3KJGA

Adp-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
total genus 76
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjgA00
4MDEA 3WRYC 2ZJ5A 2RHDA 1ZU5A 1DS6A 5DN6D 1NMZA 5DHAA 1G7TA 4TN1A 5KPJA 1R0XA 4JLDA 2REOA 5FR2A 4M0LA 2RKOA 3TUIC 4PZLA 1HE1C 3DMDA 4LK2A 2BVNA 2GXQA 4JT4A 3V4FA 1FPMA 2OG2A 2V6IA 5E7JA 1IN6A 4CEJA 3TSZA 2P5TB 4GMDA 4U02A 2FGJA 4E03A 3VHLB 4V02A 3TRFA 5EXXA 4Q02A 1X1RA 3B1XA 4WVFA 2EW1A 5B2ZA 4LWZA 3TSOA 2QSYA 1LF5A 3GP8A 3VR2A 3DL0A 1L8QA 3BORA 3AB3A 2W6ID 2WJIA 2KB0A 4RD6A 1A2KC 2IXGA 3HDTA 1EFCA 3NHAA 3T15A 1HV8A 3E70C 3GLIB 4ERNA 4RZ2A 4OK3A 1DEKA 4A2WA 2C5LA 3RRZA 5C2JB 5D3MB 2WV9A 1ELOA 1EESA 421PA 2QZ4A 2HDNB 5BYJA 1UKVY 3H4MA 1LW7A 3LLUA 4MRPA 2W0SA 2BMDA 5DIFA 4EDHA 2MSDB 2NO6A 4Q01A 3R7WB 2A9KA 2IHYA 2YYZA 4UXJA 5LBIA 4K46A 4Q1BA 1QVAA 4QNMA 1IN7A 4NCJA 1YZUA 2FSIA 4IVPA 4PTLA 3IIMA 2CLSA 5CK5A 4HAZA 1P2VA 5GADl 5KNBA 2JJ8A 4RVCA 4JIMA 3QSYA 4HATA 3WBKA 1II8B 4MYCA 1QVRA 4FINA 5G3YA 3SI7A 1HQCA 1Z0JA 2OZEA 3GFOA 2ASEA 5L8VA 4A92A 5H1YA 1ANKA 1XD9A 1GP2A 3K9HA 4H9GA 3G82C 4ZDKA 4CEJB 4KV9A 3Q5DA 2QTVB 4FMCF 1KY2A 4UJ5A 2GXUA 1G291 3DO6A 3RS0A 3T5DA 4YXWA 1MO4A 1U0HC 3FE2A 3TW4A 3QF4A 4B43A 4DSOA 1JR3A 1XZQA 1IXZA 2EFEB 1WMSA 1NVWQ 4S35A 2QPAA 3CPEA 5AWFC 4IJMA 1ZM4A 5K8LA 1ZC4A 3GEHA 1Z0AA 2NPFA 2XNDA 1XPOA 4KFUA 1G1MA 1MO5A 3MWYW 3RYTC 4D0NA 3U7HB 1IHUA 3KUDA 2D2EA 3THWB 3AP2A 2B6HA 2HXSA 1AGPA 1OIVA 4DDUA 5A5GA 5DGXA 3KDSE 2RAPA 5DE3A 3EIQA 5FBQB 3W8RA 2PEYA 4TMXA 3QPWA 3TH5A 4JT2A 3BK7A 1UBGA 3KFVA 4LJ6A 1M8PA 1ZRHA 2NO1A 4YQFA 5KDOA 5AJVB 4EPVA 1COWD 2C2HA 2NOAA 2W2TA 3AVOA 2VP5A 1P2TA 3L0OA 4B76A 2WKQA 3GQBA 1KK3A 4HLQB 4R7ZA 4WZAE 1SVWA 3NBXX 4PX9A 5DNYB 4A2PA 4HAUA 4QL3A 4M4SA 4DIEA 4IOLA 4I99A 2V1XA 4EPWA 2QU8A 5FOWA 3CR7A 2R6DA 1WCV1 4CEHB 1XPRA 5A4JA 2QNRA 3KUCA 2H5EA 3KJEA 4DKXA 2AK2A 2CE7A 3R20A 4JYBA 3WMEA 1II8A 1RRPA 3LQRA 4QXAA 4ZI3A 2C78A 4U5XA 3PQCA 2Z0MA 5TDHA 2IXEA 4ABYA 1YR9A 4Q9JA 3TKLA 4D4KA 3PJRA 1E2QA 1NVUQ 4JLPA 2AFIE 1ZC3A 1NJFA 2CNWA 2FSGA 2N46A 4NH0A 1HEIA 4IDHA 1UJ2A 1NVXQ 4CEIA 4JL8A 2H92A 3A1UA 5F3WB 1W47A 4RZ3A 2FEMA 1XFAA 3CRVA 2IYYA 3MWKA 4UJ3A 4DBLC 4P4UA 3NHBA 4Z1MD 1U0JA 1YZKA 3Q3JB 3VR3A 1QHHB 2RGNA 3U5ZB 2ZSDA 5EE1A 2NZ8A 5FR1A 1U98A 3RSOA 4HUTA 3BAFA 2GAAA 2ZJOA 3ADCA 3L0PA 3RC3A 3ZDQA 3MUFA 2PEZA 2FFBA 2WAYA 2OCYC 3CO5A 1RIFA 4NYJQ 2QBYB 2GEUA 3LO5A 4TYQA 5FPKA 2Q21A 1ZP6A 5SZIA 1TQ6A 2OHFA 3I5XA 1OFUX 3OFNA 4CIDA 4LJ8A 1ZMXA 1OB2A 3WYAA 4C0JA 4DCTA 4OKSA 3LX8A 4XWKA 3GJ8A 3WRXC 1DAIA 2BMJA 5EP2A 1NVVR 3BFVA 2VP4A 2AWNA 2L0XA 4MGZR 2IYRA 1KI3A 3IIJA 1XB2A 4F4IA 3VKGA 1YR7A 3I8XA 1SXJC 1ONBA 2GESA 3VKHA 3D6TB 3SBDA 3VQTA 1KSFX 5FL3A 1OW3B 1G5PA 1J90A 3AGQA 2EFHB 2QTFA 2IS2A 1BO6A 1E0SA 3KB2A 5JRJA 3MJRA 5IRCD 1D2MA 2GILA 4L15A 1VG1A 3GLIA 1ZNWA 3AF4A 4JJZA 2J5XA 1R2QA 4M53A 4TYYA 1OH7A 1CLUA 3CRMA 4NPHA 4Q4LA 1UF9A 2ZYWX 4WZ6A 2GJ9A 4XVUA 4G1UC 3KJIA 4BFUA 2FX3A 1ZYUA 2ZSAA 1FMJA 4G0NA 5CM9C 2GZDA 3B9PA 2ZRPA 2F3TA 2H18A 3OIYA 4PO9A 1ZBDA 4US1R 4AD8A 5KU1A 1JXMA 1NY6A 2QROA 5J47A 1COWA 1DO0A 4DLZA 3FTQA 2QEQA 1IN4A 4OHWA 3K9GA 4MUAA 3B2EA 4UNRA 1FP6A 2X8AA 1W46A 4PO8A 3VKWA 2P65A 3T34A 1KI6B 2FFAA 3PG5A 4XD7D 3K70D 1Y3AA 3ZIAA 1Q20A 4H1UA 2VYFA 3AF2A 4D0LB 4CEHA 3AP1A 1HH4A 4ARZA 1KZGB 1W0JA 3WMFA 2IXFA 5DI3A 4PXAA 1TPZA 1Z6XA 3QG1A 1KYIA 1XTSA 2IL1A 1GRNA 2WWHA 4LSGA 1W7AA 3ZD6A 4DSNA 2G0NA 2BWJA 2FFHA 4LGMA 2YOHA 4EQ6A 4DUGD 2CL7X 5L3QB 2FZLA 1E1QA 1N6OA 2UZ3A 1SKYB 3NEYA 4LYHA 5JFGA 2VA8A 5KYKA 3GFPA 3U6KA 2FNAA 1A5TA 2WTUA 2GJSA 1NG9A 1N3BA 3KKQA 5FPHA 2D4HA 2W00A 5AJXA 1L4YA 1XCMA 2QMEA 1I2DA 2V7QA 2WWGA 1M7BA 4ILEA 2RB4A 4Q18A 4QG7A 1SVOA 1ZUIA 1N25A 4Z54A 1QHGA 2WPDD 4MITA 2IYTA 3D8BA 3EASA 4BRWA 1OH5A 4C7OA 2XJ4A 1S9DA 5H70A 1DO2A 4IOKA 2VHTA 4PPFA 4TQUS 2ONJA 3RRMA 1OXSC 1W4AA 3OIVA 4KYIB 1CIPA 3IPYA 2IYVA 2ATXA 1GL6A 1FX0B 3ETLA 4NKRA 3U44B 2FOLA 2BCJQ 4YONB 3KX2A 3KZ1E 2GDJA 5GJVC 4ZV4A 1QG2A 2FF7A 3MD0A 4KITB 2VP2A 3K70B 2ZE6A 4JZKA 4URYR 2ORIA 3EAQA 2WOJA 5HCIA 5CDFE 2F7SA 3RS7A 4JVNA 3U3JA 1R7RA 4LBYA 1G18A 2YNMA 4LBZA 5FTNA 3Q8XB 5HZKA 1YZNA 2H57A 2IC5A 2QMOA 3B9QA 2GRJA 2ZANA 1OE0A 5EUMA 2OESA 3OIWA 1XEWX 1YZTA 2HT1A 3NBFA 3W5JA 3FKSA 5FTMA 2JATA 4PO1A 2ANBA 4DDTA 4Q1DA 1P75A 4URVR 1S3SA 1NN0A 3SDZA 5EQTA 2JLXA 2J3EA 1VCMA 1NLYA 2I4IA 3QJYA 4JYCA 4FMDF 2J41A 5TY0A 1F5NA 2G88A 1PLKA 3AVUA 1X8JA 2W83A 2ZS9A 5DN6A 2WKRA 4G01B 4EPYA 3UWKA 4RKEA 3BD9A 3IEUA 5DH9A 2PCLA 2VHQA 3FMIA 5DSZA 1TF7A 4LBVA 2EYUA 3LVQE 1V43A 4DEYA 4EPTA 1SQ5A 3K53A 2WWXA 2XTMA 4PHFA 5FOTA 3RSLA 1JAHA 2OCBA 5C46F 3S1AB 3C16C 4Q19A 2FWRA 5DYGA 1Q1EA 1QG4A 2JLSA 1U8YA 3AQ4A 5KOYA 2RGCA 4MQBA 5G3ZA 3NWJA 4HSEA 1E2DA 2DHRA 2OFXA 4B75A 4Z51A 3KQKA 4B48A 1OLOA 2VHCA 4S2EA 5B57C 5KNCA 3GLHE 3L0IB 3TSWA 4UXIA 3VMFA 4NDZA 4AKHA 1BIFA 4X8MA 1DARA 1W4CA 1E4YA 3VX4A 4OHXA 1KTVA 1ZVQA 3KKPA 1Z5ZA 3DZDA 4ASUA 5JWOA 1UBFA 2QE7D 3A8TA 2F3RA 3UATA 4MYTA 4DCSA 4DVGA 4A6XA 3AVYA 4M8NE 4URXR 1KDOA 3ZJYA 2QL6A 1NSFA 4M1SA 1YZQA 3IDQA 1Z83A 3QE0A 4BFZA 1MRSA 4A6PA 1FNNA 3HJNA 3R9XA 1DAMA 4Q9LA 4BZPA 2VL7A 3X1WA 4IKEA 1JJ7A 1T91A 1N5JA 3DZ8A 2EWWA 3OHMA 2QTHA 4C9BA 4OHYA 2AKAB 1IY0A 4QHTA 4PHHA 5JSZB 2ANCA 1ZUNB 3CWQA 1N6RA 1UEIA 5C1BA 1SVIA 5M04A 1SVSA 2GKSA 4G5RA 4WW0A 2BKEA 2G9NA 1J70A 3KB1A 1OJLA 3U2QA 2YWEA 1XTJA 1T8TA 1VHLA 2ZE7A 3WY9A 4AURA 4N3NA 1CJVC 4Q7LA 2ONKA 2CHGA 3I8SA 3TVDA 1T3SA 3U7GA 3E2IA 3FKQA 3NH6A 1D2EA 3OE7A 5FBLB 3IIKA 4LJ7A 1PV4A 3FHCB 1Z6TA 3QUSA 2Q9BA 2OCAA 4XVRA 4HI0E 1CR1A 4LHZA 4DLXA 3SJAA 5FH9A 3GFTA 3QF4B 2VRWA 1AS0A 3SR0A 4ACBA 1P9WA 1W1WA 1EFHA 2A5GA 2JJ2A 2QE7A 3CZQA 3WP0A 3HR7A 2VF7A 1XDBA 3NDBB 2NO0A 2PLFA 2WJVA 2QAGB 2ZUDA 3LFUA 1NVVQ 2J0QA 3EC2A 1FOEB 3GLHB 4TLAA 1W36C 1XXHA 3NG1A 3LDAA 4QHYA 2CJWB 1BYUA 1QHIA 3B1VA 5IK2A 2J7PA 2MMGA 5JCPA 1ZNZA 1BOFA 3X1XA 4XIGS 3THYB 2Z4RA 4L16A 1JALA 3W34A 1C9KA 3OEED 3RRNA 4BLTA 1E96A 2IEYA 2JJ1D 1QHXA 1OSNA 4C0AC 3U6BA 4MRVA 4RD1A 4V0ME 3UMRA 2E9SA 4QJ4A 1NF3A 4D4JA 2QP4A 4OJQA 4DSTA 2ZSFA 2ZUBA 3UXMA 2H17A 1GKIA 2PLRA 5FBVB 3DM9B 3G0HA 1EXMA 4URUR 1EK0A 1NBME 1E2FA 1NY5A 4MKIA 3HU1A 2A5DA 1TUEA 2FMXA 1GILA 1XWIA 1YE8A 3ZIAD 1FTNA 4TLBA 1ZJ6A 1ZW6A 4Q4HA 4W7SA 3PEWA 1LV7A 3W8NA 1E1RD 2IWRA 3ZS8A 1LFDB 5JJLA 1XXHE 1W2GA 1ZM7A 1GFIA 2KJQA 3O47A 3QKTA 1NI3A 4TSFD 2J1LA 4L9SA 4XTRA 2J59A 2ZETA 3FDIA 4B33A 5BXQC 3VAAA 1T3LA 4KBGA 3A37A 5HCNA 3D7MA 4KXFB 4HAVA 1WB9A 1GSIA 4JL5A 3PCRB 4MYHA 1GL9B 2VBCA 4HB3A 3U4QB 3L82B 1OKKD 1R4AA 1E32A 4X8LA 1CEEA 4YXWD 1BH2A 1ZD8A 4QKQA 1XBTA 4URZR 5LD2C 2D74A 1MV5A 1Z06A 2ZI9A 1P2SA 2O0HA 4AKIA 1W0KA 3RDPA 3KTAA 1K5DA 4Q1EA 1CJKC 2VQSA 2QP3A 1TUIA 4FD2A 1DAHA 1P4SA 2H1LA 2IA5A 3L8ZA 5CLLA 4ZKDA 4BFSA 4LDJA 5C4MA 3NC0C 2X19A 3CZPA 1XMJA 4TSFA 2KSQA 2O8BA 1Q0UA 2J0UB 2DFNA 1N0VC 4JVLA 3VR4A 1GRQA 1D8TA 2FH5B 3QPVA 1JI0A 1E69A 2GK7A 2P67A 2ZRGA 3IKJA 3LV8A 2ZUCA 4KJZA 4OBEA 1N6HA 2OLKA 4IDNA 3QKSA 4IVRA 1ZINA 1EG7A 1KI9A 3K1JA 1JPNA 2O8CB 1FX0A 4FMCB 3C14C 1VYUA 1ESMA 2FSFA 2BDTA 2V3CC 3AKEA 1FUKA 3FMFA 2BV3A 1XU4A 2WWIA 5FL7D 4X8OA 3KQUA 1U9IC 3LX5A 4C0KA 4LHYA 4TL8A 5B58C 3CX8A 3QBVA 1OT3A 4HZUB 3X1YA 1Q44A 1WQ1R 4I1SA 3AGPA 1Q21A 4GZLA 3HR8A 4B73A 4E09A 4CVNA 5K8UA 5FTLA 621PA 1FQKA 3AKCA 2EFCB 4LYJA 2O0JA 2JJ1A 2XEXA 1H8ED 1WRBA 1JECA 2EFGA 1P60A 3FHTA 3B1ZA 3KXLA 4B47A 2GAOA 2C95A 2JGNA 1DBSA 2Z6VA 3UK6A 5JEEA 3EPKA 1KKMA 2DY1A 1TX4B 2P3SA 5JBQA 3U3OA 1JXOA 3DOEA 4B3FX 4JL6A 2A7QA 1IOZA 3C8UA 3MCAA 3LXXA 3ZVNA 1XXHB 4PFSA 3KJHA 4TQ9A 4D25A 4MGIR 3C7KA 1T6NA 1J99A 1E79A 2IF2A 4TLCA 3T06B 4G5OA 2A5FA 2AFHE 1R5NA 1G64A 3CF2A 2WZQA 3N2IA 1O3YA 4XJXA 5GVSA 3C5CA 4GT1A 3K09C 2CK3A 4LV6A 4NCNA 3SZRA 4BFVA 4N0DA 5FTKA 5FUYA 1AQYA 1KI6A 3CONA 3WBJA 5JS7A 4EJSC 4KSCA 2FPLA 1AA9A 4P4SA 2XOKD 3ICEA 1MABB 2EYQA 1S0UA 2GJAA 4RFSB 3ZZTA 1G7CA 1IAQA 1CXZA 3UPUA 1OH8A 2HCBA 1Z0IA 2ZU0C 1GTVA 2QY9A 1HYQA 3KTAB 1K8RA 5BN5A 1RVDA 1ZIPA 2VHJA 2JDID 3B1WA 1TAGA 4ZI2A 1Q3HA 4Q7KA 2DB3A 2DFLA 2XNSA 1UEJA 2IS4A 3TJZA 4NCIA 4NYIR 1VHTA 1KSJA 5SZHB 5FFMA 3GJXC 1WE2A 4BUJA 2GF0A 2QGZA 3FGNA 3ZVMA 2Q9AA 4A0HA 3ZQJA 3CX7A 1R0WA 1RE0A 1MO3A 4HDOB 2ZJYA 2P6UA 1JNYA 1XTRA 4R2IA 4TQAA 4B35A 4EJSB 4W5JA 3VR5A 1IN8A 3I5YA 5JI3E 4OHZA 2R9VA 3RVBA 5KUTA 2PBRA 2RGXA 3H0KA 3LVRE 1VTKA 4UXHA 1MOZA 1W36B 1FTSA 1KO5A 3B78A 4HUQA 1OFIA 1SVLA 3AVPA 4J0QA 5KDDA 4D4MA 1GL7A 2XOKA 1VG8A 4ZO4A 3ZVLA 5AUOB 4A36A 2YZ2A 1D5CA 2PX0A 3K0CA 5A0FA 3BJIC 4Y0AA 3LLMA 3TAUA 2V9PA 2HJGA 1SULA 4NYIQ 1S96A 5JRZA 1ZM3A 1YQTA 2ZR9A 4XWOA 3GJ0A 2XXAA 2OFWA 3I61A 1T5LA 4LJ5A 4QRHA 4OL0A 3NKVA 1T8UA 4NYJR 5HR5A 3M4YA 1E2HA 1E9EA 2KI5A 4Q21A 3IHWA 2GXSA 2ZI6A 5EE5B 3PEVA 3ZD7A 2IS6A 4OHVA 3U7FB 4P3YA 3TW8B 5JJKA 3NBYC 1AN0A 2HF9A 2YC4C 2ZI4A 4LJAA 1TMKA 4MKFA 4Q03A 1BMFA 3TR0A 4F4CA 1G9XA 4OQLA 4BECA 1Z6AA 2ZR0A 2ODBA 4PAQA 2ORWA 3VU9B 6Q21A 4CEIB 5AUQA 5G53C 2QM7A 3BGWA 4A0FA 4BQSA 3P4XA 4RCZA 3AUXA 3TVTA 4HUQB 3PITA 1G8YA 2RH5A 1Z47A 2GJKA 4ZDWA 1NMXA 1UDWA 1RKBA 3T1OA 4AKEA 1D9ZA 3HYTA 4PPNA 1II0A 1GITA 1K6MA 3C4JA 2UKDA 2ZRDA 1QZXA 3IGFA 3Q5EA 1KK2A 4YC7A 2Q6TA 5TV2A 3SJBA 2FN4A 1AK2A 5EJEA 4ON9A 3KQHA 1OYWA 3P4YA 3O8RA 5EXTA 3S1AA 2JEOA 5DHFA 3FFBA 1H8HD 5FI0B 2HLDD 3KQNA 1F2TA 1BKDR 2ZJAA 3ICQB 2F43A 5BW8A 4FWIB 4C30A 1ODFA 2BBTA 2GF9A 3L0SA 4OJKA 2NO7A 2V55B 1S3GA 3GLFE 4HZUA 4PHTA 3W6PA 4IEIA 1W4RA 2KBFA 1P7CA 4JJKA 4PZYA 4CYMA 1PZNA 4FWTA 4TZ0A 1HURA 4GRAA 2FPMA 4C2UA 1KHTA 2CDNA 1F6BA 1GKYA 821PA 2H8KA 3NBZC 1PJRA 4DCUA 1L2TA 4KFSA 5E7MA 3TMKA 4Q00A 1VCNA 3RNLA 1NIJA 5AUPB 4FN5A 1YJ5A 2MSEB 4GNKA 3QXCA 1ZD9A 1Z07A 4QFMA 5CDFA 4QGAA 4EUNA 3LNCA 1E9FA 5IDVA 3EX7C 4QGHA 2F9MA 4LYFA 2ZQ5A 1SXJD 1SHZA 3QF7A 1DPFA 2IYWA 4A9AA 3L2OB 2R6GA 4TLDA 2G83A 2IYUA 2J7KA 2G6BA 4ASUD 3AVTA 3VTKA 2C8VA 5TMPA 3PEYA 1DE0A 4QNRA 5L3SB 4DRZA 2WSMA 4HEJA 1G7RA 4OI2A 4CF7A 4QM6A 4AKGA 2ZRCA 4BLQA 3ZYCA 3RHFA 3K70C 2JAQA 2CK3D 5EP3A 3QI2A 2AN9A 4QBHA 2DFTA 4ARZB 1CRPA 1WXQA 1OH6A 1NRJB 2OEPA 4CT5A 2WKPA 3FMPB 3FVQA 4PPGA 1SGWA 2W2VA 4HDCA 1ZNXA 4M21A 4PSVA 1CBUA 3VNVA 1OYYA 1HQYE 4QOSA 2GCPA 1PUJA 1FP7A 1P72A 4RCYA 2GTPA 1GNPA 4R2HA 1N6LA 3UWOA 2H7VA 2W2XA 3GLHA 2J7PD 3SOPA 2V4ZA 4B3GA 2F9LA 2C96A 2QAGA 2IYQA 2ZREA 1ZD1A 3OIUA 4AY2A 1NL3A 5GJBA 2ZYTX 1OXXK 4JLJA 3W3ZB 3WHKA 1U94A 1EX6A 2AL7A 1HUQA 8OHMA 1XRJA 3GCGA 1NLZA 2QAGC 3NC1C 4D4LA 4DJTA 1E0AA 1DOAA 3REGA 1G4AE 4C0HA 2ZRFA 2ZR7A 4U00A 4EQ6B 1TL7C 2AXPA 1OHHD 1I4DD 3OE7D 3MLEA 2YWGA 4ESVA 1M1YE 3O8CA 4Q9IA 1UDXA 2HV8A 1VDZA 2BHRA 4YMWA 3TAHA 1N6KA 4NHOA 3GD7A 2WJYA 1SZPA 2SHKA 1AGRA 1LVGA 4BEBA 4MH0R 4TTPA 1G8GA 2GZAA 4EIWA 3THYA 4RD2A 1YU9A 4LX0A 4F92B 2GXAA 2CXXA 5FUXA 3QIAA 4CZ2A 2RGEA 4YMTA 4A8JB 5LD2B 1E94E 5BN3A 3K9LA 2DYKA 2ZRMA 2VP6A 3CH4B 2AR7A 5JZVA 3DKPA 3AVXA 4BFYA 1NKTA 5K8TA 5F98A 5J4YA 3K8YA 3H84A 1G17A 4CT4B 5CB6A 1CR2A 2GEDA 1OF1A 1ZNYA 1RRGA 4DCNA 1E6CA 3EZFA 4QC2A 4BRUA 3AVVA 4M9XA 1I2MA 4ZDIA 3JZMA 2F43B 3P27A 3NTUA 1RW4A 5KSZA 1G41A 2IBMA 1E9BA 3IO3A 2PMDA 2REBA 5TXGA 3M1IA 1G5TA 2JA1A 1G16A 1R6BX 4GSYA 1Q1QA 2V7QD 5F2EA 2BKUA 4BLSA 2ZE8A 4Q4AB 1VG9B 2F1HA 5CYOA 2CMKA 1C1YA 2JIZA 2VSFA 4TMZA 2JLVA 2FU5C 3K0EA 4B32A 1GRRA 2YVUA 3EWSA 1KK0A 3Q72A 2WWYA 2OXCA 4C3ZA 4L4UA 5EP4A 4TTQA 1KI4A 3AVQA 3EZ7A 2R44A 1GVNB 1E9CA 4FIDA 3EIHA 3K09A 1ZIOA 3QKRA 4B6FA 1WBDA 2QGNA 4F7WA 4U7DA 1N5LA 3CPJB 1A4RA 5JEDA 4BLRA 1P62B 3WYFA 3HU3A 2UVQA 1M34E 3N70A 1W0JD 2UZIR 2VTKA 1IBRA 2QPOA 1G8FA 1VMAA 2C99A 2XTNA 1VYVA 2ZXUA 3GLFA 4C0SA 3A1TA 3IBGA 2CNWD 4B2IA 3DVLA 3KKOA 4AG6A 2NPIA 3CNLA 2CHQA 3OAAD 3ZS9A 5BN4A 2GJ8A 1JJVA 1KOFA 2ORVA 2ZJZA 3P20A 5BQ5A 2AD1A 1CF4A 3K9NA 3WNCA 1FNMA 4HLDA 2XXAB 1LTQA 3W6NA 1OB5A 2B92A 3OEEA 4W5WA 3PEUA 3VX3A 1S4QA 3TK1A 3TIFA 3M6AA 1LNZA 3HPRA 2Q0HA 1XCPA 4GFDA 1Q3TA 2XX3A 5EE3A 2EQBA 4DLWA 221PA 2VIIA 4B3XA 1KDRA 5EUQB 4PAMA 1NSTA 1HTWA 4Q4HB 2V8OA 4JVMA 2E1RA 1XMVA 4WA7A 2O8EA 2F1RA 4LPSA 4NBSA 2J45A 1KO4A 1R5BA 3C41J 4OQXA 3SFZA 4DDVA 3K0AA 1G3IA 5CIWA 3CUEF 2JLUA 3THOA 1Z22A 2PJZA 3SS8A 3BC1A 5J4KA 3EXAA 4KBFA 1VPLA 2IYXA 3EG5A 2YINC 3BH0A 4L5BA 4IXMA 1Q1BA 2A5YB 1TQ4A 2IHBA 4EAQA 1M7GA 2GCNA 4RFSA 1E0JA 4PHGA 5CYPA 3EWAA 1XEWY 3QVVA 2IYLD 1JR3D 1L7VC 4FCWA 1SKQA 4PAOA 4WZBE 4ZIRA 5L3VA 5JHHB 1LS1A 3WP1B 1II9A 3BH6A 1E98A 2GNOA 4JLBA 2XSZA 2ZVPX 4F4JA 3GMTA 4DLSA 2IUTA 3MWLA 3QPUA 1OPXA 4NU0A 1E2EA 1GAJA 2AD5A 2RHMA 2D3WA 3T1VA 1A1VA 3NH9A 4KSBA 3I72A 5DISB 3R7WA 4B3BA 5JJIA 4DEXA 2B8TA 4ZKEA 4TLEA 2D62A 2RGGA 1Q57A 4IDOA 4XOIA 1QHYA 4B44A 4TYWA 3W3AA 1JPJA 1P3JA 3RAPR 2GZHA 3CR8A 1NMYA 1G8HA 3HP1A 5H68A 1ZAKA 1KI1A 2PX3A 2QRNA 2IX3A 1X1SA 5IT5A 2IF0A 2YOFA 3SQWA 1OFTA 3F3YA 3MG9A 5K8IA 4DC9A 2OAP1 4O2RA 1UAAA 1SXJE 2ZI7A 1NN3A 2EU8A 4A8JA 4BEJA 4ZCMA 3LY5A 2HLDA 4XWAA 1TF2A 1P2UA 5FPTA 3U7EB 3C15C 1G6HA 1OHHA 4P32A 3SN6A 3I73A 2QMHA 1GUAA 1N2CE 5JWHA 4D26A 4TTRA 1E3MA 2OBLA 2R6CA 2PZGA 3BWDD 4JSYA 4POAA 1NNEA 3AKDA 3CWZA 2P6RA 3I62A 3PUYA 3FWYA 3P32A 1QF9A 2F6RA 4HB4A 3CRRA 2ZJ2A 1J8MF 4YMSA 4CRWB 1KAOA 3LBIA 1OIWA 3X1DA 4B71A 2GVZC 4OQFA 2BMEA 4GP6A 1UM8A 4F91B 5IK2D 2O8DA 2FEOA 1G5RA 1N0UA 3CRQA 1XMIA 4B2LA 2ZI3A 1YVDA 1LY1A 3WNDA 1O87A 4GI7A 4BLOA 3BS4A 3IHLA 4PR0A 3OAAA 3M0EA 3A1WA 2G77B 2J0SA 1E0KA 4TWZA 2QPTA 1VG0B 2BIFA 2W6JD 2WHXA 3MRSA 5GJCA 3X2SA 2JLQA 3NDPA 1XTIA 4NP6A 2O5VA 3DHWC 4W9MC 4C2TA 4ZIRB 5JS8A 4O25A 5CB8A 4EFNA 4YMVA 3W90A 4O3MA 1SVKA 1AJEA 1ZU4A 1JR3E 1EFTA 3SU8A 5AJWA 3K0SA 2I1VB 4IOJA 2HT6A 1YHNA 3W5IA 2RGAA 4D80A 5JLJA 1VECA 2OBMA 3EA0A 3QEJA 3P1JA 3T61A 2YC2C 1S2MA 1JBKA 3GLIE 5JI2E 3BIFA 1HT2E 4JKIA 2LKDA 4K81B 3H1TA 2J9RA 3MWJA 1T0HB 2IYZA 3UMSA 4TZ6A 3D31A 1AS3A 5LPNA 2FE4A 4V0NA 1W0KD 3MFYA 3AF0A 3KJGA 2HCJB 3R9WA 2O8CA 1JEEA 2BMFA 1IM2A 2C9CA 4OI4A 4NYMQ 2HYIC 2QENA 2RMKA 5DI3B 1OKKA 4GZMA 5CJPA 3GPLA 1DVRA 2OV2A 3ZZ0A 1P73A 4CGZA 4JMPA 1XD8A 2AHOA 4M9ZA 1DTSA 1E2NA 3DDCA 4LPKA 4N0EA 4RZXA 4B6EA 2WJGA 1TQ2A 2NO9A 3DMNA 4YDHB 1TQDA 3ZH9B 4JLVA 4PPQA 4TT3A 4PC7A 1LF0A 2Q3MA 2Z5FA 1MRNA 1TU3A 4A1FA 2BBOA 1KJZA 1T9HA 3I4LA 2OM2A 2CEAA 2LWIA 2FG5A 2D06A 2WPDA 3SBEA 4ZCIA 5KPDA 2QBYA 4FXPA 3ND9A 3F0TA 2R8RA 3BFXA 3QXXA 5L3SA 2ZVQX 1OFHA 1Z29A 1N6NA 3HWSA 4UKDA 4G3XA 4L9WA 3U44A 1L4UA 4TMVA 5B30A 1H8HA 4PQRA 4DIDA 2CVHA 4ZPXA 1N0WA 1KSHA 1G19A 4Q4AA 2OE2A 3KXKA 4JBXA 4RY2A 4DUGA 4RJLA 1NBMD 2DWOA 4DB4A 1IY2A 2HXYA 1EGAA 2ZU6A 5KSPA 2R65A 3TUJC 3RRYA 3EW9A 3IBYA 3THWA 4I1UA 3A1SA 1UFQA 3GJ3A 721PA 5LB4A 4TMWA 1N5IA 2CE2X 3ZVRA 3IUYA 1N5KA 3SC3A 1G3QA 1D9XA 3QEOA 2O8DB 1US8B 1NKSA 1CRQA 2FJUA 4BLPA 2DBYA 2ZRHA 1R10A 1E2GA 1UPTA 4Q66C 2GHIA 2J46A 4BFWA 1CJMA 3LBNA 4JBWA 1YZGA 1KK1A 1FZQA 1GIAA 1MT0A 2B7BA 1YKSA 3MJHA 3TE6A 4M1OA 2O8FA 2G1KA 1XNJA 1U8ZA 1DAGA 1T4GA 3PUVA 3U3RA 4HB2A 5JMTA 3IPXA 1XTQA 3B5JA 4NONA 4HLUC 4M2LA 1P6XA 3QXJA 4PC2A 3VHXA 4IW3B 4A15A 1W5TA 2EVWX 2Z43A 2VSOA 4QGFA 5JSZA 4BZXA 3BOSA 2XZLA 1RRFA 1OV4A 1IJEA 3BE4A 4QBGB 4A2QA 3EPJA 1HA3A 1MH1A 1KSGA 5EZ6B 3AM1A 4D0GA 4JLMA 5AJYA 4LYAA 2JLWA 2O0KA 3I32A 1RPZA 2GVDC 1US8A 4L8GA 2NMVA 1RYFA 2PT7A 3CKLA 2VPPA 1OXVA 3LW7A 1G7SA 3C5HA 2XZPA 4I4LA 3LBHA 5CIQA 2OAQ1 2I1QA 2OUKA 2RGBA 2G3YA 3QENA 4KFRA 4TL9A 5GJWC 2QA5A 3LD9A 3UG7A 2FDCA 2K5UA 3ONWA 1F3OA 2ZAMA 3MGCA 3RWOA 2DCUA 1GNQA 2WWWA 2IT1A 1KO7A 2OCPA 4MGYR 3SJCA 2FA9A 4M1MA 1W44A 1HT1E 4N1AA 3AUYA 1ZM9A 2YHSA 5KTYA 4DLYA 1H65A 1KI2A 1WF3A 1GG2A 4XSHA 2C03A 4G5SA 1U8AA 2WJJA 2A2ZA 4ACAA 2QI9C 2ECKA 1DG1G 1M7HA 3EC1A 3LRPA 4K8OA 2HJVA 1X8LA 2ATVA 5FPYA 2IW3A 4OYHA 4IFBA 3CH5A 2BJWA 2ZE5A 1UKEA 3K0AB 1DAKA 2QSZA 2CVFA 4HZIA 2QQ0A 3EA5A 2WWFA 1E99A 2X2FA 3L8YA 4TL7A 3NXSA 3MMPA 3FHOA 4LOAA 2ZPTX 4KLZA 4E5UA 1Q12A 3FYHA 3Q9LA 4RD0A 2WSSA 4P0TA 3FFAA 2HUPA 5HZHA 4YLGA 4AYWA 4XSGA 3T12A 4AK9A 2D7CA 2CL0X 5EXPA 1EFRA 1XD2B 1Q22A 3PUXA 4V0KA 1A7JA 1CULC 1NG1A 2GETA 2RGDA 4QJ5A 4JLAA 5EZ5A 5GVRA 1G3RA 3B8HA 2XB4A 4PC6A 1JQLB 1U0LA 3TLXA 4EPRA 1VCIA 3U3KA 1I4TD 2AXNA 5FBWB 5D3QA 3K0FA 3OEHD 1DAEA 4DXAA 5FOXA 4RSGA 4M1KA 4LV8B 1F2UA 3SJZA 1M6NA 2VH5R 3U3MA 1GWNA 5FBRB 2BJVA 5HPYB 5KSYA 4D2IA 4LRWA 1TU4A 4AWXA 4KFTA 4JBYA 2KE5A 4DT1A 2DR3A 4QGGA 2IUSA 3ADDA 1FL9A 3R8FA 2OO7A 2PL3A 2ZJ8A 5FUWA 1IXSB 4F38A 3TUZC 1P61B 1HY3A 1KNXA 2N1BA 5G40A 3VR6A 1SKYE 3QY0A 3QKSB 2AK3A 2IWHA 4FCTA 1I4LD 1M74A 4B74A 1KI7A 4QHSA 1TF5A 4RKFA 2REXB 1VIYA 4Q5IA 5EE9A 1YRBA 1XPUA 3ZQ6A 2OLJA 2PH1A 2ZRJA 3R9IA 3QQ5A 4KYUA 4ZCLA 521PA 2PJRA 4BASA 1KGDA 3QKUA 1XP8A 1FFHA 2VP0A 2WOOA 5DYIA 3PFIA 3WXMA 1CJTC 2YV5A 1F2UB 4GP7A 3KL4A 2BEKA 3I1FA 4B2PA 3I92A 4XVQA 2OSBA 2Q3FA 1GKUB 3K0FB 1S9HA 4AIIA 1KJYA 1DAFA 2KBEA 4MYUA 1XEFA 1U9IA 5DO9A 4BGDA 2JLZA 1CKEA 1NN1A 2GA8A 3OEHA 2XZOA 4A8JC 4M22A 1JQJC 1AKEA 1Z0DA 4BWYA 4DDWA 2X2EA 1YR6A 3CLVA 4YDSA 3B1YA 3THXB 1X86B 4HYYA 1KDTA 3EPHA 4MUBA 1XEXB 4FI3C 4DLRA 1NP6A 1RC8A 3WYGA 4IRUB 4MGKR 3REFA 4D81A 4C7OB 1UBEA 3GLGA 1G6OA 4GL2A 4FMBB 3ECCA 4TMKA 2IS1A 4E07A 1TTTA 4JS0A 4DZZA 1TADA 2WSSD 1GNRA 2ZRIA 3SQXA 1X6VA 5CITA 4OK5A 3RS4A 1QRAA 2QUZA 4JKYA 4Q47A 3TGPA 2BBSA 2YJTD 1E1RA 4M1TA 5LB2A 4TYNA 2CLCX 3O8BA 2PZEA 4MA4A 3GJ6A 2VF8A 3ZZUA 3A4LA 1VCOA 4EFMA 3EARA 4NE2A 3T1TA 3NVAA 3JVVA 4A82A 2YOGA 4IHQA 1U81A 4G5QA 3LQQA 5FTJA 2AX4A 1QHNA 3EZ2A 3QXHA 4LHXA 4DT1B 1P5ZB 4BE7B 2YWHA 1EX7A 2W0MA 4PQYA 1JB1A 4V03A 3E5HA 1F48A 4KLNA 4LCBA 1ETUA 1N6PA 4O2LA 3SYKA 3V9PA 2ZM5A 2OILA 5J5CA 2FPKA 2WMOB 1G3MA 5SZJA 3O8DA 2P0EA 2Y8EA 5BYKA 2F55A 5TB5A 4Q48A 4A0GA 5J4LA 3DM5A 3AKYA 2V1UA 2AWOA 1MKYA 2H16A 2ZEJA 1RFLA 5C4GB 3AVWA 2ZS7A 4GOKA 5J4HA 3X1ZA 3KKMA 1BS1A 1E9SA 1TEVA 2WVJA 4QBFA 3VR1A 4EJSA 5E3HA 2F1IA 4C0QC 2FV8A 1AKYA 2ZIAA 4P4SB 1W49A 3WMGA 5HTKA 2IYSA 4Q4JA 4YMUA 3DKVA 4II7A 3SE0A 1E9RA 1Z28A 5AR1A 1PVOA 3N5CA 2JIZD 4IDPA 5HKKA 2G1JA 2ZRAA 2B7CA 2QM8A 4KI0A 4Q9KA 2R2AA 3W9YA 5KHOC 1B23P 1RZ3A 2BM1A 4PSAA 2J0VA 4OQMA 2QT1A 2CBZA 2V6JA 1EWQA 2WBLC 4QJ3A 1T0JB 1Z8FA 4Q7MB 2XSZD 1Z0FA 1KI8A 1ZM2A 4WIAA 2ERYA 4RD3A 3PUZA 3QKRB 4P31A 4HLUA 1M2OB 1E1QD 3GEIA 3CNNA 1CJUC 4GOXA 4AYXA 3N2EA 2NZJA 4UNPA 1PLJA 2XTZA 1IN5A 3OZXA 2ZTSA 5HE8A 5KNDA 4HAWA 1J2JA 4UNQA 5KDLA 2JLYA 1DG3A 1R0YA 2EWVA 3UANA 2ZRKA 1CTQA 3FPAA 3CF6R 3F5FA 4URWR 2ZRNA 1W2HA 4EPXA 4RZUA 4M1WA 1IJFA 4XTCS 3GEEA 1PLLA 4HAXA 2HF8A 4AG5A 1E79D 2JLRA 2XGJA 5FUVA 5CLQA 1U99A 1ZUHA 4LY6A 1IXRC 2FZ4A 2D2FA 3ASYA 4HB0A 4RD4A 1J7KA 4X8HA 1KMHA 4NTZA 1NLFA 1B0UA 5CJ2A 4Z8YA 2WICA 2O8BB 4JVSB 3J81k 1AQUA 4FMDB 1MO6A 3RS2A 2ZSEA 2A3RA 5C18A 1KO8A 4G5GA 1W48A 4TYPA 4KU4A 1WP9A 5FI1B 2JJ2D 3PV0A 2QMUA 1KAGA 4LV5B 1LB1B 3PR1A 2WMNB 3BRWD 1E2KA 3H86A 4W5HA 3KKNA 1Z6YA 4TT3D 4WOPA 3SHFA 3EIEA 2KWIA 3RLFA 2LKCA 4ZDJA 3U4QA 3AF1A 2NQ2C 1FMLA 5F9FA 3LWNA 4IVQA 3T5GA 3W6OA 1D2NA 1W4BA 1YRAA 5E7IA 3NEJA 2WIBA 3ZLJA 4GMXA 2ODWA 3AV0B 4MKHA 1AZTA 3CF0A 5P21A 2BEJA 3QVUA 3A6PC 2P5SA 1AS2A 3IO5A 3Q7PA 4US0R 1R0ZA 4P33A 3RC8A 4DHEA 5LDDC 2VLIA 1Z2AA 2X77A 4FW9A 4IXNA 4OQNA 2R6AA 3CBQA 4CW7A 1KO1A 4F93B 1UBCA 4RFVA 2C77A 3U60B 1N6IA 3OFND 3TQCA 3VU9A 4D6PA 2NGRA 3B85A 1XF9A 3SFVA 4I81A 3QG5A 4HDQB 1KZ7B 4IEEA 4M9QA 3GJ4A 2FGKA 2QQEA 1RRCA 2EFDB 1F60A 1G21E 1E2IA 2JASA 5FOUA 3T1QA 3UIEA 4ESHA 4Q7JB 1E9AA 1DADA 1Z3IX 1OIXA 1OXUA 1KY3A 2BBWA 3OESA 4B3CA 5FOVA 1S1CA 2QN6A 2IEZA 1K5GA 2R6FA 2LCFA 1AZSC 1R8SA 2I3BA 2GBLA 3B6EA 4AC9A 1VIAA 3ZGXA 2YKGA 2Q3HA 3RS3A 2XITA 3FOZA 4WXPA 1E4VA 4Z1MA 2HEIA 3VNUA 1T5IA 1JEDA 1E9DA 1W5SA 3F8TA 4B3DA 4IDQA 5FOSA 2IUUA 5J40A 3FB4A 2XJ9A 3CB4A 4DLTA 1BYIA 1EWRA 3BFKA 2WJHA 4LHVA 2JDIA 4MKGA 4C0BA 5EXSA 1G4UR 1WA5A 4UNSA 4EKDA 4Q9HA 1YR8A 3CRW1 4NYMR 2QG6A 4Q4JB 3WHLA 4O0MA 3QOFA 4JLNA 5TVKA 4Q1AA 5UKDA 3SEAA 5ELXA 1VKJA 2ZJBA 1TNDA 2C98A 3LA6A 3P26A 4ITRC 4LJ9A 1R5OA 4UQOA 1KNQA 2QRZA 2P6NA 1A82A 2QAJA 3PVSA 3QNUA 4MDFA 2W6JA 4DSUA 1Z2CA 2WM9B 2Z83A 4OI0A 5H8WA 2GBLC 3CX6A 2CL6X 5ANRB 4M1YA 2R62A 2IK8A 3QBTA 1CR4A 2W6IA 1QBKC 1P9RA 4XH9B 2A5JA 4EFLA 3H2YA 4PZZA 5AUNB 3PXGA 3MAAC 2CJWA 4OI1A 3B82A 1AIPA 4Z8XA 4DCVA 3RABA 5FL7A 1NIPA 3A36A 2NTYC 1KIMA 3BB3A 3JZAA 4LBWA 5B64A 3FMOB 4I1OA 4LI0A 3GLGE 1H8EA 4LUCA 2NIPA 3FKSD 2P2LA 3R8CA 2DWQA 2GWHA 3DPUA 2PT5A 5L3QA 4V0OA 3BH7A 2E87A 3CNOA 4NL4H 1SXJA 4KVGA 4QBIA 5KSOA 4DWJA 4MRRA 1WDTA 3B60A 2G0TA 1ZCBA 3B7GA 4PANA 4R71A 4Q1CA 1IONA 1X8KA 1RJ9B 1XD2A 4NZYA 5IF9A 1VYTA 4GBMA 3AEZA 1GZSA 3BBPA 5IHPA 3IEVA 3MSXA 3CM0A 5L3RA 1XCGB 1XZPA 2ZAOA 1EFUA 5J4VA 3K0CC 1KKLA 3PENA 1Z6GA 4NCKA 1ESNA 4BZQA 3AH8A 2TMKA 2OXRA 3CPHA 3ADKA 2BCGY 2Q9CA 1G3UA 4WAUA 3V4RA 3CW2A 1G20E 1QHHA 1Q1ZA 2CHVA 5AJZA 1E2JA 2OFOA 2W58A 2C9OA 1XJCA 2ZRLA 1U90A 1XMSA 3IQXA 1JR6A 3QXSA 3A1VA 3LXRA 5E95A 1IY1A 2PCJA 4V0LA 4PC1A 4TL6A 3RANA 4PSKA 4KVAA 4IFEA 4JLKA 2FSHA 4KODA 4PQFA 5HKKD 5JCZA 1C4OA 3B13B 3TNFA 3LAWA 3SHWA 3BERA 3Q7QA 2RCNA 1P9NA 1FQJA 1Z08A 2XB2A 4Q1FA 3L43A 2AKYA 1KDPA 3D3QA 1T3HA 2C9YA 3HU2A 5JHGB 4KAXA 2F1JA 3IILA 1XJ0A 2ZI5A 3SYLA 1E2LA 1CS4C 4LZZA 2ZROA 3RS5A 3TQFA 2PZFA 2VSXA 4GPTA 2J0UA 2V54A 2ODNA 4UNNA 2MMCA 4HLCA 2ZYUX 3DOFA 3E1SA 4LJYA 4XD7A 2GK6A 4Y0VA 4MRNA 1X3SA 3SNHA 5G41A 3A58B 1J8YF 1BMFD 2FFQA 5KO2A 4WBSA 4OK6A 2WAXA 5BWMA 5F9HA 3KXIA 2MSCB 3TBKA 4FCVA 4GDFA 4I1VA 4MRSA 4LJ4A 2VHUA 4JSTA 2QORA 2GCOA 3PIRA 2N42A 3GLGB 4AI6A 2XAUA 3KQLA 2PMKA 1GDDA 2O8EB 4C4PA 4V0MA 1R8QA 4KO8A 4P4TA 4R98A 4E22A 1XEXA 4HAYA 1Y63A 2B8WA 1Z63A 1W36D 3A4NA 1V5WA 1RYHA 2CCJA 3UG6A 3THXA 1NBMA 1EFRD 1UADA 1XTKA 4GOJA 3TR5A 2ZSBA 3JVUA 3GJ5A 2BC9A 5SZKB 2OT3B 1KJWA 3PUWA 1TEXA 2CCGA 4A4DA 1MABA 1CR0A 2XNDD 2DPXA 2C04A 2GCOB 1S1MA 1Z0KA 4US2R 5DLQC 4NMMA 4R9UC 1E2MA 1D6JA 2ODEA 2ZS8A 4B34A 1E2PA 1IQPA 1G8PA 4LC0A 1A2BA 2GEVA 2DWPA 3BB1A 3UMFA 1RJ9A 1PUIA 2VEDA 3NIBA 1WBBA 2WIAA 1S8FA 3GJ7A 4IOMA 4QM7A 2ERXA 3EZ9A 3VFDA 4D82A 2OBNA 3KFXA 1KMHB 2BOVA 1UKZA 3AP3A 4M9SA 5E4FA 5DI9A 2QT0A 1FW6A 1AM4D 2Z4SA 3BXZA 121PA 2J87A 1HE8B 1MR3F 1DELA 2O52A 2ZITA 1QDEA 2NG1A 3HYRA 3I3SR 4LC1A 1SHKA 2A78A 4WXRA 5CK4A 5CM8B 4BPBA 1OXTA 3BB4A 3DEFA 3OF5A 3Q85A 5JWRA 1YZLA 3LH5A 3WNBA 5HE9A 4DLUA 3ADBA 2B21A 3GLFB 2DFKB 3AF3A 3LW8A 3A4MA 3T35A 2VO1A 4KCGA 1SVMA 4LHWA 4BFTA 1SXJB 4TMTA 5EE0A 2O8FB 3ND8A 3U61B 2QP9X 1F2TB 3EZ6A 4KHZA 2CLDX 3G5UA 1CP2A 1XJQA 1KMQA 2BM0A 2ZRBA 5EP1A 2HYDA 4BFXA 4A0RA 2D7DA 2RGNC 3UKDA 1LS6A 1JAIA 4AYTA 4H1VA 4C0LA 4PC3A 3RWMB 5FPSA 3CIOA 5JECA 5TARA 1NJGA 3ASZA 1U2RA 3EPLA 4DB2A 2X1VA 1XX6A 4CDGA 1QHSA 2JCSA 1UKYA 4NCHA 5AK0A 1GOTA 2VP9A 3IQWA 2CCKA 3V00A 4DLVA 3SYNA 1GM5A 1FUUA 5D3MA 1NN5A 2YWFA 1CU1A 3HPQA 4JLOA 2ZYVX 2A30A 1ZCAA
chains in the Genus database with same CATH superfamily
3OOHA 4MDEA 1XZKA 1P18A 5FCDA 1LA2A 2Q8PA 1RNLA 1WU7A 4TN1A 3BT7A 1P4HA 2REOA 4D44A 1Q95A 3MCZA 1E8NA 1HE1C 1ESEA 1EXDA 4LK2A 4K6KA 1X2EA 4EEKA 2GXQA 1EX1A 2QTVA 4JT4A 1T1EA 1FPMA 3OPYI 3V4FA 4DMGA 2P4HX 5KREA 5KBYA 3QLVC 3TNDA 1GG9A 1B8PA 3LUHA 1ZI8A 5HJ7A 2WIGA 1V8FA 1SK8A 2A4MA 2ZWIA 3AJEA 4RJIA 5EXXA 2OCIA 3H87A 2C00A 4QYIB 1J8QA 2XDAA 3FYDA 5GIPE 1FSFA 4GUDA 3ZUPA 4LWZA 5K20A 4RH0A 4R8LA 3UYLA 2B4TO 2FP3A 3B70A 4JJ4A 1HQDA 4V0RA 1DTWA 5EAIA 1GUDA 4RD6A 4BMPB 5EJ5A 3GP8A 2OD2A 4NR0A 3QE4A 4Q7QA 1G60A 3HDTA 1ULTA 3OP4A 5BQPA 3KLOA 3GLIB 5G4LA 1M2EA 4RZ2A 4P83A 4MRMB 4YUVA 3FWPA 2R3SA 2BUAA 2YVQA 3SEQA 3SR4A 1BXGB 3FTNA 2Y2UA 4QT4A 4MR9A 4GLJA 5TR9A 421PA 3OJLA 3E9CA 4N47A 3HZRA 2OXEA 3DDHA 4XIIA 3WKCA 4N7MA 3WLFA 2WTNA 2AN4A 1M2FA 3C74A 2RHWA 3LKZA 1ZW1A 3R3JA 4KVZA 5BR1A 2ADFA 2W0SA 3V80A 4O0LA 2DHCA 4QE3A 4MW2A 2NO6A 4MMYB 5EYPB 2D3TA 2HA0A 3IUNA 2IHYA 4UXJA 2YJ5A 3FSGD 5BSRA 1QYRA 1V8ZA 3I05A 3GY0A 3GRVA 4IVPA 4PTLA 5DGIA 1M2VA 3VR6H 1R4ZA 1J2UA 2QD2A 3WC4A 2NT4A 2Y68A 1EVYA 4MUYA 2QKYA 2VJOA 3EXIB 3U4CA 5DASA 3C5EA 4D9BA 4QZVA 3H5NA 2QM0A 3LZCA 1IN1A 4EB6A 2ZIXA 1XZGA 2B83A 2C1XA 3WBKA 4F2HA 2L2QA 3GOHA 4BWGA 4NWIA 1RWWA 4FINA 5KI6A 2RGUA 3SI7A 3MGBA 2OO5C 1YR2A 2WF6A 1I6KA 2G04A 2P9ZA 4FR2A 4INJA 2KLHA 1QX4A 4TWIA 5AJHA 5H1YA 1GP2A 4ZDKA 5C8YB 1XTVA 1ATZA 3AW9A 4QUBA 5HOQA 1GAEO 4FMCF 2I4LA 4FFBB 4UJ5A 2GXUA 2B4AA 5REQA 4IKOA 2ZW9A 1ZIDA 1JG1A 1U0HC 3IEXA 4KAJA 3TW4A 3QF4A 4B43A 4MB0A 1YI0A 3OA2A 4DSOA 1JDBC 4RVUA 4TMFA 2HA2A 1V96A 2O2YA 4CODB 1E1YA 1XZAA 1JRLA 1XN4A 2QMYA 4EA9A 2B5WA 3O9ZA 4RLFA 4J3JA 1P5FA 1MPXA 2NPFA 2GUWA 1Y6FA 3N59A 1G1MA 5BUSA 1MO5A 3MWYW 4PSUA 4LF6B 3JCZA 5JQWA 1AMNA 1IEQA 3JSXA 4NMXB 4FU0A 3THWB 1IPFA 1Z4PX 2IYNA 4UMDA 5DU2A 3NWEA 3OG9A 5E0KB 1MDFA 1EUDA 4HVTA 4DYDA 4H77A 3HCEA 2RAPA 4HH3C 5FQNA 4DAOA 3HBJA 1F0KA 3P9YA 1CR6A 2AXEA 2KW5A 4XDZA 2PEYA 3PC2A 3VM6A 4MQFB 1PR6A 2EEZA 1EJBA 4TMXA 3QPWA 5EZYF 1DUSA 1X7WB 3TD2A 3V42A 5HQ3A 3KFVA 4JFAA 1NVDA 1NM5C 1ZRHA 2NO1A 1FBNA 4YQFA 1UEXC 2J32A 4Q34A 1DAPA 4QQKA 1AKMA 1UDBA 1H3NA 1VMIA 2C2HA 4WK0B 3AVOA 3BE5A 2UZ0A 1RC0A 3GQBA 1KK3A 2QZZA 4WZAE 5BUZA 5IN4A 1CW2B 2VYND 3VZPA 3ZK7A 2PIDA 5AIBA 5DK6A 3O1LA 4I99A 2QU8A 5FOWA 2I4NA 5HILA 1QH8B 1T8SA 4YJHB 1JFRA 1XPRA 5A4JA 1U4OA 3HSKA 4R84A 2Y1KA 2AK2A 2CE7A 3D8NA 1K06A 3R20A 4R9NA 4TZKA 4ZVQA 1GN8A 1II8A 2PIAA 3WMEA 1JL3A 1KIAA 3GZTB 5K0SA 2IHNA 3Q3CA 3V8VA 3SM9A 4ABYA 3GUVA 3K2BA 3TKLA 3PJRA 1E2QA 2Y67A 3BHJA 4LC9A 1NUHA 4U6NA 1OXMA 2X41A 4IHJA 3SC2B 3V2IA 1AMUA 2UUCB 5HIAA 4IF6A 1YC2A 4U7PB 3W06A 4JL8A 4X20A 3OCUA 3A06A 4QQRA 3V8RA 3IA2A 3W5UA 1NTOA 3ZDRA 2FEMA 3MWKA 1YUBA 4KQFA 3UUWA 4L5YA 3HA5A 3NHBA 4EABA 2MCFA 3Q3JB 1PQUA 2RGNA 3U5ZB 3KKKA 4ER3A 1NE7A 1BZYA 1M6HA 3UUGA 1V8PA 4N41A 3LPNA 3ZCSA 2QLNA 2ZJOA 3L0PA 3RC3A 1ZJZA 2PEZA 1L5WA 3HA7A 1GPKA 1JX6A 3O83A 4D8UA 5B55A 1GO2A 3E61A 3CO5A 1RIFA 2K7ZA 5KNDD 4NYJQ 1QOPB 3UHOA 2GEUA 1S01A 3DAPA 3LO5A 3BTUA 3LRTA 2BGJA 5FPKA 2OHFA 2XUGA 4N39A 2OXTA 3UFXA 4YCMA 4COKA 3JAKB 1GFZA 4MV4A 4KWEA 3ND7A 4CIDA 1ZMXA 3V4PB 4NK4A 3IBFA 3LX8A 4RWEA 4BPRA 3WRXC 4W4TA 1DAIA 4EL5A 1GUYA 5EP2A 3BFVA 1NVFA 3BRSA 3IP9A 4PGHA 5E1BA 4MUKA 5ADWA 1RABA 3U48A 3FCEA 1M73E 1KOJA 1CJCA 4O33A 4X1IB 4FLEA 2H4JA 4EUEA 1XYVA 2G82A 3LHIA 1YR7A 4KLAA 1SXJC 2GESA 3SBDA 4WZAB 2QJTA 3MB5A 3WLRA 3BWCA 1G5PA 2I5PO 5EHGA 3OFKA 1B8OA 3MTDA 3T3MB 1TZCA 3PZBA 2IS2A 1J7JA 1G5HA 1LC3A 3DFKA 2UU9B 3FAZA 4MQMA 6AT1A 2NO4A 3QPBA 4B0PA 3BYZA 4H3SA 5KTMA 4DMKA 1ZNWA 2OLEA 2ZPAA 3ZVKA 4R8VA 3UAZA 3KB6A 3TOCA 5JNSA 4Y2QA 1YQGA 3EGDB 4Q4LA 2QVBA 3ICPA 3EG9B 4MK4A 4WZ6A 3ZW8A 3UHPA 4LIPD 5ALRA 3WDMA 3RE1A 5LOVA 5K7SA 2Q46A 4GPEA 2XMQA 3B6ZA 4FE7A 5BVGB 2MT9A 4EFDA 2ZRPA 4AD8A 2IEGA 5JFTA 5KU1A 2RH4A 5JLAA 4N4AA 1ENZA 1SIWA 2FK7A 4B4DA 2DMRA 1NUUA 3PXCX 4Y6QA 2WAOA 3G0GA 4OHWA 2OGWA 5IT0A 4YREA 3RTBA 5AKLA 1W46A 3FFTA 4WECA 4D9CA 3CZ4A 1KI6B 1Y3AA 5LKAA 2GT1A 2AHRA 4DCNA 1EAMA 6ADHA 4IZOA 4WLEA 4R05A 5LZ7A 3AJAA 4CM6A 1HH4A 1ORDA 3OZCA 2RG1A 2HK6A 1W0JA 3EULA 4I46A 5HMMA 2PK3A 3OJCA 1L5FA 3AR2A 2HLPA 2VJMB 1QVZA 5K3FA 3RYIA 4LMRA 4LJSA 1AKVA 2IL1A 4KQEA 3AHCA 2AFVA 3OU7A 4PZAA 3N39C 4J76A 3ZNPA 4D4GA 5HIJA 2FFHA 5K0EA 2BFWA 4LGMA 3ZD6A 2A84A 3T0GA 3HWX1 3GJTA 5AW3A 2C5FA 2O59A 1E1QA 2BHTA 3IQZA 5KYWB 4YQYA 2X0IA 4UREA 1YGYA 2JK1A 3O3CA 2IYAA 3NEYA 4L8LA 2BKVA 4R1TA 3OWXA 4TTJA 3DA8A 4UM9B 5CB0A 5FDFA 1TIBA 3RTCA 1UK8A 2EF0A 2ZWMA 3GFPA 2FNAA 4FSDA 2WTUA 2FQWA 2Z8YM 4MQ5A 5FPHA 2D4HA 2QB5A 4QYTA 1QB7A 5AJXA 4RLSA 3ZTWA 1UFOA 4I1IA 4KZKA 1FVOA 4Q18A 4AWBA 4ZN6A 2HGZA 3QMMA 4URFA 3O8QA 3MK31 4ZEWA 2IYTA 2F1KA 3ED5A 1HDXA 4QWMA 4YH1A 4BRWA 5EIXA 2B1JA 1SHJA 1S9DA 2A8YA 3DCIA 4RE5A 2CV2A 2AOVA 4TQUS 2GPWA 1IM8A 4Z7JA 1IULA 2IXDA 1OXSC 1YASA 3GZNA 5EUCA 1RTTA 4G0OA 1M6EX 2IXAA 2WM2A 4AECA 4FB5A 3HXTA 5MFPA 5ALFA 2BR5A 3ETLA 1LI4A 2VK2A 2JHFA 5EMKA 2JFBA 5EJ8A 4YONB 3KX2A 2B9VA 3KZ1E 1F9EA 1PFGA 2GDJA 3HADA 3PQ8A 2OORA 3A9WA 1RBQA 3DUFA 5EOVA 3O2JA 4QUAA 4PFKA 1PUXA 1NVBA 2B2XA 2VHYA 2Y05A 3PDCA 4URYR 5TPZA 1FUIA 3IQGX 4BJ3A 2FWJA 2WOJA 3H0EA 5HCIA 5EWLB 4JVNA 3U3JA 3S68A 3GC6A 4CIXA 5TS2A 4DPLA 1WSDA 2QZ9A 4LBZA 4RL4A 2O4UX 5B53A 3IERA 2POCA 2IC5A 2XIQA 4ZI7B 2AC2A 2GRJA 2GERA 2R4TA 3FTPA 3KOMA 5ITSA 6YASA 4Y2TA 3W1EA 3T7SA 3OIWA 3V1KA 4NF2A 4TN5A 1P17A 3GRRA 2ROQA 3W5JA 1TEZA 5IMSA 1P1IA 3ACCA 4HRXA 1MJGM 2I29A 4XM1A 3QWIA 4Q1DA 4DDTA 1LZLA 1KOLA 1P75A 1BJTA 2ZTHA 4URVR 1S3SA 3L6EA 3W04A 1JDTA 1MX5A 3C6ZA 2J3EA 1VGRA 3T3DA 1QNFA 4I6JA 3UGTA 1Z5OA 4N03A 4DC0A 1QIMA 1GNTA 2JKVA 2HMAA 5SICE 1WPXA 1M1UA 1EPUA 1ZCZA 4UDYX 1B26A 2IZ5A 3HB9A 1X8JA 3IUPA 3C8ZA 5EWJA 4G01B 4TGLA 2X8LA 1TCAA 4EPYA 3J80A 2Q2VA 3BD9A 1JAXA 1JIJA 5DH9A 4XJVA 5AI0A 5DSZA 2UVPB 4LBVA 3GGCA 3N0WA 2PRIA 3R1IA 3HH8A 4DEYA 4O5OA 4EPTA 1I7SB 4WK4B 3I8OA 4N5LA 2XTMA 5IBRA 4HNHA 3AHFA 3K1YA 4INZA 5FOTA 1JAHA 3PT5A 3IP7A 2R1ZA 5D3KA 2OCBA 1CY4A 5C46F 1J8DA 5KS2A 2LIPA 1R0KA 1SCDA 2O57A 3C16C 3C3XA 3QVSA 4K3UA 2JLSA 4EG7A 4D9KA 5KOYA 4Q93A 3TTVA 4MQBA 1O9HA 4HSEA 3G0BA 1N1DA 2DHRA 4RQBA 4JJAA 4OIFA 3F4LA 4JEIA 4F6RB 4B48A 5IHXA 1PHPA 1XE3A 2M2IA 5F9MA 5B57C 2W7TA 3H1AA 5I7RA 4MINA 5CD1A 3GLHE 1PS9A 3DKIA 1Z36A 2BTQA 1QGUA 2RDMA 1BIFA 2ZWVA 2V6GA 4X8MA 3W8FA 3F7OA 4FC6A 4R2WA 4AKHA 4XJSA 2PGIA 3WWOA 1KTVA 1VHJA 2G17A 1Z5ZA 5IDYA 3UK0A 5AM1A 5JWOA 5HFNA 2HM7A 4FGUA 4M8IA 4KR2A 1FLAA 4MVXA 2F3RA 1PL6A 2Z95A 1GCUA 2WABA 4NIMA 1HDZA 4URXR 4HWTA 2ZRQA 4HNQA 4EY7A 1Z83A 1G2OA 4YRKA 3QE0A 1HDYA 3MM4A 1WD7A 3UBTA 4H3KB 1OLXA 1A9QA 5GONB 1DAMA 3FCAA 2C0QA 3B20A 4N6NA 3ZI4A 2E18A 3GGDA 4NJMB 2VL7A 3NBQA 4O4IA 3X1WA 3ZE7A 3QLUC 1NGSA 3VXKA 1JJ7A 1T91A 1ENPA 2JIDA 3DZ8A 3JWEA 2P9YA 1IJBA 4NY1A 3SEZA 3GWGA 5CBPB 3MTJA 5JSHA 2FDRA 3CXRA 4QHTA 1OLUB 5CX1A 4PHHA 2SKCA 1DKLA 4I3GA 1WF6A 1HNNA 1U1IA 2FEXA 3E7WA 3WS7A 4PN7A 1ML3A 1CD5A 2Q7OE 1G8JA 1SVIA 4CBVA 3V34A 3FZNA 1SVSA 5M04A 4BY9E 2P4SA 5BNWA 4G65A 4G5RA 2FWIA 1E7YA 2W6OA 4NCBA 3TE7A 1RPTA 2HU2A 1UZMA 4HYQA 1OJLA 2C97A 2L19A 5LZ5A 2VQEB 1TO2E 1A3CA 2ZE7A 3H5VA 4AURA 4RQTA 1CJVC 2N0SA 2XE7A 3DS8A 3N2KA 2IELA 3N7UA 4KUGA 4ZAVA 1KZHA 2PUVA 1UK6A 2ONKA 2CHGA 5CB4A 3T3HA 1S2LA 4YCNA 3W77A 3KTOA 2IOQA 5JCJD 3T9DA 3JD3A 1AQIA 4MCJA 3WISA 1DTEA 2Q9BA 4XVRA 1AKUA 1FC0A 4HI0E 5ICSA 4ETMA 1CR1A 5FH9A 2EV9A 2H0QA 1Z68A 4LXXA 4B6OA 2P4EA 3SR0A 5G2OA 4XIJA 2QE7A 2FPUA 2JJ2A 3CZQA 1ISHA 1QMPA 5BXYA 3HR7A 5BMVA 1XDBA 2WJVA 4AQ7A 3I2FA 5FEUA 1NVVQ 1W96A 2B69A 2PH3A 3ABOB 3GLHB 1BVRA 4PWZA 4HGQA 1XXHA 4B45A 1W36C 5BMVF 1DIAA 1QHIA 1YBFA 3B1VA 3DLPX 5FYDA 5IK2A 1YRLA 2MMGA 3NOQA 1CUHA 1ZNZA 1BOFA 2VPZA 4XGRA 3RB8A 3V7WA 3WYCA 2QUHA 2GKOA 1DIOB 3A1NA 4WOCA 3P0IA 4YRZA 5KTPA 4CTJA 3RRNA 4CDNA 5CA0B 1RJWA 3DTVD 3W2IA 1QHXA 4QXRA 2OKGA 1HYEA 3NGLA 3OZAA 4LISA 4EGAA 3V7UA 4EJMA 1E6LA 3U6BA 3UMMA 5KTRA 1N2EA 2E9SA 4N8DA 4DY4A 4E5DA 4EG8A 2QP4A 2XYQA 2M9MA 5BPHA 1XA4A 1JHZA 4LXQA 5B7GA 5COBA 1ND6A 2H17A 2J5KA 2PX8A 3RBVA 4F72A 5HGXA 2AOUB 3STHA 5B1YA 4U2GA 2FJPA 2QXTA 3PRHA 2LIVA 1VKHA 4UASA 3RK4A 4BJ1A 2VK4A 1I7NA 1EK0A 4GR9A 1I7PA 1NBME 4LTDA 1DJQA 3VO8A 5EKDA 4R2LA 3H99A 4EELA 2QLFA 2G9ZA 5A7HA 5HDBB 1RWPA 1YE8A 1T3TA 1RZRD 3NI2A 1U1GA 3IAHA 2A0XA 4BTLA 3N2GB 3WICA 3NJ8A 5TGTA 3WE7A 4W5NA 4MWEA 1ADFA 4R8MA 1MZPA 3CSDA 3BDAA 1MN6A 1Z2PX 3ZS8A 4C6SA 4RTKA 1LFDB 3CLSC 3ROMA 1XXHE 2BTQB 4KZPA 1JSLA 2HSDA 3V2GA 1ZM7A 1DQSA 3QKTA 5CFLA 3Q3GE 3FVWA 3MS4A 1M6WA 5CEFA 4L9SA 1E3SA 2JCVA 5B3JA 3EYAA 3Q9UA 2ZT5A 5BXQC 2CXHA 2HTFA 3KAPA 3MMXA 1N8NA 3JWHA 4UE6A 1T3LA 1ZJ4A 3KOXA 2QVLA 2Z56A 5DM60 4ZVUA 4R7GA 2SKDA 3ZWNA 1Q7TA 5F51A 5HCNA 1N2GA 2V3VA 1WB9A 3QFRA 3L1VA 4DLKA 2FQYA 4M36A 1CUXA 4HFRA 3BIXA 4MYHA 3H4TA 1ONOA 3UC5A 5AVQA 1CRWG 1WW3A 3MYRA 4MRMA 1E32A 3IMKA 1J9GA 3HHPA 4C20A 4YXWD 4CIBA 1NP3A 1MFPA 2B1GA 3PNPA 1ZD8A 1NULA 1ZHHA 3T94A 4AZ0A 3OZDA 4URZR 5LD2C 1A8PA 1LV8A 1Y48E 5EWJB 5D2CA 2O0HA 1UPCA 1W0KA 4D79A 5B36A 3GNLA 3KTAA 5LCXA 3QV1A 5LMZA 1CJKC 2C2ZA 2NTJA 3WO0A 2EBWA 4RXMA 3WRYA 3N05A 1B6TA 1P4SA 2CNKA 1XMXA 2GCIA 1TYZA 1AV7A 2IA5A 3KWJA 3L8ZA 4RNCA 4LDJA 1PVDA 3PJFA 3PR3A 4PZCA 3ZZNA 5C4MA 2XGGA 1XMJA 1QTNA 2O7QA 1JEQB 1Q0UA 3OZBA 1BN6A 3VR4A 4JVLA 3W5DA 3NYQA 1YS2X 3VO2A 5ALPA 2ZRGA 2GNAA 2COEA 2LP4Y 2ZUCA 3GFBA 3K92A 3NBUA 4IGAA 1N6HA 1I2AA 4IDNA 2XYPA 1WKCA 3AESB 4OL9A 5JS6A 3M1YA 4N01A 4MUGA 4O1MA 5CA0F 5DNYB 4JC5A 1KI9A 2DP4E 3K1JA 3DUWA 5A2GA 1JPNA 3HFGA 1MAWA 2RONA 3JYNA 3NHRA 4YCBA 3RYFA 3VJMA 3VR2D 3C14C 3I01M 5CA0A 4QRIA 1GQOA 1NC3A 2FSFA 4WFQA 1RQGA 4CM9D 3KQPA 5C5IA 1AV6A 3FMFA 5K51A 3WX0A 1AZLA 2AXQA 2BV3A 3FWKA 2X7HA 1JVNA 4LRSB 4X8OA 4XWGA 4CMKA 4DEVA 1Y8ZA 5IJ9B 1QJCA 2X3UA 1WUIS 3QBVA 1QHEA 3PWKA 2O2JA 1Q44A 4I1SA 5ETJA 4KIGA 4EGSA 1Q21A 4B73A 1NX6A 4E09A 1IG3A 4X0EA 4CVNA 4QU5A 2PMBA 5FTLA 2C58A 1WULS 3A25A 4PINA 621PA 1FQKA 1SHUX 1ZX1A 2YBEA 2FPOA 3AKCA 3ZHTA 3FOEC 3C3PA 1UL1X 3GXBA 2ZVDA 3PXEA 1KQ3A 2JJ1A 3PHBE 1GJRA 1H8ED 2QN1A 3GZ4A 3V1TC 3QFFA 2O3SA 1P7YA 1TUBA 3P4UA 4R1MA 3NNDA 1EFVA 4NBVA 4PU0A 3SPXA 5BSMA 3ORQA 4B47A 1PI3A 1WQ4A 2C95A 2Z8ZA 3JW8A 1I6WA 4HGZA 2VJAA 3AXTA 1UH5A 1QFZA 3QUQA 5JBQA 3EVEA 5FBHA 4TTTS 4B4WA 1JXOA 2XUFA 3DXZA 4BKUA 1ODJA 1ULHA 1B15A 1ZK2A 2KMLA 4IVNA 3UMJA 4POOA 4PFSA 1LQUA 3GHHA 3KJHA 4D25A 4INOA 3C7KA 3EFHA 4RLHA 3REOA 3ZQKA 3LQFA 4QRDA 5K9ZA 4P7JA 1VL0A 2WZQA 3N2IA 2A0KA 3G8DA 4YDRA 4TXNA 3HKDA 5JNWA 2CXNA 4GT1A 2DT5A 2PGJA 4BFVA 4BTEA 3TLAA 5I45A 3N2GA 1YQUA 5FTKA 4CTOA 3MGKA 2DG2A 3MMSA 2JLCA 4JFRA 4KSCA 1AA9A 2N75A 4EJSC 4KO1S 2OYCA 2BFBB 2LR0A 3HBAA 2PX6A 5KVCA 1IXYA 2WRZA 3ZZTA 2X76A 1LPNA 3EBPA 1CXZA 3DWGA 4I5EA 1M5UA 4E5SA 2D1FA 2HCBA 1JUDA 2EZ8A 3HS3A 4TTIA 1OH8A 1HYQA 1E7SA 1H0RA 2R8ZA 4ZVNA 1GLVA 4AZTA 2BFFA 4RK4A 2BFAA 4BQIA 1MFZA 5CEJA 2PBFA 3WLTA 2WLTA 4ZI2A 2RJ3A 1IY9A 2DB3A 1EK1A 2DFLA 4YP7A 1BCSA 2VHEA 4YJKA 5G0VA 2PD4A 4IMJB 2AYZA 2C2MA 4OKNA 1JR2A 3TJZA 5EKUA 1P0PA 4UAGA 5GP1A 4U8HA 1KAEA 5PGMA 5SZHB 1EXVA 4KIWA 4NS4A 2XNHA 2BEWB 3IAAA 4P1ZA 5EMJA 1T4MA 4AVYA 4FFRA 2M32A 3CUKA 2IHTA 3FGNA 3ONFA 4L95C 4DIOA 2JAHA 4A0HA 3CX7A 1XQ6A 3VHRA 2CJXA 1VKZA 4JI4B 4HDOB 4LGCA 2GARA 2ZJYA 4FMPA 2HK9A 5A04A 3DLAA 4EJSB 2WJZB 4QYSA 1SKAA 4GVXA 4F3KA 3WL6A 1U1EA 2I3AA 2UYYA 3E22B 1ECPA 3BDVA 3HJCA 3OLZA 4U7HA 2QE6A 2YBDA 1VP3A 3LVRE 4RQAA 1QP8A 3BWXA 1MOZA 3CLSD 1FTSA 4MX8A 4X1KB 5GY7A 5JUWA 1W36B 1D0IA 2TYSB 5AQ1A 2J3QA 2FFJA 4ZO6A 1WSWA 4ZQGA 1GL7A 3IQDB 3ZVLA 5JXGA 4RFLA 4CM3A 2DR0A 1HMYA 1QYIA 4FNAA 1DKPA 2VVTA 2ZIGA 4A10A 5A0FA 4DV1B 1X7YA 4Y0AA 1DRVA 1W85B 2MU1A 4QOEA 4R83A 4X7MA 3TAUA 3KSUA 1D6MA 3KNZA 2UZAA 3PSAA 3QLUA 3KU1A 4IIXA 3VO1A 4ZK6A 5LYJB 1N9ZA 3LY7A 3DNPA 3GJSA 4YK7A 1KF0A 5JALA 4A73A 1ZM3A 4PYOA 4BKQA 1VE3A 2YHIB 4LXIA 4GI2A 5IEJA 1LSUA 1GZ6A 3LUFA 1T5LA 4LJ5A 3W4JA 1QFJA 3Q8WA 2ZB4A 3F8SA 2EQAA 4HO1X 4QRHA 3EQ6A 3GLVA 1KC1A 3B5IA 5FEMA 3GPCA 3AKZA 3VJLA 4BVBA 2R7MA 1V26A 1WHTB 3N0RA 3DGFC 4XR4A 4LFAB 1ODLA 1E3QA 2IS6A 3GA0A 3U7FB 5D7BA 3TW8B 3IC5A 4FQ8A 1E89A 2IPMA 4KXQA 4P3NA 4LJAA 3SZGA 4DR2B 1JWLA 3FKJA 1GPUA 4Q03A 4F4CA 2XV1A 4XEUA 3S7ZA 1Z6AA 4PAQA 3QUBA 2GBCA 2JBAA 1HYBA 4RH1A 2IHUA 2AJTA 4AP6A 1E7MA 3BGWA 3KG2A 2A1UA 2FG6C 3D81A 3P4XA 4CWAA 4KL8S 3B9BA 5AI5A 2J9FB 4O2AA 3PITA 1ADYA 2YN0A 3RJ9A 3FRHA 4HGYA 1I36A 1M6YA 2GOYA 3GCZA 1ZRNA 4ZDWA 2JH8A 1RKBA 1RCTE 2TS1A 3T1OA 2DBRA 4IH9A 4QTZA 1A72A 4OP1A 3HYTA 4PPNA 1F2DA 1K0FA 4OA8A 3NT2A 1K6MA 4F6RA 3Q5EA 3QVXA 3DE0X 3EW7A 4Z2YA 1BMQA 2Q6TA 4WZZA 5REQB 4HXYA 1SCBA 3R6TA 1U9CA 2FN4A 2YWXA 5EJEA 4BCBA 3ID6C 1OYWA 2BGUA 4CFSA 5K03A 2AKEA 1QM5A 1SZDA 1B14A 1ODKA 3BGDA 3MWDB 3FLMA 2QRUA 5EXTA 2JEOA 5DHFA 3KETA 5FI0B 2HLDD 4L0MA 1BKDR 1UJBA 2ZJAA 2FEPA 2C4NA 3M1LA 4UFPA 2WP0A 2H2WA 4C30A 1NNUA 1YV9A 1QB8A 1Y4SA 1O95A 4Z4HA 1OA0A 2HJHA 8ADHA 1LBEA 3EZLA 1SCQA 3G02A 4U0JA 4ER7A 2NO7A 2QVYX 4JLUA 1UJ6A 5BYBA 1W30A 3RKRA 4DPMA 4E5NA 1CUBA 4GPZA 5IUNC 5LU9A 1FTYA 3FJ1A 1A9YA 1C7FA 4NE7A 3IPCA 1XJWA 2X8JA 4PZYA 1RBYA 3FUUA 4Z4GA 4O8CA 3GEMA 1NUQA 4XQ9A 3NV7A 4Q82A 3EUEA 1UXIA 1QOZA 2EBFX 1KPIA 1XRRA 2H1FA 2H8KA 4O8ZA 3UK7A 3PX7A 1L2TA 5IP5A 3SXUB 1S8NA 3OFVA 3TMKA 1VCNA 3P9RA 4QOHA 5EN4A 1HDEA 4BB0A 4FN5A 4J0HA 1Q0LA 2RGRA 3S8YA 3H3XA 4ZA2A 2VF5X 4OXQA 1N2ZA 4TS3A 5CDFA 3VDQA 4QGAA 1PYGA 2BFCB 3ERCA 2VWGA 3GOQA 5J23A 4WQMA 3TZEA 3UHFA 5BV8A 4HOYA 4P58A 4YRQA 4LYFA 3N8IA 4JOSA 5F5XA 2PZAA 1OAOC 1O5TA 1W8DA 2G07A 4YRJA 1XHFA 4JBGA 4BFCA 2G83A 2X0EA 1M1ZA 4PS1A 4LOJA 2O5EA 2C8VA 1T9ZA 1BTOA 3MAGA 3PEYA 1JFSA 4HG2A 1PBTA 2BKAA 3TQIA 1P0CA 3L4JA 3CT6A 3CN7A 4OI2A 3Q41A 3ZV6A 2VUSA 4EUSA 2ZRCA 1M83A 3RHFA 3RUAA 3K70C 2J6HA 3WIOA 3HKBB 1BAPA 4ARZB 1EUCA 1J06A 4M6WA 5FWNA 3FOWA 2ZKLA 4PPGA 4HDCA 4IJ6A 4M21A 2PZLA 4YMHA 4TVSA 1XLUA 4CG2A 1L7BA 1LBIA 5THKA 1MNAA 1H93A 2CLKB 1RI4A 1FP7A 4Y6GB 2RJOA 1P72A 4RCYA 4RYDA 2GTPA 4R2HA 1BE8A 2NNLD 2FSVA 3UJDA 3QVJA 4QDUA 5B3KA 1X38A 2QX6A 1O96B 3A28A 3PFKA 4ZICA 4ZQIA 4BO8A 5A9TA 4CI9A 2ZREA 4G4GA 2H51A 3OIUA 4Y0NA 5E9WA 3VZRA 2IVZA 5H7XA 2ZYTX 1OXXK 3RK1A 3W3ZB 5KHLB 1KERA 4BO0A 4D46A 3DDNA 4TWRA 1MUUA 3GJRA 4FDVA 4MR7B 2DWCA 1E2UA 1SC1A 1L7RA 1ZDMA 2QQ5A 4MZXA 1G4AE 2P40A 3GRKA 1V9CA 4MVCA 3ZWAA 2E4ZA 3KQSA 4U00A 4EQ6B 3UCXA 1SKUA 3HCNA 4ZRNA 1RQXA 1OHHD 2AXPA 3U4DA 2BGRA 5DP2A 2G1PA 5FFFA 4GKJB 3TX6A 3R75A 4C4SA 1VJDA 3DHEA 2KS6A 4RABA 5DYYA 3SVTA 1MH9A 4BJ5A 3JARB 1UDXA 2BHRA 2HV8A 3MT8A 4YMWA 1N6KA 2REQA 3UAYA 2WJYA 4UHFA 4YDQA 1FRQA 3ZTTA 3ZR4B 1AGRA 1NXPA 3UT6A 4BEBA 4MH0R 2X9GA 4QOJA 1G8GA 2Y1DA 2BFNA 3RVDA 4F92B 3CY6A 4DJFC 3F97A 4EZBA 4YMTA 5KYYB 1PSDA 3WK6A 5LD2B 1HFEL 2Q1SA 3NTVA 4J0JA 2NV6A 4IRMA 1W5BA 3O74A 4ZFNA 4W9RA 3BQNB 2AR7A 5BR8B 1XVIA 3EOBI 5EIWA 4DRXA 2HN9A 4MI6A 1H2ZA 2Q4OA 1Y6JA 1CUEA 1EP1B 4E7OA 5LUAA 4I19A 2BGKA 3K8YA 1VE9A 1G17A 2V9CA 3PJDA 3AINA 4CT4B 1CR2A 1F6DA 1Y37A 5JBIA 1ZNYA 2QSUA 2W2NA 3EF0A 1WG8A 3PB3A 1R0RE 1GZ4A 1WLSA 3I2HA 1A71A 3MOGA 1OAKA 4R3UC 2QX7A 4BRUA 4D9MA 2K87A 4GKBA 3SQDA 3JZMA 1SH7A 1X0VA 4JQZA 4YRMA 2EBUA 5FX2A 1H85A 2UYCA 3NTUA 1RW4A 1Q3KA 1XMPA 3HDYA 3K0BA 1E9BA 3HKDB 4OXIA 2DC1A 4ME6A 4XLZA 3A6JA 5EA2A 2H0RA 4I4CA 5EWLA 5TXGA 3PTAA 1HLPA 5CH5A 4GSYA 3AMVA 2FHSA 4KQJA 3PICA 5AW5A 3T8YA 3L7NA 5ALHA 2W6CX 2XW6A 4F4DA 2WDPA 4M49A 4YJ3A 2HADA 1XP5A 4Q4AB 4JXJA 1VG9B 4D9GA 2F1HA 4IXWA 4MPJA 5JIBA 2BE7A 4RVDA 5IH3A 4DXDA 1NOJA 1GRRA 2YVUA 5JD3A 3EWSA 3OOJA 3QU7A 1WCYA 2Z58A 3FSRA 3A10A 4HQKA 4TTQA 1KI4A 1TO1E 2JI7A 1VHWA 1HYHA 4MYDA 4AJNA 1GVNB 2R44A 1E9CA 4FNMA 3Q10A 5I9SA 5L7WA 2FWMX 4ALLA 4B6FA 3IP8A 3WQHA 3R9XB 1YULA 3RC1A 4D6YA 4WCFA 1Z17A 2VPWA 4BLRA 3RSHA 4Z2AA 1M34E 2I6XA 2PV7A 3EEQA 1W0JD 2IYPA 3NANA 4QXPA 4RIEA 1IBRA 2QPOA 3K9FC 2CT8A 1SUDA 2YZKA 2C99A 3CLUD 7YASA 1G0OA 1ISRA 2BDUA 3KR2A 4B2IA 2ZCUA 3A04A 1NVMB 1XDSA 4KLCA 4OFXA 3MUEA 3AEKA 4TXHA 3UXEA 3SDSA 5ICMA 5JAOA 5J3JA 1QPZA 3ZS9A 4EKIA 2HBRA 1ABEA 1KRWA 3N1UA 3T4XA 1XR3A 2AD1A 4XARA 2IEIA 1M2HA 2GPSA 2G4CA 2XB9A 4OHRA 1OB5A 1Q15A 3PEUA 4MJXA 3AK4A 3L8MA 3SXPA 3Q7IA 1GGHA 3LDUA 4FK8A 2PSHA 1CUDA 3T3IA 3HPRA 3UOAB 2Q0HA 1XCPA 4I66A 1Q3TA 4L8FA 3EZGA 2I2FA 4JI1B 4B3XA 2BL4A 2FWNA 4E7PA 1KDRA 1U2PA 2COUA 5LZ9A 4DR1B 3S2SA 1NSTA 5FPQA 1CIJA 2JFXA 4FHGA 2GM5A 3LL7A 1U8TA 1KRHA 3EGEA 3HL0A 2GHQA 2IP4A 1W1UA 3RV4A 1RHMA 4F1KA 1X77A 2XADA 4EKNB 1KO4A 2YHBA 4OQXA 1X2BA 3JATB 4WOJA 5DTMA 1OU4A 4U2FA 4DDVA 3MHTA 3ZOZA 1HXHA 4NULA 1J1ZA 1NW4A 4QXQA 5KYGA 3WSVA 1SA0B 5J4KA 1RWBA 3FROA 5FP0A 1DL5A 1RWNA 3EG5A 2YINC 4IXMA 1TQ4A 3ZHSA 2IHBA 4EAQA 2Q6VA 3RTEA 5F52A 4LG1A 5FLYA 4AJ1A 4BQNA 1E0JA 3T1NA 2IVFA 5TGDA 3VPAA 2DE0X 3QVVA 4PAOA 3T5CA 3CMCO 2XT6A 3P94A 5L3VA 4J29A 1JG2A 2C83A 2YH2A 2JHCA 1PIWA 2Y9MB 3WP1B 1P5HA 1PDVA 1XVAA 1YQ9A 2P2CA 3S2IA 4FHCA 1QKIA 1Q0HA 4I08A 4JELA 2QJOA 1RU3A 3NCHA 4F4JA 1CQIA 3GMTA 2I1LA 4YAKA 4GBJA 2IUTA 3MWLA 4GZ3A 2V65A 5BWNA 2OL4A 2IIPA 1PWYE 3IS3A 3T1VA 4YUZA 2PLAA 1R4NA 3I58A 4KSBA 3I72A 1JXAA 3EMBA 3R7WA 4B3BA 2D1SA 3NASA 3FAKA 2UXCB 4EY5A 1Y34E 2G1UA 1LDMA 5GGXA 2RGGA 1BS2A 3E9QA 3H9EO 1EXNA 1AHNA 1Y3HA 2I80A 1JFVA 4TYWA 3W3AA 1JPJA 3OQIB 1I51A 1PW5A 2GZHA 4FDMA 1XZIA 4MKXA 5A71A 5BSWA 1G8HA 4WERA 5FUBA 1T2NA 4AU1A 4IIYA 3MWGA 3CLKA 2JIOA 1X1SA 5A7FA 3MG9A 2HRCA 2C5HA 5DSTA 1UAAA 3IBTA 3BQMB 2Z1NA 4BO4A 2EU8A 3PL5A 1ZGAA 1UZLA 1K68A 1TF2A 1P2UA 2CEKA 1UXGA 3KZMA 4XWAA 2VDRB 2CFTA 4EYGA 3C15C 4CUKA 3PQ6A 1OHHA 3A0RB 5JWHA 3L4EA 3MLBA 2OBLA 4DS3A 4QU8A 4GMKA 4JSYA 4TZTA 3UJ9A 3E15A 4OYYA 4POAA 4C06A 2FSVC 2GGSA 2UZ4A 5JASA 1NNEA 3AKDA 3CWZA 5IZCA 4EKYA 3H1GA 3I62A 2ZBDA 3FWYA 2ABWA 3DV0A 4HB4A 1YQXA 1J8MF 2ZBPA 4JUBA 4MS1A 4BZWA 3LBIA 1PFYA 1CUFA 2R79A 5H59A 2IFTA 3BF8A 3P96A 4I0WB 4OQFA 3SHVA 4DGQA 4F91B 3CRQA 4K9RA 4B2LA 1GZVA 2ZI3A 1WZIA 3Q8MA 5H3LA 4ENWA 1BEUB 3WNDA 2V74B 2VZ0A 2Y71A 3L1HA 4QJBA 1ZR4A 2RH8A 5C32A 3OM9A 3QWFA 1C0