3KJGA

Adp-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
b'MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
total genus 76
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjgA00
4B47A 3C5HA 2WKRA 4B48A 1CRPA 2W6ID 1E2PA 1RW4A 1XTSA 2V9PA 2AWOA 2X1VA 3B60A 2ZU0C 4NCNA 2C96A 1GKIA 4GMXA 1F2TA 1VG9B 2CVFA 1FQJA 4R7ZA 3B78A 5CYPA 5B58C 3B85A 2AWNA 4B3FX 3TAUA 1G5PA 1R0XA 3QKSB 3H4MA 1DAFA 1KHTA 2YC2C 4URXR 4DKXA 2QBYB 2BVNA 3I61A 1T5IA 2WWYA 2F43B 4QGFA 4A0FA 4LV6A 4MKHA 4QFMA 1Q1ZA 1A82A 4US0R 1G18A 1M1YE 4RZ3A 2GNOA 2R65A 3FHOA 2HCBA 1ZW6A 1SZPA 1W1WA 1XTKA 3IBYA 2ZANA 3VKHA 4UKDA 2IC5A 1XRJA 2GZDA 4DUGA 1FTSA 3B9PA 3S1AA 3KTAA 1E2NA 5FTJA 3WRYC 2ERXA 3TSOA 3PEYA 2GDJA 2VO1A 4HLQB 4RD4A 2WIAA 3MFYA 4AKEA 1PZNA 4QC2A 5J40A 3DKVA 1M2OB 4B3BA 1ZU4A 3LO5A 1ETUA 3UK6A 4EJSA 4XH9B 1ZC4A 3OESA 1ZVQA 4PHGA 4C0BA 4QJ3A 1XU4A 1TADA 1XWIA 2C99A 2PZFA 3THWB 4NYMR 3AVTA 5JS7A 3PJRA 2GA8A 2FSGA 2IWRA 5KSPA 5BWMA 1NG9A 4KAXA 4XSGA 4BLPA 1SHKA 3K0CA 4A1FA 2C9YA 3AVYA 2AD5A 4M2LA 2XAUA 1R5OA 2ZRBA 4Q1FA 5B30A 1AJEA 1BIFA 2DHRA 2VA8A 3I3SR 3KB1A 3QPWA 4AYXA 1QF9A 1HY3A 3DM9B 3THYA 3K0AB 2XX3A 3GEIA 3K70C 3UG6A 1DTSA 1XEXB 1XJ0A 4IVPA 4TYWA 2IUTA 1KO1A 1KJZA 1UEIA 4HLCA 1UADA 5EP1A 3TJZA 2VLIA 4UJ5A 4PO9A 5JMTA 1R10A 1GVNB 2VHUA 3HU3A 4FD2A 3ZS9A 4DSNA 4URVR 3UXMA 1T8UA 3ND8A 2O0KA 1XB2A 2DWQA 4DLYA 2KE5A 3PUWA 4DHEA 2J59A 2C9OA 3RSOA 3PFIA 4MRNA 2MSEB 4BFYA 1U0LA 3UWOA 4A92A 4B2IA 1UKZA 2OXCA 2ZRNA 3QOFA 1D9XA 2WZQA 1RC8A 2VF8A 1OHHD 1TU3A 4URYR 2BDTA 1U99A 2DWPA 4PTLA 2V6IA 1ZUIA 3QF7A 1T5LA 2O8BB 2D2EA 1P3JA 4B2LA 5EE0A 5FPHA 3KUCA 5DN6D 5K8LA 3UG7A 2IS1A 4B6EA 1U8YA 3O8DA 3SJAA 1JBKA 3TUIC 1TEXA 4Q4AB 5HE8A 2GVDC 3DEFA 3W5JA 2J5XA 1OFTA 1Z8FA 3CWQA 1GL9B 2CCKA 3CW2A 5CLQA 4F92B 5JRZA 1Z6GA 3SC3A 3U44A 4RD2A 3I32A 1FX0B 4Q4HB 2QQ0A 1NLFA 3REFA 4DCUA 4HZUB 4ON9A 2OFOA 3T34A 1BMFA 2PCJA 4HAXA 1S0UA 2JJ1D 3K9LA 3MAAC 3T35A 4NCHA 2WWIA 4FCVA 1NNEA 4IRUB 4TQUS 2WWGA 2GZHA 2ZSEA 1JEDA 4PAQA 4LBYA 5DLQC 2FZ4A 4NDZA 5AJZA 3TUJC 2IK8A 4DLVA 3VR5A 2A2ZA 4U00A 5KSOA 2P5SA 1XCPA 4B34A 1LNZA 1HT1E 1T3LA 2BEJA 4AK9A 1GITA 4EUNA 1N6NA 4OBEA 1SVMA 4IOKA 4B3DA 4NYJQ 1WF3A 5EXPA 1NG1A 2JDIA 3DKPA 1NBMA 1OIXA 1YQTA 4BPBA 3QVUA 3THXB 4TTQA 1KNXA 1ODFA 1VIAA 3GJXC 3LXRA 4DXAA 1TF2A 2ZR0A 1HA3A 1I4TD 1RKBA 5FPYA 4ARZA 5F3WB 1RVDA 2IHYA 3R8FA 4Q1EA 2R6FA 1KK0A 3GFOA 1GIAA 3ZIAD 2H8KA 2IYTA 1TU4A 3SU8A 1MKYA 2ZRPA 4LJ8A 2ORIA 4EPRA 3J81k 4UXIA 5JI3E 3SJBA 4OL0A 1ZM4A 2EVWX 4DLUA 4G5GA 2ZJ5A 3Q85A 3SZRA 2AFHE 2XXAB 1G7CA 4L15A 4OHVA 1E9SA 1G291 2R2AA 3QQ5A 1OF1A 3HYRA 2PL3A 4FMCF 4A8JA 2AK2A 3EW9A 3U6BA 3OIWA 3KJIA 1HURA 3RAPR 3BFXA 3IUYA 4RJLA 2IA5A 1H65A 4RZUA 1GZSA 2ZRLA 2J3EA 3LRPA 3PENA 5H1YA 1S9HA 2B8TA 2X2FA 2XTMA 3WRXC 2SHKA 3KKNA 2QEQA 4LJ6A 4CRWB 1G6HA 4DLTA 3CZPA 1RRFA 2FF7A 2JLZA 2FFQA 1E1RD 3HYTA 2J9RA 4OKSA 4B76A 3V4RA 3VKGA 1B0UA 1E9CA 2O8CB 1K6MA 3N5CA 2ZXUA 5SZJA 5AUNB 2IUUA 2HCJB 2GCOA 2RKOA 3SYNA 6Q21A 2HYDA 3K1JA 1DBSA 4Q02A 3IILA 1TF7A 4YONB 1A1VA 1CR0A 5LD2C 2EFHB 2GXUA 2CL7X 3K9NA 1K5DA 1ZP6A 2QROA 5KO2A 2J7KA 5IF9A 4YXWD 3A1SA 4KBGA 3L0SA 1YZTA 2KBEA 2O0HA 2XZOA 3L0IB 3OIYA 4WXPA 1AZSC 1ZBDA 2QGNA 1FTNA 3GLGE 2VPPA 5HKKA 2RGXA 3IIMA 2RGBA 2BC9A 4IDNA 3QXHA 8OHMA 2ZI4A 3L2OB 4RZ2A 4HYYA 4BFUA 1V5WA 2WOOA 1Q57A 3EZFA 1N25A 4GRAA 1X6VA 5FUYA 1NKTA 3OAAD 3RRYA 1DAMA 2QAGC 4XD7A 4LHZA 3AP2A 1E9EA 2AK3A 1PLLA 4MKIA 1RYFA 1YR8A 4HLUA 5G3YA 3PIRA 5DNYB 5BXQC 4Q00A 3HWSA 1Z0KA 1TNDA 2ZREA 5C46F 3OEEA 1SXJE 2OE2A 1TEVA 1CULC 3KDSE 2B7BA 3NC0C 1CXZA 2OCPA 3B7GA 2QMUA 1W0JD 1DVRA 3FDIA 2B8WA 1GDDA 1VECA 4IDOA 3RABA 2MMCA 4US2R 2XNDA 3K9GA 5H70A 2QSZA 4LUCA 4CEJA 4PSKA 1RYHA 1S96A 2ZYTX 1XFAA 5DHFA 3S1AB 3KTAB 1W49A 1KDPA 2XB2A 2IUSA 2ZI3A 5D3QA 1R0YA 1IOZA 2NG1A 2ODEA 3TR5A 2X2EA 4IDHA 3B82A 1T6NA 2JLRA 3D6TB 3SDZA 5H68A 2W0MA 4P31A 2OUKA 4EJSB 1Z0FA 2G88A 3B1VA 2QA5A 4C0LA 5CITA 4NBSA 3LQQA 4FIDA 4QNMA 1VYTA 3B5JA 3EZ9A 4KCGA 3VFDA 4D0LB 2OCAA 5C18A 2ZJAA 4NCJA 2QRNA 4N0EA 1DAKA 4N0DA 4DWJA 4BZQA 4POAA 4JT2A 2J41A 3U6KA 4EFLA 1DOAA 3B1ZA 1G1MA 1I2MA 4QXAA 1D2MA 5E7MA 1FUUA 4P32A 5IHPA 4DDWA 621PA 3A4NA 5G53C 5AR1A 3AF2A 4LJ5A 1G3QA 1VG0B 4HB0A 5FPSA 2NIPA 3THYB 1IBRA 1AGPA 4M1SA 3PG5A 2J45A 3X1WA 3BS4A 4ERNA 3AP3A 2NTYC 3FKSD 4R2IA 1ZNZA 2WKQA 4C30A 4B2PA 1ZUHA 2N46A 4HAUA 4Q18A 4Z1MA 4BASA 3BH0A 3QSYA 4LHYA 2AKAB 3SHFA 2HYIC 4PO1A 1L4YA 4LJ7A 2HF8A 1NLZA 2WJIA 3L82B 5B2ZA 2CE2X 2BKUA 2I1VB 1OH7A 2OO7A 3QF4A 3NDPA 4C4PA 5GJBA 1KK1A 4PC1A 2LWIA 1P6XA 2XSZA 5C2JB 2V54A 4C7OA 2P2LA 4IDPA 4FI3C 3BWDD 4ASUD 4Q1AA 1Z6AA 4OI1A 4Q7KA 2EYUA 3NVAA 1ZM7A 1FP6A 1P9WA 5IRCD 2WSMA 1LW7A 2OT3B 2RHDA 2V3CC 4HAYA 4RFSA 5F9FA 2ZVPX 4UNPA 5F2EA 1E0SA 1OPXA 2R8RA 4Q01A 3SQWA 3ZDQA 1SVLA 2ZJBA 2HEIA 2WIBA 4Q21A 4C3ZA 2PJRA 3U44B 3C5CA 1ZCAA 1R0WA 3OE7D 2FSFA 4LHWA 2FA9A 5JWRA 1FP7A 1NN3A 3I72A 2VP6A 3AV0B 4PX9A 1W46A 3TSWA 5JHHB 2JIZD 1E2GA 2D3WA 4UJ3A 3U2QA 4GP6A 2GXAA 2RAPA 1OIWA 5E7JA 4UNSA 3QXXA 5JBQA 1P2TA 1NBME 3FPAA 3L8ZA 5CDFE 2NZ8A 2H18A 2WSSA 4DB4A 3HPQA 5AUQA 1Q1BA 4OJQA 1KYIA 1OW3B 2ZTSA 2X8AA 3W8NA 2C04A 2VSXA 4MDFA 2FPKA 1IONA 3A1VA 2QM7A 3Q72A 3BB3A 3HPRA 1Z2CA 2QN6A 1E99A 2FN4A 2OM2A 2FEMA 4JVMA 2C78A 2GJ8A 4L9WA 4QG7A 2VF7A 2G0NA 2EFCB 4LBZA 4AYTA 121PA 3SYLA 4XWAA 3R8CA 1X1RA 2IYSA 3F5FA 3IQWA 1R0ZA 1IJEA 1COWD 2V7QA 4GT1A 1E0KA 1UBGA 2RGCA 3IKJA 5SZIA 3R9IA 1H8HA 2GK7A 2VTKA 1Q3TA 2P65A 4Q9HA 2W2VA 3CONA 1Z22A 3DDCA 5HZHA 3NH6A 4O2RA 3W5IA 2WJYA 4DDTA 3LBNA 4DCSA 4WZAE 1N6IA 2GEDA 3TSZA 3OFND 3U61B 2GJAA 3UPUA 2Z5FA 1JXOA 1O3YA 4XTCS 2F9MA 2JLXA 2IS6A 1XPRA 4ZCIA 3SOPA 1S3SA 2IYRA 2VP5A 5L3QA 4A2WA 1WBDA 3X1ZA 2FWRA 1XTQA 5EXTA 3TE6A 3K8YA 3CF6R 2GK6A 5C4MA 2CHGA 2BWJA 4BFWA 2ZRJA 2I1QA 3BH6A 5CM9C 3IIKA 2AHOA 2F1IA 2KWIA 1BYIA 2QG6A 3PITA 3QXSA 3RANA 4I4LA 3U5ZB 4B75A 2QT0A 2BCJQ 1YR9A 1Z0JA 1Y3AA 1G64A 2VHCA 1QHIA 1XMSA 5LPNA 3K70D 3T1OA 3TBKA 2QP9X 4JL5A 4OI2A 2ZRCA 1DAIA 5L3RA 1UAAA 2V8OA 4ZDIA 1NP6A 1E2IA 2P6NA 2W6JD 4QBFA 1OYYA 4JVSB 5BN5A 2H1LA 3BORA 5HPYB 1MV5A 3VR6A 2Q3HA 4EQ6B 3OIUA 2ZAMA 1WXQA 3LWNA 2XZLA 3MSXA 5TV2A 2C2HA 2J7PD 4EPTA 1YZNA 2GCOB 4RKEA 1T8TA 2ZS8A 2QMHA 1N6PA 4MQBA 2BJWA 2O8EA 2J0QA 1VDZA 2CK3A 4NMMA 4W5HA 3SNHA 4MRRA 3KFVA 1T3HA 3CLVA 3HDTA 2QAJA 3M4YA 2WOJA 4BRUA 4CEHA 1CEEA 2JCSA 3KJHA 3H2YA 4DCVA 1KK3A 3H86A 2IWHA 1IN6A 5L8VA 4IJMA 1D5CA 2QORA 4C0HA 4FINA 4YMVA 3EX7C 3WMFA 1QHNA 3VR3A 5BN3A 1VTKA 1YKSA 3REGA 2X19A 3B8HA 3EASA 2JLYA 1Q21A 4KSCA 4B3XA 3KB2A 3MGCA 4CIDA 3EXAA 3GD7A 1E2LA 3QVVA 4JKYA 2KSQA 1AGRA 2GEUA 4IXMA 2OILA 1LTQA 2VHTA 5JECA 2W2TA 4M8NE 1SVWA 5FI1B 5FUWA 3GJ7A 3DPUA 1DO0A 5EP3A 4A15A 1VHTA 3A1WA 1AS3A 1YHNA 3R9WA 4GZLA 4M0LA 4QNRA 1GNPA 4JVLA 3AM1A 1XJCA 4CDGA 4LYHA 2CL0X 3QXCA 4F4CA 1YZQA 1W4BA 3NHAA 4D4KA 2E87A 1N0UA 1GAJA 1CR4A 2WKPA 4CEJB 3CR7A 5KSYA 1LVGA 3PV0A 4LWZA 3NKVA 3QIAA 1MOZA 4JLPA 3ZD6A 3FKQA 4TLBA 2HT6A 5LBIA 4MYUA 3CRVA 4TL8A 4IOJA 1ZM3A 2IYQA 4C2UA 4F7WA 2XOKA 4Q47A 4M1WA 4LHVA 4PQFA 1PUJA 1E94E 4O0MA 3UWKA 4HDQB 2Z43A 4Q4JA 3U4QA 3WBJA 4B44A 4Z8YA 3PUXA 3JVVA 4NP6A 3RS7A 3AF1A 5FH9A 1QG4A 1G17A 3CZQA 4OK5A 1PV4A 3OEHD 1L8QA 3BE4A 1VMAA 2R9VA 5FOVA 4ZKEA 2UZIR 4A0RA 1OH5A 4C0KA 1II8A 4C9BA 3VX3A 4XJXA 2OESA 1FQKA 1OSNA 4RFVA 1OV4A 5JWHA 4GPTA 1Q12A 5KDOA 4KVGA 4MYTA 2OEPA 3OZXA 5KDLA 4JL6A 3BAFA 4ZCLA 3R9XA 5GADl 3DM5A 2BIFA 2VRWA 1JXMA 1WMSA 4I1VA 4B71A 4AIIA 1LB1B 1G19A 2GJ9A 4UNNA 3F3YA 4WAUA 3VU9A 2X77A 2W0SA 1FMJA 4PANA 3WNDA 1WCV1 2DWOA 3THOA 4IEEA 3GEHA 3GJ5A 4JBXA 1U8ZA 3QF4B 4LZZA 3I8SA 4AKGA 4IFEA 4TT3A 1OB5A 2GAAA 4TMWA 4A2PA 2PT5A 2V4ZA 2QL6A 4L4UA 3R7WA 4C7OB 2GKSA 4FMCB 4DC9A 1E1QA 4JJKA 1OFUX 3O8CA 3QJYA 2GBLA 2XTNA 3TVDA 1W0KA 1R7RA 3A37A 3GLGA 3EWAA 2A9KA 3VQTA 3CO5A 3W90A 5F98A 4QM7A 4D4LA 4LSGA 4RFSB 4KU4A 4TSFA 1XPOA 1SGWA 2JLQA 2VP4A 4HSEA 3BBPA 3L43A 1Z3IX 2DFLA 3P27A 4Q1DA 2RGNA 2CL6X 1QRAA 1EESA 1A2KC 4M53A 3Q5DA 2PX0A 3BFKA 3DVLA 4CVNA 3AVXA 1SKYE 2ZM5A 1E2FA 4H1UA 3CF2A 3TLXA 3GJ6A 1D6JA 2ATXA 4DSTA 5FOTA 1P2SA 1SXJA 3IIJA 5J4YA 3KQLA 3EZ7A 1KKMA 1ZUNB 1CU1A 4LOAA 4Q7JB 1BMFD 4GZMA 4Q7MB 1NKSA 5TB5A 1FUKA 3ZQ6A 2QTFA 5DI3A 2CEAA 4HAVA 2AL7A 2YINC 3WHKA 2JJ2D 4XVQA 1VCNA 1AZTA 1TPZA 4M1YA 3BB1A 4II7A 4BFXA 4MGKR 3I5YA 3UKDA 4M1KA 2JA1A 1UDWA 2J0VA 5DSZA 3MRSA 1HEIA 4MUBA 3RDPA 1WDTA 2EFEB 3ADKA 3LY5A 4B6FA 4LYAA 2IYUA 3K0EA 5EE3A 4DLWA 1X8JA 3K0FA 3RRNA 5CIWA 5FOWA 3C7KA 4F4JA 2HV8A 5FPTA 1K5GA 1Z07A 3GLHE 2HUPA 2BMJA 2NPIA 2IYYA 2JDID 4CEIA 1G8GA 1UF9A 3AH8A 3LLUA 3X2SA 2NZJA 2ZU6A 3RRMA 4LY6A 4QBHA 1N2CE 2O5VA 3RSLA 1MABA 1G5RA 2YWEA 2GF0A 2GF9A 4A82A 4KYUA 2IL1A 1R2QA 4V0OA 3AKCA 1J2JA 2ONKA 1KK2A 1G9XA 3LX5A 3AGQA 3BH7A 3DMDA 5KNCA 5CLLA 2AXPA 5L3QB 4IVRA 1EFRA 3CPEA 4ESHA 1GL7A 4TMTA 4PXAA 4M22A 4WOPA 1DG3A 3U3RA 2OCYC 4JLAA 2CHVA 1DE0A 1G3UA 2ZS9A 4E22A 5BYJA 3KQKA 2NO1A 2ZE8A 4E07A 4CF7A 2PX3A 1IY0A 2QE7A 1ZD8A 4EPXA 5D3MA 2Q21A 1GTVA 1RRPA 3IHWA 1YE8A 4FMBB 2QY9A 2ZQ5A 1X1SA 4RD0A 4JSYA 4EPVA 2NQ2C 1Z29A 3L0OA 4M1TA 1YJ5A 2QPTA 1AIPA 1OXTA 2ZR9A 4LCBA 1GL6A 3SEAA 1UJ2A 4PC3A 4R2HA 4G3XA 4KJZA 4KVAA 4RD6A 2JEOA 2ZRMA 1MT0A 3AKYA 3EA5A 2NOAA 1FOEB 1VG1A 1XNJA 1IJFA 1G5TA 3B13B 2REXB 1G7RA 4QM6A 3QG1A 4R98A 1JEEA 4M9QA 2O8EB 3B9QA 2ECKA 4PC7A 3TVTA 2IXFA 3RS2A 4GSYA 5IK2A 4LV5B 2OXRA 4CEHB 2JATA 3R20A 1Z6XA 5TXGA 2A5DA 1DADA 2R6AA 3FE2A 3O8BA 1Q3HA 1IY1A 4TN1A 5BW8A 4K46A 4FCWA 2NO0A 4K8OA 5CK5A 3ADCA 2ZRGA 1UM8A 4AY2A 1MO3A 1CS4C 2H17A 4PPFA 2QSYA 2PLRA 4BQSA 3SYKA 1GRNA 5FTLA 5CYOA 1ZM2A 3RWOA 1GNRA 2FMXA 3CNOA 5CDFA 1AM4D 2DCUA 3GLIE 1AA9A 3FYHA 2ZSFA 1G8PA 3KXIA 2Z0MA 3PEVA 4NHOA 2XTZA 3QPUA 2IF2A 1UEJA 1IQPA 3A1TA 3GJ0A 1CRQA 1WRBA 2RCNA 1DS6A 2ZRIA 3LH5A 3X1DA 1OXUA 4F38A 2QP3A 2NMVA 2ZS7A 1UFQA 1P2UA 4XD7D 3TAHA 3AUYA 4A6PA 4G5OA 4EJSC 1SXJC 1GFIA 3IHLA 3HR8A 3LW8A 4GI7A 5FUXA 1F2UA 1J7KA 4CT5A 4FWTA 4M1MA 5FTNA 2FNAA 5JEDA 3EIEA 5FOUA 5DHAA 2G83A 2R6DA 4RKFA 4YDSA 2ZI5A 5EZ5A 1OXVA 3LBHA 1N6OA 3K0CC 4PPGA 3KKQA 1KJWA 4UQOA 4AKHA 2HDNB 1DAGA 3TKLA 1EX6A 2PH1A 1XD2A 2GILA 2XNDD 3U7EB 5FI0B 4RCZA 2FPMA 4HUQA 3T5GA 4LX0A 3T06B 2IX3A 2BM0A 2FFBA 2XJ4A 3V4FA 1DG1G 2GJSA 2L0XA 1W44A 2J87A 2IYWA 4Q5IA 5DN6A 4KYIB 2Z6VA 2Q3FA 4KFRA 1YVDA 4GNKA 4Q4JB 3TIFA 3KKMA 3KKPA 4B74A 4CYMA 721PA 1T4GA 3AUXA 1C9KA 5EE1A 3NBYC 3EPKA 5TDHA 4URWR 1VIYA 3X1YA 1D8TA 3LA6A 4BE7B 5FBWB 3CR8A 2PZEA 4G0NA 4OQMA 1II0A 4TL9A 1M7GA 2UZ3A 4Q66C 2WJGA 1II8B 4XOIA 1AK2A 4GFDA 4TYYA 1KI6A 1W4CA 2GWHA 4ZPXA 5TMPA 3ICQB 3MWLA 3H0KA 4XSHA 4IKEA 1TAGA 5JEEA 2B7CA 5J4VA 4BRWA 3SN6A 4OYHA 2CXXA 4LYFA 2D2FA 1Z83A 2QI9C 3KL4A 4DBLC 4CW7A 2GRJA 1PUIA 1U94A 1HQYE 4QL3A 5E3HA 3NBXX 1GP2A 4UXHA 1J99A 2QTVB 1QHHA 4QHYA 3FGNA 3GJ3A 2VP2A 4L16A 4I1SA 5FBQB 3KKOA 3CB4A 1KTVA 4D4JA 3LXXA 3O8RA 2BCGY 2IW3A 1NVVQ 5TVKA 2FX3A 5LB4A 4D2IA 4D4MA 4JIMA 4Z54A 4Z1MD 1OFIA 3VU9B 1OLOA 3CUEF 4JBWA 2F1HA 4KHZA 1ZNWA 1S2MA 1F2TB 1XJQA 4ZDKA 4MITA 4HZIA 2WM9B 3R7WB 1NI3A 2CCJA 4M21A 1Q22A 2OFXA 2FDCA 4XIGS 1H8EA 1GWNA 2YOHA 3AVPA 4DT1A 2P6RA 2MSDB 3FHCB 3D3QA 3B1YA 1OJLA 2J0UA 1UBFA 3SI7A 3F8TA 3GLGB 1CF4A 3TR0A 3KJEA 3AVQA 3A36A 2EYQA 5FR1A 1YRAA 4OQXA 4ACAA 1XD9A 4NPHA 3Q5EA 1I4LD 1E2KA 4G5QA 2N42A 1KI1A 4G5RA 4JYCA 4S2EA 1JR3D 2WJJA 4WZ6A 1L4UA 2AD1A 2JLVA 1NMXA 2D06A 1KO5A 4NH0A 1EX7A 1NN5A 4EKDA 4XWOA 4TYNA 3UMFA 3H1TA 4HATA 3LW7A 1N5LA 2I4IA 3PUYA 1KZGB 3T61A 5AUOB 1R8SA 2VBCA 1NN0A 4ILEA 1IXZA 2A5GA 1A4RA 2CBZA 2WAXA 2IS2A 2VEDA 3FTQA 4PPNA 4WW0A 3MLEA 1U90A 4R71A 3A4MA 5JSZA 3VHLB 2FOLA 2BJVA 3I8XA 2BMFA 2ODNA 1SXJB 5JFGA 3D7MA 4OHZA 1E2DA 1W36B 3A6PC 1JQLB 5AJXA 1NVWQ 4ESVA 4EPYA 2FSIA 1DAHA 3PUVA 1IN5A 3UMRA 5KHOC 4BLSA 1XP8A 3FMFA 4G1UC 1X8LA 2ZRAA 4N3NA 4D80A 4DDVA 4QJ4A 2NGRA 1E2MA 2C98A 4HEJA 5DI3B 2J0SA 3PVSA 4GOKA 1A2BA 3BOSA 4ZKDA 3JVUA 221PA 4Q1BA 3ADBA 3HP1A 4HLDA 4QHSA 4B33A 4E09A 1Z0DA 3KXLA 3P4XA 4AWXA 1E1RA 1NY5A 1XTRA 3W34A 2YOFA 3WYGA 2GEVA 3SQXA 2G1KA 1KSHA 4A8JC 2W2XA 2WJHA 3IPXA 3K0FB 3UANA 2DFKB 2G6BA 4LJ9A 4ZIRA 1HUQA 5AJVB 2QPOA 3TW4A 1YR7A 2F3TA 1NMYA 1G4AE 2VIIA 5FBLB 2QMEA 4V0MA 1N0VC 5FBVB 1U98A 3TK1A 2ZI7A 5JCPA 2D62A 4AKIA 3GQBA 3GJ8A 2ZYUX 2V7QD 3BRWD 4CEIB 3TMKA 2Y8EA 5EXXA 1XD8A 2F1RA 3WY9A 4E03A 1Z28A 1ZU5A 2UVQA 1H8HD 3MD0A 1T3SA 1MABB 4TL6A 3MUFA 1U9IA 5FOSA 2WTUA 3K9HA 4DZZA 1ZJ6A 3DL0A 3SHWA 2ZJ8A 1TUIA 2GVZC 1JJ7A 3CM0A 2RB4A 2AXNA 3QE0A 5JCZA 3LV8A 1OKKD 1W2GA 2R6GA 4URZR 3EZ6A 1Q1QA 3ZLJA 2H7VA 2VH5R 2EQBA 5KYKA 3MG9A 3T12A 4YMUA 5HCIA 1RJ9A 5M04A 1US8A 1JI0A 1V43A 3KFXA 5J4KA 2C5LA 1ZAKA 1MR3F 1G20E 2EFGA 1EGAA 5CK4A 5D3MB 2E9SA 2Q0HA 4MGZR 2ATVA 4E5UA 4JT4A 5K8IA 2CNWA 5LDDC 1E2HA 2DFNA 5SZHB 1P7CA 1XEFA 2AR7A 1EFCA 1KI8A 3T1QA 4M9SA 2QBYA 3IGFA 5DE3A 4PZYA 2XZPA 3ND9A 4RCYA 3VR4A 5KPJA 2DYKA 2WV9A 1KI7A 4Z8XA 4V03A 2OAP1 1XXHE 4HB4A 3PEUA 5TY0A 1G3RA 4KFUA 1E9RA 2IBMA 3BJIC 3AVUA 3CF0A 5B64A 4Q1CA 1G16A 1E9FA 1CBUA 3B2EA 1TF5A 4NYMQ 4P4UA 5IDVA 1PJRA 3JZAA 3HR7A 4HLUC 4C0JA 3ZZTA 4DLZA 4LJAA 3KX2A 3TGPA 3CX6A 5J47A 1KY2A 4A9AA 4AYWA 2A3RA 1BYUA 4GOXA 4NYIQ 1FMLA 1M6NA 4OK6A 1RZ3A 1OH6A 4A2QA 4JLNA 4A6XA 1VCIA 1VG8A 2ERYA 3P1JA 4H9GA 3CRQA 2MSCB 4D82A 1IAQA 2FU5C 4Q9KA 4Z51A 3D8BA 3CNLA 4BZXA 3WYAA 5HCNA 1BH2A 5KSZA 4JZKA 3DMNA 4US1R 3LBIA 5FL7D 4D0GA 4ARZB 1ESMA 1P60A 4GP7A 5A4JA 3PCRB 4PAMA 1W4AA 4JMPA 1BKDR 4ZCMA 2BBTA 1PVOA 2TMKA 4WVFA 2G77B 1XTIA 5B57C 3ADDA 1Z63A 4TYQA 5HE9A 5J4LA 2WWXA 5FL3A 1F2UB 1Q1EA 3LLMA 3QBVA 4NYJR 3V00A 1G7SA 4BFZA 4TQAA 1NJFA 5KNDA 1XEWX 4JKIA 1TQ4A 3LNCA 3IEUA 1Z0IA 2GJKA 1CTQA 2F7SA 1E2QA 3IPYA 3FWYA 5FTMA 4A8JB 2FG5A 3VNUA 3GLHA 1CLUA 4LC0A 1A5TA 1Z47A 1GKUB 2HLDA 3I62A 1XCGB 3FMPB 4AURA 2BM1A 1XD2B 5GJVC 5AJYA 3FFBA 3SJCA 4HUQB 2D4HA 2OBNA 3ZVMA 3CBQA 1P75A 1NSTA 3GFTA 1LF0A 2BBWA 3KUDA 2DBYA 3N70A 4FXPA 5HTKA 2EWWA 1HTWA 2V55B 1S8FA 2IEYA 1KO4A 4Q03A 5JJLA 3GCGA 1WP9A 4Y0VA 2Q9CA 1R6BX 4OQFA 2QRZA 5JRJA 1WBBA 2XOKD 1IM2A 1E2EA 1PLKA 4PO8A 5DIFA 2KI5A 3QKRA 5EZ6B 3ZYCA 3PUZA 1TUEA 2WICA 4YMWA 3CH4B 1L2TA 4Q4AA 5KU1A 1FZQA 5EE9A 4JLOA 3BXZA 3QKUA 5GJWC 2G0TA 4AG5A 4OQNA 1KI6B 3UIEA 3ICEA 1DARA 4HB3A 2WBLC 3NXSA 4TLCA 3EC1A 1RRCA 3RS0A 4M4SA 4Q4HA 5JZVA 1UDXA 3WP1B 1G8FA 1YU9A 4AG6A 1RIFA 2ZI9A 1KKLA 4FW9A 1KSJA 1QHHB 3LVQE 4RD1A 5L3SA 1VKJA 4ABYA 4UNRA 2QTHA 1WA5A 3QEOA 4FN5A 4FCTA 1ELOA 2WVJA 3IO5A 2ZPTX 2ZRFA 2DY1A 1CJUC 1G6OA 2O8DA 3LX8A 4JYBA 3NC1C 5FTKA 4IVQA 4M9XA 4W5JA 4FMDF 3M0EA 1KSFX 4OI4A 1JJVA 1HE8B 4HDCA 3VR1A 3C14C 3U3KA 2C03A 1W48A 2P5TB 4HB2A 2RGAA 2ZVQX 1KO8A 2YV5A 3BFVA 4C0QC 4DT1B 3E70C 1E1QD 1E79A 2J0UB 2IYLD 2Z4RA 4KV9A 2GAOA 2D7DA 1F5NA 1MO4A 1WQ1R 2LCFA 4AC9A 4HI0E 4U7DA 1OFHA 4OHXA 2IT1A 1W7AA 1DELA 3W6NA 3AVWA 5EQTA 3GLIA 2W83A 4NCIA 1T91A 1KJYA 4TSFD 1FFHA 2QENA 4NZYA 4J0QA 3EIHA 2MMGA 2PLFA 4U02A 1NJGA 2Q6TA 4W5WA 1B23P 5P21A 3K09A 1ONBA 4DUGD 3U3OA 1HE1C 2IF0A 1VCMA 2YZ2A 2ZJ2A 3NBFA 3AGPA 5JSZB 2IYZA 3UATA 3CWZA 3P20A 1JAIA 1GRRA 2FFAA 2CJWA 5AUPB 4V0ME 3FMOB 3CRRA 3AP1A 3CX7A 3MJRA 4LJ4A 4XVUA 1SXJD 2PZGA 3I73A 1M74A 5DGXA 4O2LA 2IHBA 3U4QB 3SBEA 3C15C 5KTYA 3B1WA 1P73A 1NVXQ 2BKEA 2W6JA 4GMDA 3WNBA 4PSVA 1JQJC 1HH4A 3QNUA 4PHHA 4RSGA 3CX8A 4IOLA 1Q0UA 1OXXK 1D2EA 1XZPA 3T5DA 3GLFA 3VNVA 3VX4A 2BBSA 1AQUA 1KDTA 1T9HA 421PA 4A36A 1DAEA 1XBTA 3AEZA 4IHQA 2D7CA 2WPDA 2JAQA 1S1MA 5G40A 3Q8XB 3SS8A 2B92A 1SVIA 3U3MA 4BUJA 2OSBA 3CRW1 1LY1A 3AF4A 4MRPA 3Q7QA 2FE4A 3KQUA 2DFTA 2XNSA 1W47A 3K53A 2WJVA 2GZAA 1Z6YA 2FJUA 1CJTC 1E3MA 1OE0A 3IEVA 1R5NA 1KDOA 1R5BA 4DEYA 3KQHA 4F91B 1EK0A 2JASA 1RJ9B 2RGDA 1Z0AA 1UPTA 1EFRD 1US8B 1NVUQ 2ZSDA 1MRNA 1XF9A 4OJKA 3RC3A 2EU8A 2XGJA 1Z5ZA 4A0HA 2BV3A 2FZLA 3C41J 1XPUA 1GM5A 5JLJA 2O52A 1HT2E 4MGYR 3RVBA 3AKDA 3Q3JB 3U7FB 2DPXA 2QE7D 3SBDA 4KITB 2OAQ1 3GP8A 1G4UR 3CH5A 3NEYA 3ZVNA 3ZS8A 4B32A 3FHTA 4BEJA 3W3AA 2ZUBA 2BHRA 1U2RA 2LKCA 1I2DA 2OLKA 2GHIA 2PEZA 3DOEA 1FPMA 3TQFA 4P0TA 5BYKA 2ZETA 3M6AA 2EW1A 1N5KA 2OBMA 3MWKA 4GDFA 4TMZA 4TLAA 5E4FA 4DDUA 1EXMA 1LS1A 1QZXA 5DISB 3MMPA 4LC1A 3LQRA 4LPKA 1W2HA 2ORWA 4YMTA 4PPQA 1EWQA 2F6RA 4URUR 4EIWA 3W6PA 1I4DD 1S4QA 3V9PA 3RNLA 4BEBA 2CE7A 1UKEA 5IK2D 4I1UA 3E2IA 4D81A 4PC6A 2RH5A 3NTUA 1VHLA 2ORVA 3OEHA 4O3MA 1SKYB 4O25A 4R9UC 1WE2A 4TMXA 4QGHA 2RGGA 1XX6A 2KJQA 4AD8A 4MRVA 1NRJB 3QEJA 3CPHA 2ZJOA 4NONA 4TWZA 4CT4B 3LD9A 1NBMD 2KB0A 1CKEA 3AF0A 3K09C 3IBGA 2ZSAA 4NYIR 3PQCA 1AKYA 4JSTA 4PFSA 4EPWA 3T1TA 1OXSC 1XMVA 4TMKA 4LPSA 1HV8A 2FV8A 1KNQA 2W6IA 3P32A 3FFAA 1CR1A 4LJYA 4P4SA 4QGAA 4DEXA 3NWJA 2WMOB 2GESA 3DO6A 2R44A 1TQ6A 1NY6A 1NIPA 1NIJA 3GLHB 3ZZ0A 4DSOA 2BOVA 1TTTA 2RHMA 2ZI6A 3W6OA 4BZPA 2CHQA 3T1VA 2F55A 1ZYUA 2BMDA 4MKGA 1E6CA 1W5TA 3QXJA 1XMIA 4A0GA 3H84A 1XZQA 2VQSA 1UBCA 1WB9A 5FUVA 2ZJYA 2Q9AA 5LB2A 1F48A 1Z06A 2RGEA 4W9MC 4C0SA 4L8GA 5F9HA 4MUAA 1MH1A 1D9ZA 4PZLA 2FSHA 4IFBA 4NU0A 5FBRB 4V0NA 2EWVA 5JWOA 3QKRB 3NEJA 3QG5A 1E9BA 3W8RA 1P72A 3BB4A 4X8LA 1Q44A 3EPHA 1W5SA 4JLJA 4QRHA 4IOMA 2ZRDA 5EE5B 2XB4A 3IDQA 3A4LA 1ZD9A 2QAGA 1EFUA 4LRWA 2GBLC 1GKYA 5CJPA 2YOGA 1F60A 1YZUA 3WMEA 1ESNA 3B6EA 4OQLA 3P4YA 3I1FA 4IDQA 3TRFA 1IHUA 4JVNA 4QOSA 1KSGA 5L3SB 1XXHA 3ONWA 2BEKA 1EFHA 4ZV4A 2JJ2A 3SE0A 4KO8A 1IY2A 5HKKD 3ZQJA 2FEOA 1L7VC 1Q20A 2K5UA 2RGNC 2VSFA 4PZZA 1IN7A 2O8DB 2ZJZA 3TNFA 3GJ4A 3OF5A 4LK2A 4I81A 4DVGA 3EPJA 2AN9A 4IXNA 4JS0A 1GG2A 3ZD7A 1E2JA 4G5SA 3RWMB 2JLWA 1YZLA 1KMHA 1UBEA 1W36C 2FH5B 1E0JA 3PXGA 4HUTA 1QDEA 5AK0A 4Q48A 4LBWA 1KGDA 4LV8B 4QBGB 1AQYA 5DO9A 1M7HA 3BK7A 3O47A 4DRZA 4LBVA 1H8ED 4MA4A 2YNMA 2F9LA 3OEED 5EUQB 1QHGA 1JR6A 3L0PA 2YWFA 2Z83A 1ZM9A 1G8HA 3LAWA 3IQXA 3GLIB 1VPLA 3G0HA 1MO5A 2OCBA 3RYTC 4XWKA 1CIPA 2QZ4A 1N5JA 2NO6A 2PCLA 1OHHA 5K8UA 2YYZA 2CLDX 4KFTA 4MDEA 4LYJA 3TH5A 2YJTD 3KXKA 3WBKA 2O8FA 1VYUA 2GXQA 1C1YA 3EG5A 1ZNYA 2H16A 1U8AA 3DZ8A 3GLFE 2F1JA 1CR2A 4ZI2A 3RHFA 3CKLA 4RY2A 4BFSA 2OG2A 3JZMA 1GNQA 5DI9A 3U3JA 5JJIA 5DH9A 3K70B 2CJWB 5TARA 3IO3A 1E69A 4QKQA 3U60B 4LGMA 5FFMA 1CJMA 2R62A 2XJ9A 2XEXA 4UNQA 5KOYA 1CJVC 1IN8A 2VP0A 4RD3A 1BO6A 2A7QA 3D31A 1SQ5A 5A0FA 4OI0A 3EAQA 5ANRB 4YC7A 2IYXA 2QM8A 2JJ1A 1Y63A 1N6HA 1QVRA 1U0JA 3QKTA 1PLJA 3Q9LA 2PMKA 4OK3A 3GLFB 2CLSA 1FW6A 1JALA 5JI2E 4Q19A 4EQ6A 3LDAA 4TYPA 2JLSA 4DCNA 1LS6A 4W7SA 1S1CA 2BBOA 2QPAA 4NL4H 4P4TA 1GRQA 4DSUA 5JHGB 1QG2A 5CB6A 1M34E 5KDDA 4P33A 1QHSA 2EFDB 2ZRHA 3E5HA 2J1LA 5FOXA 2ZE7A 1G41A 2OLJA 2QMOA 4TLDA 3HJNA 3QI2A 4KI0A 1DEKA 4DLXA 4EFMA 4EAQA 3EPLA 4TZ0A 2OBLA 4L9SA 4XVRA 4Q9JA 2REBA 1XMJA 1BOFA 1EG7A 2XSZD 4BLTA 3C8UA 1OB2A 4MGIR 3WP0A 3RS5A 4BECA 2IS4A 3ZIAA 3VMFA 2ZE5A 1G8YA 3WNCA 1ANKA 1G3IA 4QHTA 1ZRHA 5IT5A 3QENA 4YLGA 1SULA 1NN1A 3KJGA 3QY0A 1M8PA 1N6LA 1XTJA 2IEZA 1E0AA 4WXRA 1A7JA 4KXFB 4MYCA 4TTPA 2CNWD 1XCMA 2H57A 2NO9A 2ZAOA 2VSOA 3RC8A 4WBSA 3I4LA 5KPDA 2YHSA 1N6KA 4CGZA 3PEWA 4GBMA 4PSAA 1M7BA 4CZ2A 1IXSB 4S35A 1J8MF 5L3VA 2CMKA 2A5JA 1S9DA 2ZUCA 1YZGA 4YDHB 4N1AA 2P67A 1QHYA 1VYVA 4V02A 2WSSD 4B73A 1E98A 4B43A 2REOA 4KODA 3L8YA 4BLOA 5J4HA 1KAOA 2WWHA 2PJZA 2ZITA 1JNYA 4TLEA 5C1BA 2V1UA 2AKYA 4B3GA 4V0KA 3A8TA 3E1SA 1FNNA 4DJTA 2PBRA 4M1OA 3VAAA 4FMDB 4BFVA 2V1XA 4Y0AA 4PR0A 1ZNXA 4DIDA 2FPLA 3K0SA 1KMQA 1OYWA 2G1JA 3PR1A 2CVHA 1K8RA 1J70A 4YXWA 4X8OA 2CLCX 4ZDWA 2R6CA 3AQ4A 5DYGA 3FOZA 2ODBA 2ZEJA 5EP2A 1AN0A 3FB4A 3LVRE 1UKYA 4H1VA 3WYFA 2P3SA 5KUTA 4P4SB 5FR2A 4TMVA 2FFHA 3N2IA 3RS4A 4DB2A 2LKDA 1TQ2A 2CDNA 3SR0A 3OAAA 3CIOA 1KI3A 1EWRA 2C77A 1CP2A 1ZMXA 3AF3A 1RRGA 4IW3B 1JPNA 3DZDA 5SZKB 1KIMA 1QVAA 1J90A 3BERA 2GCPA 4QJ5A 1DPFA 1W4RA 5KNBA 2OFWA 1E9AA 1SKQA 2ZR7A 4B35A 3CPJB 3FVQA 3NDBB 4NTZA 5CJ2A 3NBZC 3EARA 3QKSA 4WA7A 4UXJA 5A5GA 4OHYA 2HLDD 4LDJA 1ZCBA 4FWIB 3VR2A 3T15A 1NLYA 2OHFA 3BC1A 4A4DA 3GMTA 5LD2B 1W0JA 3F0TA 3NIBA 1JB1A 2F43A 2Q3MA 2O0JA 3RLFA 3ZJYA 1Z08A 4Q9LA 3NH9A 1N3BA 4JLKA 5JS8A 1JR3A 1J8YF 4WIAA 4EFNA 2ODWA 3AB3A 1D2NA 1X3SA 3W9YA 2GETA 4L5BA 1R8QA 1N6RA 2GCNA 2ZROA 1TL7C 5EJEA 3TQCA 3AVVA 2E1RA 2G3YA 2V6JA 2WMNB 5HZKA 1X8KA 4ZI3A 4QGGA 3RS3A 2OV2A 2J46A 1RFLA 1P5ZB 2QAGB 4B3CA 4EDHA 1ZC3A 2IXGA 1OIVA 2VL7A 3AKEA 2CK3D 1KI9A 3A1UA 4KLNA 2NO7A 2JJ8A 2QU8A 2B21A 3ZZUA 1X86B 2HT1A 5G41A 1P2VA 3VTKA 4BWYA 3GFPA 4RVCA 2ONJA 5CM8B 2HXSA 1QHXA 1DO2A 1XXHB 2YC4C 1KI2A 3X1XA 3BGWA 4JLDA 4PQRA 3THWA 1JECA 5DYIA 4P3YA 4M9ZA 1LF5A 3ASYA 1ZIOA 2VYFA 5GVRA 5H8WA 1NMZA 1KDRA 4JJZA 4TZ6A 2H5EA 3KZ1E 4DLRA 1U0HC 1MRSA 3EWSA 5GJCA 1SVKA 2YWHA 2PMDA 4F93B 1TX4B 2ANCA 2WWFA 4U5XA 2ZYWX 4ZO4A 2IYVA 3FKSA 1R4AA 4MYHA 4D25A 1F3OA 1KMHB 2VP9A 3K0AA 3MWYW 1HYQA 2VHJA 4ZDJA 5FPKA 1KY3A 1XEXA 1T0HB 4NCKA 5CB8A 2AFIE 1XEWY 3WHLA 1GOTA 4GL2A 2C95A 4NE2A 5BN4A 3ECCA 3QPVA 2CCGA 1F6BA 2GXSA 1E79D 2RMKA 1E4YA 1AS2A 4X8MA 2A30A 3G5UA 4JLMA 3RRZA 1P9NA 2HXYA 3EIQA 4D0NA 4ASUA 1OKKA 3SJZA 2O8FB 1XDBA 4YQFA 2QGZA 3ZGXA 3BIFA 3ASZA 1NSFA 3VHXA 3DHWC 4V0LA 2FGKA 5GVSA 2YKGA 2O8BA 3EA0A 2W58A 2Q9BA 1SVSA 4OHWA 4TL7A 2D74A 2ZE6A 4KSBA 4HAWA 3VKWA 1II9A 1E96A 1GILA 3C16C 2ZRKA 3NHBA 1GSIA 3OE7A 1U9IC 3TUZC 4TTRA 2AX4A 4JBYA 2PEYA 3HU2A 4KFSA 3MWJA 2JIZA 1NL3A 2ZYVX 2PT7A 2GTPA 3QBTA 1ZINA 1YR6A 1E9DA 2C8VA 2WWWA 1G3MA 4F4IA 4MKFA 1AS0A 1ZIPA 4RZXA 1Z2AA 1KOFA 2BMEA 5G3ZA 1FX0A 3QUSA 5CIQA 4HZUA 1ZD1A 3CRMA 821PA 2QQEA 1UKVY 4DCTA 1G7TA 5JJKA 4Q4LA 4MRSA 3A58B 3Q7PA 1YRBA 2IXEA 2N1BA 1RE0A 3U7HB 1RPZA 4JLVA 1JPJA 4G01B 1IN4A 5BQ5A 3SFVA 3OIVA 3P26A 4QBIA 1MO6A 1P62B 5K8TA 3G82C 2JLUA 1QBKC 1HQCA 2WPDD 1N0WA 3EZ2A 3MJHA 4PHTA 1E4VA 2YWGA 5HR5A 2FGJA 1BS1A 4IEIA 1G21E 1Z6TA 1VCOA 4HAZA 1COWA 5ELXA 3DOFA 1KI4A 1EFTA 4TT3D 4C2TA 2KBFA 2DR3A 3KQNA 5FL7A 1JAHA 2WAYA 3TW8B 4PC2A 2QT1A 1KO7A 1NVVR 3AVOA 4ITRC 3THXA 5UKDA 4X8HA 4LI0A 3U7GA 3LFUA 1E32A 1W0KD 1YZKA 2DB3A 3I5XA 3GPLA 2W00A 3OFNA 3GEEA 2B6HA 4MH0R 3B1XA 4DIEA 4BLRA 1CJKC 5J5CA 1KAGA 4ACBA 2ASEA 2P6UA 5C4GB 3SFZA 1OH8A 3ETLA 1P9RA 2A78A 3ZVLA 1AKEA 5AJWA 2WHXA 4GOJA 4LHXA 4PHFA 3WMGA 2QUZA 2XXAA 4Q9IA 1P61B 4WZBE 4D26A 4BLQA 2QP4A 2YVUA 5EP4A 2C9CA 2F3RA 4YMSA 3HU1A 3WXMA 2JGNA 2ZSBA 1O87A 2HJGA 4C0AC 2ZUDA 1LV7A 2OZEA 2P0EA 1GUAA 2HF9A 1W36D 3C4JA 4JL8A 1SVOA 2ZIAA 1N5IA 2A5FA 3ZVRA 2I3BA 2A5YB 1U81A 4D6PA 4NKRA 1NF3A 1S3GA 1FNMA 4KLZA 2H92A 2QNRA 3FMIA 2UKDA 1FL9A 1TQDA 5EUMA 3NG1A 3OHMA 2NPFA 4DLSA 3UMSA 2J7PA 1LFDB 4KBFA 4ZIRB 4XTRA 2VHQA 4TQ9A 2O8CA 4HDOB 4AI6A 1C4OA 1P4SA 1SHZA 5EXSA 4PAOA 5E95A 4K81B 3CNNA 2XITA 2HJVA 4BFTA 1KZ7B 5AWFC 1IXRC 2G9NA 4PQYA 4Q7LA 3W3ZB 4BGDA 3I92A 3N2EA 1TMKA 3ZH9B 521PA 1OT3A 3EC2A 3M1IA 3BD9A 4JLBA 2ANBA 5E7IA 1JR3E 3MCAA 2Z4SA 4I99A 1T0JB 4I1OA
chains in the Genus database with same CATH superfamily
1WZUA 4PHCA 1CUAA 4B48A 2WKRA 1CRPA 2LW7A 3WK9A 2C0PA 5K3CA 3PNYA 4N0QA 3F96A 3MF4A 3FWNA 2PGJA 1QCDA 4G8CA 4B6QA 3GY0A 5CMLA 2CV1A 5A0TA 3OQIB 4GMXA 2OGZA 1KU6A 4LNAA 3PFCA 3I6QA 3Q3GE 3UH1A 3V8MA 4R68A 4L8FA 4XLLA 2AWNA 1C29B 1PJCA 5JZBA 3H2ZA 3DKKA 3HCFA 5JZ9A 1IJKA 5EIBC 1P5FA 2RHBA 2BEUA 4BNTA 4F1JA 3N1UA 2QMZA 5CXQA 3I61A 1T5IA 4QOEA 4IMPA 4Z86A 3MYRA 3R6TA 5F51A 4ALJA 4EKEA 2Y1EA 1VFPA 1UWCA 3EDRA 4G4JA 5J9FA 3K9QO 1Q1ZA 1U1FA 4US0R 5TEWA 6PFKA 1OWPA 2OC9A 3N8KA 3HZZA 2BEWA 3HKEB 1I0IA 1KYXA 2DY0A 3FHOA 4KE7A 1I2ZA 2HCBA 5JASA 1XL1A 1MT3A 3WHPA 1MMFB 2HGZA 5AQ1A 2W7TA 3HC7A 5K3DA 3DOHA 4L2IB 4RHTA 1J2EA 1Z37A 3M4NA 1X94A 1XRJA 2GOYA 4M86A 4WECA 2SBTA 1YI8A 5EWJB 1M2VB 2EKZA 3EXFA 1UEXC 4ONEA 4R1NA 3F8WA 1BFDA 2WAOA 3MCTA 4KIJA 3TSOA 3C2QA 5BYAA 1G9TA 2D0PB 4N03A 4YHHB 3PEYA 3DTNA 1E8NA 1H0SA 1S2LA 4Y1FA 4AKEA 5K7SA 1QIIA 3N3BC 1SBIA 1FIUA 4QC2A 3PK0A 3LCMA 3DKVA 2JFBA 4H6WA 1C3OB 2X1LA 4HBGA 4O2AA 1QNFA 5A3SA 2VK2A 1U7ZA 3LO5A 5C5IA 5DNCA 1M2JA 3L9XA 4XH9B 2R1TA 1DO8A 5A6VA 2HXGA 3EZYA 2B35A 4YIKA 1XU4A 2C99A 2PZFA 2Q8QA 2JGFA 4IMRA 2CVOA 4NYMR 4ZVPA 5IH3A 3AVTA 4P9NA 6REQA 3PJRA 1JMYA 4I55F 2IWRA 4YT5A 2PFGA 5BWMA 1NG9A 4X6UA 4ENUA 1IBKB 1A5SB 5AI0A 1I1NA 4BLPA 1SHKA 2XCIA 4A1FA 1ISRA 4J0EA 3WADA 1PIWA 1IWBB 4TOIA 3LUGA 1SAYA 2X6RA 4J29A 4JUBA 1BIFA 4CODB 5D85A 2VA8A 3VVBA 2Z57A 2ZJ3A 2DWCA 4D8UA 3DGFC 4J0KA 3GEIA 2BGTA 1U8UA 3ECAA 3IBCA 5DLDA 3EVGA 3UG6A 2H59A 3UFXB 4EG7A 5KYXB 3KD3A 5LWHA 4H15A 4QWWA 2JGLA 1EFAA 5FIUA 4G1EB 4LF7B 5DBHX 5K2MA 4UJ5A 1XMPA 1P1IA 5BN4B 4MW4A 4LC9A 3HU3A 1L3CA 1AMOA 1LTKA 1NVBA 3GUZA 3NM4A 4TKUA 2OM6A 3LPNA 3ZS9A 1LA2A 3WTCA 1T8UA 3EEBA 3ZE9A 5MGNA 3B6IA 3DGEC 4IEFB 4YAEA 2PU5A 2J59A 3RSOA 1YE5A 2XZTA 3BWCA 4YJ2B 4BUZA 1OVMA 2J33A 2QZ9A 2PWPA 4MRNA 2N3ZA 2A0YA 2Q1XA 2G9UA 2FLWA 5LZ5A 1R8JA 3DFZA 3H3XA 2OXCA 4L72A 3HWX1 4PLHA 4C76A 1BCSB 5H83A 5DM0A 3BVPA 2BDTA 4URYR 4B4UA 4E2YA 4ZV4A 1MXHA 1U99A 2V6IA 1SMKA 1ZUIA 1CY7A 3WZMA 4PZEA 1T5LA 2A1IA 4I9FA 3U7QB 1NOKA 1P3JA 1RXIA 3ZKAA 2AEFA 3DZJA 4P7FA 3PHJA 4MW7A 5FPHA 3WMWA 4DC0A 3UKOA 4BVGA 5K8LA 5ALQA 3UQZA 3O8DA 1SD2A 4NNOA 3LRXA 4CL0A 1GUFA 3DJYA 3OQBA 1GQOA 1WHSB 4MVJP 4ZVLA 4Q4AB 3RTCA 1PJTA 2GVDC 2XRFA 3LOPA 3MW8A 3PFFA 3TBHA 2GM9A 5CLQA 3EFHA 3K2EA 4IDDA 4F92B 1C0LA 2FPSA 5H3LA 4E5KA 1N0IA 2QRLA 4BGUA 5ES4B 2HF7A 2NUPB 3FW1A 1U9YA 4KYTA 4FGJA 1FX0B 2QQ0A 2WNHA 4C43A 2OFOA 4LSWA 1ULUA 3DLTA 4NHEA 5IM4A 1T8SA 4GQAA 3TOSA 2VUUA 1U2GC 2HK6A 4GBGA 1H4SA 3A0RB 4TLLB 1TI7A 1AV6A 2G8LA 4FCVA 2BR4A 5ECYA 1B93A 3M6MD 4BKPA 4YP5A 2CDBA 1TUBB 2JW5A 2PU7A 1D2CA 2H11A 2HAEA 1Z16A 4LOHA 1L7NA 4P7BA 4F86A 2PUFA 2GZHA 1V1MA 2ZSEA 1DU4A 4OBBA 5CLFA 4LBYA 3W3AH 3HL0A 4CMBA 3PRJA 1ZJJA 5KSOA 2ONCA 3V4VB 1RAFA 3J80A 1PQ4A 4YS6A 1H2EA 1LNZA 4BO3A 3FNHA 1JFSA 1OPRA 2QZZA 2BEJA 4R5HA 3CE9A 3QU5A 2J3LA 4TMYA 4TSKA 3IE0A 5GONA 1ZG3A 1AXRA 1I7QB 2QT9A 1QKJA 3RYIB 6AT1A 5EXPA 3KWJA 5IEJA 4HFJA 1DTWA 1NUQA 2DPHA 2XDQB 3DKPA 3R3HA 1OIXA 5D2CA 1ENYA 1PR2A 4PNHA 4GR4A 3GJXC 4DXAA 4MWEA 4ARZA 3LUHA 2IIVA 4OHBA 1QZZA 1JDZA 1KK0A 1RP7A 3GFOA 3GT7A 1GIAA 4HEA6 4MI3A 2P35A 4IMIB 4GE3A 4QAQA 4RYDA 3LKZA 1YMUA 4IY1A 4DC1A 5C3UA 4MUNA 1X7ZA 3O93A 1LSSA 4OSEA 4ABTA 1SXIA 3JRNA 2QLTA 5BMOA 1MKYA 3UQYS 4LJ8A 1DUIA 3AUTA 1E66A 1KGSA 1U5BA 3GK3A 5DNWA 2IFTA 2AFHE 1SU8A 1YDMA 2HJSA 1Y1TA 3G88A 1G291 1XLTA 2K2QB 3IERA 3E1KA 3QQ5A 5ALDA 1HG0A 1BWQA 4DRXA 2AC2A 3BA6A 4FMCF 5I7AA 1QDLB 2HA6A 2B5OA 4H1TA 4A8JA 5IKMA 3NUGA 1W5EA 4HS9A 4RJLA 3S29A 3H2IA 2CDRA 4JNKA 4C20A 5EKSA 1H2HA 5H1YA 3ZBQA 3ZGVA 2DCMA 2FW9A 5JISA 1R0SA 3NU1A 1A9YA 2FQ1A 3V6LA 5TF4A 2X2FA 1XL0A 1OA0A 2XTMA 3S2GA 4JHLA 3DL2A 1I1HA 3QFSA 3ZLTA 4UAGA 3HYNA 4JT8A 4UBLA 4B17A 4E32A 1R64A 4GOOD 3PL5A 5EJ9A 4XM2A 1O5OA 1OBHA 3PPVA 4P58A 3DBLA 1SH7A 4DG9A 2XWSA 4HDRB 4OKSA 4HNQA 4IZIA 5JH7F 1E9CA 3I9KA 2O8CB 3MVEA 5LYJA 3QK7A 1ECCA 3CUVA 5AUNB 5IKEA 1X92A 2PV0A 2FWJA 6Q21A 1F8YA 2HYDA 5JQGB 2W8ZA 1H5UA 1YRHA 2NSYA 3M7IA 5ALKA 4ZZ3A 2H1OA 3NAGA 1DKMA 3SEZA 1CY6A 5DHTA 2ZG6A 4RAOA 5TPZA 5JNSA 1L7EA 2DJIA 1CR0A 3MRVA 3ZCXA 1TJPB 5FXMA 1ZP6A 2J7KA 5IF9A 3A1SA 1Y5IA 4KBGA 1YZTA 3HK2A 3L0IB 2B61A 2GUWA 1ZBDA 5IBRA 3GLGE 1ATZA 1IK4A 4ZT4A 4E14A 5BQPA 4F1KA 2BC9A 3KPVA 5CNIA 3G9QA 2ZI4A 2K2WA 5DXAA 4RBNA 1V5WA 4B80A 5C7LO 1TDJA 1YSCA 3OE1A 5HJ2A 1FDSA 2WA2A 4LA4A 4D46A 1V8BA 2XGGA 3LQYA 4FDUA 3VO1A 4EOGA 3VZBA 3AP2A 2OTCA 5EI5A 1RAAA 2AK3A 3M5PA 3ANSA 4OP2A 2AVNA 3B48A 1YR8A 3P19A 4HLUA 1U8FO 5DNYB 5I47A 2AZDA 4MQUA 5KNBD 1DC4A 2AIRA 4OQ4A 4LIPD 1XRPA 2EBFX 1B0AA 2ZREA 3NONA 4MLPA 1HLFA 5T8KA 4U7TB 1CULC 2FPRA 3QU4A 3VR2D 5CEFA 2HY7A 4RORA 1RC0A 5KTOA 4KDCA 4FS3A 4TS4A 1A7UA 1JDSA 2VN8A 4IQ4A 4M7RA 1WBJB 3ON5A 4US2R 3B70A 3BL8A 3LWZA 3K1AA 2E6UX 5JS2A 2NVOA 4F3NA 2R3SA 1RYHA 2X1HA 1BXGA 2P6PA 2ZYTX 5E0KB 5CLHA 3ONVA 4OLJA 2KHZA 4QU5A 4R83A 1GU0A 1JKJA 1R50A 4X97A 1DHTA 3T9AA 3PFBA 1EFPB 1KDPA 4WI1A 4UHHA 2ZI3A 3UMMA 4N4AA 2I34A 4E1VA 1EM8B 2X2EA 4K6FA 4EG6A 2J3DA 3LO8A 3NVMB 2QRVB 2WB2A 3D6TB 1CYEA 5H68A 4IIYA 4NQZA 3WWZA 1XKTA 2XYRA 2LE0A 3Q98A 2JANA 3B1VA 2QA5A 1RTKA 4R8RA 4RVFA 4ERXA 1XNQB 4FIDA 1JQDA 2IIPA 2OXIA 1U02A 3QA9A 2C0QA 4IGFA 2NX2A 4MW6A 3LTNC 4N0DA 2MYUA 1MG5A 4EHHA 5DHSA 3PXDA 4IKOA 3SM9A 5B58T 4Z6KA 1MGOA 4EMTA 4K5QA 1VL5A 5K5EA 3Q41A 1HFJA 3IEMA 3KYBA 1QC5B 4X54A 1U6JA 3HXMA 2WJAA 2DG2A 4OTZA 5C1OA 3HP4A 1T5BA 4DDWA 621PA 5JPCA 3O4HA 6CHYA 2RONA 4LJ5A 3DBOB 1C3VA 1G3QA 4PV7A 2NIPA 2A94A 3G1UA 4L9RA 3PG5A 3X1WA 5G0UA 5DM1A 13PKA 2BFMA 5JTUA 3ESRA 1AUVA 4ERNA 3VU1A 4TVBA 1XI2A 3FKSD 4TXLA 2YL2A 1S89A 1ZNZA 2B78A 2GUGA 3DFKA 2RHGB 4TM8A 3VH1A 2HW8A 2FR1A 2SCUA 4B2PA 2BLNA 4KXLA 1PNTA 4BASA 2I7DA 3NHUA 3OJEA 4FDAA 3JD0A 2AKAB 2YXBA 4LHYA 4JXKA 4K6KA 1R4ZA 3SY8A 3ZWNA 1Y1LA 1ISMA 1BROA 1NWCA 3KOMA 5JVDF 1KP3A 5AW1A 3QE3A 4YJ3F 5M2QA 2WD7A 2X9VA 4TTIA 2CE2X 1A9OA 2I1VB 3DL4A 4V2IA 1SHTX 2TYSB 2OO7A 4UOQA 1OH7A 4TV9F 4ZVKA 2Y1WA 3LGAA 3RIYA 3UICA 1VDMA 2XSZA 4PWZA 2P2LA 3CNHA 4FI3C 4IDPA 2OOSA 4U0JA 4EB6B 1EUDA 2AA3A 5JE8A 3URMA 1OWNA 2UVPA 2XZDA 1K2WA 2IXDA 4ZXPA 3QU9A 3NVAA 4FJ0A 3IQIX 1XVAA 5IRCD 5EMJA 1LW7A 5LJLA 1Q7GA 4P8RA 4YRZA 4CNQA 3ESZA 3ZCPA 1JRLA 3DMPA 1KZ9A 2P40A 2QVLA 1W581 1EPUA 1WMAA 3GI1A 3K0BA 2HO4A 4MR7A 4PRYA 2FXVA 3HJBA 2HEIA 1Q1GA 5FLYA 1U6IA 2XYPA 1GNSA 3G9ZA 3ZDRA 2PLWA 5J58A 1BG6A 1P4RA 5DZSA 2NNWB 1C0KA 1ZCAA 6YASA 5HM8A 2F1KA 2V5UA 3NBAA 3JWGA 1Y9DA 3GUVA 3OD1A 1H42A 2FA9A 4ZRDA 1NN3A 1Z2OX 2JAWA 4PX9A 3TSWA 3ZVKA 2HK9A 3BSSA 4QBTA 3RVRA 1Z4KA 5JHHB 1Z35A 1JEQA 2G17A 3HYSA 3QXXA 4UNSA 4POOA 3EMKA 4Y1RB 4BEWA 3H0EA 5JDCA 1SCKA 3FPAA 4IRMA 3L8ZA 4KO2S 1JDVA 3I9FA 3FA2A 1SRRA 2XNKA 2UZ1B 3HDQA 1AK9A 4P53A 3B8EA 4DB4A 3HPQA 3PA8A 3PBKA 4U7WA 5HQTA 3WL7A 1OW3B 2I4OA 3ZWPA 4B7ZA 4UFNA 2JGDA 2C8KA 3S55A 3QLUA 2M6KA 2VPTA 3C4QA 2C04A 2DUNA 4I4NA 2VSXA 4L7VA 2FPKA 4AJPA 3A1VA 4B87A 4Z1OA 3BB3A 2QN6A 4G5YA 4LMBA 5BSEA 1EWYA 1GRCA 4L8WB 4PYOA 3DMTA 4YUXA 1QH9A 3CUYA 2C78A 3A3PA 3OZRA 1YO6A 3H9BA 2EFCB 2FI1A 1B42A 2EDCA 3L18A 2DUMA 3KCNA 3SYLA 4K6GA 4XWAA 1ZVKA 1X1RA 3X1JA 3F5FA 3OOWA 4CG1A 4F2WA 4AY6A 3BJZA 1UBGA 1UC5B 1PVVA 5F9MA 3UAYA 3DT8A 5SZIA 2OD7A 3R1IA 3R9IA 3PX7A 1D0IA 1EHCA 2ST1A 3C7CB 1TOAA 1V3VA 2VTKA 4R8VA 4ZQFA 4B3RB 3DE0X 1LU9A 4E13A 4Q9HA 4R2KA 3UYLA 4Y1GA 2WEKA 2VYVA 4DWWA 2DHQA 2OGTA 5M29A 4DDTA 3WS7A 5FQOA 2QLJA 4P6VF 4CKYA 2IW1A 3TSZA 3KSZO 4ODIA 3P2OA 5FD8A 3TKAA 2GJAA 2RIPA 3UV3A 4NI5A 2IS6A 1NVGA 1O3YA 2JLXA 2F9MA 3H1EA 1KU0A 3P45A 4HNTA 1T5SA 3SOPA 1RJGA 2IYRA 3BWYA 5L3QA 4O4HB 1ITZA 4WFIA 5T41A 4C4TA 4I50A 3O73A 5TC4A 3TE6A 3ZDYB 1HF3A 3KNZA 4IRXA 2ZBQA 2I1QA 3BWXA 2Y0BA 2Z1DA 5CM9C 1O03A 1FDIA 3KYCB 1HMYA 3T9EA 4C4XA 4DV7B 4YAGA 1UBHS 1YR9A 2V97A 1Y3AA 1G64A 3NGXA 4L78A 1XMSA 2VZ8A 4W6QA 3K70D 4FC6A 4N3CA 3ZY2A 3MBKA 4MEJA 3SIRA 1RNLA 3EXG2 3L7CA 4OI2A 4BNVA 1FVFA 2IXAA 3GHHA 1MW8X 1QOZA 1Z68A 3ONNA 1MX1A 4ZDIA 3GAAA 4MUKA 2A86A 2P6NA 5HTOA 1V5FA 2R8XA 3H8SA 1ILWA 2AE2A 1OYYA 5BRAA 5BN5A 3N8DA 5HPYB 4HRYA 4LGVA 5E4TA 3I2YX 3NLLA 2Q3HA 3QVGB 3S2SA 3VR6A 3STTA 3OIFA 3SX4A 1QNLA 1R6VA 4RKWA 2XZLA 2PX6A 3WSVA 1KVSA 1ZZEA 2QTWB 2Q6IA 4HQOA 2C2HA 3V1UA 1HL7A 1DRJA 1HZZA 2GCOB 1Q7EA 3MWEA 3PQ3A 1T8TA 2VRCD 1EM6A 2O8FB 2QMHA 1QIGA 2BJWA 3GGPA 1T9AA 3NW9A 4JEIA 3O9MA 1Q3KA 4O2BF 2CK3A 2OQIA 4IX1A 1B6SA 4W5HA 5ICSA 3UJNA 1QB7A 4BIMA 5ELLA 4CEHA 3M4YA 5AXDA 3A6KA 2C3PA 3BMOA 2Q45A 4L0QA 5EHIA 4BRUA 2QRJA 5C81A 1HOTA 3HG7A 4DCVA 1Z82A 2GDZA 2P4QA 3X2EA 3WA6A 4I5DA 2Y67A 1EMDA 2UYQA 1H4VB 3DCNA 3CHYA 4B0PA 4BP8A 2A5LA 3D43A 4P5EA 2QORA 3O4VA 4Z4IA 1RPNA 2E89A 4MUEA 3HZRA 3F7OA 3Q3VA 2H1HA 4MPTA 5D7NA 3ROFA 3ZHYA 1P8AA 1T6YA 4NCAA 4MUGA 3B8HA 1QGDA 3EASA 2BW0A 2OWEA 1J1UA 1Q21A 1LH0A 4AQ7A 4M0DA 4MARA 4AUMA 3GD7A 1PZXA 3DMFA 4ENQA 2G5CA 1JFFA 5EUBA 4KOEC 3O2JA 4BNMA 2KSQA 3HRIA 4IXMA 2UYCA 3C43A 1KMNA 5TGZA 1R9MA 4CM4A 3GJ7A 4HMPA 5EP3A 2Q3LA 3VR0A 1C7QA 2FN7A 1QH1A 1VHTA 2GPNA 5FYDA 4ZFNA 2G4VA 4RPHA 4IXDA 3R9WA 1L5RA 4QNRA 3AETA 4JVLA 1U0RA 3ER6A 3KTFA 4HYTA 3CPSA 4WT7A 4YB8A 2XCRB 1USVA 3MCUA 5JPDA 4M7PA 4LYHA 4N39A 4LY3A 2IHTA 5SY9A 7AT1A 1AMUA 3H2BA 2PRSA 1NQ5A 4KLRA 4NC9A 1YZQA 5KYYA 3G7UA 4QOIA 1GAJA 2RGUA 3O8QA 1ZIXA 2UYYA 5KQLA 1C3JA 1G8KA 1HFWA 2BLLA 4CEJB 2BAGA 2ODQA 4LVUA 4LWZA 3P2JA 1NRWA 3QIAA 1MOZA 4K9DA 2C54A 4X1IA 4D4HA 3DWIA 4C3VA 1E63A 2ZIGA 4PGFA 5IANA 2E7ZA 4IOJA 4C2UA 3ZTYA 4YJFB 2NSHA 3TNJA 2HIGA 4LHVA 4RXMA 1E94E 2NZXA 4C6TA 3N05A 4HDQB 1LZKA 4XYMA 3WBJA 4ZJPA 1K0FA 4Z8YA 3OP1A 4NABA 3JVVA 5B1HA 2OFPA 4J9VA 3A6LA 3RC2A 3RS7A 1G17A 2IZZA 3CZQA 1CYDA 2QD2A 3IBFA 4TXJA 1FJXA 3DLHA 2PUHA 1L8QA 1VGVA 5MN4A 1VMAA 4X6LA 4RZQA 2TMGA 2I78A 2NUTB 3EA4A 5FOVA 4F9GA 1SQ0A 1II8A 2GAFA 1XC7A 1AGXA 3MJCA 3PFKA 4NENB 4W7IA 4B7CA 4ZHQF 1OSNA 3PKZA 3VKFA 2OO3A 1MC4A 1N7GA 2PWAA 4RIFA 5SYMA 5TJ9A 2PSSA 1U11A 4ZICA 2WYIA 3UMYA 1Z5UA 1NW5A 1GHTA 3K32A 2GN9A 4Q12A 4RWEA 3GPDG 1DG9A 5KDLA 3P5SA 4JL6A 4OHFA 5B7QA 3R9XA 4K9SA 1C9YA 3BE6A 4MGHA 3DM5A 1J2UA 2G5PA 3NHMA 4LYDA 2W98A 5K0FA 2JKYA 4RV5A 1JXMA 1TPYA 5ED0A 1T4CB 2JFXA 5EJAA 2X0EA 1LB1B 3GVHA 3R3YA 4FHZA 4YASA 4D9FA 4R1UA 5EY5B 3PHBE 1IRIA 1V1RB 3GFSA 3RVNA 2WILA 3M70A 3IJ5A 5LA6B 4WNCA 5EJ5A 2W0SA 2C7GA 2J09A 4B6RA 2YVQA 2DWOA 3EGCA 3ODPA 2PXHA 2XIQA 5HBRA 4F46A 1UZLA 3HO8A 4JBXA 4P7KA 3PEFA 2E82A 3QF4B 4CCAA 2ZUFA 5E1BA 1TFRA 2GAAA 4QULA 2PJRA 2W37A 4L4UA 4HDNB 2QL6A 3R7WA 4AG3A 3PXAA 4JJKA 4CETA 1OFUX 4UUPA 3S8YA 1ZMBA 1AK1A 4HRAA 3TVDA 3D2BA 1W0KA 4IIXA 1R7RA 5K6RA 4RULA 3U4HA 2B2CA 4X1KB 5ARDA 2C9ZA 2A9KA 5NLLA 3KU4A 1PR9A 2JL1A 1Y7IA 3W90A 1YAHA 4Q6WA 1GLGA 4FGSA 3ZXXA 4RFSB 1PGPA 2OCIA 5CCXA 4ZVMA 3WLFA 4BNKA 2C4UA 4HSEA 4MROA 3E53A 5CH8A 3L43A 4EG5A 4CLOA 2ZIZA 3S44A 3FNBA 1V7CA 4K9RA 1JBQA 2AQHA 4JBNA 3L93A 3S8EA 1RPAA 2JJQA 2R79A 1E6KA 2WSBA 1WW2A 3ORFA 3ZHCA 1WXEA 2PX0A 3BFKA 1JIUA 3OJXA 4CM9D 1SKYE 4G0ZA 4X3PA 5IXYA 4H1UA 4RTMA 2FY8A 1R4MB 4QPPA 3TLXA 2ATXA 3KQLA 2ZB4A 2CFTA 4W82A 1TW2A 2E4WA 1ZUNB 1KERA 2RAUA 2Z1MA 3D6JA 1MDFA 3JQAB 4UHDA 5CB4B 3A9TA 3W5AA 1GL3A 2BGUA 4S1OA 5TB5A 2OBBA 5CT5A 5FA8A 4C06A 1HI9A 2VJAA 3JWPA 1ZRNA 5DI3A 1YOVA 4BO0A 1R3UA 3WHKA 2FX5A 4EHLA 1EWVA 2GZRA 2JJ2D 3CXRA 1AZTA 1TPZA 4M1YA 4XVQA 2RB5A 3TZQA 3BB1A 4MGKR 1H1LA 1HDCA 4FHFA 3C7AA 3I5YA 1UDWA 4GLJA 2J0VA 3S70A 4W5TA 5DSZA 1P45A 1EBFA 1OX4B 4MUBA 4RHCA 1NU6A 2H4WA 4LYAA 3ZY6A 2IYUA 3A3OA 3PU6A 2GTIA 4WK6A 3SXPA 3SYRA 4CIYA 4DLWA 1X8JA 2H63A 4C05A 3LUKA 4BZZA 2RAVA 4KPEC 1ECLA 4U2GA 3TECE 5EHXA 4GYYA 4B2YA 1Y7PA 5FPTA 1KWGA 2DR2A 3B6MA 2GKGA 2BMJA 3LX4A 4I4TA 2NPIA 4NZNA 2QUJA 4LF4B 3R5SA 4CEIA 3LLUA 1VBFA 3A3NA 1VSQA 1MEEA 1XHLA 5F7XA 1XCBA 4A82A 1E77A 1KAMA 4MVJH 4NS4A 3W4KA 4KYUA 2AEEA 3PRYA 3Q0IA 3AKCA 3TG2A 5DM70 3BIXA 2OZLB 5DDIP 4L4XA 1TKCA 3AGQA 3IXLA 3M1YA 4DQDA 3KXPA 2JVKA 2NU8A 5G4KA 2ZVDA 4N9QA 1MQ9A 2X9QA 3DFMA 2FUG6 1QFSA 4JCCA 1U2ZA 1DRVA 1JYEA 1N2GA 2BFWA 4TMTA 4ESHA 2XBUA 9LDTA 4ZHSA 2JD1A 1DG3A 4KLCA 1RJFA 1Y37A 2BELA 2CHVA 4QGBA 4CMIA 4ARVA 1I3CA 5BYJA 3KQKA 4P86A 5G1PA 3V4SA 1Y4SA 3RRFA 3CLRC 1Q84A 2ZYSA 4FEGA 4RF4A 1ZD8A 4IJ5A 4WCFB 5SYAA 1V3UA 1YE8A 4MS3A 4HV4A 2PZAA 1VJCA 1Z8DA 2ECPA 2HU7A 2KM1A 2O07A 2QY9A 2ZQ5A 3H8VA 1Z6QA 4EYOA 1GPKA 2V6GA 4L95C 5TMBA 1Q74A 4GEGA 1Z29A 4EPVA 3L0OA 4M1TA 5CXUA 2ZR9A 1K3TA 1OXTA 2HWXA 3ZYZA 4FPXA 1HNNA 4PC3A 2W48A 3AEUA 1XTPA 4OAPA 4BX0A 2DKNA 3IUQA 2XMGA 4EL0A 4INPA 4HL6A 4RVDA 3SG0A 1FOEB 3QUBA 4I46A 1VG1A 4NAUA 4BHTA 1G5TA 3B13B 2OB2A 2FXIA 2QV7A 1JEEA 1Q11A 1SURA 3EXHB 3B9QA 4PC7A 2CDCA 4NV0A 4J1TA 3ZX4A 4EHBA 5LMCA 5FPPA 2DPGA 4DHWA 2GZ2A 1QH8A 4GMHA 4QFCA 2JATA 1EI9A 3CVOA 3W6UA 2R6AA 3UKJA 3FE2A 1JKIA 1Q3HA 2B3TA 2PSDA 3NQ41 1JTFA 3VMMA 4K2AA 1OY1A 2W4QA 4LEIA 5TPZD 4IXTA 5BW8A 1SU7A 2ZTVA 4JI0B 2VPYA 3KQYA 3IAEA 1SCBA 3OPYB 1MEOA 2HWUA 2LRHA 2RHOA 1UM8A 3LK6A 4IIGA 2BKAA 4RE6A 4PPFA 5LP6B 2GRUA 2PLRA 2C5GA 3BKWA 1R37A 5ALJA 2D8AA 1FXSA 1ZM2A 2FMXA 4N5MA 3CNOA 3K73O 3RVDA 1HBJA 2CLLB 2ZBVA 3L1UA 3KXIA 2Z0MA 3PEVA 4FD3A 4NHOA 3UT5A 1NYRA 1EA5A 1U8TA 1RCTE 4YUZA 4F38A 4HX2A 3LH5A 3MS2A 3UJDA 2QP3A 3U81A 2PKQP 2RJNA 2ZS7A 2NMVA 1P2UA 2OAEA 2GHQA 3LLVA 4TXNA 5BNFA 3PNSA 4A0SA 4KR0A 1YHZA 1J7KA 3TD2A 1V4BA 4ADSG 4FWTA 1QK3A 4PIPA 1VRCA 3DE6X 4M1MA 1LDYA 5JEDA 3EIEA 3NFRA 3G2NA 1OAAA 4JJ7A 2XMRA 3F98A 4PGMA 2G83A 5AW9A 2W2KB 1P91A 2MINB 5IYZF 3ITEA 1WLYA 4A8PA 4CQMD 1ZH8A 1OXVA 4GYJA 4BO9A 3F6CA 4EUEA 3K0CC 1HLGA 4EDFA 5CURA 3IPLA 1C4KA 3Q15C 4TRMA 5KTSA 4XIFA 2HDNB 3KE8A 3TKLA 2KLBA 1EX6A 4TKVB 1YC2A 3A7EA 1QYVA 1XD2A 2GILA 3GZNA 4HSGA 3UHOA 4E70A 3B1JA 3TMAA 4BVFA 2O7RA 5LXTA 2YY7A 4WZAA 2BM0A 3V8VA 3SR3A 1KPIA 2Y2VA 3DR5A 3NAZA 2O2SA 3Q87B 4NK4A 5IM5A 3ZE8A 3WMXA 2I4RA 1P1RA 4S1TA 4IVNA 5DN6A 3HJCA 4IF6A 1XZLA 2NADA 2Z6VA 3C4VA 1YVDA 3BD6A 4GNKA 4KFRA 4X91A 4A16A 4B74A 4J16C 2AFHB 5IDXA 3EDCA 3D0KA 4ZI7A 2OQRA 4XQ9A 3ZW8A 1EZZA 1NASA 3G49A 4A03A 5KYUB 1WB4A 4Y30A 5TDHA 5KTMA 4J0DA 3PVZA 4O5AA 2HFKA 1A9XA 1U2SA 4WN3A 2G04A 5EPOA 4AJHA 4RTNA 3CB2A 4Q66C 3BQMB 1EQUA 1MFZA 2WJGA 2BL4A 4TYYA 1AK2A 3IUBA 1A7AA 1KI6A 3OF3A 3PQ2A 3MWLA 3O21A 3T7TA 3F67A 1RTTA 2WD9A 4OYHA 4LXXA 1FMTA 4Z2YA 3SR4A 4OEHA 3RYFB 3MWDB 4G81A 3ZBUA 2PVPA 4CW7A 1R18A 1PUIA 2GRJA 2WHYA 2X7XA 3A1CA 1KOGA 3LWDA 3F9RA 1K5PA 2QOEA 3NBXX 4ZQGA 5HXAA 3RKUA 3RU9A 3GJ3A 2R00A 1J39A 1ZCJA 3KVVA 3ETHA 2Q2QA 3KKOA 3CB4A 3KT8A 4D4JA 1NR5A 3LXXA 1RI3A 2WU1A 2YZKA 4GZ5A 4REQA 3VAZA 5KX5B 4D2IA 3A1DA 1CLEA 3GGSA 3CUEF 4TXMA 3SE7A 1E3WA 1T2CA 1Z7YA 3ZY5A 1S2MA 3OVMA 3D4IA 3BSFA 3CW9A 3P4UA 2XUJA 3KUKA 3R9KA 2O1WA 1AX9A 1ZDMA 3TM5A 4JJ4A 4IQ8A 4EBBA 2DGDA 4Y9TA 5F35A 2VHVA 3PXBA 3DWGA 3KV1A 1NI3A 4RW0A 3FUTA 1Q22A 2OFXA 1PO7A 4M21A 4XIGS 1N36B 4CV1A 1GWNA 1OWMA 1ZH0A 5BYBA 4C01A 2XE6A 4DT1A 1I7LA 1KR5A 5FO1A 2MSDB 2W2OA 3L7OA 1ACLA 2J0UA 3GLGB 1NURA 3KJEA 3AHIA 2IODA 4LX8A 3RUPA 4MP8A 4QFDA 2D4AA 3FNFA 1I6WA 5TQVA 2R6HA 1E2KA 2NU6A 3I45A 3GC6A 4G5QA 4GI1A 3ADOA 4YH1A 1JR3D 7ADHA 4WZ6A 2QX7A 3L8GA 5JU6A 4O29A 4TYNA 2OYCA 3H1TA 1PQWA 4HATA 5FNVB 4PVCA 1N5LA 4OVKA 1UJBA 4G4SO 1R8SA 2F3QA 1XZCA 3QV1A 1NN0A 1XU7A 4P4GA 4EFDA 1SCQA 2A5GA 3G0IA 3WR5A 1QTQA 2VEDA 1WCIB 2POCA 3FTQA 4JBHA 5TQ0A 1MN6A 3W7VA 1JTVA 3MLEA 3AJEA 3LL7A 3S3TA 4M6WB 4HNVA 1ES9A 4R71A 4CR8A 3A6EA 4M9CA 1KOLA 2QVBA 3UTCA 2FOLA 3IQFA 3WNVA 3ZUGA 2E4VA 2ODNA 3JQ6A 4OHZA 1JEYA 2PJUA 3DBVO 2GPSA 1W36B 1BMQA 1JQLB 4UU7A 2H3EA 5AJXA 4JT9A 3WYBA 2FSIA 4ESVA 3PUVA 1MJGA 3LC1O 4AROA 2YZ7A 4GLOA 2EERA 1X8LA 2ZRAA 2VNSA 3O03A 3SDSA 3GPCA 2NGRA 1WUJS 2OR3A 4EVSA 4ZOEA 2J0SA 3WIUA 3T94A 5I9SA 3TO5A 1ND6A 2PQ2A 3KOWA 3O1JC 4ETMA 1DFHA 1YOBA 2CUKA 2GAIA 3FBTA 5DNAA 2O0MA 3EZNA 3K9CA 2AMFA 1OU4A 3P4XA 2WAMA 1NY5A 3VDQA 1KYVA 1XN1A 1ULBA 2G1KA 2HA3A 2VDUE 1KSHA 3SJUA 3DDHA 3HU5A 2B1IA 3T41A 1ZH2A 2RG1A 3IAHA 4ESOA 1ZQ1A 2AFRA 1Z9BA 2FMHA 3HFJA 5AJVB 3EHEA 3PC7A 4ND4A 3U7IA 1NMYA 2YMPA 1G4AE 4LZOA 5FBLB 1YQQA 2Q2NA 4QOFA 1NNI1 4IAOA 4V0MA 1U98A 4WKPA 3TK1A 5FBVB 4A23A 5JW6A 2Y1LA 3BRWD 1QMGA 1CDOA 2Y8EA 2G9ZA 1M1NB 1XD8A 1LI5A 5EXXA 1WJGA 3TD9A 1IPFA 3QMWA 3SEFA 4QX6A 1LJUA 2A3NA 3GLUA 4TL6A 3MUFA 1U9IA 5FOSA 4RVSA 4X0EA 4L85A 1PHRA 2A84A 2VYVD 3SHWA 4UREA 2ZJ8A 3C3JA 1TUIA 5KQGA 1JJ7A 1ULTA 3CM0A 3AERA 3ZNNA 2AXNA 5JCZA 1UDBA 4W9RA 1FK8A 3SX0A 5JLAA 1W2GA 2HA2A 3ONEA 4L0DA 4URZR 2XVMA 2AZMA 2H7VA 5KYKA 4GGOA 5LNK6 4M88A 4YMUA 1CUVA 2HREA 5M04A 3R5FA 1XN4A 3DE1X 1QP0A 3GCDA 4ZAGA 2QL7A 5D3MB 2Q41A 3KJNA 2HR1A 3I04A 2VNAA 3UNXA 3UHPA 1NXPA 2AOUB 5K8IA 4JT4A 2CNWA 2Z98A 2Y1CA 2RGRA 4M89A 1P7CA 2AR7A 1EFCA 3TRDA 3EGDA 5A9SB 1V11A 3FFWA 3PDHA 1VPEA 3IGFA 3S4YA 3QIVA 2PKXA 3U09A 3LYHA 1Z4NA 4EZBA 2DYKA 2P0YA 2PRIA 2OVFA 3E0XA 4TWAA 2OAP1 4HB4A 4LQDA 4ZOLF 2O7VA 3PEUA 4KN5A 2K7ZA 1GVHA 3W1EA 4P5DA 1Z75A 1AY0A 1NTRA 2YJZA 3CYFA 4KFUA 5CT8A 1U7OA 5JPIA 3AVUA 1H2WA 1A98A 3NHWA 4IS2A 5K0GA 1AOXA 1E9FA 4LZAA 4QLAA 1TF5A 4P4UA 1PFYA 4G67A 3HR7A 4YVFA 3WQBA 3FFTA 1DKPA 3F6YA 3IVMA 1O6ZA 3ANNA 2P6OA 4LJAA 1V7PC 3CX6A 1PD0A 1SKBA 1Z7EA 3FPSA 5J47A 3GNLA 4NYIQ 2O7SA 3FUCA 3UHFA 4HQRA 2WU3A 1JB9A 4JLNA 1J97A 5E1DA 1S2OA 1QTIA 1RAIA 1SY7A 3IQHX 5MF6A 4QXQA 3WB2A 4D82A 1J2YA 1YB2A 3SQNA 1WMDA 2HGSA 2LVBA 5LYYA 1JU3A 4J03A 3PJDA 3FJYA 3T4XA 3DMNA 3ZEAA 4AO7A 1NW9B 2ZYHA 3JR7A 3UMVA 3V34A 4ARZB 1P60A 3KEGA 4FP9A 2J6IA 5A4JA 4JMPA 3CTMA 1BKDR 3LM8A 3DHVA 3WB1A 3HXOA 3U0VA 2WTBA 4B1FA 1S7GA 4WVFA 1BDHA 1DRUA 4QQFA 4JR2A 2CXPA 2GRAA 1Z63A 4DQVA 3HA3A 5SY6A 1USIA 4V3CA 3W2GA 2WWXA 1N2BA 4DF3A 1F2UB 3MT9A 2Z09A 4Y98A 3PPXA 2Z56A 1EP9A 5IC6A 1HEYA 2QPLA 3M82A 3TZEA 5KWIA 4P36A 3C98A 3IEUA 1Z0IA 3OMWA 1CTQA 1K8XB 2F7SA 2GGSA 4KIUA 4CDNA 4KH1A 5DP2A 3TF5A 4G8DA 2GK3A 4A8JB 3SZMA 1VB5A 2NNLD 3VNUA 1HTTA 5EZQA 3GLHA 4FYXA 1JQEA 4LC0A 1HGXA 1WPXA 5DCYA 2G9VA 3SBOA 4QO8A 3SZ3A 4QPJC 2CT8A 2HLDA 3F4LA 3HO1A