3NWOA

Crystal structure of proline iminopeptidase mycobacterium smegmatis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
299
structure length
299
Chain Sequence
SSRTVPFGDHETWVQVTTPENAQPHALPLIVLHGGPGMAHNYVANIAALADETGRTVIHYDQVGCGNSTHLPDAPADFWTPQLFVDEFHAVCTALGIERYHVLGQSWGGMLGAEIAVRQPSGLVSLAICNSPASMRLWSEAAGDLRAQLPAETRAALDRHEAAGTITHPDYLQAAAEFYRRHVCRVVPTPQDFADSVAQMEAEPTVYHTMNGPNEFHVVGTLGDWSVIDRLPDVTAPVLVIAGEHDEATPKTWQPFVDHIPDVRSHVFPGTSHCTHLEKPEEFRAVVAQFLHQHDLAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 113
structure length 299
sequence length 299
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nwoA00
3O4IA 2GBFA 1TKRA 3FAKA 5AM4A 4BB0A 5AI8A 3QPAA 3C43A 4P93A 4FNMA 2HRRA 1L7QA 4C6HA 4DLNA 3I28A 4K5QA 3G8YA 3WKDA 2VT7A 4OB7A 1H2ZA 4GW3A 1J2EA 1JKMA 1XRPA 1CPYA 5BV7A 4AX4A 2JGFA 3R41A 2J4FA 1UK8A 3QITA 1XRRA 5D6OA 2B4KA 2G63A 1QONA 4KAFA 2HADA 3EQ9A 4WFIA 1MX5A 4A23A 1N5MA 1HDEA 5LIPA 1WM1A 5I9IA 1DWPA 1XZGA 4FLMA 2I3ZA 1YA4A 2RAUA 3BDVA 3VVMA 3WMRA 4Y2SA 1MO2A 3D5EA 3ILSA 1ZJ4A 4Y2YA 3STUA 2VJBA 5JARA 3HEAA 5IVIA 2OGZA 1WHSA 4UBNA 1AKNA 1J1IA 3G9UA 3R3UA 2O2HA 4X85A 2O2GA 4HRXA 1BEEA 3B3QA 1LBTA 1U65A 4J0KA 4Y2XA 3ZLTA 2FJ0A 4XWGA 3FNBA 4P92A 4B0OA 3ESBA 1JI3A 2FX5A 4U2CA 2Y2VA 3BF7A 2WLSA 5EIEA 4UUQA 4F21A 1XZFA 1XKTA 3A2MA 3O0DA 2QJWA 3LS2A 1QLWA 2W6CX 5AM2A 5JZ9A 1DU4A 3G9TA 1UXOA 3UUEA 3V1KA 3DOIA 2HFKA 1XZHA 4KE6A 3I2JA 1L7AA 2XQGA 4JEIA 5AI4A 3ANTA 2HA6A 3R0VA 6YASA 1YS1X 2H1IA 1UOOA 2WUGA 5CH5A 4EZIA 4NS4A 1XZBA 3OTQA 2OCGA 3WA7A 1CEXA 3WWPA 3SX4A 2PPLA 2WIKA 2PBLA 3GELA 4JNCA 3IVMA 1QJ4A 2QRUA 5FOQA 2JGMA 4CG3A 5H3HA 1QTIA 4XX1A 3S2ZA 2H7YA 5LP1A 1JJBA 3WI7A 5ALVA 1W76A 2XDWA 4G9EA 5ALTA 3O95A 1R3DA 2VTVA 2XUKA 2GZRA 3MUOA 3OOSA 1UKCA 4DIUA 1TIBA 2Z8ZA 2DHDA 1VOTA 1HLGA 2WIDA 1A8QA 1R9NA 1CUFA 5AK6A 2HU7A 4G5XA 3N0TA 2V96A 1G5FA 5T4FA 2Y6UA 1W75A 1MJ5A 3C45A 4PW0A 1QZ3A 3LIIA 4UBJA 5AI6A 5HKAA 4PV7A 1MPXA 1CUJA 1QTRA 4RNCA 3SWWA 4OB8A 3A2LA 3F9CA 3TJMA 4G4JA 4DNPA 2XB6A 1GT6A 2RONA 5AM5A 3IBTA 1XZEA 4FBMA 5FDFA 1QOZA 5EGNA 1BRTA 4HAIA 2C5GA 4CFSA 4FDMA 3WIBA 2C5FA 4LXGA 4Q1VA 2WU3A 3WLAA 3C8HA 2WHPA 4ZI5A 3H2JA 3MVEA 2ZYSA 1XZLA 4AZ3A 2OQIA 5DLPA 3I2FA 4FLFA 5J3JA 4UBIA 3EIOA 3AIOA 1E8NA 1ORWA 5E4JA 3L1JA 2C58A 4B81A 4BTVA 1F0NA 1CUVA 4PQEA 1S8OA 1VZ3A 3T52A 1JU4A 1YAJA 4OB6A 3L1IA 4W1PA 5CTAA 2G4LA 4KE7A 1I6WA 3WKAA 4CG2A 4QNNA 5AIBA 1EDBA 3WK5A 4PF1A 5ALKA 5FXMA 3FCXA 5JAUA 2Z3WA 4H0CA 3DL4A 4HXFB 3DOHA 4J7AA 2E3JA 2CBGA 4AB1A 5C7YA 4BVKA 4CI9A 1IUPA 1K6EA 3WWCA 4N8SA 1CUZA 2VATA 4C88A 1C7IA 1ODSA 1AGYA 2PL5A 1CUXA 4FHZA 4JUIA 3C5WP 1A8UA 1UKAA 1ZJ5A 4DMKA 4X71A 2ZJ7A 3H19A 2JEZA 2P8SA 3DD5A 5CH3A 4EY7A 4TPKA 4X6UA 1GQSA 1THGA 2XMBA 3U1TA 4DYHA 1RWQA 1AX9A 2WUFA 4W63A 2WFLA 4GXNA 4W9RA 5E4YA 4BAUA 3W04A 4C4XA 1YCDA 1TK3A 3Q8WA 5BOVA 1E8MA 2I03A 2WUEA 5HFAA 2XMSA 4B84A 4UHFA 2XUOA 1XFDA 1LPOA 2Z3ZA 2EEPA 3QYJA 5AH0A 2WG1A 5BWBA 4KAJA 3ZV7A 1CUAA 1H2WA 2HA4A 3BWXA 3VXKA 1IMJA 1Y37A 1WB6A 3HRHA 3WK8A 2BGNA 4MXDA 2YXPX 3KDAA 5AP9A 4FBLA 2VAXA 4DNOA 3I2IA 1T4MA 4ZREA 3VJKA 1E8DA 3G9XA 4WCVA 4MQLA 3WK7A 3QM1A 1EK1A 3A2NA 4DTCA 4UHCA 3WIOA 1CUHA 4QLAA 3I6ZA 1XKLA 4QWWA 5AKEA 1CUIA 4H77A 5C81A 3WZLA 5HF8A 2CB9A 2XLBA 4UHEA 3STVA 1QIFA 1E3QA 4H18A 3PUHA 1Q0ZA 4Z49A 2H7CA 1CR6A 2WIFA 2WTMA 3I2KA 3W9BA 1FJ2A 2AXEA 3HSSA 4IH9A 2WM2A 5DJ5A 3F8SA 4J0HA 2VEOA 4N8DA 2HA3A 3I6YA 3KOOA 4M0EA 2DSNA 4FKBA 2R8BA 3RARA 3STYA 2DCMA 3EBLA 4KE8A 4DGQA 2BUAA 4OPMA 3AZOA 5IKXA 4Y2RA 3WWOA 2C0QA 3AZPA 1XZAA 2DQYA 2AJCA 4UBMA 4XVCA 3ICVA 3R3YA 1ZI9A 3HACA 3IULA 3F98A 4I3FA 4BRZA 3WQHA 1R4ZA 3HC7A 4F0JA 1YAHA 3UUFA 5LZ5A 2O2IA 5CT9A 2Y2UA 2C4HA 2WU4A 1SOMA 2JGJA 4FWBA 5FV4A 3AJAA 4U2BA 2XQKA 4B9EA 2K2QB 1M33A 3O4GA 3WK4A 4BAGA 1AURA 1TCCA 2BGRA 2ORYA 4Q3OA 5LYYA 2RI6A 1HQDA 4UHBA 4JYMA 2OCIA 2X8BA 4AO8A 3PFCA 5LZ4A 3QVMA 5AK4A 3WL7A 2ZYHA 3FLEA 3G02A 1F0PA 3G9ZA 3WL6A 1UWCA 5A71A 3MUNA 1YB6A 3HJUA 3HI4A 5FRDA 1MTZA 5SYNA 1H2YA 5K3FA 5SYMA 3B5EA 2H9YA 5AKXA 5JZBA 4X92A 4XJVA 5IH7A 5A7GA 5ALEA 5ALPA 3W06A 4Y9SA 3BXPA 3LLCA 2GYUA 4ARBA 3L1HA 4UPDA 4XIIA 3WJ2A 3AUKA 3D2CA 4OD0A 2XUJA 1CUWA 1RP1A 3V9AA 3D3NA 5CT6A 5K5EA 2XMDA 2C0PA 3DQZA 3FLBA 3ZI7A 2ACKA 2XUFA 4C4YA 1EDEA 4Y2PA 2HU5A 3G0CA 2RHWA 4G8CA 4X90A 5CXUA 2V9ZA 1J07A 1EH5A 1ZGBA 4GDMA 5LZ2A 2CJPA 1QIIA 1ZD3A 4LYDA 3KWFA 5CMLA 1EINA 4Y2TA 4EBBA 2QT9A 5D3KA 2OPHA 1CUSA 4IH4A 4PSDA 4MJ3A 1FFBA 4DMFA 1GPNA 2JBWA 3BE8A 4GECA 5EI5A 3H2HA 5HF6A 3NUZA 1BROA 4FMPA 4ZXFA 1ZI8A 4S0XA 1ISPA 3DCNA 1YB7A 1R1DA 4U2FA 1EB8A 5ALXA 1R9MA 5AJHA 1LPSA 2JF0A 1USWA 3WYDA 4CG1A 4BC1A 2YH2A 4KR0A 3NGMA 3VJLA 2V97A 1P0QA 2WSLA 4I4CA 3F97A 3TGLA 3D2AA 4K6KA 4HVTA 4Q05A 1SCKA 4HS9A 3ESAA 2HRQA 3LIPA 2ZYIA 3FCYA 3C70A 4RGYA 2RHTA 2HIHA 4G8DA 1QIEA 2PUHA 1PFQA 5AKHA 2DHEA 4DMHA 2BFNA 5JD6A 4TVKA 5ALQA 1NU6A 5JALA 3DKRA 2XMRA 4G4GA 3I6MA 1XZKA 2ECFA 4KJXA 5E2IA 2OCKA 4Q3LA 1VXRA 3QH4A 3HYSA 4UBLA 3K6KA 4BDTA 3QMVA 1XQXA 3PUIA 5AKKA 2J4CA 2VQ6A 2GZSA 2G5PA 2JIDA 4W1SA 1B41A 4FNGA 5AI0A 3BIWA 3KWJA 3K9BA 5LZ7A 1KEZA 5LZ9A 4X94A 2IIVA 2XUIA 4HXGA 1OCEA 4BVLA 4JH0A 4G4IA 1ZIYA 2BAGA 3D0KA 1ZGCA 1O6FA 2HFJA 1MNQA 2WILA 1CUYA 2QMQA 3BJMA 1WHTA 2ACEA 2CMFA 4AN0A 1LLFA 2RIPA 1XLUA 4YX9A 1BN7A 4HTAA 5KWIA 5JASA 3DLTA 1X70A 5ALGA 2CEKA 5ALWA 2B20A 1ODTC 2WFZA 2PSJA 5ALRA 5KBYA 3M3DA 1EK2A 4BTLA 1R88A 1T2NA 3ESDA 3NOXA 4AQDA 1XROA 4Y2JA 2QUBA 3M82A 2QXTA 1UK6A 1MX1A 3GUUA 3KXPA 1VA4A 4G8BA 1OXMA 3RK4A 3G0DA 3ANSA 4FOLA 1IZ7A 1ACLA 5DWDA 5K3AA 1WPRA 5ALZA 2GBCA 3WYNA 4Q82A 2AJ8A 3STWA 3VISA 1CUDA 1UK7A 1TAHA 2WG2A 3IURA 1X2BA 5JD5A 1IVYA 2PUJA 1ORVA 3K2IA 1MNAA 4W1RA 5DNUA 3OURA 3SC2A 5ALDA 1P0IA 1JU3A 3WK9A 2G5TA 2XQFA 5AKYA 1ZI6A 1PJAA 2ZSHA 4YK7A 4GWLA 3WWEA 2DHCA 3F96A 5ALSA 4DNFA 3A6ZA 1XZCA 5HF9A 4INZA 1XRLA 2IX9A 3JW8A 2D0DA 4ROTA 3C5VA 3WL8A 1DTEA 1AMNA 5AI9A 2V98A 5FP0A 3ESCA 4AO7A 3I1IA 4J0IA 2XT0A 1JMKC 2JEYA 1QIKA 1K4YA 4EY4A 3WKEA 5FKJA 5FPQA 4PNZA 4WFJA 4H35A 3U0VA 4AMYA 2ZYRA 4B0PA 3FWHA 5ALOA 3E1GA 4WJLA 3GA7A 5AKZA 2EDAA 1X2EA 3VJMA 4GI1A 2BKLA 3FYUB 4EB0A 1ODCA 4BVJA 4M0MA 4L9AA 3DS8A 4X93A 3IDAA 1CUEA 2H7XA 4BCDA 4J0JA 3GZJA 4BC0A 3DL7A 2QZPA 1KU6A 5K3FB 1UFOA 3IUMA 5HK8A 2QTBA 1Q0RA 4H7HA 3IA2A 3MGAA 5EHNA 4OU4A 4DNQA 3H0CA 1TRHA 2DQZA 5AKGA 5F4ZA 1MU0A 5CT5A 5JZSA 4BATA 4QDTA 2HU8A 1F6WA 1CRLA 4IQ4A 3WKCA 1F8UA 2WHRA 4AZ0A 1W6RA 5K3EA 1XZDA 5JAPA 4K6GA 5DTJA 2C7BA 1J06A 1XRQA 2XE4A 5AKLA 4A5SA 1UK9A 1DX4A 5KREA 4IHAA 1RYYA 4UFNA 3AIMA 4IO0A 1WB5A 4D9JA 4C89A 5LZ8A 2VJCA 3F67A 4KRXA 3OPMA 5DYTA 1LPAB 4LXIA 3H1BA 1LZLA 2Z5GA 1YA8A 3H18A 4QE3A 4B80A 4H7FA 1DT3A 5CRIA 2WJ6A 5EHQA 4M0FA 4MWSA 3E4DA 5JAHA 3RKSA 2PU5A 5HZGA 2OAEA 3OC0A 4UFOA 4P08A 1L7RA 4BAZA 5CH8A 1DWOA 1C4XA 4HRYA 2JGEA 2PKYX 2R11A 2XQJA 2VSQA 3PF8A 1Q83A 4L0CA 2WFLB 2AJLI 5AICA 4X95A 5DYYA 2D5LA 4KEAA 1ETHA 3I1YA 2XMQA 2GYVA 3D7RA 5ALYA 2OCLA 1QE3A 4BYMA 3BDIA 3FLAA 2IITA 5ESRA 1VA5A 2EDCA 2WKWA 2XI4A 3EF3A 1U4NA 5AO9A 1DQZA 1C7JA 3DEAA 4EUSA 3M81A 3WJ1A 3H2GA 4N8EA 1GPLA 3GROA 2OAGA 5DTIA 1GPKA 4ZV7A 5HKBA 1FSSA 2RGUA 4NVRA 4P9NA 4X7BA 1QIDA 2QVBA 4B7ZA 4MYSA 5CW2A 1CIJA 2ZVDA 1CFJA 2WHQA 5AIAA 5JATA 1CUCA 3O9MA 3NWOA 1N8SA 1Q84A 1ZICA 2WJ4A 1WB4A 4V2IA 4U2EA 4MWTA 1MT3A 1YSCA 1FFCA 1ZD2P 2QXUA 3JWEA 4WDRA 4K6HA 5A7HA 2QS9A 4L72A 1XZIA 1Y7IA 1YASA 3R3ZA 5IVDA 1LPPA 1MN6A 5K3DA 4F60A 3PDCA 1BCSA 4EY8A 4UBOA 2YASA 1UT6A 4OSEA 3WL5A 1DX6A 3IIIA 1FFAA 2LIPA 4C87A 1DWQA 4MYDA 2ES4A 4WDQA 3O4JA 2QR5A 1HKHA 1LPMA 3HZOA 3WZMA 1THTA 1JJFA 1VKHA 3VKFA 5CURA 3N2ZB 1MX9A 4MQMA 5DNVA 1E89A 1H23A 1UKBA 2XMZA 1XRNA 3UMJA 5AM3A 3GBSA 1BS9A 3O4HA 4GEGA 1O6GA 5CBKA 3BF8A 1LZKA 4H7EA 3W9UA 1K63A 3KSRA 2QJRA 1DT5A 3H2KA 2XQIA 4G1FA 4QWMA 3AZQA 4I19A 1VXOA 1G66A 2OLEA 4UHHA 5AOAA 1A88A 1W1IA 3A70A 4LIPD 5T4EA 4ZV9A 1BN6A 3BIXA 4B9AA 5AKIA 3G0GA 1YS2X 4G9GA 3HLKA 4U2DA 5AHXA 4EY6A 5IVHA 5A6VA 1ZD5A 4ZRDA 4B83A 5K3BA 5DYWA 1BE0A 5CT8A 2ONCA 3E3AA 2WFMA 3D59A 4FFWA 1ZIXA 3ZWQA 4DSAA 5C8ZA 4BDSA 2AJDA 4CIAA 1EB9A 1SCQA 1XRMA 4QLOA 4H7IA 3X3HA 3AFIA 4CIBA 2XMGA 4E15A 5KWJA 1GGVA 2DR0A 4MEAA 2XUQA 3BJRA 4IH1A 2B9VA 3PICA 1LGYA 1P0MA 4B6GA 2XUHA 1TQHA 2OGTA 4OYYA 4PO3X 1FFDA 3CN7A 2ROQA 2QM0A 4QEKA 4Y2QA 1IUNA 5A62A 1G42A 4ZGBA 5CXXA 1JFRA 4X00A 1IUOA 1LPNA 1TCAA 1ZOIA 2WIGA 5DNWA 3AINA 1SCIA 1XZJA 3FSGD 4CCYB 2XMCA 2QUAA 3CCBA 3V1MA 4DSZA 5HFNA 3EQ8A 3IUQA 1FFEA 1E5TA 2PM8A 1KU0A 3R3WA 4J0DA 4TGLA 3DNMA 1AQLA 3CXUA 2O7VA 1BEZA 3W2TA 2HHAA 1SFRA 5AM1A 2HDWA 5EHXA 1Z68A 4KYVA 4N5IX 5ALHA 1SC9A 4X3CA 2J3QA 2PSHA 2QOEA 4X91A 3OM8A 4FLEA 3D4LA 4X6XA 4OU5A 4GHWA 4BE9A 2XUGA 1LNSA 4BP9A 3V48A 1HL7A 3TRDA 2GBGA 3DJYA 4OCZA 4C01A 2O7RA 3FVTA 4ETWA 3M83A 5AOBA 2WQZA 1WCYA 3WKBA 1W52X 1QFMA 2PSDA 3DDUA 5T4BA 3AIKA 5FUMA 4YASA 3WK6A 1QFSA 2WIJA 4E14A 1UZAA 5JANA 3LP5A 4U2GA 1WOMA 1XLVA 5LKAA 4E46A 3IUJA 5I8PA 2AJBA 3TEJA 2Y1KA 4H7JA 5T4HA 3KD2A 2WHPB 1EVEA 1EX9A 2ZJ6A 4JYPA 3G0BA 4WFKA 2J3DA 3HXKA 5A7FA 2BCEA 2BUCA 1TCBA 4LYEA 2VJAA 3IB3A 3C6BA 4E11A 3ZPXA 2ZSIA 3DYVA 2PSEA 4O08A 4K2AA 5ALLA 2NW6A 2PX6A 3ICWA 3G0IA 5AK3A 2WTNA 4L3WA 4UHDA 5ALIA 1AUOA 4UBKA 5C8XA 5BWCA 4B82A 3W05A 4BE4A 5D7BA 1CUUA 1W4LA 3E0XA 4QDXA 3JYHA 4GLBA 4AN1A 3ZLUA 4BCBA 5EIHA 3R3VA 1BCRA 1CQZA 4PSCA 2JGKA 1QGED 3I2HA 2OG1A 2CKMA 2UZ0A 4BCCA 3RLIA 2Z8XA 4Y2UA 3QMWA 1WPXA 2VA9A 4QA9A 3QZUA 3H04A 4Y2VA 5EIAA 2HM7A 1HBJA 7YASA 4C4ZA 3QPCA 1GQRA 4LXHA 1EXWA 4RE5A 4GBGA 2BJHA 1N5RA 2CZQA 1QO7A 5HK9A 2QKYA 2X5XA 4QDZA 1A8SA 3S8YA 3C8DA 2HA2A 4Y7DA 4HXEB 2XUAA 4BZWA 1EI9A 4BBZA 3FBWA 2ZJFA 4EA6A 4W1QA 1XLWA 4Q3KA 5JIBA 5FLKA 1LBSA 3CN9A 3R3XA 3C6YA 3C87A 1D07A 3FYUC 4PSUA 3B12A 1VLQA 2GYWA 4OYLA 3QMMA 5C8VA 4F5ZA 3FYUA 1JMYA 5ALNA 2BUBA 3C6ZA 3EQ7A 2XUPA 3QPDA 5IVKA 5LKRA 4CCYA 1CUBA 1EVQA 1BU8A 4KACA 3STTA 4AO6A 4WY8A 2WUDA 4UFPA 3VDXA 2PU7A 1EHYA 3VVLA 2X76A 1A7UA 3DYIA 1H2XA 3HABA 4RPCA 2VAVA 5AK5A 1K8QA 3FOBA 2CUTA 1GXSA 2HA0A 2PVSA 5CT4A 5EFZA 4BP8A 5JD4A 1EDDA 5HQ3A 3D2BA 1ZD4A 4AXBA 4QDUA 3OG9A 4NZZA 4J0CA 3H1AA 3P2MA 1VE6A 2HL6A 4AMZA 5JADA 5LLSA 4WY5A 4BRSA 2VJDA 1JJIA 1CLEA 4H7DA 3PE6A 2YYSA 5AKJA 1PV1A 1AC5A 4OUKX 4A16A 1CUGA 5JYCA 1R50A 3AILA 1GZ7A 1N1MA 4KRYA 5ALUA 1B6GA 2XLCA 1XQVA 4DMCA 4FFVA 4NMWA 5HQ3B 1QIMA 1IZ8A 5HF5A 4CCWA 1MAHA 2WJ3A 4H7KA 1Y7HA 1YR2A 4KE9A 5AOCA 2JGIA 4J0GA 3G7NA 2VF2A 4RE6A 4ARAA 3STXA 2GBIA 3PFBA 4YPVA 5AM0A 1LPBB 1CVLA 2FUKA 3R40A 1ACJA 3I2GA 1OILA 4EHBA 4EY5A 4QZVA 3V1NA 1AZWA 2WG0A 3PI6A 3BL8A 2XUDA 2I78A 2HA5A 3FSGA 1E66A 1HPLA 1QIGA 5D3ZA 3GFFA 2Y6VA 1GKLA 1CV2A 1P0PA 3PF9A 2VT6A 5ALMA 4FTWA 4Q34A 2FJPA 5JAOA 1U8EA 3WA6A 1K5PA 3CCCA 2JGLA 4X6YA 3ED1A 3H17A 5ISMA 1NU8A 1XQYA 2OGSA 1XZMA 4BZZA 3QBJA 4LHEA 5FPPA 2I3DA 4N5HX 4B85A 4J03A 2OQVA 5ALJA 5K3CA 5AI5A 4MEBA 1U2EA 1VZ2A 4DM7A 2W22A 3LCRA 3ZLVA 1VJ5A 1XQWA 3H2IA 1MAAA 3IUNA 1VE7A 1GKKA 1CQWA 2B61A 3C6XA 4J3JA 4KAAA 3FVRA 1NX9A 2HA7A 3O9VA 5EHZA 2OXEA 3RM3A 5YASA 4LKOA 5A2GA 1QIJA 1UOQA 1QO9A 4ITVA 1UOPA 3DKKA 5ALFA 2DFPA 3T4UA 3FYTA 1JT2A 3YASA 1DQYA 3V1LA 4QDOA 3SK0A 5I7UA 2Q0XA 2PSFA 4HZGA 3Q0TA 1EA5A 4X97A 1QIHA 1G4HA 1H22A 3WWDA 5HCUA 4ZWNA 1DINA 5E4TA
chains in the Genus database with same CATH superfamily
2D8AA 2XIQA 4IV8A 5EKUA 4KAXA 2GBFA 1TKRA 3PL5A 1W30A 3G9QA 4YJDA 1DJLA 5AM4A 3GT3A 1E92A 2VZ0A 3QPAA 4G0OA 5AI8A 1PUJA 5FTNA 5BR4A 1EP1B 4UZSA 4EB6A 1JQKA 4E1AA 1JKJA 2HRRA 3E0QA 1JEQB 1NFRA 2PIAA 3EGCA 2JVIA 5KDDA 4IINA 5ENZA 3UT0A 1AVTA 1U2ZA 1ZD1A 3GCDA 4IMRA 5IAOA 2NT4A 1SRRA 1NKVA 4UAVA 2O2JA 1SKUA 3RC1A 2WHYA 5BSKA 1DTSA 2VT7A 1YFLA 2QW1A 5ICCA 2ZSEA 5LNK1 1GTRA 3ITNA 3LX5A 2BM1A 4MKFA 4J0EA 3IMKA 1JKMA 1NQXA 2VSYA 4CXMA 3HY6A 4I36A 3FXAA 4ZD6A 4CZ2A 4DHEA 2QSJA 3A9CA 4M1KA 1CPYA 3D8NA 1T5SA 4BVGA 5LB4A 4D0NA 5BV7A 5KYVA 4DQKA 2GAOA 2JGFA 4URZR 4I4TB 2ORIA 4IG9A 4AUKA 1QF9A 5KNDH 5F3RA 4IJUA 3NM6B 4MLCA 1YJAA 3PXXA 5AW1A 3EULA 4B35A 1IBRA 4PZEA 2X58A 1TZBA 2GEVA 3FHTA 3CVJA 2Q3DA 1SVSA 1KTVA 1BX0A 4FCWA 5KU1A 2SHKA 5CLGA 4XJXA 2HT1A 1MB2A 1NXXA 2PX8A 3W8DA 3PKZA 5B3KA 2Q45A 3KKLA 1RLMA 4JT9A 4FHCA 2PL1A 4A23A 1PLJA 3IE2A 4HFNA 4MR8B 1UP7A 2NO0A 2QLTA 2QPTA 3BWCA 1N5MA 1XCPA 3QENA 1UEXC 2P3SA 3MTAA 4N5DA 3PKJA 4WOPA 2YUIA 4RVHA 1ZOPA 4V0LA 2AT1A 4UUBA 1QHHA 1UZLA 3H0EA 2EFJA 1UPCA 1XZGA 2JGDB 4MUAA 1ORDA 1O0BA 4GT1A 3HU5A 4DNXA 5FWNA 3BDVA 3F78A 3JYQA 1PU2A 4PCAA 1Z8FA 4FU0A 4BQQA 1AJEA 1HRDA 3W8EA 1WXIA 2FP4B 2R8PA 4BNHA 2IIPA 4EF6A 1EUCB 3TD9A 1CXZA 3D5EA 4PBTA 2ZT7A 4BV3A 3LHSA 3M0EA 3DO6A 2VJBA 3P4YA 3TQSA 1WF3A 3HJRA 3AKEA 4MVJG 1BFKA 3CH7A 4Q3CA 2H4ZA 2JFVA 4KUGA 4CMHA 4UBNA 4TZ0A 4GL4A 4MGHA 1AKNA 3KCQA 3P5BA 1Q7BA 2ZKLA 3QWIA 1KJZA 1A72A 3G9UA 4RENA 4WERA 5F21A 4BRUA 4CM4A 1Z15A 3G5LA 3R3UA 3W1WA 3FFWA 1VG8A 2D4HA 2C3UA 5HIKA 4OQDA 1CQJA 4DIOA 3DZ8A 3L7DA 2HR1A 5BPFA 2FW0A 7MDHA 1P3DA 4K0KB 2WA2A 4WCFA 2REXB 1W88B 2PLAA 4L73A 3WMWA 4HBZA 1BRMA 2QRMA 5CHEA 5G0UA 1ODLA 3SBEA 3UY4A 4RZQA 1LBTA 4E4RA 3AI1A 5DM2A 3WSVA 4O4JB 4BZXA 4P22A 5L3SB 1YMQA 2ZUDA 4KVGA 4YAFA 2CXXA 2RIRA 3E03A 2YOHA 3FNBA 4IHJF 4K3UA 4B0OA 3ESBA 2CFRA 2FLKA 3FM9A 3U7EB 4H1HA 1KO4A 1JI3A 4KMOA 2X13A 3BF7A 2P9EA 2YMQA 2VDVE 4YMLA 2IU4A 2PMBA 2WLSA 4JU9A 1G6Q1 3WGQA 3LT4A 1KJYA 4NZMA 1DG9A 1FVOA 1MRNA 1HOTA 4JLVA 2A0KA 1XZFA 1EG2A 1XKTA 2E0IA 3A2MA 4ID3A 1B8NA 4NLLA 5DIFA 3O0DA 5F5LA 3TRFA 3U7QB 3O8RA 1I0IA 5DMXA 2V1UA 2I7XA 1THMA 2W6CX 3HYNA 4LNHA 2VPWA 4ON9A 3TI7A 4D44A 5BSFA 3CNNA 1XSEA 1OXTA 1O95A 3OKFA 1QV9A 1ZK1A 4N9QA 1Y9AA 4RDHA 5IKMA 3E23A 2IXGA 2HZBA 3AKDA 2ILTA 4P4UA 3RUEA 3WLLA 4IXWA 4OLHA 4CI0B 3WAGA 4DC1A 3E7DA 3HEMA 3CSDA 4G1EB 5EUMA 1SQ6A 3DMYA 3KFLA 4Q4HB 1CJUC 4KO1S 1QAMA 1XTJA 4AZWA 3DCIA 1NVVR 5LXTF 2I1LA 4I6EA 4CHTA 3A9SA 4ZCTA 3O1HB 3WG9A 1BWSA 3ZGLA 2C2MA 5K7SA 1VMEA 3FDIA 3CM0A 3E1KA 2R8RA 3GJ6A 3CEJA 4Z0HO 2P3QA 4B3GA 3KQOA 5AUOB 1EVJA 2ZBVA 3GLFE 2WDPA 3BWEA 1MC1A 2NV2B 1T6XA 4EMSA 4EYSA 2AFHB 3B5IA 4IW3B 3U56A 3O74A 5F7ZA 2WUGA 5CH5A 1XDWA 1QYIA 1V6CA 3I1FA 4XYMA 3L46A 3UHFA 4D8UA 4RAQA 3OTQA 5I8WA 3PUYA 1CEXA 2A9KA 2Y1DA 3WWPA 1RMYA 3L06A 3N3BC 2OHGA 2A1IA 3V1UA 2PPLA 1ZM4A 3P9CA 4EA9A 1NOJA 3SD7A 2VHXA 1HKUA 3B1ZA 4AJEA 4FQ7A 1DQPA 4L4XA 5BSUA 2PGDA 3WTBA 4P98A 3U7HB 2HV8A 3CZCA 3IVMA 3NAMA 4GPEA 4ZOBA 1VPDA 5FADA 2BDEA 3VOTA 1EP9A 2J9FB 2QRUA 1L5FA 4C5CA 2C94A 5KTTA 1I4TD 2VDWA 3NYQA 4CG3A 1QTIA 3S2ZA 2QRQA 3RO7A 1TRKA 3CRQA 5LP1A 1JHDA 1ZCJA 4G1MB 4GD3Q 3WI7A 5ALVA 5KWSA 1XP8A 4HWOA 2VDRB 1LW6E 3L8YA 1W76A 4XI9A 2PGNA 1DEKA 4HMOA 1L5HB 4L8FA 5KNBA 4F2GA 1M2VB 1MD9A 3OSZA 3MUOA 1FS5A 3AL0C 5KYTA 1N92A 4WLUA 4DIUA 1E58A 1QCDA 2G72A 2IHKA 2REOA 2GFQA 2OHJA 2Z8ZA 2NU9A 4D4GA 1VOTA 1O9GA 5DXAA 1F1BA 3QLVC 1W0JA 1M2OB 3E5NA 3ROPA 1A8QA 3L0SA 5KC8A 3QXXA 1KVTA 3TR0A 1CUFA 1YZGA 1AQNA 2ZJ3A 3AX6A 2HCFA 1F2UA 3DZJA 3VSCA 2QX7A 5IVPA 2V96A 4RWEA 2WSIA 3K09A 1G0NA 3V8QA 4TYNA 4ER6A 1HE1C 2E37A 3MT7A 1PN3A 1WVIA 2PGIA 3OQIB 4JP1A 3VHQA 5G40A 4ILKA 4MVJM 1M6EX 1M6WA 3L93A 5LA6F 1BQ4A 1TGVA 4A26A 5AI6A 3AFOA 4MYRA 1GSAA 4PO8A 4ED9A 3WNVA 1CUJA 1E1RA 1ZHHA 3TEFA 5FH9A 4KO8A 1P4SA 2RGWA 2ZVJA 2ZWMA 4Q1EA 2YS6A 2A5LA 2C96A 2FPIB 3NW9A 4LHXA 4Y1GA 5CBPA 3V4RA 4Q9HA 3JYOA 4OB8A 4Q4JA 2VAMA 3A2LA 3ZNNA 4JX9A 1AH2A 2XADA 3TJMA 3NAZA 4YWHA 4G4JA 2V5VA 3WV4A 4DSNA 2X3UA 1I14A 3RIHA 5LU9A 3PHGA 5AM5A 3RTDA 2OL4A 4ZVPA 3F0TA 1KYYA 3IBTA 3BM5A 3K5HA 1R0CA 4UTVA 5C51B 2FW8A 2Z5FA 3A3YA 2NYUA 2YNMD 4OKNA 3BJEA 1JW9B 4TYMA 1YZQA 1QOZA 3VDQA 3GL9A 4ZI2A 5EGNA 1QK5A 3N0VA 3PQ8A 2C5GA 1EXDA 2GN4A 2WAOA 3DMTA 1Z88A 5KNCA 3QXSA 2OZPA 4UREA 1VBNA 2A0UA 2DF8A 2P2NA 3IQHX 2OZVA 1RYZA 1ZO8A 4I4TF 2UKDA 3BE4A 2Y1GA 5DI3B 4Q1VA 2QD4A 4RACA 3Q7PA 4DMRA 2WU3A 1QAQA 3NEAA 1KJNA 3SJ7A 3TUJC 1ZUIA 2UYGA 2REBA 3WLAA 1F3OA 2X42A 1W35A 1EQAA 4IP0A 4Z3KA 2R66A 5HKKA 2ADOA 5TVGA 4QELA 3SQNA 2IH4A 3F3SA 4ZI5A 1ZJZA 1C2TA 1YCFA 4BJ1A 1VPWA 2J9RA 2WAMA 3I9KA 2Y1CA 5BY2A 5L7TA 2DFTA 2FMXA 2ZYSA 3A06A 4I9FA 3TLGB 3UH1A 2J59A 4CF7A 3MTQA 4JI6B 3OPQA 4TN1A 3MTBA 1TFUA 4E94A 4B32A 4FLFA 4EFNA 1Q14A 3LQFA 3EIOA 4F3CA 3KT0A 4URXR 3AIOA 3K96A 1E20A 2AOUA 3ZKWB 1E8NA 2I1WA 2ILVA 2GAJA 1M1NA 1KPIA 1EX7A 5K0ZA 1B0AA 3LY9A 5F51A 2PUGA 1KO7A 1P44A 1BD3A 3SIXA 1H0RA 2I7VA 2Y1FA 4XYGA 3RIXA 1M83A 4W6QA 4INAA 4B81A 4BP3A 4C6SA 4BTVA 4RK5A 5E1BA 4PO1A 4YV2A 1F0NA 1P2VA 3QE9Y 3MWYW 2CDRA 3IH5A 4HQKA 4QGHA 2VSFA 5HVNA 3AEUA 3FTNA 3IEKA 1A9QA 1QGDA 1S8OA 1LV8A 1FX1A 2CLCX 1J2YA 3BMOA 3P7MA 1EBFA 4RAOA 4CDNA 1AK2A 5BR1A 2AHRA 1E0AA 2WF8A 1H85A 2FRXA 4FYVA 1DC5A 2G0AA 4OHRA 4EIWA 2XJ9A 1YU6A 2BI8A 3LXMA 1V7QA 3K0FB 4RCYA 4ZHQA 1N77A 1E3JA 3EFEA 4PY2A 3KQLA 5F2EA 5PGMA 4EVSA 5C5IA 1C4WA 3VPHA 3MK31 3U6BA 1U3TA 3CQ9A 3JATA 1OYVA 3OZXA 2IU6A 3ZQ6A 1Y89A 4PF1A 4FZJA 2VDNB 3MLAA 2YV2A 3GLSA 5FXMA 1XMVA 4BIMA 1Q12A 4ZZ0A 3UMCA 5FX2A 1T3GA 4A6EA 3OETA 4R83A 5BSEA 5GQSA 3C7KA 4EG6A 2ZRGA 2QZZA 3P9ZA 2H5EA 3FDJA 4H0CA 4K0RA 4QHTA 1BDBA 3AHEA 2B8EA 4TV8A 3UTDA 4G2NA 1JHZA 3GJ4A 3GLGE 2JFBA 2V59A 5CCDA 4R84A 1EP2B 1WVGA 4M9RA 4M1MA 3G1UA 4UZEA 4DPKA 2P2GA 2R65A 4P31A 4DDVA 3EPKA 1SXIA 1Z0FA 1I13A 1Z0JA 4V3BA 1NVUQ 4ALMA 4HAUA 3RWMB 1VHJA 2FZWA 2VWPA 2QMYA 4JR1A 4BQRA 4EG1A 4W5OA 3EXFA 3O2SB 1WPGA 3VYSB 1Y3CE 3HYLA 1U80A 2H00A 2CCJA 4NDNE 3C7CB 3WWCA 4CKBA 4E5SA 5K8LA 2B4QA 4OJTA 3KR2A 1CUZA 3EGOA 3G88A 4LX8A 1AQIA 5BSTA 5K3OA 1I6KA 1II8A 2C4MA 4NOMA 3A6HA 4IJKA 3V8BA 3EISA 2PL5A 3QFCA 4ICIA 5F64A 5TNXA 3WXBA 4AM8A 3ECAA 3OLVA 4KFCA 2DJIA 3CW8X 2XQVA 3AESA 4MINA 2CXNA 3B52X 2Q9BA 5T5QA 3WRXC 5KOIA 1TUBB 1C1XB 4KGVA 2GHTA 1OI4A 3KNZA 3RT9A 1NI4A 1XP5A 4YO8A 4UUPA 3AR9A 4ZEOA 1A8UA 1KBZA 2H8GA 4Q00A 3ACBA 4MVYA 1W2HA 4AUMA 1COZA 3EPJA 1P2BA 1VKZA 3N8HA 4HY3A 4BMOB 2YNMA 2D2XA 4DLYA 2AC4A 2ZJ7A 3H19A 5DBFA 5DW3A 5J4HA 1G2OA 2O9JA 3LUHA 1R0KA 4CJXA 4H0FA 1V5WA 1P1IA 5COBA 3GWGA 2W42A 1XDDA 1JLRA 4LDAA 2DBYA 2WUFA 1PZFA 3A6JA 1HDXA 4D8VA 4U9IS 3KJHA 3QX7A 1DFHA 2AV6A 4UMEA 4GXNA 3C3KA 4PYQA 3SFTA 3BQ9A 3G2JA 4MROA 2VPZA 1NPYA 4W9RA 5E4YA 3SC3A 3WNCA 2SKCA 5IFLA 1OLXA 1KRWA 2D1SA 2G76A 3CG0A 3C74A 2VOEA 2V7VA 4QTUB 3WYCA 4A8HA 3QUQA 1JE0A 2CXHA 3QELA 3TW8A 1JTFA 1QU3A 3KOZA 3OM9A 2BEVB 2PKQP 4YFYA 1XDZA 4QBGB 3Q8WA 1QCCA 1Z62A 3QBDA 4BKUA 2I03A 2WUEA 2WBLC 1TGYA 2BR4A 4BMCA 2RKOA 2N46A 1QOQB 3HWWA 2XKAA 3E1SA 5BQ3A 4UUAA 3JYNA 1DC8A 2X9NA 5CX1B 2VP9A 3OH8A 1OKKA 1Q1EA 4GLOA 2WG1A 3HBNA 2O0JA 1HXHA 2HSZA 2O52A 3RG2A 4L5JA 2PANA 5AXBA 3BMNB 1DCFA 4R5MA 4C3UA 3CLRC 1H2AS 5EN4A 3TZ6A 2RGCA 1KAEA 2Z6VA 1WB6A 3HRHA 1KP3A 4MUHA 4TTSA 5REQA 2PQ2A 1ENOA 3B7WA 1H9CA 3BFKA 2F00A 2YXPX 1M2NA 4G23A 3AETB 1E4VA 3Q0EA 4UTZA 4W5HA 4HATA 2JJYA 1RFGE 3OD5A 5NLLA 3AJRA 2CCKA 3X2FA 1T4MA 5CFRA 3W5SA 2DPXA 1PR6A 4Z2YA 5AVQA 3EXFB 1XC7A 2IY7A 3OT1A 5JNVA 4B2YA 4MQLA 1LBQA 4GOXA 1KMNA 5HDBB 3A2NA 1GZDA 4JC8A 2WNHA 4EEZA 4MI1A 3NRBA 1QJCA 4IMIB 4QLAA 5LQJA 1KDRA 1RLIA 3KQPA 1PL8A 3ROKA 4QWWA 3COZA 5AKEA 3VOBA 4B4VA 1USGA 5A6SA 7ADHA 1V3UA 1P3Y1 1OVMA 4LC9A 2F62A 2JZNA 1TXGA 4WIAA 4Q1AA 3UJ7A 1CUIA 4L0QA 2CUZA 2PT6A 3EWIA 3GGJA 4N39A 5CCXA 2PLFA 1WSAA 3LKVA 3E9ZA 4JI1B 3RSHA 5A9TA 3H16A 3B2QA 4LZNA 3D81A 3DWGA 5ICFA 1L4HA 1UJ5A 3ZHUA 3IAM1 4MHTA 2W58A 3B9BA 3HUTA 4KQWA 4ZAFA 2RKWA 1E3QA 4DIMA 3G8BA 3DBHB 4H18A 3UVEA 3V42A 1JBKA 1KI8A 2QX6A 2X1MA 1MIHA 4NU5A 4QOGA 4UJ3A 3K0FA 5EPOA 3TLKA 4FSDA 5JTUA 3FMPB 2EZ4A 1ZU5A 3A7EA 4FGZA 2HRZA 2QAGA 3HVJA 3OU7A 3ZXUB 5IAAA 2H7CA 1VJDA 2J5QA 1DO8A 2OHIA 4C04A 1J23A 3EVBA 3H5TA 4RK0A 4UM9D 1GLVA 1T9GR 1I4DD 1T8WA 2WM2A 3BMOB 1FF9A 3HSSA 5J40A 4U3JA 2QAGC 2IEGA 2VK2A 2REQA 2VEOA 5EIWA 4UE6A 4YCNA 4RV9A 3C7TA 4Y0VA 1GZ5A 2YIMA 1BFDA 1R0XA 3A3NA 3KOOA 3OE1A 3CRMA 4NG5A 3RE1A 4ZXPA 4QPDA 1NZDA 3TX2A 4CKWB 2I91A 5E8RA 3T61A 2DSNA 2FJUA 3CLUD 1SHTX 1M6VB 2J09A 2IYYA 3ETNA 1Q7GA 2IHTA 2B9EA 3EMVA 4HLNA 4PIVA 2AXNA 3LFHA 2J6BA 1OGJA 2CZGA 3AVWA 3K2QA 1FPQA 3E58A 2NUAA 2DCMA 2PVPA 1BTOA 3PDWA 3VVCA 3NEJA 1WCIA 4UNRA 3KAJA 4ZJZA 2JHGA 4MRRA 2WC1A 4ZVQA 5KKAA 4GSKA 3NHMA 3RUCA 1OLSA 2YBDA 2QN8A 5C8YA 1DC6A 4JJAA 3U5TA 4OPMA 5FIUA 5LR6A 1HFWA 2RFLA 2QXYA 1JAXA 1JWAB 1TYDE 3WWOA 4JI2B 5HOQA 1EM8A 3K8YA 4BWGA 1DKOA 2C95A 3AFGA 4O8CA 4REMA 3GLVA 1ODIA 3DZDA 4DR3B 1Q1NA 4Z1OA 5DI3A 1WEKA 3DDSA 2GD1O 2YWBA 3RYIA 2XNSA 5K0GA 1IY9A 4QM7A 4Q1FA 5PNTA 2CD7A 4OY3A 2DULA 3HRKA 3MNFA 3ICVA 2GXUA 2RHDA 2CNOA 4G5SA 3C85A 1YIDA 3ACDA 2PIDA 3NAQA 4FS8A 4LVOA 4YB8A 4BZPA 2QNRA 1ZI9A 3HACA 4MQ4A 4B6RA 1EDZA 1RU3A 5G53C 3CGWA 3IULA 1FFSA 3F98A 5DN6A 4DBLE 2QPAA 2VA8A 3WB9A 2BVNA 1EE9A 1WW2A 2C2YA 5I7SA 1H2BA 4IJ5A 4KYUA 4YCCA 1I0LA 4X3PA 7GPBA 1B8UA 3OO0A 1HT2E 2OB1A 1X7XB 4ASUD 2H59A 3L0OA 5L6MB 2C9MA 4L8YA 4BV2A 2I5PO 3EA4A 2YNMC 3F2VA 1BA3A 1XHLA 3PL1A 4MDYA 5IN4A 5F35A 5L6LB 2DLNA 4OHUA 1E4EB 2CXPA 3GJ5A 4M9SA 4Q01A 5EWJB 3QEAZ 1L4BA 4FFNA 1TYZA 2CFCA 4RTSA 5JS1A 3AL2A 1EWVA 2EFGA 3GRAA 3INGA 4U2BA 1T3ZA 3MMPA 3OC6A 3A6KA 3ICEA 3GJ3A 1F2UB 3U37A 4OXNA 2A7QA 3PUZA 3ZJ4A 4LVUA 3DTYA 1OXKB 3VJRA 4YHHB 4EJSA 1E98A 5DASA 4FEGA 3SIRA 4XSVA 3I39X 2PA0A 1AURA 3DEFA 4KR9A 2WD7B 2VLIA 4F7DA 3E84A 1WP9A 1HQDA 3E9NA 3N2KB 3T7KA 4JYMA 1GM5A 4ECAA 1PP4A 4R2JA 3WICA 1YQTA 4OJYA 6Q21A 2R8EA 3RGWS 2WKSA 3HL0A 1JFVA 1U8AA 5LZ4A 5DIZA 1ZLYA 3AUUA 3BXGA 5AK4A 2RAFA 1E0JA 1FFXB 1W5EA 4LVNA 4Q3BA 3UB4A 5K0TA 1F0PA 1I1NA 2W2QA 2Z3VA 1H0HA 3HSKA 1UWCA 4NYJQ 3JQDA 4EFMA 1WPQA 3K8QA 4L5AA 4NDAA 4V1CA 3ZXIA 1ML4A 3N2IA 2O6LA 5DCWA 4EZBA 4MQEB 4OHVA 1U5BA 3G5AA 3NYIA 3ZD9A 1BNCA 1K0FA 2J7PD 3JY6A 4EHKA 5L4SA 3SVZA 4L7QA 3QTBA 3WIVA 4EMBA 1KY5A 3E6AA 1B4DA 2HREA 3UHAA 1LKZA 3MILA 5A7GA 5P8WA 2FWJA 1YBAA 3L8CA 4LFAB 2D5AA 5FLXA 2RGAA 5IT9A 3B9RA 2K7ZA 4M1ZA 1MKYA 2UZ4A 4DCPA 4YAOA 2VXYA 4GWKA 1Z7WA 4H1UA 5IUKC 4XIIA 1QB7A 2CY0A 3PWTA 2CE2X 2PEZA 1PZHA 3DTVB 3D6MA 4PG5A 3W9SA 4D6YA 4ERNA 5BN5A 2W6JA 2XUJA 3QW2A 1RP1A 3V9AA 2P5SA 4GVLA 2XRFA 1RPZA 2LW7A 3OM1A 3JQ8A 4GP7A 1GZ3A 2JFQA 5CT6A 3IA7A 5EKDA 5JSQA 3Q2KA 1XVTA 4DZTA 5J23A 5FTKA 4M0PA 3VUFA 2C0PA 1ZM2A 3B9QA 2AEEA 5KTSA 1T4CB 1N8TA 3DQZA 3FF1A 3HJTA 1GRNA 1PGOA 2Q3LA 4RZHA 5G1PA 5TJ9A 3ZI7A 2CFSA 4XE5A 3RSGA 3DAOA 3LL7A 2FB9A 1XA0A 4ZVSA 3ZU5A 3ND8A 2HU2A 1Q74A 1B0ZA 4DQLA 1EDEA 3USZA 2X7XA 1QQ6A 3G0CA 5D86A 2NT3A 3FCAA 2DUJA 1FP7A 2VP5A 1IEQA 2E18A 2A9FA 1R3UA 5LJIA 5TT0A 3F1KA 1F8XA 1FDRA 2A9VA 2WTBA 4IO1A 1F9EA 2GXSA 4FYPA 2PT9A 2ZAMA 3PEEA 1JG2A 1IE3A 1KMMA 3QBEA 1BMDA 2RCYA 3U17A 3IEUA 2PAFA 3U3JA 4ZYXA 4HKTA 5KVVA 1GNTA 1UM9B 3LBNA 2CJPA 2ODTX 5CJJA 4US2R 1IQPA 3UCEA 1ZD3A 3ISTA 1NOKA 3DJFA 3GLHB 3JQBA 4LYDA 3KWFA 2CXUA 4C03A 5CMLA 1EINA 4Y2TA 4B48A 1GUBA 3LVBA 4OUDA 5D3KA 4MO9A 3WLPA 4CL0A 6LDHA 4K6MA 4ZCSA 1J6UA 4M7WA 4PSDA 1KEWA 3UJ3X 1N2CE 2PE5A 4Z0TA 5FPSA 4DMFA 1KE1A 2Y1LA 3L6CA 3PQ6A 2GNOA 1F8FA 3IT2A 3HNRA 2PGXA 1RAHA 4FOTA 4WXHA 1Q3HA 3QV1A 3TOCA 3UFXB 3ZZNA 3HYRA 4Z4EA 5HBRA 4HB2A 5DX0A 1G2QA 3ZS9A 1P9LA 4RMHA 1Q20A 5TRTA 3P2OA 4IIJB 1V5GA 1ZI8A 2NV6A 4YRPA 4S0XA 3H4TA 1GU7A 2CVPA 1K08A 4BLPA 1NASA 4U2FA 3AR8A 4OQLA 2X22A 4WINA 4H17A 3TM4A 1R9MA 4YP9A 1T10A 1Q1AA 1JLSA 1MORA 1L4NA 2GK4A 1JPUA 2OR3A 5SZJA 4Y98A 3B20A 4CLHA 3ZOZA 1B0UA 1WU7A 1R4AA 1NP7A 4BO1A 3B36A 1ECFA 4NYJR 1J39A 3VZPA 4NMMA 2QGFA 3QXJA 5FOUA 2I4MA 4DG8A 3T34A 2GESA 2YW9A 4IVPA 5ITSA 3L1KA 4HDNB 1Z2PX 5CYPA 2L42A 4EUNA 5AW6A 4I4CA 3F97A 2IFTA 2CVFA 4TYYA 1G8FA 1REQB 3PB3A 4NEQA 2W2PA 4EEKA 2XCQA 1M0TA 3D2AA 1AHHA 3TTUA 2B6HA 2HRBA 4L3VA 1HYQA 3FCEA 1J2UA 3U4GA 3GIWA 1G5PA 3LIPA 4W82A 2F4NA 2B94A 4D97A 3OZDA 1KZHA 3QV2A 1E1LA 3FCYA 4P4SB 2R6ZA 1PGQA 1YS4A 4NU6A 1YCGA 4AF7A 2NG1A 3ENZA 1J20A 4XVQA 1XPOA 5CDTA 4E08A 1ECGA 2X6TA 4XJSA 5G4KA 3BKWA 4II2A 2ZTUA 2ZBGA 4UNNA 2PUFA 3DVSX 3KE9A 1XUOA 3NHLA 4INJA 1PZEA 2DHEA 3NUGA 3IERA 2P1ZA 3OQIA 4RV5A 4EENA 1NSYA 5CR9A 821PA 1SHLA 2NVOA 3MTEA 4DMHA 4DEVA 2AZXA 5FNZA 5C1OA 4B3TB 1H9AA 2BFNA 5JD6A 4TVKA 4BTEA 1ULBA 5HUJA 1NU6A 3DKRA 2Z4RA 3IKMB 1PUIA 4G4GA 4QTYA 1WMAA 3I6MA 2ZCJA 1M72A 1XZKA 2P0EA 2BIFA 1JR3A 3HJNA 5TPWA 5K2OA 1GL7A 5E2IA 1ULAA 1TVEA 5E6UA 3UA3A 2J45A 5GIPE 3ZCUA 2E4VA 3CWZA 3PQ5A 4U9UA 4POOA 2W2NA 1ABBA 2EYUA 1VXRA 1YVDA 8LDHA 4ALJA 2A9OA 3FF4A 4ARSA 4B47A 3FDZA 1NV8A 1MV8A 4Q1BA 3NTLA 3VU0A 2DQKA 1YI0A 2F7SA 3OKCA 3RTEA 2GZSA 1G98A 3ENKA 2YQ4A 3ZDBA 2JIDA 2VKQA 3BBLA 4IDHA 1I4OA 4W1SA 4LF7B 1XMOB 4WBXC 1RKUA 2WSYB 3D8TA 1XYVA 4BO9A 3BIWA 3TQQA 5EKXA 3M34A 5CM8B 1U0GA 4JOBA 4NMXB 1M7HA 5LZ7A 3RYIB 3PPWA 1BYUA 3N2EA 1X39A 4CMGA 1KAMA 1N5OX 4QBFA 1YZTA 4RWZA 4CM7A 3Q2IA 5JZMA 2VYVA 3Q7IA 1JIIA 3MA0A 3U4IA 1PWHA 2DBQA 4GLJA 4JLBA 1W36D 2O8FA 1A96A 3H11A 2AJTA 2ZAGA 2B3DA 3V4ZA 1UAAA 3R24A 3UAGA 1KQFA 2HJ9A 2ANBA 1TJPB 1VSUA 2X19A 4MR9A 5B64A 5L3VA 2HHHB 3WDSA 1HO3A 1YRWA 5EMMA 4HGZA 2VH5R 3BD6A 3SEAA 2P90A 4RM3A 1PFKA 4YEDA 1B76A 2CF6A 1XNQB 3DFUA 3PA6A 3Q9NA 3NAGA 2QN2A 3VR1A 5JLAA 3A9WA 3TKAA 4O63O 1P7YA 2YIDA 1XLUA 4YX9A 1YL5A 2IZ5A 1WKCA 1XK7A 2ODEA 1J70A 3DOFA 2M6LA 1XPRA 1NF8A 4BNJA 3S4YA 4PYOA 4Q4HA 1M75A 2WJVA 1YDGA 3QVWA 4ZHQB 5C1DA 1Z08A 2X0FA 5JASA 3SKYA 3U5ZB 1OV4A 1ZL2A 3NIFB 4JR2A 4ESEA 5ALGA 2SBTA 5FOVA 2IZ1A 3MERA 3I6QA 3EY4A 2B20A 2P9JA 4NABA 1ODTC 5ALWA 2ZR7A 1IEVA 3X2EA 4HWPA 5M29A 1R0WA 1QGAA 1PD0A 3IQEA 1OWNA 2AB0A 3RIEA 4C7MA 1FYEA 3MZ0A 1NJSA 4OJMX 3RFXA 5LQKA 3A1WA 2X0NA 1CFZA 2EGHA 4I0WB 3QNWA 1NI3A 5F2OA 4OG2A 5F98A 1CY4A 3NOXA 4N3CA 3ROGA 3WS7A 4BGEA 2C3PA 2DE0X 1WZIA 2A5JA 2EOAA 1IONA 4W8HA 4QPPA 3OECA 2BFOA 2WYHA 4FUQA 1K7YA 3FCUB 2QUBA 4EHLA 3HB7A 3P4UA 4U6NA 3MCZA 2V9PA 4HSGA 5JCOA 4L6AA 3O84A 3A1CA 4YDQA 1A4IA 2QE7D 2RDMA 2GHIA 2QXTA 2VCYA 4DABA 1MX1A 1G7RA 1ZGJA 3FVQA 3PFKA 4ZC1A 3RJTA 2XCIA 2VF5X 4DRYA 1GGFA 2GZDA 4R01A 2C2BA 3RK4A 1M54A 5J5VA 2QRVA 3LGXA 3EGXA 1W0KD 3H2YA 3O2QB 1GWNA 2X8AA 1H8HD 1GD1O 1C30A 4HQRA 3H3XA 4NICA 4OLFA 2JK0A 5D1HA 1EWRA 3NHPA 4C21A 4CDGA 2V6FA 5EJAA 4YIKA 3JAWA 4QARA 3A3KA 4BNNA 2JLWA 1IWPB 3PD0A 4GOND 1DZIA 2H1LA 2AJ8A 4B4WA 3C0KA 3OPVA 4PVDA 4QJ5A 1CUDA 1FZQA 3KEGA 3STWA 1PR1A 4XYBA 2CDNA 4KQCA 2OOKA 2ZSAA 5JD5A 1LC0A 2A4KA 1K06A 4LRXA 1VB5A 3E8MA 1IVYA 4C2UA 3VH3A 4ER7A 5KJFA 5EE3A 4NF2A 1MNAA 5DNUA 5L4NA 2JIZA 1XU7A 4GR5A 3BB3A 5REQB 3T35A 2JHCA 5ALDA 1NFQA 1P0IA 4OJQA 3WK9A 1SAYA 3EPHA 4TRJA 3KJQA 1RTKA 2OT3B 3JQEA 3V55A 4EEXA 5E2BA 5AKYA 4NCXA 1PGJA 1U1GA 4OIFA 3I53A 3L0YA 1CP2A 4KI7A 1NQAO 4K9NA 4YK7A 2H4FA 4D9FA 8ADHA 4P0PB 1R15A 3F96A 4OI2A 4LPSA 1NXVA 3LHKA 4H7PA 1WOYA 2VQSA 5E6UB 3RFTA 3AJDA 4WFQA 3AY3A 5HF9A 1YC2A 5D3QA 4INZA 1Z6PA 1TA4A 2C88A 3RU3A 2OM6A 2Q3EA 3K16A 1T2CA 1DAMA 1Z9BA 2FMKA 3EIEA 4TMVA 3U7RA 3GN2A 2AG5A 4ROTA 1FW8A 3ZNOA 5JRJA 1N6NA 2XD4A 3LA6A 3EBPA 3C5VA 3VR0A 4LGMA 2YJNA 3K5PA 3OQHA 4B6EA 3ENVA 4F8EA 2Q0QA 2QN3A 4QGAA 5G4KB 1AMNA 1RWXA 2P78A 5F7JA 2CHGA 3PVZA 1BWRA 2YYYA 4K9QA 1GXSB 1OR8A 2ZJOA 3CUTA 3PXGA 1S3SA 2FMTA 1TJ4A 3FCOA 3I1IA 4MIOA 1SU8A 1HC7A 4W7SA 1DBIA 4MQ6A 1QIKA 3NVMB 5TT1A 4PXYA 3W5BA 4YJ3B 1KI3A 2HLDD 3I8SA 2J3KA 4BLUA 5FPQA 2VWGA 3MJHA 2AA3A 2BTOA 4PNZA 1DBSA 3G1WA 4DVGA 1TLLA 3LY7A 4ZDKA 4H35A 2WMNB 3BXHA 4NE2A 4QXMA 5AVXA 3F5FA 1FDOA 2IYRA 3FWHA 1H66A 2XCOA 3JQ9C 1TMYA 3LZDA 1YL7A 5ALOA 1H93A 4EHAA 4WJLA 1NVVQ 1QR6A 2J3LA 3D3WB 3DAFA 3GA7A 3QWHA 4C7OB 3IDOA 3PT5A 1EUYA 4TS9A 1B74A 1XJCA 1B3BA 2A5FA 2P4QA 3NBXX 4HEJA 4TT8A 4UQPA 3PPYA 3V1YA 2ZM5A 3FETA 2BKLA 2WDZA 3DZHA 4JKOA 2IXFA 3RAJA 1JWBB 1ODCA 3EZ7A 1PV2A 1PT6A 2RG1A 3DE0X 4HGQA 5HCIA 3UK7A 1T4DA 3O26A 1SPXA 4BVJA 4RHCA 3OOWA 4NJOA 2COUA 3DDCA 4X93A 3IDAA 4O4IB 4DDWA 2GM9A 1G8KA 4X64B 2H7XA 4Q3DA 1WA5A 1JJAA 2QTHA 4OGGA 1L5RA 4MW0A 4V0RA 4J0JA 1PEDA 5AJZA 2W6OA 3UFXA 1X8LA 4U7GA 1I8TA 3MQ4A 1WNTA 3GA0A 1PFWA 3TS1A 4XTCS 2P11A 1SIOA 4YY3B 4MPPA 2NNWB 4ZQHA 1KU6A 4MK4A 2ZUFA 4M38A 5K3FB 1UFOA 2KLBA 3RUHA 1CZNA 1TTQB 1U1FA 5CB4B 1IH8A 4D41A 3U7FB 5HK8A 1OLUA 4MKIA 3ZWXA 1JHVA 2FY8A 2IUYA 1E61A 1V43A 1PDOA 2ZB8A 3OCJA 2CN1A 2R4UA 4W9NC 3TLCA 5CDGA 3V00A 1U2GC 3R0IA 1VIDA 2EKDA 3L7IA 3KLBA 5EHNA 5HFJA 4DNQA 3AF5A 1PBTA 1EFRA 1V45E 1LJUA 2XWQA 5CIQA 1F2TB 3I45A 2NUPB 3MIIA 5GAJA 5CT5A 5IYZA 3MCWA 4Q48A 2M98A 5F12A 1ZIPA 2A9JA 4Z9BA 3I62A 4HUTA 4UVDA 1KQOA 4IQ4A 3D1JA 1N2JA 2O50A 3O8NA 1LUAA 5IYZF 5HKLA 1OZ0A 1YGPA 3DEYX 1C9KA 3OLWA 4AP5A 4AZ0A 1TO6A 1ZLXA 3PNOA 5CDHA 4WNCA 1XTUA 1SU4A 1XZDA 3MW8A 4LHVA 2C7BA 1XHEA 1XRQA 1BVYF 3GEEA 4PPYA 3WGJA 3MCUA 4CFYA 1ZM9A 2X86A 1WCWA 3I37X 2GHRA 4L1KA 2XGSA 3ANLA 4A5SA 1OFVA 1JDBC 3MS2A 4UKDA 1UK9A 2LZ0A 3MMXA 3QLJA 1EEHA 4YNBA 4DM4A 3MWKA 5KJ1A 1WRBA 3IFSA 3JQ7B 3VZBA 4AC9A 1XWIA 2VLBA 2QLBA 4GMKA 4NFLA 3AIMA 3EC1A 3SXUB 3USCS 3C8MA 3OE7D 4ZOLB 5LP6B 4D9JA 4UNQA 4C89A 2AG1A 4H6PA 5LZ8A 3R9KA 3F67A 5H81A 3F8WA 2XMPA 2NTJA 2JHFA 1R00A 2J46A 5BW6B 3U7IA 4BX2A 2O8NA 3HGQA 4HB0A 1UZMA 2IDZA 1Q0PA 1TT5A 5TC4A 4AKEA 1CE8A 1LZLA 3GOHA 1A9XB 4MQEA 4PSVA 4PZ9A 1YA8A 1TYBE 1OTXA 1U3GA 5ANRB 5FR2A 2ZPTX 4E1BA 4MV4A 4C7JA 4CMBA 4DW8A 4DR5B 2DYKA 4YROA 3RROA 1L3BA 1TU0A 3KOUA 3NR2A 4DMMA 2C8JA 1KJQA 1O8CA 3QKSB 3ELWA 1CU1A 3PE3A 1V16B 4MWSA 4PNHA 4EYKA 4AX8A 5KNBD 3QNMA 2F6RA 2IHYA 2ZI7A 5J2UB 5KOHB 1GUYA 5BRNA 2HXYA 3SHVA 2PU5A 3EC7A 5HZGA 1XEWX 3NC4A 2IVFA 3KDSE 3VDMA 4O4IF 2OAEA 2O14A 2ZAOA 2OFFA 3WGNA 4F4HA 5I6DA 1YXMA 5LQMA 5D2CA 2P5UA 4FB4A 3LXUX 1CJBA 1T36B 2WT9A 4LRWA 2GPAA 3RRJA 4MJXA 1Z0UA 1DWOA 2YINC 4QJ3A 3W7AA 2YWRA 1GPJA 1SUCA 1ZJJA 2C98A 2YYZA 1NJ1A 1RWOA 2Y8EA 1QMGA 3EXG1 3PF8A 4ZZ2A 4DDMA 2EFCB 3DGEC 2IF2A 2R96A 5CVEA 2CVQA 3ADKA 2PMKA 1RZ3A 3TINA 3IIJA 1FS4A 2AJLI 2QR3A 2WT8A 4HNAA 5AICA 5DYYA 2VEDA 1V4BA 1U0EA 5TSDA 1UUFA 1C50A 4PR0A 1GO2A 1Z36A 5A5VA 1KOGA 1MT0A 3TI9A 1B7GO 5ALYA 5KI6A 3AW9A 3HNPA 1IRIA 1QP8A 1QE3A 2X4GA 4RY8A 2P9TA 4HNUA 4AZ3B 1DPFA 3W90A 2A0YA 4OAOA 4EG5A 1D4OA 4LY3A 4F6RA 4P80A 1TJ3A 2QG9A 4KOEC 3UAVA 4PLCA 2QQEA 2HLPA 5ESRA 2YXEA 4LJ4A 4FFRA 2RGYA 4MV0A 1VA5A 3W1EA 3VA7A 1RJWA 1Y3IA 1X1TA 4PCVA 3W6NA 2P7IA 4FHGA 2DAPA 4YAIA 4FX5A 1OYYA 3JQFA 1DQZA 5AO9A 3RVRA 2GK3A 1FU8A 3DEAA 4JJ4A 1EEXB 4TMWA 2B35A 4V2UA 4LDPA 3HDQA 3NCHA 4WUTA 3WMEA 1VCIA 3GV0A 4KRGA 4MKZA 4LY0A 2AK2A 3PFWO 2NVUB 5DTIA 1GPKA 2ZIFA 3MOSA 5C18A 4TYWA 3N39C 1IOZA 1W29A 2IE8A 4V03A 1FSSA 4NVRA 1G8PA 4KVZA 1NW5A 1ZQ9A 2CVHA 2ZE8A 4Q0MA 3A6LA 4F2DA 1FUYB 2OZLA 2RD2A 1GYPA 4BKMA 2QV7A 2QVBA 3TZEA 3NP7A 4LJKA 4L4UA 3BAZA 3QEKA 3LQ4A 1CIJA 1A98A 1WUIS 3HA5A 3ZWCA 5HYVA 3RKUA 3TMAA 2ET6A 5DLYA 1H4QA 1L5WA 3EOAI 1L7BA 1TM1E 5LUAA 3AR5A 4LFCB 2C7GA 2NMVA 1SOAA 5HRAA 4IBOA 3RS5A 4N0EA 1NIJA 2JFGA 5BNFA 2GI4A 2MU1A 5SY9A 4O5OA 3LWZA 4I9UA 1OBVA 2YC4C 2Z2KA 1TE2A 1WX1A 3NWOA 1M6NA 3I3OA 3LOUA 4QPNA 4XR4A 2ERCA 5KVCA 3N2GA 3W5CA 2Z6AA 3W5AA 1Q84A 4PLPA 5CX4A 1DCTA 5KWIA 2DLCX 1PKEA 4V2IA 2W7TA 3ASUA 4L4YA 4MWTA 1MT3A 4FYXA 4GQBA 4PAGA 2J9YB 4DBVO 2XE8A 1BJRE 2APJA 4MS1B 3ROMA 1ZD2P 3A36A 1BDIA 1ZAKA 4LTMA 3JWEA 4JN6B 5EZYB 3VSDA 3BD9A 4HNVA 3S81A 1IHDA 4KP7A 2HD4A 1VLZA 1A7JA 2V6IA 1MQ8B 4D43A 1HTWA 5KYWA 1DRKA 1MH1A 1V2HE 1W47A 2QRGA 4L72A 5GJVC 3VO8A 1XZIA 2JZOA 4NDZA 2VXCA 4LBWA 1VTKA 2DQ4A 4G63A 2QLLA 1NXOA 3MJRA 5IVDA 1HNWB 2CLEB 1R8SA 2CJFA 3PC3A 1LPPA 1SC1A 3O93A 1BH6A 1HFEL 1ST3A 3FKQA 1RQLA 2BTQB 3DHVA 2JARA 4KC0A 4X9XA 5KMGA 3PDCA 1COWD 1J90A 2NAPA 1AF7A 4DCCA 1N5JA 4WBNB 4NE9A 2QD1A 1N2CB 2BFDB 2YASA 3M7IA 4UBOA 4YDRA 5JNSA 1D5CA 1UT6A 4Q47A 3C6MA 3WL5A 4O0MA 1IAQA 4ZRMA 1B16A 1NVAA 2X9VA 5BORA 1E5LA 1NTOA 3IODA 4H3HB 1FFAA 4FNOA 4C3ZA 2BKVA 2J31A 1QC5A 1DWQA 2BEWA 4TXLA 1N5IA 3JQBC 1IOWA 3O4JA 3ZI0A 1F6BA 4AW9A 4L85A 1LPMA 1MRSA 3HZOA 4WNAA 1P33A 1JJFA 1VKHA 5AHWA 3VKFA 5IXSA 3N2ZB 4ML3A 1MX9A 1E2JA 4QU5A 5F33A 3RDPA 3ZHOA 2J0UB 3PC4A 5B4UA 4PZ0A 4F5YA 1F9AA 3PJEA 2OQRA 2IYLD 1AGXA 3ILHA 3WP0A 2A30A 5CLIA 1H23A 3IT1A 3DW1X 4TZKA 1G8YA 1L4YA 1CHDA 2I3AA 4DL9A 1JF8A 2V6MA 3AJ8A 1GPBA 3UMJA 1N7GA 1GNRA 3ZE6A 4MW6A 3GBSA 1BS9A 1Z6TA 2L17A 4HNGA 2OORA 2AW5A 1O6GA 1R0YA 5A5EA 2HQRA 4NJMA 3LDHA 4RF5A 1QP0A 4ND3A 1JIUA 3QX3A 3KV1A 2ZUEA 2ZYWX 2IQIA 4N40A 4P38A 1TM5E 4B87A 1DQNA 3DPIA 1H6CA 1G8SA 4F3KA 3UYKA 5JMWA 2Y77A 3QF4B 2C2WA 1HYHA 1JYEA 1K63A 3KSRA 4INOA 3D4IA 2OESA 3U3MA 3W2GA 5B6JA 3T38A 1U9JA 2P2YA 5JISA 3C5HA 2EKZA 3H2KA 5KQRA 2JGAA 4H3VA 5B3AA 3KB2A 3C39A 4TQGA 5MN6A 4LE0A 4RSGA 2O3RA 2CHVA 3KQQA 5FNVA 1A1VA 3VPGA 1CQIA 4O2BB 3SXJA 5CA1B 3TIXB 4KXUA 4WKOA 1GARA 2VDKB 3P32A 3DUFA 2XEDA 4OYHA 1IAVA 1C7EA 2O8DB 1C1YA 1I2BA 1L3IA 2TS1A 3DOUA 3UHPA 4PLFA 4YRSA 1YKGA 2MYNA 4G09A 3VU9A 3RYCB 2QR2A 5TS3A 3TTXA 1DXYA 4EZEA 3FSJX 1M5UA 1W1IA 4LIPD 4EMTA 1SVMA 3ETLA 5JVDB 3ZI4A 3BH6A 4PYJA 3AWIA 5LYJA 1Y5RA 2LD4A 3QE0A 4L5BA 2PBZA 4B9AA 1XCGB 1Y7TA 3IAXA 4I4TA 1ZHOA 4OTZA 5SY4A 2H4HA 2NQ8A 3HLKA 2KI5A 3F7OA 1O9BA 4HWGA 4U2DA 1PT9A 4EY6A 1PHRA 3LUAA 3ZDCA 2D3TA 1W2WB 2QAJA 5CA0B 3L4BA 3DVAB 4PSAA 1KI1A 1W5SA 1X0XA 2CLSA 4HDNA 2V3CC 1PSDA 2JGRA 3QHQA 4QYMA 4IZHA 4AP9A 1Z39A 2VDJA 4RTJA 5DYWA 2ZRCA 1BE0A 5K4GA 1MABB 3GUZA 4KN8A 4XB2A 5FOXA 4RY9A 5DNCA 2ONCA 1D6NA 5DM1A 3ZX5A 2DSTA 2QTNA 3E9QA 3K0BA 4IQ0A 4R8RA 5GONB 3R0XA 4ETNA 3ZVMA 4LBZA 4DQXA 2FCRA 3ZWQA 3UMBA 3JQ9A 2YHIB 2IU3A 5HIAA 3HVHA 4QSHA 1SCJA 5ULLA 3H5LA 3NHFA 3ZBUA 4HB3A 4KQEA 4JSTA 4R2IA 4KQKA 1J49A 2IYUA 1NQUA 4HOYA 3EGEA 4JHLA 5AESA 4Q3EA 4AYXA 4RTKA 3DXXA 1F5NA 5C53B 1NW7A 2GDZA 1N0UA 1SUAA 4PAWA 1SCQA 3WIDA 2OMEA 4ZIRB 3GJXC 4QLOA 2O8EB 3X3HA 2WHXA 3AFIA 1EK5A 4CIBA 2ZB7A 1PNVA 2EEZA 1C8KA 4ROSA 5FBKA 1NW3A 4E15A 1BZYA 4O1IA 1Y34E 3HGTA 1GGVA 3FUXA 4Y1RA 1K66A 2YHBA 3MLBA 2D00A 5CAEB 3SSMA 1HDYA 1SXJA 2J41A 2DUUA 4X44A 4IH1A 1HG0A 1P0MA 1T3SA 4LS3A 4PX3A 2XUHA 3PV0A 4B6GA 1M34B 2OGTA 4OYYA 4PO3X 3SR4A 1FFDA 2NO1A 4S1TA 5F52A 1F38A 3CN7A 1EGAA 3JASA 3DMHA 4QEKA 4A2QA 2IP1A 1BEUB 4MWDA 1PBNA 3HZZA 2HDHA 2NPFA 5B58C 3QLEA 5LLDA 3PYMA 2OK8A 1L5KA 1ZN8A 2V7QD 1Z2CA 1AV7A 5CXXA 5TMEA 1F1JA 4FSHA 2AQ8A 1C2YA 3OOYA 4YV1A 2Z9DA 2JAOA 1EUZA 3RU9A 2V0CA 2NZVG 1GUAA 1WDLA 3KB8A 1NZFA 4RL4A 4FI3C 3ZUGA 2RARA 1ZC4A 1UBHS 5KKCA 1SCIA 3K9FC 3JQCA 1WQ1R 1JN0A 1XZJA 1JDNA 1RRFA 3ASYA 5EXSA 3TDMA 4C7VA 3ZDDA 1RKQA 4KWIA 3IV7A 2J3MA 2P62A 3FSGD 2PBRA 5K6RA 1AN0A 3V1MA 4G25A 3TGWA 4DSZA 1L4FA 3GMTA 2QB5A 1IBSA 2IUSA 3EQ8A 4XVUA 1R2QA 4HNQA 4HP8A 2AOTB 3PCTA 1QXSA 4MB6A 3JTMA 1L5SA 1SUDA 1XDGA 2B4RO 4J0DA 1EK0A 4J43A 1NLZA 1W4AA 1EUDA 1FYXA 2W83A 4PIMA 4E12A 2IS2A 1JSRA 1OXVA 2JKYA 2P2ZA 5AM1A 4Z0PA 2I33A 2ZAIA 4E5DA 4QUGA 3MTJA 3VH2A 1Z68A 5CCBA 1H6DA 2V6GA 4QSMA 4P8RA 3KM0A 1I2AA 5LMZA 1JFSA 4LOHA 2CXTA 3ECCA 5CVUA 4U7DA 3P9PA 2GR9A 4REQA 1WD5A 2ZEJA 3PCRB 1VHDA 2QQGA 1ADYA 1K4MA 3EWAA 3RAEC 3IB6A 2QOEA 2EP7A 2O7QA 4X8HA 5DNAA 2J67A 4UMFA 4QXOA 2O3TA 4CM8B 1MABA 3OM8A 4FLEA 4X91A 3D4LA 3G7UA 3GAFA 3L04A 3QVOA 1YRAA 1FEZA 2Q5FA 4OU5A 4RKQA 4HGRA 4BE9A 2QQ0A 2XUGA 4ESVA 1LNSA 1DXQA 1PEAA 3GJ7A 2WPDA 4OK6A 4U8HA 3V48A 1SURA 3N74A 3K4HA 4IRXA 1K75A 5SY6A 4NOJA 4YCMA 5B7GA 5AW2A 3QFTA 5HRCA 1W85A 4BB6A 2H08A 2Z56A 1KDVA 1OXXK 4OCZA 3ZY5A 2BFFA 4M0DA 1MC4A 3A9UA 3IPLA 2UUPA 5GP1A 4ETWA 1KQPA 3OTIA 3M83A 1B15A 3TAUA 2FRDC 2Q5CA 2QRPA 3BTVA 3OQ6A 1WCYA 3KX2A 4JD5A 2PH1A 2OCAA 1FIUA 4MUEA 2ZZNA 1Z16A 3ANYB 3AIKA 1Z0SA 2OYCA 2FAXA 2ATEA 1CDZA 3IYLW 4Y9DA 4I55B 3OMXA 4E4YA 1PO7A 2ZJ5A 5CBPB 3DUFB 1RIIA 1AKRA 1B2RA 1FBTA 3AC0A 1P7ZA 1QFSA 2I54A 1E7WA 3GI1A 1EFVA 2HSJA 3KZCA 4RX1A 1JEAA 4YWJA 3OZFA 4E14A 3L6UA 4Z5XA 2A86A 3LP5A 4H31A 1U0RA 1ADCA 1T2VA 5LKAA 1W8IA 2BMEA 2CYAA 3IUJA 3MF4A 1NT2A 1GPUA 2GARA 1UBSB 2AJBA 3TEJA 3INNA 2QMEA 3DPUA 3HN7A 4AY5A 2FEWB 1U0FA 4IAOA 1L6IA 3HMKA 1G20A 4QQNA 5G02A 4J0QA 4QYWA 1YL6A 5C34B 1NBAA 4UZFA 4K1LA 3KD2A 3PNPA 1VMIA 4WMLA 3DR5A 3D8RA 2E6KA 3CT4A 3BORA 5A4FS 2MINB 1J2TA 1M8PA 3ELUA 4EL0A 1OH7A 4P58A 3KZKA 5JW6A 1Z5UA 3KEFA 2CMDA 1YGYA 3SOZA 3AVOA 2I76A 1RI3A 3F7MA 2OMKA 4IHQA 3BDAA 2B8JA 1ZWLA 4M6WA 2W8BB 3UXMA 1PI3A 1Z6QA 1Z56C 1EMDA 5J4KA 4Q37A 3M5WA 3SAJA 4KBGA 3VSEA 3AR3A 1WABA 2ZSIA 1X7ZA 3JYLA 3S1LA 2DFKB 1II9A 2V7PA 4MYTA 4JVLA 4LDZA 5C5DA 2P3LA 1RTTA 4S04A 2I4TA 3ZVLA 4BLOA 1TKCA 1DKNA 3DBOB 3NXKA 2A7XA 5A9SA 3SQMA 3D8SA 4WK2B 3J81k 2CT8A 4QVIA 1EGQA 3ZGVA 1SZDA 3L7KA 1U3CA 2NW6A 1I1QB 1JA0A 2RHLA 4HH1A 5JMPA 1YR9A 3I9LA 3GLFB 1W0JD 1X1RA 5K6AA 2UZ3A 3TQHA 5AK3A 1DMRA 2RJOA 3UGKA 4TKVB 5ALIA 4EABA 5LQUA 4KNWA 4KVAA 2J08A 2JEOA 3LVRE 3LXRA 4OXYA 3NU1A 4LOAA 4D0LB 1HR0B 4BE4A 3EVEA 4KIJA 4HRAA 1LVHA 4LEIA 4FHEA 5D7BA 1V48A 3D43A 1GJRA 4AY4A 4XWKA 1MB4A 1VJ0A 1W4LA 3UBMA 3KVNA 1K68A 4JU8A 4MO2A 1LW7A 3DL2A 3BSFA 1FTSA 1Y9JA 4ZYWA 2VXOA 3FYCA 3KSDO 1PEYA 1YJQA 1J2JA 4XUGB 1D6MA 4BFYA 2O8EA 5IBPA 2C8VA 1N75A 5AVZA 4M3NA 4YT2A 5A3QA 3EA5A 1P60A 2HDOA 1EFAA 1FDIA 4GIBA 4XGNA 5FFFA 5FYQA 1CQZA 2IV2X 4ZMRA 1RWWA 5FPYA 4LXXA 4R71A 3NASA 1XPJA 3BZUA 4P2GA 2HQOA 2Z95A 2VK4A 2UZ0A 4D80A 2C99A 1PR4A 1YE3A 3TNFA 5BN4A 3CUWA 1NUTA 2W6ZA 5LP6C 2XVYA 1O08A 3IUBA 1UBOS 4JBWA 1S2GA 5SICE 2Q5HA 2PCLA 5AD1A 1GITA 2FZEA 5COQA 4A92A 2G82A 4QA9A 3QZUA 3RS4A 1NQ5A 2QT0A 1P4RA 1TO2E 2YIJA 4ZOCA 4Y2VA 5EIAA 4C07A 1A9ZA 1WE2A 1DFGA 2EF1A 4GEKA 4KDEA 4DQDA 3W5HA 2CD9A 5F2NA 3MUFA 1Q0HA 2P9QA 4Z86A 3ZCXA 1EXWA 1ZM3A 4J49A 2Q4OA 1G8GA 2JVJA 1N5RA 1ZGZA 2FPPA 2M1XA 3B3JA 3HFSA 1D03A 4GLLA 4MWBA 3A4MA 4JODA 1IM8A 4JDUA 5HK9A 2P91A 1AKQA 2XCLA 4QDZA 1A8SA 2W8BA 4YO7A 4IDAA 4NEGA 4RD3A 3AO0B 4PYKA 2FN8A 1SB9A 5FOWA 4TTQA 5ELLA 2XUAA 3IP5A 2XYRA 1SHJA 2L69A 4XJTA 2H3EA 4RZXA 5HTOA 4RHYA 2CL7X 2J6HA 4RPKA 5JWOA 2ZJFA 2ZWIA 3ENQA 3U4AA 3H8WA 4Q3KA 5JIBA 3PJRA 2NZJA 2K6GA 4OATA 3UFBA 3MINA 3I76A 1E2PA 2CWWA 5EMKA 3Q3EA 4HTFB 3C6YA 2CGEA 2PS1A 4A7PA 2PCJA 5A5GA 3FYUC 1NF9A 4CM5A 4O2AB 3I5YA 3B12A 4M54A 1Z0IA 2GYWA 2OYRA 4CHGA 3EK2A 5AQEA 4D42A 3THYA 2GJ4A 4GQIA 5DEIA 1QRSA 4JXKA 2WJWA 4IQ8A 3P45A 1RAEA 4KGDA 2RHMA 3S1AB 1JMYA 2WMYA 2JH3A 2PNFA 2V65A 2BUBA 2YHIA 4MNTA 4MMYB 3CLTD 4C78A 1NDQA 4ZYYA 2XUPA 3GGOA 1K8RA 1CY8A 2X3FA 4JLNA 2JDIA 4I1OA 4UMVA 3VHRA 1J09A 2I71A 5F9HA 2I6GA 1CS0A 3I4FA 1G5QA 1G9TA 4CCYA 5LKRA 4BXOA 5A02A 4RKYA 2QVXX 1T36A 5SYAA 4CNBA 1QRUA 1GQYA 2YHUA 4QUHA 5JAZA 1XVLA 4KSCA 1OD6A 3T1TA 4WY8A 4UAGA 1N2BA 3T5TA 4AMGA 5I4BA 1DARA 2YTZA 2VHYA 3IR5A 2OEPA 3G79A 3QJYA 3VVLA 3R9XA 1CR1A 5D84A 5B3LA 4INPA 2WT4A 4ETMA 2IY8A 4CW7A 4PC3A 4LW8A 1QX4A 1UBGA 1WXEA 3OOJA 4B75A 4CVNA 3IDQA 2ZJ0A 5HQTA 3TM5A 4DR2B 3LC0A 4BP8A 1ZGGA 3LWBA 5JD4A 2DY0A 1EDDA 3L7BA 3SN6A 1MEEA 2OK7A 2BGMA 2F9MA 4L74A 5IZCC 2RHJA 5JSZB 3CTPA 1ZD4A 3AFNA 3Q7TA 2PT5A 4MV3A 2CNDA 2WKQA 3OTHA 4QDUA 1UANA 3TQFA 4EW6A 5JHHB 2SCUA 5C4MA 2EKPA 3RC8A 3WLOA 3N0WA 2C7VA 3HM2A 5DM0A 3A8TA 4EPTA 1VGRA 1G60A 4HDRA 1RRPA 2HL6A 1JYFA 3TSOA 2SECE 1E1QA 1JBQA 1T1RA 1TUBA 3CEMA 3VAYA 3ZV3A 4BEVA 4CKZA 1L9XA 4YYEA 2XYVA 3IKJA 4WY5A 1QQBA 2PRSA 4Q6WA 1II8B 4EO7A 4EI7A 1EUDB 1Y1KE 1A69A 4CCAA 1Y6ZA 3JD0A 4XFKA 2QUHA 5JOQA 1KI9A 1ZNXA 4RD1A 4TKUA 3HN6A 3MQFA 2JHAA 4OUKX 3URKA 2ZXUA 3WNQA 3CLVA 2JFOA 2VK1A 3K0CC 2PWBA 1P7VA 3JX9A 1K27A 1V35A 3LECA 1DVRA 3PNYA 4TXNA 4UDXX 3UAZA 3SBDA 2WKRA 3KTDA 5FWAA 4IUCS 4ALNA 1AMUA 1NDHA 1XTVA 4UDYX 2CNWA 5IKOA 2FUEA 1CF4A 3VC2A 1QO0D 1D4FA 3FDFA 1E3DA 2P40A 1MVNA 1EK6A 1RVV1 2GAIA 3AF3A 1O94D 2XLCA 1R4NB 5AJUA 4C7BA 4DMCA 1ZONA 5DHSA 4D46A 1ORHA 1T4BA 3B70A 3IMCA 5TLSA 4TRNA 3WXMA 5HQ3B 1MDBA 2C4UA 1JFTA 1U02A 2ID9A 3OLXA 4PN3A 1FDTA 2NUPA 2WI8A 5JG7A 5IYZB 4Y9RA 4ZTBA 1IZ8A 5BN4B 1H65A 3KEQA 3HSYA 2GCGA 5HF5A 3VYWA 1P5ZB 2ASEA 3JATB 2QX9A 3PA8A 1NT4A 1R6DA 3KWMA 2Y1EA 4Y6QA 3BK2A 4HDSB 2E4YA 4PHGA 4OQFA 2DRIA 4JLAA 3PRYA 3WB1A 2ZOSA 2ZDQA 2BHNA 5EWLA 1XELA 4IWNA 3ZDQA 1I6MA 3Q6NA 2BRUC 1TLTA 3KQUA 2RE8A 5AOCA 1QWSA 2JGIA 1XMPA 3FZYA 2QNIA 4FOOA 4UUNA 1PE0A 2Q07A 3HPRA 2VT3A 3LCCA 3ZNQA 4X20A 4H2DA 3DCYA 4S2UA 3RUFA 4DY6A 2P9YA 3MAAC 1C3EA 1EGHA 4I66A 4L2IB 5LIRA 2Q1XA 5I7FA 2BTQA 5KMGB 3OUUA 1SCDA 2RSLA 2AD1A 2FUKA 3CRZA 5AJWA 4NECA 2HV9A 5LVAA 3DXYA 4X20B 3TNLA 1WMEA 1YKFA 3I2GA 4GKVA 4K8OA 3L8EA 2PRYA 3L49A 3TIFA 2ZYDA 2B4AA 5HGJA 2CVZA 2PUBA 4OXQA 4PZUA 2WG0A 1A97A 3HKBB 3BL8A 2XUDA 4NKRA 2I78A 5KYWB 3TVTA 2HA5A 3TUIC 4BWFB 5JRZA 2Z08A 3FSGA 2ODWA 1E66A 3KYDB 4XIYA 3UYLA 4F9TA 3UGJA 5A9SB 4LGYA 5G4LA 3F73A 1HURA 1MAUA 2CFOA 1QIGA 2ON6A 2OBYA 4MEJA 1DXOA 2YVUA 3FPEA 2C20A 4G1UC 2AFVA 2NSLA 2O57A 1AK9A 1O58A 3E18A 1OZGA 3QIVA 1JDSA 4AN4A 2VP6A 2HIAA 2V55B 3I8OA 3D7LA 4Y2GA 1CF9A 4GR9A 1VYVA 4N41A 1URPA 4X1YB 4YT5A 1JVSA 2FK8A 5ALMA 4X54A 1SUSA 3ZBTA 5K8TA 5CVCA 1GUFA 4YCBA 5KOJB 3SI7A 3B6EA 5JJKA 2ORWA 1U8EA 3RS9A 3ED5A 2B8WA 5BOSA 3COVA 1N6OA 2GDJA 1P29A 4DT1B 1EESA 2EKQA 5ISMA 3WC4A 1NU8A 2ZK7A 1Z6GA 4BASA 3LG2A 4BLWA 4Y1RB 5J2TF 1B8PA 4BZZA 2HWUA 2IYPA 3KOYA 4QAQA 4XQCA 3FUUA 4DLPA 5KHLB 4A0GA 1VL5A 1WMSA 3PD1A 4NOLA 1X1QA 3KKEA 2FSHA 4B85A 4FJ2A 4EW1A 1Y33E 2JLCA 3VOAA 4BKQA 1QH9A 3QU2A 3E7WA 4Q4JB 5ALJA 4YLGA 2I29A 2G9UA 1NLYA 2PXCA 4JELA 5C31A 2ID8A 1JKFA 3PGA1 4KIGA 4ZGWA 4CMCA 1FFHA 2GF9A 3A4YA 1S02A 2UVQA 4TVSA 2UZIR 2ZJYA 4F11A 4URVR 1NM5C 1L7NA 2W22A 3KZOA 1G5TA 3WLFA 2P2LA 3ZLVA 5F3WB 3PEYA 1JL3A 2A9RA 3D0OA 1VJ5A 1KARA 2VTBB 2PTHA 4QQ8A 1CQWA