FX5A 1QIKA 4KPUB 4DCJA 1OKKA 3EOAI 2R5FA 1ZMRA 5DW3A 1U8XX 3WNQA 4C01A 3R7AA 1ZXLA 4BWGA 2H4YA 4J7CA 2Y76A 4TMZA 1MIOB 5DTMA 3C7KA 2VA9A 4UHHA 4RIFA 1SEPA 3QMWA 3TTVA 3V1LA 1B00A 4N5IX 3ZNPA 4NZMA 1MRNA 4WQMA 4YJ2A 1GU0A 4MVJF 4DR1B 4JBLA 3W5CA 1YA8A 2QR2A 4N0EA 5A5VA 3U44A 2V8OA 4OHFA 5E9WA 1I9CA 2YNMD 4P08A 4C87A 2O7QA 2C20A 2OY0A 2A35A 5BRJA 3ND6A 2Q3DA 4P7FA 1I33A 3JQ9C 2ZM5A 4RVGA 4WOPA 1GT91 4DJ5X 4V24A 5HSGA 3VR5H 1XKXA 1R5JA 4TT3D 2CD9A 3GDHA 2A9PA 3PV0A 3RS5A 4JQOA 3WHKA 2MSKA 1MB3A 2JAQA 4DJJA 1R18A 3FFBA 4EY8A 1M54A 4AO6A 1KU6A 4A2CA 4C0WA 5DF1A 3JYPA 1A4RA 1M2VB 1BXRB 1PF7E 4S1VA 2HF8A 3K0CA 1DEKA 3JQFA 4GP6A 3SG0A 1QZTA 4KR0A 3MAGA 1R4AA 1IVNA 1YACA 5FUYA 3FTNA 1UC8A 3E0XA 5JUWA 1RP1A 5EERA 5F73A 1EXVA 2WM9B 4OLAA 4OFBA 1PQUA 4WX2B 4POAA 5DSXA 1J22A 4MVXA 2YIJA 3KZKA 3F8TA 4BPBA 1YRLA 2WUDA 4Q3NA 4LDNA 2D4HA 4KMRA 3QXCA 2BGWA 1XKQA 2BFOA 5JQGA 3AVXA 3OZEA 7REQA 2QENA 1Q3HA 4ZDIA 1V11A 3P0HA 1FRVA 3DE7X 3KZNA 2CL7X 2NU6B 1RHRA 1CHNA 1R9GA 4ML3A 5IK2A 2AHRA 3DAOA 4B4DA 1FUKA 4C21A 2QZPA 3ZDRA 5KSYA 4JGBA 3QPCA 3CRQA 3NX4A 4B7CA 5B7NA 2YXLA 3NBYC 4PHFA 3UA3A 2X8JB 5C1IA 1J39A 2Z1MA 1DCFA 1HOXA 1OWNA 1QR6A 2CE2X 3H9QA 3MYYA 4GVLA 4K8OA 4PLZA 3P32A 3G2KA 5DX0A 1D8TA 1F8YA 4DQDA 4K9OA 1IY8A 1D2RA 2AOWA 5DN9A 5D1NA 2X7JA 3L0BA 5C8YA 1UAGA 1QE3A 1J20A 1LBQA 3DMRA 1ZW6A 2V54A 2HSZA 2GBLA 3KT8A 4N7MA 2H2WA 3VBEA 2G82A 3ZCPA 4ZZIA 4LHWA 2PA3A 5EXTA 3W9BA 2WJIA 2JHCA 3A6DA 4P4NA 1NASA 4P0TA 2I1QA 4Y7CA 5CT6A 2Q0HA 1LQUA 2PYIA 4DL9A 2P4SA 2J31A 4QDXA 2BMJA 3TJMA 4D8XA 3ER9A 1A9XB 4B2PA 4HEHA 2FR8A 2G9ZA 2VT6A 1CJCA 3NB0A 2HDOA 2B1GA 1ENPA 3PHLA 1CZUA 4K26A 4KVAA 3VU9B 2QI9F 3WHPA 4BMSA 1DPGA 3C98A 3T9AA 2NP7A 2IXEA 1OC4A 1PL6A 3B52X 3ENZA 3A3OA 1J0BA 2XMPA 4GHWA 4Y6QA 5DIZA 5KVCA 3M9XA 4TT3A 3E9YA 3N2YA 4FBGA 4JH0A 2QKYA 4DBVO 4YNBA 4KWEA 4PQEA 3CG4A 4LK2A 1YE8A 3CVXA 1SU7A 5BVHA 1KI6B 4NLLA 5B1YA 2ERXA 4OYRA 5F1PA 1QANA 4LQDA 2D1TA 1G8FA 3O8BA 1OWOA 3MGKA 2AOTB 3HGTA 3CLKA 1SKYE 4NZYA 2A9KA 3D7MA 5EZQA 1KO8A 1PR4A 3REOA 3TR6A 1J90A 3UK1A 3SIPA 3ZD8A 1E8DA 3KE9A 4Q5IA 4C7XA 1K4KA 2GHIA 2TSYB 2VDNB 3EPLA 1X1CA 1NSTA 1Q6YA 3N5CA 1UXOA 3KQQA 3NVMB 4Y0VA 5FI0B 5KYWB 1UPUA 3EZ9A 1XZCA 3OCYA 4TL8A 4GBGA 5AJYA 4XRRA 4E51A 3IPAA 2ZI3A 5CLHA 1PK8A 4NEGA 2QUHA 2OLKA 2HRBA 2ZUBA 4Z9FA 3UT5B 4BHTA 5B3KA 3C87A 2CHUA 5BW5A 4JEHA 3QWHA 5SY4A 1S2GA 4RVDA 3SXUA 3E58A 1S3FA 4IJQA 2M6KA 4QAJA 4NOJA 4RXMA 3IAXA 5DBEX 4DLSA 1OB5A 5JLJA 4ZPJA 5KHOC 4LW8A 3Q7QA 4LTNA 4MWTA 1VKHA 2PZBA 2XNKA 3PKJA 4CN9A 2ZIXA 3IR5A 3DBRB 2PIDA 3ZV5A 1KI1A 4DAOA 2GDJA 4PFKA 2WM3A 4EKYA 4NC9A 4GXTA 4DIMA 4KUGA 3AJEA 4JBYA 3MCUA 1U2PA 2H57A 3FSGA 3E3OA 2ZVQX 5F4BA 5FOVA 3ZWXA 3GH3A 2NVWA 5MFPA 3EOBI 4MDYA 4RZUA 2XMQA 2Q1TA 1RPJA 2F59A 1YAHA 4RQBA 3VDRA 4HQKA 1ZVVA 4C2TA 5KKNB 2QJTA 1QFJA 1ELOA 3JQAB 3LUJA 5CIQA 3VU1A 4DMFA 3UEOA 1GTRA 1RBMA 2PLRA 3IR7A 1GZ5A 2PQ6A 2KS6A 5HF9A 2GETA 5CHEA 3VUEA 4CTNA 1TMKA 1ZIPA 3LGAA 3R7NA 3PQ7A 3W78A 1JIIA 2BGGA 3IJ5A 4M1QA 3CF0A 5DYGA 2I34A 4TKVB 3IVRA 4CV0A 2D2XA 4P83A 1YJ8A 2DHCA 5A5DA 4HS4A 1C9EA 1XROA 4OYHA 4OGGA 2GQ0A 2GN0A 4M37A 5K20A 2FPIB 4RF4A 5T64A 2RG7A 2VUUA 4MKGA 5JWRA 5ARBA 1JDUA 2Q8PA 2HMUA 2NTNA 2ZXUA 2FZVA 4ZCLA 3LPDA 1V26A 1XZQA 2V3WA 4MVWA 4DA6A 2VPQA 3L1UA 1P2GA 2YN0A 2ZJZA 2PL5A 4D79A 3NNNA 1T36B 2GJ8A 4XR9A 5LDHA 2SNIE 3RH0A 3TG2A 2V6BA 4YRSA 4JFRA 2B0CA 1NFQA 1XMOB 1IOZA 3WXBA 2NXEA 3DKKA 2X77A 3U4GA 4XIYA 1QG0A 3ADCA 1Z4MA 2V6IA 5FRDA 1M6NA 3COSA 5LBIA 4B2LA 2YMLA 2EFGA 2I4IA 3K9WA 3RVRA 1W5FA 4P81A 3D6JA 1PHPA 3LT5A 5J2TB 4J1NA 5AXAA 1QG6A 4Z3KA 4MLPA 1YQGA 5FQNA 4CEIA 3K7EA 5D51S 1MTOA 1SCBA 1M2NA 4DMKA 1GUBA 4FYIA 4LPSA 3PJFA 5AKKA 2WJGA 5ICGA 2QN2A 1ACMA 3EUEA 2IXBA 3GRZA 4CQNA 1TOAA 4OQLA 1W1WA 5E3IA 2FMKA 5JI3E 3Q5DA 4W5QA 4G0UA 2EJCA 1ECJA 3ETLA 3GK3A 2XMRA 3P5BA 1GPBA 1RRPA 1SXJC 3JWHA 3PRJA 4OJKA 4WOKA 3RJTA 4C0LA 5LMNB 3E03A 4DZZA 1OHHD 2FKNA 1YCGA 2N42A 2AQKA 2YN4A 3OOEA 4J16C 1LGYA 3FNIA 4ZQHA 5LYYA 4XYLA 1UH5A 1TJNA 4HB4A 3KOWA 4NCHA 1A9SA 5UKDA 2FA9A 3PJEA 5EJ2A 5IN5A 4EJ0A 1PP4A 1JFTA 4MGHA 4ACBA 4XWWA 2VP6A 2ZPTX 1UWLA 3AIMA 1ESCA 3OIGA 4BNFA 3GVCA 1BN6A 3IP3A 2JJ1D 2OXEA 3LCCA 1T9KA 1Q92A 3WK7A 1Z0AA 2B35A 4U6SA 4YJ2B 2DY1A 4EMUA 4UFNA 5ALYA 5ABPA 3U44B 5FBRB 4GC9A 1SIWA 4NJMA 4YAJA 3KVYA 4QA9A 4YDQA 3IEXA 1NLZA 4XD2A 1XZGA 5JCOA 1CU1A 1YKSA 3RRJA 2JGFA 1N2JA 3N75A 3U3ZA 4AYTA 1R8XA 4IHJB 1LBIA 2YJTD 2I4NA 3OM9A 4MAAA 3ZHZA 3P2JA 1XQ6A 4GI3A 4LS3A 1S8FA 5EQDA 1X2BA 4G2NA 4KQXA 5G1PA 4BMDA 1GL7A 1QC5A 4XQEA 3NM4A 4A8TA 2J5XA 4XLTA 3KB6A 2QJWA 4UHCA 3HB0A 3QE3A 1T0BA 4LC9A 3Q9SA 2WAYA 4O1IA 4QEKA 5JC8A 3HN6A 3M9LA 2VT3A 3CYFA 4H6XA 4K87A 1QCYA 3TNJA 1V5GA 3JQ8A 1KRWA 1ZIYA 2XA9A 4MEJA 1Y6RA 2VUTA 5GGXA 3MINB 4ZARA 1PWXA 4MB0A 3BWXA 4NI5A 3GAMA 3L8HA 4X1YA 4LCJA 5KQPA 1E6KA 3FMFA 2Q21A 1E7WA 3TECE 4GYWA 5E2BA 2ZZNA 1RXCA 5EE3A 5JQGB 4MO2A 7REQB 4KAXA 2BY4A 2BGKA 3G3EA 1XELA 1W96A 1V11B 2VHCA 5FWDA 5A1TA 1N6IA 4JOCA 4UBJA 3R74A 2G72A 3PXEA 2GBIA 3ROEA 4CKEA 3TQQA 5TIIA 1P45A 1Z7GA 4DIDA 3FFTA 4TQAA 2D74A 2HSDA 3GJSA 1A04A 1KPGA 1UZNA 4Z4HA 4ZEVA 5JAUA 3QELA 1OZFA 4G81A 3RS2A 4I9UA 2QL6A 4WJKB 3TO5A 3NHJA 5C8YB 1MO2A 3CKYA 3L6CA 1F0PA 1NSFA 3PXBA 3AEXA 2V6JA 1I6WA 3JQ6A 1J24A 4H7PA 3UW1A 2JJ1A 2VRCD 3O3NB 4XIGS 3BSYA 2O5CA 1Z2AA 2Q8QA 2YZKA 9LDTA 3QOFA 3OIDA 4HAVA 1K08A 4KLCA 4P3OA 3STYA 3DE5X 4QVGA 2LTAA 3V1KA 3D4BA 1U2GC 5U4XA 1FXWF 4L78A 3TFOA 2JFXA 3T15A 2GJ4A 3D3NA 4OMFG 4CMHA 5CM2Z 4KOEC 4D9JA 2V4MA 1K75A 4OLJA 4WLUA 2OHGA 5BWLA 2GR9A 3JAKA 3IV9A 2AUTA 1EYZA 4RXUA 4WZBE 1OXMA 1RABA 1ZO8A 4IXMA 5DW0A 2WG1A 2GGSA 2VPZA 2QF7A 3AR4A 4IVPA 4K9DA 5BVHB 1DFIA 3CX3A 3MWDB 3T7DA 1E0AA 3MERA 2HF9A 3I6MA 2PLAA 1XTVA 4PF1A 2QTGA 2Q2QA 2E85A 3CEPB 2B2NA 2HNBA 2CB9A 3C5EA 1VLVA 3PCXA 2H0QA 4I2NA 4K9SA 4LYEA 4JI6B 3SDZA 3X44A 1I2CA 1Y81A 1G66A 1H66A 1K5DA 1GFZA 1Z26A 2ZJBA 4BQRA 1FE8A 4K2AA 3A1VA 4O59O 2GLXA 1GCIA 3OJLA 3PPYA 4RWZA 2P69A 2G36A 3SEQA 4YV0A 5THXA 4ZALA 3CEJA 2ZAGA 5JEEA 3O8NA 1C8KA 5F52A 3NTRA 3R0JA 1I32A 1FQJA 4MUIA 4MW7A 3QX9A 4I9HA 2B4KA 4G0WA 4R0MA 3KWJA 3VMMA 4BLRA 4BQEA 3FOFC 1DLJA 2LXNA 4ZXPA 3SXUB 1F0NA 3R4VA 4ZC8A 4ZI2A 1CQZA 1E1QD 4TLMB 4YV1A 2KB0A 4B31A 3KEGA 3Q7RA 3BRSA 2RH4A 1TPZA 3U0BA 4RVFA 3VO9A 4BO7A 2ZJ7A 2ZIXB 3SOPA 1WUHS 5J4VA 1FMTA 1PZGA 4XDGA 5CK4A 2YY6A 1KBQA 2GNPA 4MYTA 4QVKA 5B6PA 3DD5A 4A82A 1PQ4A 1E0DA 4X1KA 4G0YA 1RYHA 4QDKA 4KHZA 2ATIA 5KNDD 1G59A 4LJ5A 4RZXA 1RYMA 4J3JA 3VR4H 5IMSA 2C94A 5DK6A 3O8LA 2GSWA 2NVUB 3TYXA 1XT6A 2A59A 3OG9A 2FUCA 1SOUA 4B35A 5J1SB 1XNHA 4DR4B 1MVNA 4MQ4A 3WMFA 3BS4A 1IZ9A 1N3YA 2YUTA 1ISSA 3A6JA 2EEPA 3DBLB 1L5ZA 3X0DA 1Y6ZA 3U7GA 4O4LB 1UOEA 1RM0A 3IP1A 1EMDA 5EHZA 1PEAA 3FLAA 3QJ5A 5TE9A 3DQZA 5J5AA 1N8KA 4MIKA 3P9IA 3GRAA 3I2KA 2QB5A 1M1YE 2QLLA 3LV8A 4F4JA 2YIVX 4YN3A 2KBEA 2WA2A 2XBUA 2C7GA 3HV2A 4CM4B 2HLDD 2EWWA 4O4HF 1KI8A 2DHDA 1W4LA 2IYTA 2WSIA 3DAFA 3H04A 2ZWOA 4P7GA 2N0SA 3TSYA 2RG1A 1EA7A 1L7VC 3DZBA 4XASA 2GEUA 4HQNA 1ZU5A 4TXNA 3VVCA 4BX0A 1TA4A 3L1KA 1A9OA 2NV6A 1L5QA 2DU8A 1DUIA 1M2WA 1YR1A 2ZU6A 3R3XA 1FS5A 4PO9A 5A9SA 4P7KA 2AVNA 3M33A 3O1HB 1Y4ZA 4JA2A 1VG8A 2R8XA 3T06B 3BKXA 4RV9A 4AJ4A 1LA2A 1P1KA 3GUHA 1NIJA 3I04M 3MWGA 4R2WA 4DSNA 1GZDA 2HM7A 2J32A 5EKSA 2QVLA 621PA 3CRZA 4C06A 1EFUA 3P9ZA 1D6JA 1E1QA 2UVPB 3AUJB 4KAFA 3RVDA 4BVKA 2AFVA 4M3NA 4RD4A 3RTAA 2MSCB 4CEIB 2Y4OA 3P9PA 4HRYA 4D8UA 3HBAA 2IVZA 2OGZA 2YCBA 1OXKB 1NKTA 3U9LA 5K0FA 4B6GA 5KNDA 5D3QA 1W87A 2WILA 3V5NA 1FOEB 1I51A 1SOVA 1FFHA 3R6TA 3HVJA 1ICEA 1JDVA 5F21A 3GRFA 2D1RA 5CNMA 2O8EB 1ORDA 2YJZA 2FETA 2CJXA 4QLBA 5JYBA 5KKCA 4I55A 1XLUA 4M2LA 3EPPA 3WL8A 5AESA 3PI7A 2RIPA 3CX6A 4P92A 1D0IA 1IB0A 2PFSA 3PKZA 4KWIA 4Y6OA 2VFAA 4AC9A 4E1VA 3RUPA 2ZR7A 1ACLA 4H4EA 1FNDA 4CF5A 1YCFA 1B8UA 1YONA 2B36A 2IZZA 1H1LA 5L8VA 3BQNB 1T2EA 2VKQA 4FW9A 2H31A 3A28A 3BC1A 1EGVB 1GPDG 1MV8A 3WGMA 1TCCA 1O97D 4GOOD 3OOWA 2FZ4A 5SZHB 2DFNA 4BE7B 4XVHA 3L6OO 4WFKA 4NJMB 5TMDA 1U2ZA 3JRWA 3Q9UA 3S2UA 3UAGA 3WSVA 3ZXYA 3JD1A 4R1SA 4DTIA 2CXQA 4ZYUA 3K5IA 3WS7A 5A4KA 3UB3A 3BULA 5DNYB 5HW0A 4C43A 4C4ZA 2IYVA 4H6VA 5E3HA 4CQJA 5ALDA 1WZIA 3U1TA 3DXXA 3EG5A 5GONF 4JI4B 1QC5B 4OEHA 4FDUA 1C7ZA 4LA4A 1QX3A 1GNQA 1X13A 1ZI9A 2D59A 4FOTA 3W6ZA 2PEZA 1WTAA 2H3EA 1J07A 1FXWA 3E8XA 1B1AA 2FX3A 3K15A 4XKJA 4FFLA 4ZVMA 3B7WA 2FG7C 3JQ8B 5J2UF 5EE0A 1SG0A 1L5SA 3LPLA 4WLOA 4E2WA 5F9MA 4X1YB 2R9VA 5FFMA 4Y2SA 2JL1A 1IRXA 4IEFB 4ZGGA 1R1DA 1IN8A 5BQPA 3ZI7A 5TQJA 1WO8A 2E2WA 3QBTA 3AXTA 1MFZA 5TGZA 2JVJA 1N1DA 2RH8A 1AZWA 3L7CA 1O1YA 3IIIA 3OTGA 4KI7A 3V33A 4CKEB 2XGOA 2YWJA 3B2EA 4JT9A 4B09A 2GZHA 3LE8A 3O8DA 4Z1OA 5AM3A 1CT9A 1OZ0A 1QFYA 5BQ3A 3I62A 2QMZA 1ZD5A 1OX5A 5D01A 4MJXA 3LA8A 4PBRA 2PX0A 1K8XB 4UOQA 4Z0TA 1A4XA 3KPWA 4GPD1 4LYFA 1Z47A 3UJNA 3QELB 4NR0A 4QGHA 3DPIA 4D41A 5AW1A 1E4OA 1FNBA 1Y9EA 3PUKA 4CR6A 1MZVA 3H1GA 2BFDA 3D1VA 1W73A 3ZE7A 1KAQA 2J5KA 2OQ2A 3BEOA 4H08A 2IYXA 3ZD9A 2XRFA 2AG8A 2LDBA 2ZBQA 2FDXA 3QM1A 1VP3A 1XD8A 2HJVA 1LZLA 3DAYA 3GJ6A 4RJTA 2XCRB 1V5IA 4LF4B 1NN0A 2FPMA 4C14A 3LQFA 4ZHQA 4N39A 4IIXA 5FR1A 4E3WA 1X15A 4FYKA 1UBLS 5FEMA 4MDFA 3JU3A 1XHEA 3GGGA 1H8EA 2ZWAA 4Q1VA 2AD1A 4MI6A 1T4MA 3JAKB 4BNYA 3C6XA 2HPAA 1EUZA 1OAAA 3GLSA 4RLSA 4OBXA 4OXQA 3G0BA 5KZMB 2Z1NA 4F6RA 5KCMA 4XB2A 5AI5A 3F1LA 4KIWA 2CHEA 2DB3A 3C3CA 2E87A 1JU3A 5IABA 4WKOA 2FYTA 4P22A 2ZPUA 1Z06A 1NOIA 4D9MA 2FFAA 1JB9A 2HOQA 1A1VA 2QE7A 2H4FA 4QXAA 1HDEA 3GPCA 1CJKC 2B8JA 2BFAA 4AKTA 2F3TA 5K3OA 4LMRA 2VEDA 1EGHA 2XNHA 1S89A 3VKWA 2TS1A 3DOHA 5EA2A 1GCOA 1VCNA 4EQ6A 3QVUA 2GF9A 2Y05A 3IA2A 5K3SA 4JQSA 2PTGA 3BGSA 4DNQA 2AFIA 1K8YB 5HUJA 2WJJA 4D9FA 4UNPA 3A4NA 2H2GA 1TTTA 2Q5CA 3KOZA 5IZCC 1KP3A 2XXBA 4D02A 3V8NA 4UM5A 2BDTA 3GCGA 1EGMB 1EGQA 2BPOA 2P2YA 2Q1SA 1KFJB 1EK2A 1EQ2A 4QASA 3QPBA 1SBZA 3LL7A 1OGIA 1GPLA 1R9MA 1XTTA 1U8TA 3PRYA 2W71A 4MCIA 4NMWA 2JRLA 4M4SA 3DC7A 4C07A 1DLIA 1GPYA 4J0JA 3T7AA 3Q0TA 3LY9A 3R3UA 3EVTA 3LW8A 4PNPA 3CLRC 2X8BA 3JY6A 3NIWA 4L57A 4X1KB 4KO2S 1SQ0A 2Z83A 3Q8LA 5EE9A 4ZAVA 4PCUA 3RK4A 1OH8A 4H7KA 2VF7A 3ER6A 4N3NA 5HE8A 3RVOA 2V5UA 4QFBA 5EXEA 4D8YA 2YS7A 3ANTA 1RKQA 4IHQA 1T9HA 3FHLA 2CT8A 2RJOA 2OLEA 1N36B 1BIFA 4EX6A 5AM4A 3ICOA 3KJHA 1KYYA 4X6XA 3GRPA 1DXQA 2J09A 5EFZA 1MDBA 3L7OA 1RJ9A 4QUDA 1G5HA 5KOYA 4I9NA 4B84A 4RVNA 1RD4A 3WNCA 2PVCA 1XYGA 2X7HA 2P2NA 4NHOA 5LKAA 4DY4A 1RQLA 1UBOS 4HZUB 1J5EB 2DP4E 1GR1A 3W8RA 4ZC1A 3EA0A 4KE9A 2YRXA 3BCRA 2YASA 5IWCA 2PZEA 4AP5A 4XJSA 4RF2A 4HDQB 4IIBA 1CPYA 3JQDA 4MITA 4MV9A 2MSWA 2R86A 3EH2A 3IB6A 1SCQA 3NONA 4G63A 5CVUA 3SJAA 4B5KA 5A9SB 2Q29A 3NM5A 1CUDA 1HE2A 2P67A 5EIAA 1EDEA 2VDMB 2W11A 2ZWPA 3QQPA 4Q21A 5THQA 1KGDA 3SZOA 4CXMA 5AQ1A 3A9UA 5LUAA 4YRQA 2IUUA 3LF2A 1HI9A 1TRKA 1ZKDA 4JL8A 4NONA 5K51A 4KR7A 3CRVA 3GRRA 4IS2A 4E2FA 2XXAA 1Z07A 3R3HA 1HLDA 2UUPA 5GONA 2WC1A 1O96A 4ZI5A 1QK3A 4K2HA 4GKAA 4DC1A 3D64A 1QBGA 3OE5A 2QLJA 1SCDA 1QQTA 3E9MA 4ZRDA 2HFKA 3IALA 4GAEA 4LNHA 4YAEA 2VOJA 3BD6A 2D62A 1SC6A 4FMCB 1Y8QA 4AY2A 4E03A 5J2UA 1SM4A 1I36A 1RWKA 4K9LA 3JD4A 4Q3BA 1TF2A 4Q03A 3CW9A 3UJ8A 1ACJA 3Q3EA 3Q9NA 4I55B 4BECA 2O5RA 1WW3A 1J2YA 2XUPA 4IDEA 4IZHA 1RHQA 4HVCA 5KTOA 4K0KB 2I71A 3HRIA 2NX2A 1JFLA 4YI3A 1NI4B 3BFJA 2FF7A 2PNJA 2CMKA 2OCAA 4M38A 1K68A 3T5GA 4A0GA 3DTNA 4ATNA 2IDZA 3BOSA 3H2KA 1H4VB 1G8YA 3OU6A 3BE8A 3EGDA 4YHBA 3RE1A 4XDYA 2OUKA 3F71A 5BW4A 1H1LB 5JYCA 3NIFB 2KHZA 4RJKA 5AK4A 1W2GA 5DNAA 1QMPA 1L7RA 1EQAA 2OGTA 1CUFA 4R51A 4ZOAA 3EAGA 2A1IA 1S6YA 2IQIA 1YOVA 4FOPA 1P17A 5EOVA 5I9MA 5ISMA 2CLHB 1CUYA 1QCZA 5BN4A 2C2HA 1BE1A 5B4UA 1CS0A 3PFWO 3N87A 2P41A 2OOSA 3SHQA 4GPEA 1AGPA 2IS6A 2I2XB 3PGVA 3RF7A 1ABBA 1T34A 3T3DA 4I46A 4U9HS