2JNWA

Solution structure of a ercc1-xpa heterodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
NSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA excision repair protein ERCC-1
publication title Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 32
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03834 Rad10 Binding domain of DNA repair protein Ercc1 (rad10/Swi10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jnwA00
4M6WB 2JPDA 1J23A 2ZIVB 2BGWA 2ZIXA 4P0PB 4M6WA 2ZIWB 1J22A 4BXOB 2ZIUB 2M9MA 4P0QB 1J25A 2BHNA 1J24A 2JNWA 2A1IA 4BXOA
chains in the Genus database with same CATH superfamily
3BXGA 4TMFA 4AJEA 5ENVA 4JT4A 3ZIAD 2ZIFA 5BORA 2KSQA 5E6UB 4BTEA 4KKXB 4H7HA 5CEJA 1YB1A 2BONA 2GOYA 4RGQA 1A5ZA 1OX4B 1NOIA 4YCBA 2XPCA 1XNJA 3LC7O 4WINA 4K9DA 5EJ6A 1P60A 2GRJA 4CLEA 5G40A 3E2IA 4UZSA 4BO2A 2BBWA 1JGTA 4IMRA 3TLXA 4EHJA 4O0MA 6NULA 5HJ5A 4J94A 4CODB 2YWHA 4LF5B 1A9TA 4IIJF 5AKLA 2OXIA 5EJ4A 1UADA 4R41A 1EKXA 1WKBA 2FI1A 5KSPA 3RSHA 4DJEC 3L6CA 4P32A 1D07A 4A8JC 3FOZA 5JO9A 4IHJB 4A0QA 4ES6A 3HU3A 3DWIA 4HNVA 5A5FA 2QZ9A 2JJMA 2C88A 4G4JA 1ZJ4A 5FWXB 2AN3A 3H6GA 3AFIA 5K6AC 3G1WA 1HL3A 1Q44A 1I5OA 4U9UA 4RVHA 4M2LA 2RHWA 1DDOA 2Y1XA 2CHEA 3FWPA 4L5CA 2IGBA 1XD9A 5KTMA 4KOAA 2OCKA 4TRNA 5F52A 2ADOA 1B8NA 2ZXFA 4Y7CA 5K3CA 5J23A 1EUYA 1OXVA 1L6RA 1U4OA 2UVPA 2WEKA 1S3IA 1NRIA 1NN0A 2CF5A 4DMUB 3W7AA 4NI5A 3GCWA 2O8DA 2P4QA 3NTLA 1SVSA 2ABWA 3UUWA 2QM0A 4NDNE 3M89A 2ENUA 3TAXA 3UEOA 5ERXA 2YJNA 4GQIA 4ZV7A 1OBFO 4LNAA 1F7VA 4MXDA 4L07A 1GG2A 3PI7A 4NYIQ 1PK7A 4O2AF 5EEGA 2JGLA 4ZC1A 2HFJA 1KOJA 3WAJA 1A2OA 4OGWA 1QO0A 4E31A 1FP6A 3ELDA 3SQDA 1MEOA 1DUSA 1RRFA 2Z8YA 3OEHA 3ZJ5A 4ZI7A 1QB8A 1ENPA 5CURA 2W4QA 1IWPB 1LWOA 1WX1A 1YJAA 2JI4A 4CLDA 4YACA 1KMMA 2H4JA 3RD5A 3WRYC 4MW6A 5FULA 1NTRA 2YH2A 3C7CB 5ALFA 4MVYA 4MKFA 3HABA 3COYA 4LMAA 4JS0A 4HOYA 3BFJA 4RKFA 3HKCA 5E4FA 1I3KA 4YQEA 4HBZA 2JDID 4F60A 1GL7A 2RGUA 5FWNA 2NUPB 2IYRA 2RI0A 3FAZA 4IP0A 5DHUA 3TJRA 2BHSA 1PR2A 3HY6A 1R0XA 4DOMA 1A9XB 1WUTA 1II8A 2IZ0A 2GPJA 2ZE7A 1A1SA 2X6RA 2PU5A 2BMAA 1Z38A 3RFFA 3EUWA 3UWOA 4KPUA 3X1WA 2IS1A 3RW9A 4UD6A 1ZXLA 3WJ7A 4J16A 2BGGA 3QOFA 1ADYA 2AOWA 2BD0A 1P9WA 2HUPA 1Q50A 5L45A 3PT9A 4ZGGA 3W2IA 2VJPA 3BTSA 2NPFA 3T6KA 3LKVA 1CXZA 8AT1A 2OXEA 3FPCA 3IPXA 4MK4A 3SBEA 3TI7A 5IT0A 2DPXA 3JQ8A 4PX3A 1R0CA 2ZSFA 5F2OA 2GTHA 5C37A 5AK4A 5DP2A 4CMCA 1E1CB 3VJRA 1R0LA 1P39A 4FHDA 1C8VB 2BFEB 1ZAYA 4QQFA 3WNQA 1H4TA 4U02A 5HEKA 2BLNA 1UBGA 2Y9MB 3K6SA 1OPXA 2BGIA 3WK5A 5TS2A 1SXJE 1ZG3A 2PKYX 3VISA 4Y6QA 1LK0A 5JALA 5AW0A 3V4RA 1EX7A 1UIRA 4WADA 3W2EA 4YRZA 1I7QB 3PQ2A 1PVDA 1VDZA 2ORIA 3A25A 1HZZC 1NLFA 4XWKA 2HHAA 1YGYA 2JAPA 3UANA 4ME6A 4A10A 1DPGA 1FFXB 2XTNA 2D3WA 4DSUA 2B7LA 3G2QA 4INZA 3HRIA 4ZYUA 1T6NA 3DTTA 4C22A 3IKLA 4FT2A 2GYVA 1ZXBA 3EFBA 2PWAA 3DM5A 4HTFB 1BMTA 1SBCA 1QS0B 2WU3A 3N0XA 4EMBA 1P1CA 1XLTC 2H6EA 2JS7A 5CB0A 5KYYB 1A9SA 1PNOA 1QG2A 3FYUA 3U7FB 3AVUA 1L3BA 3C3WA 1GR0A 1TQDA 3CN7A 3MRXA 5J5AA 2A84A 1HE1C 3R5KA 4G86A 3D6JA 1A9QA 1O96A 3BB1A 4FFSA 5JMTA 2WIKA 4RYDA 2JCGA 4XD2A 4OBEA 1JDZA 3RODA 2J5KA 4MQFA 1TQHA 1PHRA 1L5QA 2Y1WA 3X44A 3MVEA 1V7ZA 3QBTA 3ABRB 3PJEA 4AJIA 4OQNA 1CJSA 2XUFA 2YVKA 4OH1A 4QXAA 4UNSA 1BMFA 1SEPA 1ZS9A 2R4QA 2W48A 2WWRA 4FNOA 5E0OA 4BKPA 4D3DA 4NR0A 3SQMA 4KHPB 4KIGA 4KR6A 1Y7IA 4PLVA 3EGIA 3L8ZA 4FW8A 2R8PA 2FRXA 4QUDA 3UAVA 4EUKA 2ZT7A 1GTSA 1Y7PA 2LVBA 1JX6A 4MROA 4CLHA 4EKIA 4I1UA 3VTKA 1V16B 3ODGA 3NALA 2B34A 4BQRA 2HJ9A 3WDSA 4RS4A 3VHXA 4V02A 2QSYA 4D9KA 4MKZA 1ODJA 1GYQA 4Q9HA 4F86A 3O95A 4K1LA 4YEDA 2JH9A 4B45A 2A1TS 1BTOA 3SE0A 4M8LA 3WL8A 5C2JB 4DTCA 4ZJYA 2AKAB 1SXJA 2O7RA 4Q93A 2VUUA 1ZH8A 3PKJA 1MA3A 2G9NA 1SVOA 4RFLA 1ZUD1 3FKSA 3EZ6A 3OEYA 4BNDA 3BD7A 3LIPA 1GRVA 2J5RA 4Q3DA 2OHGA 2NSYA 3GBVA 5DIFA 2ZSJA 2ZU6A 5KCZA 1XCJA 2VOJA 4JL8A 3A04A 5ICCA 2H07A 4OJQA 4A8PA 1D8AA 4U7HA 5BW6B 4K5QA 3L6EA 4ZI3A 3ZK7A 5FBHA 3GZJA 5KDLA 4V24A 2EZ4A 1H22A 2Z6QA 5COAA 2BCGY 4UE3S 2NO6A 1DTEA 2PZLA 5TRTA 3N6XA 1KAQA 4QUBA 1UINA 1ZW6A 3E8SA 1VOTA 2NU9A 4AT1A 3AZOA 4Q02A 2UDPA 1T9AA 5A5DA 3EF3A 2WAYA 4Y9RA 2G72A 3UOWA 4DVGA 3QE9Y 3KR9A 2BBSA 2RGCA 4GMKA 2IL1A 2DUUA 2IU0A 1T4MA 4G09A 1MHTA 1NN1A 3E9CA 2E6KA 4RZQA 2ZTHA 3JAKA 3ND9A 4NY1A 3ERCA 1SWWA 1FS5A 3O74A 3O4FA 3QPDA 4JJZA 1IULA 3BCSA 3BGWA 3OCUA 3V8MA 2ZRJA 1G98A 1U1DA 1OWOA 1TMGE 2M98A 2QMEA 3HR8A 4FGUA 4G81A 4LAFA 4WKNA 5CCDA 3RF6A 3AOGA 4DL9A 3HZOA 3ND6A 5BUZA 1RPNA 1TLTA 2LDBA 2F2TA 3ML1A 3UOAB 1N2SA 1ZY2A 1NUUA 3BIFA 5CXQA 3JZFA 3R0ZA 3RUEA 2AN4A 1QHHB 1TM2A 4HDRB 1M5RA 1SIWA 1JLLB 1DBRA 4MIKA 1I7SB 4QEZA 5JJ5A 2DHEA 4QNNA 3SJAA 3BE4A 2WU8A 3BD8A 3W8DA 2XX3A 2I1WA 4B3TB 1OYYA 4Z9YA 4WLNA 2EL9A 2Z2XA 3E84A 5U1PA 3RS5A 2OXFA 2LDXA 3X1KA 1JEYA 1YI1A 1I8TA 3QEBZ 1FNNA 3LVQE 1IG0A 4Z1MD 4LMBA 2NO4A 4W7IA 5TMPA 3GOQA 2R6ZA 1T0UA 1ZD9A 4KQGA 1E77A 1UK9A 4PBRA 4FYKA 4YASA 2PAFA 5BXYA 5JRDS 1V5IA 2NP7A 4RVNA 2PMKA 4NK4A 5LJIA 1YDEA 3C5VA 1QHYA 1RACA 4WCFC 4Y2SA 4MB6A 1VQ1A 4KRGA 1X7WB 1EP9A 2CL0X 4FSHA 1RCUA 1OWNA 2QMOA 3SAJA 2XBMA 5CK4A 1L5HA 3ER9A 1OGYA 1KC3A 1L2TA 1ZRSA 1ZBQA 2DQZA 4YP6A 3ANYB 4PZCA 4PY2A 1WIWA 1X1TA 1GSHA 1CHNA 2QEQA 4Q9IA 2XNDD 4ENTA 2UYQA 1PWZA 4FC7A 3LHSA 4I46A 3NHKA 1TVKB 4YO7A 4ZOCA 4XM2A 3DF7A 1NPYA 1J7JA 4GPBA 4RLSA 9ABPA 2G8NA 3S8MA 3IA7A 2VQSA 4HX2A 1FFAA 4Y0VA 2NZVG 4CM5A 1PRYA 5AI6A 2VHXA 4YFVA 3SX2A 3TCNA 3ZHBA 1EE1A 4WBXC 5JH7B 3IAXA 2FSPA 3NWJA 1LFAA 3H05A 3KPYA 1I1QB 3GJ3A 4LHXA 4AK9A 2ZRAA 3VDRA 3DTYA 3QA3E 4RENA 2AB0A 3PA8A 3TIFA 4UU8A 4ECAA 3F4KA 3BJMA 3BXEA 3A1VA 2GZ1A 1RYZA 1WHTB 1JLSA 4OA5A 4CLRA 4J7XA 4WBNB 4FONA 1UDXA 3GNLA 3HBFA 1KC1A 2Y66A 5CX1B 4YYEA 1Y3DE 2BUCA 2ID7A 3B1JA 1BCRB 3F4BA 1WUJS 2MSNA 3MYRA 1G42A 1YJXA 2JLVA 4GE3A 2AJBA 4PC7A 3L8MA 4DUPA 3VR2A 3DEYX 4QJ5A 1PV1A 2XHZA 3F6PA 1RT9A 4D79A 4BP8A 4KSYA 1JEQB 3JYQA 1CUVA 1H2FA 1YI0A 2NYUA 4OCZA 4KKVA 4I81A 4AZTA 1KI9A 1HDGO 4OXXA 3RR2A 3BT7A 2DOKA 3PRHA 4IV5A 4QATA 1RFLA 3TOXA 2HA4A 1JR3E 5GTDA 2DLCX 4MS4B 4UTVA 3OZIA 4X45A 1YR2A 4TMKA 1F8UA 2F9LA 2QE7A 2X13A 3J81A 1KP9A 1R0WA 3OE1A 5JD6A 4J6EA 3W1VA 1G2PA 2D5BA 4LXIA 2HYIC 1NTOA 2WP0A 3WXBA 2H4ZA 4AIIA 2BTEA 3EQ8A 4RMJA 4LOHA 2PPVA 2RHOA 1OH6A 1KFCB 4Y6OA 1TB4A 1P8AA 4C0AC 3QJGA 3QG5A 1EGHA 1XL1A 4OGGA 1HQDA 3K0SA 3RSQA 4R68A 1ELOA 3WK6A 1DEXA 2NQ8A 4F9FA 4TYQA 5K45A 1KAHA 1DAOA 3EA0A 3E7XA 4D43A 1ZI6A 3K9CA 5HKOA 1O77A 4GU5A 2Z6AA 1T5HX 5JARA 2YQ5A 4GOKA 3B6EA 2W4MA 2X4DA 2WB2A 1H2RS 1D7AA 3N53A 2H5LA 4MWEA 3BKXA 1WOMA 4S2EA 3TLZA 3ZE9A 4BFXA 4E32A 1ODKA 1OF1A 1BJKA 1JPVA 1EESA 3I2KA 3W8RA 2A0UA 1UP7A 1SRRA 4I5GA 4L5YA 3QBEA 4FKZA 4ZYVA 1PL0A 5GVSA 3M70A 5DK6A 4NBKA 4IDBA 2F8SA 4BDTA 1GJRA 3HKBA 4UJ5A 5IFKA 3THWA 1N6KA 1LDMA 1PYDA 3HVIA 1OWMA 1WBBA 2UV8A 2GHTA 5EHXA 3RU2A 1SOMA 2EGGA 2VJBA 1KEEA 1M7BA 5REQB 2ZREA 4PAOA 5BRAA 1VLMA 3F46A 1PFYA 1V35A 5DGDA 4F2HA 3OLYA 2HZBA 2J3KA 4Q3OA 3D54D 1LDEA 2FX2A 5IK2A 4C4RA 1NVVR 4DC0A 3IIKA 1T3GA 1NV9A 3THYA 5F7ZA 3U7QB 2IYFA 2W70A 2O54A 3N1UA 5KVSA 3K2IA 4F4UA 4Q4JA 5L4NA 2HWWA 1FRQA 2YW2A 3D6TB 1SCIA 4N41A 2BTQA 1N7HA 2PQMA 1T6XA 3CVJA 4B8YA 2GVZC 4U6NA 4F4DA 2ISSD 1N36B 2VJYA 4GMHA 2BF7A 2JFGA 3OF5A 3D0RA 2O50A 1YUBA 4FGZA 2ZSBA 4M4SA 5AK6A 2VTBB 1WW2A 2NO5A 3OZGA 3PC7A 4UCWA 1QKJA 3FPGA 4GR9A 3DO6A 2H11A 3DT8A 3G23A 3ZV6A 3V4FA 1WHSB 3REGA 5BR4A 1QK4A 3DXZA 4LZAA 2AD1A 3H4VA 1Z7WA 4PIVA 3ON5A 5PGMA 4C7VA 4Z5XA 4ZVVA 3KJHA 4G5FA 1HDYA 1E9SA 2GEFA 2XE6A 3DFFA 1G3QA 2C29D 5LOVF 5DX0A 4YFYA 5FUWA 3TIIA 4DEXA 3LO8A 5D01A 3G79A 3LHFA 3HCDA 1A9OA 3R8FA 3W5VA 5I7UA 2Q49A 1AF4A 5ARBA 3N74A 5SY9A 3HCOA 1EH5A 5H68A 3ETDA 4M22A 1SG9A 3O73A 4PRLA 2YOFA 1U1FA 3FVTA 1IJBA 3H97A 1Y6JA 3MJHA 4MR7B 3TIGA 4L76A 4ND4A 4AWAA 3PWKA 2Z5GA 3ENKA 1PGQA 4BDSA 4JWTA 1N8NA 2G6BA 4BU0A 3E1SA 4AXXA 2K7FA 3KFLA 1CUAA 4ZGBA 3RGWS 1P5JA 1XPJA 4DLKA 3OH8A 3IEUA 4BBAA 5D3QA 3JRXA 3ZDBA 1J2TA 5ANRB 4X64B 4YRTA 4BMPB 4OJYA 2IYVA 1R6AA 1X38A 1J0AA 1DJOA 4AJHA 5BW4A 5EIBC 1NR1A 4RH1A 1KIMA 3AEKB 1CY0A 2PFSA 3N2LA 4HLNA 4J0HA 4OFXA 4H7IA 3SFZA 5B4UA 5KMGA 4P0PB 4AN0A 3SR0A 5JFOA 4ZODA 2QJOA 3MWDB 3CQ9A 3K09C 1IDN1 4DR1B 3OHPA 1J8DA 2JFYA 3LUJA 2V54A 4RHEA 4X54A 3THXB 3GROA 4KVZA 3DZFA 4US0R 1JHDA 2CE7A 4D41A 4NCIA 5B58C 1FJHA 1IPFA 3H3FA 1DDGA 1G8FA 4NBNA 3OG9A 3NDBB 1FFSA 1ZIDA 4WLVA 3V1UA 3X43A 5J2TB 3LP6A 4GIBA 3BVPA 3R6TA 1YVDA 2ZJ4A 3I58A 4PINA 1EVKA 1G5TA 1CPYA 2VKTA 2A57A 4F9TA 2H1IA 4ZAVA 1Z08A 3L4BA 5DRTA 1BCSB 2C77A 4W8OA 1V3VA 3TMYA 1XXHB 3PT5A 1QG6A 2EZ9A 5EMNA 3UJBA 1CR4A 2GZAA 2Q45A 5BYJA 4AB1A 2GZSA 1MX9A 1YIOA 5EIBD 2ZPUA 2C1XA 3N0TA 3V9AA 4B2IA 2OCPA 5C5CA 4OJKA 2JFPA 3L93A 5G2OA 4GRDA 3UWMA 2HSEA 3T9AA 3BA6A 4HGOA 1Y8QB 4TLLB 1KF0A 4UTXA 5SYAA 3ZWNA 1Q21A 4EUNA 1R6VA 4E5DA 4LKRA 1OX5A 3CMCO 4BUCA 4INOA 2ZSHA 3MGAA 4G4SP 2OZKA 3TQRA 2RH5A 3AMVA 5CH5A 5B3LA 5LQUA 2Q6VA 1EZ1A 2CDAA 1MIHA 2HMUA 1FPQA 2IZ6A 2WUVA 2D2FA 3D02A 1JDUA 4JEUA 4LSZA 3VUFA 3TUZC 4XB2A 1E61A 4JVOA 4D8VA 2FEWB 5GY7A 1AC5A 2QR5A 2QUIA 2HH9A 5J59A 3RRXA 1WS6A 1ZCJA 2X1LA 3DDNA 3D31A 4Q12A 3VU9A 2CEAA 4R1MA 3ZY6A 1AGYA 1KNQA 2PH5A 4R2LA 4PC3A 3DCNA 4B48A 1NVUQ 3TN7A 1P2SA 2FPMA 2DWOA 2C03A 3N70A 1QYVA 3BH7A 4QGAA 3T15A 3GRRA 2XXBA 5H82A 5U9CA 4O08A 1ECJA 1T8TA 4DSAA 4KR9A 1RWVA 2QMYA 3LKZA 1JI0A 4RVGA 2H59A 4ZOBA 1KY4A 4QUAA 4ZRMA 5J1TB 1OFGA 3I73A 3QVTA 2ZYSA 3UK7A 2ORVA 3BMCA 2WF5A 4BMVA 2YVLA 3BDAA 3CCCA 1Y81A 5IDXA 1UMBB 1QPBA 4ENVA 2WTAA 2VNKA 2QX6A 3U4QB 1ZVVA 4PLFA 1IUPA 3QTBA 4FB5A 4Z4EA 2PKQO 4OD0A 4MVJG 4YRKA 3PIDA 3I9V1 4RTJA 4R83A 4PVDA 1P81A 1KE1A 3JQ7B 3PNSA 1JE1A 1QU2A 13PKA 2OCIA 4B6QA 3AI1A 4KUGA 1VLLA 1CIPA 5FR2A 1TIKA 4MTLA 5KVVA 1EP2B 4EB8A 2J7PD 5EZYA 3X2FA 5C4IA 2IYZA 5EWJB 4M1SA 8OHMA 3FZNA 1EVJA 2FKNA 3B20A 3FWHA 4RHFA 1A3CA 1IZ8A 1KO7A 5JI2E 2WFAA 1KIFA 4KH1A 4WXYB 2AWNA 3GRAA 4FEGA 5CVUA 2JLWA 3VOSA 2HA5A 3B6ZA 4MW9A 4N7MA 3W5BA 2BMVA 4F5WA 3TL2A 1SN7A 4LV8B 3IO5A 1KZ7B 3IPAA 5EE5B 3WKBA 2Q28A 4L28A 2P75A 5TT1A 1IY1A 2OBBA 4L1KA 2HPAA 3KQHA 2W8ZA 4NOJA 1E5XA 3I53A 2G4LA 2YY6A 3BBLA 1OA0A 5KHAA 4NIMA 5GAJA 5IF3A 5JLAA 1RHQA 2O9JA 3IALA 3ZIDA 1CQIA 1YRHA 2VKQA 5KI6A 4P0TA 2C00A 1SQSA 1PT8A 2POQX 5BSTA 3IAFA 3U31A 3NTRA 2P65A 2OGTA 3GRCA 4KMMA 2ZRKA 2D5AA 3HCWA 4NBUA 3F6YA 4O3FA 4P7FA 5JSYA 3HM2A 4C20A 1W5FA 3N59A 2PZEA 2GFIA 4JYPA 3U9SA 3P9RA 3E22B 3BHMA 2ZBUA 3M4YA 3ORSA 1SUIA 4IUDS 4LZZA 4QEKA 3AY6A 4H7PA 5BWCA 4GYKA 3N8HA 3TOSA 2XD4A 4BEJA 3PE6A 1DWQA 5CK5A 3OKAA 1AZSC 1H93A 1Y4AE 3HCNA 5F3DA 1XZDA 3NBQA 1R0BA 4YJ2F 1GXSB 2PUDA 1G20B 1KI4A 4CF5A 5KYNA 4NZ9A 1N2CE 5LWQA 4DB2A 2GZHA 3DZKA 1NBOA 2IHNA 4DCOA 3RIGA 2PUWA 4MB0A 5FPQA 3RUCA 4B33A 5HPYB 1SXQA 5T57A 3MMPA 2FWBA 1GGJA 2A86A 3WB2A 3BUSA 1M2OB 1SUWA 1HRKA 2EF0A 2R6HA 4WJZA 4CYMA 4FGWA 5AMXA 3RYIB 4CIWA 2IUTA 1IN4A 1U0HC 3LPCA 3OMWA 1XZJA 4MR9A 4E09A 2IIQA 1DFHA 3KSAC 4M87A 4Y9TA 1W8DA 3EEIA 3N2KA 4EX7A 2V3CC 1JKIA 2JEZA 5KIAA 1MPXA 2VCHA 4LJSA 1KKUA 3OJ0A 1JUDA 5H70A 4DLSA 5IASA 5KTRA 1W34A 2B4AA 1NOKA 1M2NA 5FBVB 4II3A 3ZHQA 4I66A 4S1PA 2X8LA 2H5JA 3I92A 3W2HA 1ES9A 4D42A 3RC8A 5J47A 3SHFA 2B6HA 1XJCA 2JJ1A 2V0NA 3HYRA 4RETA 3RJTA 4Z6KA 3KB6A 5FTNA 3ZY5A 3O4RA 2VOEA 1JIKA 1Q91A 2HF7A 4HGQA 1ABEA 4FBLA 4WZAE 1NW9B 4F4FA 3M8KA 1AU9A 2CMFA 3PDCA 5EJ7A 3RVPA 3FOEC 3B89A 4JWKA 1BYUA 3A1DA 5ALGA 2AC2A 5HQJA 5A6SB 4F71A 4H16A 2FMFA 3PXEA 2I3AA 1COWA 3INTA 1ORRA 3K9NA 1CJBA 3R20A 4KWTA 1WW8A 2VA8A 2PKCA 5DDIP 4YJHA 4WY5A 5JPDA 1A76A 1AF7A 1PCXA 5K6TA 4X1IA 2QAGA 4PGAA 3NHMA 4OQXA 3B85A 4P34A 1E1NA 1KR2A 2X9NA 5CG2A 1JYEA 4UVGA 3SMVA 5I7WA 2O6LA 2DEUA 1O4VA 1JIIA 2FYTA 1JU9A 1CULC 2QTCA 2XGGA 2JGDA 5HFJA 3SDZA 5E4JA 5I8ZA 3R0IA 1N2CA 4C0KA 2WMOB 4B7XA 3T99A 2IOYA 4MYHA 4XIYA 1W4CA 2WMYA 1AMOA 1YZLA 2JI7A 4N03A 5A1TA 3DAGA 1GPAA 1P4JA 3ZV5A 2VSQA 2V5AA 2YVUA 3DO5A 1CZNA 1T3SA 5LP6A 4GSYA 4CEHB 3NIDB 3H5TA 4REOA 4DCGA 2QRMA 3GP8A 1JECA 3VPFA 3UTDA 2DY0A 4JBGA 3SX4A 4OQ4A 4YGYA 1ZI8A 1U8FO 4OXQA 4FX5A 3AHEA 3SICE 1Q6ZA 1RKXA 4LC0A 5F1PA 2YTZA 1R9NA 4HWKA 1N0UA 3ETCA 4Y2XA 4L5JA 4LGVA 4ZVPA 3C4VA 1BGWA 4D3YA 5LQRA 4ENSA 4FE7A 3FE2A 4B3DA 3CLUC 4DG8A 4B0OA 1U0NA 1EYZA 3CNNA 1XP5A 1E3EA 3FXAA 3HMKA 4PNEA 1L9KA 1T9GS 1JQKA 1X1RA 1MO4A 1YQXA 2C9CA 2CFIA 2JIBA 3BXFA 3W6OA 2EVWX 1GVHA 3BWEA 4WZAA 4EFDA 1UM8A 1IU9A 3HN2A 4OYRA 2J1LA 5J2UA 1CRQA 3GYBA 4CM9D 2FPGB 1BMQA 1G7CA 2VLIA 3DBIA 1R15A 3FTCA 1FW8A 1U80A 2QP9X 4FT4A 5D85A 2APJA 3OZDA 3OSUA 1S2OA 2VXCA 1XEFA 2Q5LA 3UN1A 1H8EA 3NPAA 1YRAA 1L7RA 1CJUC 4JSTA 3VZBA 1LNZA 4UTPA 2O7SA 1FJXA 1QPZA 3BSSA 4ZT7A 2RAFA 1KRXA 4TUYA 2HMAA 3AV0B 5KNCD 4U7GA 4XLLA 3GLHB 4OSPA 1ML3A 2LWIA 1ULZA 3TKYA 4YWJA 2TMYA 4LA4A 3IT2A 3ZHRA 1L7AA 1GADO 4BO4A 1XPOA 3HJFA 1E0JA 2VPPA 3HEAA 4D0RA 3CZMA 5EXDA 2XJ9A 4OQFA 5JPCA 4F2GA 2HPVA 1CJTC 3FDFA 5J4YA 3HI6A 5HF5A 4OI2A 2B5OA 1EHYA 3WGGA 4UHFA 3OICA 3GNQA 4IRUB 2CJWA 4IHJF 1CDOA 2A78A 3AFOA 3JVUA 1Q3TA 3LTEA 1YH3A 4K2HA 4P9NA 4YUYA 4RHYA 3OTWA 3R6GA 2ECFA 4KQ2A 4DA9A 3L7KA 5B7GA 1YR1A 1WZNA 3L41A 4K9PA 3HKCB 4AMBA 1U7HA 4ZQHA 3GVXA 5CEFA 3M1LA 4PYOA 1ZVJA 2TSYB 3BFXA 3I8SA 3KPJA 4MP6A 3KOOA 4KE8A 2F67A 3GI1A 4H3VA 3ZZTA 1N9ZA 2XGMA 4A26A 4D8WA 2OV1A 5IC4A 1USKA 1TM3E 4WI1A 1YDWA 4L72A 5K03A 1BRMA 1GUDA 4NPCA 3HYLA 3BEDA 3AU8A 3N6VA 2BUAA 5DGHA 5LB4A 3TCKA 1P8JA 4FI3F 3TL3A 4FINA 2VPZA 1CDEA 1YFKA 3A4YA 4QWWA 1KGSA 1E18A 5A9TA 5HM6A 5JNRA 1U1EA 3E61A 4DV0B 3FBWA 5DK4A 1YTUA 3GQBA 3N86A 4PLCA 1TO6A 5CJPA 1SB9A 3KQSA 4PM4A 3CVUA 4DR2B 1WXWA 3S1SA 3CXUA 4ND5A 3GJSA 2R1ZA 3AEYA 2Z2YA 1PJQA 1XJQA 4RJIA 3FZEA 1R4NA 2WJWA 1BHO1 2A4KA 2E48A 2WJ4A 4FFPA 5U4QA 2EBUA 5CLLA 1P73A 1T2EA 3DTVD 4QOEA 2EW1A 3U3MA 4B47A 2P2GA 4AI6A 1Q0QA 1RSZA 1V6AA 3TQFA 1DQNA 1QF6A 1M66A 2WPDD 1T1RA 4FHGA 4UQPA 2XMZA 1GTVA 1CETA 3PIRA 3Q7TA 2WV7A 4MHOA 5CFOA 2WF7A 5M7EA 2XYVA 3PNBA 4WRRA 4QOJA 1L5GB 5CFZA 1HE2A 3DLIA 5TSDA 4US2R 2FG7C 2OTCA 2C3OA 4R8KA 2D2XA 3KHTA 2VQFB 3G85A 3PLRA 1YZVA 3PR3A 3KZKA 4EB6B 4RAOA 4CIVA 4B4VA 2E21A 4LTNA 5DWDA 2PUVA 3KOZA 3O0DA 2AJTA 3S2EA 4BVAA 1CFJA 2REOA 3NHBA 3RIHA 6LDHA 4QTUB 2FRDA 5ITWA 3U1TA 1Y3IA 4F3RA 1YZYA 1AQJA 2XF2A 2PKEA 3FYUB 1FNBA 1TIBA 1JPNA 4G1UC 4MRVA 3WIOA 3KAQA 4BC1A 4XRRA 5LKAA 4V0ME 1R6XA 4GZMA 4Q6BA 4ZAYA 3AVWA 2WJVA 5JJKA 1X1DA 4PX5A 1XVUA 3CLVA 1TZJA 1EDEA 2HT6A 2UYHA 1GDTA 1XN1A 2XB8A 2IOQA 3FF4A 1L4YA 3GJ8A 3JQEA 3M6AA 2GJ4A 3M5PA 1VBMA 2OVBA 4H6PA 1XMXA 3LQYA 3W1EA 1M6YA 4LXUA 4YXWA 4Y6PA 3HCRA 5SZKB 1H6CA 3KYJB 2VNAA 3O3CA 3Q41A 2Q7DA 4U2CA 1U31A 3RUPA 2VDNB 3T3GA 4EPRA 5B3JC 3OURA 5B55A 4YHHB 3KVOA 1H6BA 1KQ3A 4GD3Q 2V4ZA 2ZANA 1N6HA 3L6BA 4CVNA 1TCBA 2EYQA 2CNWA 3QIAA 5CT4A 2AF3C 3SYKA 3V8VA 2O5RA 5DXAA 3VHXB 1D9XA 4CN9A 1ACMA 1C29B 1VSUA 3NANA 2BE7A 2HDOA 1AKVA 3GFFA 3G1TA 1CUDA 2QUAA 2HX1A 3MJSA 1KXJA 3N7TA 4HH4A 1P2BA 1KOLA 3V1KA 1O97C 2HBZA 1P33A 4POOA 3RFCA 1Q16A 4EIWA 1XFAA 3BXZA 2QT0A 4RHUA 3LYUA 1W2GA 3WNCA 3HGMA 3GMDA 3ET5A 5H5JA 2Y1OA 4KFTA 3ZWWA 5I47A 4UD2A 3NR2A 1A69A 5JY1A 2HK7A 2YRWA 2C0PA 3D1LA 1E2QA 3F71A 3MM4A 4I1SA 5CA0F 1ILEA 1INLA 2JEYA 2P0YA 2NXJA 3DHEA 4EYOA 3NTXA 5AI8A 1EWYA 1G0NA 1LWNA 2RI6A 3F97A 3FDXA 1MOZA 3VZQA 3OU6A 1G21E 1JR2A 3C3YA 4GZ5A 4HVAA 5K8UA 2V7BA 2VR1A 2AKYA 4X91A 4IW3B 2PIAA 2DPYA 3HN6A 4L8VA 3EGWA 4L85A 4MUKA 4W1SA 3ZN2A 1K27A 1PK9A 4QHTA 4CTKA 2FB9A 5C4MA 2YMPA 4MGYR 3TFWA 1B0UA 2JGMA 3FYHA 1UBSB 3K9QO 3QPBA 1MU0A 1B6TA 1KGDA 1NMEA 5JZMA 3GUZA 1OREA 1GPWB 4Q3EA 4QUHA 4X66B 3DONA 3KZMA 5H0IA 1O97D 3CNOA 1DJPA 3IVGA 3QVUA 3JQAB 3EWIA 3TB4A 4DUGD 1EXNA 2ZI7A 3HQ4O 3Q4GA 4DV1B 1WR8A 5JATA 2OWEA 2R4TA 3OOEA 1RHUA 4XTCS 3N39C 3QUQA 5AW3A 3QKTA 2BM8A 4O2LA 3S1LA 1O7JA 3HDJA 5H81A 3LCCA 5EUQB 3MN1A 4ZFNA 4DXHA 2ZBVA 2F9FA 4HO1X 4MAFA 4OYYA 1HRDA 3PR1A 3IAS6 2EYUA 4UMVA 5T8KC 1D2CA 3RHZA 3TXXA 5ECYA 4TZTA 3V4ZA 3VR3A 1I13A 2FAXA 1T24A 1ORVA 2B6NA 2IYUA 2NVWA 1NVFA 2WVAA 2IT1A 3GPIA 5BNIA 2QR2A 2NW6A 1NXVA 2JC3A 5H8WA 4PYLA 1PE0A 3UC5A 4X8OA 5JDIA 1HLFA 5BN4A 2KHZA 2HJWA 4XDYA 4EJFA 2C9ZA 1JEYB 2QLFA 1U6IA 4C2BA 3NW9A 1RQPA 1CUIA 5LMUB 4C4ZA 5FNZA 1U8AA 4FCVA 2GM3A 3HO6A 4DLNA 2K4MA 5KYGA 3H1TA 2IXDA 2GN8A 3G0BA 5IJWA 2A0WA 3K4QA 2G06A 2MHCA 3EJ6A 4MKGA 4O4LB 4LX0A 3UA3A 4LOJA 2P11A 2WFLB 5AD1A 5L3ZA 1L5HB 3KVVA 2FSSA 4B5KA 2OCAA 1NBIA 2POCA 2Y1CA 3HYTA 3LW8A 1W19A 4CQJA 4L0CA 1EDDA 2MSWA 5AKGA 5IM5A 3G5AA 2W2KB 2R00C 4FMDB 4D56A 2XDQB 3OOSA 4HDCA 2QD5A 4NCXA 3IGFA 4RV4A 3FPEA 4HMQA 4X93A 3SR4A 1WB4A 3E3OA 3DVLA 4FEYA 4D82A 4L0QA 1R8JA 5IJ0A 3WO0A 2AUNA 1IQ0A 1O6ZA 4WLFA 4BNGA 4CDMA 3SEFA 1W6UA 1TJ3A 3PRJA 3GLUA 2JLYA 2O3JA 1ODFA 3KJIA 4PZZA 4WFKA 1SKMA 2BISA 4D74A 1A8IA 1F2UA 4B1FA 1J9EA 1HH4A 2HO5A 4NXMB 5C9ZA 5BSRA 3HSSA 3ANNA 4BQEA 4K3VA 3AR5A 2GCIA 4IGEA 1AE1A 2IPAB 3OPVA 4FE4A 4EQ6B 2G7MC 1KO1A 5I8PA 1D6MA 3H2HA 1KI2A 1KJ8A 2F3UA 3P9KA 4JNCA 5T4FA 2HW8A 4CLRB 1VA4A 5LBTA 5L53A 1B0ZA 1E2LA 1FYFA 2RBEA 2ZYUX 4UULA 4B3FX 4C0HA 2QSJA 1TU0A 2JHAA 4E14A 3K7EA 5IWCA 3PEYA 1VI6A 4XB6B 3EPLA 3K70B 1HYBA 4ND6A 4C76A 2O7NA 3P0EA 4RMNA 5JR3A 4ND2A 3AL0C 3T7CA 1MB0A 1JHXA 1JMYA 1P29A 1ZGCA 2Q3DA 2RAUA 3P9SA 4TOIA 3RC1A 2TS1A 1JKJB 2NX2A 2Y0EA 1U90A 4M0EA 1Q1BA 2JLRA 2CDBA 4Y2TA 2I99A 3DKVA 2F1RA 3EIFA 1Y98A 1Z5NA 3DE4X 2JFBA 4E12A 1S2LA 1SXPA 3K0CA 3CX4A 1NYLA 2OV2A 3PNPA 2CZQA 2BFBA 2C94A 4EHHA 3L1JA 4F8YA 1HG0A 5HRAA 2BHRA 3D64A 3M4NA 2O2ZA 4OJMX 3R0VA 1E0SA 1NW4A 4FVTA 1NPTO 4MUIA 1V4VA 4X3CA 4MV1A 1XRJA 3B1VA 5G1PA 1ZOLA 3RYFB 1VKJA 4URUR 1MV8A 1E8NA 4A15A 1JLRA 1E6CA 5JH7F 2DFKB 2QX9A 1NVAA 4JYZA 4LDRA 3B9RA 2V55B 3NBYC 4GF5A 1GGVA 2KMLA 2XT6A 2M9MA 4K6HA 1UZNA 3A37A 1PL7A 3PE4A 1J0XO 3LKBA 3WI7A 4KO1S 3QHPA 1N2IA 4UM7A 5B6IA 3B2NA 2OORC 2PLFA 1UJ6A 1U1GA 3H11A 1Z5OA 3QOYA 2ZYIA 4HY3A 2DKOA 1BW9B 1JAHA 1YOVB 2ZJBA 1T6YA 3EDYA 3IR7A 4D0NA 2GM5A 4PQFA 2YCBA 2OFPA 1Z6YA 3BH6A 2P2CA 1DV2A 4KACA 3CFYA 3HNOA 4QRDA 1R16A 3OEED 3HL4A 4GEGA 3JWEA 2P9EA 5CPBA 1NFRA 4BQOA 4YRBA 2IEYA 5HCIA 3DCIA 3ESQA 1FPMA 3OLXA 4QYTA 2J5QA 1EB9A 3QV2A 4W5NA 4UAUA 4WJKB 3TRFA 2LP4Y 3F47A 3H1PA 4MVCA 3PF8A 4L9RA 3LQQA 1FYWA 3O6VA 4D46A 4Y7DA 5BOSA 4JYBA 3QPUA 3L6UA 1YRYE 5CDGA 3HXOA 2ZJ1A 8LDHA 4J0DA 4QC2A 2P6NA 1MNQA 2QLJA 2I6TA 2OHHA 2H18A 2W11A 1VFPA 2AG0A 2WTXA 3CEPB 1G60A 3EFHA 3LFTA 4QLOA 5EAIA 3WLPA 4I55F 3A1UA 1M72A 3JXEA 5JYBA 1ZM9A 2PKXA 3C6BA 4QHSA 3LIIA 1U63A 4TWZA 2TMDA 3KEOA 3EYWA 3TDKA 5DNYB 4QLBA 5CYFA 3P9PA 4GYWA 4K87A 3PL1A 5C7LO 3W4KA 4QFMA 2OO7A 3WY9A 3GUYA 3NUGA 3CWQA 3O1HB 2IW1A 3AJRA 1OZAA 4UXIA 5K3OA 1MCZA 4LRQA 1TVEA 3BK2A 4EK9A 4HWSA 4YCAA 4BWFB 4IR7A 4IFTA 4OK5A 3ZY4A 3AF6A 1IMOA 1AKQA 1MZVA 1I3OA 3W78A 2ZUUA 1LCIA 1H2BA 4EYQA 5K0TA 1QG0A 3D6UA 5E6SB 1HFKA 1Z74A 1MFPA 4S1NA 3JZDA 3LW7A 3WV4A 1NYQA 3QUSA 1DMRA 2V6BA 2WUGA 2XXJA 4ZCPA 3ST7A 3FWZA 3KXDA 3SC2A 3ZWXA 1Z16A 1JQLB 1I3MA 4ZT4A 2DB3A 5PNTA 3M34A 2HCBA 3UK1A 2GETA 2PGLA 2WA2A 1XA3A 3R0XA 3PFFA 4E08A 1JDNA 1MT0A 4KMRA 5AQ1A 4JROA 2O14A 5AKZA 3K20A 1RAEA 4NMXB 3PFWO 4FOLA 4KIUA 3VNVA 1R9GA 3UJ6A 2YYAA 1YWGO 3UJNA 3E15A 2V7UA 1XCPA 1YZGA 1GZUA 3AOEC 2F1JA 5EKDA 4Q9AA 3IHTA 1IC6A 1YZNA 4RTOA 2A9KA 5ELXA 4C89A 5K3AA 3QWFA 2Q3EA 2A94A 1DAHA 8ADHA 1UWKA 3OSZA 5FBLB 1D2RA 3UOGA 3FHOA 1U28A 4BECA 5KMGB 621PA 5HW0A 1DQZA 4HYEA 1Q19A 2C97A 4JB3A 2DU8A 2HL6A 2IYNA 2FZGA 1PJRA 3EW7A 3MWLA 1CF2O 1YE8A 4D97A 5JSZA 1HFEL 4ALIA 2WYOA 4TVOA 1CYEA 1GTG1 4IIGA 1YKSA 2VYVD 1L7DA 1QGOA 1J8QA 3RTDA 2YDYA 2H29A 2ZDQA 4YMHA 2IHUA 2O8FB 3DOHA 3QEMB 4ZQEA 1XDWA 2XIJA 3HBMA 2PEZA 1GPMA 1PT7A 4A8JA 3IULA 3KBBA 3Q3GE 1Q83A 1XN4A 3M6FA 4A4DA 4CQNA 1S2GA 5CCXA 5CH3A 3S2FA 3B3GA 1K4YA 2ZZMA 4P1ZA 1J07A 2B2NA 3OQIB 5EWLA 3DL7A 5AR1A 4WERA 1PWHA 3U7EB 4E7PA 2H5EA 4QASA 5EJIA 5G0UA 5KYUB 2FEAA 3MWGA 1GUZA 4DDKA 5AVSA 2G1KA 4BRSA 3DOEA 2XR1A 4MZDA 3U7RA 1CSEE 3L0OA 4OI0A 1WLSA 4QEDA 1IK6A 1OZ0A 1IN6A 1RMYA 2JCXA 1QFYA 2WDZA 2ILVA 1RD4A 3P20A 1Z6AA 1JHZA 1XZQA 1FZQA 4TXJA 1H9AA 5IZCC 1IXZA 4P84A 4YAWA 5GJVC 4WZBE 3PJFA 5B53A 3WIVA 4ARIA 2D13A 4M1ZA 4PFSA 1ORTA 3BORA 3SQLA 5J5CA 4LDAA 4NABA 1D2NA 4UHDA 1NU8A 3SJZA 1NNSA 4D0LB 3GMSA 1Z0ZA 5I45A 1TI7A 3URMA 1EA7A 1T2AA 4UVEA 4PVCA 5CPFA 1FDWA 2C3PA 4EW3A 2B1QA 2IYPA 5BSMA 4FYWA 4ARZB 4LZLA 4ZYWA 1SUAA 3ESDA 1A5TA 2QY6A 3BCUA 1C80A 3ZX4A 4B4WA 5B36A 1ZJYA 1G8YA 2VP4A 3F90A 5I48A 1NJGA 2QYOA 1MPTA 3O91A 4D6XA 3SYLA 1JVBA 1YCHA 4BGUA 4S0ZA 5IJ9B 4MQEA 1TUEA 2YWFA 3GA5A 5DW3A 3NEAA 2P35A 5DM60 1WCV1 3UATA 5IKPA 5HIJA 1RKQA 1WMBA 2Q99A 2BEUA 4ZTZB 1C30A 4N8SA 3N8GA 3W3ZB 4NC9A 3NT5A 5EIHA 5JNVA 1HG1A 1V1JA 4FFMA 1WWKA 2WMNB 1A9RA 4WMLA 1HSZA 3BRSA 3UGQA 1O4WA 4TL7A 5JI3E 1JEEA 3KTAB 3A3KA 3DE7X 1OZFA 1SKUA 2IHVA 2NZ8A 3OUUA 3P26A 5KJ6A 1PR5A 3M6UA 1A97A 5IUJC 1P0IA 3UT6A 2O8BA 2Q2OA 4GZ6A 4U7TB 2FW6A 2B5VA 2JAOA 5TQ2B 1O9GA 5F2NA 5IXSA 4KPEC 4LHVA 4D6PA 2JLCA 2W2LA 5F1YA 1JVSA 4C4AA 3TR6A 4Z7JA 2H57A 4GR4A 2HQBA 1ZK0A 2CDCA 1QE0A 1G9XA 5FYDA 1JA9A 2VHUA 2PFKA 1Z34A 5LIPA 4E13A 4ZJPA 4YPVA 1E3MA 3G8AA 2ZWMA 1GPKA 4E03A 1DAFA 3S2IA 3VZCA 3SVTA 2IS2A 3UJ8A 4DPLA 1ITZA 5DYGA 2B0JA 1KBQA 2PA0A 4B3BA 4UPEA 4B3RB 3FYDA 3IQIX 4UCQA 4I2NA 1DQYA 1U0JA 3JWGA 3OLZA 4L8FA 3NP7A 4IWYA 4RPIA 4DYVA 2V7VA 1PAUA 1HDOA 3SKXA 2I71A 4B3JA 3GWGA 2H08A 3KOUA 1W1IA 2WOJA 5DEOA 1J8FA 4QVKA 1PIWA 2VWHA 3Q6IA 2BEWA 1Z68A 2GDJA 4GX0A 4RKRA 4TLBA 3OIWA 4F0JA 1AQIA 1HE4A 1SVUA 2I2BA 4NEGA 3V2UA 4KITB 2D2VA 4YVFA 3FSRA 3Q3HA 2OSBA 1ISJA 1SKAA 1T36A 2Q1SA 3A1TA 3U3DA 3FNGA 3SK0A 4YDRA 1WCIB 3IPCA 2OKGA 2D7DA 4ZI5A 1Z6ZA 3VYSB 1VCHA 4MQ4A 1XTSA 3AUUA 4D98A 1JL3A 3F5FA 3ESCA 2YQ4A 4AF6A 3CT4A 1YASA 3TZBA 4JP2A 1SBNE 4UQLA 2DT8A 2JGNA 2IHJA 5EXSA 4BYMA 2CLKB 1XZ8A 2BFNA 1GL9B 3DLHA 1JYSA 4KAAA 4ALMA 4HNUA 2IBSA 1DEAA 1XK6A 3DE6X 2OXCA 1NQWA 1VRCA 3ABOB 1EX1A 1OI3A 3DMHA 3GT0A 2IDZA 4QJBA 4AY3A 4ISCA 4B32A 4DS3A 1D8TA 3L4EA 1HMYA 2YYYA 2ZJFA 3HDQA 3DXXA 2GGSA 3GFTA 2RGAA 4Q6WA 4ANFA 2C9MA 4QG3A 2IYYA 3GLQA 5ALMA 1GUFA 3R7AA 1GZ4A 2ADMA 4EDFA 5TEVA 3F5SA 3K16A 2YIJA 4OAOA 1NJSA 1I4TD 1QGZA 2VP9A 4MR9B 4NYIR 5AVQA 1Z4PX 5E3JA 5EXTA 3I39X 2H7XA 3CZQA 3UBTA 1U2TA 1DDIA 1O0SA 1QV9A 1E6UA 3GAZA 4Q4DA 2C7BA 1O89A 3GH1A 2XQVA 5EIEA 4TLAA 1IDOA 2J3QA 4H7JA 5BV7A 2WG1A 5HS4A 3SD7A 4IXNA 1XDBA 2NVBA 2V59A 4ZARA 1A4IA 3LBHA 3VSEA 5A5VA 2G9ZA 5KNBA 1T1SA 1JIQA 3TECE 5HKKD 2XOEA 3AW8A 1U2EA 3ZJUA 1OIVA 1VKOA 2E85A 3EDMA 1ZOOA 3IBFA 4RTRA 2O8EB 3LQ2A 3VX3A 1P4HA 2IIVA 1X7GA 1XF9A 1AK1A 1GSAA 2P4SA 4IXMA 5ILOA 1RLTA 1UJ5A 4EKGA 5JTTA 2OBLA 4JSRA 5G0VA 1IZ0A 3ZHSA 1B6SA 5EHIA 4F3NA 4N12A 4RMIA 3WQSB 3L18A 2QRKA 3BE6A 2GYWA 2AOTA 2C9DA 1P80A 4YJHB 1U7PA 1TRKA 1VMIA 3QXSA 4X1IB 2Q1TA 4JBWA 5KZMB 3AZPA 2ZBRA 3CUSA 3UFXB 1IHOA 3EWAA 3R6DA 5EUBA 3RHTA 3GLRA 3QHQA 4DMLA 1R3UA 4WEOA 2VHQA 1EUDB 1I2DA 3UT5A 2JIZD 5HK9A 3EX7C 4O1MA 1I5EA 3QU4A 5ALDA 4BMXA 2X6QA 4DCCA 3K0EA 3ZU6A 1O03A 2J0VA 2A9JA 5BQPA 3X3HA 3T5AA 2M6SA 1NBME 4JI3B 4MVJE 5ER6A 4JEIA 4DV4B 1Q0HA 3I6YA 2NO7A 3USZA 3PPIA 3D3WA 2ZATA 4FFVA 2BW0A 4MAAA 4J76A 3IAEA 2ZT5A 5HBRA 3SBDA 3PHBE 4HZUA 5COQA 3DOOA 5AKYA 2BH9A 1EUCA 2JFZA 2VAMA 3UTCA 5KX5B 1H4SA 2QPAA 2VRBA 3INRA 2QVYX 3OC6A 1YIAA 3BFVA 1VBNA 4G0ZA 4M9RA 4AWXA 2A3NA 3NV9A 3SF0A 5DTQA 5EJ8A 1IBMB 1ZJZA 2Y0PA 3KAPA 4URYR 3FBGA 4AZSA 4RD2A 2GD1O 2NAPA 3G2PA 3ETGA 4BC0A 1AGPA 2ESRA 1DIGA 5DTMA 2J41A 1EJ6A 2PZGA 1S7GA 2XDAA 3U7GA 3BK7A 1UKVY 5CA1A 1NX6A 2DR2A 4OX9B 1XDGA 2J6HA 4XYGA 2IHYA 5FA6A 3FSGD 1ZOIA 4IICA 2C7PA 4N3GA 3CG4A 3HWX1 4RZ3A 5K0GA 1DHTA 2IA5A 5J2UB 4OMCA 3DVQX 1EP1B 2PWYA 1SBQA 4M0DA 4NOLA 1M2VA 4AG3A 2ZRCA 5IKMA 2DT5A 1PW5A 2J7KA 2NN3C 3OC0A 3R3ZA 4FYIA 2PR7A 4FBGA 1C1HA 4BLRA 1JV2B 3PNYA 4TQUS 2WTMA 2W58A 4GM4A 1U5AA 3TSOA 2C83A 3ZBPA 3QNUA 1YMUA 1Z0IA 1DFIA 1DKMA 4J3NA 3D8NA 4CU5A 4MDFA 3OUZA 1J25A 1CEYA 3IRVA 1VIMA 2MMGA 5JECA 1N3LA 4WK6A 5LC1A 2DSTA 4G0YA 4EMTA 2VC2B 3ADPA 2FHPA 4HGYA 1QLHA 2NQ2C 3IILA 2HSGA 1RAHA 2XYRA 3F1LA 4MV5A 3HJNA 5DM4A 5BP7A 3DBRB 2NU8A 2LZ0A 2IC5A 1E2HA 2VRNA 1POWA 4XIFA 4D26A 4CFSA 1E4OA 1V26A 3R75A 3ZKWA 1N5MA 1KJWA 1L4FA 4ARUA 2I9KA 1KRWA 5JBIA 2FZCA 2IBMA 4KXMA 2C54A 2IW3A 3N87A 1XZNA 2GA8A 5T4BA 3VPAA 3NRCA 3KJEA 2A1UA 1UDRA 1ZGAA 2I9PA 4QBFA 5DM2A 4EA8A 5ADUS 4CKEA 1XZMA 3COVA 4G0XA 2UKDA 5AJTA 3TL6A 3Q2IA 4BMSA 5EP1A 3RREA 4JLJA 3LUAA 4WV3A 1T6ZA 4QYSA 3AEZA 2X0DA 3VQTA 3N2ZB 5JAMA 4CF4A 1AXGA 1L9XA 3KSUA 4LPSA 1I4DD 2AJ8A 4TTJA 5AJHA 3S8YA 3D4BA 3NDRA 2C4VA 5JE8A 2RJNA 5TB5A 2B98A 4IEFB 2IKQA 1P5FA 2NXCA 3G8YA 4JL5A 4KV9A 4QPZA 3ZLUA 2DFTA 3O2QB 3P7MA 1GGEA 1SA0A 4CDNA 1W5SA 4Q0MA 2QD3A 2B78A 2PVPA 4B8ZA 4C87A 1YMVA 1IOVA 3B60A 1AY0A 5D2CA 2UUBB 4L6CA 4PQEA 4WKOA 2FEOA 3LWZA 4FZJA 4YAOA 4MPTA 4PYRA 4A82A 1W47A 2W0MA 3TR0A 5LCXA 2R1VA 4OQQA 1MR3F 3A1SA 4RH3A 2OHJA 3BRCA 4J75A 3NKLA 1XWIA 1PT5A 4GPIB 1D5CA 1W4BA 2GZDA 2P3OA 4Y6LA 3RT1A 1GNPA 2IUEA 5BQ3A 4ABTA 2JJ2A 1XG5A 4R31A 5D1NA 4MJ3A 2I2DA 3OTGA 3PXCX 2LXNA 4NNOA 4FLEA 3HB1A 1WY5A 1JF8A 2B69A 1OI2A 1AQLA 1CKEA 1YRBA 2EGHA 4PLPA 5KJ1A 4I50B 5KVCA 4DWWA 4KPYA 2O2CA 3ZNQA 4EJ2A 1NZDA 1RBMA 5GOTA 1LTKA 3Q7PA 5FI1B 5BV0A 2H1FA 5CB4B 4LY3A 4YMVA 4UM8B 4W1PA 2R66A 3ND7A 3K9BA 4GAEA 2ZCVA 2GF9A 2QMUA 1Z2OX 2XA9A 2FXIA 3O8LA 2UAGA 1RRPA 1SNYA 1RQLA 2P0AA 4IYJA 4WAUA 5CVDA 3S99A 1LB1B 2GO7A 2A59A 3GRPA 3LCMA 4BNFA 3MB5A 4GT1A 4M9CA 4DXAA 3AF0A 3CHYA 4WWHA 5I5EA 4ENQA 4HQ6A 4MPRA 4L8GA 2PSJA 5HHTA 2R97A 3FR8A 1I6MA 2HU7A 4MKXA 5EXEA 3CNQS 2YV1A 2F9MA 2VBGA 3IHKA 1GDHA 4KGZA 3A6GA 2LKDA 3WFJA 3KTDA 3FUUA 2DFPA 3D7LA 3DKPA 4J43A 3QKUA 4ACBA 2PTHA 3B9BA 3KYCB 3HCAA 5A4DA 1FP2A 3VVMA 5BUQA 5K0BA 3BWXA 1KI8A 2YINC 2CMDA 2SNIE 5AQEA 3LUPA 3C43A 3LUFA 1VJRA 4URZR 4X44A 4C5AA 5AVUA 1UPTA 1H2ZA 1UKCA 2ANBA 3B6IA 4QQRA 5TVKA 1P1BA 4O4JA 4PAWA 2AZDA 2CNDA 2GPNA 2J4FA 3KKEA 2W4IA 1GYPA 4I4TF 4TKZA 4BMZA 4MQBA 4UDNA 2QNIA 2DBYA 3PEFA 4PBSA 1S5PA 3GDFA 2WHRA 4PC6A 2ID4A 2WYVA 2Y1FA 4PO3X 3UJDA 2HHHB 3AETA 1Z2AA 2ONKA 3HJUA 3NBFA 2X2PA 3I1IA 1OPRA 3RRFA 4B71A 1M2EA 5F7JA 1GY8A 5JEDA 1AKMA 3F6SA 3OWXA 3A1NA 1U4NA 1YA8A 4CGZA 2J67A 2W5UA 1V71A 3BZWA 1GLNA 1Q20A 2IIPA 1QUFA 3QW4B 4DFDA 1Q0LA 1NIPA 4PO8A 5JAOA 2JIRA 3PSHA 1C1DB 2XWJI 3MTIA 4ROTA 5JSHA 1TUBA 1P7PA 4W5OA 1B23P 2LCFA 3A6EA 2GLXA 3ENNA 4NE9A 5TGTA 2Z8XA 5LYJB 4OLJA 2NO0A 1I0LA 1P91A 2I6SA 2JGKA 4C0WA 2CV1A 2P41A 2CUTA 2MYNA 4DM4A 1RCTE 2FSVA 1RLOA 3LUDA 3PITA 4OHZA 4B7CA 3FVQA 2DH5A 4GG1A 1YSCA 3QW2A 4IGFA 4PYIA 4UHJA 2HT1A 2FUG1 3EQ7A 5FOWA 3SC4A 1HZJA 1VB5A 5I7SA 4H7DA 1E92A 3TZKA 3V6LA 1OLOA 2O1EA 3P71T 1PR4A 1OLXA 2H2HA 2C3UA 3A32A 3ZWKA 5GZ1A 2Y0BA 3QFCA 5L7TA 2FV8A 1BXRB 3DKRA 1IIBA 3W7BA 4NS1A 3AF3A 3OO1A 1HE8B 2FMUA 1A82A 3BRQA 1V4NA 5IAJA 3WICA 3IBGA 4BNJA 4UHCA 2B1GA 1FS6A 2CB9A 1JEDA 3BXXA 2QRJA 3LT1A 2ONCA 5F21A 1RZRD 4WD3A 3HB5X 1Z37A 1IATA 3GZNB 1PS8A 2CLIB 5CTJA 1BVRA 4FE3A 4N0PA 4NG5A 5JIBA 3FMGA 1V6SA 3LBYA 1LLDA 4ZO8A 4DLTA 1V39A 3G02A 4F4HA 4EY3A 1IYZA 1K66A 2R7KA 3AP3A 5GONB 4AXBA 1DBIA 3FTDA 4JOSA 3KYIB 4C7XA 3DHNA 4ARVA 3HHEA 3PCRB 2H1OA 4DV5B 2VZ9A 4L57A 4O2BF 1B42A 5ALNA 3KQVA 1PDVA 4NPAA 4WVFA 5FV7A 1NR7A 1UFVA 4NV3A 4QECA 3GF4A 4EYEA 4UTOA 3B7WA 2XCIA 3OLWA 2BJVA 4IGAA 2NP6A 1CUUA 4XJSA 2DXIA 5LP1A 1E2EA 4NDZA 4X7BA 2CV2A 5ADHA 5BN4B 1WQ1R 3C1TA 2F1HA 1E0DA 2GBPA 2PNFA 2QA5A 3H9EO 2ZVDA 2WSYB 2G70A 4KLNA 4XIJA 4K88A 3K1TA 3T9BA 1TMKA 3GFPA 4WDRA 4DCSA 1FYXA 2EGUA 4ZZ1A 1J5EB 1UQRA 3A9UA 3ETLA 3F6EX 3AVQA 3QV1A 1M8FA 4IWXA 4RSGA 1FVHA 1MVNA 2QRNA 2JCBA 2XMRA 2OFXA 3C4QA 3UIEA 1NDHA 1LFDB 1RVV1 4FMCF 4KIFA 3VZSA 2QL9A 3FF1A 4UNIA 3VDMA 2Y8EA 4ND8A 1EFRA 1EI9A 1FRZA 1G21B 1GQQA 1GGKA 2ZJ5A 3E0QA 3FX2A 2X5XA 1N1MA 4DT1B 5DYWA 3UO8B 1Z63A 4R6WA 3QKRB 1AHPA 5MN6A 5EQFA 3JX9A 3U4CA 2NWQA 1MW8X 3U6BA 2G9UA 2ORED 2V0CA 3IO3A 4HLUA 1B6RA 1OMOA 2BJWA 5MHTA 4I8IA 3EK2A 1EK6A 2RGEA 1RW4A 2WABA 4EARA 2P9QA 4AROA 1W4ZA 2NM0A 3FI0A 4NMLA 1RXIA 5BYBA 4GHWA 3H5NA 2Q3MA 3OM8A 4HCJA 3MGBA 1F2UB 3R1IA 4HLCA 5CM2Z 1EFCA 3WKCA 2V9CA 4XEUA 1B15A 2R7NA 1KK1A 5JJBA 2QLLA 2WM8A 1ZJ5A 1A4RA 4DWVA 1ECLA 4JDPA 4MQ5A 4BX2A 4GP6A 4EY4A 1CIVA 2FE4A 3KU1A 5K0EA 3JALB 4C6SA 1ZU5A 3ZOZA 2BEJA 2PANA 4G5QA 5MGBA 1Y6RA 2IUUA 2QV0A 2C92A 4LXHA 3G9TA 3FB4A 1E2GA 4GVPA 4REMA 4GMFA 3E03A 4WN9A 3EQZA 4O4HA 1J1IA 3IDSA 1S3FA 3DQPA 1UBKS 2QLNA 3A7DA 3HKDB 5KSZA 2OFWA 3V1TC 1HOTA 3L7LA 3WIDA 3CJQA 4NENA 2PL3A 3O84A 2O0KA 2JIPA 1EAYA 2ORWA 1NW6A 2GEKA 4MGZR 4RK4A 5LFAA 1U0RA 5BSUA 2QXUA 2AWOA 1F2DA 4O4LF 2QKYA 5ALIA 3KEGA 2VJMA 1XTVA 2PLAA 3CUTA 5CNMA 2IWHA 5DCYA 3DBVO 2I2WA 2D2IA 3VNAA 4O59O 1K6JA 1N0IA 2NZ2A 2FWPA 2Z9CA 4QDXA 2CLOB 1JFVA 1UJNA 2J0EA 3EG9A 3PQEA 4LYHA 4TPKA 5JPIA 4A2PA 3NHJA 4QNRA 4XSGA 3S1AA 4EY8A 4HAVA 4L22A 5GJBA 4R1NA 3I30X 4AO6A 1RE1A 2YMMA 4IDHA 4ENWA 4EYSA 3HTXA 1FMLA 4Y3UA 5CDFA 4EHFA 4EVSA 1EWKA 4AJJA 1F2VA 1RHKA 1XYYA 5IM4A 4CJXA 4C4TA 4IH1A 1YB4A 2OV6A 3LUBA 3PC8A 2O07A 2EQAA 3GN2A 2NTYC 2ZIGA 3MTAA 3OCWA 4MPPA 4LF9B 2Q1YA 1NY5A 1YQ9A 2JKVA 3UCXA 1U3DA 4O2AA 4Z8YA 5EJMA 2QM3A 5TS3A 3RT7A 2VTKA 5KTOA 1DUVG 3FPAA 3ECSA 3GHHA 1VL8A 3A2LA 1ZD4A 5C31A 3DLBA 4DLRA 1NXPA 3QXJA 3I64A 2KQUA 2Z3ZA 3GA7A 1DFGA 1MNAA 3K1AA 3WL7A 3QFHA 4QT4A 3FJYA 2C31A 1D3AA 2R47A 3HZZA 3IUYA 3LHIA 4DQVA 4D9HA 3NKVA 5J4LA 5M3BA 1NKVA 3FPBA 3NRBA 4RA9A 3L7AA 3WC4A 1RXWA 5KU7A 2JH3A 5ELMA 3AM5A 2VQEB 2AJDA 3ZQ4A 4Z7QB 3I9FA 5KQMA 1SMKA 2NZUG 5EJ5A 1K7SN 1RWNA 3HJAA 1CG6A 3UBMA 5BOSB 2EOAA 5JJIA 5KOIA 4G63A 1W0JD 5BV1A 1NBAA 2Z30A 2W6MA 3S68A 3UKDA 4G5YA 4ASUD 4M54A 4N5HX 4TV8F 1NYTA 4GLJA 1F20A 2EXXA 3G5TA 4ZWNA 1Y3HA 1KQPA 1OIXA 2C8LA 4N3AA 3VZRA 1RRKA 1TYAE 5AKEA 1TNDA 3DV2A 1OLUA 3FHJA 4W8HA 5IWAB 5EKTA 3UGJA 5E8JA 4CIBA 2J07A 5TQJA 1QUEA 3O9ZA 1DT3A 4LDPA 3WQHA 3AONB 1Z4MA 4DPMA 3KG2A 3TX6A 4DQXA 1K8ZB 4CDRA 4JHXA 3EZ7A 3RTAA 2CXTA 4IBOA 1HE5A 2GEJA 4AVYA 3WGKA 1QQ6A 2PWZA 1MC1A 4KXQA 5JADA 3AVPA 4D9MA 1OVMA 2VNHA 1C3JA 4IUBS 3FZGA 4BPRA 3PJRA 4U7FA 3UAXA 1UJCA 1X2BA 2IXEA 4YNBA 3O4JA 5TF0A 4BO8A 2FMKA 2H4FA 2Y93A 3CEJA 4G4GA 1FTGA 3RGGA 3LXMA 3T5TA 1AOXA 2ZI4A 4P3KA 5ICMA 3YASA 1MJFA 5LMCA 2OB2A 1J97A 3AXTA 1V9SA 2R68A 5IABA 2JKYA 2QLTA 4XSHA 1OXXK 5IVIA 3SP1A 1D09A 1QGED 4OLFA 7AT1A 1RWMA 5DMXA 2XMCA 1DX9A 5LQKA 1VLJA 4H4CA 3QXCA 4I6JA 5TC4A 3I9LA 3L82B 2L17A 4COOA 4WNAA 3EXHA 1SZCA 3QKWA 4G0QA 3ASYA 4H0CA 3P19A 4PZAA 4UE6A 2VP3A 2QTBA 2VRCD 4O4IA 1THMA 1U5CA 4KFRA 1ZC3A 4EKEA 4CRWB 3X1JA 1DKPA 4J29A 4PS1A 5ALTA 3O2NA 3ND8A 3ZXIA 4DR7B 1BIFA 1NRXA 2PZKA 1L7MA 2XAUA 3EJWA 3RVBA 3SYRA 2R7AA 1USUA 1EFVB 3F9CA 3FWYA 1QMPA 3IQDB 1U3FA 4LI0A 1P3DA 3DEHA 4RHCA 4YJ3A 1F1BA 4TWAA 2AOXA 5EOVA 2G80A 3FBTA 3I37X 4QUJA 2AVNA 2ZDGA 1EFLA 4RPKA 3UY4A 1PZGA 3A2NA 5JSZB 1VZ3A 1KH3A 2ZIZA 5A7HA 2EKZA 5KTSA 1E94E 4OB8A 2ZR0A 3GA0A 4TV9B 4C5BA 3THRA 1X42A 1YR8A 1RZ3A 3RG2A 3ONWA 4YJDA 2OLKA 4JQZA 3S2ZA 1LBEA 4YRNA 4K28A 2HGZA 4O2RA 4BEWA 2JJQA 2AEMA 2H06A 1QYCA 3IIIA 4MW4A 3WK4A 1F6BA 1PF7E 1MAWA 3RSFA 1JHMA 5LB2A 3VDXA 3SMQA 1P2VA 1HT0A 4KBGA 3U44A 4EG3A 3MWEA 4DIBA 1GZSA 3JAWA 5BT9A 3PGMA 3A4MA 3AERB 2A33A 3ZDCA 5TPWB 4NE2A 2G63A 1K4KA 3JQRA 1J2RA 1EQ2A 1ENZA 1PG2A 1NVXQ 1Y8RB 3WQQA 3WZMA 3ZYZA 4RY8A 3R9KA 5BR7A 2I65A 4MX8A 3W9SA 4J0FA 3E6AA 2FVYA 1GLGA 1ZISA 3ZE6A 1BS1A 3JYOA 1SHZA 3CLTD 1JZSA 2Q4BA 1LF5A 3LFUA 1ZM3A 1PG5A 3K94A 4YTEA 5TQ0B 3SM9A 4B3IA 4DIUA 1MMFB 5ENDA 1UM9A 3B7GA 4QUKA 5GJCA 3PJGA 2RHDA 1YK0A 1A2KC 1KFEB 2BUBA 4AULA 5FI0B 4A8HA 4D9FA 5HOQA 4X6YA 2P90A 2EKPA 1B93A 1HTBA 4GL2A 2O2IA 4BB6A 4C0JA 4BUZA 3U37A 4DTIA 1SAYA 1Z2NX 1XNRB 2ZBEA 1O94C 2GF0A 3H5AA 3PEUA 2PSFA 4R84A 5EN4A 5GMOA 3OFSA 1VGQA 1UMKA 4NOMA 3C1OA 3HVJA 2D5CA 3O92A 421PA 4KI0A 1D6SA 1DRJA 3B9QA 3EXEA 2Z2JA 1RXEA 4O25A 4A23A 4DIFA 3VX4A 3CR7A 4HR7A 5ECGC 1ZRNA 5L6MB 5IT5A 1C30B 3OT5A 1R4ZA 1EJBA 4LJAA 4WESB 1YQEA 2DFDA 2C4WA 3DOJA 3TINA 2F3RA 1T5OA 2ZJYA 5AKJA 2EW8A 1P45A 1WXHA 2ECPA 3KU4A 4OVKA 5DNVA 4LF7B 1IUKA 3HVKA 3IXLA 1EAMA 4IHKA 4JJ4A 7REQB 3KUKA 3QPWA 4UXJA 4F6CA 1YU6A 2B7BA 1ZA2A 1Z2PX 2DLNA 5FTMA 4AZ0A 3WMFA 3L84A 3DMTC 4KQEA 2XUKA 3QVLA 2I3DA 5FPHA 1D4FA 3WDLA 4TT3A 3X1XA 1EPUA 1N0WA 2EWMA 2IUFA 2VDUE 5DGIA 4Q9DA 5E1OA 4B83A 5KDDA 3JD0A 2B9EA 4BP1A 1BWQA 1SKQA 4TS3A 1VECA 1XVTA 3VO8A 5IG2A 5GIPE 4IAOA 4CLOA 1QORA 1X77A 5GV7A 4WZBB 1UC4B 3I5XA 2RAVA 3BGOS 1CS0B 1DV1A 3QWHA 1DO2A 4UMEA 3OECA 1QG4A 4D80A 4XVUA 3PTZA 3FLEA 3ICVA 4JH0A 3DE2X 2Q27A 1FRNA 5FXMA 1AUOA 2KJQA 3SZOA 3LBFA 4CZ2A 3D4LA 1IY0A 1ESEA 2C59A 2D62A 2QTWB 1MP0A 4UUMA 1E64A 2GPBA 1TU3A 3AXSA 3NO4A 2VPYA 2BEWB 4GMXA 5FUXA 3CBQA 4RV9A 3QYAA 2QD4A 3RVLA 2RGWA 3KDAA 1G8JA 4X24A 1LS1A 4PF1A 3OLQA 3KJFA 5LDDC 2W6ZA 5JU6A 1P1RA 3UJHA 4LHEA 1T36B 1YBFA 1GL6A 2OCXA 4WNIA 1TLLA 4ZPXA 4BKMA 2PMWB 3I0NA 5LR6A 1PR6A 2EARA 3H6KA 3ONDA 1E5DA 4PHGA 4PICA 5KU1A 4BZZA 3AVXA 3J7AC 1PGPA 2WHEA 4QJ4A 3G7NA 5HNKA 1OCEA 1XTJA 2X5KO 4AO7A 4WKGA 3R0QA 1A0OA 4TSFA 5JCOA 4A0FA 4K2AA 4AG5A 1T5IA 5B1HA 1X7HA 4KXVA 4F84A 2GCGA 4C21A 1S1MA 2ZI3A 4I1PA 4JKYA 2VHWA 4CMGA 1UWCA 1Z35A 2N47A 3OOHA 4G89A 2QTRA 4OUKX 3S2YA 1CP2A 1U81A 3EAQA 3T5BA 3TLAA 2ZZNA 3I9KA 1WEHA 2XQFA 4E2YA 4GM1A 5A4FS 1J70A 3KT3A 1YF3A 1P7ZA 4IJ5A 1A9ZA 1LK5A 5LQJA 1DOZA 3IBTA 1MV5A 4RJJA 1CQJA 1VHQA 3IMCA 1MW9X 1K6IA 5B3JA 2WNSA 1UPCA 3F2IA 2Z1MA 3AEUA 3PV0A 1QVWA 1AXRA 2G0TA 3QMPA 4J4TA 4J9VA 4QXMA 3P5SA 3FUVA 4MWCA 4BLVA 1NP3A 2H52A 1IE3A 1S8OA 4XUGB 1ST3A 3MRSA 5EQJB 2XZLA 2V7QA 1E1KA 4O3MA 1R8QA 3ABSB 3JASB 3ZE1B 3KZCA 2WYHA 5GOZA 2Y1DA 3PWTA 3E9RA 4RY0A 1N8KA 2ZAMA 3IPRA 3JQ9A 4OQMA 1W85A 1ZD5A 2AQIA 4UVIA 5HGJA 1NVWQ 4IDNA 4GXRA 2HWXA 1IG3A 1Z4LA 4N6GA 2AZXA 1MVOA 2FETA 1UBMS 1O9BA 1PLLA 4KBFA 5AVJA 1ONSA 3V1MA 4BHTA 1BHQ1 1GKKA 1OI7A 3SXUB 1DXHA 4IRXA 1LXCA 2QU8A 3K0FA 1CERA 3DDSA 3H17A 4EPXA 2VPIA 3IP1A 3SZUA 5CVTA 2R6JA 4YUWA 2WT4A 4A6EA 3W0LB 4UTNA 2I1LA 3GLGE 1TM1E 1P6XA 1AQ6A 4RDCA 4UASA 1M54A 3AJDA 4EKDA 1QO0D 1U6JA 2C98A 4J16C 5K3FA 1HEYA 1O0CA 2OT3B 4RF4A 3G0GA 3LDAA 3OEHD 1N34B 1IVSA 3V00A 2FFQA 3AIMA 3D7KA 3LYLA 1JLHA 2P5SA 2YS6A 3K15A 1ECFA 1VPLA 1GZHB 2FW1A 2IPLA 3K0BA 3MMSA 4UFNA 5DBOA 1ZFNA 5HIKA 4CDGA 3COPA 1P9NA 2P3SA 5JXGA 4YLGA 1CNMA 3DYBA 3ETEA 4J0IA 1YVPA 3SF8B 1DTWB 4TZKA 2PVCA 4NU6A 5KC9A 5KYYA 2FWMX 2NQTA 3VOBA 4IOMA 4MYDA 4NEHB 4C6TA 2GN6A 4H27A 1V4BA 1W25A 4TL9A 4BPBA 2Z8YM 3VC3A 4OHKA 4NCNA 1DP4A 2UYYA 2I4LA 3I5AA 1VPTA 5HBGA 5SY4A 3EAGA 4M49A 5FA5A 1NY6A 2RHRA 4BQNA 4DIOA 3J7TA 2FUKA 2ZYWX 1JSRA 5LP6F 5KQPA 4GQAA 4KVGA 2IEBA 4RVOA 2DUMA 1FDTA 2TMGA 4K46A 5HE9A 4MKRA 4A6XA 4EP1A 1EZZA 1Y1QA 2VDJA 3P4XA 3M33A 3WYEA 2L2QA 2COKA 1YIDA 5DNDA 3EBLA 1XV5A 2KPOA 1VTKA 1H2AS 4D9CA 4R9SA 3U56A 4QUEA 2J0QA 4TXLA 5B30A 3NUZA 3JSXA 3QF4B 5F1KA 3B3QA 5GQSA 1JG1A 1FSGA 4TQGA 4EI2A 4V0KA 4OMUA 1UZMA 2RGNA 1EFDN 1C0IA 1M2VB 2Q21A 1KNXA 3FYUC 3OZSA 4NCKA 4D7AA 6PFKA 2RKWA 4INPA 1IEWA 2ZT6A 4NARA 2D74A 3A9CA 1V41E 4NP6A 3JR7A 5EINA 5IBPA 6REQA 1M1XB 5HIAA 1ZN7A 2SKEA 4L3OA 4QGHA 3DMDA 4EBBA 3HU5A 3DL4A 1BKDR 4OHUA 3SHOA 3GFVA 1N2XA 3C5HA 3DD1A 4LV6A 4AJNA 1HDIA 3GLGA 2FLWA 2ZOSA 4HDQB 4RPJA 4WFJA 3EZYA 3HB7A 3ZVKA 1UKYA 1RBZA 1Z0UA 3UH0A 2H92A 4DWJA 1IFXA 1FQWA 1Z4KA 4FUTA 3E9QA 2QL7A 4X3OA 5HG0A 3V8NA 3BJZA 4DV2B 2KLHA 5BV2P 5DHSA 1N78A 1HETA 1IM8A 2A5DA 1EGMB 4IHAA 4KGVA 3AHGA 4IDPA 4QARA 4GVLA 1FUIA 3DF9A 5F9MA 2ZQYA 2ZROA 3FCUB 3JVIA 4EM6A 1YULA 3AUXA 4QOIA 3V8EA 4F92B 5KX5F 1C2TA 3LY8A 3BXPA 3NOVA 4MV3A 4OXNA 2H2GA 4B2YA 5CDHA 3BBPA 2CHGA 3MJEA 1AURA 1N6PA 1W94A 2JRLA 4TKVB 5E4YA 3Q3VA 4IO1A 1T2FA 1UWVA 3GDOA 1QH1B 1SXJC 3L9XA 3IUBA 3A9WA 2W6CX 2J9XB 4R8RA 3RH0A 3MBOA 1LW7A 3T12A 5B2EA 1FXWF 1N75A 1JXOA 1NQVA 3M3PA 3MTEA 4HWTA 5A7GA 3V3KA 2P67A 1N25A 3MMXA 4JT8A 1RI2A 3WIEA 1E99A 1L5RA 1RS0A 1XTBA 4I3GA 4EZBA 3ZGZA 4LY9A 2FW7A 1NW3A 2BCEA 3OCZA 2OECA 2VJAA 2VT3A 2O52A 3OZCA 4LQ4A 8GPBA 1CU1A 4Z7OB 1UMDB 3C2QA 5ECDA 4V0QA 5GVRA 2QVBA 3FJ1A 3K2EA 1BMFD 5F7OA 5JWOA 2ZS8A 1LBTA 1RQRA 1KMCA 4ZREA 3DZBA 4ZJZA 1ZH4A 2P1RA 1XYGA 4TN1A 2X0FA 4ER3A 1IQUA 1TQ2A 3ORQA 2VK1A 4X1YB 1YR6A 2ASVA 2G7ZA 5JC8A 4BS9A 2XTMA 3LPDA 4L15A 1SC9A 1U2PA 3EMDA 3QQ5A 4BLPA 1IHYA 5D8DA 3AZQA 3UMRA 3TH5A 2BR5A 4K8OA 2Z09A 4P4LA 4OREX 3BMQA 4Q1BA 1I4OA 3C6MA 3PA6A 2PXCA 4KAFA 1EINA 3KP1A 3AKZA 3G9UA 3LMKA 5JY6A 1LC0A 3T5GA 1SXJD 3HUTA 4CUJA 1M73E 4S24A 1Z17A 4M7WA 4OAQA 3ACDA 1DKQA 3FKSD 2V45A 3KD2A 4YT8A 4JQSA 2OV8A 5KTYA 1A8HA 4B9AA 4M1KA 5SICE 1FUKA 3Q1LA 4B40A 4ZEOA 2CNBA 5EA2A 4HRAA 5LLSA 4CL0A 5KYKA 1IN8A 3NGXA 2PL9A 4PYKA 3RFUA 1QP0A 2G1UA 3WYDA 2XB2A 2OC9A 3EGXA 1HNXB 1VKZA 2Z08A 3KWLA 2R86A 4JBIA 2JATA 2QT9A 2RCNA 4PRKA 3ZHYA 1LVGA 3PHCA 1ZGJA 1KI3A 2QD2A 3A6JA 3NV7A 4IS3A 3LXXA 5AJUA 5FBRB 1TAUA 1E3JA 2PQ2A 4HUTA 1R8XA 2O3UA 4R9NA 3D7RA 1W88B 1TLFA 3PCTA 4MRMB 4U3JA 3V7YA 2NZWA 4C14A 1NXQA 1DB3A 1MB2A 2Q9UA 1JDBB 2OV4A 3ZW8A 1RAGA 3B1FA 1P1KA 3QA9A 4AP9A 4HKTA 4U63A 4JUDX 3UXHA 4B6JA 5C7YA 2Z2ZA 1FP1D 3O31A 1U9IA 1FDSA 3DHVA 3LL4A 3K4HA 5AH0A 5DMHA 1JDVA 5SYMA 1TJ4A 3ZD6A 1CVIA 2IHKA 2PLRA 2Q6KA 1XD2B 1QRAA 3AETB 3PQ3A 3D9QX 2EU8A 4ITRC 1HSOA 3TVTA 5A5GA 3DC7A 3EXIB 1GCUA 5HVNA 1KS2A 3C6ZA 3CIOA 4HRVA 4JGBA 2W6PA 5D3MA 2X0KA 3ZWQA 1ZJJA 4MULA 4EAAA 4K6GA 2CLEB 1P6QA 4I0WB 1W48A 1H4QA 4NULA 3H83A 4I50F 1B3RA 4RHXA 3UW3A 3WGTA 3FW1A 1SURA 3QRWA 1GPUA 4E6EA 3VZPA 2HLNA 2YUIA 3LC1O 4FDAA 3VOAA 3ZJYA 8ABPA 1E9RA 3E3NA 4Q3LA 4H3KB 1H2HA 1Z39A 4S2UA 1RTKA 2EJCA 3TI9A 1DAMA 4CM4B 2GEBA 2AC4A 5K3BA 2IYWA 2DUWA 5F76A 1NFQA 3UV7A 5C35A 1X7XB 4P3NA 4AX4A 1L4HA 1ZMRA 5KUTA 3CEMA 1HXHA 3DEAA 4TTTS 3EISA 3RHFA 1WW3A 2BCJQ 2CSUA 2QN3A 1X1CA 3QTTA 1P5HA 3G9QA 3ZBUA 5KWVA 3PU6A 3RROA 1ZCBA 4AM8A 2NNWB 2XTJA 3TUJC 4DV7B 1KYTA 3DLPX 1ZCZA 2NPIA 2PD3A 1Z5VA 3OPQA 4HHEA 3EIUA 4BVGA 4LCJA 1RAIA 2QG4A 3BSYA 1WY7A 2Z56A 3WWDA 1YBVA 2G88A 2Q62A 4GPD1 4ZOEA 4G5GA 1EGQA 3P2IA 5BWLA 2BDTA 4KQ1A 3GHYA 4G9EA 3W5UA 1I4WA 1U0OC 5E9JA 4Q16A 1GSOA 4C3OB 2VSFA 3BGVA 3AYXB 1QHNA 2PWBA 3IJ5A 1W76A 4HI0E 1WDMA 3SM3A 4ZKDA 1ZMXA 1G4AE 4J3FA 1XLVA 3L7DA 3PGA1 4BVLA 1M6HA 3D3EA 1Y5IA 1P7WA 3L04A 4H7FA 1G5PA 2JRCA 5J40A 4YJ2A 3QE2A 1N77A 2JFFA 1GTZA 2F90A 1YB6A 2C9OA 2PA3A 3UAGA 4MV7A 5KTNA 3LI2A 1TMOA 1HI9A 2RC5A 5LQCA 4R16A 3AEQA 2IP1A 2QRVA 5DVZA 5A71A 1NSYA 2BMEA 2R5FA 3WFZA 1RQXA 1QF9A 3QOXA 4PO1A 4P6VF 4M83A 2VP2A 3U4AA 1BQ3A 6AT1A 2ZJ3A 5LYJF 1JAZA 1CQZA 3L8DA 4ZEVA 1KKMA 3KO8A 4BO5A 3ZPXA 4REQB 2VK4A 3BN3A 2XADA 2LPMA 3EQ6A 1GCGA 3K8QA 3VR2D 3VU1A 4CTMA 2WTUA 1SJ9A 3U4MA 1URPA 1GAWA 1KXZA 3PKZA 2C7QA 5ARCA 3LS2A 2YZ7A 3WQBA 3K6JA 1CTQA 3D0KA 3GB9A 1I9GA 3GMTA 3FNQA 4IIBA 3F67A 2EIXA 2JD0A 3AQ4A 4XJTA 1Z06A 2QYTA 4AKIA 4PGGA 4KPFC 2QE7D 3QE3A 1I5RA 1MRSA 1W6RA 1ZWLA 1K3UB 4QTYA 1K89A 1JVNA 2DG2A 1RBYA 3D6HA 4ND8B 4N5NA 4ARAA 4MP8A 1BC5A 3KSMA 1FLNA 4JJIA 4E5YA 3EDQA 2H7CA 3O1LA 2ZIAA 2PY6A 3AGPA 5EC8A 1VSVA 3DBOB 3ECAA 3K32A 2LNDA 3DDZX 4ZAGA 4FIZA 5GONF 2NU6B 3BPSA 2OCLA 3O9VA 3H18A 4JN6B 1LPMA 2WZQA 1WUHS 3RIYA 4KOEC 3BB3A 3PWSA 3I72A 1CF4A 2IZ7A 3IKVA 4Z4FA 4I4IA 4J0JA 2PGIA 3JTMA 2C5HA 1YDMA 1AM4D 1PR1A 1SVKA 2WU0A 4Y2HA 4PN7A 3F74A 3ZXYA 3FDZB 4IRMA 2JGAA 4FILA 4HNQA 4I1YA 1DOAA 1QCCA 2CVPA 1AQUA 1YQTA 2PMCA 1GKIA 3CISA 4HDNB 1SVLA 1V5FA 2O20A 2EFEB 1R9JA 2O5VA 3EW9A 4IIJB 4I3FA 4WOBA 4GQBA 4WN9B 4HNTA 4MZXA 4PWZA 1KP3A 4DKXA 4XPIA 4BBPA 4Q9JA 1B1AA 2IF0A 4IDFA 4YRRA 1JU4A 4YUXA 3ADOA 3LRPA 3WP1B 4J3JA 2ILTA 4NENB 3HU2A 5IK2D 4GMGA 2W6NA 3DLCA 2CNNA 3KOWA 4XM1A 2HREA 1ICIA 4RELA 4RV5A 2P8SA 1XHLA 2AYYA 2GJKA 4KXLA 4PRYA 1BXZA 1G8SA 3AL2A 1VG0B 3KELA 1UDBA 3JQ6A 4EATA 4EJSA 5CH8A 5MDHA 2A5JA 1CJMA 1J56A 2Q6LA 3OQOA 2C2OA 5C1IA 1CJCA 1Z3CA 3MERA 2F7SA 4KL8S 4TYYA 5IARA 4F9EA 1QH0A 1UXGA 2VTEA 4QXPA 2QZ4A 4RPLA 3BAZA 2VUHB 3T5PA 2XNHA 4NECA 2QXYA 2PH7A 4BAGA 5ELLA 3WADA 1ZSNA 4HAYA 4P4UA 2GCNA 3WLSA 2JZCA 3NYQA 1ZMTA 4I4NA 3G0CA 4RIGA 2ZUTA 1H85A 2ASEA 2Y0DA 1M75A 4HATA 3VU3A 1E9DA 3OU2A 5BW8A 2HYDA 3UK0A 4GKAA 4AF7A 1FFYA 1OX4A 2BY4A 2Q3BA 3MCAA 4JL6A 4O2AB 1F51E 2GERA 1Q3KA 1ZD1A 2FPIB 1Q1GA 3DKIA 4ZHSA 3H4MA 1AXEA 3OWHA 1BFKA 3ROTA 5LPNA 2H85A 2NTJA 1ZYUA 4F96A 4UHBA 1MH9A 2HQOA 3RRJA 3WS7A 4KR2A 6CHYA 1TM4E 4FZ5A 4MITA 3C8ZA 1VKHA 1WUKS 4DMGA 5A2QA 3E5MA 4ZP1A 3CTPA 1G3IA 2JD2A 3NRJA 2XVMA 3F8SA 4JNKA 1PJ2A 2A0XA 3B6KA 2P9JA 3CB4A 3IJRA 4IHJA 3E2MA 4JVLA 3RLFA 2CHUA 5K3SA 3HP4A 2FLKA 3DDCA 3L4BC 5FWXA 2ZTUA 4DNOA 1F8XA 2QW1A 4ESOA 3SSMA 2Y99A 3JCZA 3I9NA 1EM8B 2A9VA 1HYGA 3DXYA 3OHMA 1DLJA 2OCYC 4IIEA 2IYTA 2WE7A 4NZYA 4Z0HO 3TD2A 4LXYA 1GCOA 4MIOA 4KE6A 3S28A 5CR9A 10MHA 3ABIA 3LY7A 1IXYA 1XVLA 1GA6A 1UK8A 3DBHA 3D8HA 4EENA 1BHJA 1OBOA 1UBJS 1OXSC 1L5KA 4R0VA 4HEJA 5L3RA 2B4KA 3K2BA 3GW8A 4JYCA 4U8HA 3OQVA 2DX7A 3I1FA 3UNXA 3T9DA 1DIBA 1T43A 3LRTA 4DGQA 3HXPA 1SOWA 3AFHA 2BR3A 3R5XA 4UFOA 1QE5A 3TBHA 1MOQA 3LT0A 2PUFA 3DB1A 3MJRA 3NBUA 2XY4A 4KN5A 2HDHA 3BWCA 5AKIA 2R8RA 4LFCB 1IN1A 3K2Q