3NWOA

Crystal structure of proline iminopeptidase mycobacterium smegmatis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
299
structure length
299
Chain Sequence
SSRTVPFGDHETWVQVTTPENAQPHALPLIVLHGGPGMAHNYVANIAALADETGRTVIHYDQVGCGNSTHLPDAPADFWTPQLFVDEFHAVCTALGIERYHVLGQSWGGMLGAEIAVRQPSGLVSLAICNSPASMRLWSEAAGDLRAQLPAETRAALDRHEAAGTITHPDYLQAAAEFYRRHVCRVVPTPQDFADSVAQMEAEPTVYHTMNGPNEFHVVGTLGDWSVIDRLPDVTAPVLVIAGEHDEATPKTWQPFVDHIPDVRSHVFPGTSHCTHLEKPEEFRAVVAQFLHQHDLAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 113
structure length 299
sequence length 299
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nwoA00
2DHEA 5ALUA 1TCBA 2VF2A 2CKMA 1QO9A 4H77A 3SK0A 5EHXA 2G5TA 4PO3X 3ICWA 2RIPA 4W63A 3R3UA 2J3DA 1MT3A 1E8DA 2XQFA 3GFFA 3OURA 2CJPA 5ALQA 4BTLA 2H7YA 2PL5A 5HZGA 1R9NA 2WG1A 4BRZA 2I03A 1UT6A 1W6RA 4HXGA 1KU6A 2QR5A 3CCBA 2FJPA 5AO9A 4QNNA 2ZJ7A 3WL5A 3QMVA 3WWEA 1MJ5A 2XUOA 3A6ZA 2OCKA 5AI5A 4CIBA 2GBFA 2QTBA 2XUQA 4IQ4A 2WFLB 4Y2PA 2HM7A 3LP5A 3FYUC 4OSEA 1FSSA 2IIVA 4HVTA 2ZYIA 1LGYA 1XLWA 4KRYA 3AIOA 3R40A 1IUPA 3I2GA 1RWQA 5SYNA 3ICVA 1DT3A 2G63A 5ALDA 4E14A 3PE6A 1ODTC 5ALGA 3FWHA 3W9BA 1GZ7A 2XMDA 4AQDA 5AKYA 1XQXA 1B41A 2XQGA 1TAHA 3GUUA 3BF8A 4B9AA 1UK9A 4EY5A 3C87A 5AKHA 1VLQA 5FDFA 3E4DA 3H19A 4H7JA 4TPKA 1ZD4A 2P8SA 2OAGA 3K9BA 2HA0A 1GQSA 2AJBA 5HF6A 4ZI5A 1CUIA 1QONA 3HLKA 4LYDA 3CCCA 2PUHA 1P0MA 3S8YA 1BE0A 3O0DA 3QYJA 4MWTA 1G42A 5HFAA 5ALPA 5F4ZA 2JGKA 3QMWA 1UFOA 1HDEA 5JAUA 1XQWA 1K63A 3C6ZA 3CN7A 1CQZA 3GBSA 1EHYA 1CRLA 5CBKA 2JBWA 1A8SA 4QE3A 3ESDA 4A16A 3S2ZA 1WHSA 3MGAA 1QFMA 1CEXA 2WIFA 3E0XA 5AK4A 3ESBA 3O4GA 3VJKA 1ODCA 1HQDA 5K3CA 2DHDA 4L0CA 3H04A 4Q34A 4Y7DA 3WJ1A 3Q0TA 5IVKA 4BCDA 3I2JA 2PU5A 3WKAA 5DJ5A 2BCEA 3PFBA 3B12A 1ACJA 4Q3LA 2HA6A 4F21A 2V97A 2H9YA 1YB7A 4BE4A 3OG9A 3KDAA 1W1IA 3BDIA 4KAFA 4CG1A 2O7VA 4W9RA 4IH1A 4L72A 1JJFA 5CXXA 4BDSA 5HK8A 3F97A 3D7RA 1HBJA 4UFPA 2ZJFA 2WUFA 4Y2SA 1YA4A 1N8SA 4FNGA 7YASA 2GBIA 1FFEA 1ZGBA 2IX9A 5KBYA 4JEIA 4OU4A 5LZ9A 3C8HA 2Z5GA 1WCYA 1SOMA 3BIXA 2HRQA 4K2AA 3FLAA 4OB8A 5JAPA 3C43A 5JZBA 3G02A 3V1MA 3D5EA 4DLNA 2PM8A 3AZQA 1DQYA 1VE7A 5LKAA 3PICA 4FLMA 4BCBA 1ODSA 1XZBA 4MYDA 2CEKA 2V9ZA 2LIPA 5DYYA 4PNZA 3WZMA 3HEAA 4NVRA 3H2JA 3WKBA 2OG1A 1AMNA 1VA5A 4FFWA 1HPLA 1XZHA 4XJVA 4LXHA 1DQZA 1XZEA 3L1JA 1QIMA 5EIAA 2XMQA 4B7ZA 1XRRA 1GQRA 5C8ZA 4EZIA 3EF3A 5DLPA 1XLUA 1P0PA 5EI5A 2AJ8A 3V1LA 4BAGA 2XUAA 4CCYA 4Z49A 4OB7A 2Y1KA 4AXBA 5BV7A 3ESAA 1MX5A 5A7FA 5FP0A 4I4CA 5DNWA 4H7DA 3VJMA 4KR0A 2ES4A 2CUTA 3O4JA 5EIEA 1R88A 4MQMA 1IVYA 2AXEA 4UBJA 5AI6A 5AIAA 1CUAA 1Y37A 1CUSA 1YASA 5ALWA 3WK8A 3FSGA 3UMJA 1TRHA 1NX9A 5AK3A 2AJDA 5JAHA 1LBTA 4DMKA 1HL7A 5AKGA 3HZOA 1XKLA 2ZSHA 3STWA 2HU7A 2VTVA 2WFZA 2VJDA 3M81A 5LP1A 1QLWA 4C4ZA 4NZZA 1QFSA 5JALA 1QIHA 2PU7A 4MEBA 2QT9A 3SX4A 2O7RA 2VT7A 3D59A 3OC0A 4Y2XA 4CCWA 4BP8A 5BWCA 4YK7A 2Z8XA 4UBKA 1UOPA 4BTVA 4ARBA 1CIJA 3WK9A 2RAUA 3X3HA 1ZGCA 3IDAA 1THGA 1MN6A 2AJLI 4J0KA 1CUJA 1WPXA 5ALTA 3V9AA 3WK4A 3EQ9A 1EA5A 1XZIA 2VA9A 5D3KA 1CUEA 4XIIA 3VJLA 3DD5A 3MVEA 5CT8A 5DNUA 4DNFA 2WHQA 3FBWA 2WG0A 3C6YA 2WU4A 5DTIA 5K3FA 4B81A 2QUAA 2K2QB 1EX9A 1JMKC 1UK6A 2C5GA 4G8CA 3FCXA 4FWBA 3AILA 4KAAA 4G4JA 1H23A 3IVMA 2C4HA 1EDEA 1CUWA 4MXDA 3GROA 2W6CX 3MUOA 2J4CA 3G0BA 2J4FA 4FBMA 4J0DA 3BXPA 5E2IA 2QKYA 3AJAA 4DMHA 3WWPA 4UHCA 1UK7A 4KEAA 1T4MA 4GBGA 4HXFB 5CMLA 1F8UA 4D9JA 3OOSA 3IULA 4ZWNA 3V1KA 3WIBA 4TGLA 4MYSA 5BOVA 5HKAA 2QZPA 3DDUA 4INZA 3W05A 1U4NA 1CUCA 4PSDA 1J2EA 1USWA 3M83A 1VZ2A 1YR2A 2H7XA 3M82A 3PDCA 1Q0ZA 2V96A 2XMBA 3H2GA 2QJWA 1CUUA 1GPLA 3DKRA 1O6FA 3STUA 4BVJA 3ESCA 3WIOA 5I8PA 2XUFA 2XUHA 1W4LA 2GBCA 4WDRA 3I6MA 3WYNA 2GYWA 4N5IX 1GGVA 5JAOA 2WIKA 1EB8A 5E4JA 4BE9A 4X7BA 2EDCA 4UUQA 4OU5A 3RARA 1XZLA 5LLSA 1AC5A 2ZJ6A 3NUZA 2OQVA 1QIKA 2XI4A 4X93A 1X70A 2Z8ZA 2Z3WA 5A2GA 4IHAA 4H7KA 4RGYA 3FAKA 3RKSA 1AUOA 4RE6A 3G9ZA 1DU4A 1R9MA 3DEAA 3IUNA 4WJLA 1O6GA 5EIHA 2H7CA 4G9GA 4UHDA 5ISMA 1LPBB 2HA4A 3NWOA 4GECA 5AI0A 4XX1A 1I6WA 4WFJA 5AK5A 3A2LA 4DNQA 2GZRA 5AKKA 1FFDA 4FOLA 2ONCA 2B20A 3SC2A 2BKLA 4BB0A 1U65A 1C7JA 3FVRA 1QTRA 5YASA 1CUHA 2XUGA 3KOOA 1H2ZA 5HKBA 4XWGA 1H2XA 3O9MA 3WKDA 1Q84A 5T4HA 1XRMA 2PBLA 1WOMA 3JYHA 1JFRA 2ZSIA 2XDWA 1A8QA 1GKLA 1XZAA 1ZD5A 5AK6A 4U2DA 3VVLA 1ISPA 1VJ5A 4RPCA 1XZJA 3IUJA 3LIPA 2QUBA 4X90A 1MNQA 4FFVA 4H35A 3NOXA 4Q3KA 5CT9A 3K6KA 1CUGA 4M0MA 3VDXA 4X6XA 1DWPA 1RYYA 4BC1A 4KE7A 4AMZA 1MU0A 2X8BA 2HDWA 2ROQA 2CBGA 4PSCA 5CH5A 1J06A 5LZ2A 1T2NA 5KWJA 1MAHA 1QGED 1ZD3A 3L1HA 5CXUA 1GPNA 1ZD2P 1HLGA 4DSZA 4J7AA 3DOIA 4DNPA 2X76A 2GYVA 2Z3ZA 4EY4A 1L7QA 3WL8A 4CFSA 5HF8A 5AI9A 2C5FA 1JI3A 1LPSA 5CTAA 4B84A 2WM2A 1UK8A 4Q1VA 4LXIA 2EEPA 3I1YA 4W1SA 4GEGA 2G4LA 4MJ3A 2VJCA 4C4XA 4N5HX 4HRYA 5CURA 1ZOIA 1CUFA 5A71A 1K6EA 4V2IA 4EA6A 4TVKA 4FHZA 1EI9A 1Y7HA 2XMCA 4QLAA 5D7BA 1BN7A 4KE8A 1EK2A 2PVSA 3G0DA 2WQZA 4CG3A 2FX5A 1JKMA 2OCGA 4GW3A 5CT4A 5AM1A 4C01A 1E3QA 3KWJA 4X71A 2OPHA 2ZYHA 3R3XA 1QIFA 2QXTA 1YCDA 5CH8A 4G4IA 4E15A 2BAGA 4HAIA 1F6WA 2HA5A 4HRXA 1TCCA 4BDTA 4L9AA 1QOZA 2WJ3A 5JZSA 4AO8A 2JGJA 4QDOA 3GA7A 5D6OA 4HXEB 4W1QA 2HL6A 2B61A 5JASA 2ZVDA 5AKZA 2HA3A 4J0CA 1CUXA 5ALIA 2RI6A 3O9VA 1WB4A 4B6GA 4Y2RA 2B9VA 4F60A 5AICA 3VISA 1QTIA 5T4BA 3O4HA 2OQIA 2ACKA 1CFJA 3HYSA 4B82A 2G5PA 4GHWA 1MX1A 4EBBA 1ZICA 2XLCA 2R11A 1LPAB 3I2HA 3F96A 4E11A 1CLEA 3ANSA 4RE5A 3RLIA 4YPVA 3EQ8A 3WKEA 5JADA 3HSSA 4WY5A 3HXKA 1LPNA 5J3JA 1ZI8A 4B0OA 2DQZA 4A5SA 5LZ7A 4CIAA 3WJ2A 1DX4A 4G1FA 2BGNA 5ALJA 1PJAA 3I6ZA 1CUVA 4XVCA 2RHTA 3HABA 1UKAA 3D3NA 1ZJ4A 1R50A 4UPDA 4AZ0A 4C89A 1WM1A 5HK9A 3QITA 5CW2A 5FLKA 2XQIA 2BUBA 2PSFA 3AINA 2WIGA 2W22A 4PV7A 3R3ZA 3R3YA 2I78A 1NU8A 2Y2VA 3PFCA 3Q8WA 5BWBA 5E4TA 3ZWQA 3QM1A 4J03A 4OYYA 1XZKA 1WB6A 4UHEA 3ILSA 1GPKA 3N2ZB 5LIPA 3UUEA 1GKKA 4Y2UA 1XRPA 3F8SA 3ZV7A 1F0PA 1XFDA 5FKJA 4N8SA 1SCQA 4OUKX 1CUZA 5AM2A 3M3DA 2Q0XA 3G9UA 5ALSA 4X6YA 2I3DA 2DSNA 1XRLA 4UBMA 1JMYA 2DCMA 3LS2A 4YX9A 2PPLA 4Q3OA 2VEOA 2C58A 5FPQA 4N8DA 3T4UA 1YSCA 3H17A 1XZDA 4JH0A 4H7FA 5C8VA 2QOEA 1QIDA 2QMQA 1MTZA 3AFIA 4X92A 5JZ9A 2HU5A 1WB5A 4HS9A 2YYSA 3KD2A 1XRNA 1ZI6A 4DNOA 5JARA 4AN1A 4CCYB 3KWFA 4DIUA 2PKYX 4GWLA 1Z68A 3FYUA 1G66A 4Y2JA 4X94A 3O95A 2Y2UA 4B80A 2ECFA 4I3FA 1G4HA 4ROTA 3TRDA 4EY6A 5AOAA 1PV1A 1W52X 2ORYA 2BGRA 4IH9A 4AMYA 4YASA 1CPYA 3DYIA 5K5EA 1TQHA 3CXUA 4G8DA 4X85A 3WKCA 2WHRA 2OGTA 4FLEA 5FUMA 4B0PA 3G0IA 1ORWA 1AKNA 3RM3A 4BC0A 4LIPD 5EFZA 3WI7A 4AB1A 1N5RA 5DYTA 2JIDA 3WQHA 4F5ZA 3F67A 1LBSA 3FLEA 4W1PA 1KU0A 4KRXA 5HFNA 4F0JA 1UOQA 4L3WA 1CQWA 1U8EA 2WIJA 1VOTA 4UHHA 4OCZA 1XLVA 2ACEA 2NW6A 1H22A 3WK7A 4BAZA 4EHBA 1TK3A 4AZ3A 4FLFA 2QVBA 1OCEA 2H1IA 3PUIA 4B85A 1N1MA 2VJBA 5AM5A 4BVKA 2I3ZA 4EY8A 4MWSA 1ZJ5A 3G0CA 3YASA 3F9CA 2WTMA 1DWOA 3STXA 3DL7A 3WA6A 5AM0A 1ZIXA 5AP9A 4BATA 3QPDA 4ETWA 5K3FB 2O2IA 1FFAA 2OGSA 5ALYA 1H2YA 4FKBA 3U1TA 2FJ0A 5AM4A 3QBJA 4IO0A 3A2NA 5AI4A 1TCAA 3GELA 1E5TA 1LZLA 2JEYA 1JJIA 1JT2A 3IBTA 4LHEA 1BRTA 4BBZA 1BEEA 5ALRA 4K6GA 5DYWA 5C81A 3R3WA 3AZPA 4U2EA 3DNMA 4FMPA 4G9EA 3W9UA 3KSRA 1XZCA 3WWDA 4LYEA 4GI1A 5I9IA 3C8DA 2PSDA 1EVQA 4PQEA 5HQ3A 1BEZA 4UBOA 2YH2A 4FDMA 4X91A 1UWCA 3R0VA 4P08A 1OILA 2XLBA 2AJCA 4HTAA 2OCIA 1SCKA 3WWCA 4BP9A 5C8XA 2C0QA 4S0XA 3LCRA 2V98A 4GXNA 1QIIA 2JGMA 3AIKA 1LPPA 3OPMA 3SWWA 4RNCA 1SCIA 3A70A 1QE3A 3WZLA 3P2MA 2WUDA 3F98A 2FUKA 4OD0A 1AX9A 1YB6A 5ALHA 4JYPA 4QWWA 4J0GA 2HFKA 2JGEA 3R3VA 3FLBA 2WUGA 2XUKA 2WJ6A 2WKWA 4OPMA 4EB0A 2XUPA 4HZGA 3B5EA 2YXPX 4P93A 5IH7A 3CN9A 3TJMA 3D0KA 5K3EA 3LLCA 1SFRA 5IVDA 2WHPA 1BS9A 3ZLUA 1YA8A 1PFQA 1R4ZA 1Y7IA 2C7BA 2WUEA 5A6VA 5IVHA 4QZVA 5LYYA 5AKJA 1EXWA 2HRRA 4NS4A 1UOOA 4H0CA 4LKOA 2JGFA 5HF5A 1KEZA 2HIHA 5H3HA 3R41A 2BUAA 1VXOA 4UBNA 5CH3A 1DTEA 5HF9A 3I2KA 2D5LA 2X5XA 4BAUA 3WA7A 3PF8A 4P9NA 1TKRA 1E8NA 3HI4A 4H18A 4KE9A 5ALVA 2BFNA 2HFJA 2WHPB 2XMZA 4DYHA 4ZGBA 4DTCA 1EH5A 3FVTA 2WIDA 4QDTA 3BWXA 3AZOA 3KXPA 5AIBA 4C4YA 2XUIA 5FPPA 3WK6A 4MEAA 1VKHA 4AO6A 2VAXA 1FFCA 1IZ8A 2IITA 2VJAA 4AX4A 5DNVA 4M0EA 5ALEA 3D2AA 1BCRA 3PUHA 1CV2A 2CZQA 2XMSA 4CI9A 2XE4A 3C5WP 3L1IA 1J1IA 4H7EA 5K3AA 2R8BA 1C4XA 3ZLTA 4UBIA 4BYMA 5EHZA 4DMFA 1A7UA 1ACLA 2GYUA 4N8EA 5LZ5A 3D2BA 5AKEA 1XQVA 3DJYA 3U0VA 2XQJA 5CRIA 3AIMA 1LPOA 3EBLA 4ZV9A 2PSEA 1SC9A 4Y2TA 2ZYRA 2VATA 2QXUA 1LPMA 1H2WA 2RGUA 2D0DA 5HCUA 2HA7A 1ZI9A 5K3BA 3IURA 2ZYSA 3ZI7A 5AOBA 5FOQA 3UUFA 3FSGD 2XMGA 1LNSA 1MPXA 3STYA 2HA2A 4FBLA 1S8OA 1JU4A 4KE6A 3BJRA 4Y2QA 3BF7A 1WHTA 5JD4A 4DSAA 3DQZA 1EB9A 3I28A 5ALKA 3WL6A 3BIWA 4QLOA 3B3QA 5EHNA 4P92A 4Q05A 4BRSA 1QIEA 2VQ6A 3W2TA 2E3JA 2QS9A 3DCNA 4Y9SA 2OXEA 1AQLA 5A62A 4NMWA 2QJRA 1BROA 4KYVA 1P0QA 4QWMA 5LZ8A 1YAJA 2RONA 2VT6A 3AUKA 4PW0A 4U2BA 1B6GA 3G9XA 5ALLA 2XUDA 4WFKA 1XROA 1IMJA 5ALFA 2PSJA 4QEKA 3I2IA 4O08A 4I19A 2GBGA 3BE8A 3LIIA 4M0FA 5AH0A 4A23A 5JATA 3WK5A 3ZLVA 4B83A 1E89A 3G8YA 2DR0A 3DKKA 3BL8A 1XZFA 3D4LA 3DOHA 1GT6A 1X2EA 3IUQA 3W04A 5AM3A 2PX6A 5LZ4A 1IUNA 1YS2X 2CMFA 3V1NA 4BCCA 4E46A 4IH4A 3QMMA 1LLFA 3OM8A 2OGZA 4GDMA 3OTQA 4DGQA 5LKRA 3QVMA 5A7HA 4J0IA 1UZAA 5FV4A 5KWIA 3EIOA 4J0JA 1THTA 4PF1A 2B4KA 1AURA 3DL4A 1E66A 1WPRA 4FTWA 1UKCA 3JW8A 2EDAA 5C7YA 4U2CA 3ANTA 4Y2VA 3ZPXA 2JGLA 1UXOA 1DINA 5CT5A 4WFIA 2DQYA 3O4IA 4JYMA 4WY8A 1CUDA 4H7IA 3STTA 4BZWA 1LZKA 4J0HA 4KAJA 5D3ZA 4WCVA 5A7GA 4X3CA 2Y6VA 1BCSA 4DM7A 1FJ2A 3V48A 2WU3A 4G8BA 4KJXA 4X97A 2HHAA 4J3JA 1X2BA 3H18A 3FOBA 3QPAA 3DS8A 1U2EA 1VXRA 1QIGA 3QPCA 1W75A 4QDUA 1K4YA 4CG2A 3JWEA 4EY7A 3BJMA 5ALNA 1OXMA 4UBLA 4QDXA 3A2MA 3C6BA 2WTNA 4X00A 2WFMA 1L7RA 1W76A 2CB9A 3DLTA 1EDBA 2WJ4A 2O2HA 2XUJA 2XT0A 3H1BA 1GXSA 4OYLA 2QM0A 4G5XA 1IZ7A 4X95A 1MX9A 4X6UA 2OAEA 1HKHA 3H0CA 5CT6A 3BDVA 4FNMA 1CUBA 1RP1A 1QJ4A 1VA4A 3EQ7A 3W06A 1JU3A 4AN0A 4EUSA 4UFNA 3VXKA 5JANA 4Y2YA 1CVLA 1EK1A 3D2CA 1M33A 2QRUA 5IKXA 4MQLA 3FYUB 6YASA 1IUOA 3IA2A 3C6XA 2JF0A 5IVIA 1XRQA 5AHXA 3HRHA 4Q82A 3TGLA 3C70A 3I2FA 2OLEA 3GZJA 1ETHA 2PSHA 3H2KA 3HACA 5JIBA 1CUYA 3WWOA 4OB6A 2RHWA 3FCYA 2BJHA 4WDQA 2HADA 5ALXA 1JJBA 3K2IA 1Q83A 3H1AA 4U2FA 3DYVA 3WMRA 2C0PA 4QDZA 2WLSA 3I6YA 1VE6A 4K6KA 4KACA 3G7NA 3HC7A 1EDDA 4K6HA 1C7IA 5SYMA 5JD5A 1DX6A 1J07A 1UKBA 1YS1X 3IB3A 3IUMA 1XKTA 2XMRA 3VKFA 2XB6A 2VSQA 4K5QA 1XZGA 4QA9A 5AJHA 3WYDA 1BU8A 1AZWA 5T4EA 2WSLA 1MAAA 5DTJA 4C6HA 5KREA 2UZ0A 1E8MA 5DWDA 2OCLA 1QZ3A 5JD6A 4LXGA 4H7HA 1ZIYA 2Y6UA 3NGMA 4ZXFA 5EHQA 1AGYA 5AKIA 3H2HA 1FFBA 2J3QA 1R3DA 2BUCA 5FXMA 4C87A 3G9TA 2JEZA 1K8QA 4W1RA 3VVMA 4B9EA 2XQKA 1MNAA 2DHCA 5ALZA 1DWQA 5I7UA 5AOCA 1F0NA 3C5VA 4G4GA 5AKLA 1N5MA 5EGNA 4AO7A 5E4YA 5T4FA 4C88A 2PUJA 1XQYA 3IIIA 1QO7A 5ESRA 4U2GA 3PF9A 1QIJA 3E1GA 3HJUA 1TIBA 1DT5A 2WILA 4JNCA 1EINA 1ORVA 2HU8A 3H2IA 2WG2A 1XZMA 3T52A 3FNBA 5FRDA 3I1IA 4JUIA 4ZV7A 4ITVA 4ZRDA 3MUNA 3E3AA 4UFOA 3TEJA 1A88A 1D07A 3QZUA 3RK4A 1MO2A 1YAHA 2DFPA 5ALMA 5K3DA 3G0GA 3STVA 1EVEA 5JYCA 2O2GA 4DMCA 4BVLA 1NU6A 1CR6A 3FYTA 1P0IA 2GZSA 5HQ3B 3QH4A 4UHBA 1VZ3A 1G5FA 4GLBA 3WLAA 3ED1A 4PSUA 4ZREA 1BN6A 5AI8A 2VAVA 1A8UA 5ALOA 1Q0RA 1L7AA 3PI6A 5AKXA 1K5PA 4UHFA 4BZZA 2YASA 3N0TA 4ARAA 3WL7A 2JGIA 3C45A 1R1DA 2WFLA
chains in the Genus database with same CATH superfamily
5K03A 4CMCA 3GC6A 3G5UA 1JHAA 2BCGY 3EGCA 4J6FA 3KP1A 1RTKA 3HXPA 1RYHA 1USIA 2GOYA 3MSXA 3R20A 4QVKA 1IBLB 3JAWB 4QATA 1IM5A 2HRBA 4Q39A 4WXYB 1AKRA 2NVUB 1E6KA 2W8ZA 4EG0A 1H9BA 3SK0A 4S1OA 5BOSB 4WV3A 4KR7A 1ZBDA 2AQ8A 3EA5A 1IJKA 4QGFA 3F8TA 1TYZA 1Q0PA 4YAIA 3ICWA 4GOOD 2CXHA 3EIFA 3M8KA 4P7KA 4J4TA 3SLKA 3ZWYA 5EEGA 4MDHA 3U44A 3DLBA 3EN0A 3R3UA 2J3DA 1MT3A 3KZOA 5DOVA 3CEMA 3GFFA 2B7CA 3CRVA 3UAXA 2C83A 5ESDA 5ALQA 3DMNA 3V34A 5C1DA 2H7YA 3OE7D 3BZBA 2HJHA 4RD6A 3TW4A 3GLIA 4G5GA 4P33A 5JZMA 4PZYA 4TTJA 2QJFA 3LY5A 1D5WA 1Z6TA 5JC8A 2NUAA 1UT6A 2OB2A 4WCFA 1Y8ZA 2VOJA 5T7BA 3D4OA 2PMWB 3JQRA 1FRQA 2MMCA 1L7EA 3IE2A 2JIRA 2ZITA 2RKWA 5AO9A 4MRPA 2VBCA 4ZI3A 1MJ5A 2XUOA 3LL4A 4ZO7A 1BMTA 3UWPA 1K7FB 2X40A 2QMOA 2BH9A 4GMDA 3R0ZA 1L3BA 1JXAA 3KZMA 4EYOA 3EPPA 4MKHA 2VPIA 4DG8A 2QTBA 2C2KA 1QZXA 2XUQA 5M5BA 4ZOQI 3KEGA 2ZYGA 1U0LA 2Y1FA 4FMBB 4BYGA 1RXWA 3NT4A 1V35A 3ILVA 3BK1A 4BKRA 5JCZA 1LNQA 1M0TA 3LP5A 1CJBA 2X5NA 1ZU4A 4F91B 1Z0KA 1KO1A 2GKSA 3NYQA 4L08A 4M9CA 3DLAA 3A3YA 5DRYA 3X1WA 2IIVA 3DM9B 2RFLA 4HVTA 1G21B 3ICOA 3ITDA 4LBYA 3CVUA 1ODKA 3HYLA 3V4RA 4BMCA 1RWQA 5EXDA 5GONA 3TL2A 3AT1A 3SQXA 2XYRA 3FI9A 4YP6A 1P1HA 3EVNA 3UWOA 3KOZA 3AKDA 3HBAA 5A3VA 2AC2A 4E14A 4Q3AA 5EEHA 3TB4A 2IYEA 1WA5A 1ODTC 3PE6A 2VDNB 3PRKE 1E2NA 4JLKA 3FJOA 1X80A 4JZYA 4PAMA 2H2WA 4MAAA 1Y6QA 3LVRE 5ALGA 1TUBA 2DECA 1DTWA 2X1LA 3NOOA 4HCJA 3U4AA 4EPWA 2ZK7A 4UVHA 3UGKA 1YS9A 3DOUA 5BN4A 1D6MA 1QYVA 2IP2A 1BH6A 3EFOB 2F8MA 3PDUA 4MDYA 2CYCA 4O0MA 4OJNA 1R8QA 5T3UA 4IX9A 2Q1XA 4ZEOA 1EM6A 2ZI6A 3DAFA 2GT1A 2NSJA 1YC5A 2QTWB 2R3SA 3BWMA 2GLXA 2PGIA 4DLAA 3FPLA 4TWRA 5BRNA 1ZCJA 2EP7A 2KHZA 2WSSA 1QO0D 4NCHA 2BLNA 4MVJF 1YIOA 5AMXA 1TAHA 3KVYA 3AYZB 3GZ4A 3GUUA 4B9AA 2QL5A 4F1JA 4EY5A 2QJOA 4M9QA 1Z5VA 1ZN9A 2C8LA 2O2DA 3UB4A 1PLKA 1CQJB 3L9WA 2AYXA 4O4JF 3ZVRA 2R7AA 1NG1A 2VQEB 4NWIA 1A2QA 2EYQA 4H7JA 4PCVA 4OGWA 2CNLA 4R1UA 3LBIA 1Z7GA 3DD1A 2IZ1A 4MQ6A 2OAGA 4CF6A 5CX4A 1O4WA 4K0KB 4C22A 1STOA 1IPFA 4S05A 5EPEA 3ONEA 1N3IA 3WLOA 5DVZA 4DZZA 3FFAA 3FZNA 4WLFA 4A0SA 2IP4A 2QDXA 2Q4OA 2CVQA 2AJBA 5AJUA 5IU6A 4QUAA 3UWDA 2CFIA 1BCRB 1CUIA 1ZGAA 3C8UA 3FUVA 3R09A 2QRQA 4LYDA 2R47A 1GTL1 1ZUHA 4B2PA 5FBWB 2VT2A 5AVRA 3TF5A 3QQ5A 4B6PA 1L4MA 1LVHA 1IULA 2W6IA 3CTPA 2ZTLA 4KXNA 5FPKA 5JY1A 2FVXA 3QYJA 1Z15A 5LQCA 4X62B 3RRZA 4I6GA 2ISSD 4MMXB 4BKOA 1L5HA 4MHOA 4NFSA 2BKVA 1TJNA 3M6WA 4R2HA 1CE8B 2FSPA 2PT6A 4PX9A 3ELDA 1HDEA 4QNRA 4TRMA 5A9SB 4BQOA 4N76A 2AS0A 4FMCB 2HJGA 4LDJA 4RVNA 4AF6A 1TOAA 1LC0A 3DHYA 1XQWA 3C6ZA 3CN7A 3DULA 1LK0A 4H1UA 4N03A 4OHPA 3V7YA 3TVDA 1YJAA 4LEIA 2QL7A 4MA0A 3E81A 1N9ZA 3LUDA 5D6NA 5IUJC 1SVWA 3GBSA 1K06A 1EHYA 2Q0QA 5KNBH 4YXWA 4R9SA 3FWZA 1U8YA 3NDIA 1N7IA 2JH3A 5IBRA 1N2CB 2VDMB 3RYFA 2X5JO 4C6SA 3QI7A 4RHCA 4N5NA 4XTCS 1TAGA 2Q5LA 4OXYA 1RWNA 2GD2A 3DAYA 3S2ZA 4G84A 3ZCQA 4ND2A 4LDZA 1QFMA 3FPHA 4Y1RB 2UYGA 3NU1A 4LRUA 5FI1B 4YPFA 3TMKA 3CLTC 5FI3A 3ROZA 2YY7A 2B9EA 3ESBA 3R4VA 4EB6A 4UDNA 5C7LO 5AVXA 1PYDA 3THRA 5SZHB 3BE6A 4KQ6A 2Z98A 4YI3A 1RLIA 4JK3A 2AH5A 1GSOA 4OJMX 5A6SB 3T61A 4L0CA 3COPA 4OMCA 3DB1A 2ZZKA 4XD7A 4F9TA 2OCXA 1XMIA 3ZCUA 3PLNA 3RSQA 2WMDA 2GFHA 4DN6A 4QJ3A 4DDVA 1FS4A 4NJOA 3WJ1A 2RB4A 3K5HA 3Q0TA 3EIWA 1PK9A 2H1FA 1SZPA 3UHJA 1PQ4A 2IU3A 3GBPA 3NPAA 1RPNA 5HCNA 5J59A 3AHFA 3V7FA 3VOTA 4EJ6A 2BCEA 4UEWA 4ARVA 4Q3LA 1N8NA 2HA6A 3O6VA 4KKXB 2X14A 3R6LA 4G1UC 4INOA 4KU4A 5EJFA 5IJ9B 4RXMA 3C4VA 4MKRA 5BR8B 5KNLA 3IKLA 1KI8A 3KYIB 3UAVA 4AUKA 1QFXA 3SHVA 3OG9A 4KKVA 2B34A 4AICA 2IEAA 4DHWA 1GG8A 1NULA 1PTJC 1W1IA 4H6PA 4NOKA 1XEXB 1J49A 2UUBB 3SJCA 2TECE 1JNXX 4IQFA 1NIJA 1CCWA 1GNTA 2FAXA 1LQUA 2KQUA 4UUAA 4BNHA 3MINB 9ATCA 2P90A 5BSKA 2HU2A 3RKRA 4YQYA 5F9HA 1MJHA 1HQKA 2BMFA 1HDGO 2XMPA 1CRQA 1HBJA 3GZNA 1R6AA 3M3HA 1D2HA 3CKYA 2GPYA 1GR1A 3FFTA 2MJLA 2I1VB 3NPMA 4IAOA 5BNIA 3RUIA 4CM5A 3DDOA 1F7VA 2FPIA 1DIRA 3BMCA 2AYZA 3V4FA 1KBQA 3LGXA 4KR9A 2ODWA 2UZ4A 1YA4A 3JQBA 4INPA 5CFLA 1N8SA 4LVNA 1DKMA 2RDMA 3OKFA 3ZIDA 1ZGBA 1P7WA 1LSOA 2C5EA 1BDBA 4HLCA 1YL5A 5HA5A 3MOGA 4GU5A 4EPXA 1QUFA 3KHKA 3V1TC 2CHVA 1DMSA 1ZFNA 4M9ZA 3IPXA 3AMVA 2VQDA 3JYOA 5LZ9A 4PX5A 5HOEA 5FEMA 2Z5GA 1YKFA 2HNKA 3SF0A 3ZGLA 3PWZA 4XTRA 1T1EA 1P9LA 4X54A 1KVUA 2UVDA 2LVBA 1EZZA 2WP0A 3ZJVA 2RH8A 4ABYA 2VFAA 3FLAA 4OB8A 1WMSA 3TLGA 4AKEA 4UTVA 2HMYB 5JAPA 3Q7IA 3C43A 16PKA 1VMDA 2EWWA 1FYWA 5C3UA 3KE8A 2YRFA 3D5EA 3BXHA 3GOQA 3ZGVA 4EABA 2GM9A 2VJNA 1IEXA 5GTDA 3Q6NA 1QXSA 3AZQA 2E4YA 1H4VB 5LKAA 3C0KA 2WU0A 3P4UA 2R48A 4BCBA 1RACA 3IJPA 4UMFA 3OO0A 5FTLA 4ENTA 1YFJA 1XU7A 2FN9A 1ODSA 3DE1X 1VBMA 3ETNA 4JT9A 1ZLYA 1NBOA 4C0LA 1TIKA 3A6LA 1XG5A 2V9ZA 4LHZA 4EK9A 5E3IA 3VHXB 2DBQA 1RQGA 2I8AA 2IA5A 2LIPA 3FPCA 3IHKA 4IIXA 1MXFA 4R1MA 4IFIA 1D03A 2GZHA 3HEAA 3WLSA 1SK9A 3ILXA 2R66A 1ZMTA 4QGBA 3WKBA 1QF9A 1OWPA 2OG1A 4JXJA 3SSMA 1A82A 1VA5A 4FFWA 2R1TB 3QOFA 1UJ6A 3EOZA 1ZN8A 4QTTB 5FCDA 3UO8B 3VR1A 1PDWA 4HO1X 2W2LD 1C8LA 3PEUA 3UC5A 3L1JA 2ERCA 2YS6A 3DDSA 2FPPB 3BH7A 3GJ5A 3M0EA 1OTYA 2EAUA 1TT5B 3RVDA 1QAMA 2X3FA 4R9NA 1U4SA 1UCFA 3KKMA 3L40A 4B7ZA 4RZ3A 1RAHA 3GVHA 4WEOA 1SGWA 4PICA 4Q48A 121PA 3NAGA 4PXYA 5C8ZA 1V8DA 3L43A 3I76A 5DLPA 3Q2IA 2ZBUA 2P79A 3PPWA 4LZNA 1UC9A 3ZDDA 1XLUA 4GXRA 4UUMA 2YWCA 2VRNA 4QVGA 2VSFA 5D85A 5TE9A 4Z9AA 1FXWA 2CHFA 5AHOA 3AHHA 3QPBA 4YALA 4CEJB 1J8DA 1URPA 3BBPA 3PNYA 1WZIA 1ZK2A 3H1GA 4GFDA 4S24A 4BAGA 2HHHB 1BG6A 3QE4A 4Z49A 3Q3HA 3UJPA 3RJ9A 2Y0DA 5BV7A 5DIFA 1QU3A 4MMZB 3GJSA 5FP0A 1SPXA 1IPHA 4TS3A 2L2QA 1MTOA 2PKXA 4I4CA 5DNWA 1HT0A 3EW9A 3SZUA 4B48A 4NE2A 2VPXA 3A4VA 4YJHB 1IM2A 2JLQA 1VBNA 4OAPA 3IP1A 1ID1A 1X8XA 3EGXA 1E1LA 5G4KB 2NACA 3WQRA 4WADA 4A0HA 2QA5A 2SKCA 3B8HA 3WGIA 5BMVB 1MRZA 3DO5A 1CIVA 1XAGA 5AI6A 1OH7A 5AIAA 4EQ6B 4JQSA 4Y6PA 1Y37A 5L3SA 1CUSA 1VHWA 5ALWA 3D3QA 4UAJA 5FOVA 1X7ZB 1YDFA 4RMJA 4J7CA 2OUKA 3RKUA 2PH1A 1NX9A 1NVGA 2VF5X 4JLVA 3QNMA 2YX1A 3PLRA 2B4RO 4E2FA 5JAHA 4XSVA 1J5EB 4PBRA 4GX5A 3LRTA 1T24A 4UW9A 1JLKA 3HPQA 4ML3A 3ZXUB 3N2EA 1LBTA 1UQRA 2ICAA 4WZAA 5AKGA 1I7NA 3NKLA 1A8PA 4LDRA 1P7YA 2JI6A 2VJLA 3HZOA 4XGIA 2BY4A 4KMSA 4N18A 2ACVA 3WOHA 2XODA 2RH5A 1YL6A 4Q01A 2QL6A 4NG5A 1E3WB 5BW6B 2H4ZA 1MABB 3TLKA 3QE0A 3DHNA 5DI9A 4ND8A 3UIEA 1CT9A 2WNSA 1NE2A 2V5VA 2A2ZA 1QLWA 3U17A 4AXXA 5JDCC 3DZFA 4AWBA 1QHEA 1O58A 4X65B 4JKIA 5JALA 4KODA 1L9XA 2PU7A 4D57A 4KDRA 5H83A 1J8VA 1YHZA 2O7RA 5JS1A 4NDNE 1T5HX 4NOLA 1L2TA 1OU0A 2ZUWA 4RY0A 4AECA 1Y9JA 5BSWA 1WBBA 2HLPA 2WPNA 4WKOA 4XGKA 821PA 3L7BA 5HXAA 3Q9LA 3QLUC 1D2EA 5BWCA 1L4KA 2Z8XA 2QG6A 3D6AA 4UBKA 4D9KA 4LZOA 2J0UA 5E6UB 3FYDA 4OM8A 1UOPA 2EFDB 3MD0A 1LVGA 3U2QA 3U26A 2C2BA 2IT1A 3QELB 1KERA 2X8AA 3UUWA 3WK9A 4EJSB 5IBQA 2H2IA 1GQQA 2F43A 3GRVA 1THGA 3D4BA 1JA1A 4QQRA 2GA9A 3TJRA 1YTUA 1PWZA 1PZFA 1XQ9A 2O1EA 1GPJA 3T7TA 3WK4A 2A0FA 3A7EA 3EQ9A 5EJ9A 1XZIA 3NBAA 3W2FA 5D3KA 2UXBB 1D9XA 2M6SA 1PEKE 4L5YA 1XDGA 3VYUB 1P9WA 2G9QA 4K9KA 1HDXA 1YNSA 2J5XA 4WACA 5IN5A 2JASA 4XIIA 3UBMA 2JKVA 1O5IA 3NVMB 2HWXA 3U09A 4Y1FA 2CHUA 4X64B 1RI3A 2IKSA 2Q9UA 1IM8A 2R00A 4G65A 4Q3CA 3TK1A 1BC5A 3U9TA 4DG9A 4DNFA 3JR3A 4HGOA 3S1SA 3NBFA 4K9DA 3K72B 2DFLA 3JSXA 1MW9X 3FRHA 4E30A 4BWGA 3H7IA 4WESB 2OZVA 2H63A 1QCCA 2O2CA 3AM4A 3ON5A 1GXSB 2I7DA 1FVXA 3A1UA 3RUHA 1M1YB 3N3AC 2W8BB 4R84A 3U48A 3I32A 2JNWA 1AQNA 3S1AB 4D0GA 4G25A 3WAGA 2D7DA 3QXHA 2RB5A 5JW6A 2C5GA 4ZMBA 4TWIA 3UMMA 2Q41A 1NV8A 1XTBA 3H1FA 1UP4A 2B4TO 3FE2A 1U2ZA 4RZ2A 3ER9A 1O8BA 3UPDA 5DN6A 1SHKA 4NCIA 1T8YA 1Z4OA 2TMKA 4A5OA 2PNJA 1HUQA 2OQ2A 2E4VA 1PVVA 1EDEA 1T8RA 4MRSA 4J9UE 3T3EA 4JEUA 1H94A 4XYBA 1X9GA 3R7SA 4AJOA 2I65A 1KE1A 3RC2A 2QQ0A 3A3OA 1ESEA 2EBHX 1WCXA 1SIWA 2J4CA 4PZPA 1XPOA 5C5DA 2QGFA 2A5DA 1T1RA 5DIZA 5A4JA 2J4FA 4P7FA 3FRIA 2QG9A 3IBCA 3S99A 2WJVA 4ZA2A 4MW9A 1ZOOA 4B73A 2QR3A 3DW3X 3ZK9A 3GEMA 3VHRA 4NU0A 3NJ4A 5E2IA 4QEZA 8OHMA 2B1RA 5BV0A 3OF2A 4DMHA 4GWGA 3A4LA 3UV7A 3BJIC 1ZINA 5IZCA 2Z5VA 2YV2A 2HPZA 2P5YA 3WAKA 4XM0A 2PT9A 4KEAA 4QXRA 4ZOAA 4Z0TA 4W7SA 1L5RA 4K03A 2D3WA 5BQ5A 1O57A 3PC8C 1P3Y1 2CVPA 4I5GA 3WFIA 1VBFA 4L4ZA 4OHFA 1E9FA 2J9FA 1NE7A 4HXFB 1G20B 4KYIB 3D0OA 3NIBA 2EL9A 3MILA 3QVTA 4K3VA 4CMGA 2O2EA 4KYUA 4KFCA 2IRWA 3K70B 1QYWA 4H6WA 2IOHA 3NETA 2EX1A 3OD1A 1I4WA 1Q20A 2H8GA 4MYSA 1QAOA 5HKAA 2QZPA 3IR5A 3KQNA 2PUEA 1CFZA 4P4UA 1Y33E 3GPCA 4K9NA 5HBGA 3O47A 4QTZA 3LQ1A 1N4DA 2QAIA 2CHGA 3DDUA 4QUHA 4JC5A 1JDBC 2DKFA 1OOEA 2GPSA 2XQVA 3CMMA 1WL8A 2I4OA 4RW0A 5BWLA 1VKZA 2PZBA 3FOZA 4M0LA 1JPUA 1RW4A 2XYVA 1L3CA 3ZWDA 1TK9A 4XUDA 3M83A 1QV7A 4MOWA 3WRVA 1PS0A 4PQFA 2JCSA 5DLQC 3OQBA 4IZHA 1VZ2A 4PG5A 3T95A 5IM4A 5K0GA 1UUFA 1NQTA 1JSZA 3PDCA 5CA1A 4HN9A 1DWUA 2D5BA 3DEYX 1HLFA 1L4NA 4HATA 3LPCA 1W29A 1KO8A 1CUUA 2JEOA 3HN6A 1L7XA 1C3XA 1EESA 5DASA 1SD1A 1COWD 2FFAA 2I9PA 3QA9A 1BU5A 3QQPA 3BD6A 4X61A 3ESCA 1AB6A 3RSHA 1ATIA 2J9GA 4EBFA 2FETA 1W4LA 1DKLA 1RADA 2P3QA 2XUHA 3M2TA 3UA4A 4K40A 4PLGA 5DP1A 2ZAYA 2RGYA 3CZ4A 1XA0A 2QQFA 4FXOA 3GRFA 4HTFA 5K0TA 2RC5A 4EYKA 2VRCA 1P31A 5JAOA 3KQLA 1FQKA 1NI3A 4B74A 2BDTA 1PZHA 2R5FA 4P35A 4W8OA 3TPCA 5E4JA 5A0FA 1G98A 1S4MA 2LIVA 1XJWA 3LWZA 5T3YA 4DQDA 5EJ4A 1JB1A 1V5WA 1VQ1A 2DJ5A 3WSTA 1EUCB 4D3DA 4KC0A 2YJ5A 4X1YB 3L0YA 1JIUA 1HYHA 2UKDA 3C7KA 4GVXA 3D1VA 2P4UA 3VZRA 1XZLA 4LKRA 3EFEA 1ISIA 4O2BA 3K5PA 5EMKA 1MEOA 1GM5A 4UE6A 5MDHA 1I80A 4KFUA 3FTQA 2O5EA 3TQTA 5AW6A 1SVSA 2NPOA 1QIKA 5BT9A 2OQVA 1VL0A 4GX0A 5JPDA 4IS3A 1FDRA 1UBKS 1C9DB 1KDRA 2C4VA 1NAHA 2ZI4A 3AEQB 1X70A 1LJLA 3FPFA 2FRDA 3L8MA 4BUZA 1PF7E 4HGNA 4Q9AA 5DK6A 1FNSA 2P2NA 1DKNA 3A1NA 1TYBE 3FAKA 4NEHB 3SF8B 2IUSA 3P8ZA 1VM6A 2P0EA 1CB7A 1S2LA 2B25A 3MJRA 4JGBA 4X8OA 4AQ7A 3E48A 3DEAA 2MSDB 5H02A 3KLPX 5IWAB 4M1SA 4MV6A 1JZSA 4Z1MA 4BB6A 3TCXB 2XOEA 1HG1A 5MF6A 3K9FC 1QOQB 2CHEA 3FUXA 2P3LA 3AHEA 4HDAA 1I3NA 1JH9A 1LPBB 3UXEA 5J5VA 2HA4A 1DG3A 5LQSA 2Z3VA 1ZQ1A 2CFRA 4CLXA 2NU6A 2A30A 2WWXA 3R7DA 3AF1A 4XX1A 3FNEA 2J87A 3W7BA 2NMVA 2F90A 3RG2A 3NCTA 1YZ3A 2DC1A 2X9VA 1I6WA 4CQLA 3GLRA 4NBTA 1C5KA 5LN1A 4KQHA 1FXWF 4N7JA 2XYHA 5HG0A 4DNQA 4HB4A 3RU7A 3SX0A 2JGAA 4IGEA 3U4CA 3AR8A 2FE4A 2DT8A 1SCAA 2NSYA 1MMFB 4R68A 3PHIA 3G2IA 5TARA 1DOAA 3RHFA 1VJ1A 6AT1A 1FFDA 1KZ1A 2ONCA 3U7FB 2ODTX 3MB5A 3T7SA 1ZRHA 1VL1A 3GFTA 3K09A 1GTG1 3A1SA 4KG7A 4EA7A 4JELA 3NO4A 4S1NA 1A5ZA 3RYIA 3AONB 1HTTA 5HKLA 3N07A 3I30X 4RKEA 1C9YA 2QE7A 1SVUA 3B1ZA 3ZWAA 1L5SA 1FJGB 2OG2A 4OXXA 2GPAA 1CUHA 4CEIB 2WYOA 2XUGA 5HQJA 2IYFA 1GG9A 3N28A 5KTSA 1MRNA 1A1VA 1O6CA 2ZUBA 3CC8A 1C3JA 3GUZA 2EFYA 3PS9A 3EZXA 3R0JA 2B83A 3JQFA 3GGJA 4UMVA 4XCQA 4WW0A 4B2LA 3U31A 3KETA 3VPSA 2FUG6 4RJLA 3LQKA 3FBGA 3HN7A 3TZBA 4V0MA 4D6PA 1OZAA 4F3KA 1Q84A 1Y1QA 2YTZA 2QW1A 4N1AA 4YEDA 4IGIA 4B3MB 1ORIA 5KTNA 4ENSA 2AFVA 1WOMA 1TMGE 5BT8A 4C7OB 3JYHA 1RPZA 1FMFA 1JFRA 4HFJA 3P9RA 3KALA 2XDWA 2OKGA 5J1TB 3UENA 2HNAA 3GMTA 3MWEA 3LHDA 2VL7A 3N0XA 2QM8A 2GAJA 2YZGA 3FR7A 3K2EA 1C1XB 3OZVA 4JD5A 4CKCA 4DAEA 5KJCA 1DAGA 4BNYA 1YQGA 4OOEA 1PYOA 3UWSA 3CISA 4QTYA 3H87A 3AVPA 1M5TA 4N01A 4A91A 5IDWA 4ZYUA 2GAFA 1D9ZA 4A2PA 2VC2B 2RD2A 5AJWA 2J9YB 2E82A 2GN6A 2R44A 1MNQA 5KVSA 3DBRA 2NX2A 2ST1A 2H2HA 1ZM9A 3NOXA 2BOVA 4OF4A 5A9TA 5J2TA 1ZUNA 2QNIA 1CUGA 1UWKA 1ZNWA 2JFXA 3QFSA 3WLFA 2DLNA 1AK9A 1SQSA 2A4KA 4QHSA 1JBKA 3LYUA 5FJIA 3TR5A 4BC1A 2PUCA 1X19A 1Z4NA 2AMLA 1DRVA 5DCWA 3WVNA 4ZQEA 1AA9A 3OZ7A 5CAEA 3UT6A 4D02A 1XP5A 3INRA 2M2IA 2VPZA 3PGLA 1ISJA 3HJNA 1QAQA 4TQUS 4H1HA 1M8FA 4LGYA 3JRWA 4B3CA 3AH8A 5CBPA 3KYBA 1JR2A 3VNSA 4EYEA 1ZD3A 3L1HA 2A5LA 1HLGA 4HJXA 5KVAA 1MJNA 3DOIA 4DNPA 3DMRA 2PUWA 3RIMA 3S2YA 5KU7A 3AVWA 2XB9A 3GCWA 4DEYA 5CVTA 3GG2A 5ELMA 3L7JA 2FWAA 1KYZA 2DRIA 4P3NA 3WL8A 3PR1A 1QJCA 5GV8A 4C29A 5GJCA 2ZT7A 4Q1BA 1MAVA 4PPFA 1B42A 1JR4A 4NRDA 4EHHA 1JI3A 1LPSA 2B8EA 1U1DA 1D2AA 3EYWA 4XUEA 5L3QB 1ZHOA 5K0BA 2VAWA 4CIXA 1W0JA 4B84A 1USGA 2R6HA 2WM2A 2EEPA 3D3JA 3I1YA 4MIYA 4Q1VA 4CF4A 5C35A 1II9A 2I2CA 4RKYA 1I1HA 3I4FA 3GGGA 5GV7A 2P9TA 2VDPB 3AOEC 1XXHA 1G3UA 2G4LA 3BB4A 4OJTA 3LOPA 4P4SB 5CVDA 1N5DA 3HNRA 5K51A 4MJ3A 4MR7B 3ESQA 4U6QA 4RESA 3GGPA 4X20A 3TNFA 3LC2O 3W77A 4HUQA 2O06A 2RARA 2JLVA 2CVFA 2I1QA 2ZUSA 5MHTA 1G291 4PXSA 4CU2A 4R4JA 3VU1A 2IYSA 3T4PA 1X7HA 4L50A 5A71A 3GK3A 3ZK7A 1AGXA 1G17A 1K6EA 3QSGA 3KSBC 4C0SA 1MH1A 1KK0A 3JQ6A 4S1VA 2KB0A 1VFPA 3G1UA 2PWZA 5TMPA 2BHRA 3QUQA 4K8RB 5DBGA 2H1SA 2P9GA 1XSEA 2GI4A 4CDGA 1MCZA 4Y9DA 1S1CA 1EI9A 1T0BA 1XB2A 2WWVD 4TL7A 3LH5A 4P5DA 1MV5A 1ZBQA 3EWNA 3QV1A 1Q3TA 3R7LA 3MS2A 3EVAA 1CZHA 3WP0A 3NBUA 4YRFA 5JOQA 3AR3A 4DCOA 3EASA 4PXAA 1EK2A 2PVSA 1DIOB 1QNLA 1XDZA 4WE3A 1E4VA 4YDRA 1OXBB 5D5HA 4B3IA 3E2MA 3V6LA 3NRBA 1T9HA 3ASVA 3FVQA 3IT3A 2E85A 3GFGA 3PPXA 1S8NA 3QHPA 4HNSA 4JJ6A 2FX5A 3D6JA 4ZKDA 4RFLA 3R74A 1W36D 5CPBA 3N53A 3NBKA 2ZT8A 1JHXA 1WCIB 5BYAA 5CT4A 2KWIA 5KEIA 3FZYA 1NONA 1U04A 2GPJA 3L1UA 2V9PA 5BSMA 2AD5A 4X71A 2WB2A 5THQA 1LK5A 4ZOEA 2OPHA 2EVWX 4IFEA 3D8HA 4FCCA 4PY2A 2NUBA 4UHKA 8ATCA 2BN4A 4L7VA 3ESYA 1OC2A 1C4KA 1V25A 2CF6A 2QXTA 3RODA 3B3JA 1DLIA 3DZIA 3KVVA 4NV0A 3TEFA 2EIHA 3IC5A 2N0SA 5EP2A 2A33A 3FOAA 1A9OA 3ELWA 2RJ3A 1E92A 1YV9A 4LRSB 2A0KA 5EL0A 1CYEA 5EWLB 4KQIA 3E9YA 3JAKA 2C03A 5IARA 3BHIA 2GHQA 2NYUA 3SNKA 3SJBA 4AP9A 5IWCA 1HR0B 3LUGA 2Y05A 3HB4X 1TCCA 4R5MA 3K71B 1UJCA 1VIMA 1QOZA 2RKBA 4L9AA 4RXTA 1KI1A 3RU9A 4PU0A 2JGJA 4GC5A 1RQRA 4UM9B 2DTXA 4BB9A 4YWHA 3C1TA 2DPYA 4E5KA 3D6MA 3AUAA 5AUQA 4N3AA 5JY6A 3IEKA 2CDNA 2AVDA 1ZU5A 3MB8A 3VHLB 4HXYA 1NI5A 2WWGA 4TL6A 5IM4F 3B3GA 1IN7A 3RAEC 1L8OA 3BWCA 4J0CA 4YMIA 1XALA 5TT0A 2EG5A 1M9NA 1HSZA 1SG6A 1YBVA 3K9QO 3PPVA 4FYVA 5TPWB 4NJEA 4G0ZA 3O9VA 2QAGA 3INYA 5CHYA 5AQ1A 1QV9A 1WB4A 1BGXT 1H8HA 2VYVD 1OFIA 2XBLA 3ZGXA 3CX4A 4E51A 2YHSA 1FRZA 2FMFA 3PYLA 1AG9A 5HDQA 2R6GA 1U3TA 1G18A 3V8NA 4AYTA 3L46A 4GSYA 5T4BA 4LYGA 4IIVA 4IP0A 5LU8A 4CMHA 2MMGA 2FFRA 3FHJA 4B82A 3NVKI 3UW3A 1ZCZA 3Q0IA 2P35A 2JJ2D 2JS7A 1AKEA 1BRMA 1H9AA 3ENZA 1O6BA 1P60A 4P54A 4Y9UA 4DLXA 1WHSB 3F2IA 3NFYA 1HI9A 2VDRB 3AM5A 3NIGB 4FVTA 2C3YA 1IY8A 1YJ8A 1TM3E 4TN1A 3RRJA 1ZOSA 1CLEA 2C99A 4WXHA 4E11A 3ZE2B 4NG4A 5JLJA 3ANSA 4P98A 2CWWA 2IPLA 3RLIA 4JBGA 3ZHCA 4WOCA 4O2BF 1I3KA 3H11B 2F4NA 3K9GA 1KQGA 1O5TA 2HV9A 2YICA 5EMJA 3IAUA 2YHBA 2WC1A 3ZZNA 3WGTA 1QQ6A 3UW1A 2ATIA 4WCDA 3S81A 4J1TA 4MVJD 1N3BA 2BF7A 1G21E 4S1TA 1EMDA 2QYHA 4BZXA 1XCMA 3I6ZA 3HCAA 3X1MA 3L7YA 3C3MA 3FJYA 1EZ1A 4ZU3A 1KL7A 3KZXA 1B8VA 4J2OA 3ZH9B 5LFAA 3HABA 2R2AA 1JFTA 5GGXA 1UKAA 1Q74A 2XKKA 1ZKDA 3R5XA 1ZJ4A 5K2OA 1VDZA 3GFBA 4P8RA 1JDTA 1PJCA 3EH2A 4IV5A 1Y8AA 4KLAA 4BX2A 5KNDA 1S01A 4QDJA 3GUCA 1Z75A 1U2SA 2BEVA 1JDUA 1RQLA 2DHQA 3SG0A 3W6OA 3FMFA 1RC1A 1YQWA 4UPVA 4NQZA 3WRYA 4A1FA 1E77A 4IZOA 3TDNA 3WICA 1MA3A 2CJXA 3F4KA 4FGSA 2XF8A 2JG3A 2Z2XA 3M1AA 1M1NB 2QUZA 1UH5A 3NEJA 3QITA 2CD7A 3PD1A 4WHMA 2PCJA 3LF2A 1K8RA 4WUTA 5CW2A 3WR5A 4UU8A 2X2FA 4XZ3A 3AINA 3OIVA 1FNBA 1U7OA 3C7CB 4R7TA 3BFJA 3S6JA 1RBMA 5FULA 3ZZTA 4I4TB 2B2CA 3TM4A 1Z83A 1FQOA 4MR8B 1EHIA 1FTYA 1UEIA 1Y7TA 3NTLA 3R3ZA 3ZUPA 3OPVA 2I78A 1Z82A 1XHEA 2CYBA 2YXEA 4KBGA 4POAA 4WKPA 4AY3A 1E96A 2Q4DA 3QM1A 3K30A 4QBKA 2W2MA 4R2XA 4F4DA 5TF0A 1XZKA 1Z7BA 1JI0A 1YE5A 1WB6A 1UR5A 1Y8RA 2BKEA 2CJYA 2Y1DA 2ZJ1A 3ILSA 4UHEA 5EZQA 4HYTA 3WLKX 3QPWA 1IZ9A 4QGHA 4D3YA 3NKVA 1R8XA 3SXUB 2QMHA 1RIFA 4UE3S 3NWPA 5HZKA 3ROGA 3TB6A 3UQZA 5LOVB 3IOBA 3BQMB 1MIOB 2Y1GA 3MC1A 4N8SA 3DOEA 4I1UA 5B7PA 4JSYA 3U3RA 3ZU4A 4F71A 1JEYA 3PA8A 3H6HA 3QFTA 2I9KA 1UMBB 3GDHA 3AYXB 4TL8A 3LQYA 2R5NA 3M3DA 1YGYA 4B43A 2OR3A 3HP7A 4Z5XA 1EGAA 4BO1A 2V0GA 4K28A 2WD7A 1BW9B 5ER9A 3GYGA 1XRLA 4UBMA 1QU2A 4H3KB 2R1UA 4LHWA 4GPD1 4MVJH 3U19A 4QPPA 2YZKA 3ORRA 2DCMA 3LS2A 5JPIA 3FRJA 1AUQA 4PFJA 3UXYA 4Q3OA 1KDTA 2NO4A 3GH3A 2WKSA 3UAWA 1C1DB 4XPZA 3RC8A 2SKDA 3OIGA 4N48A 2C58A 2VDWB 4EHJA 3C39A 1DC6A 2XRFA 4TWJA 2QDKA 4N8DA 1CB0A 4LSMA 4QICA 4P32A 4JP3A 5FFFA 3T4UA 2DOKA 1KSJA 2LCIA 5C8VA 2FQQA 2O9JA 4MR9A 2GYYA 4MRMA 4RVSA 2WEKA 3TQSA 1N2CE 4MB0A 4JI2B 1ZNYA 4NTZA 3UMGA 3AL0C 4C0AC 3HHPA 3K5IA 3LXUX 1HDZA 4MW6A 2DUJA 5JZ9A 2HU5A 4MIKA 3L7DA 5LQMA 2AFIA 1Z13A 3OU2A 1SVKA 1C81A 4HS9A 4RZQA 3TLBA 1CY0A 1XNJA 1NC3A 2O5RA 2P9JA 4E5DA 2I4LA 2IJGX 2WF6A 1KPIA 1TMOA 2YHIA 5KYUB 4JV5B 4R01A 5MFZA 3PE3A 4WCFC 2I87A 1RJFA 1XCOA 4P5EA 3WISA 3X43A 1XRNA 3P9IA 2ZIGA 4A0GA 3BJEA 3DMGA 4ME6A 1FTWA 4GNRA 4Z9YA 4BNIA 4CCYB 2HSGA 2C2ZA 1I32A 2X8JA 3BXOA 1CY4A 3DFUA 1H6BA 3JASA 5DXAA 2I7XA 1I0ZA 2C2OA 4MCJA 4Y2JA 5IMBA 3AETB 3TM5A 5BP7A 1NQVA 1PL8A 4WBNB 1ZL0A 2AXPA 4KDCA 3TL6A 2DJIA 2ECFA 4I3FA 4B80A 1M1UA 3GIDA 5IK2A 1G4HA 2CVHA 3UWKA 1SQ0A 3IT1A 4ROTA 2ODAA 3TRDA 1MHPA 3ZOKA 3HKBB 5F23A 3N39C 4KUEA 4MV1A 1F1JA 4EG4A 3DV2A 4EY6A 1U9CA 4MKIA 1W52X 3A25A 4K2HA 1SXPA 2CY0A 2BVNA 2BGRA 5DI3A 3DVRX 2NIPA 2ZRQA 2PD6A 3DKPA 4AMYA 4OSPA 4YASA 3DVLA 4OKNA 2BSQA 4C0KA 4PG4A 3Q2OA 4QQ8A 4UD6A 1VYVA 3ILYA 2DULA 2O8EA 1XN4A 4QU0A 5ULLA 4ZVUA 4BRWA 2CLLB 1HT3A 3EMVA 3QKRA 3BEOA 1FXUA 3RSFA 1G4AE 2ZRAA 5EUQB 1R0CA 1XD2B 1ZJJA 3HJGA 3KR9A 1GHTA 4MPRA 3TGPA 4MH0R 3E1SA 5FH9A 3IBYA 4BJ6A 3CVVA 1J39A 5LA6B 5LL6P 2VAMA 3UYLA 5FOUA 4YJGA 5IKMA 2WBLC 4MDEA 3GYBA 5FUMA 3CSDA 2V7QA 4B0PA 3H5NA 5CNJA 2GO1A 4JI3B 1H42A 4E08A 2B82A 3V32A 3RM3A 3Q3EA 4LIPD 4BC0A 4DMMA 3TUZC 4DRYA 4B4DA 2V3CC 4M1WA 5EFZA 4ER6A 1GSHA 4AB1A 1RLJA 4K81B 3WNVA 5FUBA 3GV0A 4BVAA 2FSSA 1IHDA 2QRMA 3CZQA 4MI6A 4CEHB 3WQHA 3VFDA 2BFWA 4QARA 4M1KA 7GPBA 5EOVA 4ISCA 2O8VA 5J47A 3GP8A 1FC0A 1LBSA 4MW7A 1J24A 1COZA 1EQ2A 1GUZA 3MBOA 2MWMA 4F0JA 3OFVA 1F3OA 4NAHA 1UOQA 3BICA 1JHOA 2HWWA 3EZYA 4Y2HA 1NW3A 2EV9A 4WI1A 5TLSA 5BW4A 1UJBA 2Z5FA 4WXPA 5IT4A 3GLGB 2B7LA 5DYIA 3N6XA 2DR3A 3RI3A 4TKZA 2V1XA 1Z62A 2NW6A 3L3BA 4BEJA 2B37A 1MDBA 3GQBB 1XYVA 3RRBA 1H22A 3HXTA 3MCAA 2A86A 1PN3A 2ZGVA 4M37A 1X87A 2QVBA 3AW9A 2IHZA 3QU5A 4TS4A 5BW8A 1WXGA 3UXHA 2D0IA 4B85A 2Z8YM 2ASEA 2CW5A 3SP1A 3FCUB 3SI7A 2B3TA 3UUGA 3HSYA 1M5RA 2ZSEA 2I3ZA 1K3UB 1UKVY 4IIFA 4NH4A 3YASA 2JFOA 1DTSA 1QCYA 2FUG1 4JJAA 4YBRA 3VH2A 3MT0A 4ZK6A 3EJWA 1MR3F 3EEYA 5SY9A 3RAPR 3LUBA 3CCFA 2XJ9A 1IBMB 2Z2YA 3TXAA 1NT2A 5HE9A 2D1SA 2ZXEA 4N49A 4YA6A 2VZEA 4ONEA 3AF4A 4URFA 2Z6VA 2PWYA 3GRUA 1PEDA 4BNZA 1KR5A 5IT9A 5J5CA 4HMQA 2BTQB 3OOJA 1T36A 4EHNA 4QO8A 4BRUA 3QPDA 1TU0A 1KWGA 4D97A 4E94A 1IDN1 4U3JB 4PHHA 3ZVLA 3R6DA 2R86A 6Q21A 3UB2A 2WV9A 3HCPA 3VDQA 4LXUA 4RZHA 1DAPA 1JEJA 2A9PA 4HFNA 1JKXA 1OY1A 4HGYA 1JWLA 3SKXA 2FWRA 4J16A 1SIOA 4AULA 3EVBA 1HDIA 3HUEA 1X6VA 4IGAA 3IR7A 8LDHA 2MSLA 4JCCA 1D8AA 4FKBA 4JX8A 3ONFA 4TKUB 4ZKEA 5AW4A 1BVUA 3C24A 3TUJC 2F1OA 1C0LA 2PV0A 4IV8A 1KR2A 3O4VA 3PX7A 2BEKA 4CMIB 5AI4A 4MVJG 2I4MA 5A4FS 2JFQA 1DJPA 2EU8A 1R2QA 3M89A 3Q88A 1C50A 3GELA 3CF4A 4I9GA 4TKLA 4MP3A 4KGDA 2J3KA 5CVVA 4AZ3B 1E6UA 4FC7A 5GP1A 1GGHA 3Q1LA 1PQYA 2JEYA 1JJIA 3ABSB 2G1AA 3IBTA 3OTWA 3DLPX 1BWQA 4ZT7A 4DV2B 5KSZA 2LBPA 1KS9A 2IZZA 1QTQA 2YOFA 1L4GA 1LKZA 2AT1A 4JB0A 1SWWA 1Z29A 1RZ3A 2JJMA 4LOHA 1DEKA 2ZT6A 4TTIA 5ALRA 2QTGA 2QEQA 2FOIA 3IIEA 4FOTA 4K6GA 1JAIA 1L9KA 2YNMD 5DYWA 1Y5IA 1ZH4A 2AKAB 2GA8A 1K2VN 2WAOA 2FJUA 3AZPA 3R3WA 4JXKA 4KN8A 4LZLA 5FTKA 4KV7A 3T1VA 4I8IA 4MUMA 3JWGA 1YRLA 1EFAA 1WW3A 1JHMA 3NHJA 3ODGA 3OZXA 3W8DA 4RAQA 1IHYA 2YWBA 3R6WA 3BN3A 3P20A 4FMPA 4N6GA 5IYZF 3E3MA 4PZ9A 1UAAA 1D04A 2P9HA 3KSRA 1YIDA 1XZCA 1D2CA 2PX3A 2WSSD 3BOSA 3G7SA 4RABA 2VF7A 5H70A 4D0LB 4UPEA 4RJTA 2PR2A 5KQSA 3ZQJA 1LA2A 2FH5B 3BILA 2PSDA 2W2KB 3LC1O 1Z2DA 2ZIWB 3DT9A 5DX1A 2H4JA 5CTJA 2A5FA 3AHIA 4UBOA 4BJ5A 5CB4A 2C7QA 3BHMA 1R7RA 5L53A 3R9XB 1LDYA 3TE6A 2GJAA 3JQBC 3UGTA 3HJHA 1B6RA 1INLA 1T6BY 2FX3A 2XWPA 4IXNA 4JA2A 1LTHR 4G63A 4P08A 1N1GA 3F74A 4OH1A 1NYRA 3JPWA 1TKBA 2P2LA 2QJTA 5AUNB 2QN2A 2AFIE 3P19A 4WOBA 4GZMA 3SICE 3AQ4A 4BFWA 3K4HA 5TMEA 3VNAA 1OBCA 2F3UA 1K5DA 2C07A 3IJRA 3OZDA 4M9UA 5B7NA 4LI0A 1R0XA 4V0SA 4ZODA 3SC6A 4FDTA 4PLCA 1HZJA 2B4AA 4GKAA 2VZ0A 3EAFA 2W6ID 3TLJA 1LPPA 5KYYA 4D4HA 3NR2A 4O4LA 3H9QA 3ITNA 1TYCA 4MLPA 5FHRA 3JD0A 3L6EA 5KYXA 1SCIA 2WTBA 2R0QC 1EM8A 2A7QA 5DTEA 4AZTA 3EVFA 1A50B 1MO4A 2WUDA 5F64A 3IAM6 5JPCA 2D13A 2HK7A 2FUKA 1DOHA 2FWIA 5IJ0B 3TL3A 5BMVF 2JI9A 2Q99A 4TLLB 3GXOA 2P6UA 4RTRA 4LISA 1JMVA 3K2QA 1G38A 2AEJA 2P6PA 4PZCA 4O3MA 2HFKA 1QPGA 2QD5A 4Q4HA 3LQFA 2IIPA 4HNUA 1Z6PA 3H3FA 1N7GA 2WJ6A 8ADHA 3OJWA 3IQGX 1C9MA 2KMLA 2NVWA 2QF7A 3HH8A 1XK7A 4U9IS 1V96A 1RXIA 3S27A 4RKQA 2ZANA 4DADA 2WAAA 1VCNA 2DB3A 2VPQA 3WTBA 2XUPA 2Z6AA 4HZGA 5I9MA 1WSAA 3LBNA 2YXPX 4P93A 3TN7A 3HBMA 3A0UA 5C18A 5K3EA 4IHKA 2C1EA 4XWAA 1UM9B 4IIDA 2SBTA 3TPZA 2YYYA 2HOQA 1A04A 3VPFA 5J4LA 3V4PB 4CM9D 3LWNA 1EX1A 5JC1A 2VKTA 2XGGA 3HP4A 2A84A 1B23P 2B1QA 3D6TB 4LE2A 2BYTA 2YWEA 3CBQA 4LVUA 4JJ8A 4D45A 4IIGA 3IESA 1HGXA 4HRAA 4IICA 4IJMA 2NQ2C 1R4ZA 1U7DA 2C7BA 3P9QA 4F1KA 4HNTA 3DMFA 2EX4A 4M8SA 3TE7A 1FU4A 3TTTA 5JR3A 1QZUA 4C7KA 3PNLA 4OBWA 5FO1A 4B3XA 2EW2A 3KEQA 5C1BA 5KTPA 1Y80A 1G1AA 4F6LA 3RYCB 5DNYB 2X13A 1A71A 1LI4A 1PX2A 3IPLA 1EXWA 4B3FX 1O87A 4B6SA 2BMJA 2V7GA 5LUBA 5CPFA 3DOFA 3HGTA 4LKOA 1IOWA 1VRVA 4OI4A 3RSSA 4V24A 4XFKA 3EGEA 2G07A 3JY6A 4G41A 3UC9A 4LJ8A 3RNLA 1J09A 2ETXA 3R41A 4BUJA 5IKPA 3PEWA 1VXOA 3OETA 2B36A 5F77A 2G80A 2PLFA 3ER8A 4KXQA 1BWSA 4NNJA 1PL0A 2JA2A 1DTEA 5HF9A 1JQLB 2QRVB 3LCCA 3K0BA 2UYOA 5KQRA 2BKXA 3OT1B 2D5LA 2BMVA 5TGTA 1BX3A 3PNMA 2LWIA 2YIJA 1GPAA 3O31A 3IAAA 1R6BX 4P9NA 5D5QA 5EKSA 3T4EA 5A4IS 3O03A 1GZUA 5EIBD 3RIGA 4ARIA 1TKRA 4CIWA 1E8NA 2JAUA 5EP4A 2LP4Y 5LQNA 4OEHA 3PITA 3S29A 1VCIA 3HI4A 4CUKA 4XJTA 2LV8A 2WHPB 3DV0B 1K89A 3O73A 4Q6BA 5H59A 5HFJA 2QLJA 2PANA 3SC3A 4LRWA 3SE7A 4A6EA 4IDFA 4D43A 4DTCA 4I4NA 3FVTA 2XT9A 2PZEA 2IU6A 2AW5A 3SQDA 5BV2P 5K8CA 4HJRA 4MS3A 1X15A 3GWGA 5A03A 4PQGA 1YS4A 3H5LA 2ZIVB 4QDTA 2VT3A 5AIBA 1ZK3A 3KSMA 1KBOA 1JXQA 4MEAA 4TTSA 1TKAA 1N2JA 2ANCA 2FN4A 2IOQA 2E6UX 1RQ7A 3B53X 3JXEA 3LUHA 3PQDA 4YBZA 3CSUA 1CY1A 2IXTA 2XOXA 2XVYA 1U7HA 4M21A 5DNVA 2EF0A 4UARA 1Q7RA 1IXKA 1QX4A 1GSAA 2OAQ1 5FBHA 3X1YA 2ET6A 1U11A 2O8BB 4JFAA 4DR1B 1EWQA 1YS7A 5JYDA 4HFMA 1X77A 2XMSA 5CYOA 1VDMA 3TSCA 2MDTA 3GJYA 3WB2A 5F35A 4IOJA 2GAAA 3C5WP 3MAJA 3FNIA 2MT9A 1MA0A 3FI0A 5EVJA 1J1IA 2ZREA 3KD3A 4K9MA 3FYCA 4Q4AB 1Z63A 5JCJD 1FYDA 4RA9B 3LA6A 3PPIA 1PZMA 2H9AA 4QYWA 2Q1TA 1EFVB 3EGIA 2R8BA 3RS9A 5LB4A 3L93A 2C9MA 3MA0A 4DFDA 3U6KA 2IBTA 4MV3A 3TCKA 3R2JA 4DRZA 1S4QA 2GYUA 3DR5A 3EWAA 1H4QA 3ZWXA 4BIMA 2D54A 3IPRA 1YZLA 5FUWA 2R00C 2YVAA 1L4UA 3FA2A 2ECPA 3HGQA 3I8OA 5AKEA 4EF4A 3NKFA 1S9DA 2IOYA 4UCQA 5CB8A 2XW6A 1WD5A 2PTGA 1TTHA 2EKQA 4Z8XA 1UBOS 1FQWA 3GNQA 2YOHA 2Q45A 3U0VA 5D3MA 4G0VA 3BWYA 4FZRA 5EXXA 4ALNA 2XQJA 5IXYA 2JIPA 4IDOA 3KYDA 1FDOA 3QP9A 3GMDA 3AIMA 3KPJA 3QWHA 4XASA 3RSOA 4YDQA 3PFHA 3EIEA 2ZKLA 4AVYA 4ZV9A 2CNBA 2FG6C 1KI6B 1ZR4A 2D6FA 2WE8A 4WK2B 3WLRA 1Z25A 1DUVG 2C1XA 2RHMA 2XNHA 1MH9A 2F67A 2P5SA 1C0KA 3P9KA 4OHYA 1WW8A 4V1CB 2EQBA 5CM8B 5IT0A 2EYUA 3Q85A 2HCBA 3AC0A 3F6EX 4FW8A 4RAOA 3KBOA 4H6VA 1CX9B 4WMLA 3UHPA 1KMMA 3EJ6A 2D0DA 3JCZA 1Q16A 2X6QA 2YJZA 2HA7A 3LQ2A 3O2QB 1J21A 3JVUA 1R0RE 1B6SA 1GLNA 1NP6A 1RLOA 2A5YB 1C4OA 3TUIC 3I83A 2YV5A 3O1HB 4G97A 2UVQA 1WPGA 3FOWA 4IQ8A 4PGAA 3FB1A 4QX6A 3ZQKA 3T06B 2AI3A 2FN3A 4F12A 3OOHA 1BDJA 4TM7A 3UUFA 1CU1A 1ZXBA 2OLKA 1G8JA 2PA3A 2Q3HA 2QIPA 1A9SA 2HA2A 2BFCA 3OE5A 1QOPB 4FEEA 1JG3A 1NVVQ 4KIFA 1S8OA 3HJAA 3IOEA 3NBYC 5CIWA 3WB9A 1HKUA 1JU4A 3KEFA 4FD2A 3PX2A 1DUIA 4UNSA 5IZCC 1C0IA 1WHTA 3PTLA 3R0IA 1ODJA 5BR1A 3U61B 1ESCA 2O07A 2P78A 4FN5A 3QX8A 1EUDB 5EWJB 2VNKA 3IOYA 1F51E 1J2UA 3FUTA 5A05A 4C4AA 1PSZA 2W4MA 4TTVA 2BONA 5C2JB 2V7VA 4DDHA 2AZDA 1FW8A 5KMGA 2Z9DA 1Y89A 3OP4A 3U16A 2C4WA 4EW1A 2XA1A 4YREA 4CIYA 1VIVA 4EX7A 4TSFA 4D9EA 5SV2A 3HR8A 4N3NA 3T3GA 5JSZA 5BUCA 1LS6A 3MGKA 5CFMA 1W30A 3I8SA 2WF8A 1WTCA 4GRAA 1C30B 1S2OA 2JLCA 1NJ6A 1PW7A 3AF2A 1XE3A 4UUOA 1IBRA 5A62A 1QHYA 4CFYA 3UG7A 4ZZ3A 5GINE 1UDWA 2FQXA 2IZ6A 4NMWA 2VZ9A 2QPOA 4LYFA 4MQ4A 3EBPA 3STHA 1ORRA 3JZAA 1ZMRA 1UXGA 4TZTA 3HJFA 1DAFA 1M73E 3C3BA 3K7EA 1E2KA 4QWMA 4KXMA 2B8TA 4WJZA 5EPUA 2NU9A 1JLMA 4GBMA 4IMJB 2O50A 3QVXA 2G67A 2X19A 1Q5PA 3PFIA 1Q0TA 1XTKA 1ACMA 1BXGA 1WX1A 3OEHA 2CXSA 3LDHA 1TM2A 1XROA 1BXKA 2PGJA 2YBEA 2P3OA 3W3AA 1WXFA 2EFJA 2QU7A 1YDMA 3OPYB 5GJWC 1PNQA 2GM4A 3PHGA 3I2IA 5D86A 2FSHA 4L8VA 3QX9A 1FMLA 1BO6A 1Q7BA 4P7GA 5DGCA 3BE8A 1D6SA 1RWWA 2BMWA 3JD3A 3A4NA 2ZQZA 5TXGA 2CFOA 1XU9A 2QP9X 2X15A 3JZIA 1OIVA 3KJFA 4IFTA 1KOGA 1SURA 4LJKA 2H17A 2AG8A 2B8NA 3RC3A 1MGOA 2C7PA 2JLSA 3GMIA 4RGBA 5E2AA 4A23A 4Z7QB 1FL9A 1P75A 3B20A 1ZK1A 3WK5A 1AV7A 1R6VA 2PXXA 3G88A 2RK4A 1O0BA 2J0SA 3WSWA 1NMXA 1KC3A 1X42A 2R1ZA 3DO6A 4RVGA 1ILEA 4L9RA 2XXAA 5A4KA 3EVEA 3G8YA 3IERA 4CLRA 3HCRA 4H16A 2NTVA 3DTVA 2R6DA 1GT6A 1M1ZA 4UQOA 2FRDC 1XF1A 6REQA 3UK1A 3QUTA 4JCOA 4PC7A 5AM3A 1FDWA 2XNJA 1KDYA 1YS2X 2BP7B 1RAEA 4E46A 4RDIA 2NM0A 3S2EA 1VE1A 3O8NA 4IYJA 4YMUA 2FW7A 5EC8A 3QMMA 1UPUA 1YJCA 2OBBA 2JHPA 3OTQA 4EAAA 4B3GA 1QDEA 2Q6LA 2OV6A 2R8YA 2PGLA 4C04A 5EKDA 2Q3DA 3RIEA 2IYTA 3QVMA 4OP3A 4JT2A 3T3HA 5L8VA 4J0IA 2JIMA 1XC7A 2BH2A 2VJPA 1UZAA 3IBGA 3LYHA 4R1QA 2UZ1B 4LBZA 3U40A 1G6OA 4J0JA 1RM3A 1AURA 2WDZA 3PNOA 1TYDE 3FPGA 1E66A 3J7AC 3IPAA 2AR0A 1M75A 4H7PA 1G4UR 1JVSA 3JWPA 3UGJA 3ZXYA 3K92A 4E2WA 3VYTB 2EDAA 221PA 4QREA 2D1FA 2G9RA 1P2GA 1VJTA 2OBMA 2VYFA 2JGLA 3I09A 3KB8A 4MUEA 4U2CA 1M2VA 3IV6A 1AZTA 3QG5A 4L8FA 4P22A 5TQ2A 3KB2A 5IW8A 2VJMA 1ABFA 1DJLA 1K97A 4H7IA 4YRJA 4A6PA 1RWMA 4Z4CA 1X1DA 1KK3A 1QUEA 3DOOA 4KPYA 4RS3A 4KAJA 2BL4A 3RBVA 1RRCA 1K7XB 1UPFA 4L16A 5D3ZA 3VH3A 3K09C 4UU7A 4CKBB 1Z45A 4TM8A 1TVKA 4BBAA 4RIFA 3C14C 1JHPA 4GI2A 4JA0A 1E32A 3ZEIA 1KZ9A 5EJ8A 4S04A 5KC8A 4GOJA 1JF8A 2Z43A 4EL5A 1SVOA 1FJ2A 2IUEA 1V1RA 2VUIB 4JSTA 3NEPX 2NAPA 5B1IA 3IMKA 1G6HA 4AUMA 3N87A 4NCJA 3SBDA 4LF5B 1R4MA 1ECLA 2G8NA 3SJAA 3TECE 3AM1A 3A6HA 3UCXA 3JQFC 3E84A 1VCOA 1PS9A 1MT0A 2Q2WA 4Q9IA 2ZS7A 4OL9A 5CK4A 3PXDA 4Z3OA 1VXRA 3OMXA 5TIIA 3N2KB 2GEKA 4KXUA 4KWEA 4KMOA 4MAFA 4P36A 4PFKA 1W75A 5K05A 2JK0A 4NULA 2QUKA 4Y6SA 3JWEA 1QS0A 4CG2A 2UU9B 2A1IA 2H57A 1IG0A 3OZUA 4MKFA 4BLWA 1WXXA 2ZYTX 5ALNA 1NVXQ 3MMNA 2F8TA 2PQMA 2JLXA 3QVKA 2RHOA 3GLSA 4I36A 2YVKA 5EE5B 2VRCD 2NU8B 1Q7CA 2I67A 5HX7A 4HBZA 1C0PA 3B82A 4I66A 3LI2A 1UFQA 1CHDA 4QU5A 4ZVQA 3R7NA 5MN6A 3A2MA 3UV6A 2VNSA 5DTRA 5EJ7A 4KX3A 3ZHYA 4O5AA 1DC7A 1XCLA 2H92A 1JG6A 1MC8A 2W83A 2XDAA 3A3NA 4NP6A 1Q2UA 5AVTA 2WA1A 2F00A 1TO1E 4A4DA 3MOIA 1G3IA 4V3CA 1EDBA 4BV2A 4YUWA 1NLYA 1V8OA 2WFAA 3ABOB 3LP6A 2NP7A 4HC4A 1GAEO 3A0RB 3DUFB 1QZTA 1QGYA 1OW3B 2XUJA 5CYFA 2A57A 3H1BA 4QKQA 5LNK6 5I01A 2KLHA 3SBXA 1UODA 3LK6A 4JIGA 4XJSA 1TF7A 2JFGA 2Q1SA 4EDFA 1QVRA 1DAHA 5FPSA 8AT1A 4O4IA 1Q77A 1V3VA 4Y8VA 6PFKA 1IYZA 3BSWA 1IZ7A 3DE5X 3F7NA 2XNKA 1IY0A 1KSFX 3QXGA 4NV1A 1WAMA 2Z2JA 3PVCA 4X6UA 1NBAA 5EJ5A 1RLMA 2ZBEA 3CMCO 3C5EA 2BISA 5CA0B 2ID9A 4K87A 4KSYA 1KIFA 2I6FA 3IQEA 4QT4A 1IJEA 3IQZA 4E31A 1QKKA 4FNMA 5JEEA 3TLYA 4Z1MD 3IAM1 4F92B 3TZCA 4B7XA 5C8YB 1QJ4A 1VA4A 3EQ7A 5G0SA 2YWHA 4CUJA 1GCAA 5KOJB 3PWSA 3KAKA 5L4LA 1JALA 3AJEA 2BGUA 1N33B 4Y2YA 5DZSA 1EK1A 4FEGA 2I5PO 2F7SA 4ZYXA 5JVDA 2P2GA 3IMFA 4EA9A 5B6JA 2F1IA 5HZMA 4QBFA 1TT7A 2YWGA 2P1ZA 2XDQB 2AOUB 3EIXA 1M33A 1PR4A 2QTNA 1HEIA 3SZLA 1T35A 3LVBA 3IA2A 1XYYA 3NATA 1BFUA 2ZU6A 3C6XA 3NOVA 4CV0A 1TCUA 2O2YA 1U8AA 5AHXA 4BMOB 1D3AA 1GAJA 4Y1EA 5JLAA 1FYVA 3S2SA 4Q82A 1P4HA 4DC0A 1K98A 4RK6A 2SHKA 1YBMA 4A2CA 2OLEA 2K6GA 3B3AA 2ZI5A 1FUUA 1KQOA 3O3MB 3WNBA 2YWRA 1EFTA 2WAMA 3SBEA 4EFDA 1CUYA 3ELYA 5JIBA 1U6IA 2DWPA 2IVFA 3FCYA 5C31A 2BJHA 1R18A 1JJBA 3LZ6A 3SJ7A 3QVWA 3LLUA 1J5XA 1Y9AA 2LCFA 3PQ2A 1GOTA 4PGHA 2Q07A 3BH0A 3C5CA 3ZQ4A 4MPJA 3DYVA 5EYPB 3WMRA 1KA9H 4L0DA 2FQYA 1PKEA 1NPDA 4HN2A 3GAAA 3W6ZA 1O3YA 2BGKA 1VE6A 1AQ6A 2P4HX 1KE2A 2BFBB 3L7OA 1X7YA 1WV0A 1C14A 4K6KA 4WK4B 2GHIA 2DT5A 3G7NA 3NAZA 5AW1A 4Q4DA 1AU9A 4POOA 1JJAA 4HZIA 4K6HA 5JO0A 1AA6A 2P69A 3LBYA 3OFJA 3TGWA 1P7CA 1Y1RA 3GF4A 1B8UA 4QULA 2QN8A 1J07A 1UKBA 1JKJB 1M2EA 3KYCA 4LS3A 2Q8NA 4ARZB 4YCNA 3IKVA 4BVBA 4GL2A 1V2HE 1PNOA 4LJ5A 3DJFA 1YS6A 1KI7A 3IUMA 3AIIA 1F17A 5E6RB 3OQNA 5BSFA 5CLJA 3TAHA 4JI8B 1MO6A 1UDCA 2VSQA 4WLVA 1F2TA 5AJHA 5BNFA 1VP3A 3PUYA 3RT7A 3WYDA 4XWOA 2G08A 3KQMA 4M1YA 3ANYB 1AZWA 5DKFA 4RX1A 1A77A 1KBZA 3IP5A 3PWKA 4PG6A 2ZS8A 5GM1A 1TW2A 2V6BA 3ZIAA 1MAAA 4KIWA 2OYCA 3OECA 1FFXB 3OOWA 4YX9A 4EUKA 2ZTMA 3GQVA 1KNQA 2RGEA 4HSEA 5I51A 1USUA 5DLDA 1UQUA 3J80A 3D8TA 3PQ3A 1QK5A 4H7HA 3H5AA 4M46A 4Z3DA 1U5BB 2VN8A 4JUDX 3WIDA 2MINB 2H1OA 1XCPA 2HMWA 3U9LA 1KEEA 3NGMA 3KT6A 3ERCA 5P8WA 4ZXFA 1OBOA 1FJXA 1EJ6A 2QQGA 3NYWA 1O2DA 3E7DA 4ISBA 2LPMA 1PR9A 3H2HA 4Z4HA 3NT5A 2J3QA 1OYYA 4IVNA 1OAKA 4MKGA 1SZDA 1M6NA 4L28A 1T1IA 4HDCA 4OK3A 5F4BA 1Y5NA 4U7FA 3A1CA 3L0ZA 2C96A 4JL6A 3FMGA 2HKIA 4NHOA 5KOHB 3CNLA 5COBA 1T4CB 4U6SA 2JEZA 5KKAA 5JH7A 2NU7B 2PV7A 2VYND 5ED0A 3LHSA 3VVMA 2QAGC 2XTAA 4B9EA 3NP7A 1N9KA 1ANKA 2ASVA 4XDYA 1MNAA 5LQKA 4DPMA 4XKJA 1IJFA 3P1JA 4L75A 1DWQA 2XOKD 2ZDQA 4HLNA 4ZYZA 1DJOA 1RJGA 1I2BA 1ZGGA 1VHQA 2PGXA 2VK2A 2VP4A 3O82A 4FFBA 4GR4A 4MYHA 3KL4A 1N5MA 3W4IA 1ID8A 2H00A 4XYEA 4Z9XA 5KC9A 3ZKWA 5EZYA 1IEWA 1QC5B 3EEIA 5T4FA 1W0JD 1OTHA 3KZNA 1Z6XA 2COKA 2BMDA 1XQYA 2XHEA 3JQ8B 4GYKA 2IYYA 1K7YA 3DZ8A 4U2GA 2Y1WA 2NOAA 1OAAA 5FBRB 5JDIA 1KVSA 3E1GA 4DCCA 3IL2A 2Y1CA 3H9CA 1V11A 1Z4QA 4JNCA 1EINA 2JPDA 4URWR 4HDNB 2OFPA 2P2DA 3H2IA 1V43A 5I9NA 3PENA 3CRMA 5CW1A 2GXAA 4J1TC 4YV0A 4RLSA 1JBQA 3BMOB 3HCOA 4JI0B 3ZDQA 1MC1A 1Y1KE 1KFJB 1W88B 4CTKA 4ER3A 4EYQA 2C9CA 2VQFB 1NC1A 1DGQA 2G1KA 2QG4A 5DM4A 3G5AA 1NNI