3KJGA

Adp-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Hydrolase, metal binding protein
total genus 76
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjgA00
4TYWA 4QBIA 1SXJE 2FSHA 3OIVA 1VG9B 4N0DA 1XD8A 3SQXA 3AVVA 5JWHA 1ZU4A 1S3SA 3ZZTA 4LPSA 1NLYA 4FN5A 2IL1A 3KJGA 4J0QA 1DEKA 1XTSA 5EP1A 2E1RA 1W5TA 1X1RA 3GJ6A 4JBYA 3BGWA 3W9YA 4DZZA 2BCGY 2V55B 3ZLJA 3DHWC 5TB5A 1XEFA 2PEZA 1JPNA 3T5DA 2J1LA 3TUIC 4XVUA 3GFTA 4OI0A 3TVTA 3L43A 2ZRLA 1F2TA 1Z2AA 3SZRA 2BBOA 3EWSA 1R0WA 2OG2A 3SHWA 3TSZA 4DT1A 4MDEA 3W6PA 4JVSB 4NYIQ 1E79D 2ZSFA 4RD2A 1WB9A 1F3OA 3PJRA 2PJRA 4XVRA 4G3XA 4XH9B 4C4PA 4A0HA 5JCZA 2FSIA 2FN4A 3REGA 3RABA 4IHQA 4LV6A 1T3SA 3EA5A 1VHLA 3MRSA 4I4LA 4EDHA 1A4RA 121PA 3PUVA 3R7WB 2JGNA 1Z29A 1KI6B 4RFSB 4HDQB 1E0JA 1P2TA 4OHZA 4RKFA 1C4OA 5CYOA 2QEQA 1MO6A 4N0EA 1P2VA 1O87A 2QTVB 3MSXA 1II0A 4TL6A 4XOIA 6Q21A 4TLDA 2QM8A 1E9SA 1YKSA 2ZRAA 5G3YA 4B47A 4PO1A 1G6HA 2AD1A 3GLIA 4EFNA 5JBQA 3B82A 2A5GA 1EFTA 1NJFA 3KX2A 2EFDB 3X1YA 1M34E 2O8FA 2GDJA 4D4MA 3HR8A 5JEDA 4U5XA 1YHNA 4Q1DA 2D4HA 1BMFD 1ZU5A 2X1VA 4PPNA 3D31A 2QAGC 4K81B 1KI3A 2GAOA 2GVZC 2GWHA 2R9VA 1NKTA 4M1KA 4QHYA 4Q9LA 3O8CA 2FE4A 2WZQA 1Z63A 3K0CC 3CZQA 4GNKA 4L16A 4EPXA 4B2PA 1KIMA 4FCWA 4WIAA 4QGFA 3CUEF 1UF9A 1WE2A 1BO6A 1LVGA 1VCNA 2WKQA 5CM8B 4DCSA 2JEOA 4RZUA 2QAJA 1D2EA 3OHMA 4D0GA 5K8LA 4EKDA 4GRAA 1NLZA 1EWRA 1NKSA 1Q0UA 3K1JA 3KXLA 3OEHA 3BD9A 4I99A 3B78A 3ADBA 1G7TA 2QMOA 5B57C 1E9FA 1P72A 2VQSA 2ZYVX 3TK1A 3QF4A 3KL4A 4UNNA 3UMRA 1CJKC 1G20E 2CMKA 3R8CA 5B58C 1W36C 2WJVA 3NVAA 2AWNA 4W7SA 3OEEA 1KMHB 2ONJA 1TTTA 1WXQA 3FE2A 3HPQA 1CLUA 5KOYA 2IXGA 1E32A 5SZIA 1P7CA 5KDLA 1D2NA 4UQOA 1CR4A 1KYIA 1XEWX 3VKWA 3G82C 4V0KA 5AJZA 4NDZA 2JIZA 1FUKA 1W4BA 3I62A 4Z54A 2QTHA 4B44A 3GLHE 3CPEA 1WMSA 1BIFA 3GFOA 1YR7A 5FTLA 3AF0A 5IT5A 3RRZA 3UANA 2CJWB 5KNCA 2OFWA 3HYRA 3K9LA 1AKYA 3I32A 5LPNA 4CEIB 4Y0VA 1Z0IA 1OB2A 4IXNA 2R6DA 3UG7A 1KZGB 3CF0A 2IYXA 3QY0A 4AIIA 1XCGB 3F3YA 4JVMA 4Q9KA 1KHTA 4QJ4A 2F43B 5LD2B 4QJ3A 2RGDA 1DAHA 2JJ2A 2QBYA 1Q1QA 4RZ3A 1RYHA 1MRSA 4L9SA 3ZZUA 1W7AA 5FOWA 1ZD9A 5TVKA 3C15C 1GKYA 2I1VB 2BVNA 3K53A 1XDBA 4Q1BA 1GNRA 3OEHD 1HYQA 1H8ED 3K9NA 3SYKA 2IYSA 4BZQA 1Q3HA 2J0UA 3DM5A 2WKRA 1NBMA 5A5GA 3RDPA 1XMSA 2ZQ5A 1TMKA 3SDZA 2GF0A 4M53A 3PUZA 4KSBA 1JAIA 2ZJ8A 5H8WA 3A37A 2E9SA 1ODFA 2JJ1A 2QZ4A 1AM4D 1MO3A 1NMYA 3AGQA 2B7BA 4MKFA 3UMSA 3ZH9B 3RS7A 5KNDA 1E1RD 1XXHB 3DL0A 1DO2A 4JJZA 5C4GB 3ICQB 4OK6A 5TV2A 3IPYA 2W6JD 1J99A 2KI5A 3K9HA 1MO5A 3KTAA 1OFHA 1MABA 2XZLA 1FL9A 1QG4A 3QG1A 3KKQA 1TX4B 4TLCA 4UNQA 3TE6A 4A82A 4B6FA 2NQ2C 3T35A 4DKXA 1E4YA 4NHOA 3K0CA 2ECKA 2OHFA 3ETLA 1NSTA 1G41A 1AQYA 4LYJA 5JZVA 2FEMA 1XD2B 3X2SA 4D0NA 1IN8A 2WTUA 1G4UR 3MWLA 2PZFA 1RKBA 4TSFA 2OBNA 1OXTA 3EZ7A 5JSZB 5FBRB 3BC1A 3GJ5A 2OESA 5DLQC 5FTNA 1WCV1 4G5RA 2WSSD 5L3QB 3K09C 4GMXA 2DWOA 1E2GA 1F60A 4W5JA 5JS7A 4NH0A 2P5TB 1VMAA 3FGNA 4D81A 2OFOA 3OE7D 1FX0A 1US8B 4GOXA 5L3SB 4TYQA 2UVQA 4DUGA 3A1SA 1J7KA 3B8HA 2ANBA 3VMFA 4A15A 5BQ5A 2BC9A 1OH6A 1QG2A 3KUDA 2JLRA 1UKYA 2X19A 5ANRB 3CNNA 3K0FA 2IS4A 4Y0AA 3SHFA 4NL4H 1VIAA 3SU8A 1KJWA 5EP2A 2BMDA 2WJIA 3EZ9A 3LBIA 4MYHA 2WICA 4NYJQ 4A8JB 4M8NE 4Q4JB 4C0JA 2ZJZA 2Q3HA 5DSZA 2LWIA 3PENA 4CVNA 4NCHA 1FW6A 1AGPA 1PV4A 3PEYA 1U2RA 1GM5A 1CU1A 5FOXA 3TKLA 3N70A 2R6FA 4F93B 1OXUA 3DMNA 1NY6A 2GVDC 2C9YA 4PO8A 3FHTA 3RS2A 3BS4A 1T5LA 1ZD8A 1N0VC 1NN5A 2NO1A 4LK2A 2G0NA 3V4RA 3ASYA 3AUXA 5B2ZA 2ZRHA 1Z0KA 1SULA 3CKLA 4DLWA 1ZBDA 2O8EB 4B35A 2RGAA 3U44A 4V0ME 3VR6A 3BH0A 621PA 1CXZA 1GRNA 4U02A 1KY3A 2BEJA 2W0SA 3L0PA 3EARA 1E1QA 1UAAA 3DM9B 3Q9LA 1EFCA 1G16A 2AK2A 4CEJB 1HEIA 3I92A 4XWOA 2IYWA 1DG3A 1JQLB 2XGJA 3NKVA 3CM0A 3K70B 5P21A 3F5FA 2P65A 1OV4A 4L4UA 4UXIA 5FR1A 1KI1A 4BFTA 1YZQA 4MUBA 4BECA 2Q0HA 3D3QA 2FFBA 4QNMA 2OLKA 4YMTA 3N5CA 3I1FA 2VYFA 2IEZA 1G3IA 3TBKA 3ZVMA 1IJEA 1E98A 1W1WA 1XU4A 3WRYC 5FUYA 2VL7A 2RGGA 3R9IA 4DSTA 3EC1A 3OIUA 3QQ5A 1E0KA 2QT1A 4PQRA 2I4IA 2OCYC 2V7QA 2IYQA 4Q7KA 3SYLA 3VKGA 1T91A 521PA 3KXKA 4Q03A 1OT3A 4YLGA 1IXRC 1BYIA 2VSXA 2QY9A 2XSZA 2D62A 4MRRA 3TAUA 2AR7A 4IEIA 5M04A 4AD8A 4A0RA 2FPKA 3ZS8A 2IF2A 1CTQA 4LYHA 3K09A 2DY1A 4P4UA 1NVVR 2CL6X 1Q12A 2WSMA 3P27A 3TVDA 2JASA 3RYTC 3W8RA 4HUQB 4IOLA 5G53C 4BFXA 2JAQA 4IOMA 5LD2C 4WOPA 2NO6A 4URXR 4DSOA 1OXXK 1XEXB 2IEYA 3ICEA 4D0LB 5JFGA 1Q1ZA 4HLCA 2PJZA 1KDTA 4ZKEA 3FKQA 3NC1C 3QXXA 4M9XA 2V4ZA 4JLBA 5EE3A 2REBA 4FMCF 3AVWA 5DI3B 2GJAA 4GFDA 4HUTA 1IHUA 1GL9B 1T8TA 4AURA 5J4LA 1DAFA 1TU3A 4JT4A 4B2LA 3U3OA 2J0VA 1EGAA 5F3WB 4OBEA 2ZRDA 2P6NA 5FL7D 4L5BA 4RY2A 3MD0A 4Q48A 3QBVA 2ZE7A 4RFSA 2FSGA 3FWYA 3VR2A 1UFQA 3IILA 3W5IA 3AP2A 2O8DB 3B9PA 3ZDQA 3TJZA 1KI9A 2PZEA 2QE7A 4EPWA 4ZDKA 4QC2A 4C0AC 1TQ6A 2QPOA 3BBPA 3SFZA 4OHVA 4FXPA 3RSLA 3MJRA 2H16A 2LKCA 2O0KA 3AF3A 5CYPA 1FPMA 1YE8A 4P4SB 4Q4AB 1WDTA 3G5UA 4TYPA 4C0BA 1NSFA 2WVJA 3WNBA 3QKRB 4C7OB 3Q8XB 3PIRA 3VHXA 4EFLA 4JLKA 4PTLA 2J46A 3FDIA 1U8AA 3BWDD 4PAMA 3QVVA 3VU9B 1D2MA 4JBXA 5DYGA 1Q44A 4JZKA 5EP3A 4V0LA 4HYYA 5J47A 3AVQA 1E2LA 1W2HA 1DARA 1M7GA 3AF2A 4DLZA 4FMDB 2HYIC 5KU1A 1HTWA 1YRBA 4POAA 2GEDA 4DJTA 2P5SA 3QVUA 4LJ6A 2J0QA 4JSYA 2P6UA 5FOVA 4PPQA 2G9NA 4LHZA 4MITA 2DFNA 1K5GA 2G0TA 4MA4A 4JMPA 1CJVC 3AKCA 1QZXA 1A82A 3KXIA 1E9BA 1KMHA 2MSCB 1IXSB 2NGRA 2WM9B 4Z1MD 3KFVA 4P4TA 4Q5IA 5FH9A 3MUFA 1JXMA 4PAOA 4E03A 3EWAA 3CRW1 5H1YA 3B1VA 2FWRA 1NVWQ 1F48A 1M6NA 1L7VC 1W47A 4B73A 2FGKA 3GLGE 3UKDA 1XEWY 1VYVA 821PA 3TH5A 1IY2A 4QFMA 1TADA 1OFUX 4Q00A 1RRFA 3P32A 3LW8A 5HCIA 3H2YA 5FOSA 2ODBA 3PV0A 4A8JC 1W4AA 4EQ6A 3PEWA 5IK2A 1ZRHA 2NO9A 3IO3A 1VECA 2NO7A 1Q3TA 4DLTA 1K8RA 4MKIA 2ZJYA 4Q9JA 4O25A 3QENA 5TY0A 2QN6A 5LBIA 2IXFA 5F2EA 2HLDD 5J40A 5K8TA 4PPGA 1T8UA 1GKIA 1HE8B 3VNVA 1AK2A 4IW3B 1KK3A 1YR8A 1KZ7B 3CRMA 5E4FA 3RWMB 3JZAA 2F6RA 1VG8A 3VQTA 1YRAA 2FU5C 3FMFA 1U98A 4BWYA 1FFHA 4YMVA 1ZM3A 2EFEB 1SXJD 1FMLA 2GXQA 5SZKB 4IVPA 3GEEA 4IFBA 1N0UA 3QXHA 3NDPA 2IA5A 4ARZB 5AR1A 3MWYW 3CZPA 3CRRA 2GZDA 2XITA 5BN5A 4ILEA 2OO7A 3Q7PA 4ZV4A 1GFIA 2WV9A 4LHXA 1S4QA 4R2IA 3TR0A 3KQUA 1I4LD 4LUCA 4W9MC 5KDOA 1OH8A 4I81A 3I61A 2GCOA 2GK6A 2XAUA 3L2OB 3PR1A 5JI3E 2CHQA 4GP7A 3WMGA 1W0KD 1E6CA 1R0ZA 3K70C 2GETA 2ORVA 4LJ5A 4Q4LA 4YXWD 4ERNA 3L8ZA 4IOKA 1LTQA 2ZR0A 1T3HA 4IKEA 1UDXA 4UNPA 2IYLD 2DB3A 1W46A 5FBQB 1LB1B 4BASA 3SS8A 1Q21A 2Z4SA 4PHHA 1XFAA 1E2PA 3GLHA 1AN0A 5IK2D 3K0EA 4IDNA 1S8FA 2BDTA 5BN4A 1KY2A 1U9IC 2HXSA 4OI1A 3PEVA 2QMUA 1E0SA 4URVR 3EC2A 3GLFB 2PX0A 3U7GA 4XD7D 3QBTA 3UXMA 3AF4A 5AUOB 3LY5A 4M4SA 3KQHA 4LJAA 2YWFA 3GMTA 2BJVA 4JLPA 4LYFA 4X8HA 4HLUA 5JSZA 2R44A 4JLJA 1Y3AA 2ZJBA 3QIAA 4QGAA 4O3MA 1RJ9A 4LDJA 2W2VA 1EX7A 3WYGA 2IS2A 1PLJA 3KKPA 4PZYA 2XJ4A 1Z28A 2X77A 4F38A 2R6AA 1ZD1A 5JRZA 5FBLB 3CWZA 1HV8A 4IDPA 1SVSA 4LJ9A 5BXQC 3RC8A 4L9WA 1KI7A 3ZVLA 1M7HA 1R0YA 1TNDA 4US0R 3A8TA 2IYRA 5FPYA 4FINA 2RGBA 4XTRA 5HKKA 3C5CA 4JBWA 4Q4HB 1U94A 4ZO4A 1OKKD 3U7HB 1WQ1R 4D6PA 1OFTA 5TARA 1OSNA 1GG2A 1BYUA 1KI2A 2C8VA 3DZDA 1JBKA 3IGFA 2Z5FA 3RVBA 4CZ2A 2XB2A 2WIAA 3T1TA 1E2NA 3N2EA 4EJSA 3I4LA 4Q4JA 5DH9A 2ZITA 1G8FA 4PXAA 1SVIA 1JEDA 2IXEA 3OAAA 3LLUA 5FBWB 1DS6A 2NO0A 1XMIA 5A4JA 3QJYA 1OH5A 2EWVA 3UMFA 1ZW6A 1G64A 4QXAA 5GVRA 4JLNA 1P61B 1G5PA 2XNSA 2ZSAA 1UPTA 2F1JA 1E2EA 2CK3D 4DEXA 1S1CA 2ZI6A 2P3SA 1TAGA 4X8OA 5J4VA 3DKPA 2C98A 1TU4A 4TQUS 3UWKA 5CB6A 1F2UA 5EE9A 4E5UA 2FGJA 1GWNA 5KHOC 4EPYA 1HE1C 5GADl 3AVUA 1PZNA 2QP9X 5F98A 1G3QA 1S3GA 4Q1CA 2OZEA 2CL7X 4OK5A 1KK1A 2OAP1 4F7WA 2N46A 1ANKA 4H1UA 4M1OA 2A5DA 3U3MA 4NU0A 4LHVA 1NVVQ 2GF9A 5EE0A 1TQ4A 1RE0A 3GFPA 2HF8A 5E7MA 3NWJA 1G7RA 1OYYA 1ZNWA 4MRVA 4G5OA 1E0AA 3OF5A 3U7FB 2OCPA 3IIJA 3CNOA 2A5YB 4NKRA 1ZC4A 3AQ4A 4URYR 4XSHA 2XXAA 4OI2A 5HKKD 3IBGA 1E96A 5FR2A 4ASUA 3VX3A 4BZXA 3B7GA 4TLAA 2PT5A 1G19A 3DMDA 3BJIC 3KFXA 1Z6AA 1E9EA 2BMJA 2F1IA 3IDQA 4BLSA 2VHQA 1U9IA 4FW9A 3FFBA 4RVCA 3LO5A 1RRPA 4M9QA 2V3CC 2AKYA 2IK8A 2WJYA 3MLEA 3NH9A 4PSKA 2C99A 2ZYTX 4NYMR 1GZSA 1T9HA 1QHIA 4BLQA 4B34A 5EZ6B 1HUQA 1P75A 1CRQA 4DDTA 1W44A 3I72A 4MH0R 4PPFA 1EFRA 1C1YA 1RIFA 4RD3A 2CEAA 4HAYA 1U8ZA 3C5HA 4IXMA 3G0HA 2H8KA 1GRQA 3OIWA 4AK9A 5C46F 2LKDA 2NZJA 1CIPA 2FEOA 3U2QA 2EFHB 3IQWA 4QGHA 2ZETA 1UM8A 4X8LA 1KJZA 4YMWA 4DIEA 3U7EB 1N3BA 2FFHA 1R2QA 1UEJA 1HT2E 2IW3A 4M21A 2ZIAA 3FHOA 2ZE5A 3TIFA 2O0JA 2YJTD 3I8XA 1JJVA 4ACAA 4V0MA 1KAOA 1R4AA 2BCJQ 3RAPR 1XEXA 3THYB 5JJIA 1EFUA 2YC4C 1ZINA 2VHUA 2IYUA 1GILA 1OIXA 4LZZA 4JVNA 2WWGA 4DLUA 2IX3A 4ESHA 2PX3A 3AB3A 1VPLA 2C95A 2HEIA 4RZ2A 4B33A 4M1TA 5DI3A 4QJ5A 3SBEA 1A1VA 1RZ3A 4DLYA 1XTJA 4O0MA 2E87A 4LBVA 1QVRA 3KDSE 4OK3A 4ACBA 2KWIA 2Z4RA 4G5QA 4KVAA 5F9HA 1XXHE 3IQXA 3WRXC 4DIDA 4IJMA 2VP2A 4KCGA 1FNNA 3GJ7A 1OHHA 5C2JB 2ZSDA 3ZJYA 4R7ZA 2J5XA 1E2MA 3WNDA 4A2WA 2PEYA 1QRAA 3K9GA 4BRWA 4TLEA 1ZM9A 4M1SA 1HA3A 1G18A 1BS1A 1Z6YA 2ZU6A 1ZM4A 4P4SA 421PA 4DRZA 1GVNB 4WAUA 3QE0A 2BJWA 2JDIA 2QP3A 1JR3E 1RPZA 5HE9A 3E70C 3HU1A 4CRWB 1UBEA 3WBKA 2XTZA 1AJEA 3S1AB 3VU9A 1AZTA 1KKLA 2Q3FA 2WJHA 3GD7A 2ZRGA 4OHWA 3OFNA 4MKGA 4Q7JB 5J4KA 3JVVA 4FD2A 1C9KA 1FUUA 4V0OA 1QHHB 4DLXA 2FZ4A 4D25A 4W5HA 1R5BA 3SE0A 3B6EA 4II7A 4DCVA 2O8BA 4B3XA 1E94E 2FDCA 4P0TA 2IWHA 3PEUA 2O8CB 2IYTA 5E7JA 5FI0B 3RHFA 3QI2A 1G3UA 2TMKA 3EXAA 1T0HB 1X8JA 3AH8A 2QMHA 1QDEA 4AYTA 1P6XA 3TLXA 3EPHA 4TYYA 3GEHA 4PQYA 5BYKA 2YWGA 3DEFA 1KTVA 2O0HA 4FWTA 3WYFA 4HEJA 3BK7A 1NY5A 3CF6R 4KLZA 4KV9A 1XP8A 1E9AA 4DC9A 1VHTA 2BWJA 1I2MA 4XSGA 1XBTA 4GMDA 3OEED 1E9DA 2D74A 1E9RA 1U81A 1G291 1XD9A 2UZIR 1QHNA 3K0AB 5AJWA 1R8SA 1SKYB 4MQBA 5JEEA 1OHHD 1II8B 1M1YE 3I8SA 3W90A 2FG5A 5LDDC 3UWOA 1G21E 2KE5A 2VP9A 2HDNB 3P4YA 3C4JA 2JIZD 4GP6A 1ZCBA 3THWA 3MCAA 1YU9A 2PBRA 3T61A 3TQFA 1NMXA 2VO1A 2X8AA 1ZMXA 4ZPXA 2QAGA 3SQWA 4S2EA 1PUJA 2KBFA 1KI4A 1W4RA 4LBYA 4IEEA 5EXXA 2JDID 1T6NA 1Z07A 1W5SA 2HUPA 5KPDA 4C2TA 1ESMA 1FNMA 4CT4B 4A92A 1JJ7A 3U6BA 3THXA 2B92A 2GZHA 4GT1A 1TPZA 5DNYB 2DFLA 4LC1A 3E1SA 1AKEA 3LQRA 1A5TA 2JJ2D 3GJ8A 1XTRA 2B8TA 3ZD7A 3DVLA 1XTQA 2VSOA 2A78A 2IUUA 3HU2A 1Z08A 2QGZA 1Z47A 3BRWD 4B3CA 3D8BA 4B3DA 4IRUB 5HZKA 1N25A 4PHTA 3B9QA 3M1IA 1NBMD 4I1VA 5D3QA 2HJGA 2OSBA 3ADKA 3CX6A 2GBLC 3EZ6A 1N6LA 4CIDA 4MRPA 2P6RA 2D2EA 2OM2A 3DKVA 4CEHB 1ZNZA 1OLOA 2ATVA 4KXFB 5E95A 3VR3A 4US2R 2XNDA 5LB2A 4AG5A 1NP6A 2JJ1D 3SYNA 3VR5A 1JECA 4ZIRA 1W4CA 4YDHB 1T4GA 3ADCA 3FFAA 3OESA 1NG9A 4BRUA 4WZ6A 3GLGA 1XMJA 4PANA 3CIOA 3IEUA 4NE2A 4K46A 1MO4A 3AGPA 4PC2A 5JECA 3U4QB 3WP1B 2REOA 3P26A 1OB5A 3HP1A 1G3MA 4URWR 4A4DA 1KGDA 2YVUA 2ZI7A 1G8HA 1YZGA 3Q3JB 2WAYA 1XWIA 2XOKA 3VKHA 2IYVA 3EIHA 3TW8B 4HLDA 1AS0A 2EYUA 5FUWA 2Q9CA 1I4DD 2EW1A 1N6IA 2GNOA 1CP2A 1N5KA 2FFQA 2ZRCA 1XCPA 4TN1A 1E9CA 1VDZA 1G8PA 1WRBA 4UJ5A 4UJ3A 1DAGA 3E2IA 4JJKA 1XZQA 4TSFD 1D9ZA 1E2HA 2CLSA 5CIWA 4DDWA 3VNUA 2YV5A 2C96A 3CRVA 3IPXA 2KSQA 3WMEA 2NG1A 2CDNA 4YC7A 1BKDR 1NLFA 2ZRKA 1MR3F 1M2OB 2OILA 1W36D 5EE1A 2HF9A 3NDBB 5AUNB 1P2UA 3LXRA 4RFVA 5KUTA 5LB4A 3ZQJA 4Q4HA 3HDTA 2H17A 1L8QA 1N2CE 1NN0A 3GQBA 4I1UA 4DUGD 5J4YA 3EX7C 4Q7MB 5SZJA 3AVTA 4DVGA 5KYKA 1UEIA 1N5IA 4XWAA 3ZVNA 2VPPA 3Q72A 3HWSA 2NPIA 5JJLA 3MFYA 4R9UC 4ITRC 4JS0A 1FZQA 4JLDA 5G40A 2C04A 1GL7A 3CB4A 4AG6A 1XB2A 3R9WA 2UZ3A 2QSYA 1NVXQ 2CNWA 2VP5A 1PLKA 3WY9A 1AA9A 3DOEA 4KLNA 2RHDA 3FMOB 1CF4A 2ZJOA 3TSOA 3I5XA 4AKEA 4LWZA 2Q6TA 4Q01A 2ZXUA 2GK7A 4ZCIA 2IHBA 5FL3A 2X2EA 2ERXA 3SJZA 5L8VA 1F2TB 2GXUA 1U0JA 1N0WA 3T1QA 5DN6A 4NYMQ 1UKZA 2F1RA 5DISB 4DT1B 4TZ6A 1KI8A 4MYUA 3QEJA 3H84A 1IOZA 1RRCA 1ZP6A 1TEVA 2VF8A 4HZUA 4HAWA 3FPAA 5JI2E 2QM7A 1DE0A 3M6AA 3SOPA 2IF0A 3EIQA 4C9BA 2BOVA 2P0EA 1JEEA 3FHCB 1D9XA 1KDOA 3K0SA 4HB0A 3V9PA 5JHGB 1KK2A 1KO1A 4MYCA 3A6PC 1R5NA 3EA0A 1ZNYA 2ZS8A 5DI9A 2D7CA 3W3AA 4PC1A 2GBLA 2RGNC 2O52A 1ZNXA 2YINC 1D5CA 1G8YA 1G7SA 3Q85A 2G3YA 4C0QC 3BFXA 1E1QD 1G6OA 1VG1A 2RGXA 4BE7B 4CGZA 2OBLA 3GLIB 4OL0A 4NP6A 2ZE6A 2CCGA 3FTQA 3U6KA 3CH4B 4MGZR 2O8FB 2ZJ2A 1ONBA 5A0FA 2F7SA 1CBUA 2R6CA 3C7KA 2ZUCA 4A0FA 4DLRA 2H7VA 2VHCA 2GEUA 3AP1A 4XTCS 3VHLB 4DCTA 4QBHA 5KPJA 2NMVA 3EPLA 4JLAA 2RMKA 1MH1A 1GL6A 4C3ZA 2MSDB 3CX8A 3N2IA 2FZLA 3R7WA 4B76A 1DBSA 3P1JA 2J45A 1KI6A 5KNBA 3A4MA 1CS4C 2WPDA 2Z6VA 2EQBA 3B5JA 4FCTA 5GVSA 2PL3A 2ASEA 1JNYA 4QL3A 1E2KA 5L3VA 2GTPA 1B0UA 2AXPA 2V7QD 3QKUA 4G5SA 3EZFA 3A4NA 3PVSA 4D4KA 5DN6D 1W2GA 1F6BA 1IONA 2KBEA 2BM0A 4ZKDA 4B3GA 3BH6A 1ELOA 1SKQA 3GJXC 4GOJA 2XSZD 1H65A 3L82B 4O2LA 3CWQA 1UKEA 1N6HA 4V02A 5H70A 3NXSA 3U5ZB 3WYAA 3OZXA 1L2TA 3LV8A 4PFSA 1IM2A 2H92A 2HXYA 1H8HA 4NTZA 1IBRA 2ZTSA 3KJIA 3L0SA 4FMDF 4E09A 5FTKA 5KSOA 3C14C 1IN5A 3AV0B 4DB2A 4JLMA 2W2TA 3CONA 1P73A 2EVWX 4EUNA 4GZMA 1V5WA 1OFIA 3CLVA 3GJ0A 4QOSA 1EXMA 3LVRE 5K8IA 1FTNA 2ODEA 4MGKR 1NVUQ 2J0SA 3VFDA 2GILA 4Q18A 5EXSA 2CXXA 3EAQA 4XVQA 4GOKA 3LA6A 2QU8A 2IT1A 1G7CA 2C9CA 4HB4A 1GAJA 4JIMA 5EZ5A 4NBSA 3RWOA 3QF7A 2GJSA 1GTVA 2Z43A 4B75A 4MYTA 2J7PA 2WJGA 3MMPA 2QNRA 4LY6A 2WWYA 1NN1A 3KQLA 1XNJA 1NL3A 3NBFA 3U3RA 4G5GA 3BORA 2RCNA 2JLUA 1KMQA 1F5NA 1X86B 1GP2A 5B30A 5BN3A 1PLLA 3GLFE 2QE7D 2CJWA 2IWRA 4FCVA 1OPXA 4HAUA 1Z6XA 4M9ZA 2F9MA 2GJ9A 2GJ8A 1W0JA 2J0UB 2AFHE 3ZGXA 4CEIA 4TQ9A 1J70A 4ZDJA 4TLBA 1HH4A 1Z0JA 3I73A 4KFTA 2PT7A 5AJVB 3WBJA 5IF9A 2ZRNA 3PUWA 2DPXA 4R2HA 3RNLA 1DPFA 3C8UA 4JL8A 2IC5A 2F43A 4DLVA 2WWXA 1KOFA 2ZPTX 3Q5EA 4M0LA 2O8CA 5JS8A 4WXPA 3LVQE 1XCMA 3U3JA 2ZJAA 2R8RA 4RCYA 4S35A 4TT3A 2ZS7A 3SBDA 4OQLA 2XTNA 4HDOB 4PSVA 3ECCA 3KTAB 2YNMA 2YHSA 1N6PA 2GESA 3ADDA 2G1JA 1T3LA 5EE5B 1VYTA 2V1UA 5JRJA 1XJ0A 1KO5A 4HLQB 3AVYA 2AN9A 2OCAA 2VHTA 2HV8A 3QXCA 5DYIA 4KYUA 1KSJA 3W8NA 5HCNA 3W3ZB 5J5CA 3LRPA 4PZLA 2VEDA 1DADA 2FMXA 3HYTA 1DELA 2OLJA 3GEIA 2ZUDA 2AK3A 1PVOA 3DDCA 3W34A 5AWFC 1XXHA 1JI0A 2QT0A 3NIBA 3RC3A 2WOOA 1OE0A 1LW7A 2WHXA 5JWRA 2BBSA 2J7PD 2JLVA 1DG1G 3ZIAA 3TMKA 1ZIOA 2A5FA 4PHGA 3VR4A 3ZQ6A 5C4MA 3PG5A 1FX0B 1E2IA 2Q21A 1W0JD 3J81k 5CK5A 2OBMA 3FOZA 3LAWA 1A7JA 2OXRA 2VH5R 2PH1A 4MGYR 3RANA 1XD2A 5CB8A 4C2UA 2BV3A 2XZOA 1JR3A 3IIMA 4BFUA 4R71A 3AM1A 5JJKA 4LJ8A 1XX6A 3K0FB 4WZAE 3LLMA 1LV7A 2QTFA 3SC3A 4D80A 2BKUA 5FPHA 4IDOA 1UJ2A 3EASA 4QGGA 3KQNA 5L3QA 2ANCA 4PHFA 1S96A 1ZIPA 4YONB 3L0OA 3EW9A 3TAHA 1VCIA 2WWIA 1YZKA 1E2DA 4WZBE 3B1WA 3GJ4A 1US8A 3B60A 4LC0A 4RCZA 5L3SA 4A2PA 1DVRA 5KTYA 2ZR7A 1FQKA 3O8DA 2Q9BA 2W58A 4LBZA 3X1DA 4YMUA 4DSUA 1S1MA 4CEHA 5TXGA 4KFSA 1Z2CA 2ZAOA 2A2ZA 2QQ0A 3NBXX 2A9KA 4HZIA 4WBSA 3LD9A 3R9XA 1J8MF 1CJTC 4A8JA 2PCLA 2V9PA 5DHFA 5G3ZA 1LF0A 3I5YA 1PJRA 4BLRA 3TGPA 4RZXA 1WA5A 3U4QA 3U44B 3NC0C 3RLFA 1W48A 4PQFA 2P67A 5JWOA 1ZUIA 3RRYA 4BQSA 4C0LA 5G41A 1VCMA 1OXVA 4JL6A 3IEVA 4TL7A 4TZ0A 2B8WA 4C30A 4GBMA 2ZVQX 3WMFA 2XX3A 1HQYE 1KNQA 1Z5ZA 5FPKA 3CW2A 1JXOA 3SN6A 1E79A 4A6PA 1JAHA 1GKUB 5D3MB 4OQFA 3B1ZA 4U7DA 5C1BA 2CLDX 4TMZA 4E22A 2WMNB 2ZE8A 2FSFA 3LX8A 2ODWA 5IDVA 2FOLA 4EIWA 4KFUA 3UPUA 1CKEA 1RYFA 2ZYUX 2C77A 4XWKA 3V4FA 2CBZA 2VA8A 4AWXA 4WXRA 2QRNA 2VIIA 4A9AA 1YVDA 1D8TA 4D2IA 2O8EA 4PC3A 1XZPA 1S2MA 1M7BA 1BH2A 4Q9IA 4I1SA 3PXGA 1AQUA 1OIWA 4BFYA 4KODA 5AUPB 2JLYA 2ODNA 1JPJA 3DOFA 1P4SA 1MOZA 1YZUA 3PUYA 4CEJA 3QSYA 2KJQA 1JQJC 4TL9A 3BB4A 2AL7A 3U3KA 3M0EA 2FA9A 1KO7A 3KB2A 1BMFA 4HI0E 3F0TA 2JLSA 3O47A 4Q9HA 1DAIA 2ZYWX 4JLVA 1U0HC 2PMKA 4DBLC 1N6RA 4LOAA 2FX3A 2D2FA 3PITA 1ZYUA 1XF9A 1BOFA 4PR0A 3PQCA 3TSWA 4ZDWA 1E2JA 4B71A 2ORIA 5KDDA 2ZS9A 3TUJC 1YR6A 3RRNA 1Z06A 4CF7A 2QG6A 4XIGS 5C18A 3CX7A 2GHIA 4M1MA 4OQMA 1XJCA 2V1XA 4TMWA 3AVXA 1IY0A 4PO9A 3A1UA 3OAAD 4OJQA 4JL5A 4URUR 2OXCA 4NCJA 2FNAA 2QMEA 4QG7A 4DSNA 2I1QA 3IHLA 4EPRA 2VTKA 2H1LA 2R2AA 3D6TB 4NCNA 4P33A 2DFTA 2EYQA 3AF1A 4TMTA 2CE2X 2JLQA 4KVGA 1AS2A 3UATA 2F3TA 2AXNA 3MJHA 1TQDA 1S9DA 3BERA 4BEBA 3ASZA 3MG9A 5FPSA 1G9XA 1DAKA 2QI9C 3ZS9A 4A2QA 1MT0A 2Z0MA 3GP8A 2MMCA 3AVOA 1GUAA 2XZPA 4A6XA 1UADA 3P4XA 4HUQA 5IHPA 3AVPA 2RGCA 1UBGA 3V00A 4P32A 1SVOA 4RJLA 3LWNA 2BHRA 3CPJB 4GSYA 2HT6A 4TMVA 3TRFA 2GXAA 3T15A 2LCFA 3C41J 1RW4A 4N3NA 3VAAA 4OHYA 4KI0A 1IN7A 2RKOA 3K70D 1XMVA 5GJVC 2UKDA 3DPUA 4JSTA 5EUMA 2OE2A 3CR8A 2QUZA 3WHLA 1QVAA 2CCKA 1AZSC 4V0NA 1P3JA 4ASUD 3NBYC 1SKYE 2NOAA 2ZM5A 2VBCA 1SHZA 1II9A 5FTJA 3BAFA 1KO4A 4AY2A 2WJJA 2G1KA 3EPKA 1SXJB 2RAPA 2O8DA 3KJEA 2L0XA 3CR7A 5EXTA 2B6HA 1OIVA 1TF5A 1TEXA 2AKAB 2FPLA 1QBKC 1Q57A 1H8EA 1FOEB 2W83A 2YOGA 1CEEA 4EAQA 3T06B 4RD1A 4BFVA 1IJFA 2BKEA 5EXPA 4C0SA 2VP0A 4Q4AA 1EFRD 1RVDA 2WWHA 3B1XA 1YR9A 4TL8A 4C7OA 3ZD6A 3QKRA 5DIFA 1FMJA 2Q9AA 2ZRMA 5E3HA 4ZI2A 3DZ8A 2ZI5A 2CHGA 2NTYC 2ONKA 1XJQA 3X1WA 3QG5A 1GNQA 2BMFA 1NIPA 2OV2A 2RGEA 2V6IA 1E1RA 2V6JA 1FTSA 4M1YA 4G01B 2ZAMA 3H86A 1LF5A 4HDCA 4MRSA 3TR5A 1IAQA 2ZRPA 2GAAA 5CITA 2W6JA 1JR6A 1KSHA 4FWIB 1P9RA 2IS6A 3AKDA 3CNLA 5CDFE 1FP7A 1O3YA 3SJBA 4EQ6B 2OEPA 3CBQA 3KKOA 4JVLA 1XTIA 1T5IA 2IUSA 3D7MA 2YZ2A 3IBYA 4H1VA 1Q22A 4NCKA 1Z0DA 4LRWA 1IQPA 3FMIA 3AP3A 3E5HA 2B21A 2FJUA 3BFKA 1NMZA 3H4MA 4BFSA 3A4LA 2J87A 1DTSA 2QPTA 3RS5A 4F4CA 5EJEA 2PMDA 2ZRIA 4GPTA 2PCJA 4KITB 1P9NA 1ZCAA 5HR5A 2WSSA 3BFVA 2OUKA 3WP0A 1AGRA 3VR1A 2Y8EA 4WVFA 3MAAC 4UKDA 2YWHA 3CPHA 1EX6A 3W5JA 3OE7A 4PZZA 5CJPA 4X8MA 3LBHA 1QHGA 1KDPA 3TW4A 5F9FA 4HAZA 1VIYA 2ZEJA 3SR0A 2OFXA 4OJKA 1Z83A 4W5WA 1P62B 2GCOB 1R10A 3NBZC 1NJGA 2QA5A 1IY1A 5AUQA 4IOJA 3R8FA 4A0GA 1ZJ6A 4US1R 221PA 3RS3A 5EQTA 1T0JB 1QHYA 1HY3A 3WNCA 2EFGA 3NH6A 4EFMA 1R5OA 2G77B 1UKVY 3OFND 4Q66C 1LNZA 2HCJB 2YC2C 4OHXA 5EP4A 4NCIA 3SJAA 2P2LA 1Q1BA 5HPYB 4YMSA 2PZGA 2ZI9A 2AD5A 3NEYA 4HAXA 2O5VA 4ARZA 1E99A 1VG0B 2H18A 2I3BA 4UXHA 4DEYA 2C2HA 4M2LA 1KAGA 1AS3A 4KSCA 4BPBA 3GLHB 4PX9A 4OKSA 1W49A 2R65A 4BLTA 4KU4A 1GDDA 5CLQA 4BFZA 3NTUA 1E2FA 4DHEA 2QGNA 1ZM2A 2EU8A 3SFVA 2W2XA 4KJZA 3EPJA 1NG1A 3HU3A 1U90A 4QNRA 3SNHA 3IHWA 1UBFA 1U99A 5BW8A 3IIKA 1EFHA 1TF2A 4OI4A 2WMOB 1E69A 3QNUA 4AKIA 1RJ9B 4Z51A 1YZTA 3ZVRA 1QF9A 1OJLA 2WKPA 2JLWA 3HJNA 1VKJA 3JVUA 4A1FA 1ZC3A 3AKEA 3F8TA 3KKMA 3ND8A 4BLOA 1LS6A 2IUTA 2WOJA 3FVQA 3ONWA 2VP4A 5L3RA 5JMTA 5FOTA 1WBBA 4ZDIA 4LJYA 3RS4A 1NIJA 3GLFA 3TUZC 4ZCLA 1CULC 2VF7A 1P60A 4AYXA 2VSFA 2H5EA 1G17A 1TQ2A 2GCPA 4DDVA 4BUJA 3T5GA 1X3SA 4IVRA 3P20A 1R6BX 2H57A 1GSIA 2BM1A 4BZPA 1TF7A 3I3SR 4UNRA 3BE4A 1GITA 4OQXA 1DAEA 2ZSBA 3B2EA 5TDHA 1NRJB 4EJSB 2F9LA 3JZMA 4NONA 2FPMA 2EFCB 3QUSA 4DXAA 4DDUA 2A3RA 4CDGA 4HB2A 2AFIE 2YWEA 3EIEA 4LV5B 4PAQA 4G0NA 3H1TA 1S0UA 3IO5A 3GLIE 2YOFA 2WIBA 1R7RA 2V54A 3QPWA 4CT5A 4K8OA 1P2SA 4ABYA 3T34A 4BLPA 3RSOA 1YQTA 2GEVA 3K8YA 4FMBB 4HB3A 1NNEA 2WAXA 1D6JA 2GA8A 1TL7C 2VLIA 4AKGA 1M8PA 1F2UB 2GZAA 1OH7A 3A1VA 4LHYA 2JA1A 2HT1A 2CL0X 2N1BA 2R6GA 1IN4A 1G3RA 4F4JA 1K5DA 3PUXA 2FH5B 3QKSB 4F92B 1R0XA 4P31A 3QOFA 2ZJ5A 4CYMA 1WP9A 2XNDD 5BWMA 4YQFA 3BIFA 3LFUA 1HURA 2HJVA 2R62A 2QL6A 4KBGA 4LCBA 1Z0FA 4TWZA 4A36A 3LQQA 2ZI3A 3CF2A 1SXJC 2BIFA 3DO6A 2ZRFA 3SEAA 4U00A 1Q1EA 2NPFA 2J3EA 2ZVPX 1X8LA 1ZUHA 5D3MA 2CVFA 2FFAA 1N5JA 2XXAB 3SJCA 4WA7A 4XJXA 2CHVA 5B64A 4ZI3A 4D4LA 2G88A 2XOKD 1J2JA 1N6KA 2HYDA 1DO0A 1KSFX 3WXMA 2DWQA 2MMGA 4AC9A 4KBFA 3A1WA 4QKQA 2WBLC 4RD0A 2KB0A 4Z8YA 5FL7A 2IHYA 1S9HA 2GKSA 4PC6A 2W6IA 3VTKA 2BBWA 1ZUNB 3HR7A 3ZZ0A 3C16C 4EPTA 3FYHA 1A2KC 1ZAKA 2ORWA 2ZREA 3M4YA 4DLSA 4JLOA 1TUEA 5KSYA 5TMPA 2A5JA 1ZM7A 1L4YA 1P5ZB 3RS0A 1LY1A 3KB1A 3X1XA 4Q1AA 4KFRA 5JHHB 4QBFA 2CCJA 3IUYA 4BGDA 4FI3C 1XPOA 5J4HA 1G5RA 3LDAA 3PCRB 3O8BA 4V03A 4MGIR 2IS1A 5AK0A 1IN6A 1CR1A 4B43A 1E2QA 3GJ3A 2QRZA 1SQ5A 2IYZA 3NG1A 4QHTA 2JJ8A 4P3YA 4BEJA 2VRWA 1KO8A 4ON9A 3QEOA 4LJ4A 4QHSA 3A36A 1QHSA 3B13B 1OXSC 3MGCA 4LGMA 2CNWD 4PC7A 5DO9A 2DR3A 4HSEA 3NHBA 2ZI4A 4NYIR 3UG6A 3TQCA 3T1OA 1NBME 2C5LA 1Z8FA 4QM6A 1SGWA 2Q3MA 4FMCB 4DCUA 3EG5A 2JCSA 4IDHA 4Z1MA 5FFMA 4MUAA 4F91B 2NIPA 4MDFA 1GIAA 5FUVA 4CW7A 2CE7A 4RSGA 3QF4B 1V43A 3T1VA 5HZHA 1LFDB 2JATA 2B7CA 4TTRA 2EWWA 4GZLA 5SZHB 3FKSA 3KZ1E 5CK4A 2ZRJA 4NPHA 3O8RA 1RFLA 2W6ID 4LV8B 1TUIA 4DCNA 4HAVA 3BH7A 3GPLA 4RD4A 3LX5A 1NF3A 3THYA 1J8YF 3FB4A 4R98A 1VYUA 4MKHA 4WW0A 2OCBA 1CRPA 5CM9C 3AEZA 1IXZA 1RRGA 2QROA 1JB1A 1U0LA 1NN3A 4I1OA 4LSGA 1N6NA 5KO2A 2HLDA 4MRNA 4M9SA 4B48A 2AX4A 5DE3A 2D7DA 3H0KA 4KYIB 4NMMA 1SVWA 2G83A 5CIQA 5BYJA 2VHJA 2XJ9A 4LI0A 1CJUC 2DFKB 4Q21A 4GI7A 4LJ7A 2ZUBA 1COWA 2D3WA 1SXJA 2IYYA 2X2FA 1UBCA 3BOSA 2GJKA 5FTMA 3THOA 1G1MA 1WBDA 2BEKA 2HCBA 1DOAA 2A30A 3R20A 2RHMA 4HLUC 2O8BB 2NZ8A 4Z8XA 4LHWA 1KDRA 2CLCX 2GCNA 2QBYB 4Q02A 3LXXA 3Q5DA 3QXSA 5FBVB 1Z6GA 2WPDD 2J9RA 4AYWA 2AWOA 4JKIA 3KQKA 1M74A 1XRJA 2YOHA 1XPRA 3A1TA 2OT3B 4IFEA 5DGXA 5EUQB 2DWPA 1Q20A 2PLFA 4NZYA 1W0KA 1NI3A 2AHOA 3LNCA 4M1WA 2GXSA 1Z0AA 4YXWA 3S1AA 4TTPA 1SVLA 4C0KA 2RB4A 3LH5A 4PSAA 4D26A 1QHXA 2ZROA 4O2RA 1CR2A 4GL2A 2V8OA 1QHHA 3FKSD 2MSEB 5GJWC 4B3BA 3A58B 2RGNA 1I4TD 4LX0A 5E7IA 4H9GA 1SHKA 5UKDA 2F55A 2ZANA 2ERYA 4EJSC 3BB3A 3U61B 3U60B 3FMPB 3Q7QA 5H68A 3THWB 1H8HD 4TMXA 2G6BA 1KK0A 4DWJA 1SVMA 2K5UA 1EK0A 5GJCA 2Z83A 4XD7A 4D4JA 3ND9A 1MABB 1OYWA 1CR0A 2QAGB 2QORA 3VX4A 1GNPA 2REXB 4B32A 5IRCD 2XEXA 3HPRA 1HQCA 3W6NA 3NEJA 3OIYA 3IKJA 4N1AA 3AKYA 1U8YA 1YZNA 2C78A 4LYAA 5KSZA 2QENA 3K0AA 2DYKA 2DHRA 4GDFA 1AIPA 1COWD 1X6VA 3TNFA 4KAXA 4JKYA 3PFIA 1G5TA 1KKMA 2QQEA 4KO8A 3THXB 4AKHA 1II8A 1YZLA 1JALA 3GCGA 1FQJA 4DB4A 3KUCA 3MWKA 1E3MA 2C03A 2C9OA 5JLJA 5CLLA 2JLZA 1W36B 4OQNA 2YYZA 1ETUA 1X8KA 4KHZA 4YDSA 4QBGB 5K8UA 2DCUA 4Q47A 4B2IA 5CJ2A 1OKKA 4QRHA 5KSPA 4M22A 2VP6A 1P9WA 5DHAA 4B6EA 4ESVA 4LBWA 3EZ2A 3UK6A 3BB1A 1KJYA 1KNXA 1LS1A 4ZIRB 2D06A 3BXZA 2XTMA 4HATA 4RKEA 1K6MA 5AJXA 5FOUA 3GLGB 1MKYA 4JT2A 4TMKA 5FPTA 3KJHA 4URZR 3T12A 3RRMA 4IDQA 2FV8A 4TT3D 1CJMA 3QPVA 1XTKA 4TQAA 1Y63A 3ZYCA 2CK3A 2F3RA 1HT1E 2OAQ1 4F4IA 5CDFA 3UIEA 1XPUA 2CVHA 1Z3IX 3QKTA 4G1UC 5HE8A 1MRNA 2ZR9A 4OYHA 3WHKA 1EWQA 2ATXA 1Z22A 1WF3A 2W00A 1SZPA 2WWWA 3LBNA 5ELXA 2QSZA 1FP6A 2QPAA 1ZVQA 1J90A 3AUYA 1SVKA 3B1YA 1PUIA 2ZRBA 1I2DA 5FI1B 1Z6TA 2J7KA 4TYNA 3X1ZA 5AJYA 3SI7A 2FF7A 4TTQA 1L4UA 3ZIAD 4QM7A 2J59A 1GRRA 1KSGA 1B23P 3CH5A 4B3FX 3L0IB 2SHKA 1RC8A 1G4AE 1R8QA 2A7QA 4NYJR 3REFA 2ZU0C 2GRJA 2XB4A 1N6OA 2ZSEA 4AI6A 4Q7LA 3W6OA 8OHMA 1JR3D 2RH5A 4EPVA 3CRQA 3LW7A 4ZCMA 2QP4A 4Q1EA 4JYCA 1EESA 1OW3B 1EG7A 1DAMA 4Q19A 2JLXA 1VTKA 4E07A 3CO5A 5FUXA 3QXJA 2PLRA 3L8YA 2BBTA 2YKGA 1E4VA 1GOTA 2W0MA 2BMEA 4L8GA 3B85A 4RD6A 5HTKA 5GJBA 5JCPA 1YJ5A 2IBMA 3KKNA 1UDWA 4JYBA 4FIDA 1MV5A 1G8GA 2WWFA 3MWJA 3QPUA 1OF1A 2F1HA 1ESNA 1VCOA 4B74A 4UNSA 721PA 4L15A 2J41A 4Q1FA 4C0HA 1N5LA 1X1SA 4LPKA 4D82A 1A2BA 3QKSA 4HZUB 2N42A 4UXJA 3NHAA 2DBYA 4IVQA 4BFWA
chains in the Genus database with same CATH superfamily
1VYHA 3MPOA 3Q8WA 4QBIA 2GPJA 3PNSA 2DULA 4QFCA 2FSHA 1NA5A 3OIVA 5T8KC 5B1DA 2OP0A 4M8IA 4JQCA 5BQ3A 3CH7A 4MTCA 1DUSA 1ZU4A 2ES4A 3ZZTA 4HDRB 4YP9A 1JEYB 1Z16A 4V0RA 4J0QA 1NTOA 3DR3A 5GZ3A 3I2JA 1EK6A 4F1WA 4X54A 4Q82A 5KNBH 2VBGA 2X5NA 1UWLA 1C8KA 4XVUA 5TGZA 1Q0SA 2OECA 1USIA 1LK0A 2ZRLA 4K28A 3NUQA 3BWMA 2VNSA 3KPUA 5ALGA 5B4TA 1Z2AA 4L8VA 3SZRA 1V1RB 2A9PA 2BBOA 2LIPA 1R0WA 1U7PA 2OG2A 4XYEA 2RCYA 4TRRA 5AKYA 3NGXA 4DT1A 1ZLYA 4EA6A 5JZSA 3QEBZ 2DG2A 4WKBA 3O4GA 3UAWA 2CXUA 1E79D 2GPYA 3K2EA 4RD2A 3ZWNA 1KYVA 1NONA 3IDSA 4I5FA 1J97A 3T7IA 1UMDA 1B00A 3DE3X 3FETA 4HQLA 4KUEA 3PXUA 1J22A 5AOBA 3CNQS 4DLLA 3DDZX 3NANA 1X39A 4IHQA 5AESA 2IP4A 3IH5A 1VHLA 3QZUA 2DR0A 1EXVA 4EDHA 1EM6A 3O90A 3WADA 4DRYA 4HGQA 2GLTA 2ZYAA 2YWCA 2JGNA 1Z29A 1WXIA 3PWSA 4GWKA 2W6OA 3ICCA 4HNUA 2IBTA 4J16C 1A8UA 4RFSB 4HDQB 1T1SA 2OCKA 4I6EA 4EHAA 5HJ7A 1BVHA 2QEQA 2BFDB 3MGBA 4XOIA 4EW6A 2Z3VA 3MSXA 3Q10A 3I4CA 4TLDA 2QM8A 5G3YA 4ZHQF 5AW3A 1UZUA 5JZ9A 4PLPA 3B82A 4EYOA 1NJFA 1VE7A 2CSUA 2VSYA 4M55A 4TTTS 3ZXIA 1M34E 2GPAA 3J80A 4PN3A 2O8FA 1H1LA 5A5EA 1YHNA 2BLLA 4RJTA 5FO1A 4O8CA 3FCAA 4PPNA 1JRLA 1FBTA 1E5QA 3HI6A 3D31A 4GF5A 3WC4A 1MX3A 1MHPA 5A9SA 2Y9MB 3A3PA 1KI3A 3IJRA 1QHFA 3OOJA 1E7SA 4OLFA 4L4ZA 4O0LA 3ZU3A 5CVTA 3KHTA 4CLRA 4B2PA 1KIMA 3ICPA 5B2FA 5LMCA 4QGFA 1GHTA 1BO6A 2J6IA 4IIBA 5CM8B 2JEOA 3COSA 3V8NA 2VRBA 1D2EA 3GR6A 3OHMA 3PLNA 3G8AA 4PQGA 4N76A 2I65A 4EKDA 2B4QA 1FUIA 4GRAA 2BMVA 1NKSA 1YDEA 3OEHA 4HK4A 4JEMA 4I99A 2CLMB 1Z4OA 2IJGX 1G7TA 5K1ZA 1E9FA 4OV6B 3BE6A 2ZYVX 1G8MA 3TK1A 3KL4A 5ENZA 1TVMA 5C8YF 1DFGA 2X0KA 2QX4A 1W36C 4CQLA 2WJVA 2OM6A 3FLAA 3E82A 2RBEA 2AWNA 4DQXA 2ILTA 3SXUA 4BJHB 3T3EA 5KYXB 4FOOA 1WXQA 3HPQA 2JBAA 4DQVA 2IXGA 1E32A 3DYIA 2OFFA 5SZIA 5KDLA 4CWAA 3CINA 1CR4A 1UIMA 2W7TA 3F90A 1JEQB 4PYOA 1DIAA 4V0KA 4QDZA 2JIZA 1W4BA 4Z54A 2DQKA 3GUUA 3IMEA 4M0CA 2RHHA 4B44A 2PE5A 1J8DA 3GLHE 4G8JA 4LSMA 1QMGA 5LMZA 3BTUA 3GFOA 4CMIA 5CR9A 1YR7A 5B5SA 5BOVA 5FTLA 3I37X 3ZZMA 5K5EA 5EJ7A 1KL7A 4F86A 1I4EB 1L5HB 2OFWA 1ISHA 1LBEA 1AKYA 3K9LA 4W1QA 2O7RA 1M0EA 4LXQA 4CEIB 2EG5A 2PWYA 4ZOLA 4F84A 3G9XA 4FI3F 1RVV1 2BGRA 5LUBA 3MCTA 3UG7A 4Q9AA 4BB0A 1TAHA 5LBUA 1C7FA 1KZGB 1NRWA 2IYXA 2YR0A 2Q1SA 3E8SA 3F3YA 3QY0A 5GM2A 3UFXA 1T1EA 4Q9KA 2UYQA 5DIZA 1C29B 3MGGA 3PFBA 4ZEMA 1RJGA 4O08A 4QJ3A 3K1AB 5KU7A 5KYXA 2ZTLA 4WASA 2JJ2A 1KZ6A 1Q1QA 2XUHA 3ZCRA 2QBYA 3I9V1 5CNKA 3VKVA 4FTWA 4BBJA 1M6HA 3O4IA 5KX5B 4R1TA 4ENTA 2BVNA 4MRAA 1SCDA 3PWTA 3DEIA 3B3JA 1P4HA 1YDMA 4Q1BA 1RT9A 1CVRA 4AUNA 1HYQA 2NVUA 5LQAA 2WHPA 5AKXA 2J0UA 5DBGA 2WKRA 4AROA 5A5GA 3RDPA 1XMSA 1KBQA 1U3VA 2UUOA 3SDZA 5K99A 5DXFA 5BUCA 2HB6A 3OCZA 2H65A 1DBVO 2EZ8A 1BVYF 5IVHA 4CM4B 4LZOA 3SZMA 3KPVA 3GG9A 1B7GO 2E9SA 3N7UA 3QNMA 4Z99A 4CI0B 3UYKA 5IVDA 3P0RA 1AM4D 2R751 1H9BA 3ZH9B 2A4MA 1Y37A 1A9YA 1GQOA 2BT4A 2Q5QA 2VJMB 4PM4A 4DBVO 5JNSA 3HKDA 3JTMA 5IFLA 3QBJA 4EY4A 1Q91A 4B4WA 2W6JD 1J99A 3TI9A 2IV3A 4ZFNA 5B1EA 1SIUA 3PRHA 3FPJA 3L1VA 4O4HF 1NW8A 2QJWA 2WTNA 3QFHA 4GI2A 1FFEA 1OFHA 3HFGA 4CKWB 2R5WA 4TV8A 1JVSA 5ALUA 5ARDA 3WLKX 1Z75A 5AW6A 1MJNA 1JIJA 4M8SA 4TLCA 2PNJA 5IKPA 2V3VA 2AE1A 3FNQA 2NQ2C 1HFWA 2J3LA 3DKKA 3R3JA 4DKXA 2R4UA 3D81A 3K0CA 4QOGA 2OHFA 3C1TA 4DLPA 3ASUA 4GGMX 5SV2A 2WABA 1X7WB 2BSAA 3NBAA 4EFDA 5T4HA 3ITNA 3RYCA 1G4UR 1G9SA 1KDVA 2UAGA 3IAHA 1Y8AA 4KK4A 1M73E 4Y67A 5F9MA 2FF5A 2PX6A 1X7ZB 3ST7A 4G9EA 1A5BB 5JSZB 3WJ2A 5CT9A 1UPUA 2ZULA 3BC1A 4K87A 4NVRA 4ROTA 3BA6A 2YH2A 2WSSD 1NQAO 3L6DA 5EVCA 3KOMA 4DV4B 1J1UA 4X94A 1YCDA 3KV3O 2C7PA 4PTZA 3D6FA 1US8B 1B93A 3NRBA 4FZRA 4TYQA 4MJ3A 4UOZA 3A1SA 6PFKA 2AR0A 2HQRA 3B2NA 5KYUB 3I9KA 5LXTF 1KOJA 3ESXA 4X85A 1JKFA 2HKIA 3H2BA 1UKYA 4P53A 2B69A 3CNNA 2I2WA 2IS4A 2IU6A 4BCCA 1J56A 1JG7A 4FOLA 4NL4H 3HU5A 1VIAA 4JXZA 1Q14A 3EZ9A 4FU0A 1TZJA 3A7DA 3BMOB 5FT9A 1W25A 2Y0EA 2IH5A 2DRIA 3COWA 4C0JA 4EL0A 2Q3HA 4O1IA 2LWIA 1H0RA 1P77A 4OBBA 4CVNA 1IEXA 1AGPA 3JWIA 5ETJA 5EERA 2XRZA 4U2FA 4QJIA 1G21B 1GM5A 2APJA 1P2GA 3D8HA 3DMGA 5FAXA 2H9YA 1ZVMA 3DMNA 4CODB 1SVNA 2C9YA 1VE6A 2Q3JA 3NORA 5J2TF 5HUJA 4BNGA 4PCLA 1QVVA 5BMOA 4JELA 5CCEA 5K8VA 3RS2A 1U3DA 2VPTA 3BS4A 1T5LA 1N0VC 1NJ8A 5CP8A 4F5DA 4PU0A 4QQ8A 3W5DA 3PKIA 2NO1A 3ZHUA 5EJ9A 1CY1A 2EBWA 2PU5A 2VJYA 3V4RA 3ASYA 3AUXA 1C50A 2HIGA 1YRYE 1SULA 1O5OA 3CT4A 2GNPA 2Q0QA 4B35A 3HV2A 2RGAA 1E4OA 3CG4A 1CUBA 4UEWA 1CXZA 621PA 3AHJA 4U02A 1M5TA 5KVCA 4LX8A 4TMFA 4L2IA 4GH5A 1E1QA 3DM9B 5HM8A 5IT4A 1GNSA 3BX1A 1WKBA 1QK3A 2Y66A 3ZY3A 4CQMA 5GGXA 3P2OA 4ZVUA 3NKLA 4NABA 4XWOA 4K9OA 3ACBA 4LYDA 3ZQUA 1O7JA 2XGJA 1JSCA 1W5BA 5P21A 3V7YA 5HVNA 2P65A 3VA7A 4RVOA 3PE4A 2PD3A 5KMGA 2WT9A 4G63A 2WSIA 4E5DA 1DNPA 4KZKA 1XDZA 4BFTA 4CUKA 5CEEA 5C53B 4ZOEA 2VQFB 3OQJA 4S0XA 3D3QA 4NU6A 1BN6A 1PFWA 3ZE8A 2FFBA 5JH7A 3U4HA 1MAHA 3I1FA 1Q7GA 1ML4A 3C7TA 4BJ6A 3TBKA 3ZVMA 5I9TA 4HWRA 2GPNA 1PT8A 3OURA 1E7QA 4OFWA 5C9ZA 1CUHA 2CNBA 1KE1A 1SQGA 1H5QA 1Y89A 1LLCA 2L17A 2YZGA 1NX6A 3H0CA 3IUNA 3KBBA 4H27A 3EC1A 4JA2A 4M60A 4BO8A 1TMGE 4KBYA 1WZUA 3P0HA 2QT1A 2RGRA 2P4UA 3EDCA 1YV9A 3BMCB 3AFMA 2OCYC 4C7KA 4QKQA 5JAMA 5J3JA 4XQ9A 3TRDA 3VKGA 3FG9A 3KXKA 3KPYA 3H5RA 1L3CA 1PZEA 4Q03A 5C5IA 4L22A 4EG6A 1W581 4F3KA 1IXRC 3OLVA 4U39A 2C29D 2VSXA 4ZAWA 2OA0A 2UYYA 2AR7A 3A06A 1GG9A 1JIQA 1PCXA 2B4AA 2NTEA 2REQA 3OE4A 4FS3A 4IEIA 3ZS8A 3FVRA 3QUTA 4M98A 3BE8A 2V4UA 1KQ3A 4P4UA 3AR2A 3OETA 3O83A 3P27A 4BKOA 3RUHA 4WQMA 5GV7A 1U0RA 4KUGA 3GN2A 4NOKA 2OVFA 2EL9A 1KYQA 3B3GA 2I8LA 2I8AA 3GHHA 4RVNA 1NBWB 2QYTA 3LDFA 3O5AA 5BNIA 4URXR 1BMTA 4YASA 3QM1A 1OXXK 5L9AA 2DPYA 2EX1A 2E85A 2IEYA 2P5YA 4HLCA 4ZKEA 4LDZA 4F4HA 4H7JA 4IINA 4RL4A 1Z74A 5IX8A 3F73A 3E3OA 2V4ZA 5EE3A 3CXUA 3RC7A 4QYMA 1W1UA 1UOEA 3OTGA 3IV7A 3FWZA 4H08A 5AHWA 3MWFA 1RIIA 3HDYA 3ZKWA 2F64A 3NGLA 3B51X 3QFTA 4G0PA 5IPFA 1X2BA 2IPAB 1A96A 1OZAA 2Z56A 4B2LA 2VYNA 4JGBA 1S01A 3ETHA 3KEOA 5HRCA 2GM4A 3ZLBA 2H63A 1GN8A 3U17A 1CEXA 2ZRDA 5F3WB 3ANXA 2P6NA 3V4LA 3O31A 3QBVA 3HCBA 5IMBA 5JDCC 2FDXA 3AP2A 1TJYA 4Q3KA 5I7FA 3ZUPA 2GD6A 2O8DB 1P9OA 4BTVA 2DPMA 3TJZA 4INJA 2PZEA 5HIKA 1LK7A 4QC2A 5ALXA 2NVWA 1IM8A 5D7NA 4TV9B 4GM1A 1P5JA 5FA8A 2B94A 4FXPA 3RSLA 4B4VA 3HUFA 4XCVA 4H0NA 1EFDN 3JTEA 1EVQA 2PU7A 1B8VA 4Q4AB 2OPHA 4K9KA 3I12A 2WVJA 4C7OB 1JT9A 3WNBA 1E3TA 2MHCA 3WLAA 2YFHA 1C3VA 1SM4A 1H6BA 1OD6A 4PAMA 4DA0A 1CCWA 3VU9B 1SC3A 1D2MA 2HRBA 2JIDA 3KVVA 4UMDA 4ZOLF 2EBHX 4JZKA 5DYGA 3SQNA 4HYYA 2JD1A 3SKXA 4HOYA 1M7GA 1SHJA 3AF2A 3R0VA 4S1WA 1NNI1 4MIEA 5IW8A 2CJPA 2A57A 3SVZA 3V1UA 4DLZA 4POAA 2FZEA 1N9GA 3RM3A 1VOTA 4ZK2A 1WPXA 3FPLA 4CU5A 5DZSA 4BGVA 4PRKA 3BXHA 4LJ6A 5CFNA 4B1FA 2J0QA 4JSYA 2OAEA 2P6UA 4TWAA 1JKJB 4UUOA 4INZA 5FOVA 2IH2A 2V7GA 4MITA 3BRQA 4UC0A 4AM8A 1EVKA 2YJ5A 3UGQA 3I1JA 4KMMA 4YCJA 4ZVRA 5KYTA 4UHEA 3AKCA 3DONA 3D8TA 3M7IA 1ZG3A 1A82A 1ZOLA 2AOVA 3DQZA 3MJSA 1PK8A 3V1LA 4EYEA 3KFVA 4P4TA 1DXQA 1Y9JA 1UBOS 1OVGA 4P3OA 4Q5IA 1JXMA 3CJQA 1KEVA 4NC9A 3OJ0A 3EWAA 1T9DA 4B45A 3HVKA 5HUHA 2FSPA 2YW9A 2QU7A 5IBRA 1H94A 5K0LA 2BRUC 2NP7A 3OQ1A 2BN4A 4EHBA 4EWLA 1QTQA 1VYVA 3I05A 3IPRA 2ISSD 2VWPA 1NOJA 4MW7A 2WA1A 4QFMA 7AT1A 1TADA 1OFUX 4Q00A 1DJPA 3P32A 1C1DB 3H2YA 2ODBA 1W52X 1W4AA 1I0LA 4IIDA 4LWOA 5COQA 2Z58A 4LQLA 1ECLA 3PHJA 1YVUA 4FFWA 3WJAA 4YRBA 1Q3TA 2ZJYA 4D98A 4Q9JA 3IR5A 4BP3A 5CHYA 5A3JA 3VJKA 1RQ7A 5LBIA 2FP4B 4TV8F 1M34A 4PPGA 4OH7A 3MMZA 1A71A 3VTZA 3C70A 4F5ZA 1HE8B 3OJLA 1PJ8A 1LBQA 1PQUA 5D5PA 3OFJA 2TS1A 4YRMA 1AK2A 3DBHA 4TS4A 4FDAA 1PGPA 3DA8A 5BVHB 4YRGA 2DQZA 3ELUA 4UBNA 2FU5C 4YMVA 1ZM3A 2OBXA 5AICA 3ZDXB 2HO5A 1FMLA 3LP5A 5AHXA 1JEAA 3ZHBA 2TMGA 5TF4A 4KPYA 1N0UA 3AHHA 2NYUA 4M0FA 5AR1A 2MYTA 3DCYA 1A4UA 3MWYW 3CRRA 2AS0A 1U28A 3CVOA 2WF8A 4P4NA 2AC2A 2OO7A 3H13A 3TI7A 2BFNA 3OCVA 3PTLA 4LHXA 1RJEA 2OO3A 4QQKA 3TR0A 5BW5A 3E9QA 4DARA 4AZSA 2Z6UA 3I0ZA 5KDOA 4I81A 3QVKA 3TLCA 1A9XA 1N0IA 3PR1A 4QPCA 5JI3E 2WHRA 5HBRA 3WMGA 3IVMA 1E6CA 3VZPA 4E2ZA 1QC5A 4E5PA 1YHZA 4WD3A 4IRMA 4LKOA 3D9QX 4JENA 3T0GA 5IC6A 4M7OA 3CB2A 3P9ZA 3ER6A 3DBLB 4QVIA 1LTQA 3G0OA 4I55A 2WD7A 5KTTA 2E5LB 3LIIA 4QYSA 5I47A 1UANA 3LHFA 4A5OA 1N1GA 4IIHA 4IG9A 3OJCA 1LB1B 2GPSA 5DX1A 3ZBTA 4M7WA 4PLYA 2PAAA 5TPWB 1F5SA 4G4SP 1CEQA 1XFAA 3GLHA 3W7AA 2PTGA 1AF7A 2CMDA 1JG6A 2WMDA 3F74A 5GP1A 2BMWA 2BDTA 3E9NA 4N47A 2BFAA 4G6ZA 5HIMA 4YV0A 5BN4A 3F6EX 1DRWA 4OI1A 3EDRA 4NNJA 2NAPA 2PX0A 3DBRA 4XD7D 3U7GA 3KTDA 1SKBA 2IDMA 3I9FA 4ZYTA 1K3FA 1NGSA 4JR0A 4UMFA 5F2KA 1M8GA 4AU1A 1RZRA 1T3ZA 1N2IA 1G1AA 2RG1A 4LJAA 2AMFA 4W7HA 4XWGA 2VPQA 1SU6A 3MWGA 3M81A 4LYFA 2YJ6A 3WQSB 2JPDA 4HLUA 3PS9A 3AHEA 1Y1SA 4F3CA 3ODPA 1WXWA 1Y3AA 4IWXA 2IHKA 3VISA 3JZDA 4O3MA 4LDJA 4BLWA 2PQMA 4JIGA 3WYGA 3HP7A 4B40A 2J4FA 4Y2TA 1IY9A 2H4JA 2X77A 3R24A 4F38A 2R6AA 1ZD1A 4F3RA 1XLWA 1QB7A 2I8CA 4MK4A 5DBIA 2YRWA 5BXQC 1SVSA 3BZUA 5KCMA 4L9WA 4GYJA 5FHRA 5IAJA 3R7BA 3UNXA 1R0YA 1TNDA 1FY2A 1E5XA 3RG8A 4CF5A 2GA9A 1EH5A 1U80A 4FINA 5FUQA 3RFFA 4C5BA 2VXYA 4WESB 3W1EA 2GM9A 5LYJF 1OKKD 4CIBA 2GOYA 4TVBA 3U7HB 4D6PA 3EODA 4MYRA 5EIFA 4LJKA 5IZCC 1GG2A 1PKXA 1P4AA 1TZKA 3QX7A 1P6UA 3GA0A 2YBEA 3IE0A 3LCMA 4QO7A 3UAGA 4CZ2A 2G71A 4DA7A 3T1TA 2JIMA 1MV8A 2R1TA 3VJMA 1I33A 5AVYA 1K4YA 3CGGA 5DH9A 3H2ZA 3UAZA 4MX8A 3ROTA 4RHFA 1SVIA 3A32A 3LLUA 4ZAVA 3CLKA 1JFFA 1YZ3A 2VSQA 1UXKA 3PYLA 2JD0A 5T5QA 4Z3DA 3I58A 4P5EA 2NU8B 2CD7A 4HQOA 4N9WA 2J5KA 4B3HA 2NUTB 1GQFA 2JVKA 3RU2A 4C4ZA 1BXKA 1JILA 1J2RA 1VCHA 2R6JA 4JLNA 4H1WA 4ZJZA 5FUMA 3KQQA 3FPGA 2XNSA 2H08A 4HN4B 5FP0A 3UJ9A 1JLRA 1S1CA 2P3SA 1TAGA 2YL2A 4ERXA 1AOXA 3UWKA 5CB6A 1F2UA 3CUVA 2ARKA 4EHLA 1AE1A 2FGJA 3OKAA 2G1PA 1Y4DE 4BKMA 4EPYA 1HE1C 5LJLA 5GADl 3PA6A 5F98A 2VCEA 2ZQYA 4ZT7A 4M86A 1CPYA 3F7OA 3VZCA 4B3JA 1N75A 4ETWA 4OK5A 2OAP1 1PJ3A 4EB6B 1GA1A 2N46A 1M76A 4H1UA 3VH1A 3DG9A 4IJKA 4C76A 5AM4A 4CQNA 1U4OA 4LHVA 3O2SB 1IWPB 3LSTA 4IG4A 1CY6A 2WTMA 1E0AA 4MIKA 4HZGA 4EGSA 2JK0A 3QELB 1J0XO 4MQFB 4KMOA 4URYR 5JYBA 4Z4IA 2AG1A 3ZDFA 5L4NA 4I1RA 4D4IA 3VU1A 4PZPA 4Y8VA 1N8NA 1TUGA 2JHFA 3O1HB 2PRSA 4L8FA 2DHCA 1KOLA 5HKOA 2HR1A 4OXYA 1EKXA 3D3JA 4B9EA 1XVTA 4TLAA 2PT5A 1XAJA 5J5VA 1O4VA 3I5AA 3MS7A 2F1IA 4QEZA 5JYEA 3IDQA 3GB9A 1IPFA 2GZMA 5SYAA 3O6VA 2PYDA 3W04A 4M9QA 4NMWA 2AKYA 1WEHA 2IK8A 2WJYA 3F8SA 3N28A 3RTGA 1NUUA 3ITKA 1V71A 2LIVA 1BXRA 4NYMR 1DLJA 4BLQA 4B34A 4FB4A 3Q4GA 3RARA 1NUTA 4A26A 4GX1A 3Q8MA 3GLSA 4RIIA 4PPFA 3SF8B 3MWDA 1WB6A 2ZCJA 4KMRA 4AECA 4BIMA 4MVJD 1C1YA 4XJVA 4MLPA 2I34A 3A0UA 3TKYA 3G0HA 4HC4A 4BGEA 4UQLA 1A7AA 2R87A 2I2FA 4RXUA 1KQGA 1TA0A 1HGXA 3QWBA 1RQLA 3C3XA 2GBIA 4QO8A 4R01A 4UATA 3TSYA 3WHPA 2EFHB 2X0JA 4QGHA 4UU8A 2MOKA 5KTNA 3L4SO 1GQ2A 4DIEA 3C87A 5BSRA 4OQYA 2FFHA 5L6LB 3D4OA 3TM5A 3LRTA 1C80A 5KQGA 3A9WA 1ZJYA 2IW3A 4M21A 1STOA 2ZIAA 3TIFA 4KO2S 3IE2A 3JPWA 5ER6A 5DBEX 3RUFA 3UICA 3EDMA 1ISGA 1JJVA 1E7MA 3OUTA 5CVVA 2BCJQ 2GZ1A 5FTWA 3O94A 2JFOA 2X8JA 2I76A 4DMUB 1FJ2A 1Q1GA 3LOQA 4ZVPA 4MQ4A 1XKTA 1NYQA 1CERA 3L18A 2WIJA 4GR9A 4PTYA 4DJEC 5JV5A 2XNKA 1NRIA 2HEIA 5HHTA 3L7YA 1WUHS 2MYNA 3NVDA 1A9OA 1XTJA 1PBNA 2I29A 3MRVA 3OZGA 3R7FA 1U2DC 3VPAA 3P2YA 1JX6A 2IOHA 3I5UA 1QWOA 5IDYA 3MT9A 2X7JA 1FA9A 4WEOA 5F9HA 1OLUA 3GDHA 3KYCB 2V5AA 1F0NA 1VFNA 1QG0A 4D6YA 4Y30A 3IKMB 1L3IA 2DTEA 5LR6A 2NVOA 4ZYYA 4B71A 3CSUA 5LL6P 2ODTX 2JK1A 3SFTA 2C54A 2QAIA 1X7YB 3JQ8B 3WNDA 4A2WA 3QX3A 2ZCVA 2F9FA 5IM5A 4WZZA 4TLEA 1U31A 5LQJA 3PPIA 3KE8A 1P39A 3SC6A 2CKDA 1HTBA 1G18A 1Z6YA 2H0RA 3MT7A 5BN3B 4D57A 1RBZA 3CEAA 2CXRA 3DT8A 1JR3E 1IRXA 1XZEA 4ZT5A 4GOOD 5KQRA 3E70C 1WCWA 2WYWA 3KUXA 1MQSA 1S2IA 4BL5A 3SSMA 2D2XA 4ZZ0A 5EWMB 4MMYB 4WLVA 1KKLA 2WJHA 1VPEA 3FH0A 4LJRA 4OHWA 4MKGA 4Q7JB 4PX5A 2XE6A 3JVVA 2ZWAA 4O1HA 3VSEA 4EYSA 1G98A 4IX1A 1QHHB 4D25A 3H2SA 4W5HA 1R5BA 1W29A 1TD1A 2E7ZA 4YAEA 3FOWA 3HBLA 3T7EA 2FEXA 4RWZA 4P0TA 2IWHA 3BM5A 4TQGA 2IYTA 3KAJA 1WQ4A 3UOWA 5F5NA 1YIDA 2TMKA 3EXAA 5EGSA 5GWXA 5LQKA 4DG5A 1GT91 4UU1A 1OTXA 1K7CA 3EPHA 1CDOA 1L4FA 2D5CA 5BYKA 1U65A 2AJ8A 2RH9B 1O96B 3DBOB 3DEFA 3DZJA 4AO6A 3C7DB 4F04A 4Q9NA 3SZGA 2C42A 5D3KA 1U0EA 3DT6A 4OYYA 3AL0C 2EF1A 5IVPA 2JIOA 1C30B 3ND5A 4MV0A 5HTOA 3LT0A 4MI3A 3TGWA 4DC9A 4DANA 4EJ6A 1VHTA 1CS0B 1VBNA 2WI8A 4XSGA 1XBTA 5K6AC 1E9DA 3INTA 5HKAA 2AMVA 1ULUA 4YJ2A 1Y6FA 2UZIR 2ZJ1A 1XK7A 4M38A 3WL6A 5JD5A 1J8QA 1UJNA 4MQBA 4BVGA 2RDMA 2QUKA 4UUAA 5LDDC 4KEAA 4P3NA 1UPFA 1KR2A 3RIEA 5JZOA 2PGDA 4HRXA 1J5XA 4WUTA 4KQ2A 2V7PA 2HDNB 2I2CA 3P4YA 1UPCA 5H4HA 4DMRA 2JFXA 3RQIA 1YBHA 3MCAA 3O3CA 1YU9A 4I55F 2ZB7A 4Y6QA 5CT6A 5BWCA 2PBRA 2H3EA 4U7PB 2PZAA 4ZPXA 3SQWA 4WXYB 4HTAA 1KI4A 1W4RA 4UTXA 2RI0A 2VDQB 4LRTB 2CXQA 1ZCZA 2JVJA 5EXXA 2JDID 1BDBA 4W9NA 3VZBA 3WIVA 1KPIA 2PSDA 4TKUB 4UBJA 2QNBA 5BT8A 1XMPA 4EITA 3W7VA 4MR8A 4C2TA 5I5GA 3G0GA 1ESCA 1REQB 1C41A 1FNMA 3QU4A 1MPXA 2ORYA 4OHFA 4V2IA 5JNUA 2YZMA 3NTRA 3T4UA 3UGTA 2JGMA 2IGBA 4CHGA 5HKBA 1QE0A 2QUJA 4QYWA 4XGKA 2B92A 4ZXPA 3E7WA 5FULA 3HL0A 1KH2A 1QQ6A 4HMQA 4ZXFA 5CA1B 1AC5A 4HGNA 4LC1A 3B52X 3E1SA 2DT5A 1VP3A 2ZATA 3B5EA 4JQZA 5DCUA 1I9CA 1OFVA 2B8TA 3PIDA 4FILA 1FJGB 4A10A 3F4BA 2H2AA 2OKGA 2R66A 1IUPA 1UC5B 2DPGA 3GD5A 1O58A 4ND7A 3PXDA 3WGKA 3ANYB 3ID6C 3OO0A 4GC9A 1X3LA 1GZHB 3JQAA 1NBMD 4I1VA 2AZMA 2KQUA 2R7MA 3ADKA 3HWWA 4FS8A 5D3QA 2P6RA 1I10A 3LYAA 1PW7A 5AT1A 4CEHB 1O6BA 1QJCA 2JAPA 4KXFB 3VR3A 3DW3X 2FZVA 2XNDA 3GBVA 3STYA 4DL9A 4US2R 3C3BA 1JECA 4YDHB 1KMNA 3KZXA 3EA4A 1NG9A 5IDWA 4BRUA 1DRJA 1HEUA 1O8BA 1ID8A 4NULA 1JQ5A 1VGVA 1KRWA 2HDWA 4K46A 3PQ4A 1MO4A 1RAIA 3F96A 5AK4A 4BMCA 2V6FA 4RK0A 1PJCA 3AI7A 4DA9A 3OMXA 4ZTBA 5AJHA 3P26A 1OB5A 4J4TA 3HP1A 1MJ5A 4URWR 3CLUC 1B0AA 3H6GA 3MF4A 1Z0SA 2ZI7A 4PZUA 1K63A 1ZIYA 1NVAA 3TW8B 1AS0A 1BNCA 1E8MA 2VDOB 3ZCPA 3O03A 3GFFA 1NP3A 1TLFA 2IPMA 2Q9CA 3OE1A 3TE7A 4E12A 3FWKA 1VBKA 2RC5A 1N5KA 2QRGA 5I5EA 4OUDB 1XCPA 2GMWA 3ZGYA 1N3YA 1VDZA 3DS8A 3LPCA 2F8MA 3MFQA 1XQ6A 1E2HA 1PR4A 4L7QA 3PHGA 4QX6A 1DL5A 2AQIA 2HDHA 5TT1A 2C4NA 3CRVA 2H29A 1UOPA 4YC7A 5AK5A 6AT1A 1IATA 2MDTA 1N33B 1Z68A 5EXDA 3E27A 1URPA 3HYNA 1AQ6A 3IMFA 4GMHA 2OHOA 2Q4BA 4RQBA 4XIJA 2HF9A 3UGKA 3WMXA 4LQCA 4BV9A 1VZ2A 2MR5A 1QIIA 4EUHA 2H17A 3NBUA 3SZOA 3WQQA 1N2CE 4TM8A 1OC4A 2PGOA 3ZWVA 1NN0A 4TXJA 4I1UA 2PGNA 1L1RA 1QFJA 3OQBA 1DQNA 1ZWLA 2Y1LA 3FYSA 4JHXA 4X7RA 4AZWA 2O2IA 5KYKA 4PNHA 4OGLA 4PIPA 1F8XA 1OYVA 3L0DA 3MXOA 3SLRA 1KORA 1ICEA 4NG4A 4F97A 3Q72A 2VQEB 1C9MA 4RVFA 2E89A 4EHNA 5KREA 4E2YA 4TS9A 3H9GA 2M32A 2QVBA 4JS0A 5ILQA 4C06A 4OTZA 1LBHA 5G40A 2C04A 2YV1A 2EFYA 3CB4A 4AG6A 5JZBA 4BX0A 4W5QA 1U63A 2UZ3A 2C4HA 3ZJ5A 2WUVA 3GJZA 4AS3A 1AA9A 3HJGA 3PRYA 2RHDA 4MLDA 1H3EA 2VRCA 3RIMA 4LJSA 1E5LA 2VYCA 3CX4A 1YI1A 3P96A 5HEKA 2VYQA 2ZXUA 1WMAA 1RNLA 1HFKA 2GK7A 2O3RA 1PJAA 3V34A 2IHBA 1LVHA 1M72A 3WQHA 4LOLA 3TFOA 2X2EA 2IGTA 4WPGA 1OAOC 2Q1UA 1JSXA 2H5JA 5FRDA 1U0JA 1N0WA 4HNRA 2YX1A 1B14A 2C8JA 4NYMQ 2P5UA 1QNLA 4N54A 4DT1B 1GGEA 1KA9H 3H6KA 1U2GC 3KZVA 3QEJA 1SFRA 1ADYA 3NAZA 4IGIA 4DV7B 4GRIA 1TEVA 2G76A 2XUQA 3RASA 3BPSA 3FPAA 4GBGA 4X24A 5JI2E 1SCKA 1J6UA 2QM7A 3MAGA 5DNVA 3WGTA 4C9BA 2BOVA 2NTVA 3AR3A 3W9BA 4HAOA 2E82A 2Z9CA 3FHCB 3W5AA 5HS6A 3PLAE 3K0SA 1P7YA 1R6AA 4MYCA 5KOHA 1G9TA 2DY0A 1B2LA 1ECGA 2HJHA 4OXRA 2VWGA 6NULA 3HXQA 3A6PC 4JZYA 4PC1A 2GBLA 2PKQO 1H2RS 3Q85A 2WWRA 1ZH2A 1POWA 2Z3WA 3BFXA 4X7BA 2FMTA 1G6OA 2OBLA 1IIBA 1P0IA 4LE0A 1VRCA 2BH9A 1XWFA 2GASA 2ZJ3A 3MQ2A 3N6XA 1QTNA 2CCGA 3FTQA 4LS3A 4MGZR 3OWHA 4KR3A 2P3OA 2O8FB 3N8GA 1H1LB 3JASB 3PUHA 1D07A 3QW2A 3VKUA 3B2QA 1BWPA 1Z2OX 1RRKA 3MYRA 2SECE 3AP1A 3Q11A 3VHLB 4DADA 4C04A 4BMDA 1O95C 2N1MA 3QYPA 3H4TA 4G5FA 1GL6A 4CDNA 5A62A 2MSDB 3W78A 4CLRB 1DGQA 3WSWA 2FZLA 3IEXA 5HGJA 3DJFA 1YE5A 1LPAB 2QOEA 3P1JA 2J45A 2QLBA 4LE1A 2JI7A 5KNBA 2HGZA 3B5JA 1NT4A 4NMLA 2PL3A 4YUAA 2QTVA 2HNKA 4I1IA 2AUMA 1ZXLA 3C1AA 2GJ4A 1ZI9A 2HWXA 1W6RA 3I8OA 1E1YA 1ZA2A 2PS1A 1UBHS 1LU9A 2M6KA 4G5SA 2IX3A 2J9XB 2XZDA 3AFOA 3HP4A 4D4KA 1SURA 2ZG6A 3KCNA 4RCVA 1F6BA 4C6TA 3T5AA 2VH1A 4CQLB 1VLZA 2HF2A 3CG0A 4HXYA 1A5ZA 2XSZD 1F20A 2Z5GA 4P36A 3SXUB 3WKBA 5EMHA 3KZKA 1JL3A 4YP6A 4D9CA 4ZJUA 1S3IA 1NLMA 1A9SA 3GEGA 1AX9A 1UKEA 3QX8A 1N6HA 1X42A 5IM4F 1R74A 4DQUA 2BAGA 2WM2A 1QM5A 3WYAA 1H42A 5IEJA 1L2TA 1FFDA 4REOA 1NWCA 3JD4A 3GAZA 3JYLA 4C7XA 1Z6PA 2AE2A 2X8LA 1B0PA 1MAUA 2ZKLA 1IY8A 1IM2A 2H92A 1DRVA 4YFVA 5F1YA 1CIVA 3C3KA 3ANTA 4FMDF 4E09A 5FTKA 1SIOA 4DIOA 3LPLA 3C14C 4CMIB 2UYHA 1MZVA 3FOCA 3ZV7A 5DM1A 2C9MA 4OHBA 1A88A 1P73A 3CONA 5DHUA 2EVWX 4YPVA 1IVYA 1V5WA 3CLVA 1WVGA 4R6WA 4XGRA 1BS2A 4FYKA 3QHAA 3THOA 1ECFA 4IV5A 4I9NA 3LVRE 4MPPA 1FTNA 3MBKA 4MA0A 4ZOLB 4ZAZA 4F7DA 2J0SA 1RPNA 1TZCA 2QIPA 2GILA 4Q18A 2H4YA 1ZD3A 2CXXA 3K2QA 4L74A 1MQ8B 3FOBA 4QQFA 3KXDA 4XVQA 4TTVA 3LA6A 2VF5X 1HL7A 1RC1A 3B38A 3FTNA 3U0BA 2QU8A 4ETMA 2X23A 1Y8CA 1G7CA 3UFXB 5EZ5A 1H0SA 2AJDA 3BMXA 1UBTS 4NBSA 4PGMA 1D04A 3C6XA 4UZFA 3OCCA 3EDQA 3QF7A 2QX6A 3RWOA 1U2ZA 2GJSA 1U04A 3E5MA 4X3OA 4G4GA 1VA4A 3K8QA 5EPEA 2J7PA 4P7BA 5KNDH 1FVFA 3KQLA 3UV7A 5C4IA 3U3RA 2RCNA 4DVJA 2UYOA 4A8PA 1QZUA 3GLFE 2QE7D 2PIAA 3LUDA 1DZIA 4ZZIA 2WHPB 2GJ8A 2J0UB 1W0JA 3ABIA 2AFHE 1XEAA 3I23A 4GX5A 1F8FA 4ZCPA 4E1BA 5FD8A 1GT6A 3S28A 1J70A 2B2CA 3Q2KA 3ZDBA 1DT3A 4BX8A 2P68A 1Z0JA 4PF1A 5IJWA 1KERA 3WBJA 1FSSA 3WLTA 3CZ5A 4ER3A 3LRXA 4MYDA 3WNVA 1DPFA 3C8UA 5HIIA 1YR2A 3U0VA 4CCAA 2WWXA 3M1AA 3M49A 4YO8A 4CKCA 1PHPA 2XGSA 3Q5EA 2J6CA 5J1TB 1SMKA 3NC4A 2O8CA 2CDAA 4DLNA 4MEBA 3HKDB 3U3JA 2ZJAA 1R15A 3OICA 5KAPA 4S35A 1SU4A 3E0XA 3JD0A 3EEIA 1Y42X 3OIGA 1LSJA 4MAAA 4UUBA 3OTHA 3D7LA 3MUEA 4R83A 1R8YA 2G5GX 1N6PA 2CMFA 3LDHA 3PXBA 4TV8B 4AJOA 5CVUA 1V4BA 4FB5A 4FGSA 2V1UA 1HR0B 3ZK8A 1POXA 3AVYA 3EGEA 1MEOA 2VHTA 3HS3A 3QXCA 2C3OA 4EI2A 5AKKA 1VE9A 1UXOA 1E59A 2JD2A 1D2GA 2X6QA 1HLFA