3NWOA

Crystal structure of proline iminopeptidase mycobacterium smegmatis
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
299
structure length
299
Chain Sequence
b'SSRTVPFGDHETWVQVTTPENAQPHALPLIVLHGGPGMAHNYVANIAALADETGRTVIHYDQVGCGNSTHLPDAPADFWTPQLFVDEFHAVCTALGIERYHVLGQSWGGMLGAEIAVRQPSGLVSLAICNSPASMRLWSEAAGDLRAQLPAETRAALDRHEAAGTITHPDYLQAAAEFYRRHVCRVVPTPQDFADSVAQMEAEPTVYHTMNGPNEFHVVGTLGDWSVIDRLPDVTAPVLVIAGEHDEATPKTWQPFVDHIPDVRSHVFPGTSHCTHLEKPEEFRAVVAQFLHQHDLAAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
molecule tags Hydrolase
source organism Mycobacterium smegmatis
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
total genus 113
structure length 299
sequence length 299
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nwoA00
2C4HA 4X00A 2JEYA 4Y2VA 3ESCA 3G9UA 4B9EA 4K6HA 1QO7A 5BWBA 5FV4A 3BWXA 4N5HX 3WKAA 2ES4A 5HQ3A 2C0PA 4YPVA 4BE4A 1RYYA 4Y2RA 5AI4A 5T4FA 4TVKA 2GBFA 1U4NA 4HS9A 4DMCA 1VA5A 1MN6A 4A16A 1WB5A 5JAHA 4N8EA 2WG1A 1R1DA 5JIBA 2XQKA 1XZAA 3WKEA 3Q8WA 4UFOA 2IITA 4W1SA 2HDWA 1WB6A 3PI6A 3DYIA 2C5FA 1QZ3A 1ODSA 3T4UA 3ED1A 4X92A 3VJMA 1XZJA 4X91A 4C89A 4X90A 3A2NA 2QJWA 3DL4A 2Q0XA 4KJXA 2ZYSA 4F21A 4KE9A 1AC5A 1JJFA 3OTQA 1XLVA 2H7YA 4ZXFA 3QPCA 2WHRA 5LZ9A 3SK0A 5IVIA 3STVA 1L7AA 1EVQA 4FOLA 1YSCA 4BVKA 3KWFA 4Y2TA 5CTAA 5AKZA 4HXGA 4I4CA 1BROA 3IA2A 4PV7A 4QDTA 2RHWA 3CXUA 3WZMA 5LYYA 2HA6A 3WL5A 1YS1X 1A8SA 1K63A 3ESAA 4U2DA 2OQVA 3JW8A 1JKMA 1UK7A 3BDIA 4LHEA 4PSCA 5CXXA 4KRYA 1L7QA 4NZZA 5SYMA 1U8EA 3H18A 2XUKA 3PFBA 4WDQA 3O9MA 1ZI6A 1H22A 4G8BA 3WL7A 1EDDA 2JGIA 1XZFA 3FCXA 5D6OA 5DNUA 2WFMA 5EIEA 2H9YA 2OGZA 2R11A 2GBCA 3C43A 5AK4A 3WKBA 3MGAA 2WSLA 1UOOA 1CUZA 4FBMA 1J07A 5IVKA 5ALFA 2R8BA 2HHAA 3ESBA 3H2JA 3I6MA 4CCYB 3K9BA 2OAEA 4QE3A 1G42A 3NOXA 3AILA 2XT0A 1W75A 2H1IA 2XUAA 3F97A 1W76A 3LP5A 1XRQA 3H1BA 3WK6A 5I8PA 1UK8A 1ZD3A 1MX5A 4UUQA 4AN0A 3V1MA 5BWCA 4ZREA 2VAXA 4HTAA 4KE7A 1BN7A 3ZLVA 5C8XA 2JGFA 3AIOA 3V1KA 1WM1A 3OG9A 1A88A 3M3DA 5K3AA 2OGSA 5EHNA 4LIPD 1TIBA 3AUKA 5DYWA 2WIFA 5BV7A 5C7YA 1NU6A 1GXSA 2ZYIA 2K2QB 2WTMA 2BJHA 4G4JA 4EUSA 4WY8A 1K8QA 3FVTA 3RARA 4UBJA 3W9UA 4UHDA 1CUFA 3G9ZA 5DNVA 2VJAA 1RWQA 2CB9A 5HFAA 1OCEA 1TKRA 5JZ9A 5K3EA 1YAJA 3V1LA 2YXPX 1X2BA 3I2HA 3PICA 3C6YA 2B20A 3OM8A 3TRDA 5K3DA 3MVEA 3H0CA 5JAOA 1YA8A 4GLBA 1AURA 2OLEA 4B83A 3C6ZA 3AIMA 3DDUA 2WLSA 5C8VA 4DNQA 5HZGA 5IVDA 3AINA 4OPMA 3C87A 5AI8A 2DQYA 5KBYA 4L0CA 1QO9A 4BC0A 4JYMA 4GI1A 3WK5A 1U2EA 3W06A 1HDEA 3D0KA 4ZV9A 3RLIA 4QDUA 3K2IA 1CR6A 5AM4A 4XX1A 3GFFA 1VE6A 3DJYA 2H7CA 1G66A 3G0CA 1BE0A 4X3CA 2D0DA 3I28A 5CRIA 1DWOA 2PSHA 1ZI9A 2OCIA 5EI5A 3WYNA 1YASA 3G7NA 1XRNA 2ZJ6A 4FMPA 3ZV7A 5JZSA 4QDZA 3E4DA 1Y37A 4LXHA 1AX9A 4H77A 4K6KA 3DNMA 3R40A 1XQYA 3CCBA 4EB0A 3QM1A 1MPXA 3A2MA 1P0PA 2ROQA 5E4JA 4H7EA 2DSNA 3BIWA 4QEKA 2HA4A 5JATA 1CLEA 3R3ZA 1DX4A 3E3AA 3IB3A 1GT6A 3WWPA 1KEZA 2V97A 1MX1A 3QZUA 5EHZA 3PE6A 1P0QA 3VJLA 4DSAA 4OB7A 1SCIA 3LIIA 4QDOA 1QIEA 4W1PA 5LZ2A 5IKXA 4E46A 1CUGA 4LYDA 5HKBA 1CUHA 4I19A 2BAGA 3W04A 1JJBA 1MAAA 3V9AA 4EY7A 5JD6A 2WHPA 4BE9A 5AM1A 1PJAA 1CFJA 3UMJA 1CEXA 2CKMA 1Q83A 3EBLA 4LXIA 1MX9A 3STYA 2I3ZA 4CFSA 2IX9A 2WJ3A 3H04A 3I2IA 1VJ5A 3H2HA 3R3UA 2WKWA 4HRYA 2HADA 3C45A 5AOBA 1PV1A 5DYYA 1Y7HA 2GYVA 4X97A 3X3HA 2XUFA 3RM3A 1EK2A 5AK6A 1XRLA 2BUCA 1GPKA 3HYSA 1BU8A 5K3FB 3GUUA 1FFEA 4BAZA 1XRMA 1LNSA 3BXPA 4JH0A 2XLCA 1E8NA 1QIJA 3FVRA 1QJ4A 3DQZA 5FXMA 1JJIA 3U0VA 1XQXA 4G9EA 3E0XA 1HQDA 4A23A 2PVSA 4LXGA 4NMWA 5ALKA 2XMRA 4X95A 1TCBA 3FCYA 1IZ8A 4J0DA 2O2HA 3HACA 4IH9A 1I6WA 6YASA 7YASA 4QLOA 2VA9A 4Z49A 5LZ8A 5AJHA 3D5EA 3IUJA 4OYLA 2ACKA 3NGMA 2J3QA 3LCRA 4J0CA 2ZSIA 1VKHA 3G0BA 1OILA 3BF7A 4WFIA 2VT6A 3V1NA 5K5EA 1XZIA 5FKJA 3B12A 3R3VA 5JD4A 1BRTA 4H18A 4DMFA 3W05A 4MJ3A 1BEEA 4HXEB 4F0JA 5HK9A 5CT4A 5C8ZA 2ECFA 3D2AA 4DGQA 4INZA 2VSQA 4BRSA 4WDRA 4YX9A 4C4XA 2GYWA 1XZCA 1KU0A 1AMNA 2XUDA 3DOIA 1CUEA 1R50A 1DT5A 5HF5A 2XMBA 1QIIA 1J06A 3HZOA 4LKOA 5C81A 1ZGCA 4B7ZA 3AIKA 4X6UA 1Q0RA 1DQZA 3WI7A 5LZ4A 3ZPXA 1IZ7A 3VKFA 5AM2A 4EY8A 2JGKA 4GEGA 2VF2A 1GKKA 4BZWA 4QZVA 2G63A 5HF9A 5A6VA 3BIXA 2WUFA 3B3QA 4DLNA 4WY5A 5LLSA 4M0FA 4AZ3A 5AI9A 3NWOA 2HA2A 2RIPA 2PBLA 5LKRA 3EF3A 4FWBA 4U2GA 4DIUA 4FHZA 4BTVA 2C58A 2J4CA 4E14A 3WLAA 5AH0A 4JYPA 4D9JA 3QMVA 4AX4A 2EDCA 3H2KA 5JADA 4GBGA 3DCNA 1LPMA 2G4LA 1QIFA 1FFAA 1E3QA 5EGNA 4BZZA 3BL8A 5E4TA 5T4EA 1BN6A 2ONCA 1CRLA 2OCGA 2ZYRA 3STTA 3G0DA 1RP1A 4ZGBA 1FJ2A 3WIOA 3BJMA 5ESRA 1F0PA 1C7IA 4E15A 2WFZA 3WWOA 4B80A 1JMYA 1UKCA 3MUNA 4KEAA 4O08A 1Y7IA 1CUSA 4H7IA 4Y7DA 1DINA 1HPLA 1LPNA 3OURA 4AO7A 3EQ7A 2WIDA 4EA6A 2XUPA 2XUOA 2O7RA 3SC2A 4I3FA 3FYUB 3C8HA 4Q05A 5ALSA 2XMDA 5HFNA 5ALRA 1ETHA 3QPDA 3C5WP 5D7BA 2XQFA 2GZRA 4AO6A 3LLCA 3V48A 2X5XA 3UUFA 3M82A 5A7HA 5CW2A 1GQRA 1W1IA 3IBTA 4N5IX 3ANSA 4FTWA 4X94A 4ZWNA 4OU5A 4QWWA 4P93A 5ALPA 3FSGD 2VQ6A 2Z3ZA 1ISPA 2DQZA 1L7RA 1LBTA 1QLWA 2GBGA 5CXUA 5DNWA 2GZSA 3IULA 4RNCA 2AJDA 2QS9A 1A8UA 2XB6A 4KYVA 3QITA 5ALVA 3O9VA 1K4YA 4FLEA 5AM3A 4KE8A 4KACA 1K5PA 2PX6A 2QUAA 1EDBA 2HA7A 2PU5A 4HZGA 1TRHA 4B0PA 2AJBA 2PPLA 1XRRA 1IVYA 5ALYA 4W63A 3C5VA 1CQWA 2HL6A 3BF8A 2OG1A 1MNQA 2OCLA 1F6WA 2ZVDA 4FNGA 4PSUA 4Q1VA 1VLQA 2BGRA 1ORWA 4BATA 2HU5A 1CQZA 4JNCA 1QIGA 1SCQA 2B4KA 4OD0A 3HI4A 5AKJA 1JI3A 3D4LA 3DEAA 2FUKA 5ALJA 3I2JA 1HLGA 2RONA 1P0IA 1A7UA 3D3NA 1THGA 4MEBA 3BDVA 4QWMA 3JWEA 5CH8A 5CH3A 3TJMA 2OGTA 1CV2A 4J0JA 1R3DA 4L72A 4B84A 4MWSA 1FFDA 3G0IA 2WQZA 2B61A 5FOQA 4J3JA 5K3CA 2XMZA 5JASA 5CT8A 4BTLA 5EIAA 2DFPA 1JU3A 5BOVA 4AN1A 2PSDA 2QM0A 3G9XA 2VAVA 2BCEA 2PSFA 4V2IA 4BP9A 1Z68A 3DLTA 5JD5A 1G4HA 2QUBA 5LZ7A 3F98A 4DNFA 1AKNA 4YK7A 1B6GA 2CUTA 4AO8A 2RI6A 4PNZA 1W4LA 3FYUA 3FLEA 3AZPA 3DYVA 3C6BA 2PL5A 2Y2UA 2WIGA 2PSEA 5JAPA 5ALXA 4PSDA 3T52A 2YYSA 3RK4A 3KWJA 5AP9A 2XLBA 4F5ZA 2ZJFA 3WA7A 1QFSA 1MO2A 1BEZA 1CUUA 2X76A 4C4YA 2BUAA 1QIMA 3VISA 3WMRA 2JF0A 3RKSA 4ARBA 1EB9A 5AKEA 3FAKA 3M81A 5T4HA 4Q3LA 2Z5GA 3U1TA 3DKRA 2JEZA 2I3DA 5LIPA 4ETWA 1YR2A 3PDCA 1GPNA 5JANA 1LPBB 4E11A 4JUIA 2W6CX 1ZJ4A 5SYNA 4Y2QA 1H2ZA 3HEAA 3HXKA 1N5RA 4RE6A 3JYHA 4RE5A 1GPLA 4UPDA 1H23A 1ZOIA 2WIJA 1MJ5A 3BJRA 2AJ8A 2JIDA 4Y2PA 3VDXA 1ODCA 4C88A 4B0OA 1YB7A 3QPAA 4H7KA 2WG2A 3R3WA 2GYUA 5ALWA 2RHTA 1MNAA 1BCRA 3DL7A 4KR0A 3K6KA 2XUIA 5A7GA 4Y2JA 3EQ8A 3IUMA 1MU0A 4X7BA 1XKTA 2WU3A 3R3YA 5A62A 4OU4A 2CMFA 2AXEA 1DTEA 2WG0A 1QTRA 5HF8A 1XQVA 1HBJA 5I7UA 2QVBA 2XMCA 4UHHA 3CN7A 1H2WA 3G02A 4UBMA 1CUDA 3PFCA 3HRHA 3O0DA 5JALA 3IDAA 2DR0A 2DCMA 3WKDA 1MTZA 4BVLA 3FWHA 5FPQA 4AZ0A 2DHDA 2XQIA 4CG2A 2Z8ZA 4IHAA 1T2NA 1JMKC 1LPAB 2WHQA 4B6GA 1AZWA 3GROA 3R41A 4TGLA 1ZD4A 1X70A 4QA9A 2HU8A 3KD2A 2HU7A 4U2FA 5LZ5A 3WYDA 2I78A 1ZI8A 4GWLA 3LS2A 4G4GA 5JAUA 4M0MA 2VJDA 4PW0A 3SWWA 4AB1A 5ALZA 3I2KA 4Q34A 1O6FA 4ARAA 3PUHA 1CUXA 2QTBA 1SOMA 2QJRA 2FJ0A 4DNOA 5AM5A 5E2IA 3KSRA 4X71A 5EHXA 4DSZA 3GZJA 2HRQA 5AI6A 4JEIA 1LPOA 2WU4A 5IH7A 5HF6A 4Y2UA 4FKBA 4ZV7A 4CCYA 4FFVA 3I2FA 4FNMA 1VA4A 4EBBA 3CCCA 5ALHA 1LZLA 4UBLA 4H7FA 1LPPA 4G5XA 2Y6UA 2HA3A 3D2BA 2WUGA 3EIOA 3AJAA 3A2LA 2CJPA 4GECA 1XZDA 2OCKA 4G4IA 5AI5A 3H2GA 1E5TA 1JT2A 1UKBA 2J3DA 3NUZA 4QLAA 2XE4A 3WL6A 4J7AA 1EI9A 4H7JA 4WCVA 3DS8A 3OPMA 1DWPA 3GELA 5I9IA 2EDAA 5AOCA 3H1AA 4IQ4A 4CG1A 4W1RA 3ZI7A 2WHPB 1XZMA 3N2ZB 4FLFA 4Q3KA 1H2YA 4HVTA 3AZOA 1XROA 4Q3OA 1DQYA 5E4YA 1XZBA 1AQLA 1ZGBA 4B82A 4BCBA 3A6ZA 2WJ6A 3YASA 1SC9A 3WQHA 4EY6A 3KXPA 1QIDA 4Y2SA 4CI9A 3WZLA 1Q84A 2JGEA 1UK6A 1WHSA 2DHEA 4H0CA 2QT9A 3I6ZA 4MQLA 3UUEA 2HFJA 2C7BA 3D7RA 4HRXA 1O6GA 2WM2A 5DTJA 5LKAA 3PF9A 4K5QA 5FRDA 4J0HA 5AKKA 3HJUA 2NW6A 4CIAA 5AM0A 1WPRA 1E66A 4UFPA 1YCDA 2PKYX 5ALQA 5DWDA 2FJPA 3PF8A 3B5EA 4UFNA 1GGVA 4J0GA 1X2EA 5LP1A 1U65A 3G0GA 5AIAA 4XVCA 1EK1A 5K3FA 1N5MA 1YS2X 4H35A 1HKHA 5F4ZA 5AICA 5ALDA 2AJCA 1CUBA 1N8SA 3DD5A 3FLBA 1Q0ZA 1CUVA 3BE8A 5DYTA 3FOBA 5J3JA 2V9ZA 3HSSA 2G5TA 1R4ZA 3I2GA 4BCDA 3STXA 3KOOA 2ZSHA 4FBLA 1XZEA 5EFZA 1XZHA 1XFDA 1D07A 1C4XA 1F8UA 2QRUA 4H7DA 2OPHA 3WWCA 1XQWA 1K6EA 1ORVA 3FSGA 4ZRDA 3DKKA 2JGLA 2QR5A 4K2AA 4IH4A 2WUEA 1QTIA 1ZICA 1R88A 2BGNA 4BAGA 5CH5A 1TCCA 4MQMA 5CT6A 4N8SA 5EHQA 2CZQA 4UBOA 4P92A 3FBWA 3AFIA 2HIHA 5KWJA 3O95A 4BBZA 4MXDA 1SCKA 5HKAA 1IUPA 1VXOA 4P9NA 4DYHA 3H2IA 3WK4A 4X85A 1VXRA 1CUAA 1UK9A 1YAHA 3AZQA 2OAGA 4N8DA 2C5GA 2Y6VA 3ICVA 5FUMA 4BAUA 4LYEA 3S2ZA 2XQGA 1F0NA 2RAUA 1WCYA 2QXUA 4OCZA 2WIKA 2VTVA 2Y1KA 4U2CA 5FP0A 1LPSA 5ISMA 4M0EA 2VJBA 1CUCA 4C01A 2D5LA 5K3BA 5AOAA 4OYYA 5A7FA 1TK3A 5KREA 2CBGA 1QIKA 4MWTA 2E3JA 2ZJ7A 4Y9SA 1THTA 2WFLB 1CPYA 4C6HA 4A5SA 5YASA 3I1YA 1EDEA 3F8SA 1UWCA 4L9AA 4J03A 2B9VA 1EVEA 3OC0A 1LLFA 4G8CA 4CCWA 2Z3WA 3WK8A 2XUGA 3VXKA 4EHBA 3ZLUA 5CBKA 3O4HA 5AIBA 5AKGA 4S0XA 1LGYA 3FLAA 1CUWA 5DJ5A 3IIIA 1XKLA 2EEPA 4AMYA 1TAHA 1DU4A 1FSSA 5DLPA 2QMQA 3WWDA 2X8BA 4BCCA 2JGMA 2Z8XA 3W9BA 1UZAA 4DNPA 1OXMA 1ZD2P 4W9RA 3GBSA 1EHYA 1XLUA 2VATA 2VJCA 4WFJA 1DWQA 3ICWA 5AO9A 2PUJA 3A70A 3O4GA 1TCAA 4WFKA 5FDFA 1P0MA 2HA0A 1ZJ5A 2P8SA 4MEAA 4QNNA 4GW3A 4U2BA 2OQIA 1ZIXA 3VVLA 3FYTA 1XZLA 3I6YA 4UHEA 1FFCA 3R3XA 2PSJA 3KDAA 1M33A 4IH1A 2XUJA 1XRPA 4X93A 5HK8A 4X6YA 4J0IA 1EB8A 4G8DA 1WPXA 2PM8A 1GZ7A 5DTIA 1QONA 3QYJA 2JBWA 4OSEA 3Q0TA 2V96A 3QVMA 1VOTA 2BKLA 1MAHA 4CIBA 2V98A 2BFNA 4GXNA 3WK9A 3G9TA 3IVMA 3FYUC 3L1HA 5AKXA 4C87A 2HRRA 4PO3X 5KWIA 1EX9A 2QKYA 2VEOA 3QH4A 4IO0A 1QIHA 4Y2YA 1UOQA 3H19A 1JFRA 3EQ9A 1T4MA 1CVLA 1QOZA 3QMWA 1WHTA 4XWGA 2O2IA 4BC1A 3QMMA 1UOPA 4RPCA 1CIJA 3D59A 3WWEA 3P2MA 5A2GA 1XZGA 1UT6A 2XMSA 4UHFA 4WJLA 4EY5A 2LIPA 2CEKA 2XMGA 5ALIA 2J4FA 2WJ4A 5D3ZA 5D3KA 5HCUA 3WL8A 5ALUA 2PU7A 2XDWA 2FX5A 3WIBA 1QGED 4UHCA 3ZWQA 3S8YA 5CURA 3HABA 5JZBA 4BB0A 2PUHA 4L3WA 4EZIA 1USWA 1ACJA 5FLKA 4KAFA 3VJKA 2WILA 1WOMA 1ZIYA 1LZKA 3VVMA 4DMKA 4BDTA 2ORYA 2G5PA 3I1IA 4FFWA 1MT3A 3CN9A 5AI0A 3STWA 4DTCA 3FNBA 3WK7A 3ANTA 2GBIA 4UHBA 1UFOA 1KU6A 2W22A 1J2EA 3HC7A 4TPKA 1VZ2A 4B85A 1CUYA 1QFMA 4GDMA 3OOSA 3TGLA 1W6RA 2HM7A 4RGYA 3F9CA 4KE6A 2O7VA 3TEJA 2QOEA 1H2XA 4K6GA 4NS4A 5CT5A 2I03A 4AQDA 2VT7A 4DMHA 2WTNA 3WKCA 2AJLI 5ALNA 1WB4A 4KRXA 1ZD5A 5ALOA 5JARA 4W1QA 5EIHA 4OUKX 4MYSA 4KAAA 1IUOA 4UBIA 3LIPA 4FLMA 2XUHA 4F60A 1E8MA 4OB8A 4FDMA 4HAIA 5T4BA 3W2TA 4AXBA 1J1IA 2YH2A 4MYDA 4BDSA 1ACLA 4ROTA 5ALTA 5ALMA 2Y2VA 5A71A 3N0TA 4NVRA 3STUA 5HQ3B 2DHCA 2C0QA 1R9NA 1XZKA 2IIVA 3E1GA 1B41A 3WA6A 1GQSA 1E8DA 3F96A 5ALEA 3SX4A 2QXTA 3ILSA 1PFQA 2RGUA 4CG3A 3R0VA 1S8OA 2BUBA 5AHXA 3IUQA 4ITVA 1VZ3A 5IVHA 2WUDA 4Q82A 4EY4A 4G1FA 1CUIA 4P08A 1DT3A 4B81A 3GA7A 1NX9A 4UBKA 3WJ2A 2HFKA 3O4JA 4KAJA 1YB6A 4H7HA 5AKIA 3HLKA 5ALGA 2HA5A 2YASA 1UKAA 1ODTC 3C8DA 2XUQA 3L1IA 5AK3A 2WFLA 1JU4A 1IMJA 1EXWA 4DM7A 3WJ1A 4YASA 1E89A 3D2CA 3G8YA 3IURA 3O4IA 1XLWA 1BS9A 5AKHA 1LBSA 4BP8A 4BRZA 1R9MA 1EH5A 2O2GA 1YA4A 5AK5A 1CUJA 5CT9A 3M83A 1DX6A 4PQEA 1FFBA 3C6XA 4J0KA 4XIIA 5ALLA 1IUNA 4X6XA 3IUNA 2ACEA 4ZI5A 1AUOA 4U2EA 3MUOA 2UZ0A 4AMZA 3L1JA 3PUIA 1W52X 2QZPA 4PF1A 1QE3A 2ZYHA 5AKLA 3QBJA 4XJVA 1AGYA 1N1MA 3ZLTA 5JYCA 1BCSA 3F67A 4HXFB 1VE7A 1TQHA 3DOHA 4OB6A 2H7XA 1G5FA 1GKLA 2XQJA 1EA5A 4QDXA 3H17A 4G9GA 3C70A 4BVJA 4C4ZA 4GHWA 2XI4A 5H3HA 3ESDA 1SFRA 5FPPA 5CMLA 4B9AA 4UBNA 4BYMA 1C7JA 2OXEA 2JGJA 1HL7A 2XMQA 1UXOA 1NU8A 1A8QA 5AKYA 1EINA 4Y2XA
chains in the Genus database with same CATH superfamily
2C4HA 4B32A 2NO1A 4DVGA 3KAKA 3IAS6 3UAWA 3QYAA 2XNSA 1ZM4A 4A8JC 1V6AA 2IEGA 2XNKA 3RKUA 3LVBA 1WL8A 4DV1B 1X1EA 4L75A 2Q4TA 3G9UA 2QLLA 4BB9A 2WYUA 4BNMA 1PS9A 1SZJG 1S3SA 2EOAA 3UCEA 4AS2A 4ZJZA 5BWBA 2GZMA 3JCZA 2VG8A 5LMNB 3Q4GA 4L0DA 5CNKA 2Q1YA 5EG5A 1KVUA 2W2VA 4PHFA 1IQ0A 1KI4A 1GZ3A 3ENVA 3GZ4A 1V9SA 5AHKA 4BQNA 4AKGA 3VBEA 2BMWA 2V7QD 2H2IA 2WV9A 4TROA 1A9PA 5BNWA 4H3KB 3OEWA 5JU6A 2WKQA 1MQAA 1L4HA 1NN1A 2FUEA 2B0CA 1IQRA 1NPTO 2J5QA 5HRCA 3VPXA 3BWMA 3FMGA 2WKSA 5CVJA 2KLBA 4JC8A 2ENWA 2CLHB 5CFOA 2GBFA 1U4NA 2UZAA 3S2IA 1DEXA 1NVVQ 4BEJA 5K51A 1RYEA 1U0JA 1HF3A 2Q3DA 2WF5A 3A05A 4J9UE 3M2TA 3VR6A 4KNYA 2BCGY 4M9CA 4FXOA 2O3JA 4ZODA 3BEDA 1ZONA 4HN2A 2O2YA 5JAHA 1TVCA 2ODPA 2EG9A 1IHPA 1NVGA 2K2WA 1G7TA 1AKYA 4JELA 1WTCA 3N07A 4B3TB 4WW0A 3Q3EA 1VHJA 4IXTA 2CL0X 3DGEC 4B71A 5FLEX 1N5LA 3OIFA 1MABA 1MQ9A 1GRVA 1O8CA 2H4JA 2NVBA 1NXQA 2WE7A 4FYYA 3L0CA 4KSYA 5C4GB 3S27A 3RTBA 4W1SA 3R0IA 3ZV6A 5SICE 1TW3A 1JR6A 3DH0A 2ID8A 3WQQA 2HXYA 1DTSA 3R7DA 3HHEA 3UNXA 4I1UA 4AT1A 3E9EA 2WVGA 2YZ7A 1OAOC 1QZ3A 3B6JA 2FGJA 4TYNA 4OI0A 121PA 4B3DA 2DGDA 3D1JA 5DK6A 1O5TA 3L8MA 2P9TA 2DBQA 4P0TA 1C2YA 3GRZA 3BHIA 4AS1A 1S02A 4LXTA 2LCFA 2QJWA 1U1GA 2JFVA 4JN6B 3OHSX 2HN9A 2WYOA 2QW1A 3IQXA 1Y8QA 1NF2A 1Y8QB 1JAIA 1MB3A 1QYDA 3QK7A 3CKYA 3PHIA 1QE0A 3BBLA 1TVMA 1Z6XA 4MYCA 3U4CA 3G82C 3P0RA 4L73A 4U7WA 1FDOA 1E1NA 3OTQA 1MV8A 4B4VA 5I48A 4OTZA 3U7HB 4AZWA 2O5RA 2V3CC 2JI4A 3UIEA 3JS5A 3H5OA 1G6HA 2OBXA 1P17A 1TTQB 3SK0A 1BE1A 4K05A 3V1UA 4EMBA 1KJYA 2DXIA 2I2DA 3IIEA 2IPLA 3ZCUA 5F23A 3WAKA 2KQUA 2O20A 3BTOA 1XZ8A 2PKXA 3W5DA 2G9ZA 4LCEA 4BVKA 5SYAA 2OXIA 1ZJZA 3TRIA 2ZSJA 3AF0A 3CJQA 2XYRA 5GJCA 1KL7A 4Y6LA 2NADA 2Z4TA 1UINA 3ZHZA 5CTAA 5AKZA 4EX6A 1FUIA 1SGWA 1PR5A 3CX4A 3CZ9A 5EJFA 1BROA 1DKOA 3UB3A 5I5EA 1Q44A 3O21A 1I7PA 5JO0A 4PV7A 2NSDA 1BMFA 3IAM1 4L27A 5E7QA 5EMKA 1T6NA 2H92A 1H05A 3WB2A 2X77A 4Q16A 2IBSA 3K15A 1RWPA 4D26A 3CXUA 5A3RA 4ID9A 2HA6A 3E9ZA 4KVFA 4R9RA 3T15A 1QK5A 1YS1X 2FEPA 3BE6A 4GZ5A 2NUAA 1XMSA 4UDNA 2EIHA 4MUXA 2P2CA 2OQVA 4LS3A 4A27A 1GAQA 3JW8A 3COVA 2D62A 4K9MA 1NVAA 3RJ9A 3WQBA 3FN4A 3UK7A 1AH2A 2ZRNA 3CH5A 5JISA 1UMKA 3PQCA 4HJXA 3NHBA 4HO1X 4EG7A 2B69A 2NTYC 1TU0A 2JJ2A 4NP6A 2CYCA 1T0JB 4B2YA 4MKIA 4RTSA 2V8BA 3QLUC 3TR6A 1XWFA 3ZZNA 3DOJA 1FFGA 2PZLA 3H11A 3GJ3A 3SHOA 1ZI6A 4DPMA 1Z25A 4UAJA 3RSOA 1TJ4A 5ICGA 5IKMA 4FCVA 3SJ7A 4ESVA 5T3YA 2IH2A 1IPEA 3DC2A 1EX1A 2RMKA 2OO5A 3L01A 3U7RA 1DOAA 1J1UA 3ABQB 1KY2A 4RSGA 2DR3A 1NSFA 3R8XA 3BG5A 1JIQA 4AK9A 4ZU1X 3FIJA 4ZO9A 3SHWA 1H2RS 1JWAB 4KQFA 4UQPA 2CVQA 3R7AA 4YUZA 4EMTA 1QDLB 3LLSA 5DNUA 5I7RA 1P3JA 2P7IA 4NKRA 2F6RA 2H8GA 2YFYA 4KK4A 1YH3A 5HJ7A 2WFMA 1N5KA 2OGUA 3ENQA 5EIEA 3IESA 4ILEA 4ECAA 3FH0A 5C5CA 1ZH2A 3C1OA 2XT9A 3WMXA 4F97A 4ZHQF 2PSSA 1HDIA 2J0EA 3IT2A 4EUFA 4F6RA 5AK4A 3QIVA 3Q41A 2R5FA 3OIGA 4JBIA 2OZVA 4NU6A 2GF2A 4ZFNA 2DB3A 1NVUQ 3EZLA 1F51E 1UOOA 4KMOA 3HXQA 1HEYA 1YB5A 2WYVA 3MRVA 3OA2A 4TX1A 2D4HA 2CMKA 3EWAA 4WGGA 4XVRA 1ZUWA 3OPYA 3ANLA 2Q3FA 1VYVA 3ESBA 1G7SA 3LVQE 3C4VA 4NONA 4O1IA 3ZVKA 3RS0A 3H2JA 4WQMA 3G85A 2LCIA 2OAEA 2VO1A 1QHHB 1PNQA 4NOKA 4BNDA 5HZKA 3W6ZA 4RHEA 3KZOA 3GLTA 1UWVA 3OQHA 1Q21A 3UGQA 3AR5A 3T7SA 5DGXA 2DAPA 1W75A 5BMVF 5HOQA 2QGZA 4D5EA 4D97A 2ZJZA 3C5EA 5IK2D 2X8LA 3F97A 1IJBA 1FRQA 4YJGA 3RTAA 4CUZA 1BHJA 1V9LA 3A1VA 1WXGA 4POAA 4DRZA 4EECA 5JVDB 4WE3A 4F06A 4H7PA 3SXUA 4HVLA 1V7ZA 3OWXA 1UK8A 1DO8A 1D4OA 2CV0A 3RHSA 1ZD3A 1U4SA 2VOEA 2F3SA 3OUUA 4AN0A 1HURA 1UMDB 3DBIA 1T5OA 3DTTA 4IVPA 4CLHA 4BNHA 2IYXA 4OX9B 1B1CA 2VAXA 4HTAA 3VOSA 1P5JA 1YL7A 3KJXA 4BFYA 3BSSA 4YP9A 1SVMA 3V1KA 4OGWA 4QBGB 4DB4A 4R05A 5FBZA 1QPZA 1WM1A 3V5NA 3NTXA 1A88A 5K3AA 4FYPA 5BY2A 4WECA 4B6QA 4LZOA 2QM3A 3UGTA 2H2FA 2WF7A 3I83A 1HE3A 3NC1C 1RU3A 4LSWA 4RTNA 5EHNA 3NTUA 1E62A 4YMVA 1TIBA 3V7NA 1DRKA 2W9XA 3AUKA 3SSNA 1PNVA 1DRVA 3CS3A 3L02A 1BYIA 4JI6B 4IDFA 1JR3E 1GPBA 1LNQA 3DV9A 3KQWA 1KJNA 5CUQA 1YQ9A 1BC5A 1J2YA 5DM70 2VDOB 1IBSA 3P0FA 4MI1A 3TQHA 1VJCA 4B09A 1EK0A 2I6SA 1A9OA 1K86A 1PGNA 4JLDA 4F72A 4LQCA 3H8JA 2H11A 3T7DA 5MGNA 4YCCA 4E33A 1UP4A 4OL9A 4LZWA 2ANBA 4WXEA 4WY8A 2HHLA 2XVZA 3C1TA 4GXQA 3TUZC 3L07A 4OQPA 1DB3A 1N1GA 4TS4A 2YV2A 5KX5B 3LSTA 3R23A 3ZY3A 1XC7A 3FTQA 1S2OA 4FMCF 2ZB3A 5FBLB 3RASA 1V7QA 2ZREA 2OO3A 3A7DA 4WNIA 4O2BB 4QYTA 1CUFA 2DT8A 2JJYA 3USCS 4B6FA 3BD6A 4YPFA 1FU4A 3PHCA 3CUUA 4B8ZA 2CB9A 4LZPA 1WP9A 3E3NA 4OFBA 1KMQA 1TKRA 3E9QA 1P5RA 1SCDA 4BFCA 1RRGA 4WPGA 5DNDA 5JZ9A 5DLYA 3RRNA 3V4FA 4RQBA 5K3EA 1YAJA 3S7ZA 3VYRB 2FOLA 2IS6A 4JJ7A 1TTHA 4KOEC 3CV3A 2G07A 3GUVA 3V8RA 3SBDA 4D81A 3QXSA 3TRDA 2EERA 3AKCA 1U5BA 2QYSA 4LC9A 5HWSA 3WHKA 5JH7B 1Z0FA 2XNDD 2DBRA 3AKDA 3EF0A 1EUCB 2IYAA 4GLBA 1AURA 1TM5E 5C8YA 1SBYA 2OLEA 4RA9B 1KQOA 5CB8A 3CZQA 2DE0X 5B3LA 1K2VN 4HWGA 3RRYA 4BO4A 3H4VA 4MW7A 1DAOA 1PWXA 3IOCA 3OFJA 5EUQB 1V5GA 1P3Y1 5TDHA 2G09A 4FI3F 5C8VA 3LXRA 4CVNA 5LNK6 4LJ5A 3Q8XB 3CUVA 1O54A 4JBNA 5IVDA 3RUFA 2PKWA 3AINA 4H1VA 1TM2A 3VV3A 4OPMA 3T8YA 4CIWA 2BYTA 3JAWA 2CXQA 1E2EA 3N3AC 3PE4A 1LVUA 3NX4A 2C84A 3RFFA 2IIBA 4F38A 3K3PA 2IZOA 1EAYA 2XOKD 2AFHA 3Q9UA 1KMHA 3DV0B 2R1ZA 4HK4A 3AHDA 2DETA 3F6BX 4YH1A 1M83A 5CVEA 4CKWA 2AQHA 2V4UA 2W2MA 4I99A 1VMDA 5CLQA 2PJZA 5E1OA 3NGXA 2HRCA 3W3AD 4EI7A 3PUYA 3D0KA 4REOA 3IBFA 4XZ3A 5J2TF 1GNTA 1FXWF 4PYRA 4FKMA 4QDUA 4M9SA 4CM8A 2GM3A 2AXNA 2A30A 5K0JA 1NNEA 5ARDA 3CTPA 4HWRA 5JJKA 5EUBA 2W6MA 3KYBA 1TTTA 1W2WB 3IR7A 4PLGA 1QANA 2B78A 2WDPA 2EFYA 2H7CA 4FU0A 4WWHA 3VO2A 4FSXA 1U0EA 2E4AA 3Q1KA 1M54A 4JLOA 1G21E 3WLTA 5JAZA 3AVPA 1TXGA 3WRXA 3G0CA 5FWYB 1BE0A 1E1CA 5FOVA 2EQBA 3H5LA 4P80A 3WE7A 2CLDX 1DC8A 3F78A 1XTVA 2I4NA 3E22B 1ZI9A 3HSKA 1J09A 5LP6B 1E7WA 3CH4B 1PL0A 5T7BA 3TLEA 2FMTA 4PX2A 1DO2A 3QUQA 4PYOA 1XRNA 4XWKA 4L57A 1TRKA 2C5EA 1YUBA 4RTLA 1V8ZA 1LKZA 1X8XA 1BQ3A 2I5PO 4WA8A 5HMLA 1Y37A 1JHYA 4CYMA 1AX9A 4K6KA 4JMLA 2FR0A 3K5PA 3DVQX 1ORHA 2H1HA 4K9QA 3THSA 2AOUB 2EX4A 4EG4A 1CRWG 2P9YA 4YXFA 2QN1A 2BVNA 1ZVKA 1VHTA 5JCPA 1DBQA 3QM1A 4KWCA 2IV7A 3A2MA 3KDPA 1NYQA 4PPNA 1Z12A 2H2DA 4DE5A 2GESA 3LL7A 3THRA 4US2R 3SS8A 1II8A 1T5BA 4C08A 4HNQA 4L2IA 3HP4A 1XGKA 1QP8A 3ZGOA 2BGJA 2QTVA 3D4BA 4HQLA 1IBCA 2YN2A 2BM9A 2TSYB 4ZCLA 5TX7A 3FHOA 2YXLA 4YY3B 1OFHA 4RHUA 2C7RA 2ZE8A 4ZRNA 1G8JA 4ZU3A 2HV9A 1HV8A 1MENA 2GK7A 1E2GA 3PU6A 4YDSA 3C7TA 1AN9A 3PE6A 3M6LA 4G97A 1P0QA 3F3KA 5TQJA 3WB9A 3CZRA 2O8BA 4OB7A 1WDWB 4FFSA 4YMGA 3EN0A 2AVDA 3TJZA 4WT7A 1YJ5A 1QIEA 2W2KA 1RADA 3NAMA 1KK2A 1U0TA 4W1PA 4C7MA 4E46A 4E5PA 3FPKA 1E58A 3TTWA 4JC4A 4FNOA 1Q7CA 2VDMB 4NZMA 4M1ZA 1Y7TA 4YRNA 3W04A 2F8MA 2XKKA 3O1JC 3N1UA 2Z09A 3TTTA 3JZAA 1ZOPA 3A6DA 1SBIA 3E81A 4N7BA 4DM4A 4EYSA 1YQTA 1XL0A 4RANA 5JD6A 1FYVA 4YECA 1C4OA 4ZRMA 4BQOA 2XBLA 3HR7A 1UDRA 1PJAA 1H9AA 2FPLA 1CFJA 3UMJA 4JHLA 3QU7A 4KQWA 1OROA 2GK6A 1H9BA 4XKJA 1WUYA 5D51S 5GGYA 4D45A 5C5DA 4HH0A 2PFSA 3EBLA 3LUGA 1MX9A 4ER6A 4F56A 3DLPX 5JI2E 4B4DA 3H04A 3IIJA 4RA6B 3FPEA 4K9PA 1X42A 2D2IA 4MI6A 5IJZA 1A0OA 3D3JA 3CLHA 4L5YA 4CMIA 4ZKDA 5CEJA 3RUIA 2R1VA 4CM1A 1FUEA 2MIIA 2EZ4A 5IM4A 5IRCD 2OLKA 1CHNA 2WA1A 1KXZA 4IQ0A 3CH6A 2G7ZA 1OLXA 2W6ZA 5DYYA 2I7VA 2RC6A 3GQBA 4LZLA 4MWGA 2XF2A 1TEXA 3CJRA 2X58A 5DCYA 2CD7A 3IFSA 2J0SA 1JTFA 2DP4E 1WZ2A 5LMCA 1EK2A 3DE7X 4BUCA 5LDDC 1V16B 3TD9A 1D1QA 2Z83A 3JQBA 1TTPB 4Q12A 3WFJA 3T7TA 2F8TA 3TNFA 4G1CA 1T9BA 3ZE8A 2BUCA 1ZKDA 3DWIA 4PAWA 5I4KA 1L8QA 5KJ6A 2OXFA 1Q95A 4G0XA 3MHTA 2JRCA 3TOXA 3PDWA 1LJLA 4IZ6A 3GUUA 4O4HB 1OUMA 1LK0A 4YXWA 1MHPA 2VSNA 3B1KA 3KT3A 1FFEA 4GI2A 3OM1A 4LY9A 5IT5A 1XTTA 2CBZA 2XEDA 3GJ7A 3R77A 4LOKA 5H68A 3UWKA 4C6RA 4KQKA 4L5IA 4E5VA 4X63A 1KDOA 1E8NA 1Q3HA 3IMCA 4YACA 1PDWA 3FVRA 3PYLA 3KAQA 4XVQA 1MAUA 4MRSA 4QSHA 2C42A 3WGIA 5CK5A 1E2FA 4YONB 2X5JO 5FXMA 3TOVA 5JQGF 5KQLA 2HRZA 3BB3A 4MPPA 2JJ2D 2X5KO 3GT3A 2YINC 2VA8A 1XO1A 1UKEA 1UP6A 3GV0A 1YE5A 4M21A 4M1WA 2PVSA 4LXGA 3PG5A 1T0BA 5JJLA 4NMWA 5ALKA 3JR7A 4EGCB 2EL7A 3HDYA 1MOSA 3IMGA 2GHIA 2UDPA 3PQ4A 4S3MA 1T5LA 4IGFA 3THYB 5BR7A 3Q7SA 3TH5A 2IW1A 5EXXA 5C35A 1YBHA 2ECKA 2CHQA 3HACA 5D1HA 2JK0A 4M7PA 2O2EA 3TF5A 1T1IA 4OKIA 2CN1A 2XDQB 3D3EA 3KVVA 4ZZ1A 1QS0A 2VA9A 2MJLA 2QROA 4U9HS 4YGXB 4Z49A 5LZ8A 2A9VA 5AJHA 5HOEA 1BDBA 3GWZA 3KQPA 2KI5A 5AJYA 3HXOA 3TECE 3A1CA 3IUJA 4P4SA 4HP8A 4AJLA 4CLXA 1GSOA 4KDFA 4J0CA 1WCWA 4AL4A 1Y4UA 3CX6A 5IF3A 2A59A 2YZGA 3KETA 1EXNA 4UU0A 3GJ6A 4JLAA 1J5EB 4GEKA 3A6KA 4WFIA 3T6KA 3WDLA 1Y6QA 3MWLA 2IYYA 2DFKB 5JSFA 4RM3A 1TJ3A 2YWDA 3I8XA 3U60B 3W6OA 2OWDA 3E27A 2P9CA 1S2LA 2X40A 4ZAFA 1M0EA 2PGJA 4GOXA 3FZNA 4H18A 1H0KA 1KO4A 1XTPA 2FEXA 5DSTA 1BDMA 2E4UA 1K8ZB 4RK5A 3UN1A 1U9YA 3A4IA 2IDMA 5CW1A 4MVJP 5EEHA 3WLIA 1JHOA 1SHUX 4HXEB 5FQNA 4ABYA 4DDUA 1JE1A 1CYEA 1KFJB 5CT4A 2ECFA 1KKMA 3E7PA 4ZOCA 3D2AA 3UANA 1VJ1A 3B7PA 2G9RA 1NLFA 4DUYB 1FNDA 1JW9B 2OZKA 3KPVA 1AQYA 2F9MA 1IOLA 2H9AA 1QHIA 2O2CA 2FSHA 2W2QA 3E7DA 2OECA 3JY6A 3IUEA 4QPNA 3SJUA 3UWMA 4PGMA 4YX9A 3RC7A 1UDAA 5FTWA 3WS7A 2P9BA 3EX7C 2VTKA 3KYCB 5JV5A 2F7SA 1HQCA 2I80A 2XUDA 3GGSA 4DR3B 3FG9A 1R50A 3ICEA 1CQPA 1QRAA 4NG4A 4B33A 1M3SA 3FI9A 3KR2A 3F2IA 5HF5A 4NLLA 2NNWB 3I0NA 1XF9A 5K99A 2C2YA 3HZOA 1UFKA 2J9FB 2OO5C 3QKRB 4QPDA 3KSDO 4RJIA 4OK5A 3QVVA 1R37A 5SY9A 5F4BA 3DF7A 1R8QA 1PCXA 4B7ZA 1ZP6A 2WA2A 5DBIA 3I0MA 3RAEC 1YK1A 1RR6A 2SKEA 4NHOA 5IFLA 5LZ4A 4XPIB 1MG0A 2NXCA 3GG2A 2QLJA 1QXSA 4UTXA 1PGPA 2RHOA 4IDPA 1QGYA 1E2MA 2EKBA 3HDJA 2D8MA 4L9RA 2G63A 4YDHB 1N2OA 1M6NA 3AF1A 4N5DA 3LQ2A 3ASVA 4IDHA 4NBVA 1PL6A 2FW6A 1L5SA 3JSXA 1PEAA 2DMRA 1EEHA 3CVJA 3MLBA 5C8YB 1X7YA 3FUWA 4WY5A 4QM7A 2O5CA 3EXHB 3K20A 2H16A 2V45A 4G5HA 5IUNC 4JJFA 3SSAA 4DT1B 2JD1A 1WXDA 4KFRA 1OLOA 4R2KA 5DBEX 4CKCB 1NM5C 1AK2A 2HJRA 4BIMA 4IIGA 3ZGVA 3PX7A 3F0TA 1YS7A 2RGBA 4CQMB 1IN7A 2V3VA 2BI4A 3D4IA 3DDSA 4Y2GA 5BQFA 1W30A 2XWSA 1ZL2A 2RCYA 3EF3A 3ZU2A 2VBCA 4PHCA 2C9BA 1U9ZA 1ZU5A 2H18A 4FHZA 3THWB 5B4TA 1BGVA 1Q2UA 1M67A 2R87A 1VLJA 2W6IA 3UPDA 2REBA 1GTL1 2J4CA 2Z1DA 3OPXA 4HOYA 2X19A 4R8SA 3TS1A 1VFNA 4HAZA 1HE8B 2P5UA 1PT8A 5BYBA 3WLAA 3PE3A 4JYPA 3UO8B 3BXXA 4AJHA 4PNEA 1QHEA 1TAQA 1JJAA 2Y1CA 1E9AA 3DUFB 3IJRA 3QMVA 4JX8A 4R1PA 5C18A 2C3UA 5JTTA 3H2KA 4RM2A 3QKSB 2O5EA 4ETIA 3NG1A 4PS1A 2BFPA 3DCNA 5GZ1A 2Q27A 2G4LA 2TMKA 5IPFA 1KRWA 2PXHA 1X94A 1OREA 4MAFA 4QT0A 5BSRA 4Y1RB 1KK0A 2D3WA 1DAFA 2XCLA 1NVDA 2B7BA 5DNAA 4MV7A 4YDQA 3HRKA 5JSQA 1KJWA 1XALA 2DUUA 2QL9A 4NEQA 4UZSA 4XDZA 2P9JA 3MB8A 3C3MA 2J3JA 3W2FA 4M76B 4QD3A 4RXMA 2VPQA 4JOCA 2OCGA 5AR1A 2ZYRA 3LF2A 3STTA 1P5HA 4DDTA 4A8JB 4EENA 3EPJA 5B3KA 9MHTA 5K7SA 1W2HA 4E4YA 4B3MB 1ESDA 2EX0A 3NHRA 4RMHA 1N25A 4U7GA 3ZHUA 3SQLA 3OESA 5FWXB 1DXHA 1HE4A 4R2JA 4ND5A 2XTMA 2R9VA 1ZD8A 1GNVA 1V5EA 1S2GA 3IO5A 3BMNB 2AHOA 2B3TA 3U3OA 1FSPA 4PX3A 4XSVA 4ZCRA 2TMDA 2HGSA 1EGQA 1P4JA 2J5KA 3JZFA 1F0PA 5AJXA 5FNZA 1A4XA 3L92A 1RWMA 2H52A 3FNEA 5DTMA 2WFZA 3OZFA 2BSQA 1NBOA 5H81A 2JKYA 4D9HA 4ARVA 1XU9A 3OSZA 1A9RA 3RYHA 2AYYA 1MGPA 5AVTA 4G0MA 2WWXA 5LQUA 2H1WA 3OF2A 1OIXA 1SK8A 1Y7IA 3K96A 3KZXA 3PENA 4H7IA 1UBSB 5A1TA 5CVUA 1DINA 3TQTA 5DGCA 4UEKA 1DC6A 5DMXA 4EKNB 3DT6A 3EQ7A 4ZAYA 4EA6A 3PNPA 3SC4A 3SX2A 4X7PA 4GWKA 5AXBA 3D3KA 3ELUA 2IYWA 3F8TA 2XUOA 3E5NA 2WZDA 3PPWA 1WW2A 1E5QA 1Q1EA 4PGHA 5JMTA 1JQLB 4I3FA 3FYUB 1QG2A 5CJPA 3TOCA 5DM0A 2QZ4A 5A9SA 4AM8A 1NXOA 2WV7A 2ZAGA 3AF4A 4GQAA 4U0KA 1YCHA 3FFAA 1K66A 3PFFA 2PZKA 3L6OO 1WNFA 3O3NB 3GP8A 1AHNA 2XMDA 1A27A 4J16C 5AVUA 3NRCA 4LDAA 5DEIA 3WGKA 1OIWA 4G0WA 1JLHA 3X1DA 3UMRA 2X0NA 1ULAA 4FGZA 3C48A 3RG2A 5D7BA 4QJIA 5PGMA 3DFKA 2AHRA 3X43A 4F11A 1RVV1 2H2HA 221PA 4LCJA 2VDWA 3M82A 1DFHA 5A7HA 4CTMA 1GQRA 1W1IA 4Z4CA 4N5IX 2GJ4A 1ZSVA 4RVOA 5NLLA 1WD5A 2W0MA 4PICA 3JQAB 3K1ZA 4X94A 2C99A 4OU5A 3CVVA 1E3SA 5K03A 4L07A 5ALPA 1QPGA 4HH3C 2VQ6A 4UAGA 2F3PA 1X8KA 4GXRA 1PV4A 1C41A 2PV7A 4OQXA 3ONVA 1L7XA 2HMTA 3K7EA 1GKUB 5FUWA 5GIOE 1UXIA 4YRSA 4MB2A 5G3ZA 4JBGA 5FL3A 1IHYA 1T3ZA 1T5HX 1E3IA 2CHGA 3P19A 2GBGA 4IDGA 3W4KA 1WVIA 2BGUA 3HA5A 4QBKA 2HEIA 1YQXA 4DPLA 5J4YA 1U9CA 2PD3A 5ER6A 2YNMC 5CT8A 2BH2A 3E3MA 1UL1X 3HYRA 4JHXA 2OESA 2BF7A 3ZQUA 3IULA 2RB5A 2FX2A 5TEWA 4XFKA 4ZYYA 2QU8A 6PFKA 2XR1A 1C1XA 1WUTA 3PFHA 1IK4A 4PAOA 1ZLXA 3MT0A 4WZAE 4PTZA 1K5PA 2M1ZA 2PX6A 4KO8A 4NMMA 4M1MA 1EDBA 1JEYB 2P4EA 3PL5A 4ZTUB 2ID9A 2BR4A 1BXGB 1I33A 4B0PA 3GJ8A 4CM5A 1IVYA 1ABEA 3DAYA 1OU0A 3C5VA 3QHAA 4W63A 2PNJA 1WZIA 3SKYA 4DIMA 10MHA 1QQ6A 1IAQA 3IVGA 4IFEA 1PLLA 3VNBA 4ENPA 3CRVA 3NOQA 3LGXA 4YP7A 1QFZA 1F4LA 2AWNA 5JNUA 2JFWA 3H9JA 1GAEO 1UC4B 1B7GO 2A9FA 3P2KA 4OHPA 5F5LA 5FAKA 2ZVDA 1QVWA 1ST2A 1VLQA 2ZVQX 3HXLA 3OFVA 5L51A 1ORWA 1QYVA 2Q4EA 4X6LA 4BATA 4CR7A 4KN6A 1M2NA 1DKRA 2ET6A 2ILVA 2R8PA 1W8DA 4MR9B 1KVTA 1RM0A 2DU8A 3TRJA 1GRCA 2NU8B 1RP7A 4DWOA 1JI3A 4CM9A 3DEAA 3R6DA 1F0YA 3BFKA 1NUPA 2I6UA 3EY9A 2AOXA 3L49A 3OZGA 4EYOA 4Q9LA 1JXQA 3QFTA 3G2MA 3VAAA 3OZTA 3AR7A 1VJGA 2RONA 1ZGJA 1SU4A 3UMFA 2LE0A 4XEHA 1L8XA 1Z3CA 1VSQA 4Z4EA 3COZA 1M1YE 4CLDA 5LDHA 3D3NA 1THGA 4WAUA 3JXEA 1J2UA 1BVUA 3T0FA 3A4TA 1RBZA 2FHSA 2NPFA 2DEUA 2QNIA 5CYPA 3ROTA 5L6LB 1OPXA 1WHSB 3BA1A 4V0KA 1EE9A 3GJSA 1HE2A 1LTKA 2I66A 4FR2A 4CLEA 3RC8A 4D3XA 2QVCA 3FROA 3JWEA 4JLNA 5CH8A 4PZUA 5CH3A 4L0MA 3TJMA 1TCUA 2AUTA 4BX2A 3E7FA 1YZFA 2QSZA 4ZVLA 1JIIA 3HMKA 2DLNA 2G1AA 3JQQA 4IJ6A 1CNEA 4L72A 2IZ6A 4JP1A 4ZQFA 1QF7A 3OZUA 4OHCA 4OGGA 2Y1EA 3CR3C 3LUFA 2VXBA 4XSGA 4BMZA 5H3CA 3OTOB 3QE9Y 4GMGA 2JLZA 2BFEA 2FSFA 3G0IA 3IELA 4MPDA 4AKEA 2NMVA 5AVYA 1BMTA 3VU9A 1P7VA 3IEIA 4URZR 3UH1A 5FOQA 1SVOA 5K3CA 1YI1A 1NJ2A 2PJRA 1HY3A 2XMZA 1ZC4A 4CLRB 5JASA 1ZH4A 2WU1A 2IBMA 2DFPA 2BHLA 2PN1A 4RFSB 5BOVA 3AO0B 1DVRA 1LTHR 3GFQA 1EFKA 4ND2A 5GV8A 1A76A 3SE0A 3WGHA 3M1YA 1CJBA 1Z68A 2IFTA 2RGYA 2OUKA 4BP9A 5KZMB 1T2AA 5JD5A 2GETA 4LEIA 5AUOB 4KBFA 2E6KA 4KXYA 1YWGO 4XR9A 1Z4OA 2A1UA 4RU1A 4Z0NA 4ENVA 2XCQA 1JIKA 5B5SA 4BFLA 3F98A 4RTPA 3EQ2A 5K8IA 5HJEA 3MQFA 4NU8X 3NFYA 1YZQA 4OBXA 1V3UA 2OMKA 3DM9B 1KC3A 4BO8A 1NYLA 4PNZA 3U5TA 1GL9B 1W4LA 2LDBA 3T06B 1H4TA 4DZTA 2UXBB 1A96A 1S2DA 4RXUA 5TPZA 3HK2A 4RSMA 3DYVA 2P6NA 2P2GA 3LMKA 1K92A 2GDJA 3SOPA 2WJIA 2WWGA 4PSDA 5D3MA 3WNDA 1N2CA 3MTBA 4YRJA 5CCXA 1OB5A 4L9WA 2APJA 1YCGA 5EQFA 3SZGA 2OP1A 4AIRA 4E5MA 3PNBA 3L79A 3CISA 3OZVA 5J23A 3X1XA 1OGJA 4DV2B 4YRRA 3EF1A 4Y0NA 1J99A 2H4XA 2OZLA 2Z6AA 1QFSA 2A0WA 2ZTVA 1X7ZB 1JLKA 1MO2A 5L4NA 2OVFA 2A5FA 2PS0A 3VNRA 1KK3A 4FW8A 5K4HA 2BUAA 1QIMA 3DO8A 4YAEA 3TLMA 3VISA 2DUMA 2O0JA 2WJHA 4KQXA 3TZBA 1E1KA 3DE5X 3RKSA 1VCNA 2FQWA 5AW5A 1AXGA 1JNXX 4WNAB 3ZVRA 3IAFA 1VE3A 4ZQGA 4D0NA 3FAKA 3TQRA 2B1RA 2NZJA 4XGQA 4ZOEA 1OX4A 1XD8A 5T4HA 3EBPA 1ZPDA 3VSDA 2B21A 4BKRA 4RK0A 1Y8ZA 1V48A 3IP9A 3LWZA 2EFEB 3MMSA 1FZQA 2JFBA 4Q3LA 3SC2B 4KWEA 5EMNA 4WK0B 1TLLA 5BSUA 3U1TA 3DKIA 1RPAA 3DKRA 3AVOA 3V6MA 4A0RA 3VSAA 4E7PA 3O74A 4PZ0A 3PXAA 2Y4NA 2I3DA 4HNGA 4BLUA 3SJBA 2FMKA 4WV3A 3V4LA 3SHQA 1QGAA 4BNUA 3SOZA 3TW6A 3VR6H 4CT4B 1EVYA 2JA1A 2IHNA 1LI7A 3PDCA 1GPNA 4QTZA 1ZK2A 4OQQA 4G9BA 4ECEA 1LPBB 2RH8A 4L3OA 3QOFA 1NAHA 1JEAA 1CJSA 13PKA 4JUIA 2XMPA 3OEEA 4H60A 1AXRA 3A6GA 5CNJA 3T3EA 1N5RA 2DULA 4Y67A 3NDBB 4DW8A 3ZIUA 4BKQA 3M89A 1ML3A 1BW9B 1P1FA 3PEFA 2ZR7A 4XQEA 1DUVG 1QHHA 3KB8A 5AHRA 5ADWA 2K87A 4MKFA 1BD3A 4E1AA 4P98A 4UPDA 1VP9A 4TOIA 4L15A 4BNZA 2AX4A 1HMYA 4H1UA 3RSGA 2BW0A 3GGPA 1H5QA 1TM4E 2JIBA 2WIJA 1MJ5A 3DEHA 4TQAA 1B2LA 3OT5A 3L0SA 1ZC3A 5DU2A 4TZ6A 2FSGA 3Q9SA 2CXTA 4G5GA 2AJ8A 2YN4A 5FPSA 2O7NA 3VTZA 1FJGB 1KQFA 2RG7A 2EJBA 4BMXA 1H6BA 2D06A 3TXXA 4Z1MA 3OBIA 4ZHQA 3D31A 3S8EA 2IUSA 5DYIA 5K6TA 5CLGA 3QKRA 1MDBA 4YRLA 4C88A 4B0OA 3FWNA 3NQ41 3TIIA 1WCIB 5CAEB 1KE1A 4N7MA 3FGZA 1RACA 4IAOA 2JKVA 2FPPA 3CPHA 5GVRA 2GF0A 4GPD1 4A2CA 4HDNB 1I3MA 1EJ6A 2RG1A 3U09A 1HM5A 4RZSA 5IAEA 4AD8A 3NAGA 1PX2A 4FIZA 4TYQA 4MIKA 4E03A 1A69A 4F2GA 1ZIPA 4QO7A 2JLRA 2TYSB 1WMEA 3PQEA 4KWTA 4ZI3A 2ZYDA 5HMMA 3UPTA 1KEVA 1RQRA 4C7JA 3PTAA 1JIXA 1G63A 2IIPA 3L4EA 1H1LB 2PA3A 2PMBA 3O4VA 1PQYA 3AVYA 3HI6A 5H9WA 5BYAA 3GUHA 3PNSA 1NZJA 4GLJA 4EYKA 4KHPB 2PRYA 1K5GA 4Q48A 3TX6A 4X7BA 3MJSA 4IM7A 1QG0A 3HU1A 2A5GA 4P2BA 3PWZA 1K8YB 4R0NA 4TKUB 1W5TA 2GZDA 2RGNA 4FN4A 2OORC 4OU4A 3DOCA 3HNRA 3QVGB 2YV5A 3EASA 2X8WA 4WKOA 5THQA 1NQTA 2OQRA 2Q3LA 2QF7A 4X1IA 1QZTA 3R7BA 1FRVA 4RBNA 3EGDA 3TSOA 5GWXA 1X80A 1YI8A 1WE2A 5CX1A 2B1JA 1I2CA 2W4MA 2QAIA 2MOKA 3F9RA 3JQ7B 4RZ3A 1MC1A 3JQ7A 3DMPA 4LYGA 2A9KA 1LS1A 2H4WA 1XE3A 2OV6A 2Y0PA 3TNYA 3BA6A 1RKQA 2FP3A 1BIFA 2VWHA 3IRVA 4KKXB 1N0WA 4EG5A 3KT8A 4FEGA 1OLSA 2QN7A 4M2LA 4P53A 3K70D 1MQ8B 1H2WA 1S1MA 2PO7A 4ZVVA 3RYFA 4AWXA 4LBWA 2FWMX 1G21B 2OHGA 1W36C 3E70C 5ICSA 1DEHA 3D4NA 3TXYA 1KJZA 2C4UA 3FKSA 2QZSA 1Z7YA 1KOLA 1Z2PX 4J4TA 2I29A 1GV1A 3A1TA 3QUSA 3O83A 1U0RA 4TMKA 3WKDA 1KIFA 2PZJA 1DIRA 1YBMA 3FWHA 3F5QA 4IUDS 2VAWA 5FPQA 3RS4A 4ZK2A 4GOJA 4ZCMA 2DHDA 4F3TA 4V0NA 4WZBA 4QO8A 4RA9A 4O33A 4ZYLA 1LPAB 1XV5A 2PGAA 2PH3A 5LA6F 4QGSA 3V1TC 2XITA 5EEGA 3WV5A 3IE2A 5C46F 3GLFA 2PO5A 3CVYA 1NMZA 3MS7A 4B6GA 2POCA 4Z7NB 3WJ7A 2Q45A 3NT5A 4KSCA 4JP5A 1DMRA 1SELA 1QWOA 4AYWA 2V7QA 4QKQA 1A5SB 3MOGA 2AN1A 3EJWA 2QK4A 2DWQA 3LKZA 3SIXA 4ETNA 4N49A 3UBTA 3O90A 5C7IO 1XJCA 5KNDA 3IKTA 2JFOA 5BUZA 1KMIY 1B6TA 5HE9A 3LTNC 1RHUA 3MJDA 1N4AA 4KR9A 2UU9B 2QD1A 3LS2A 1NAIA 2YV3A 3O8QA 4G4GA 1BKYA 2XXJA 4RKWA 3AG6A 3U2QA 1WVGA 3EGXA 2OMEA 4FHCA 1M8KA 1TE2A 3K32A 4M0MA 4MRPA 3R09A 4NPAA 1U7HA 3Q5DA 4CQMD 2JD2A 1GWNA 4GG1A 1M0WA 3ADPA 3ZJ5A 1GGKA 3ZXIA 4BFTA 1QAOA 5IDXA 3LLUA 4N5NA 1L7NA 1QYIA 4MH0R 1O6FA 2QAGC 1T4CA 2LTAA 3PUHA 1CK4A 4CU5A 4BZQA 3D4PA 2R86A 2ZI7A 4MQFB 5L3SB 2QTBA 2MMGA 2Q1SA 1ZK0A 2W58A 1SOMA 4BIIA 2DPMA 5EZYA 1TUEA 5TS3A 2ZI6A 3UJNA 3FX2A 3O9ZA 4EKYA 1G6Q1 1E0JA 3A9WA 3C14C 1D7AA 4DV5B 1WS6A 3I53A 1UPFA 3QVTA 2AMLA 5AM5A 2IOHA 5DFAA 2VDKB 5E2IA 5H83A 1JBKA 3OJCA 2XDQA 2I8AA 3F7MA 3AVQA 3UAXA 4LHVA 1WMSA 3ZS9A 1DG3A 3OLQA 2JAPA 1E7MA 2QMHA 2BOVA 5AI6A 1ZD1A 3BULA 1BO6A 2XA9A 1ZNZA 1TYAE 4JEIA 1TYCA 3FNRA 1OE0A 4KQ6A 2WU4A 1BGXT 2CXRA 3AB8A 4DJAA 3K0CC 5IARA 4N0PA 5DWQA 1U7ZA 1MVNA 4OVKA 2DLCX 1YQQA 1YJCA 3MWJA 4Y2UA 1GQFA 3URKA 1XPJA 4KQHA 4XM1A 1E2IA 5GAJA 2I6GA 3VUFA 1BWQA 2FR8A 4FNMA 1VA4A 1RHKA 2ST1A 5BR1A 1FC0A 2GRJA 2C4TA 2CV2A 3NM5A 3KJZA 5EMLA 3RNLA 1HDGO 1LZLA 2N47A 3AYZB 2HSDA 3LLMA 4FQ7A 4AUMA 5AVVA 2HUPA 4UBLA 1FYXA 5A3SA 1FFXB 4QFCA 1LPPA 4A03A 4F86A 3SN6A 4ZYWA 1H65A 2HNKA 2WDZA 3QLVC 4E5NA 3MCZA 3MWKA 4UREA 2JGDA 3IV6A 5A4AA 3LT4A 2ZW9A 1PR3A 3I05A 4MQEB 1P2DA 1T4DA 2WUGA 1KARA 1YDEA 4YI3A 3FPSA 4WLOA 3SR4A 3W5BA 1E6KA 1N77A 5FULA 3HHPA 3G6WA 4DT1A 1I1NA 4GECA 2QAGA 4NV1A 2A86A 1XZDA 3LU1A 4FCTA 1TUIA 3CLUD 3KNZA 4G4IA 4HX9A 1XCPA 3V4SA 4S2UA 1ZQ9A 3RQIA 2GM5A 4ENTA 1H42A 5G2OA 3OIYA 1LU9A 4PM4A 5GTDA 3DBLB 1XLTA 3M1IA 1VCOA 2IXAA 2Y1GA 3ZWVA 5KYXA 2FJUA 3HN7A 1EQAA 2HK9A 5DSXA 1I1QB 4CM9D 2JAXA 2ZB8A 3E8SA 2A4MA 3KKPA 1JT2A 2L18A 3ZDFA 3NRBA 4IEFB 3R8FA 1IZZA 2AOTA 4KQEA 3WL6A 3TW4A 1TAUA 4J7AA 2EBUA 5IULC 4LHWA 4D41A 4H7JA 3TUJC 1G8YA 2CLEB 3OZRA 3UKJA 5ICMA 4PE5B 3OPMA 3PHGA 1G59A 2JIRA 1Z82A 2IOFA 2EDAA 2VIIA 1Z06A 5J1SB 4O2AF 1ZUNA 3H1AA 1WABA 4Q01A 3KHUA 3R7LA 4CG1A 4ZVRA 3DO5A 4WBNF 2FLKA 4RLFA 4X9XA 4W1RA 3ZI7A 2IKQA 2NYUA 3OKFA 4KIGA 1P4AA 4NTZA 4BNGA 4ERXA 1GKIA 4Y6GB 3N2ZB 4YMLA 4FLFA 5KSYA 4Q3KA 3NXKA 4HVTA 4FFRA 4XA8A 3B6ZA 1EVJA 4YP0A 3EZGA 2E18A 5TNXA 1XZBA 5M29A 3F7TA 2C9ZA 3MIZA 2Z6UA 3RJ5A 1JEDA 3G8BA 3TZCA 3FMIA 3IRUA 1GPMA 4JKYA 3QLVA 4EO7A 4OA5A 1XRSB 3TQIA 4Q66C 3O4FA 1WHTB 2WJ6A 1P31A 5BWMA 1K7CA 5I7VA 2F9FA 1DBVO 2BLLA 4QUBA 4B45A 1QG4A 1G8AA 3WGUA 4P7KA 2CKDA 2XKJE 1DFGA 2JLVA 3CF4G 3Q3JB 2QLFA 1DBSA 3ADKA 4WKPA 2JGEA 4ALJA 4DBLC 1E2HA 3OMLA 2FKNA 3L6UA 1YTUA 1C4WA 3LM8A 5E8RA 2V5VA 4IUCS 2BM0A 9LDBA 1SPBS 4B7XA 2MYUA 4DLAA 4RK1A 5DIZA 3UUEA 4HFMA 5A0FA 3R7WB 3BE5A 3LSYA 2FSIA 2RHLA 3K92A 1COWD 3U17A 4EBFA 5CB4B 2HF2A 3GARA 1YU9A 4HRXA 5IZ4A 2EGHA 3G79A 4OA8A 1OA1A 2WM2A 4RVGA 2Q5HA 1NR1A 5DTJA 3PF9A 5LKAA 5M7EA 4WNAA 1NMXA 5K20A 4G1BA 5KSWB 3JRWA 2Z0MA 2W6JD 2Q6LA 1NATA 1XCGB 1C9YA 3KQUA 3F6CA 3KB2A 3GEIA 5AM0A 4Z1OA 2I71A 3KYDB 4ENRA 3DV0A 4JEMA 4LDNA 1RM4A 4WGFA 3FRHA 4M36A 2V7EA 1BWPA 2KHZA 3IPYA 3IP6A 3PC8A 4FZRA 4ESOA 5KB3A 5J2UF 4LK3A 4TN5A 5ALQA 3HSYA 3RVSA 3RIXA 3NKLA 1GUFA 3ASUA 2HJVA 4B3FX 2AUMA 3CZAA 1GGVA 4YJ3A 5K0SA 2WNIA 4I5GA 5FHQA 2VTBA 3NXSA 3R5JA 2E5WA 5AIAA 3N59A 4G0QA 4A1FA 5EP4A 1PG2A 5THXA 1YS2X 5EHIA 4N5MA 1HKHA 3NBZC 4K40A 3P9RA 4XUGB 4LPSA 3ZC3A 3M3PA 3ZIAA 3ZXUB 3L6RA 1XWIA 3T5BA 1OXSC 1YL6A 1V3TA 2BI8A 3ETEA 3MMXA 4G1EB 4L1KA 4BNIA 1TQ4A 3EXHC 1OU4A 1Q0ZA 2RK3A 1T0UA 1ZNXA 2WJPA 3E18A 4G41A 2G80A 2WSYB 1JQDA 2I8LA 2UVQA 4IXWA 3INGA 4N82A 3WY9A 4ZMRA 1XCBA 5JSYA 5ES4B 1UM9B 1MB0A 4G01B 3G9QA 3QYFA 4N9QA 5FWAA 4HKTA 4NZYA 5ECWA 5J4LA 2K7FA 3GJ5A 5D2CA 1RPNA 2E82A 1ONOA 3SM3A 3W5UA 4W7HA 3S29A 2QYOA 3HSSA 2B36A 1ULUA 4H16A 4LG1A 2IS4A 2WF9A 3I2GA 3ORHA 3OUTA 4IGAA 4YRCA 3P2OA 3ZDAA 1XK7A 4X54A 1GRQA 4DXAA 2C2ZA 5EC8A 4KO1S 4IR7A 4D6YA 1KEEB 1XZEA 2CT8A 5DCUA 4CKZA 3HZRA 2VKTA 2ZKIA 1N0HA 4X66B 1U28A 2QRUA 4FX5A 2L2QA 2J8ZA 3OQBA 3R3HA 4QPPA 3AUXA 2OPHA 4WD3A 4C7BA 4EGFA 4M88A 1XQWA 1K6EA 1ORVA 2RJ3A 3ZXYA 4Y6QA 1VPWA 3AJEA 4P7JA 3PQ8A 2P62A 3UJ8A 4AG3A 1M2OA 3FSGA 1AMOA 1Y9ZA 3EH1A 3WIEA 1E3MA 4TLMB 4NR0A 5EXSA 1PT6A 4ZVMA 2D7JA 2VBIA 4J0QA 1OKKA 3NWPA 3KOWA 3QI2A 3WIUA 1LX6A 3T9AA 1VCMA 4EYGA 4W5QA 1E9RA 1Y3IA 2WLTA 3IHLA 3WFIA 1BQEA 1DRJA 3HR4A 4OI1A 5A9SB 1ZGGA 2FRVA 3U7IA 1ZICA 2AWOA 1WNTA 4MGKR 1JQEA 1TFUA 2BGNA 2GTIA 4I1RA 3INNA 1FVOA 4O4LF 3ZHXA 1I6MA 4RELA 5BSGA 3TSWA 3KWMA 4G09A 4MQMA 3C3BA 4YQFA 2AD1A 2I2BA 3RADC 1QQAA 1U0NA 4XAQA 1CY8A 3PKIA 4M37A 2QPTA 1K06A 3OOHA 5CGZA 1GN9A 1IYZA 3SC6A 4Q9KA 2PKQO 5LQKA 3EIFA 3BKWA 3HCCA 4Y0AA 3I9JA 1KS9A 4I1SA 4INJA 4KPUA 3UYKA 3WYEA 3ZGYA 1TM7E 3O95A 4CNQA 5KWJA 3Q6IA 4JUAA 1VRVA 4BBZA 1EWQA 3RK1A 4C3VA 1PR1A 5HKAA 2OPBA 4MVJA 2D2VA 1IUPA 5F2EA 4BLPA 4P9NA 2AEFA 4MQUA 4YFVA 3RS3A 3T99A 3UQYS 3WK4A 2C29D 4A2QA 4DYHA 4YJGB 2NU7A 4YMTA 2CMHA 1CUAA 4JC0A 2X9NA 3HV0A 3KCNA 4YRFA 3QXJA 1S8AA 5FPYA 2IYOA 5J2UB 2OAGA 1HOXA 1PDOA 4N8DA 2HR1A 3AV0B 5GZ6A 2OM2A 2Y6VA 4AP6A 5K8LA 1RLUA 4IX1A 3UC5A 4D82A 2NN3C 4JLVA 2HBYA 3ORFA 3S2ZA 1A8HA 5JBNA 2XQGA 1KPIA 1VRCA 2YIDA 3KJFA 1WV1A 1E0DA 1JFSA 4M46A 3FNQA 2ERXA 4CM6A 4U2CA 3TZLA 1V45E 5B2FA 4D8TA 1NUTA 1XMOB 1W94A 1UC9A 3D8TA 4ZMBA 1AS3A 1RT9A 4R5MA 4F9GA 2KB0A 3E9YA 3Q2KA 3IPRA 4FMDB 1CUCA 1RXSA 3ASZA 2JIMA 2PGOA 4TXNA 5HM8A 3BJZA 1YJXA 4W6ZA 5LP6C 2BHTA 1Q12A 5JEEA 4NZPA 1PYGA 1TK3A 4QOJA 4FW9A 5BUSA 2VHZA 1BJRE 2L19A 1TC1A 3AMVA 2NAFA 3Q85A 2D1SA 5FH9A 1NVEA 4D0RA 1DKUA 1S89A 1I4DD 2M2IA 4HNTA 5J2UA 2QV0A 1IM8A 4YJ2F 4X44A 1THTA 1PUJA 2CFSA 2WINI 1CPYA 3HP1A 3L7DA 2AG0A 3NATA 1SOVA 3VR0A 2FMXA 3VX3A 5TT1A 1L5GB 5YASA 5JFOA 5MFZA 2E48A 3CB2A 4I8DA 4QBTA 1T1EA 4U4AA 3T7RA 2Q7DA 1YL5A 3PNQA 1F06A 1BKSB 3CCFA 4AJIA 4KV7A 1YNOA 3UG6A 3ZBTA 2P41A 4G5QA 4GRDA 4MW4A 2BMVA 2I7CA 4B76A 1DEAA 2B9VA 1GILA 1U6IA 4XWYA 1E2LA 1UBTS 3ZIAD 4NL4H 4N47A 3P71T 1E5XA 2Q29A 3EXFA 4II2A 4YQYA 3L7NA 1HORA 2GZ2A 3FPLA 3WK8A 2C2WA 3BCRA 1M66A 3NAQA 3RB8A 1NDHA 1P1BA 2UZ3A 3P9QA 1W88A 3VBCA 4LY3A 3QGMA 3HCFA 2CNBA 2BHSA 1XP8A 2B99A 2YUIA 2HH9A 1PS0A 2AEMA 2QTTA 2ZSEA 4V03A 1M6VA 1DCFA 1M76A 4HTFA 4CMBA 1WBDA 1Z0JA 3FOCA 5AW1A 2IDJA 3KUXA 3OU6A 1PJSA 4EQ6A 1Q0HA 3S5UA 4UU8A 2Q3CA 1TVKA 2GO7A 4AY4A 4UM7A 5TGTA 1QCYA 5JNLA 1FSSA 2GPBA 3M70A 1HTBA 2VPPA 3P9IA 4LJ7A 4WLVA 5KJCA 2ABWA 2QMQA 1X0XA 2CFCA 2R6R1 1XD9A 1Y9JA 2JLQA 4U7TB 4GDFA 4RYLA 4ZALA 2PLFA 1Y3CE 4BECA 1CS4C 3W9BA 1AQ6A 2VNAA 3M6UA 3O94A 1R8YA 2C94A 2HLDD 2NXJA 2BKEA 2G8LA 1A5ZA 1AZSC 5C7LO 1E3TA 5BV1A 1ADBA 3VO8A 2VATA 3RT1A 3MAGA 4QOEA 4JLBA 3EYWA 3L77A 3WRXC 4PZLA 2PUJA 3A70A 3EVEA 3GRVA 3MCAA 2BGGA 3VU0A 5GGXA 4Z53A 4E51A 3H9QA 1RXWA 2CVOA 4RTQA 5IM5A 2C2BA 2J07A 4O8ZA 1JXMA 1CF2O 3K1YA 1SXQA 4KX3A 2H1CA 4AURA 4REMA 4RVUA 4K26A 4WIAA 4KMRA 5BSWA 4N39A 2QG4A 2CVFA 4NOLA 3IIMA 3K0SA 4BZXA 4NMHA 1ZCJA 1ZOLA 1QV6A 3PFIA 3VVLA 2XTAA 3FYTA 3I61A 1H69A 1W9HA 3R3XA 3MJVA 2PSJA 4D79A 3S7TA 1UBGA 3HNPA 1YS6A 2VNHA 4NFHA 4TRRA 1PI3A 2G6TA 3DFFA 4FQ8A 3EIEA 4IH1A 3F74A 4ARCA 2XUJA 4UTRA 1SG6A 3OEHA 4QOFA 1KE2A 4AC9A 1IXSB 1ZGAA 4I2NA 4Q9NA 4RAOA 4BNNA 5AVWA 2B98A 4O29A 4MHSA 2D2FA 4EEZA 1FL9A 1WPXA 2B2CA 2Q3MA 4J0EA 4PG6A 3ZU6A 4A1OA 1ZM3A 3PJGA 2LXNA 1NUUA 4ZCPA 5KYUA 4IV8A 5GONB 5CCEA 2A67A 2VDQB 3H75A 1J0DA 1WIWA 2C9YA 1W581 2FEAA 1CF9A 3I9V1 4OFZA 3PC8C 1K8XB 2IF2A 1B8VA 2BGTA 3AHFA 2C00A 3JARB 4JYZA 1VOTA 2QPLA 2G77B 1DL5A 4KCGA 2ZBGA 1FYFA 2IPOA 2Q5LA 5CDHA 5KJ1A 1MAHA 3LC0A 3GAZA 2V98A 2FZVA 4IEEA 3H9CA 4GXNA 3IILA 2AMVA 1E3WB 1GJRA 3RG8A 2VLIA 5CJ2A 4DNXA 4BY9E 3CPJB 4O5OA 1ZUNB 3ADDA 4PAGA 2NV0A 4K7JA 5AKXA 1RIIA 5HR5A 4ZO8A 4C87A 3T5CA 3QWAA 2F2TA 3NJ4A 1FXWA 4UZFA 2BTQB 4FFBB 3IP5A 4GSLA 4RF4A 5JNTA 3O8OB 3PLAE 3IQDB 1PJ2A 3QH4A 1N6IA 2YCLA 5KDDA 3EWIA 1KC1A 4WN9A 3H9EO 2EQAA 3MJEA 4CUJA 1AVTA 2VRBA 1G4AE 1PK8A 3HPRA 2EWWA 1KQNA 1W47A 1GZ4A 1MW9X 2X9LA 4HY3A 4P81A 2R1VB 2G40A 5D1NA 5JYEA 3UT6A 1BDHA 1U63A 1SB8A 3AHEA 4G36A 3GG9A 3HBNA 3BXZA 4D56A 1WHTA 3MINA 4M8LA 1XHFA 3UA3A 3EIQA 5D00A 1DGQA 2YVQA 2GPYA 3UTDA 2H4FA 2Q49A 2WSSA 1UXKA 3P2MA 4KQIA 3ME5A 2J09A 4RMGA 4WJLA 3RYFB 3DVAA 2DFTA 4LRQA 2LIPA 4CQJA 1ZLYA 4OAOA 2XMGA 1BFKA 1W85A 2O14A 2YIVX 3WL8A 2H0QA 3V8BA 2FW0A 3RVMA 5LU8A 2QLTA 1OASA 3AERA 4RK6A 4LTDA 2BL4A 3EIHA 4MNTA 4PCLA 5PNTA 2PYDA 2QL7A 2FX5A 2R44A 2ZWOA 2P75A 3FCEA 4CV0A 4UE2A 1QGED 1XJWA 4ZJPA 4UHCA 5BVGA 4Q37A 5DM60 3PNOA 3UMCA 3WDSA 3HABA 3RTCA 4TQUS 1DAGA 3VVCA 1OHHD 5E6SB 5EWLB 1ONSA 1R0SA 4B3XA 5KNBA 4G89A 1USWA 1ACJA 2V6IA 4LRUA 4RA6A 1KBQA 3B9BA 1C2TA 1FU7A 3RRJA 4IP0A 3O5AA 2PV0A 3G8CA 4N1AA 1Q16A 1ZIYA 1JNYA 1YVUA 3OCZA 5EE5B 2PD6A 1P91A 2ATVA 2EKZA 2GN2A 1RZVA 4UNQA 2PWPA 5LD2B 1XU7A 4BDTA 2G1UA 4NY1A 4EI2A 4W4TA 2KYRA 2NTEA 3L3BA 3IBSA 4BKOA 4DA0A 4F5YA 1YIDA 4UASA 4DCCA 1E60A 3L7KA 2G5PA 2AE2A 4HBZA 1KRHA 4PVCA 3I1IA 1E0SA 3MLAA 4FFWA 3DB1A 1DG9A 3DE0X 1G18A 2P6UA 2ZWVA 3KLMX 1E79A 1GNSA 3MQ4A 3B9QA 3NIBA 3QFHA 4GPTA 3CN9A 3PJRA 4DTCA 4EZEA 1KMCA 1O95D 3ANTA 3MNFA 3DXZA 2GBIA 3UWDA 3DC7A 4DRYA 3TG8A 2FFRA 2CK3D 2HWUA 1DHTA 1A9XA 4YRTA 1U0BB 1OZGA 1C50A 2X9QA 3MT9A 4I9UA 4GYYA 2E4ZA 4KWIA 4LV8B 4O2LA 1XPUA 4URFA 2HDHA 2QPAA 3OAAD 1PBTA 1AD2A 1OZAA 2Q6OA 5JW6A 1J2EA 2BFWA 3OBBA 3TW8B 3GFPA 4MUMA 4B85A 2BFCB 1QFMA 2MR6A 4EP1A 5FA6A 3TGLA 2IPMA 1G1AA 2W2TA 1KJ9A 2F1IA 2Y71A 2YWBA 2HM7A 4C0HA 4RGYA 2IU4A 3FCOA 5ENDA 1RWNA 1Z8HA 4FYJA 4WVFA 4L51A 5EE3A 5C0OE 3CJTA 1AU9A 2FETA 1PJQA 1NJGA 4JASB 5BXQC 4JJ6A 1PQ4A 3QW2A 3B85A 4Q1DA 4CKYA 3OE7A 4XI9A 2JFNA 4HNRA 4GZ3A 2Q62A 4HDQB 4JSTA 2Q3HA 4B44A 4URWR 3ZZ0A 3EIWA 4CKEB 1TZKA 3C41J 3NJRA 3IEXA 3RFUA 4LGCA 2P68A 2Q8PA 3H84A 5DT9A 3AETA 3LRPA 1N3LA 4DL9A 1R6XA 1M8JA 1WB4A 4KRXA 3CRZA 3TZHA 4YV0A 2P3LA 2LUOA 2QR3A 5JARA 2OD9A 3BGVA 4DLZA 5EZYB 1XAHA 2PT7A 1G3IA 4IDDA 3RLFA 4IMJB 4PNPA 4OMFG 4OUKX 1OLUB 4MYSA 5MF6A 1GP2A 2MSEB 3J81A 1IUOA 3RQSA 1UJ5A 4Z3OA 4UBIA 3NWBA 2XUZA 4K03A 3QVOA 3Q6MA 2O8CA 3WHPA 1FRNA 1GQQA 1RI3A 4OB8A 4M1KA 1MC5A 4JZKA 2EJWA 2BFBB 1NFQA 1YQGA 3GNTA 3D6AA 2QN2A 3W2TA 3TSCA 4BMCA 3Q72A 3O75A 3FM9A 1DARA 2J31A 5A71A 3QBDA 2X4IA 4NVRA 2Z04A 3F3MA 1P45A 3STUA 2GCEA 2YYZA 1POXA 3H97A 1L1EA 3NLLA 3KPJA 3U48A 5HQ3B 4QTTB 2R2AA 2J6IA 2DH5A 2FFJA 1E2JA 3G2QA 3ESZA 3JQ9C 1KDYA 2A9RA 4EFNA 2CF6A 3E1GA 4JX9A 4TMWA 4YAJA 3WA6A 1QVZA 1JECA 1E8DA 1PWHA 2WBLC 3E1SA 1JEQB 1KTVA 5ALEA 1TJNA 3SX4A 2XXAB 1CC1S 1OPRA 2C5HA 4QPCA 3UEOA 3EVZA 1PFQA 1FA9A 4TYWA 1QDUA 4I55A 1WUJS 4KRGA 4OP2A 2C1ZA 4ZQIA 4L16A 3QEAZ 3ZY2A 3SYLA 1IN1A 3BM5A 1NUQA 3W2GA 4BMPB 3K9FC 3IUQA 1VLVA 4JJEA 1YR6A 3OQJA 4XDYA 3WLOA 1SK9A 1E1QD 1VZ3A 2PRSA 2Y66A 2Q7XA 2WUDA 4DV0B 1RZRA 4Q82A 1SY7A 3OU2A 1CUIA 4JNKA 3EW7A 3BGWA 3TI7A 2YN0A 4UBKA 1NX9A 4NYMQ 4TQ9A 4L02A 3IAM6 3QXHA 4Q4JA 1L5QA 1Q0SA 2FPKA 3PX3A 1LVHA 2R3SA 3U3JA 3D0OA 1L5NA 3VUEA 5KYXB 3IT0A 3P7MA 4U6NA 2BZ1A 4XIJA 4AJ1A 4UUOA 2A2ZA 2WVHA 4JAVC 3QSYA 1E9CA 1GXSB 2REOA 2JIZA 2VYND 3NW9A 3HLKA 5LC1A 2HA5A 4TTQA 2DY0A 3HVJA 3FOFC 2DBYA 4UNNA 2DECA 1L7BA 2R8OA 1U5BB 1UKAA 1Y3DE 2AMYA 2JFZA 3CRQA 1WCXA 3L1KA 4MR7A 3S1LA 2HT6A 4MV1A 4H1WA 4DSTA 1ODTC 2FR8C 4URHA 3WISA 1DKPA 2G82A 1RRCA 2GEUA 3L1IA 3PZBA 4KVAA 1PSDA 4IOKA 5HKKA 1UXGA 3ABRB 5TV2A 2FWJA 3SQNA 3S28A 3IL2A 3NC0C 1D2NA 1L4YA 1NWCA 2PH1A 3WJ1A 4FZ3A 1WEKA 1E89A 2HQRA 2VRWA 3HXTA 4TMXA 3MJHA 1P2VA 1TVEA 1W4RA 2NUPA 4NK4A 4R3UC 2YWGA 5EMJA 5AJTA 1AQIA 4BV8A 1R5BA 1G5PA 5IHXA 4HDMA 1XLWA 2QTNA 5BSVA 5L8VA 5KYYB 4W9MC 2PK3A 4H3HB 4JI0B 2C20A 4QDJA 1RI5A 2QVZX 3UJPA 2OCXA 4TQGA 1NBAA 3LX8A 3ZWKA 1EH5A 5A3VA 3ENWA 4E07A 3AF2A 4HB0A 1E69A 3DFUA 1GU7A 4LDPA 1VMAA 4TUYB 4BBPA 1E20A 1OR8A 2HMYB 2JASA 3ES9A 3ZD9A 2K6GA 4XGRA 5DN9A 5K2OA 1N36B 3DUWA 2CFIA 1KO7A 3M83A 2TECE 3AEYA 4QQKA 1U2DC 1FFBA 5FQOA 4B48A 1Z5PA 4IZIA 4H3SA 4J0KA 4K8RB 4XIIA 5ALLA 3WRWA 4BVBA 2JHGA 3UG7A 3QQ5A 4PPGA 2M1XA 2JNWA 2O0LA 3RAGA 1IUNA 4ZAXA 5FI5A 4YP1A 1AUOA 4U2EA 2RHHA 3SVZA 4RDXA 1R18A 2QD3A 2ZG6A 4GQIA 3UOWA 2NACA 3L9XA 4R84A 4AMZA 4UM8B 4HC4A 5G0UA 1C7FA 1XNQB 3D6UA 4YIKA 3ZW8A 1F1BA 3L41A 3OX4A 4PF1A 1XIVA 2BSXA 4GBMA 4LSGA 5CX4A 2ZRGA 2V0NA 2QBYB 3LQ4A 4GZ6A 4RMJA 1DFIA 1SQSA 4UU7A 4C76A 3TOZA 5J47A 2VQDA 3GCXA 4C05A 3K16A 4BNTA 1N1MA 3C1AA 4QQRA 5JYCA 4LA4A 3ZV3A 4N65A 1JAHA 4OXIA 1RWKA 4P1ZA 1PG5A 5BSKA 1MGOA 1GO2A 4HUTA 1ZH0A 4WTOA 1YE3A 1P1JA 4NZNA 4NJMB 2FN3A 2ONKA 1MPTA 3L84A 3RIYA 3L0YA 3NEYA 1TQHA 2QMEA