2JNWA

Solution structure of a ercc1-xpa heterodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
NSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA excision repair protein ERCC-1
publication title Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03834 Rad10 Binding domain of DNA repair protein Ercc1 (rad10/Swi10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jnwA00
2ZIVB 4P0PB 1J25A 4P0QB 4M6WB 4BXOB 4M6WA 4BXOA 2ZIUB 1J24A 2JNWA 2JPDA 2ZIWB 2BHNA 2A1IA 1J22A 2BGWA 2M9MA 1J23A 2ZIXA
chains in the Genus database with same CATH superfamily
2Y68A 4PIMA 1AN0A 1GGHA 1P8JA 1QKKA 2IU4A 2HIHA 4Y2SA 1LPBB 3T54A 2HC9A 2YHSA 3N8GA 4BCDA 1I14A 3GCGA 4TKLA 4O2BB 4KAXA 1OZAA 1EDZA 4QWMA 3W7BA 1V3TA 5CX1A 1PJRA 3ZVKA 3KTDA 1AC5A 3STXA 2Q1SA 1FU7A 4LMPA 4QXRA 2HMYB 3EXG1 1IQRA 3NANA 3GJ4A 1R9MA 4PZCA 3GNQA 2ZM6B 1JXQA 4DF3A 3W1EA 1ZXBA 2R79A 4XDHA 3JYOA 2N75A 2B2CA 2XEDA 2DTXA 3H97A 3Q3EA 4KBFA 4CEJA 4YT8A 4DNPA 4Q3LA 1Q74A 3P32A 2X9VA 2R1TB 1VI5A 2CHVA 5AM2A 3VR2D 5HDQA 3HM9A 1UPAA 4ZD6A 1T5SA 5IM5A 4GP9A 5EPOA 3KT8A 3RVRA 1U8XX 2O8FA 3UKDA 3B8HA 2NO4A 3BH0A 2HRDA 1YU6A 2BKEA 5K6AA 4YJHB 5ECGC 5HM6A 2QUAA 4QPJC 4X3PA 1ISSA 3J7TA 1LBTA 1MX3A 3WLJA 1IVSA 1G5QA 5I7VA 2FJUA 3DMTC 2A2ZA 1QJ4A 1HYBA 1YULA 2AXQA 1SUSA 1W5AA 2O0MA 3B6MA 2H5IA 3BWEA 1MRNA 3EDYA 4GLJA 3OP1A 5I7HA 2IXDA 4ENVA 5AVUA 5IK2D 2JFNA 4YRJA 5JG7A 2VPXA 4R1SA 4DWOA 5JAOA 1A9OA 5LZ8A 2CJXA 1ZM7A 2XUOA 3PFHA 3SDZA 1G0OA 2EFYA 3V9PA 5EZYB 4CKCA 3CF4A 1T2DA 1YWGO 2XKBA 1ODSA 1E9SA 1DOHA 3D59A 3EFOA 3MXOA 4LK2A 4Y98A 5TPZD 5IVIA 2F2TA 1RM3A 3VAAA 4ZAZA 2IHUA 1B0PA 2DWPA 2GAOA 5IT0A 3PPWA 1P1BA 3CLUC 5TEVA 3HE3A 4D45A 1FS5A 3SC6A 4EW1A 2YIJA 1UQTA 2LP4Y 1Q15A 4WZAB 3RUAA 2W4MA 2QVXX 3VJKA 4PLGA 2OBBA 3O4IA 2BEWB 4YMVA 5DHFA 3H1EA 2X41A 5BWMA 1G5PA 2JBHA 2PFGA 2ZE7A 1YZNA 3HB7A 2NTJA 3AR9A 4X64B 5BN3A 2P2LA 3T0FA 5TY0A 1PZNA 2ZIVB 3K96A 2NU7B 3KXPA 4PSCA 4UBNA 2JATA 4AO6A 3AVPA 1E0SA 1ZGGA 3NRBA 3NM4A 1IBMB 3LO5A 4FR5A 4ILKA 5G0UA 3AY3A 2PX4A 4ZOLF 2V1XA 3K9LA 3AEYA 4XWAA 2GCNA 4LZWA 4EW3A 3O4HA 2Y8EA 2PT5A 1H4QA 2Q3EA 1TLFA 2G7ZA 1E77A 4QQNA 2NVUB 5DI9A 5FWDA 4EHLA 4PNEA 5ITZB 2Y93A 1PYDA 1RAGA 1VBMA 3EQ8A 4P92A 2GPJA 4XIYA 3I9V6 1Y6RA 1K98A 1N6NA 2B37A 3A4MA 2GPAA 1P74A 3B3AA 4R9NA 3RAFC 3GEHA 2WF8A 3G0GA 1GVNB 1VYVA 4D4LA 1YI0A 4UNRA 3NP9A 2RMKA 5C8YF 1OR8A 2W8BA 3GGOA 3SBXA 3ZIDA 1V95A 2ZRJA 3S81A 3CRVA 4NBUA 2CZCA 3IUQA 2JGNA 4YBRA 3WLHA 4GI2A 2CLSA 1GR1A 2IHYA 5G4KA 5GV7A 2OD7A 2J4CA 3EODA 1COZA 1H2ZA 4HUQA 1EK6A 4YR9A 2UVQA 3O21A 2NIPA 3RUIA 5F21A 5F73A 3GFRA 5AOAA 2JJ2D 2VA8A 3HFJA 4G97A 5FBZA 3RABA 2J5BA 3PE4A 1U1CA 4X97A 3ZQ6A 3AIMA 4CFSA 3E3MA 3PXDA 5F5NA 2GHTA 5EGSA 3CW8X 3MHTA 5DSZA 3U19A 4P22A 2YBEA 4GR4A 1UJ2A 3BE6A 4GMGA 4PX3A 4UJ5A 3JQAB 2JK1A 2X8JB 2RHWA 4JC4A 3IA2A 4CEIA 1R0KA 4OL0A 4YXFA 4BNZA 1TE2A 4Q05A 2MJLA 2VCEA 3LYUA 3L6DA 3R3ZA 3U3RA 1I7NA 2OHFA 3HWRA 2NP6A 1SXJD 3R5XA 2E4WA 2GNPA 4B4KA 2UZAA 1QV9A 1O6ZA 2W9XA 2BGGA 1U6IA 4OY3A 2VZ0A 3ECAA 4PWYA 3TGPA 1U0OC 2XZLA 2JNWA 1UKVY 2ZZKA 2MCFA 3AFNA 3TW0A 4MR8B 1W49A 2OESA 4R71A 2PX5A 2I9KA 3UPUA 1UODA 4ZCPA 3FOAA 1J0BA 3QSGA 2C29D 2ZUWA 1A0OA 2AJLI 2RGYA 4NS1A 5LOVA 1E5VA 2Q9CA 3OEEA 1KORA 2G36A 3OX3A 1JIJA 1QGUB 3U6KA 1NVWQ 2G0NA 3S7ZA 1JT9A 2LKCA 3Q10A 4O4LA 1I2DA 3IAUA 4U3JB 4W9MC 3L8FA 3Q41A 3BWVA 1FJGB 2BIFA 1L0BA 3H0CA 4WN9B 1XL0A 3CYFA 3EVAA 3AOEC 2YYYA 2Q1XA 3L0BA 1VKZA 3X1WA 2R68A 5C53B 3GUCA 9LDTA 3SXUB 5LU8A 3F6BX 1LI4A 3MTJA 5K0FA 2GZHA 1OZGA 2OYSA 2ECQA 2Q6LA 3E5RA 3EWAA 3OHPA 4JFRA 4K6GA 3SJZA 2KLHA 2AUMA 3CXUA 1YGYA 4TLCA 5IAGA 1M9NA 5JIBA 4Q16A 2VTEA 3F3SA 3OMWA 3TAXA 1JSCA 1HEYA 2BKUA 3N2ZB 1U5BA 3W06A 4Z7QB 5BT8A 5AW8A 2R751 5LIPA 2ZU6A 1DBRA 1FVFA 1I3LA 3IA7A 3ITKA 4EA6A 4LF6B 2XOXA 1XVIA 2GR9A 1PJ3A 1FTQA 2WAMA 4TTSA 1H3EA 2Y66A 2G80A 2O8BB 5C18A 2NUPA 4QVIA 2YH2A 3JQBA 3TM5A 1XZAA 5LLSA 2W70A 2YRXA 4BNJA 1YQEA 1E98A 3HJNA 1UFRA 1JDUA 1U3GA 2JCYA 1TCAA 4QBIA 4DCSA 4EEZA 1QF7A 3DEAA 3QHAA 5IYZA 2Q1WA 1CZHA 1GCUA 2BJHA 5AXAA 2IP1A 4CTNA 3IIKA 3IOBA 1JFSA 4H4EA 4O02B 5EJ8A 4JBGA 4MI9A 5BXQC 4JXZA 2NM0A 1V1JA 4G2NA 3AONB 5FA6A 2IU6A 1SUEA 1VMIA 1JPUA 1W5EA 3DF7A 3SZ3A 3W2HA 1H8ED 3DE4X 4G1BA 2QLNA 4W9RA 1XK7A 1K1EA 1T3HA 3BF7A 4K40A 4D3SA 1UMBA 5BVGA 4P7KA 4V39A 5CXUA 2EEPA 3DM5A 3KYCA 3B3JA 1JHOA 4CMJA 4JBIA 4YAIA 4LJRA 4YRZA 5K0LA 4WY5A 5FDFA 5HXAA 3O8QA 3A27A 3MYRA 4I5IA 4JSYA 3KKLA 3MTQA 1UAGA 1AOXA 3BFJA 3L4SO 1U2DC 2QRZA 1DX4A 4B0OA 1JA9A 2Y0CA 3ZWQA 1K3FA 4V3CA 5L7WA 4QT4A 2BFAA 4JEHA 2LCFA 2EWVA 1B2LA 1KAOA 2FZWA 2X7HA 4PRKA 1QZTA 3KEFA 4X1OA 3SHOA 5HKKD 3MS7A 5B64A 4J1QA 1CR2A 1HDIA 4LJ6A 4EQZA 1BEZA 5KUTA 4B2LA 2I1QA 1Q3TA 2PVPA 5E1OA 4AZSA 4PZEA 4F5EA 3F46A 2WJGA 4E11A 4C5CA 3AP1A 3IH5A 1KAHA 4ZPJA 4H7JA 1YCHA 3B6ZA 4HATA 3HG7A 2F43A 4MCJA 1C9JA 4XLLA 4E4RA 3VDNB 2UYCA 1MOZA 3ZHCA 2GTIA 1MB9A 1VKRA 4IQ4A 2B4RO 1IK4A 1YJ5A 2FR8C 4GOKA 4JEMA 4P0TA 1E7WA 5HKLA 4BVJA 1KEEB 2EJVA 4TXLA 3VMFA 1KO5A 4PRYA 4UUMA 3A9TA 1L3CA 621PA 1H9CA 4RIEA 1UZMA 3RVMA 2CK3A 4EP1A 1I4WA 1NUTA 2FX3A 1E6WA 2R00C 5LD2B 4IIYA 1OH8A 3N0XA 4EKGA 3GJ0A 4HPJB 1YVUA 3JQPA 3RKSA 6ABPA 3B60A 4LA4A 2EQ5A 2OFWA 4AMYA 1XO1A 2BVNA 4JLOA 1IONA 1C9DB 1W34A 1AGXA 1V9CA 2BFNA 1XXHE 3DYBA 3JQ6A 3FZGA 1OCEA 4CTKA 3GZTB 4LF8B 2GX6A 4G0XA 1I30A 3H6KA 2I29A 4HH4A 2HI0A 3SHWA 4ZI2A 3LSYA 1EWKA 2W6MA 2XAUA 3H3XA 4K1XA 4MR7B 1QQ7A 4U02A 3IVGA 2AYXA 3D1JA 2QLJA 3S2YA 2C3UA 2W2XA 3VH4A 1P8AA 3OU2A 5B7QA 1II9A 1CUAA 2RAVA 3DNMA 4E2FA 3M6IA 2Z1MA 1NR7A 3HDTA 3M1LA 4KTTE 1KQOA 1ETUA 4WLNA 3B3FA 1KSFX 4AZ0B 3H04A 2HB6A 3QPAA 1GM5A 3O93A 2NQ8A 5K0JA 1J8VA 2BOVA 3KZNA 3PEEA 5G3ZA 1RACA 1RYDA 1TEHA 1GPBA 5DBGA 1YK0A 1GEGA 1PEKE 1S2NA 1U2QA 2O2XA 2DY0A 5A5EA 1XVTA 4B6PA 1IB0A 1JDTA 2QLTA 4H1UA 4AJ2A 1CY8A 4LZLA 3K32A 3GW8A 3JQAD 5BN5B 3UV3A 4KBGA 3VX4A 1I5OA 1VLLA 2WKWA 3EZYA 3L18A 2QE7D 1Y9ZA 1HOXA 3L7OA 1AF4A 2MOKA 1GA4A 1K8RA 5A04A 4E4TA 1HT3A 3G8YA 3M49A 3ORHA 2H2DA 3W3AH 1KPGA 4TWZA 2IGBA 2FP4B 3QKIA 1IL0A 4TUYF 2X23A 4PPQA 1JRLA 4DUYB 4DR7B 1S2IA 1NNSA 1P75A 2FN7A 2J7PA 2VDWB 1OBHA 4BBPA 3KQKA 1K3UB 3A3YA 3FUTA 1WNTA 2OFPA 1Z5ZA 3PFCA 2H2FA 5ALSA 5HBGA 4DV1B 1EK1A 3WMXA 1RFLA 1H0KA 2O6HA 2SICE 3L93A 3ZNOA 2O9JA 2NXWA 4B81A 1O87A 3GFGA 2EG9A 1FNNA 3FUXA 4HMPA 4I8DA 3D6NB 5KWEA 2F55A 3OC0A 4UXJA 1U0TA 2BGJA 3PNKA 4HN4B 4QUDA 2LCQA 4ZU3A 5A4FS 2PSSA 1S2LA 2PJDA 4B6SA 5C3MA 4ZALA 2Z6QA 2FZKA 1URPA 1FFWA 1W85B 3A1SA 1WL8A 1PJAA 4HX2A 4UHKA 5ELMA 3A6FA 1DDGA 1RLMA 2VHZA 2HLDD 4YJ3F 4E1BA 1GAQA 3WWYA 1MO4A 4GS5A 1CS4C 1PFKA 2Z8YM 2WFAA 4I55F 3EY4A 1VZ2A 2IPXA 3RG2A 4BBJA 2YN0A 2DKNA 3QBJA 4P4SB 4B09A 4KNWA 1WXGA 2I8CA 4LRQA 3UA3A 5KQGA 2F1IA 3GMIA 4PX9A 2PE5A 1TFUA 1WOYA 1FDWA 2P78A 2K5UA 4UVHA 3VBEA 3DW1X 4N4AA 1NNUA 4QE3A 4WZ6A 1L8LA 2H9AA 3IXQA 4JH0A 3CLHA 5JYDA 1RWPA 2BKXA 3QVTA 3QITA 3HCCA 5LJIA 1I24A 4D97A 1S7GA 4GAEA 2B5VA 5EVJA 2WG1A 3EBPA 1P18A 2IDJA 3GXBA 3TMYA 5L3QB 5CDSA 3DLPX 4RQUA 4C7XA 2EKZA 5KKAA 1L9KA 2R8PA 3C1OA 4IY1A 2HJ9A 4QREA 1YJ8A 1Z45A 3A10A 4OK5A 3EISA 3BDVA 5I01A 4O2RA 2JFOA 4RMHA 5BVHA 2JI4A 3E7FA 3B9PA 1IU9A 2W6JA 4XPIB 1BSVA 3RIHA 4WBNB 2R5FA 5KMGA 5DXFA 3UXMA 4MWBA 1ZGAA 2ZRDA 1ZWKA 4RFSA 1CEQA 3B38A 4RLQA 4Z9XA 4EFLA 1I13A 4URHA 3TUZC 2PO5A 4JHXA 3IP7A 2BBWA 3P7MA 1BU5A 3WGYA 4F2HA 3ZJTA 1YMUA 1KVSA 1RMQA 2XYGA 2VSQA 1G4HA 3A9UA 3NBAA 2BSAA 3S70A 3IQHX 3WRXA 1NVTA 3O03A 3KXLA 1WD7A 2GYYA 4HX5A 4JMPA 4CMCA 1WB5A 4PSVA 2TECE 5FQNA 4BY9E 2KQUA 1WXDA 3T3EA 4WY2A 1NVBA 3K70C 2XUIA 4TPKA 2QGFA 4BFYA 4EF6A 1V3QE 2ZAYA 2CNKA 3AEQB 4LJSA 1AH2A 1ND6A 1NUHA 4P7GA 1A98A 3QRWA 3PFNA 4FKZA 3SSOA 2I3ZA 3DTNA 3GZJA 1J8DA 2VFAA 5LB4A 3FCXA 2WFLB 4IHJF 4ARCA 1JR6A 4N82A 2JCXA 4DGQA 4L4ZA 4YP0A 2GCOA 4UTVA 1TO6A 2YNMC 5YASA 2F1JA 3E22B 1EDOA 5HG0A 2B21A 3OT1B 4NDAA 3B1FA 2WHXA 4DLVA 4K5QA 4X94A 3H19A 4WQMA 1RBZA 3DYIA 2G3YA 5FBQB 3ESDA 3VXKA 4O4HF 2UUOA 4JKYA 5MN5A 4WEQA 4M7PA 2FW1A 1QYRA 4FBLA 3LW7A 4EPVA 1MIOA 1I4OA 2HUPA 1SUWA 3WS7A 1CD5A 2A9PA 3NYQA 1SHTX 4DIFA 3F7MA 2GWRA 4EPYA 4XARA 4LN1A 2VHQA 4CVNA 3WJAA 4C2AA 5HP4A 3OZGA 1TUEA 2H52A 5EIAA 2HHHB 2G5TA 2J1LA 3KT0A 4BVFA 1JKJA 4IJQA 4JT8A 4BX0A 1DCTA 4Q93A 1L5RA 1FMJA 5K3CA 2A94A 1KNXA 3UK2A 1O9BA 5CH5A 3I64A 3U6BA 3IVCA 2ZPTX 1X9GA 1E32A 1LLUA 3I04M 2C7RA 1YB6A 4GPTA 3UJDA 4OEHA 3TEJA 3WMGA 2G4CA 5DX8A 4CCWA 1DFGA 2ECFA 4RPKA 2BEJA 2HFJA 2FFRA 3AM5A 2C2KA 3D7RA 3I2GA 5LDDC 3WNCA 1ZICA 4L4RA 4BUCA 1GV0A 1E1KA 5BSWA 1BJRE 3EDQA 1LDBA 1JXAA 2YJ3A 4LTNA 1GKLA 5IDVA 5JZOA 4KE9A 3DL2A 3H5NA 4OMDA 4OJNA 1T8YA 1IK6A 2A67A 3C3CA 4IIJF 1EXMA 4LHSA 2PQ2A 3PCTA 3EPRA 5B55A 1JAIA 1H93A 1UL1X 4YQEA 3BZWA 3NYRA 4JYMA 2WABA 3CC8A 4XB1A 3VNQA 3LJKA 4RV4A 3GNSA 4RK7A 4CMGA 1Y63A 4HS9A 3A70A 1T10A 2ORED 4IUDS 4LY0A 4CF4A 5DU2A 1ZK4A 5JZBA 5D84A 2E87A 5KNBA 4DR1B 3WGKA 1U4SA 4ETMA 1EFPA 3MQFA 1ZJ6A 4NJEB 2BZ0A 5JH7B 2ZE6A 1T5TA 4TMZA 4UU0A 3KUDA 5CURA 1QVZA 1C30A 1QFSA 2AC4A 4X1YA 1SRQA 4IDCA 3M6VA 1VG0B 2C2OA 4UARA 2O3UA 4FEGA 2OGUA 2VNHA 4XJSA 1YAHA 5HBRA 3S1SA 2AK2A 3IDAA 3RUPA 3SXPA 3T3MB 2WQ7A 2PANA 2DPGA 2EFCB 1UFKA 3KL4A 4F72A 2OCYC 3FHTA 2PJZA 2VCHA 3WV5A 1LWOA 4QDOA 1UR5A 5ARBA 1ZD1A 1PUXA 3G7SA 2R7NA 4CDMA 1TU4A 2Q07A 1J1ZA 1E9VA 1KK2A 1M8PA 4HAIA 5A1TA 1TZMA 4EFKA 1GG5A 1BMTA 3QEKA 2VRCD 3D6MA 3F5QA 1T3TA 4TTQA 4QXAA 2PDAA 3NXSA 3WP1B 3PNLA 4XYBA 4UPDA 3N6VA 3HJBA 4YMTA 5FTKA 2CFCA 4YMWA 2QX6A 1V16B 2HO4A 4P0QB 3WV4A 4BKRA 3KJEA 1BCSB 3OU7A 1UAAA 1GTZA 1XC7A 2BBOA 1OXKB 3LY9A 1KEPA 4R84A 4U1RA 4LJLA 4KFCA 2UXCB 3S8YA 3PJRA 2EU8A 4AIRA 1I3NA 1QVRA 2XITA 4I1SA 5LYYA 2DTEA 3FGZA 2RHCA 2Z9CA 3PA6A 2IXAA 3WZLA 1DQPA 3PF9A 2YTZA 2CLFB 4QDJA 2ZJZA 1S1CA 1NY5A 3KO8A 4G1UC 1TQ6A 4XKJA 3VOBA 5CNIA 1NVMB 5K6RA 4FWIB 2BMFA 1NQVA 2IV7A 3G5TA 4AROA 2VYNA 4LXQA 5HF5A 1A88A 1JU4A 2BR3A 2JHFA 1VHWA 3PC2A 1TRHA 5COBA 3ZHZA 4C87A 5CXQA 5GVSA 2EC5A 3VNBA 2VPWA 5C9ZA 1K92A 5JZSA 2DU8A 1XYGA 3E0XA 1D1QA 3D7NA 1L5WA 4UATA 1EA5A 2FW7A 1QFMA 1HEUA 2VDKB 4YQYA 1O8BA 3AUUA 4Y6GB 2X8WA 1EVLA 3AR7A 3OM8A 4FXOA 3LHFA 4QD3A 5A71A 4ARSA 5FOXA 2R4QA 2CNWA 2YJZA 2GLUA 4F6RA 5CCBA 4Z1MA 5BN4A 3FOEC 3I61A 1DWPA 3ZGZA 4YUZA 1LPNA 1OWMA 2GSWA 2QQFA 5KPDA 4IIHA 1N9GA 4JB0A 1EBBA 4C4XA 3E5MA 1EJ0A 4RMIA 5DFAA 3WWCA 5AVYA 1FS6A 3B9QA 4KMSA 3V1TC 4LX8A 1Q2XA 3UY4A 3M6LA 5CLQA 3N5KA 2XV1A 5I8ZA 1TJNA 1T0BA 2XMZA 1HEIA 3N75A 2OZLB 4G23A 5E6RA 2DKOA 3THOA 3Q0EA 4AY3A 3DTVA 4GLOA 4JWTA 1QHSA 3W77A 4R6WA 4RKRA 4XUDA 2EDCA 1VPWA 5A4JA 2NTNA 1E5DA 5J4KA 4PCAA 2VT6A 3RYCB 3TDKA 4QU0A 4O0LA 1Y8ZA 2AFHA 1BW9B 3LGSA 3ZZNA 3CZPA 3K9CA 5KOYA 3A4NA 1C29B 1YHNA 2QJWA 3LSTA 4KXXA 4MV6A 1XFAA 2FPUA 1X80A 3ECSA 2JAOA 4LYEA 4X92A 4Y2JA 5T67A 5JMTA 4MRPA 1B8OA 3KTOA 5ESWA 2WKRA 1NLUA 5JS2A 2NZVG 4LJ5A 3F7NA 3I5UA 4LJYA 4RF5A 3SC3A 2Q5OA 1W44A 3JYLA 5KSPA 4UAUA 4FR2A 3MJRA 4F60A 2C54A 5L3VA 3DTYA 2NPFA 1KAGA 2Q4TA 4D6XA 5G0TA 1TPYA 3VU8A 4Y0AA 1R0YA 3WLOA 4MUFA 4KDRA 1L5KA 4CWAA 4F2WA 3KQHA 3KLPX 2FI1A 1ZEMA 2VJAA 1YE3A 4JLBA 4M38A 4X3CA 3LHDA 4EZEA 3H2ZA 6ADHA 3WYAA 4DDUA 2PZGA 3QWBA 3DLAA 2QG9A 1JWBB 1VHDA 1T0PA 4I8XA 5GZ1A 5KYXA 3MLAA 4PFQA 5HWSA 4RH0A 2E37A 5LUBA 5I6DA 2BCGY 4F11A 1VKOA 2HXGA 4OTZA 1XMOB 3VSEA 4UEKA 2HGSA 4LSWA 3C3JA 1VL5A 3SQDA 5HCIA 3HV2A 1BG6A 3SICE 2X1LA 2DG2A 2J6IA 1L7EA 3V8NA 4GI1A 3G9QA 3L1KA 2PX2A 4ZOLB 3DEFA 1L4UA 4L3WA 2WLSA 4RULA 3LZDA 3ZV7A 3AOGA 1EDDA 3FRHA 4EJSB 3KSUA 1KRXA 2FGJA 4X1KA 3GUVA 4AKGA 3CF0A 4GO1A 2OFOA 5BNWA 2QR5A 4KV9A 2I4LA 2XX3A 4LYGA 2PXAA 2REOA 4N0PA 4JB8A 4KFTA 5ADHA 5KSYA 3OTOB 3ESXA 1OBCA 4FOPA 1BROA 4J29A 2NV0A 4HWPA 3R20A 1Z4PX 2P9ZA 3KJHA 5EEHA 3GJ3A 2JLCA 1TX4B 2P35A 1R8QA 1TDJA 4L95C 4MUEA 5AOVA 4B4OA 4D41A 5JDIC 1QIJA 3JD1A 2I7VA 4HAWA 2HFKA 2FPMA 3MZ0A 5L4SA 3GVHA 4DG8A 3GRKA 3QUBA 4IMRA 2FSFA 4L22A 2RHLA 1T15A 2Q2VA 4LRXA 5IM4A 2H3EA 4G9EA 1UJMA 4RF3A 1PZMA 2LUOA 2RI0A 2FWBA 1BRTA 2LW7A 4WW0A 1TK9A 1VE6A 2VSYA 2FPGB 5M3BA 4XWKA 5KTYA 1X74A 2UKDA 3A9RA 3N58A 2ZRCA 4TQ9A 3U13A 2AEJA 4V0OA 1FZTA 1GRVA 1L3IA 4G01B 1JTVA 1ZN2A 2P40A 4JVNA 2PLWA 2P2DA 1H6AA 2ZETA 4Q9DA 4CL0A 2AUTA 1K8QA 1P5JA 3I23A 3LKVA 4JI2B 3KQSA 2QUIA 2J0UB 1ADBA 1JBQA 2QP3A 4NAHA 1TUIA 3K0AB 1WXHA 2WQZA 3ZOKA 1E5QA 3O9MA 4C4AA 4CIBA 5IH7A 1HLDA 5J63A 2IKSA 4H6WA 4KXFB 1NVUQ 3TNFA 1IOZA 4O3MA 5G0SA 3GHYA 4YIHA 4WCFA 4J0GA 4AJEA 4HXFB 3JVVA 3RD5A 1YXMA 3CE9A 1GPLA 5TPWB 3G6WA 1TEXA 1DTWA 2VAXA 3EMVA 3CX4A 3EIOA 4F1WA 5DM70 2BWJA 3LZ6A 1SBQA 2JPDA 4OUDB 1AT1A 5K3SA 1IOVA 3BL6A 1X1BA 4PYRA 4C14A 3KLBA 1RXCA 4ENPA 1KF0A 3JZFA 2ZB8A 1U6JA 2JKZA 3DC7A 4JQOA 5CTJA 4U7DA 1A9QA 4L4YA 1Z7WA 1RYNA 2VPPA 3MAAC 1VA5A 1NQTA 3OE7D 3O8OB 2XHEA 1ESEA 3NFRA 4QTYA 1J49A 3QG1A 2WQ6A 2ZUEA 2DUJA 1W5SA 2F64A 2IYEA 3NOVA 1FXWF 5EUBA 1H0HA 1ZK0A 2BMEA 3VVMA 4GM4A 4GZ3A 2FSPA 2I33A 1JW9B 3VO8A 5CNJA 5HFAA 4FDMA 4MI1A 1NMYA 1E1QD 1M2KA 3F1KA 1DE0A 3C8HA 3DPUA 2WOJA 3AJ9A 4I50B 1NN5A 1QFXA 3QXHA 4M0CA 3VYUB 2ZYRA 4YO8A 2UZ1A 5KAPA 4E94A 1W35A 1PR0A 1ZVKA 2J9ZB 1Y6QA 1LRKA 3NR2A 3P9QA 5IZCA 5LXTF 3WMWA 3H16A 3OQHA 3FPKA 4EHBA 1GADO 1K3TA 2CLDX 5NULA 2OLKA 2A57A 3P9PA 4WTOA 2PKEA 1BE8A 1MQAA 4DVJA 2R44A 1KMQA 2IOHA 2XUJA 3TD2A 2VTBB 2AI2A 2AJDA 1EK5A 1ULTA 2GESA 2J48A 3WJ1A 2YY5A 3AEUA 3D6VA 1YASA 2CE7A 2HADA 3HB5X 4PTLA 4AG3A 3OD5A 5B3LA 5IABA 4NZ9A 3WLIA 1JEYA 3PHLA 5EQJB 1PTKA 3EXG2 4JX9A 4BE9A 4D7AA 3BFXA 2ZI9A 5GVRA 2P5SA 4NMWA 2A5DA 4OGKA 4Z8YA 2WKQA 3ICQB 1SQ5A 3FNBA 4G1FA 5FUWA 3TRJA 2OWDA 2NAPA 1ZVQA 2GA8A 1SG0A 1XDGA 3CZCA 5I7FA 2NYUA 2O2CA 4KXMA 4G0UA 3TQRA 2PKQP 5B6JA 2EHJA 1PR4A 4E5PA 1I1NA 5F3WB 1JECA 1E2MA 1IATA 1V8DA 3A9CA 4L7QA 3V6MA 2CWWA 2P9FA 3QK7A 3EG5A 3F4LA 4H0CA 2RJNA 4FIDA 2HPZA 3RRNA 3O1LA 3LWZA 3SYKA 4B87A 4DYVA 2IYFA 2IOFA 4X00A 4Q19A 1DJMA 2WT9A 1S8FA 4JGGA 1EFVB 2P7HA 3TLZA 3FYUA 1W0JA 1EX1A 1QBKC 4O1HA 3R6LA 2FLVA 4PRLA 2JIPA 5C51B 1U4NA 3CLKA 1YB5A 4DZTA 3ZDDA 3PLNA 2IRWA 5ESRA 1WG8A 4MGKR 4Q34A 1K7CA 3QKTA 3UTDA 3AETB 4PVDA 4PNPA 1QP7A 1QYCA 1ZKMA 2IX3A 4O5OA 3HCAA 4RBNA 3BZUA 1M8FA 1SVLA 3LWDA 3ZGLA 3PENA 4DLTA 2ST1A 1X70A 1AGYA 1QBGA 3ZE2B 4DM4A 3YASA 4A7PA 3EWNA 2WWHA 4BJ3A 3GJTA 5DW0A 2HSEA 4QRHA 3I34X 1YSCA 2YWHA 3GEGA 1R74A 2HSDA 2R87A 2XF2A 3PPYA 1ZSVA 1IZZA 3CLRD 4X90A 3S68A 3Q7EA 4TLBA 5IAOA 1KETA 4X8LA 2BM1A 2X0JA 5B2EA 3MWDA 1E4EA 1OLUA 4L8WB 2ZZNA 4X41A 1WZCA 2WP8J 4X9XA 4XQ9A 5FPHA 4KRFA 1E7MA 3FBTA 3B9BA 4KN8A 3WQHA 3O2NA 4UHBA 3D64A 2CYAA 1LKZA 1E62A 2AWOA 3Q3GE 2CSXA 3ZJ4A 2W00A 1GZHB 2Q29A 4GC9A 4IZ6A 4MB0A 5ECYA 1ZVVA 2D4AA 2XCOA 1SXQA 1IOWA 3PGLA 3OSUA 3NDIA 4TN5A 2YVAA 2YMMA 1JGTA 4U7TB 2IP2A 1A2OA 1CCWA 1QANA 1SHLA 2VT2A 4HGPA 1YIAA 4E7OA 1FP1D 4HNSA 3WYCA 1KZ6A 2O5CA 2J32A 4YAJA 1X9IA 4NJMB 4YN3A 4D0NA 5HZKA 1XVAA 3DB1A 4RY8A 1U7PA 5HIAA 1NN1A 1U04A 5IPFA 2J3KA 1K8XB 2IF0A 2ZJ3A 5PNTA 1SKQA 1JHQA 1QTRA 2DFDA 3CWCA 4LC1A 4OAQA 3ET4A 3W2FA 3S2UA 1VLVA 1NKVA 1L4MA 3K5PA 4C6HA 1LTKA 3PI7A 3V7UA 5JJLA 1GT6A 2ZW9A 1N6PA 4ENWA 1NT2A 4LHEA 3R0ZA 2QX4A 4D8TA 1XD9A 2CDBA 2DY1A 2BMJA 3DHYA 2EFJA 5KC8A 4B3RB 5K8UA 5CVJA 4MULA 1T8RA 4FEAA 1Q6YA 2D0PB 4RGBA 3E2MA 3ZQ4A 3OA2A 4F21A 5C8ZA 1U8AA 1T35A 4YJ2F 5KYVA 4Z7JA 3HP1A 4QM7A 1FP2A 1H1LA 1Q1BA 4NYJQ 1OLXA 3PRYA 1YRHA 2J3HA 4JQSA 1M76A 3EN0A 3G6KA 5L9AA 2VK8A 3QOWA 4EG4A 1Z5GA 1MFZA 5TVGA 5L45A 4QAJA 1C7FA 2HU8A 2VDOB 1A8PA 3LUGA 2B7CA 1V1MB 3MQ2A 2JZNA 3O9VA 4TUYB 1SOUA 3VPBA 2VK2A 3H5OA 4CM3A 4BMNA 2VG8A 3DEHA 3UWKA 2AI1A 2JLQA 1HETA 3PDHA 3SCZA 3TPFA 1U63A 1D6MA 1LGYA 1MDFA 1Y9AA 2HZ7A 3ELBA 3OJOA 1O3YA 1X7WA 2DH5A 4G8CA 4OXYA 5CP8A 5AW4A 1EP3B 2E85A 4D96A 1LJLA 3SS8A 4O2AF 1WEHA 1RRPA 2GJKA 3GR6A 4EKNB 1MOPA 1R2QA 5C46F 1KHTA 1PN3A 3MPUA 2Z2IA 2R8BA 4JLNA 5FORA 3F8WA 5JZVA 3WL8A 2F6RA 4ZYUA 3N2GA 1HO3A 3VVCA 4TXHA 3QVGB 1TA0A 1FRQA 2WJ4A 4UDYX 3WGQA 1ZHFA 3JQ8B 1LCIA 4LCBA 1H4SA 2G6BA 3NTVA 2NZ8A 2RKBA 2QXYA 4LXYA 2V6IA 1RE0A 1NW6A 6YASA 3Q8KA 1RAIA 2OFFA 3GRAA 3UHPA 4GGPA 3R0IA 3STWA 4CLHA 1M34A 3L7NA 2BP7B 2C9CA 3RC1A 3IEVA 2W90A 2VZ8A 3MOGA 4R1QA 4AF7A 4D4MA 2IDZA 5JWRA 3ENNA 1TJPB 1C80A 3C8UA 3WKCA 4BZWA 2ZM5A 3LT0A 2HCTA 2YWJA 3KXKA 1POXA 2I54A 3O2QB 3C14C 4IPTA 1NU8A 2QG6A 3CLSD 3WDMA 2CLLB 2NYRA 3SJ7A 3W6PA 4D9BA 3OZRA 4L9WA 4PCUA 3G0HA 1WBJB 1U1DA 4F3RA 3X1ZA 4CDRA 1B0ZA 3FD8A 5ENDA 5TR9A 4BN5A 4CPDA 1K8ZB 1IJEA 3CGGA 5GM2A 5U1PA 1T0JB 4PPGA 1F2VA 1R18A 3AY0A 1IBKB 3LCUA 1FYXA 1LPOA 1M5TA 1DC8A 3NWPA 4I1YA 1P0FA 1VKHA 4LQ4A 3RC3A 3KSBC 1ISGA 3D4LA 2XJ4A 1P2VA 3TD6A 2F48A 4L5CA 2VIIA 1ZA1A 4MQEB 4BNDA 3MGGA 1JHYA 1KO4A 4V0KA 5EY5B 3DLHA 1VG8A 3B9RA 1HXHA 2V7QA 2VLBA 3D54D 1DUIA 2GEDA 3HVKA 5F7ZA 5C3UA 3SYMA 5DNUA 4LNUA 2ZRQA 4G2TA 1K0FA 4CKWA 3DMTA 5A6SA 5KQPA 2Z6AA 4HY3A 2MMCA 3HCBA 3BXZA 3HWWA 3EASA 5IKXA 3PIIA 3PUXA 3PWTA 4HUTA 1XX6A 3AKCA 3GPDG 4NY1A 4K6HA 4PONA 5DCWA 1C3OA 2CLOB 4OHBA 1ILEA 2KM1A 4GWGA 2FXVA 2YIMA 4H17A 1KU6A 3S3TA 1YQXA 3AERA 1LZLA 3KHKA 1BGVA 5BMVA 2BFPA 3TJMA 2G72A 1V5GA 3A25A 4FCCA 3RVOA 1U9IC 4Q4CA 5K4GA 2GM3A 2RSLA 3G2MA 3G8BA 3H2HA 3MIZA 1PJZA 1N1EA 3WGMA 3CW2A 1W59A 1XCLA 1EFRA 1HI9A 1NXWA 1VIVA 2BEVB 2JAQA 2ORIA 2IXFA 2Q2NA 3M1AA 3R3YA 4HTFB 4IFTA 4Q3DA 2FN4A 4P86A 4RFVA 1AKQA 4KO3S 5KJFA 5H5JA 4U6SA 2V9PA 4Y1EA 1CNFA 5EPEA 3GLIE 4ZHQA 1IZ0A 1AXGA 2WV9A 4LGCA 2IBMA 2PKWA 4PPFA 3UJ9A 3OZ7A 4O4HB 3LCVB 1RYFA 2QN2A 1CC1S 4XOUA 3RUDA 3JX9A 4XGKA 2EF1A 5CEFA 1YBFA 3ZK9A 2G17A 3HCEA 1XSEA 3DMNA 1JKFA 3DO5A 3OJEA 4JLSA 4IIFA 4LGYA 2ONCA 5K0ZA 2PUCA 2B35A 1CUCA 3GPCA 4OX9B 1Y3CE 5GM1A 1VJ5A 2DBYA 4GFDA 8ATCA 4S2UA 4MV7A 3M1IA 4G86A 3STYA 2AMLA 3EHDA 2HTEA 5FBLB 4G36A 2BFEA 1YUBA 4JOBA 1XUOA 5CVVA 1BA3A 4EQ6A 1TUBB 3C87A 3IJRA 3KZMA 1RI1A 1XDBA 4MVJI 1PK9A 4QOHA 2I55A 4GXNA 3EVEA 3U3JA 1P17A 3VISA 1KFJB 2ZTVA 3Q7PA 2O4CA 3NIWA 4G8JA 1G3RA 1QP8A 1YKGA 3R5JA 3F9RA 4J1TA 3TQIA 2AR9A 3OF3A 4RH3A 3WISA 3JYQA 3OMXA 5IH3A 3IMFA 3LX4A 5BWNA 1OBFO 3D2BA 1FUIA 2CZGA 4MWCA 5AI8A 1TM5E 3QVLA 1WXFA 3WFZA 4FU0A 3EULA 4CMIB 3DDOA 2ZBFA 1A8HA 3GLQA 4NU8X 1IN6A 4KNVA 3MAGA 1FDOA 1ZN7A 4YV0A 4IIJB 4LRSB 1WOMA 2MTBA 1QIEA 4H3SA 4LY6A 1GDTA 3I2JA 1NJFA 5CBPB 1G21A 3SMVA 4Z0TA 1P7ZA 5G40A 2HNAA 3KK0A 1U7WA 3DZCA 2P4UA 1D04A 5AK0A 5K09A 3C3DA 4HGRA 2CVFA 4ND4A 1JA0A 1G8MA 4O0MA 1EG2A 1YO6A 1XN4A 3HBFA 2CDCA 1ZNWA 4DMKA 2JGKA 3UAYA 1HQYE 1QC5A 3MGAA 5LN1A 5TMEA 1E9EA 3B36A 3H2BA 2A3RA 2B8NA 4I1OA 1NRWA 4HPXB 4XSVA 3V4OA 4YYEA 421PA 3KR1A 4WKPA 4GDFA 1QZZA 1T2UA 4GSYA 5CXXA 2I3AA 3W1WA 4RJLA 2J3EA 2XXJA 4J0IA 2REQB 3LBFA 3PYLA 3QE9Y 1EZZA 1EESA 4ZVUA 5HA5A 2WBLC 2Z2ZA 2P6PA 3HO6A 1CY1A 1NP7A 1EM8A 4KVFA 5T8KC 1X7ZB 5M7EA 1NSTA 4OBBA 2AKEA 2RGNA 3DOUA 4M0MA 3I6BA 4JP2A 5EE3A 4B6OA 3EF0A 4M98A 1KBZA 1PGPA 3IAS6 4Y30A 5DTRA 4H2DA 3FZYA 4BMZA 1Z26A 3HY4A 1A1SA 2WJVA 2ZBVA 1S89A 4QUIA 1D0IA 5I3ZA 2ODQA 1NF2A 2Y0PA 1Z56C 2GEFA 2L17A 3EUAA 3O95A 2HK8A 2IYAA 4UUPA 5LYJA 4ASUA 1QFZA 2O0LA 3WB0A 4RKQA 4CIXA 1NI5A 3NTQA 3LLVA 4EA8A 1JXOA 4XH9B 1NMXA 3MRXA 5B1SA 3STHA 3IR7A 2XBMA 1DWOA 1JQKA 5FA8A 3SQMA 2FZCA 3F0TA 2VHWA 1NDQA 3TAHA 4M9SA 4K2HA 4AKSA 2X6RA 3GF4A 3E3NA 4C7OB 2O8DA 1L7XA 4LSGA 1VJTA 3SEQA 4S1PA 4ER0A 3HACA 4H59A 5FL7A 5DP2A 3VH1A 2I0FA 3B1ZA 4LF4B 4L2IB 4ZYWA 3NHUA 4OAPA 4Z4IA 4GXTA 4UTOA 4R1PA 4PCLA 4UM9B 5EXXA 4FT2A 1DCKA 3JAWB 1NW4A 1TI7A 1I9GA 2WILA 1Z15A 2OXRA 3KTAA 5BWCA 4MVJA 1FXSA 5G3YA 5DYNA 2UZ3A 5GQSA 5KYWB 2J4FA 5C2JB 3TXYA 2JK0A 3BMNA 3VTAA 4DE5A 2HK9A 1KJZA 4TT3A 4BV3A 4FMDF 3GLFB 1AKEA 2FSUA 4I8IA 1PZHA 4I66A 3TTUA 4AJJA 1BRMA 5EA2A 2Q3BA 5A0FA 4BZQA 2D7JA 4LG1A 5CB8A 4O6VA 2OUKA 4TMWA 1SVUA 3JAKA 1AKUA 1D2NA 3O3NB 4C43A 1TO2E 3KAJA 4TT8A 1F17A 1FCJA 4RA9B 2V97A 4UAGA 4QSHA 3AVYA 4UQOA 5CM2Z 1E8MA 4GSLA 3GLUA 4JKIA 1Y8CA 3CX8A 1GA1A 4IFIA 1F2TA 2XQIA 3CH7A 2WICA 1SPXA 3CBGA 3TTWA 1U8TA 3QBVA 3L41A 4EH1A 3IOMA 4Q9AA 1R5BA 3D8SA 4R6XA 5D5QA 1NHGA 1SUCA 2VRBA 5ADVA 3IP6A 2AHOA 4E5MA 3DKPA 3KKPA 1P2TA 3R0VA 2BT4A 1SC3A 2HD4A 2QTZA 1G291 2LNDA 1LJ8A 3EVGA 2AEFA 3OKPA 2GRAA 2ERCA 1JDBC 2G1KA 2PBZA 1LC3A 1U2DA 5K2MA 4DDVA 3OM9A 3KJZA 3P19A 4FOOA 4DC9A 3EXEB 3LRTA 2VEDA 1UOPA 2R6GA 2GTPA 3PSHA 1WMAA 1Q91A 3KJIA 5E2AA 4E32A 1B6GA 1F9AA 4ENQA 1E2FA 4CLEA 1W36C 5T4FA 3MWGA 1XV5A 5I9TA 4Y2PA 1ZBQA 4GP7A 4ILEA 4WBXC 1IQPA 2VYVD 1HNXB 2XLBA 3Q5GA 3BK1A 2E1RA 2QU7A 1Y9DA 2Z30A 3AXTA 4GR5A 4BLOA 1USKA 2H1WA 1RYBA 5KWIA 4KQFA 4GKAA 4C78A 5MHTA 1N2ZA 2ZR8A 5A03A 1WTCA 3T34A 1D5CA 1OY1A 1Q1ZA 2AA3A 3FYDA 5CLJA 3UKOA 1XMJA 1NNI1 4WK6A 3I6QA 4R8KA 1AE1A 1IPHA 3DWEX 5B5SA 4RPGA 1KU0A 2PZFA 7ABPA 1NLZA 2FR8A 1AIPA 1VIDA 3TNDA 3ZKWB 1EJ6A 1WCYA 3QMVA 4TKVA 2CUNA 3UOAB 1VQ1A 4MX8A 2O2EA 1NQXA 2O07A 4ZO8A 1FDSA 3WSTA 5FXMA 3UT5A 4R0NA 1ZOIA 2G82A 4IRMA 5HF8A 4UOEA 1A9XA 2HN9A 1KXZA 5DWDA 2R00A 3K1JA 2UAGA 2EHDA 4N39A 1H2YA 5HTKA 1P19A 2A8YA 5J1SB 2GCPA 4XX0A 4R1TA 3VDQA 1PQWA 4BAGA 2HYDA 3GDFA 2Q4BA 3MUNA 1L7VC 1L4KA 2P9GA 3F4BA 4NE2A 3E27A 2HQRA 3IKVA 4IOLA 4EKEA 4BV8A 2B92A 1A8QA 1W4RA 2Q62A 2J5RA 2ZVJA 1V5WA 2OD9A 1XHEA 1YE5A 2VH1A 4IGEA 2C5GA 3ZIAD 1FC0A 3IB6A 3CH6A 2K2QB 2Y4OA 3IR5A 3GC6A 2KI5A 4OA8A 2PPLA 1ZGHA 3B2EA 3PJFA 3EZFA 3OCVA 4YCSA 2QIOA 1GD1O 4ZHSA 1N2CE 3IPLA 3KXDA 2C5HA 2CFSA 3GBPA 1DBSA 1JR2A 1G8HA 4OQEA 1U3UA 4BOYA 4BTLA 4CV2A 4X7RA 3KALA 5LMZA 2Y71A 3C5WP 3GCZA 2ZT7A 3HXOA 1OB5A 3IE1A 5KOJB 1A7JA 2AGVA 4MVCA 2F4NA 5IAKA 4CIAA 3TFWA 1NF9A 2IEAA 4H4CA 2JLZA 1AMNA 3ZBTA 3H11A 2W4IA 3KU1A 1W0KA 4XYMA 1ZJWA 3IPXA 3DOIA 3K0CC 4JBNA 3VAYA 4E09A 1DRVA 2DUMA 3D02A 4HH0A 3V4FA 4EKYA 3IE0A 1KP3A 3JQGA 5TMBA 3ZCRA 2XRZA 2QTHA 3RIEA 1EUCA 1A4IA 1YCDA 1E7QA 2JAHA 3CHYA 4IGFA 4KQGA 4RVNA 1QP0A 4S0XA 4HVLA 4D9KA 1XKQA 1ORWA 4GR9A 3BSSA 3N2KA 5ADWA 1Y48E 3LFTA 1E1DA 4UU1A 3LUDA 2AXEA 1FP6A 4KSBA 3IBCA 1Z4OA 1WHTA 3DR5A 1KKUA 3SSNA 2VHCA 1JWAB 1IXYA 2JDID 2YWBA 1XB2A 1WUTA 1NXQA 2PRYA 4I1RA 4I6GA 1BQ4A 1J2EA 4TS9A 4Y6LA 3VYWA 3F8SA 1IY9A 3CLTD 2JA2A 3CR7A 3EA0A 5JAMA 5J2UB 5T6MA 3LH5A 3ZQKA 3RS8A 4F9FA 2H16A 3N0WA 2HEGA 1FFGA 4LQDA 3COPA 3CTMA 4QEZA 4J94A 1YZFA 5ALEA 1P9RA 1ZD4A 5K8TA 4ZEXA 4HSGA 2CDRA 4RQBA 3QE3A 2XRFA 4KLZA 1RAFA 3Q12A 3CR8A 5GAJA 5KYGA 4FS3A 1F1JA 3DBRA 1XQ1A 4UUNA 3VNVA 3FMIA 3ZCSA 3SYTA 3JQ7A 1H2HA 3QMPA 1KH1A 3D8HA 1WSAA 2VP0A 1GQFA 1RI5A 1J21A 4AMBA 3KDPA 3PQFA 2IBTA 4W6ZA 2I2FA 1QKJA 3G7NA 1R4MB 1RQLA 4UM9D 5FTMA 2KBFA 5JNWA 2GJAA 3V2IA 1CXZA 5F77A 4D80A 3I45A 2QD4A 3EGWA 2R85A 4N3CA 1LNQA 3H2JA 4R16A 1KOGA 2C1EA 4JP8A 1RIIA 2M32A 1W1UA 2HQOA 4C7MA 4BPBA 4M99A 4TVKA 1Z5VA 3EBOA 4H3VA 1AQYA 4P36A 3EAGA 5EYPB 3M0EA 3OJCA 4NJOA 3GYBA 1FMTA 1OREA 5ILQA 3EVFA 5BQFA 3K2QA 1OPXA 1P3DA 4TKZA 1SURA 3OQIA 1RQRA 2DFLA 4W8HA 3O8BA 3KYDA 3T94A 1HKHA 4W1QA 1P5FA 3KAKA 3BJRA 2FQ1A 1ZOLA 4H6VA 2Z6UA 3L0PA 3ETDA 1PKEA 1RIFA 2DQSA 5F4BA 3EWSA 1L8AA 1PT8A 1NBMA 3FVQA 3F2VA 3IQGX 1Q7TA 4N7JA 1K7EB 3NJ4A 5K3DA 4X8OA 2O1SA 4CM9D 4Q9KA 1MFPA 3G9XA 4FDTA 1L5GB 2XGJA 1VBNA 5DRYA 2QZJA 2FPLA 1L7PA 2AEMA 2QMUA 1H5QA 4MSUA 5TJ9A 4R31A 4YEDA 5T4HA 3CG0A 3M8KA 3VR6H 1FF9A 2P90A 5HPYB 5BRNA 1CJVC 4JJGA 1ZPDA 4GG1A 1CLEA 1NVAA 4CQMA 1BTOA 1PFVA 3WL4A 2OLJA 1BOOA 3IQDB 4MS1B 2PHZA 7REQA 1VIAA 3D31A 3WZMA 1ORIA 1JG1A 4II2A 3RTBA 2V6BA 3DMPA 1QYWA 1A5TA 4HEJA 1II8A 2HO5A 4LJ8A 2Z5VA 1M2EA 1I2MA 2VPYA 2WVHA 1S3FA 1DS6A 4GPAA 3JALA 1NBEA 4IMIB 2DQ4A 4P54A 3RFUA 3W6NA 4MUXA 4H08A 3BQ9A 1CRLA 5B7NA 1RI2A 3IEKA 1KZYC 3WLLA 4DOMA 3UC5A 2PEYA 1OHHD 3GLGB 1K4MA 1SWWA 4XTCS 4DCUA 2GZMA 1CUFA 1JLMA 3O1HB 2GPYA 3T5BA 2PMWB 3H2GA 1C1HA 2EBWA 1UC8A 4HGNA 2ZVPX 3QYPA 3E7DA 1G0NA 4NESA 4Q7JB 7GPBA 1AZLA 4IX9A 1GOTA 3MERA 4N3BA 2QM0A 5FYDA 4DMUB 1YKSA 1ZL2A 2QK4A 4LW8A 5FOVA 3STUA 2BR5A 2JBAA 4J16C 5DHTA 1PWYE 3AMVA 4PLWA 5FBHA 2GJ4A 4BKPA 1T25A 2XY4A 3P0HA 2ECKA 1N57A 2BTOA 2YFHA 3DOJA 3EF1A 2DT8A 3QFHA 5H1YA 3EHEA 4AJ4A 2DQYA 4YV2A 1ZM3A 4EYEA 1J0EA 1PSZA 3UCXA 3MRSA 4HO1X 4U6QA 3CLRC 4AS3A 1P1FA 4K03A 5KB3A 2OP0A 2PUWA 2H65A 2QY9A 2V8BA 1UEJA 3PDIB 4N0QA 4NBRA 1IXSB 2EBFX 4DDMA 4DUGD 1BXZA 1UZNA 1IE3A 3WQRA 1AURA 2R8OA 3QTBA 1JR3E 2VXOA 3ZDEA 4BNMA 4XSGA 3BJZA 4C0SA 5JSFA 5AKHA 4Q7MB 2BFBB 3NORA 5F9MA 1GPH1 1RRCA 5EFZA 1S3GA 4PRZA 3TGWA 3CWQA 4AQDA 4FZ5A 4OFWA 1HLPA 2H1FA 5A0VA 4BMDA 3VSCA 2W6OA 1KTVA 2ADOA 1RJ9B 3GD7A 1IN7A 1EUDB 2ONKA 2ZQZA 4M8LA 1K9VF 2PH5A 2W37A 4MIKA 1GXSB 5LQRA 1E2PA 5IBRA 3ITNA 3L0OA 3AR5A 4FMPA 2E5WA 2CFTA 3L01A 2WLTA 4GPZA 3AQIA 5CDFA 5CYPA 5DCUA 1QDLB 3GLHB 4D25A 3E5NA 3QXSA 4I5DA 4MRNA 4G5OA 2X9NA 3KV1A 3K71B 1QCZA 2POCA 3JSXA 3FUUA 2WTUA 4CTMA 4ISBA 2R84A 3E03A 5FNZA 5B1HA 4KACA 4UZFA 5CPFA 5DGCA 1E1NA 3E9ZA 4H27A 4ZDKA 3C7TA 1TLTA 2NVWA 3FNIA 2KE5A 3PEWA 1P4RA 2D2FA 4OLAA 1IWBB 1GITA 5AOCA 1C9EA 5TGZA 4YJ2B 5ALPA 1DLJA 4G5XA 4A2WA 1SO8A 5DZSA 5E6UB 4DAOA 1E6LA 5A4MS 5DN6D 1QIGA 2IXEA 2OG1A 4TTVA 5DTIA 3H1BA 3SBEA 1MAVA 1NJ1A 2ODTX 3EZLA 4RENA 1L5OA 4Q9LA 3DDSA 4EG8A 1UEXC 4JU9A 1ILWA 3HHEA 2HMVA 2YZ7A 1YMVA 4HLUC 3D4PA 4EB0A 3AR6A 1R6BX 1FSSA 5JRJA 3GARA 5ERXA 1B16A 2GWHA 2J9YB 2JD2A 2AQIA 2Q5JA 4RVUA 3EFBA 5EE0A 2V7EA 3SP1A 1IUOA 1YS1X 2I80A 1Y8RB 2GN0A 2HCBA 5IDWA 3CFYA 4JBLA 4J0DA 2BF7A 1T2VA 3UJHA 4XQCA 3CJTA 1E7RA 3GRCA 3ND9A 3QE2A 5KTNA 4O1MA 4L27A 2P0YA 1FNCA 1A95A 2I8LA 2IYQA 2GEVA 3CZAA 4O2AB 2GERA 3UMGA 3D2AA 2R1VA 3BMCA 3N70A 2EGUA 4HUQB 3M70A 4LYYA 4CLRA 1ZCFA 4OJTA 4P33A 2Z8ZA 3R0XA 2DUWA 4UMDA 1FFSA 2IFTA 3O1IC 3RYTC 4BQQA 2RHGB 1K86A 1EIWA 4RWEA 4JA2A 3PQ7A 4P53A 2VP9A 3AM4A 3COZA 2XOKA 1N0VC 2IA5A 1SC6A 4JYCA 2H08A 3H9BA 3QELB 3KZCA 1KERA 4G0MA 1J2YA 4IILA 4O4IF 5CB4F 1VL2A 4PTYA 4N6GA 3QXCA 4XGRA 5LPNA 2DETA 4KAJA 4J4HA 1ZR4A 1Z47A 2HYIC 4LXXA 4WXMA 3W8RA 1NVEA 4OGLA 5HE9A 1OXBB 2BJWA 3SE7A 1OLSB 2Q7DA 4EVQA 2OQRA 3AHJA 3KUKA 1W581 2FLKA 1TGYA 4ZQGA 3HDGA 4CEIB 4DM3A 1UDCA 1Z75A 3RF7A 2BI4A 3BK2A 2NVBA 3D5QA 4BLTA 4KGDA 2YN4A 1M73E 2XXBA 3FX2A 3PQ5A 2CHFA 4GE0A 2MWMA 1MO5A 1GPMA 3GT3A 2HCJB 1JLHA 1WW2A 1CE8B 4ZVMA 1W29A 3TIFA 4YT4A 2ZANA 2Q1TA 5AVSA 3BD8A 1G7TA 3HR4A 3QKWA 4IVNA 3PNOA 4RL4A 3I62A 3UBTA 1ID8A 3E84A 4HWKA 1FEZA 3GLKA 1KZ1A 1D5WA 1S4MA 3AEZA 1G20E 1YZVA 3K5WA 3PLRA 3U17A 4F0JA 1PUIA 3CSUA 4E08A 1IEQA 2I1LA 2IS4A 3IULA 3FDIA 3PC4A 1D9XA 3QKSA 1L4GA 1ORTA 5L3SB 4CR6A 3P2IA 1LFAA 2X4LA 4M37A 1N2IA 4RY0A 1RQ2A 2JLRA 1G98A 1E3WB 4O4LB 4V02A 4D42A 3VR5D 2P2SA 2J8ZA 1PGOA 4ZI5A 2RE8A 3NWEA 3ZZTA 1XTPA 2XI4A 4YI5A 4YIKA 1RXEA 4OU5A 2AS0A 5KYNA 4QL3A 3THYB 1Z12A 4NBVA 3DLCA 1D2CA 3BWDD 1JHUA 1R4NA 1ZUNA 2ZIFA 3MMXA 3ZHRA 4YRNA 5JBQA 3SIXA 3HXMA 5AVXA 1T8UA 3DE2X 4WGFA 4TZKA 1XMPA 1GUFA 3T5MA 3VGPA 3F5MA 1H94A 4A73A 1C4OA 4HNRA 1Z8HA 2EWWA 3EEFA 1AGRA 3CMMA 3JYNA 4PHHA 2GHQA 2IZ1A 3FTCA 3LPCA 1BNCA 5IJ0B 5CLLA 4UASA 4DCNA 1OIWA 3L0ZA 1XWIA 3TOCA 3JV7A 4UM5A 5TPZA 2DHRA 3KP1A 3JD4A 3I72A 1O95C 4QBGB 5DHPA 2WM8A 2VYFA 4P9NA 5FAXA 4YAGA 4R8VA 1JHZA 1LVGA 1TZBA 2NUPB 4LXGA 1YS2X 3N8HA 3P9IA 1JQ3A 2PMBA 3CNNA 4JDPA 4YROA 3TK1A 3ICVA 1TC1A 3L7AA 4XA8A 2QMHA 5DNCA 4MLPA 3IVMA 1Z7YA 3HVJA 1BWSA 3UW1A 4DSAA 1W8IA 3DZKA 1OT5A 2F67A 4KPUA 2H2WA 4HNAA 2H7VA 3PQ2A 3T4PA 1X15A 2XYVA 1E3TA 2BFCB 3MBOA 4HDKB 1OA1A 3SPXA 2HWWA 3G9ZA 4Y18A 3WAKA 4FYHA 1LW6E 2GN1A 2OP1A 4WOKA 2XQGA 1J8YF 4EUFA 3MCVA 1HFEL 4EB8A 2VN8A 1JSXA 2DM6A 5FRDA 4RUKA 1C41A 1S1MA 1UMBB 2X2PA 2AZXA 2I4MA 3KIPA 3AUJB 3NZEA 4XFDA 1ESMA 2CLKB 2DJ5A 2B98A 3K20A 3TR0A 4TRRA 3PUJA 3DGEC 3JD0A 3SM3A 1OE0A 4FVTA 1E99A 1SQ0A 3T6KA 4WEOA 2A0FA 2FB9A 4R54A 3QVMA 4PFJA 2OAEA 4RC9A 4BO7A 1CRZA 3ELYA 1SFRA 3ZWCA 5KREA 3FPCA 4WXHA 1PK8A 1C14A 2HJGA 1ZGBA 5AIAA 5EMMA 1PV4A 2I3GA 4OFXA 5F12A 1TGVA 1LPAB 1EWTA 2JLAA 3CINA 3JSAA 2QT0A 2GFIA 1Z6QA 4Y2TA 2G5PA 4E1AA 2SNIE 1XMXA 5JDIA 2RK4A 5J2TA 1H0RA 1MABB 1BVUA 3SBDA 1DJPA 3JZDA 4NX2A 1Z4JA 1KS9A 3OKFA 3A6PC 4QOSA 2XGGA 1CF2O 4C21A 3EIUA 2GAIA 2X5JO 3D7SA 4ZO4A 3COVA 2JJ2A 2CDAA 1QIFA 1R1DA 2ARKA 2HA5A 1XZGA 2HREA 2PN1A 2VHYA 3IUNA 3NAMA 4MQMA 3ZHUA 3J80A 2HPAA 1JQ5A 1PNVA 1Z0FA 2CVHA 4B2YA 4O4JA 4EITA 4BX9A 2WY2D 2ZB7A 3WBKA 1SIUA 3KLMX 3P97A 4J7UA 2QZSA 5KJ1A 4W6QA 1I3CA 3FFWA 3S28A 3WIOA 4DLNA 2C7VA 4L85A 1GPAA 4LWQA 4PAWA 4ZDWA 3AESB 3MELA 4IGAA 1F3LA 3IMGA 3LGAA 2QEQA 4I2NA 2JGJA 2PRZA 4HH3C 3QP9A 3GT4A 3ZY2A 4B40A 1V6AA 3BQMB 4PO1A 1SXJA 2J9FB 4B6EA 5SV2A 5I48A 3VMMA 3A04A 3KVRA 2FPOA 1V6SA 4DC0A 1PZXA 3OQOA 1D1PA 3QX7A 2XGSA 1GUAA 4TV9F 3VKHA 4IYJA 4KMRA 2R4TA 2W2KB 1Z6GA 2NO6A 2ORYA 2PX6A 4KYVA 2I22A 3G5UA 3SN6A 4UE3S 2D5AA 4I1VA 1QCYA 4E88A 1LSUA 4Z1OA 3U4MA 2O2DA 1DPFA 1IULA 2ALJA 4WKCA 3ELUA 4G65A 2I87A 4QDXA 1CY6A 1FMLA 1PWHA 1V4BA 4TZTA 4RMGA 3URMA 4ZVTA 4YY3B 3KZOA 1UANA 2FKNA 5ELLA 3CS3A 1JHVA 1W2HA 4ENSA 5K0CA 1OFGA 4ZT7A 4Y2HA 5DVZA 4HZUB 2G9VA 1X1SA 2QYOA 5SYAA 1H22A 2CJYA 3CV3A 5FI3A 4BMOB 4JZKA 3FA2A 2LRHA 5KWSA 5IU6A 3R7FA 2PQ6A 1OH5A 4BPRA 3BRWD 7MDHA 3RUCA 5KNDH 3VVBA 1VTKA 5DBOA 3W5AA 2AG0A 1PG2A 1QLWA 1ZZGA 3BRQA 4XGNA 4NF2A 5EN4A 1D0VA 1E79D 1J24A 1KI9A 2NXEA 3CONA 3H2SA 5DWVA 3NMUF 3UMBA 4JZYA 4A27A 1E1RD 4FONA 1SBNE 3FCEA 4MGYR 1G18A 3S29A 4MW4A 2WDZA 4RK5A 1UM9B 3WL7A 3CVXA 1YDEA 1HTWA 2XUQA 4OHXA 4FMDB 4DPKA 4ML3A 3ENQA 4QTUB 4IP0A 4L76A 5C35A 4ZDJA 2WTEA 1XZIA 4HC4A 1N32B 3QVWA 1GZSA 2INGX 2Z8YA 3FLAA 3LU1A 3NOOA 4MLCA 2PLAA 3A11A 3QY9A 4WDRA 3ECCA 2HF9A 1Y33E 3JQCA 2HAEA 2XGOA 1OV6A 3A2NA 3N74A 4G4IA 4PLFA 1IHDA 2NO5A 3OEWA 1L1FA 3ZQUA 3I1YA 2FPRA 3AFGA 4RD2A 4ROTA 4RZXA 1LX7A 3DQZA 1T8PA 4DMFA 5HJ5A 3C6XA 1H8EA 3M1YA 3O26A 3TO5A 3BOSA 3ULKA 3X1XA 2XCIA 4PLPA 3OFVA 3PNYA 3EVBA 3K15A 4ND6A 4YRTA 2B82A 2D59A 3E8MA 4A6PA 4EB6B 2VNJA 1EJ2A 2GN8A 4JLMA 2ZJYA 4K6CA 3ANNA 2D8MA 2AW3A 1RYMA 2JD1A 2QD5A 1PHPA 5A3JA 2AC2A 2WJYA 3I6MA 4G0WA 3GJ8A 2WTXA 2HMWA 3AV3A 1MB0A 1GA6A 4ZGWA 3F98A 1GN9A 5EZYA 5LLTA 1JS1X 2J3JA 1YS6A 5HKKA 1XRJA 2BL4A 2D13A 2YWRA 3M4NA 3RAGA 2PUDA 1DIHA 3ZYCA 1I7QB 4MROA 1QGED 2CLHB 2IZZA 4CMEC 4JXKA 1G4AE 2RB4A 2Y92A 1V3UA 2VO1A 2QN3A 1KJWA 3F7OA 1WF6A 3FTPA 1Q0RA 4GPD1 3RFVA 4AO7A 5A5FA 4M76B 4XEHA 2ZCVA 1G59A 3ZY3A 5IAAA 1SHJA 1CVRA 3OCWA 3L43A 3THSA 4AYXA 4WZAA 4NLLA 1GTG1 4R81A 5BV7A 4L4UA 2BEWA 2J85A 2PZMA 4Z99A 2FMIA 4LMBA 3RU3A 2A30A 3NC4A 1XP8A 2PTHA 5EHNA 4ZRNA 3L4BC 4B3IA 4ZO6A 4D9CA 2NU7A 1YRLA 4O5AA 3QFFA 4K6MA 4B1FA 4RXTA 3DE1X 4I0WB 1ZWLA 2DR2A 4YRFA 4DQ0A 1F9EA 2VNIA 4BLWA 1R3DA 3V8VA 3MTBA 4NPHA 1EYZA 5KMGB 5T6BA 4RFSB 2NPIA 3A28A 5JFGA 1YB2A 4OQYA 2ZKLA 3QEAZ 2NVUA 3OD1A 3TLXA 2P69A 2P5TB 5FUYA 5ITZA 4NBWA 3FVTA 3PHJA 1N2HA 1YDFA 1UXIA 4MZXA 1BYIA 2BM8A 1NC1A 1KO8A 1WWKA 1W6UA 4OKNA 3VTFA 1M0EA 4EY8A 4X6XA 2WIGA 2QOEA 3DE6X 2Q28A 3HVHA 2QSYA 4QTXA 1E64A 2PG3A 1WKVA 1DX9A 2C04A 2H1IA 3BUSA 5LQJA 3HK2A 2D5CA 3RU2A 5T4BA 3KAPA 1ADYA 2AJ8A 2AKAB 3HXQA 1F38A 1Z0IA 2FTKE 5H80A 4YAUA 1UBMS 5JARA 2PZJA 2ZSBA 1T2NA 4F1JA 1ZJZA 1YE8A 1F2UA 1I8TA 3DVRX 3L04A 1TM4E 1W5FA 4YT2A 5FF9A 2ATEA 2JGIA 1C9NA 2JFXA 2VSNA 4PSDA 4Z4FA 1LFDB 3GRPA 4YBZA 5ALWA 1T8TA 2NSYA 1Z06A 1V2HE 2H31A 1GAXA 2OENG 1NJ6A 3I1JA 1JAYA 5A06A 1BAPA 3GG9A 3GAFA 2QTVB 5LQAA 4RZUA 2FQQA 2MSCB 5BUCA 3G59A 4OOFA 1P4AA 3ZV6A 1KKLA 3W90A 3JQAA 4KE6A 2NVOA 3W6ZA 5K8CA 2WJPA 2QE7A 1C4XA 3DE5X 3QF7A 1GFIA 1WRBA 4E46A 2XWQA 1QFJA 2R7KA 2XCUA 2EL7A 3DLIA 1H9AA 2BMDA 4L0QA 5AW9A 4KR6A 4R7TA 1KIMA 3TQHA 3ZE6A 1LH0A 4KYUA 1F5NA 3ZU6A 1WUYA 4ZAGA 1G8SA 1UZAA 4PLZA 2C07A 3AZPA 4HGOA 4ZVVA 1GHTA 2DLDA 2P4EA 2W4QA 3FMFA 4NU5A 3SYRA 3DWFA 2PCLA 4BNYA 4I14A 4BFLA 2FWIA 1LDEA 2F7SA 4IHQA 2CXPA 4AI6A 2AF3C 3CLTC 5EIHA 4RL6A 1F48A 2NXCA 3D4NA 4K81B 3L8HA 3N2YA 3E2PA 1C1XA 2NZYA 2YN2A 5CGQB 3TSCA 7ADHA 4LNHA 3RNOA 2ATIA 1CY2A 1GG2A 1QGUA 2CUTA 1PQ4A 1NKSA 2L69A 2XJ9A 1FFAA 3DOFA 3KPJA 3NONA 4H7HA 4U3JA 1L5MA 2X1VA 3T7JA 3UFXB 4CLOA 2ABWA 8LDHA 2WTNA 5KKCA 3CIFA 1DXQA 3OZUA 3TPCA 3AWDA 3V8BA 3WKAA 2OCIA 4WN9A 4Z86A 5EUQB 5K6TA 4HFRA 5JROA 3OIFA 4CIWA 4DJTA 4DV3B 1NRXA 4U2KA 3KWMA 4I9UA 3SXUA 4PYJA 2GPWA 3UATA 1F0PA 3LGXA 4LJAA 4YP5A 2G1UA 1N7IA 5DM1A 1Z7GA 5E2BA 4L5IA 5BUQA 3FZQA 1KVUA 5JC1A 2PUFA 2V1UA 3IP1A 1C30B 3HB1A 4D92A 2Y1GA 3NCHA 1G9XA 2CKMA 4XWYA 1U0EA 2AOUB 1Z4QA 3IT2A 2REXB 2PR7A 3ER9A 1ZN8A 2H4XA 3CZ9A 1MEEA 5KTPA 3QXJA 2O8CA 4DJAA 2H2GA 3ABZA 3DNFA 4ZQCB 4HQNA 4TQUS 5DGXA 3K6SB 3K1YA 3LNCA 4GMHA 4LY3A 1XNJA 1TFRA 3F1LA 1FK8A 5DTEA 3PGVA 1YIDA 1HSZA 4H1TA 4K9QA 1KYZA 4M7WA 4G85A 3E7XA 5JI2E 2H51A 4FDVA 5FTWA 4INJA 3C6ZA 4FJ2A 5E8RA 2AYZA 1SOWA 4JP3A 4J7XA 4AMVA 3LTEA 4JY7A 3WGJA 2I3BA 2DWCA 2YXBA 3GFSA 2XTNA 5KX5F 3EGCA 4N3GA 4TMFA 2JRLA 2D74A 1V25A 5EFOA 1SAYA 3GT0A 4HMQA 3TMKA 4FGUA 2H07A 4MEBA 5LZ7A 5A1JA 3RS9A 1RQ7A 4LYDA 4EA9A 3I42A 3BWXA 4Q02A 2WSLA 2IQ5A 3VOSA 4F04A 2AHRA 1PL7A 4DC1A 4F2GA 3LWNA 1CDEA 1TJ3A 1BEEA 2ATXA 2WNHA 3IP8A 4G5YA 4GRDA 1U11A 2OCBA 4URVR 2DFKB 3RTGA 3MJVA 2FPSA 1Z82A 1N9ZA 2HCRA 3HB9A 1I32A 1HM5A 3HUFA 3PZRA 5CDGA 2KX7A 4COOA 2EYQA 4GOND 1C7IA 1U9IA 3PNMA 3OZSA 3L5OA 3RRMA 1T6NA 1Z3IX 3J81k 3HXTA 4TRJA 5K3OA 2E9SA 1SEVA 4WACA 1UWVA 3T9AA 4FGKA 4D56A 3LI2A 3WBFA 2ETVA 1ISFA 2QW8A 4F6RB 3QJYA 4JLAA 4US2R 2ZYWX 1ZUWA 4DV5B 3VUEA 3BD9A 5EAIA 3K9QO 2GKOA 2GAFA 4KIGA 4OPMA 4EFNA 2I7CA 3Q1KA 1KEEA 2ZWOA 1NPYA 4I99A 1CR6A 1JIVA 4GP6A 1PS0A 1ISPA 1E1MA 2XADA 2Z95A 3K6RA 1LDMA 4W9NC 3R9KA 3VDRA 1TEZA 3PX7A 4B3GA 4R98A 5E6RB 1ZH8A 1T4DA 3HN6A 3MJFA 5J4LA 1LBEA 1R4ZA 2J41A 5ER6A 1AMUA 2E82A 4R1NA 3AHIA 4OSPA 4GXRA 3VV3A 1LTQA 2QR3A 3IV9A 1P60A 3L1HA 2I66A 3C6MA 3DTTA 3QWAA 4MR7A 4Y9UA 5K9ZA 4B48A 1GQOA 3IMEA 1BKYA 4RTQA 4S05A 1XTUA 3G8DA 3ZBPA 2AG5A 3PHGA 1NLMA 3PUHA 4MV9A 3SKXA 1VPVA 1JHXA 3WL3A 2VQDA 4NYMQ 1ENYA 2J5KA 4D98A 5B6PA 1J7KA 1N2XA 3GYGA 3UAZA 1C7EA 3PK0A 3LOQA 2VOEA 3ZDAA 2VP6A 2CXRA 3Q5EA 4FYMA 4TS4A 4BQIA 1WPRA 4BBAA 3T1TA 4MUKA 1CY4A 5IKEA 1GNLA 1T9DA 4Q01A 3ZI4A 4I4IA 1GLVA 2IHBA 2VAPA 4B3DA 1YFZA 1Y7IA 4EX7A 3GPLA 2IXGA 4M1QA 4MRMA 1Z07A 1MF7A 4R40A 3HLYA 2GM9A 3R6GA 4FSHA 4W5TA 3LTNC 2C94A 4EO4A 1LSJA 5BN5A 2R47A 4FHCA 3LQRA 3ACCA 2QTRA 4FOLA 4UMFA 3VZRA 3A6EA 3KOMA 4QUHA 3CZQA 2UVPA 1JDVA 3GCXA 1KZGB 1NYRA 2WYIA 3UNXA 4P4LA 1Q20A 1LVUA 4ZQIA 1SNYA 1WV0A 2FP4A 1XCOA 4N5DA 4AS2A 3T1HB 1TCCA 2VJLA 3KBBA 1P0QA 4FZRA 3M89A 5AI9A 3R9WA 2Q0SA 2PUHA 4X1KB 3N6RA 3ICOA 1KI8A 3L06A 5LP6F 3O8CA 1UPXA 1G7CA 3TSWA 5C4MA 1QHIA 5ELXA 4D9EA 1UDBA 2YY6A 4K3UA 4HRAA 3OOSA 1EWVA 3BYZA 4QJ3A 3CRQA 2NWQA 2Q45A 2VRCA 1X1RA 1ZFNA 1V9SA 1J8QA 3FNEA 2C2YA 1OAOC 4KXUA 4EDFA 4F4JA 1XLUA 3T5GA 1MO6A 1DAGA 4XFKA 3LK7A 3DONA 1YBAA 2BELA 1LD3A 3GJRA 3SDBA 1Z6XA 2V9ZA 3IELA 3ONEA 4OB6A 1EI9A 5TIIA 1RRFA 1X7YB 1DAFA 1DIOB 1PWEA 2YV4A 2ZSJA 3KJQA 3V4ZA 3W2TA 5KNBD 2O0HA 3E9DA 4P1ZA 4MVWA 2QTBA 5E7QA 4MW5A 3K92A 4P4SA 1KPIA 5EI5A 4YCAA 3V80A 3U4QB 3CM0A 2QAGC 3L82B 3QM1A 3KFXA 3C7CB 4WNIA 3PC8C 5FBKA 5AQEA 5JD3A 4JNCA 4TVBA 1REQB 4RVFA 4HAXA 3ZX5A 4AWBA 3ANYB 5L40A 5EWLB 4DDTA 3VPSA 5FIUA 3EW7A 4B31A 1QGAA 3ZW7A 4ALJA 3DPSA 1C3VA 3CEPB 5I9LA 3R8FA 1A76A 1J23A 4FFVA 4FZ3A 1OVGA 5CHYA 4PQYA 4IXWA 4GUAA 3L0CA 3TZHA 1LDNA 2OL4A 3TR5A 3DVLA 3M6WA 4BX2A 1D6JA 1QU2A 1HFJA 1XJ5A 4LX0A 3U1VA 2JIZD 4Q15A 3BGIA 2XMCA 4HLQB 4FHGA 4U9IS 4WCFB 2ZUUA 3JQ9A 4D9NA 5JPCA 4UEJA 4HWSA 4MKRA 5IJAA 3UVEA 4P81A 4DGSA 4NICA 5B12A 1M7HA 3T4UA 1X8KA 1DTWB 2VSOA 3ASVA 3PDJA 2DH6A 1I94B 4MLZA 2FF5A 5ALJA 4XPIA 1FS4A 3EUFA 3K0HA 4YCJA 2PL5A 4P5EA 4WBNA 1DQNA 3FNFA 3PHBE 3QFCA 5ALRA 4J1SA 3VU0A 4F4IA 3C5CA 4YMGA 1XZKA 2A1IA 4J7AA 1TU0A 3IURA 5LVAA 1IRXA 5IC5A 2B99A 4YAOA 4ITRC 1IMOA 4DJDC 1NI4A 3V4LA 1RBMA 2C88A 1UCFA 4C7BA 5C1PA 2W2PA 4PX5A 3HV0A 1ZDMA 1XFDA 121PA 1SKUA 1X1EA 1RHQA 3CX7A 1NWHA 2PZLA 4OHMA 1MA3A 1T2AA 2JI8A 3VPAA 3IB3A 4MRAA 3NIDB 1Y8AA 1NW5A 3E0QA 3KLNA 1RRMA 2VYND 3RLFA 1JJBA 5FUVA 3T7EA 2V0CA 2FQXA 2G76A 2YHIA 1E9CA 3AEQA 3EQZA 4KRGA 2E6KA 3A1TA 2CCGA 3IKJA 3M4XA 1JLLB 1Z4NA 1DOAA 2UZ0A 3A58B 2Z2YA 3Q3HA 3P27A 2WIBA 1RDFA 3RS2A 3WWOA 3ODPA 5AI5A 2XDAA 3M6UA 4TQAA 2IYXA 3DKKA 1HYEA 1NE2A 2EKBA 2W71A 4M4SA 1AQJA 3R9IA 4FX2A 1ZI9A 2DWUA 3OZXA 3REQB 1FB5A 4LE1A 1QR6A 1DP4A 2ZR9A 4QUKA 2AQKA 3E22A 4UVDA 2P8JA 1GAJA 3OT1A 4QSMA 1QRAA 3OZFA 2E21A 5CLGA 3UMVA 3LT2A 4D5GA 4F4CA 2WUEA 3FGNA 4CKYA 5JJCA 3CUVA 2C7PA 5L3RA 3T7DA 1QDUA 2Z83A 1QB7A 5AUNB 5GGYA 1YV9A 5DIFA 5DISB 5BYJA 3VR4D 5LWHA 3JATA 2PVSA 3D3WA 3HRHA 3AIOA 3QMMA 3TD9A 4JKOA 5K05A 1E2HA 3U9SA 2WIFA 5FL3A 2FHPA 5JNVA 1BDHA 1GVHA 3ZDFA 4JB3A 2JJMA 1QYDA 4CM4A 4M83A 2ZSIA 2J67A 1U0FA 3DVSX 1I0ZA 3NWJA 3OQVA 4YB8A 4DLAA 2QRQA 3OFND 3IQIX 1JG6A 1I4DD 2C61A 1EVYA 1M2FA 1X1DA 1YRQA 1Y34E 2PZAA 2Q21A 3LL7A 3QIVA 4MAFA 4PZLA 3ORSA 5D7BA 4ARBA 2Z6VA 1C9MA 5BORA 3OQ1A 4RVOA 2Q4DA 1GU1A 1KI6B 1QWOA 3BWBA 5ANRB 5SZJA 2FPPB 1MC1A 2YCBA 2FXIA 1ZW1A 3G3EA 4ITVA 3ZGVA 1VGVA 2ODBA 1E20A 1R0XA 5AI0A 1SUBA 1M67A 3ESYA 2FP3A 3PEVA 4F45A 2OMKA 1C2YA 1KKMA 4B2PA 3TBFA 2N9UA 4BB9A 3K7EA 4RZ2A 2VAWA 2EGGA 2G25A 4B6RA 4ZK2A 4IXTA 1M10A 5D87A 5CD1A 1OFUA 3M9LA 3MT7A 4WT7A 4R68A 5LSAA 4DCPA 4A5OA 4TXNA 5CT6A 3E1GA 1G5FA 3M9XA 3OTHA 5AICA 3IO3A 2RBGA 4YMLA 3PPXA 2ZB3A 2P9HA 3G2PA 3B1JA 5DM60 4CU2A 2O8NA 2P2NA 4PN7A 4DR2B 1B0UA 1JSZA 1GLGA 2C2HA 1ZVMA 3CN9A 4J90A 1UJBA 2VDUE 3FHLA 2I6FA 4KZPA 1QQTA 2C4KA 1MAUA 2X0NA 5ITVA 4NKRA 1GTL1 1YNOA 5JQGF 1VRCA 4YT5A 2ZI7A 1MVOA 1EGAA 4NJEA 1ONBA 3BH6A 1B00A 4FDAA 5DB4A 2XW6A 2XODA 4Z54A 4ZQFA 3B8EA 2C4WA 5CNMA 1Z08A 3GLHE 4DCGA 1E61A 1D4AA 4JJZA 4XRRA 1DAEA 1EFHA 4K1LA 3NBXX 1QHGA 2RG1A 2Y9PB 3GL9A 1AHNA 3R6WA 2AR0A 1JHDA 4OYHA 2H4HA 3JQEA 3PFFA 1JIKA 5JSQA 2PWZA 1UBEA 3CE6A 3TB4A 1VJ0A 5ICGA 4TWIA 3ZS8A 4KPYA 1NFFA 2PLFA 1S8AA 3LM8A 1G3QA 3MJ4A 5K8LA 1P6XA 5BV1A 2J0SA 2CVQA 2I78A 3BZBA 3L2OB 5HOQA 1XLWA 2V45A 3IUJA 4AG6A 4C1BA 5GIPE 2DBVO 4RTRA 3LPAA 4KR2A 3U48A 1HOTA 2PMCA 4NOMA 3RAJA 1NDUA 4CF6A 1HT0A 4WD3A 1AHPA 3N28A 3TFOA 3NKVA 4F3CA 3K0FB 1G3MA 4QQFA 5KTSA 3PPIA 1WHSB 2PQ0A 4OX9Y 3JQRA 3LQ1A 4B6JA 1FP4A 5DJ5A 4TV9B 3MINB 1V16A 2VQ3A 1FNDA 2AJBA 2YYSA 3ANLA 4QICA 4GGMX 4KXQA 2GK6A 1D2HA 2FZLA 3MRTA 5CCDA 4WXYB 1MB2A 2A1TS 4JQYA 2C3PA 2A35A 2PUJA 3R6DA 1TJ4A 1RXUA 1ZI6A 3CO0S 3AI2A 2UUBB 1DAIA 1XROA 2B3TA 1XTVA 5EJIA 3S55A 4C6TA 2ZSFA 3CNOA 3NP7A 5GONA 1TQDA 3OQMA 2WTBA 1VRVA 5SZIA 1LDGA 4QXMA 3HC7A 1RKVA 1IM8A 2B5WA 3CEJA 4AKHA 4KRYA 4L9RA 1ONSA 2J08A 2FSSA 4IFEA 3TTXA 3AF2A 1N1DA 2FMXA 2HJWA 1GZ3A 2QBYA 1E1QA 5CLIA 5TX7A 1W9HA 1H1LB 3TNLA 2R6AA 3HBNA 4MUIA 3BEDA 4Q03A 5ALIA 1O96B 1J33A 2GARA 2XMPA 3WLPA 1PJBA 1G3IA 5J9FA 3W5HA 4FZJA 1QAMA 2RHOA 3INNA 3LV8A 1U1IA 3T9DA 1P4JA 3H83A 4MP8A 4K28A 2Z09A 1K6MA 3NVMB 1FUUA 4MGHA 5IAEA 2QORA 2O23A 3W8FA 4DZZA 3OOHA 1NLFA 4LI0A 2VP3A 5DYIA 3FY4A 1WX1A 3LUAA 4D44A 1E3EA 4L8YA 2MSDB 3WA6A 4LOLA 3U26A 3KE8A 2D2EA 4AJPA 4IHKA 3NHWA 1I1QB 1YVRA 4UW9A 3WBJA 1WP4A 2ESRA 1NBOA 2J6CA 4KH1A 3DDHA 2OZLA 4HJXA 3ZQJA 1RWQA 4HLCA 2HHCA 5G0WA 1UFQA 4OI1A 3R7DA 4XE5A 1WD5A 3RE1A 3EC2A 3QX8A 3I9OA 4M54A 3KE9A 1XYYA 1JEJA 2FG7C 2Q2WA 2YDYA 3OPMA 2HRBA 4QGHA 4ZFNA 1KQFA 4BV9A 2JJ8A 2FH5B 1UBGA 4JN6B 4WZBB 3ZDXB 3ZWWA 5K3EA 3WWPA 5JMPA 4IXDA 2G9NA 4E5NA 3SQOA 5A6VA 5DMXA 3C74A 1WCV1 3KJXA 2EERA 4B43A 1GGMA 3L7IA 3MMPA 1SC1A 2O3TA 4P2GA 3VPFA 3GFPA 4YCDA 4TZ0A 2B0JA 3OX4A 4LYJA 2H5JA 1C0PA 3I8OA 4ROSA 2OYCA 5M2QA 4LTDA 4EFMA 3RH0A 3A2MA 1C4WA 3PUYA 1RVDA 1SXPA 2G9ZA 3T9FA 3UBMA 3LUFA 3C4QA 1TCUA 4EMSA 5EJMA 3OCXA 5IKMA 3LVQE 1XQYA 1BXRB 5DWQA 4IDGA 2CJWA 3M5WA 4RQAA 5IHXA 1O7JA 3L7MA 1GNQA 1GIAA 1NXPA 3KQUA 1E9DA 1NYTA 4YLYA 4J16A 5TMPA 2D0IA 3BFKA 4MI6A 3RANA 1B6RA 3FSRA 3AXSA 3KB6A 3O83A 1SG6A 4IV0A 5KQLA 4EG3A 3DZJA 2ZYUX 2CXQA 4IVRA 4NH0A 4ZOLA 3TTTA 2P67A 1CV2A 8MHTA 4JP1A 4JLVA 2P6UA 4QOJA 4KBYA 2RAPA 2XUZA 3RU9A 1JH8A 4EJSA 4KWTA 2EXXA 4ZQBA 2IE0A 1R7RA 1FDUA 3H6GA 1G9TA 4E21A 2BFWA 4EYSA 1VLQA 5JD5A 5FTLA 1RZ3A 1XZCA 1QGZA 1I4TD 2CC2A 1C3OB 1ENOA 2GHIA 5F23A 2DPLA 5K3AA 3ISTA 1TT5B 1UJ6A 3BE5A 1NVKA 1P4SA 2I6SA 5HKOA 3CT4A 3PUVA 3AERB 1M7BA 3IOCA 5C8YA 4AZVA 3KSAC 5IMSA 5L7TA 3N1UA 1SKYE 1CF4A 1T34A 2HU5A 5FA5A 3PQEA 2M6LA 1VGQA 2QDKA 2QMYA 4OK3A 4EUSA 2QLBA 3HRKA 4F56A 3OUTA 1XCPA 2RH5A 3DM9B 4HBGA 1TIKA 1DQRA 2A7QA 4LSMA 1X77A 4N0EA 4R9SA 3GQBA 4OXQA 5CIYA 3O4GA 2VTDA 2Q5HA 2XZDA 4G0VA 1UJ4A 1XELA 3L7JA 2W6ID 3ROGA 4NCJA 4KUHA 5AHOA 1T3ZA 2CGEA 3IGFA 1GAEO 1HDGO 3O82A 4JCCA 4OVKA 2FPGA 1UMCB 4HAYA 2D5LA 5EESA 3VR1A 1HR0B 3PEYA 3FAZA 2QA5A 3DO6A 2TSYB 3HMKA 1KZ9A 2MR6A 4I08A 2QVBA 2OA0A 2P91A 2WUVA 3PHIA 1V7ZA 5CJ2A 5AJTA 5JNSA 2A4KA 3AVXA 2J0UA 3WLMA 2JLXA 5AUOB 3K0AA 5M04A 3T15A 1YOVA 5FBRB 4EQ6B 1KEZA 3I2FA 3ICPA 4EYOA 5FX2A 5JAPA 4CI0B 1NYLA 4U7WA 2O7NA 1USWA 2XWJI 5EP1A 4GBJA 3VPHA 1LSSA 3AEKB 4HLUA 1JDJA 4NQRA 2GN9A 3WRYA 4QEDA 4EG6A 2BZSA 2PBFA 2X7XA 3QU7A 3OETA 2WWFA 4HUJA 4KQ2A 5TPWA 3NH6A 1C2TA 2JKVA 4AUEA 3K2EA 4CLDA 5ITWA 3UZUA 4NU6A 3VBCA 1KIFA 1CQZA 3TVTA 1G60A 3NBMA 3D43A 5MF6A 2XNHA 2QBYB 1U2GC 3SKYA 1KVQA 4U00A 3IBFA 4OXIA 3U31A 4H9GA 1IWPB