3KJGA

Adp-bound state of cooc1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MKLAVAGKGGVGKTTVAAGLIKIMASDYDKIYAVDGDPDSCLGQTLGLSIEEAYAITPLIEMKDEIREKTGDGGLLILNPKVDGDLDKYGRYIDDKIFLIRMGEIKKGGSQCYCRENSFLGSVVSALFLDKKEAVVMDMGAGIEHLTRGTAKAVDMMIAVIEPNLNSIKTGLNIEKLAGDLGIKKVRYVINKVRNIKEEKLIKKHLPEDKILGIIPYNELFIELSLKGEEIWQSTNPAFVNLHDIYQKLRLEVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, metal binding protein
molecule keywords CO dehydrogenase/acetyl-CoA synthase complex, accessory prot
publication title Crystal Structure of the ATP-Dependent Maturation Factor of Ni,Fe-Containing Carbon Monoxide Dehydrogenases
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
total genus 76
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kjgA00
3I73A 1JNYA 1R5BA 4WAUA 1P2SA 4LBYA 4LDJA 2ZPTX 1ONBA 3VNVA 3T5DA 1AQUA 2W0MA 4MITA 3T5GA 3I8SA 3LW7A 4JL5A 4JLNA 4L8GA 2QA5A 1Q3HA 3W6NA 1GM5A 5LDDC 5HKKA 2KJQA 1E99A 3OZXA 4KLZA 3U3KA 1Z0AA 2IXGA 3G0HA 1JR6A 4EFMA 4KAXA 1XB2A 1EGAA 221PA 1UKEA 2A9KA 3B8HA 3C14C 4WW0A 4BFUA 1XPOA 1Q0UA 4PZZA 2HLDA 1DE0A 1LVGA 2GJAA 2PL3A 3LDAA 1EFTA 2DFNA 1T0HB 1QHXA 3C5CA 1UM8A 5H8WA 5HCNA 3D6TB 4PPQA 4GPTA 3C8UA 5DHAA 4L4UA 2A5YB 2IYSA 4JLKA 1KKLA 4Q9IA 1MOZA 1U2RA 2GXUA 4UKDA 1L4UA 2OAP1 1TUEA 4Z8YA 5JWOA 2QT1A 1SVIA 3THWA 2HXYA 3TUJC 3AB3A 5EUMA 2ZRNA 2W6JD 3OIVA 1EFUA 4V0OA 1BYUA 1W36D 1Q1ZA 1YRAA 4IXNA 5FOXA 4M1MA 1N5JA 4UJ3A 2IS1A 1RKBA 3EA0A 2C98A 3IQWA 1NJFA 2BBSA 1N5KA 1S1MA 2DFLA 3LVQE 3R7WA 4FCWA 5C2JB 5JEDA 1R6BX 1A7JA 2G83A 4FD2A 5FPHA 4D82A 1Z28A 3HJNA 1NG9A 1JALA 1C4OA 4A9AA 4NE2A 3AKCA 1YHNA 1OPXA 4RZ2A 1UDXA 5AJYA 2QAGB 3OF5A 3HPRA 4DXAA 1QHHA 3BFVA 1AKEA 3ND8A 4RD2A 1Q3TA 2WV9A 2JLUA 1TU4A 4LV6A 3ZD6A 5DI9A 4E07A 2Q3FA 4DWJA 3SZRA 3IHLA 2J7KA 4JLBA 5LPNA 2CE7A 1VYVA 4XVUA 4H1UA 4Q9HA 3KKPA 5KSZA 1BOFA 1IN6A 3VR3A 1CBUA 2W00A 4RVCA 2BCGY 2EFCB 1ZD1A 1EX7A 4KV9A 1YU9A 3KXIA 4JLOA 5GVRA 5KNBA 1TQ6A 1AGRA 3CZQA 4PSVA 2GETA 3RHFA 2MSEB 3GLHE 3QIAA 4RD0A 5KSOA 5DE3A 5EP3A 3VTKA 4ASUD 1T3HA 4AY2A 1KYIA 2ZU0C 1G8GA 1DELA 5CB8A 2JDID 5FUXA 4QFMA 1LNZA 3IGFA 1E69A 1Z2CA 3U7FB 3M1IA 1N25A 1D6JA 2ZI5A 3IO5A 3RC3A 1GRNA 4JZKA 1P62B 3GJ3A 1N6PA 3NG1A 2XZLA 4A36A 1T0JB 3VR4A 2CL0X 2FZLA 3FVQA 2DYKA 4P4TA 4BFVA 1ZMXA 1JPJA 4X8HA 1UPTA 3L0IB 1XPRA 1E98A 4LBVA 3R20A 2ZRGA 1AS3A 1ZM3A 1LTQA 2WKPA 3WYAA 4GI7A 4D0NA 2C9YA 3AH8A 3W5IA 1UAAA 3BGWA 1T4GA 2YC2C 2BJWA 3UG7A 2IHBA 2ZJ5A 4YQFA 1XWIA 2JIZD 4IJMA 1YZNA 3Q7PA 4EPRA 2YWFA 2F9MA 5TB5A 1D5CA 1R8SA 5AJWA 2Z5FA 4HAWA 4KVAA 3TMKA 5IHPA 3H2YA 1E2GA 4C0HA 3EC1A 4DIDA 1Z6GA 4KI0A 4PHTA 5J40A 2BMJA 3LLMA 4M22A 2HYDA 5EUQB 1IXSB 1EFRD 1Z5ZA 2B8TA 1JPNA 4G3XA 1IN4A 4PSAA 2AKYA 4Z1MD 2Q0HA 4C0LA 2HCBA 4FMCB 4HLUC 3CM0A 1VYUA 2YYZA 4Q4LA 2VHQA 4QBFA 1E1RA 1EXMA 4MH0R 1ZINA 3GFTA 5LBIA 2FPKA 1IM2A 2G1KA 2WJIA 2LKDA 3AP3A 4GT1A 1QBKC 2IYWA 4YXWA 4XIGS 4LCBA 4MRSA 1COWA 3E70C 3BBPA 1Z29A 2QMEA 4JT2A 4A2WA 4QHSA 4LHZA 1GDDA 3UMSA 4BZQA 1KJYA 3A1TA 3L43A 4B44A 2ZJAA 4XWAA 1MRNA 5DISB 3IHWA 4R9UC 4FWTA 5GADl 2I1VB 4IW3B 3X2SA 3Q7QA 2QBYB 2QTFA 1N6OA 2JJ1D 3TH5A 1CRQA 8OHMA 6Q21A 2ZAOA 1T9HA 3DL0A 5KDOA 4A0RA 2J59A 2QBYA 1YJ5A 1E2FA 4L9WA 2V8OA 1NBMA 2A2ZA 4EPWA 1ZVQA 4Q7MB 1OFHA 1RZ3A 2QTHA 3BAFA 3OHMA 1CR4A 2GBLC 4F4IA 1IXZA 1KY3A 2REXB 4Q02A 1WF3A 3SI7A 1OXTA 4Q1FA 1SXJD 1QHYA 4BE7B 3KB1A 3ICQB 1RRPA 1ZNYA 4QGFA 2AWNA 3LXXA 3EIEA 4URYR 4MDEA 1E2DA 2JATA 2VHJA 2ZRFA 4V0LA 3KQUA 3DZ8A 4OQNA 5EE5B 4C0SA 3CO5A 4JVLA 4CW7A 2QUZA 1CP2A 4ERNA 4EQ6B 2BEJA 4M9ZA 1NRJB 4OQFA 2HYIC 4DDWA 2D74A 2IHYA 4GBMA 4WIAA 5FBLB 4DIEA 1ZBDA 4O25A 3Q5DA 3FHOA 3WNDA 5KPDA 1VTKA 2VL7A 3QUSA 5KPJA 2O8EB 1MKYA 4ACAA 5HKKD 1KI3A 3B13B 4LBWA 2ODEA 5G40A 2IS4A 2FA9A 2IWRA 3G82C 1LF0A 1FFHA 3AVUA 2OO7A 2O8EA 3RWOA 5EXSA 2EU8A 1XCMA 2JASA 4RCYA 5E95A 4GOXA 4A2PA 3K53A 4PAMA 1MABB 2ZRHA 1ZNZA 2DB3A 2A5GA 4GNKA 1E9BA 3QKSB 4NMMA 5E3HA 1TQDA 1NF3A 4GL2A 1WBDA 4L15A 4LX0A 5JWHA 4URZR 3H4MA 2Q9CA 4JVMA 4LYAA 1DAEA 2XEXA 1OYWA 3C15C 3L2OB 3ZYCA 4F38A 4W7SA 3RANA 3NC0C 1ZD8A 3LBNA 1P5ZB 4TLEA 1CR0A 5DYIA 2PEYA 4PXAA 4LHVA 1Z6XA 5E7MA 3ASZA 4IVPA 1M7GA 4RFVA 3SHWA 2RGCA 4AKGA 5FTNA 2K5UA 4Q9JA 1T5LA 3U3RA 3QXJA 1Z07A 5CB6A 4DLSA 3AGQA 1AIPA 3U4QA 4OQLA 3ZDQA 1S3GA 1WQ1R 2RGEA 1OIWA 1VCOA 3IQXA 4FI3C 4S2EA 5SZIA 4A0GA 3UG6A 1OKKA 5G41A 4DLXA 1XX6A 2ZS9A 4TZ0A 3AEZA 2PBRA 4NZYA 4EDHA 2VP6A 2PLFA 4HLUA 1QG2A 1QZXA 4A8JC 1VPLA 5A5GA 4DEYA 1N6LA 1R7RA 2D7DA 1E2LA 1V5WA 5KDDA 3MAAC 2PEZA 1F2TB 1S9HA 1ZU5A 1ZM9A 2AD5A 4HI0E 4TTPA 3MLEA 4EPYA 2ZJBA 1RJ9B 3FMOB 3RLFA 5CJ2A 2BDTA 4QKQA 4MGZR 1CJVC 1ESMA 4M4SA 1F2TA 1YE8A 2IXFA 3WNCA 1XNJA 1RJ9A 3BRWD 4WXPA 2FSGA 2ZJOA 5FOUA 1DARA 2OEPA 1FZQA 1ZIOA 4PQFA 1TU3A 5L3RA 4TYNA 1JB1A 5D3QA 1TF2A 1XP8A 3REGA 3AF1A 5E7JA 3ADDA 2FPMA 2NO9A 3KKMA 2AHOA 1HE8B 4M21A 2H5EA 4IVQA 4NCNA 4Z8XA 1UJ2A 1N0VC 3C16C 4JBYA 2JLRA 4RZXA 5FTMA 3QKUA 4AYTA 4QXAA 3GLIB 3MRSA 2FNAA 4K8OA 2GEUA 3W34A 1N0WA 2C78A 3PCRB 5HZKA 2OZEA 1XMIA 1OFTA 5DI3B 4OI4A 2J3EA 3CNNA 1RC8A 1GP2A 1ZM4A 3KJHA 4UQOA 4JKIA 1AJEA 4HZUB 2GBLA 4ACBA 4KCGA 2CL6X 5AWFC 5DIFA 2VHUA 4CT4B 5F98A 4HZUA 2WJGA 4KFUA 2J5XA 5HZHA 5J4HA 1R4AA 1E0SA 1RIFA 1EWRA 1YZGA 2P65A 1L8QA 1EX6A 1FL9A 2HDNB 3UMRA 2GKSA 2GJKA 5FTKA 1M74A 1MO5A 4MUAA 5TXGA 4ZKDA 2QT0A 4F4JA 1X8KA 4HLCA 3L0SA 1ELOA 4PQYA 2WJYA 4TYWA 1GL6A 1G19A 3FOZA 4Q18A 2AXPA 2RAPA 4G5OA 4QGAA 4OI2A 1KO5A 1UADA 5TDHA 1U0JA 4NYIR 4OHXA 5EE9A 4P31A 2F3TA 4ZDIA 2UKDA 5EP1A 4BGDA 4AG5A 3ADKA 1UBFA 4Q7JB 4CZ2A 4EPVA 3CIOA 3EZ9A 3GJ7A 1YQTA 1ZC4A 2IWHA 3T35A 4MKIA 4ARZB 2X8AA 1E1RD 2OE2A 3LH5A 1G64A 5JEEA 2DFKB 3CF0A 2YWHA 4US2R 3PR1A 2FFQA 2X77A 3QF7A 2DPXA 5G3YA 4YXWD 3THYB 1COWD 1T3LA 1W47A 4TL7A 3SFVA 2ZITA 3RRYA 1W36B 4YMVA 2ZSEA 3R9WA 1KTVA 3H84A 3HDTA 2QMOA 4GFDA 3ZZUA 1E2EA 1NMZA 2W6JA 5BW8A 3N2IA 2ERXA 2WWWA 2D62A 1RRFA 2TMKA 1KY2A 2OLJA 2VH5R 3EASA 3QXXA 1R2QA 3LWNA 1FX0B 2GEDA 1GITA 1W44A 1A1VA 3HR7A 2N1BA 1U90A 1FW6A 4KXFB 1BKDR 4JL8A 2ZXUA 3RSOA 4B32A 1CR1A 1FX0A 4IOMA 1RRCA 4F91B 2YINC 1Z06A 1XPUA 1P2UA 1NBMD 1G7TA 2ZYUX 4MKFA 2RGAA 1HQYE 3NDBB 1ZM7A 4LJ8A 2H57A 3UIEA 3OEEA 4WBSA 2WJVA 3GJ5A 2WICA 1U81A 2WWIA 4YMSA 1OB5A 3CW2A 3CF2A 2QI9C 2ZI9A 4RZUA 2RGDA 2F55A 1XU4A 2FGJA 1UEJA 4ZDWA 2GXSA 2ZRLA 4WVFA 4NONA 3F8TA 2ZTSA 2XITA 3FGNA 1F60A 3LQQA 4V0ME 2JLZA 1VECA 1E2KA 2FSHA 2GJ8A 421PA 4LYFA 4Q9LA 4DCNA 1L4YA 1J2JA 4NU0A 1NP6A 3WYFA 2HXSA 4RFSB 3BOSA 3IIJA 1P9RA 1SGWA 4I1UA 4US0R 4MRRA 3TJZA 3WBJA 4TN1A 4O3MA 3AVYA 4RFSA 2OFWA 5GJWC 4CEIB 2WAXA 2LCFA 5FBWB 4D25A 1YZLA 1EG7A 1W5SA 1A2BA 3QVUA 2A5JA 3MMPA 2X19A 3P26A 4GSYA 2Z4SA 4W5WA 1RYFA 3CLVA 2QQEA 5C4GB 2BMFA 4Q01A 4II7A 5EXPA 1LV7A 2ZUBA 1RVDA 2F1JA 3IUYA 2AL7A 2GZHA 1BS1A 2FU5C 2O8DB 4OBEA 1UKVY 3NBFA 3TAUA 3A1UA 3P4YA 4JBXA 3T15A 4G5GA 3O8DA 3I3SR 2HT6A 2WAYA 3A58B 1KMHA 3ZH9B 3WY9A 4BLQA 1W4RA 3DOEA 4PSKA 2R65A 3IEUA 3UWKA 3BB4A 2V55B 1G8HA 4BWYA 2B8WA 4OJKA 2G0TA 4AURA 1LW7A 3KXLA 1G8YA 4WOPA 2GHIA 2XSZA 3CUEF 1VIYA 2RGNC 3LX8A 4CT5A 4HAVA 4KFTA 4LC0A 4IEEA 4JMPA 4EFLA 1I4LD 2JEOA 2W2VA 3A6PC 3W3AA 1CR2A 5AJXA 2QM7A 2R6CA 1K5DA 5FL3A 3R9IA 3GLGE 3KTAB 1YKSA 4HDCA 4DCSA 3EXAA 4UNPA 2XTZA 4C2UA 3VKHA 1N6HA 1KI8A 5BN3A 3K70B 3RRZA 4IFEA 1U98A 2CEAA 3H86A 3PUZA 3KTAA 1K5GA 2CBZA 4HB2A 3RNLA 4ZKEA 3RWMB 4JLJA 4M1KA 3ZVNA 5KTYA 2ZSBA 5DNYB 3BB3A 1GTVA 2EWWA 3GFPA 4PC3A 2MSDB 5IT5A 1KJWA 1OKKD 1NMXA 4NTZA 3MJHA 1SKYE 1NI3A 3LAWA 4KVGA 3P4XA 3AVWA 3CWQA 1CF4A 4Q21A 1AKYA 1J90A 1NSTA 3N2EA 2KWIA 2C03A 2X2EA 2NO1A 4FIDA 1EFCA 2FFBA 2OLKA 4IOKA 4WZ6A 3LQRA 2J0UB 3B6EA 2BC9A 3W3ZB 5B58C 4M1YA 4Q7LA 2WMOB 2WBLC 4PZYA 3FMFA 3S1AB 1TMKA 1Z2AA 1R5OA 4IDHA 2FG5A 2HV8A 5DN6A 3EARA 4U00A 1MO4A 1IJFA 4PPFA 2QM8A 2C9OA 2G88A 2J7PA 3KFVA 4Q4AB 5FR2A 5A4JA 2J1LA 3QSYA 3QBVA 2OAQ1 2UZ3A 4XVQA 4PQRA 3BFXA 4GZMA 1ETUA 3BE4A 2VSOA 1KAGA 2ZYTX 3B1VA 4AK9A 1QG4A 4B3BA 3EA5A 2R2AA 1KI9A 3I62A 1PLLA 1ODFA 3PFIA 2GA8A 1KK0A 1WXQA 2WJJA 1J8YF 2L0XA 3QOFA 5JECA 5A0FA 1VCMA 3ZGXA 5CITA 2KSQA 3GEIA 1OYYA 2B92A 4LY6A 2BMDA 4IDQA 4MDFA 4LJAA 4M9QA 4WXRA 1IY2A 5E4FA 3U6BA 4OHVA 3A1VA 2G6BA 3U7EB 4BUJA 1O87A 2OXRA 4JVNA 2VP5A 4TWZA 4DCTA 4ON9A 3BH6A 3C5HA 1NIJA 2XAUA 5IK2A 4EPTA 5FUVA 4I1VA 3U3OA 4GZLA 1PUIA 1U9IA 4JYBA 2F6RA 3O47A 3GLHA 4TMKA 1G7SA 3OIWA 3ZS9A 3RS2A 1JQJC 2DR3A 4GRAA 3U44B 2OCPA 2V6JA 5L8VA 1KDPA 4WZBE 5EE0A 1ZD9A 2R44A 1ZNWA 4ILEA 4DLRA 2N42A 1GWNA 3U44A 2Q21A 3IPYA 2BBTA 1OV4A 2IYZA 4NBSA 4HSEA 5CM9C 3RVBA 3V9PA 2QPOA 4HYYA 4ESVA 1RFLA 3CB4A 3K1JA 2BCJQ 3LD9A 4TQAA 4YMWA 3UANA 1PLKA 1IJEA 1BIFA 1KZ7B 4UXIA 4NYMR 3THWB 3KUCA 5AUQA 4MYUA 1OH6A 1S3SA 1IQPA 2GAAA 4UNNA 3WXMA 1SQ5A 3WP1B 1MT0A 3TUIC 3HP1A 3ZQJA 4BFYA 1NVVR 5FH9A 1E0KA 1IAQA 2VO1A 3NHBA 1XTSA 2C9CA 3UWOA 3X1YA 2ZREA 2O0JA 4Q1AA 4XD7A 3PITA 3R7WB 5DSZA 3T34A 3VQTA 3QENA 3U5ZB 1YRBA 2OXCA 2JA1A 5BWMA 1U94A 4DDUA 821PA 1E9DA 3K9NA 1KI2A 4XWOA 1NJGA 1ZW6A 1ZYUA 2GRJA 3FHCB 3SQXA 2HCJB 1E0JA 1G6OA 1KOFA 1N0UA 2V6IA 3T1OA 1Q1BA 4EJSB 1QHHB 3L0PA 5DGXA 4B35A 1D9ZA 3IIKA 1YZQA 1JEDA 5H68A 4P0TA 2GK6A 3K09C 4MQBA 2A30A 3QF4A 4D0GA 5JI3E 4EJSA 1AS2A 3OEED 5F2EA 4G5QA 3THOA 3LNCA 1KO7A 2RGGA 4IDOA 1GILA 3B82A 1V43A 3QPWA 5DO9A 5F9HA 3AKYA 2J87A 3HPQA 2FSFA 5AUPB 4D4LA 3TBKA 4A6PA 4DSNA 3AVXA 4QNMA 3QKRA 3DMNA 1DAHA 3K8YA 1Q57A 1G7CA 2FX3A 2OFXA 4HB0A 3OIUA 5E7IA 4Q00A 4XOIA 1E32A 2ZS7A 1UDWA 3IILA 1E2JA 3EG5A 4B73A 2RGBA 2W2XA 1YVDA 3B1ZA 1A82A 3T12A 2PJRA 3R9XA 2NMVA 2VLIA 2ZRCA 2R6AA 3EPHA 5FBQB 4LRWA 3RC8A 1QHSA 5HCIA 4DB2A 1VCNA 2GILA 2H8KA 3TQCA 2J9RA 3CRQA 2PZFA 1GAJA 1R8QA 2I4IA 4XSGA 4MGKR 5HTKA 2WKQA 1JXOA 1LS1A 1TPZA 5KHOC 4CVNA 2QSYA 2CHVA 1O3YA 2KB0A 3N5CA 1IN5A 3OIYA 4O2LA 5C1BA 4IDNA 4B76A 3KQLA 4ITRC 4JLAA 4NYIQ 2VA8A 3LBHA 4P4SB 4U5XA 1G291 1C1YA 4URWR 2IBMA 1DO2A 3DZDA 1DAMA 4I81A 4PPGA 4BLPA 4P4SA 1CS4C 2ZSFA 1VMAA 3PUXA 3QXHA 5LD2C 3SDZA 1OFUX 2QEQA 1JAHA 3PEUA 1A2KC 2O8BA 4JJZA 5KDLA 4PC6A 3REFA 2FWRA 2YWEA 4LJYA 5B30A 4HZIA 3AKDA 2XJ4A 1WE2A 1Q12A 1XTQA 4A92A 4DLVA 1PLJA 1II0A 2XNDA 4AWXA 2VHCA 3P32A 1ZJ6A 5BYJA 1DBSA 2ZRDA 4PPNA 4JLVA 4A6XA 4Q4JB 5TMPA 2B6HA 2XSZD 3TSWA 3CZPA 4HATA 1U0LA 5KSYA 5BYKA 2GCNA 3PJRA 4RKFA 2EQBA 4Q4JA 2ZE8A 3QG5A 3X1ZA 3VMFA 5JHGB 5CLLA 2YNMA 1SVOA 2WMNB 3KX2A 2ZRIA 4B75A 4OI1A 2XTNA 2Z0MA 4B48A 2XGJA 2O0KA 3ZIAA 4JVSB 4FMDF 1SZPA 2F43A 2ZJ2A 5GJBA 2FN4A 3R8FA 1L7VC 3BWDD 2W2TA 4I1SA 3SYNA 1WCV1 3ONWA 2V54A 3SJCA 3K70D 2BOVA 1SVMA 4GP7A 3VU9A 1XCGB 1LY1A 2JGNA 2AK2A 4G0NA 4NCKA 5FPSA 1NL3A 3AVTA 3EC2A 2FMXA 5BN4A 1OXSC 1B23P 1CJUC 1HYQA 1XXHE 2IYYA 3CRRA 1Z3IX 2VPPA 1N3BA 3I5YA 3V00A 1XBTA 1F5NA 1AZSC 2MSCB 2A5DA 3CX6A 1WA5A 3DHWC 4DDVA 2FDCA 3NEJA 3NC1C 1MO3A 1XZQA 4RD4A 2FJUA 1DAKA 1P73A 4B3GA 4R98A 4KYUA 2W6IA 4TYPA 3ZVRA 5DN6D 4FWIB 4HDOB 1IY1A 2IXEA 1XJ0A 2J7PD 4PTLA 2NO7A 1AZTA 1CLUA 2CCJA 3SBEA 2ANBA 2R6DA 2ZR0A 1G8PA 3C41J 4K81B 3FKQA 1GZSA 4EPXA 4B34A 4DLTA 1NNEA 1OFIA 5D3MA 4AYWA 2DBYA 2VTKA 4C0KA 121PA 2CCKA 4DC9A 1DPFA 1Z6YA 2WSMA 3K09A 4M8NE 1B0UA 3VR1A 4DDTA 4F92B 3PENA 2J0SA 5K8TA 1Q44A 2CCGA 721PA 1CJKC 1DAGA 3AKEA 1S9DA 1DG1G 1P4SA 3A1SA 2VYFA 4LWZA 1U8YA 1ZP6A 2FZ4A 2ZJ8A 3H0KA 5JLJA 5IK2D 5JJLA 2GJ9A 1Y63A 2DWQA 3QI2A 4RSGA 2I3BA 5EZ6B 2BV3A 1XD9A 2OBNA 1GL7A 4KHZA 4TMWA 4PO9A 4ZCMA 2ORWA 3CNOA 3LO5A 2ZRJA 5H1YA 1N5IA 3CWZA 2O52A 3M6AA 1E0AA 1QF9A 4NCJA 5JSZA 4NKRA 2G77B 2ZVQX 3M0EA 4N1AA 3A37A 4U02A 2CK3A 1D8TA 2HJVA 3HWSA 3D8BA 4TMTA 5FTLA 1KIMA 4N0DA 1TAGA 1KMQA 2CL7X 2PT5A 3BXZA 1BH2A 4B2LA 1GRRA 4QC2A 2RMKA 3KKNA 1JBKA 4DLZA 4Q66C 1OSNA 4KSBA 1P7CA 3FMIA 3Q8XB 4A2QA 1CULC 3K0EA 4C30A 3X1XA 1XTIA 2PX0A 4TT3A 4XTRA 2P0EA 3AUXA 4XD7D 2ZANA 2ZUDA 5J5CA 4AC9A 1M8PA 1KI6A 4FW9A 3SHFA 2B7BA 2H92A 1R0WA 4J0QA 4BRWA 5J47A 3PUWA 3WYGA 3U4QB 1SVSA 1W4AA 3RS0A 2JJ2A 3B1YA 2EFDB 2P5TB 3GPLA 1W36C 2VP9A 1IY0A 3RS4A 3CRW1 5EE3A 1TNDA 3ZVMA 3B7GA 3ZZ0A 2AR7A 1GFIA 4OK6A 1E1QA 1T91A 2AWOA 4B71A 2J45A 2GF0A 1XMJA 3LVRE 3EZ7A 4PHHA 3TAHA 1Z6TA 1K8RA 2KI5A 3UMFA 3DKPA 2ZJZA 3TW8B 3KB2A 5KU1A 5KO2A 1BYIA 4OI0A 4M9SA 2QRNA 2WHXA 4PAQA 3FB4A 3K0CC 2IF2A 4V0KA 1H8HA 4LJ6A 1FUKA 2PZEA 4JIMA 1NMYA 2CLDX 3CPJB 2EVWX 3EIHA 4JSYA 4TL8A 4KODA 4KSCA 1VKJA 2IW3A 1NVUQ 1Q1QA 4MYTA 4D2IA 4ZV4A 5IF9A 4ZDKA 5J4YA 2D2EA 4PX9A 1D2MA 3GJXC 4MKHA 2YOFA 3W90A 1JR3A 2EW1A 2XZOA 4KITB 3CF6R 1NVXQ 2F9LA 4Q03A 4GOJA 4KBGA 4BFSA 5FUYA 4P33A 4BASA 5FL7A 4IOLA 4ZI3A 1VHTA 1QHNA 4OQXA 4WZAE 4PO1A 1YR6A 1RYHA 4B3FX 1GKYA 4AG6A 4BLSA 2XOKA 2XB4A 2XZPA 3B1XA 3EPLA 2CJWB 3QJYA 1KI7A 4KU4A 1W5TA 4NYMQ 1UBCA 4HUTA 4POAA 3FMPB 2CLSA 1KJZA 2QE7A 3TNFA 4AD8A 5HE8A 1FQKA 2AFIE 4V0MA 1P9WA 2CJWA 2F3RA 4XH9B 4D80A 1CIPA 1K6MA 1JAIA 2XNDD 4IVRA 4EFNA 5JZVA 2WIAA 1HH4A 2NQ2C 2VHTA 3C7KA 2UVQA 4Q48A 3PQCA 2E87A 3K9HA 1A5TA 1U0HC 2FEOA 4YDSA 4C3ZA 1IHUA 2G0NA 1E96A 1KSHA 1L2TA 1S96A 4C0BA 4CEJB 2ZE6A 2AN9A 3WRYC 1E2NA 2BKEA 1XEXA 2VP2A 2DFTA 1OXUA 3GCGA 4TYQA 3ZIAD 1SULA 3UPUA 2ASEA 2GJSA 2REOA 4LYJA 2EYUA 4M1SA 5FFMA 3UK6A 2QN6A 4CEJA 5EZ5A 4TLAA 4DB4A 4PC1A 2QY9A 1Z0DA 4NPHA 2V7QA 3VNUA 3LX5A 1XJQA 1W4BA 2BEKA 2ZE7A 4AI6A 3UKDA 2BHRA 3BH7A 4TLBA 1X86B 1OIVA 4QM7A 5AUNB 4YMTA 4DSTA 2ECKA 3KJEA 1VCIA 4LPKA 3KXKA 4X8OA 1W1WA 2MMGA 2Z4RA 3SFZA 2VF7A 2VRWA 3CR8A 3AVVA 2B21A 2F1HA 4RZ3A 4S35A 1TL7C 1S1CA 3TSZA 4D26A 4C7OB 4B2IA 3WMEA 1OF1A 4Q1DA 2WJHA 3U2QA 1P6XA 1FOEB 2W6ID 2FF7A 3BFKA 1R0XA 1JR3E 1J99A 4C7OA 4PR0A 4JBWA 2YOGA 2XTMA 3BIFA 3GLGA 1ZUHA 1KKMA 3W8NA 2ZIAA 4DUGA 1AK2A 2PH1A 2ZUCA 4A0HA 4MA4A 3RABA 2IEYA 1Z83A 2OBLA 4LOAA 5C18A 3OAAA 2GF9A 5AJZA 1E2MA 1IBRA 2ZEJA 4ZIRB 3HU2A 2Q9BA 1SKYB 4QG7A 5DH9A 4HUQB 1AS0A 2ORIA 1XMVA 5FPYA 5B2ZA 3VHXA 2BM1A 2ZQ5A 4AKIA 3JVUA 3GQBA 2IX3A 4ZIRA 1T5IA 1OW3B 2FFHA 4HUQA 1G16A 4HAYA 3HU3A 2NG1A 1TQ4A 2QTVB 1U8AA 1T8UA 2V1UA 3WBKA 1W2HA 1XMSA 3B1WA 4A8JB 3ADBA 4KYIB 3RS7A 2O8FA 1SXJC 3HYTA 3NBZC 5TVKA 1XTRA 1Y3AA 2QMUA 4UJ5A 3BK7A 4V0NA 2ODNA 1Z8FA 2R8RA 1G3UA 2WOJA 4O0MA 2C95A 3K0CA 4A8JA 4BZXA 4CF7A 3JZMA 2ORVA 3K9GA 3P20A 4GMDA 1YR9A 2F1RA 1NIPA 2JAQA 4NCHA 3GLIE 3RYTC 2WPDA 3SU8A 3QBTA 3W6PA 3SQWA 1YZKA 4LGMA 4FINA 2Q3MA 2ZROA 4M1TA 4B6FA 1KDOA 3DPUA 4LK2A 2CK3D 3U6KA 4QRHA 3SJBA 4BFZA 1G7RA 3NH6A 4DEXA 2QPTA 3QPUA 5FBVB 1E2IA 1T6NA 1Z0JA 5TV2A 4DSUA 3WMFA 3I72A 1JECA 3ETLA 4MRVA 2IT1A 1E9RA 4DBLC 3OFNA 1KMHB 4C0JA 3DVLA 3MSXA 1R10A 2AX4A 2FE4A 4QBIA 3VAAA 4I1OA 1KNQA 1YZUA 1W0KA 1P60A 1Z0FA 4D0LB 3AP2A 3HYRA 1GKUB 2GZAA 1YR7A 4TT3D 4BFTA 1E2HA 1G3MA 5J4VA 2GZDA 3UATA 1X1RA 3T1QA 4HLDA 4URUR 5FTJA 1XJCA 3KL4A 4MKGA 2JLXA 2JLVA 3VFDA 4D6PA 2CVFA 3BS4A 3IBGA 1HV8A 5EXTA 4GOKA 1T8TA 3T61A 2R6GA 2JJ2D 1HUQA 3LFUA 2FFAA 1U99A 4IFBA 2OSBA 4MYCA 3ZQ6A 2ZI4A 3GJ0A 1G9XA 3F3YA 1VG9B 1KK1A 5CK5A 2LWIA 5HR5A 4M0LA 2GVZC 4PC2A 1SVLA 1E1QD 3GJ8A 1C9KA 2GTPA 3QKTA 5EQTA 4X8LA 1M7HA 4TLDA 2VEDA 3QXSA 4KBFA 1KNXA 3PIRA 1CTQA 3B60A 2IYTA 4H9GA 3Q85A 2ZYVX 3K0FB 2BBOA 1G1MA 2QAJA 1W4CA 3NDPA 1GSIA 3DM5A 5CIQA 5LB4A 3FE2A 5JRZA 1H8HD 3K0FA 1G5PA 4DHEA 2BIFA 2QAGC 1DAIA 5BXQC 4FCVA 2ODBA 3WMGA 4R71A 3MJRA 4B74A 1SHZA 3FPAA 4XWKA 1GIAA 4NYJR 1JJ7A 1JR3D 4OKSA 2ERYA 5KUTA 1KK3A 2REBA 4LJ9A 1Q1EA 2WSSA 2C96A 2RB4A 2NPIA 3DMDA 4CYMA 2X1VA 2Z83A 3FTQA 4HDQB 4AIIA 4BLRA 2IS6A 4IDPA 3MWKA 1PJRA 2XX3A 4G5RA 1Z6AA 2BBWA 3KDSE 5AR1A 5FL7D 1KO1A 1AM4D 1WRBA 3SYKA 1H8EA 5JCPA 5FOTA 4D4KA 5GJCA 3T06B 5K8LA 4ABYA 3NIBA 1JI0A 2XOKD 4K46A 4QHYA 3AF4A 3AGPA 2PX3A 4ZO4A 2HT1A 1XEWY 4D81A 1AA9A 3DOFA 1G3RA 2VP0A 2QL6A 2NZ8A 3MUFA 1HT1E 2J0VA 1N6NA 1TF5A 2QE7D 3O8CA 2XXAB 1E2PA 5L3SB 1TTTA 3Q9LA 2VP4A 1HEIA 3VR2A 1KO4A 4YC7A 4CEHA 1I2DA 2BMEA 1ZRHA 1F3OA 4JKYA 3GJ6A 5K8UA 2J46A 3GLHB 4TL6A 2XXAA 5L3SA 3IEVA 4P4UA 1ZCAA 4D4MA 3D3QA 2MMCA 4UXJA 1NLZA 4H1VA 1H65A 1KSFX 4A15A 5GVSA 2P6RA 2AD1A 3AUYA 1NLFA 4QGGA 5C46F 4QJ3A 2H16A 1XTJA 2XNSA 1KSGA 3TGPA 3EZ6A 5JFGA 1GNPA 1JJVA 3GJ4A 4M1OA 1KSJA 3QG1A 5K8IA 5H70A 5CYPA 3K0AA 3PVSA 2XJ9A 1ZAKA 3B9QA 3E2IA 4A4DA 1LF5A 4QBGB 4AKEA 1WBBA 3CRVA 4RD1A 5EXXA 1QRAA 3SR0A 4GMXA 4RJLA 3THXA 2EFGA 3FYHA 4UNSA 3D7MA 3TE6A 3A4NA 2V7QD 4JSTA 1P3JA 2KBFA 1SHKA 1QVAA 1XD2B 4HAUA 2NOAA 4PFSA 2X2FA 5L3QB 1OXXK 2H18A 1XD2A 3PEYA 1JQLB 2JLQA 3KZ1E 3W8RA 1SVKA 4NH0A 1VDZA 4B3CA 5L3QA 1DADA 1PZNA 2IUSA 2ZRAA 3I61A 3MCAA 1P2TA 2QG6A 3KJIA 5FOSA 3I8XA 2OCAA 2VQSA 3ASYA 1R0YA 3ECCA 4QOSA 2A3RA 2ZAMA 1HE1C 1W48A 3GLFE 2ZR7A 4EUNA 3W6OA 4JT4A 3QF4B 1E2QA 4DUGD 4AYXA 2ZJYA 1LB1B 4V03A 2AK3A 3OAAD 2RGNA 3LY5A 4MRNA 4D4JA 4JL6A 3X1WA 4A0FA 1P2VA 2C8VA 1P72A 4OHYA 2PT7A 1UEIA 1KK2A 2QGNA 2OFOA 2P2LA 3QKRB 3OEHA 4LUCA 4TL9A 5FOWA 2H7VA 5TY0A 2B7CA 5CJPA 3QQ5A 1XXHB 2NIPA 2FV8A 4YONB 4US1R 2R62A 1J7KA 1BO6A 4Q19A 4BPBA 2ZRMA 4ZCLA 4Q1CA 1P75A 4PO8A 4Y0AA 4LC1A 1XXHA 3LA6A 5DYGA 1FNNA 3RRMA 2XB2A 1FMLA 2Q9AA 2VSFA 3NH9A 1OIXA 2RHMA 1LS6A 2PMKA 3D31A 4MRPA 3SC3A 5B64A 1DEKA 3E5HA 3U61B 1FPMA 3GEEA 3I92A 1R0ZA 5IDVA 4XJXA 4LI0A 2QAGA 3AF3A 1SXJE 4DLUA 2WOOA 5EP2A 4URVR 1KI1A 5CDFE 3V4RA 4AKHA 2WPDD 1Q21A 3TIFA 2CNWA 1E4VA 3N70A 3BJIC 2C2HA 4IEIA 1RRGA 1ZCBA 3CKLA 4LHYA 4XSHA 3CR7A 4DKXA 3EZFA 4E03A 2QSZA 3BC1A 2WTUA 1CU1A 2C77A 1W0JA 2QNRA 2VIIA 2ZR9A 3IKJA 4HB3A 4B3XA 3GMTA 4BECA 2O8BB 3K9LA 1TX4B 4JLMA 5SZJA 3OFND 1G8FA 1AN0A 1XDBA 2OCBA 4OJQA 1W0KD 1NG1A 4OL0A 5FPKA 4YMUA 4IXMA 4JLPA 1G18A 2CHGA 1MRSA 3AVOA 4BLOA 4EAQA 2GEVA 1XCPA 2DCUA 2BM0A 3NBXX 4CIDA 5FUWA 2BKUA 3A4LA 5CM8B 4LV5B 4G01B 1NKTA 2D06A 1BMFA 4LJ4A 2EFEB 5DLQC 1MR3F 1HURA 2HEIA 1E9AA 1KHTA 5EJEA 4MYHA 5G53C 2JLSA 3A4MA 1OE0A 2A5FA 3OE7A 4PZLA 1E4YA 2F43B 5KSPA 3WHKA 1EESA 1G4AE 2WKRA 4FMDB 2KE5A 3P1JA 4I4LA 4OHWA 5KNDA 3FKSA 4HAZA 3VU9B 2I1QA 1G21E 4DZZA 1CKEA 2QGZA 1HQCA 3AVQA 3SBDA 2WM9B 5GJVC 2OILA 4ZPXA 2GXAA 5FR1A 3W5JA 3LLUA 1FQJA 1MO6A 2A7QA 4NP6A 5BN5A 1E9EA 3BERA 2CVHA 3U7HB 4BLTA 1DOAA 4B2PA 1E94E 2NZJA 3LRPA 3AM1A 4B33A 1E9SA 3SJZA 1XF9A 4BEBA 2EYQA 1OB2A 2E9SA 1HTWA 4MGYR 4B6EA 2GCPA 4LPSA 5KYKA 1F6BA 4CRWB 4TSFA 3KQNA 5M04A 1X6VA 3RDPA 4C0AC 1KO8A 4EIWA 1CEEA 621PA 1OHHA 1GOTA 5CYOA 1N6RA 1NVWQ 3P27A 4B47A 1W2GA 2CXXA 3MG9A 4FMCF 1WP9A 2YVUA 1RPZA 2O0HA 3ZVLA 1KDRA 1QDEA 2WSSD 3BD9A 4HLQB 4C9BA 3MWYW 2ONKA 3J81k 2GVDC 3CX7A 4UNQA 3LV8A 3G5UA 5D3MB 3B9PA 1G3IA 1H8ED 2A78A 2GDJA 1X8LA 2Z6VA 4M9XA 4R2IA 3M4YA 4QNRA 4TTQA 5J4LA 1ZNXA 1TF7A 3FDIA 4TQUS 2LKCA 2ZETA 2IYLD 4QL3A 4CDGA 4L16A 4B3DA 5FPTA 2IYVA 1ESNA 4PAOA 1QVRA 3RRNA 4C0QC 4ZDJA 4QM6A 1CJTC 1UBEA 3QEJA 1VG0B 2H17A 1II9A 4HB4A 2AFHE 1DG3A 1GUAA 4TTRA 3EW9A 4BRUA 1G4UR 1N5LA 1D2NA 2KBEA 4URXR 4U7DA 1TUIA 4IHQA 2QENA 3OESA 2RGXA 3TUZC 5F3WB 2C99A 4LBZA 3HU1A 5JSZB 1GNQA 2YWGA 5DHFA 1CXZA 2JJ8A 1N6KA 3ZJYA 2Q6TA 3IPXA 2JLYA 1ZUNB 1SVWA 2CE2X 3CBQA 1XRJA 5EP4A 2OUKA 2IC5A 3L8YA 2D7CA 5CLQA 4Q7KA 3CH4B 1M34E 1XEWX 1XZPA 5P21A 2NO0A 3QNUA 1G3QA 2QZ4A 1GNRA 1NY6A 3NWJA 4EQ6A 3EIQA 2YJTD 1M2OB 3RS5A 1FNMA 3NXSA 4TMZA 5CIWA 3MD0A 3JVVA 4X8MA 2UZIR 3RSLA 3WNBA 5LD2B 2OV2A 3VX4A 2RHDA 1OXVA 3O8BA 4L9SA 4OK5A 3SS8A 5JI2E 2QRZA 1KI6B 2DHRA 4RCZA 2QU8A 1GVNB 4JYCA 2BWJA 3E1SA 1M1YE 1E79A 2HLDD 2ZS8A 2QP3A 2D4HA 1A4RA 1NSFA 3GD7A 3MFYA 5LB2A 4Q5IA 4NYJQ 4ZI2A 4L5BA 4QJ4A 3U3JA 1R5NA 2W0SA 4LJ5A 4UXHA 4TYYA 3BH0A 2F7SA 3LXRA 1VHLA 1MABA 1VG1A 1VYTA 4KLNA 4RD6A 3IDQA 5SZKB 4Q1BA 4R2HA 4Q47A 2RCNA 1ZC3A 5JCZA 3TW4A 1DAFA 3QKSA 1P61B 1PUJA 1S4QA 1U8ZA 2ANCA 3NEYA 5AK0A 3AQ4A 1AGPA 1ZU4A 4EKDA 2GCOB 4FXPA 2D3WA 2IYXA 3OEHD 4IKEA 3B2EA 3GP8A 3DKVA 4GDFA 1MV5A 3QY0A 3QEOA 2OCYC 4ZCIA 2GCOA 1SKQA 2VBCA 3FHTA 3IIMA 2WWHA 4M53A 4DCUA 4V02A 2ZSAA 2Q3HA 3CX8A 4G1UC 1D9XA 1N6IA 1E9CA 2P67A 2W83A 3QE0A 3L0OA 1UFQA 3DDCA 3GFOA 4DVGA 1NBME 3EPJA 4DLWA 4CGZA 1NN3A 2GAOA 2IF0A 3KUDA 4P32A 4QHTA 1F2UB 3A36A 4OQMA 1VIAA 1FTSA 4KFRA 2GXQA 2CNWD 2ZYWX 2C5LA 5L3VA 1F2UA 3A8TA 4F7WA 3WP0A 4E22A 2V4ZA 1E3MA 4N3NA 4NCIA 1RE0A 3ZLJA 3DM9B 3SE0A 1XEFA 4KO8A 1W0JD 3TQFA 1Z22A 3R8CA 2R9VA 1KGDA 3B78A 3DEFA 2FH5B 1FUUA 4W5JA 2NO6A 2QQ0A 2CDNA 4RKEA 3TVTA 2VSXA 3AF2A 3Q5EA 5CK4A 2P3SA 1PV4A 1WMSA 3UXMA 4RY2A 2CMKA 4OYHA 4QJ5A 2ZE5A 3VX3A 3TK1A 2P6UA 1TEVA 1NVVQ 2FSIA 4M1WA 3VHLB 4OHZA 2GESA 3EZ2A 4IRUB 1FMJA 2IUUA 4C2TA 1EWQA 2AXNA 2OHFA 1KDTA 1QHIA 3QVVA 5KNCA 3X1DA 2IK8A 4A1FA 1JEEA 2IEZA 1HA3A 3QXCA 4TMXA 2JLWA 1BMFD 2G1JA 1TQ2A 2ZRPA 4HAXA 1HY3A 2ATVA 3F5FA 5FOVA 3AVPA 1XEXB 4DSOA 3PEWA 3OE7D 5G3ZA 3GLIA 1G17A 3NTUA 3WRXC 3SN6A 4BQSA 3NHAA 1W49A 5FI0B 5DI3A 3V4FA 3T1VA 3FKSD 2YOHA 3EWSA 1FP7A 2P6NA 2ZI7A 3VKWA 2OT3B 4DT1B 3KKOA 2OESA 3AF0A 4QGHA 3PV0A 1J70A 1N2CE 1Z0KA 1UF9A 2SHKA 2NPFA 4QBHA 1X3SA 1TADA 5J4KA 1WDTA 1J8MF 4DT1A 4OK3A 4BEJA 1YZTA 4A82A 1XFAA 1G5TA 3HR8A 2ZI3A 5JS8A 1X8JA 4TSFD 3K70C 2D2FA 1OJLA 3AV0B 3Q3JB 1XD8A 2RH5A 1NN1A 3TVDA 5JJKA 1D2EA 1P9NA 4Z51A 1OHHD 3VKGA 2WIBA 3MGCA 4G5SA 3GLGB 3CPHA 2OG2A 1G5RA 1GKIA 4Z54A 3IBYA 2FGKA 2V1XA 4Y0VA 3TR5A 2DWPA 4ARZA 5SZHB 4KJZA 4MUBA 1IOZA 5UKDA 3PUVA 1M6NA 1MH1A 2OBMA 4XVRA 2WWYA 3SNHA 3THYA 3PEVA 4NL4H 2IYQA 2QMHA 4YLGA 1G41A 3MWLA 1GL9B 3KQKA 2ZRBA 2YKGA 2WVJA 3QPVA 2ZSDA 1QHGA 3LW8A 3PXGA 5JBQA 2WWFA 3KFXA 2E1RA 4UNRA 2V9PA 2O8FB 1GG2A 5JS7A 3FWYA 2J41A 3EAQA 1NY5A 3TKLA 1OH7A 1NN5A 3CPEA 2YZ2A 2WZQA 1FP6A 1OLOA 3EX7C 5TARA 4KFSA 2V3CC 1I4DD 5C4MA 2NGRA 3BB1A 1T3SA 2DY1A 3L82B 3CONA 2PLRA 1Z47A 4PHFA 3I5XA 3O8RA 1Z08A 2IYRA 3CRMA 4NDZA 1CRPA 3ICEA 2PCLA 4Q9KA 1ANKA 3TLXA 4E09A 1ZIPA 5JWRA 2DWOA 3BORA 3FFAA 4LHXA 1U9IC 2GK7A 4E5UA 2JCSA 2RKOA 4TLCA 4PC7A 1RW4A 5JJIA 3IO3A 2ZRKA 1Z0IA 2FEMA 2FPLA 5ELXA 2CLCX 4F93B 3GEHA 3C4JA 4O2RA 2ZM5A 5HPYB 1JXMA 1M7BA 3FFBA 4FN5A 1S0UA 2HUPA 3NKVA 4DJTA 4MGIR 1W46A 3F0TA 1X1SA 4NHOA 1IXRC 1I2MA 3VR5A 1UKZA 4LZZA 5B57C 4DLYA 4ASUA 4JS0A 5EE1A 3CH5A 4B43A 3NVAA 2HF9A 2YC4C 2JDIA 3I32A 4XTCS 4CEIA 1E79D 1Q20A 2BJVA 3KQHA 2F1IA 1DS6A 4PHGA 3ND9A 1IONA 2N46A 4ESHA 4FMBB 1F48A 1S8FA 5BQ5A 2G9NA 4W5HA 3EWAA 2R6FA 1G6HA 2HF8A 3ZZTA 5KOYA 4LSGA 1DO0A 2ZI6A 1Z63A 2YV5A 1OH5A 2O8DA 4LYHA 2NTYC 2IYUA 2ZVPX 1ZUIA 3VR6A 1TEXA 1NN0A 4YDHB 1OH8A 1DTSA 1II8B 1NLYA 1US8B 2H1LA 5JRJA 1ZM2A 2C04A 2Z43A 2JIZA 1Q22A 4P3YA 2O8CB 3L8ZA 2PCJA 3PUYA 1II8A 2YHSA 4TQ9A 3RAPR 1US8A 3JZAA 2VF8A 3U7GA 2QPAA 3A1WA 3KJGA 3NBYC 4EJSC 3KKQA 4Q4HB 2O8CA 3PG5A 4HEJA 1EFRA 1CJMA 1E9FA 5FBRB 5JMTA 2IUTA 2QROA 4LHWA 521PA 4R7ZA 1EK0A 4Q4HA 1YR8A 5FI1B 2FOLA 3B5JA 3GLFB 3SJAA 4Z1MA 3ZS8A 1NKSA 4RD3A 1UBGA 4F4CA 3SYLA 2PMDA 1DVRA 2ATXA 4W9MC 2GWHA 1UKYA 2O5VA 2QORA 3SOPA 3LBIA 5IRCD 4JJKA 3GLFA 3AP1A 4PANA 4DRZA 2BVNA 4Q1EA 5AJVB 2WWGA 3RS3A 1E6CA 4IOJA 3U3MA 4BZPA 3EPKA 2AKAB 2OM2A 1OT3A 1LFDB 2PZGA 5HE9A 4BFXA 3T1TA 3CNLA 1IN7A 1KI4A 3TSOA 3ADCA 4GP6A 1VG8A 3B85A 2QP9X 2GNOA 1PVOA 4TMVA 1KAOA 2IA5A 5AUOB 4I99A 1KZGB 2CHQA 3U60B 3MWJA 2IS2A 2HJGA 3DO6A 5F9FA 4CEHB 1WB9A 4DCVA 4M2LA 3Q72A 2JJ1A 1EFHA 2J0UA 2ZU6A 5ANRB 2P5SA 4LJ7A 1HT2E 2G3YA 4N0EA 2ONJA 2QP4A 3S1AA 1GRQA 3SEAA 1FTNA 2PJZA 1W7AA 4FCTA 1SXJB 5JHHB 4Q4AA 1S2MA 1AQYA 4BFWA 1I4TD 1G20E 2Y8EA 4LV8B 2EFHB 3K0SA 3K0AB 1SXJA 5CDFA 3I4LA 3TR0A 2EWVA 2ODWA 3ZD7A 3TRFA 4WA7A 3H1TA 3THXB 2WWXA 3I1FA 3WHLA 2J0QA 4JLDA 2IL1A 2W58A 4TZ6A 1IN8A 4C4PA 3W9YA 1XTKA
chains in the Genus database with same CATH superfamily
3C6YA 4WAUA 1O08A 4B9EA 1DU4A 1RMYA 3SLRA 3RYIA 4BY9E 4IQ4A 1C0KA 5EMMA 1ONBA 3BDVA 2ZB7A 3MIZA 2Y3IA 1FFBA 3LW7A 3R8XA 1C50A 4JL5A 3VPCA 1UZMA 4MO2A 3T4UA 1G2QA 2CW5A 1CF2O 1P5FA 3RVKA 3UC9A 4R05A 3FLAA 1IC6A 1XZJA 1PJLA 1RBZA 4TVKA 2KJQA 4KLZA 2AVDA 1HDXA 1Z0AA 3G0HA 4ZOCA 4EFMA 1R50A 1XDDA 2AG6A 3C14C 3QWBA 1XPOA 1GPLA 1P5RA 4K9KA 3EC7A 4G89A 1QP0A 1Q0UA 4PZZA 1CW2B 1DE0A 1LRJA 2OV1A 2PG3A 3PP8A 4DF3A 3KXPA 5JZ9A 4TRNA 5EQJB 1GCGA 3OQ1A 1Q5PA 3OSZA 5ALKA 3TE7A 5C8YF 3A3OA 4W82A 1NM5C 1QHXA 2E2WA 3C5CA 1IWOA 5HCNA 5JYEA 3D6TB 4EY5A 2IUYA 2VPZA 4OUKX 2A67A 1PSZA 1G21B 1HT0A 4Q9IA 4DV5B 5JWOA 4YGYA 2VRBA 1A9ZA 1R00A 1TLFA 2IFTA 2QT1A 4XX0B 1H4TA 1S89A 4Y2XA 5CMLA 4BBAA 2PRYA 2ZRNA 2FQXA 3HYCA 2W6JD 1WMEA 1PK9A 4PPYA 1G8SA 1P0IA 1RYMA 3JRWA 3D8NA 1LLDA 3KEOA 4V0OA 3I9KA 5A2GA 1EIWA 4CI9A 1D07A 4F85A 2A0FA 4WK0B 3EA0A 1NBIA 2YZKA 2Q4BA 2LNDA 3FHJA 4WACA 5EHQA 2EJWA 1OA1A 3PJEA 3LVQE 3QVOA 4FCWA 5JEDA 1NG9A 1SEPA 1N2XA 3GRPA 3JTEA 1OWMA 2H7CA 1DIRA 3LGAA 1HNWB 3ELWA 1R16A 4HGZA 4NE2A 1OPXA 4RDCA 1EFPB 1XKQA 1ZOLA 4LI3X 3O92A 3OF5A 4OB7A 4QTTB 5AI9A 3SPXA 3BFVA 5K0TA 2IDMA 4JI4B 2QL7A 5BN1A 3Q2IA 1VIVA 3ND8A 2NXEA 3KSMA 3NIDB 3C4VA 2JLUA 1TA4A 3NWOA 2F3PA 4A23A 1Y3FE 4E07A 1CS0B 2Q3FA 3P9QA 3R0VA 3KKLA 5E6RB 5U1PA 1KMIY 4U6QA 2GRAA 4BX8A 5AOAA 1HLGA 4ND6A 3RTEA 1LZKA 3SZRA 1N7GA 1UK6A 3W4KA 4GGMX 4NPCA 4PBSA 5HJEA 4XVUA 1J9GA 3KKPA 1HLPA 1TKCA 1M6YA 2ZDGA 4P98A 5AESA 5ECYA 2B4KA 3VR3A 3GLQA 2BCGY 2EFCB 4HDSA 3S8MA 5BV2P 3KAPA 3ZYZA 3N3AC 1SD2A 2AOUA 3P94A 3KXIA 2LIVA 2YJ4A 1AGRA 1RFGE 2GFIA 4HNQA 4PSVA 2Z09A 2GPNA 1RT9A 4P4LA 3VR5D 3U49A 1PR0A 2GSDA 3BMQA 2OECA 2V7PA 2ZT6A 4FZVA 1R0SA 3BMOB 1GPAA 2YWBA 4AY2A 3QPCA 2AJBA 3OT5A 4LMPA 5TSDA 1K6IA 4BO2A 1HLFA 2OHGA 5CT5A 4QFMA 4B80A 3NJRA 2G7MC 2WF8A 1I1OA 1Z2CA 1Z56C 4FONA 1D6JA 3U7FB 2I6SA 2R86A 1IBLB 5L7TA 2XMSA 1LBIA 1Y1KE 2V3VA 2I1LA 1U2QA 1DCMA 3NG1A 1E3LA 1X0VA 1TTQB 1SK8A 3IVMA 2WTEA 3OCJA 3UUGA 4QBTA 4A36A 2B6NA 2Q6LA 3GEMA 3EFOA 3O8QB 4PX3A 4YP6A 5T5QA 1FYEA 4HY3A 4PCUA 2SNIE 4BGVA 2IEDA 5FBHA 5I7VA 3EB9A 3ZK8A 3LL4A 1T2DA 1MB9A 2BUCA 3DZBA 3R6GA 4MNTA 4OGFA 5ENVA 4ATNA 1PFVA 4UNRA 3N76A 1P6QA 2J5BA 1AS3A 1GY8A 2PAAA 3OE5A 1ZM3A 4JITA 4EGQA 1BWPA 2WKPA 3WYAA 3O1HB 5J2UA 1BE6A 4CU5A 3RSHA 3W5IA 5DCWA 4PY2A 3WLEA 1UAAA 4IKOA 2XUZA 1J97A 2BJWA 2IHZA 1P2GA 4KAJA 4TVOA 3UG7A 5LP6A 1XWIA 2JIZD 3W7VA 4CMIA 3Q7PA 3R7NA 3W1WA 4RVFA 4EPRA 4AF6A 3NYQA 3PNLA 4ENRA 5D84A 1D5CA 1SPBS 5CTAA 1PJQA 5IHPA 1L1RA 4YPVA 3GY0A 1PWXA 3H2YA 3W5DA 3S27A 3CLKA 3HQ4O 1WNFA 4BVHA 3KD3A 1R8YA 3ZY3A 1D2AA 3H8WA 3T7EA 1NVKA 4KI0A 1M1YB 1XCOA 4EZIA 2HBZA 5JC8A 1ZDMA 5KWIA 2CLOB 4M22A 2HYDA 5FO1A 1IXSB 3U4GA 2C7GA 1TUBA 1Y8ZA 4KPGA 4DR7B 2YL2A 2KX7A 1KRHA 4ZP1A 1IN4A 1MU0A 1CQIB 4PSAA 4D99A 4U2GA 3MAGA 1IBCA 4Z1MD 2Q0HA 3MTEA 4C0LA 5JZSA 2Z9CA 2GASA 3KO8A 4UU7A 3OA2A 3CKMA 1K8YB 4FMCB 3CM0A 4FFMA 4HLUC 1VYUA 4H7FA 4M9UA 3QLJA 3RQSA 3QHPA 1V35A 2I29A 1MH9A 3PC6A 4LXGA 4QBFA 3DBHB 3IUQA 4JJGA 2FPKA 2G1KA 3I2HA 3NM6B 2WJIA 2YHUA 4GT1A 2IYWA 2NUTA 1C3JA 1SWWA 3NKLA 3KQSA 4XIGS 1Z4OA 3VSEA 4MVJG 4MRSA 3ACBA 3D8SA 2OV6A 2UVPA 1NM5A 1VGQA 4A2WA 3D6MA 2MCFA 1XA4A 4IS3A 3F6SA 3PSHA 4LHZA 5L9AA 4P53A 3F3SA 1W5EA 4IRXA 4LOIA 3L49A 3BQNB 3A1TA 3JQBA 2JIMA 3SP1A 4P4NA 2HLPA 5JMPA 4B44A 3N7AA 4AAYA 4Q9AA 3TTSA 4C87A 1UMCB 3EJWA 3IS3A 3IHWA 4R9UC 5C1PA 5EIEA 2I1VB 4IW3B 2C31A 2R7NA 2WINI 4H3HB 3X2SA 5GADl 3VVMA 4G1CA 2JJMA 4CMEA 1AKTA 4D9JA 1CRQA 1BXGA 1V9CA 2PV0A 2ZAOA 1T9HA 2Z2KA 4TV8F 1JA9A 2YY7A 4H6XA 1WQ3A 4HNRA 1HORA 2FWBA 5AIBA 2A2ZA 1L8OA 1OFHA 2G08A 3CVVA 4LTMA 3ESZA 5ITZA 4GZ3A 1RM3A 1CR4A 4MRAA 2GBLC 4L73A 4YALA 2WAAA 4Q02A 2VDUE 3MINB 5MFZA 2K6GA 5E8JA 2B0JA 2F3SA 4CUJA 1E2DA 2WFLA 3SY8A 5INTA 1VE5A 2JATA 1NQ5A 3OZCA 2ZRFA 3BXGA 4UNIA 3KQUA 3KG2A 4ZU3A 4OQNA 4CW7A 4JVLA 3HFSA 3QYJA 3U7JA 4EQ6B 1RI4A 4UAUA 1P1CA 1PO7A 3GRCA 4QQKA 4EG8A 4E3WA 1I3CA 4M6WB 4QJBA 2APJA 5KHAA 4OQFA 3DLBA 5IKEA 5LZ2A 1U1FA 1WKBA 2PZKA 5LQSA 4DL9A 4GBMA 4IIUA 1IEQA 3FIUA 3M7IA 3SX2A 4B09A 5EWMA 2AFIB 1JFLA 2ZIGA 2Z8YA 3VISA 4DDVA 3FHOA 2XUHA 2AIRA 2Y99A 1GGNA 2XD4A 3GFSA 4GUAA 1VTKA 4CKEB 3T6KA 3CVXA 3TZBA 5KPJA 1YJCA 2DQYA 2WDZA 2HA6A 3TBHA 4DDMA 2X9LA 3CUVA 3LX6A 4MAMA 2DHDA 3ZWKA 1WZEA 6CHYA 2FA9A 1GPUA 3G82C 4RXUA 1FFHA 1KL7A 1SKMA 1RYYA 3PDJA 3PLAE 3X1MA 5KYWB 1P2DA 3ETJA 4IG9A 4S1TA 4TVBA 2EU8A 1A9XB 1XCMA 2JASA 2OB2A 4FOSA 2WMDA 5D3KA 3AYZB 4JSRA 3RODA 3VRHA 4I50F 2XLCA 4UC0A 1JJFA 2AE2A 4A27A 1ZNZA 4NBKA 1MCZA 5FV4A 5CDUA 2Q0XA 1O6FA 3M4NA 1S2IA 1BC5A 2I6GA 3QKSB 4NMMA 4QDTA 2H2FA 3EVTA 4LTNA 3GXBA 5K0NA 5K6AC 4IJQA 2QRMA 1PJCA 2QWXA 1AHNA 5JWHA 1TKAA 3N0RA 5BVHB 2IZ7A 4LYAA 4GI5A 3GT0A 3SQXA 3VTAA 3ZYCA 1USKA 3EDMA 1XTTA 3ZJ5A 1QR2A 4MR7B 5TMEA 3RANA 2X6QA 4W8GA 3TDMA 1P5ZB 4RV9A 1CR0A 1XALA 4UM9B 1DMSA 1FA9A 2PBZA 3AJ9A 4CCYB 2PT6A 2QRGA 3TTYA 1AKUA 2WJAA 1QH8A 1T0PA 3T4XA 4CUKA 4DV1B 4WLNA 1ZBQA 4AKGA 2VWQA 4DLNA 5MN5A 4P8RA 5TT1A 2AFRA 3U3RA 1E5LA 3QXJA 1YCHA 2AQ8A 1A1SA 4BBZA 2PX4A 3JAKB 1AIPA 3LT2A 4TSKA 1V8BA 4YH1A 5FWYA 4OQLA 4QYIA 5EXDA 2FWNA 3FI9A 2GAIA 1GPYA 3N8HA 3VZRA 3GFFA 1B8VA 1F9EA 1DX6A 5KC8A 2G9UA 1B6RA 1M0SA 3SQNA 2GI4A 4ZJYA 3HH8A 1TA0A 1NOJA 5EMNA 1F4LA 2JFZA 4G97A 1YS4A 1ACLA 1BTOA 4DLXA 2RJOA 1EGHA 3LXMA 4EDHA 1L5MA 1X1BA 2EZ9A 1WUKS 2COEA 2PLFA 2NU6A 2QZJA 4G0XA 4HLUA 1QZXA 4QA9A 5HDBB 3VPFA 1PFGA 4B6SA 4B7XA 4E70A 1MG5A 4LFCB 5A5GA 4B17A 2R68A 2VKTA 3MAAC 4FFDA 4O33A 2YWXA 3PCXA 1CWUA 3VR3D 4OSPA 4TTPA 2WHQA 3FYSA 1LPPA 4HDKB 4DYVA 2O48X 3VR0A 4Z4IA 4C07A 2CVOA 3AV3A 3Q3CA 2QW0X 1UINA 1S8AA 3BA1A 4MGZR 4TM8A 4EHBA 5AVXA 4M4SA 5EMKA 3WAJA 2GH1A 1RJ9A 2H0RA 3E61A 4L9AA 3WFJA 3E4DA 4F4DA 1DARA 3DE1X 1IMJA 3AOEC 3DQZA 2FR8C 1JB1A 3CUUA 4Y67A 5TGTA 1KYQA 3LY9A 3H9UA 4K9RA 3GW8A 4RYDA 1YULA 2YN2A 3AF1A 3DE4X 3M3PA 4QOJA 2FPMA 2B98A 3D2AA 5LYJA 1HE8B 2VHYA 2GEKA 2H5EA 5KEIA 1JXAA 1EJBA 3JWEA 4R5HA 4CTNA 1N0VC 2WIGA 4HTFB 5FTMA 3NEPX 1NT2A 2ZSJA 2LBPA 2C3YA 2EEZA 1RWKA 3ROFA 4K8OA 3W34A 3PCRB 5KMGA 5L51A 1GNTA 1HDIA 5DOVA 2Z3VA 4JAVC 3OTIA 2ZAIA 4OSOA 1M72A 2J3EA 3RNOA 1RC8A 3VPAA 1LDNA 4UQOA 1B73A 3TIVA 5GAJA 4D4GA 1ST3A 4HZUB 2GBLA 2L82A 3AUTA 3TLAA 1N78A 2PGJA 3QYAA 4KCGA 5CFQA 5KQGA 1UT8A 5H82A 2FN9A 1DP4A 4RF2A 4JEHA 4YK7A 3K4PA 4QPDA 5IT4A 3NALA 3C3PA 1F3LA 3Q3VA 5F98A 2ZLBA 2J5XA 1KXJA 4WQMA 5JNRA 2IDJA 5JY6A 3DFZA 1RIFA 3PVZA 3SWWA 1YZGA 2P65A 4J1TA 4DGSA 1C3OB 2WUFA 1B43A 1FL9A 4CLOB 2IODA 2GJKA 1A9SA 1G38A 1VXOA 5TXGA 3G0DA 1V6AA 4Y30A 1X8KA 1XF1A 3O5AA 4FSXA 3UK0A 2AMJA 1P0MA 3H8VA 4AJNA 3F5QA 3O83A 5HJ7A 4QO7A 1FVFA 1JFRA 1UWLA 1G19A 1ZD2P 2VG8A 3FA2A 2AXPA 2CHEA 2NZVG 4G63A 4I6JA 4QQFA 1RLMA 4XWWA 2B4TO 2I6UA 5DBIA 1DL5A 2F3TA 4ML3A 3ILXA 2NU8B 1GRVA 1SBHA 1Y37A 4F5YA 3R7AA 2VJMA 1ZESA 4Q7JB 3W7AA 4DV6B 3K8QA 2MDTA 5K0ZA 2OPBA 4YS6A 5LQNA 4MKIA 1MNAA 2H1FA 2VUUA 1EUZA 3T7KA 4DRXA 5I4KA 1A97A 3TCKA 1CR6A 3EDYA 3ZR4B 1WZ2A 1G64A 5AKJA 2ZM5A 4M0CA 4E33A 5EGNA 1VBFA 2DFKB 1T15A 3PR1A 3X1JA 4K03A 1CDOA 1Q6ZA 3IOMA 4WBNF 3PHIA 1IY8A 4DAOA 1X14A 3JZIA 3MHPA 4OHUA 3RRYA 3R9WA 4S12A 2CJXA 2CWDA 4GFDA 2C1ZA 4KMSA 1R4ZA 2C5GA 3PFNA 5TPZA 3N2IA 13PKA 1ZWKA 2BLLA 2EGUA 1EK1A 2PZLA 4W63A 4E4RA 5IM4F 2PX8A 4HFNA 2O8NA 2ZCUA 5DW3A 3SC6A 2W43A 1FX0B 4JJ6A 3TCNA 4GF5A 5HM8A 2HRZA 1W44A 2H1HA 2Q1XA 4J7AA 4TPKA 1TYDE 1VA5A 4PVDA 4CCAA 1Y7HA 1BKDR 3D3WA 3KUKA 3TOSA 4IOMA 4RZIA 1RRCA 4FR5A 1DTEA 1M5TA 4RK5A 4MKFA 4CTJA 1HQYE 2EFJA 1PFYA 2R8PA 3NZEA 3P2OA 4LJ8A 4U8GA 3UIEA 2CXPA 3OEEA 3PL5A 3BIWA 4Z53A 4EKGA 1O7JA 2WICA 5A3VA 4F5ZA 1OB5A 3WIDA 4MS4B 5AI0A 3K15A 1LA2A 4RZUA 3U56A 3ND5A 4N54A 3AKZA 3PJFA 3ZW8A 3UHAA 2OXTA 1UEJA 4J16A 2GXSA 2YV4A 1B2LA 3AEQB 2ZRLA 4MLCA 4ZDWA 5T4BA 2ZTSA 2XITA 3EXIA 5IDYA 3ISTA 5BSTA 3DD1A 2P2GA 1OA0A 1CVLA 3CX3A 2TMDA 4BNVA 2JLZA 1MP0A 1IEVA 2AW5A 5EY5B 5DNUA 2C4VA 2FSHA 4GC9A 1NVEA 1QOZA 2HV9A 1Y1TA 3BHMA 3N07A 5HFJA 4AL4A 2I4OA 2Q5HA 2B30A 4H3SA 1ISMA 1U0TA 3WYFA 3H3FA 1XPUA 5JATA 4EP1A 3BOSA 4KB5A 3PGLA 3RAEC 1W4ZA 3QRWA 1PEKE 2R751 3V8EA 4MRRA 3DT6A 3A4IA 4O3MA 2NM0A 1EI9A 1VMKA 4RFSA 3TOVA 3UWPA 1ND6A 4MLDA 1Y1RA 1YZLA 4BN5A 1G20B 1MJNA 2DMRA 1LBTA 1MO2A 3RBZA 4EB6A 3AWDA 3CTPA 2Z2JA 2VQFB 3ITKA 1QYWA 2QQEA 1NQTA 3AOEA 2FR8A 3IAS6 5C4GB 3S2UA 4Q01A 1L5OA 4WUTA 2G5PA 2OQRA 1XAGA 2QRQA 3T7DA 1LV7A 1DMRA 5LZ9A 1BE8A 4PCVA 4Z3KA 2AL7A 2GZHA 2W37A 5K0JA 1ZMOA 4IIHA 3TLMA 2CVZA 2YFQA 2R79A 3TZ6A 3A1UA 1MX9A 1P77A 3RUFA 3RW9A 3EAGA 3T15A 1IRXA 4QYWA 4LK3A 2V6BA 2G5CA 3R44A 1Z4JA 1SOAA 1VBMA 2I8LA 5F12A 4XR9A 3ZH9B 1MJ5A 4QGBA 3DOEA 3L02A 2SBTA 4R8MA 5AP9A 4E2XA 4E88A 8GPBA 4QZVA 3IB6A 1J56A 1JVNA 1XJWA 3P9CA 1Q50A 1CQPA 1IXYA 3DXFA 3DT9A 4AURA 2XWJI 3FDXA 4JBGA 3KXLA 3LC1O 2Q27A 2XNJA 1Z25A 2J3JA 2JFGA 3CUEF 4NNOA 3H2JA 4M9CA 1VIYA 4S3MA 4BMXA 1VJ0A 4HAVA 1VXRA 1ZH0A 2H1SA 1OBHA 2NNLD 3CZ5A 3NHMA 4YV2A 3OO0A 3WNZA 2W2VA 1Y3BE 2CT8A 4NCBA 3A6PC 1CB0A 5CNMA 3R9IA 5FL3A 4EARA 3LBYA 4O02B 2C84A 1YL6A 1ESZA 1YKSA 3D0OA 4HDCA 4UNPA 4C2UA 1JH8A 3AG5A 2W4MA 4F3CA 1KI8A 3HL0A 5BN3A 4JIGA 3LE8A 3MNFA 4IFEA 5BSGA 5ALZA 5KYUB 3CA8A 3KTAA 2CBZA 1H2ZA 3RWMB 3WLAA 4OGLA 3JVDA 4DMRA 2ZSBA 4KNWA 1J20A 3S2FA 1GTVA 4U8HA 5ALYA 2R47A 3H9JA 3EHEA 3K1TA 3DFIA 2ZIEA 4GR4A 1NMXA 4NTZA 3D7KA 4ZAFA 1ZCJA 1Y9JA 2P9ZA 3LAWA 5B3JA 3KKEA 1A69A 1TM5E 4M9RA 3U62A 4O2AF 1AKYA 3BXHA 1F4PA 1J90A 1NSTA 3V33A 2C03A 4FVTA 1NRIA 3G5LA 1RXSA 2PS0A 1YNSA 4BNDA 2XUAA 3UA3A 3FUXA 4UBJA 2JFNA 3LQRA 3PGMA 2J0UB 4BS9A 3L0DA 2AJTA 4LYGA 1QYCA 4CNQA 1R37A 4M1YA 2WMOB 1MQSA 3S1AB 1UPUA 2M1XA 1R5OA 2CXNA 4CN9A 2JZCA 2WYOA 5C8ZA 4MROA 4TT8A 4LZJA 1V1JA 1O6ZA 1FP4A 1UT5A 1NJ2A 2OQIA 1GN8A 2QNBA 2W71A 2ZOSA 5IKPA 3QSYA 2J1LA 3CVYA 4YCAA 3QBVA 5L95A 4YJFA 2WIFA 3EVFA 3V4OA 1J39A 1NI5A 1V4NA 2UZ3A 1B8PA 3HBFA 3WBBA 2ODPA 5EFOA 3ROGA 1HL3A 4O4IF 4MRMA 1P8AA 2IEGA 1PEYA 3B1VA 5EHGA 3ZH2A 5FTWA 4LF5B 2FX5A 3B1FA 3RD5A 5KVQA 4PYOA 1L5LA 1ODFA 3PFIA 4XEUA 3GJSA 4ZI5A 1KK0A 1WXQA 2NYUA 3KJQA 4JQOA 1QO7A 3B3FA 2J9XB 4JJ4A 4RY0A 1VCMA 1YZFA 1AXRA 3ZGXA 2KSQA 2WYWA 1BNCA 1YI0A 3PXBA 5ESXA 4WA8A 1JFSA 3CVWA 5I4IA 4XCVA 4CJXA 1DKUA 1Z39A 1QTRA 2RHWA 3P45A 3STUA 3N2ZB 1KQPA 3MJ4A 4RMNA 4E6PA 1WU7A 3LTNC 2H1RA 2YMLA 3A1VA 3IUEA 2BLNA 2XDQB 1J2TA 3QVTA 2PMCA 1E61A 1C1XB 1WHSB 3F46A 2VT3A 2BFCA 2CVPA 3I1JA 3IT3A 2HAEA 2IDZA 1N92A 5IK2A 2W8ZA 1XIVA 5FUVA 1CD5A 3VKFA 5HFAA 1E20A 4JYBA 5BSMA 1SEVA 4ZYZA 1FTYA 3GLHA 1G7SA 4PLVA 1CZKA 3QUQA 1P7ZA 2GBFA 1B42A 1WCWA 3ZDCA 4REQB 3A9SA 2NUPB 4LJLA 3DV2A 2BFFB 2OCPA 3CKKA 5ALGA 3BZUA 3DGEC 5EE0A 2Q5JA 4CLDA 1QIHA 3P9NA 1G0NA 3R23A 5F4ZA 4ILEA 2GYVA 3MGGA 5JNWA 2ID7A 3UK2A 3IPYA 3O93A 3ZV4A 3HXMA 1OV4A 2QJOA 1ENOA 4G24A 2HHJA 5DBFA 4HYYA 1G2OA 3G2HA 3TNLA 3COYA 3KALA 3JASB 3IALA 4MV8A 1IJEA 2I03A 5KSWB 5KNDH 2YH2A 5A03A 1KZ7B 2HA0A 2EBWA 4EKIA 2V7UA 2WQ7A 1BWSA 1S3SA 1IQPA 2WM2A 1TT5B 1QFSA 2O6LA 1O94A 2WPNA 1SQ5A 4MJXA 3WP1B 1YDEA 3FZYA 2IXTA 2YMPA 1NVVR 1AV7A 4JQZA 1GG5A 3PFBA 5ADVA 5LJIA 3EZNA 4PXSA 2GD6A 4MWBA 5TPZD 3AHCA 1XNRB 5G0SA 2C9CA 2JAWA 4GX5A 3X1YA 2F1KA 3E3NA 4XD7A 3PITA 5AM5A 3S5UA 1YB5A 4BQOA 3L4SO 3QENA 5EPUA 2QOEA 3U5ZB 5E9AA 4OMUA 1GGKA 8ABPA 3WRWA 3MCZA 4K40A 4BE4A 5CFMA 3V32A 821PA 1KI2A 3I09A 1RPNA 1T29A 2WTAA 2YJZA 2QVCA 1T5DX 3R2JA 4LNUA 2P3LA 5JVDF 1E0JA 1N0UA 3UV3A 4U7WA 5K2OA 2FTKE 1RQXA 4FQ8A 4EJSB 2X4IA 4RK1A 4EKYA 1NBHA 1QHHB 1UJ5A 3KK0A 4TTIA 2QIPA 1JDJA 4IDAA 3C8HA 5DGXA 4RYLA 4BL5A 4FUQA 1JMYA 1XU9A 2GK6A 2RI1A 4MQBA 5JI3E 3EGDB 3IV6A 3OEED 5CNJA 2XCTB 4FNAA 3EULA 3LNCA 1TCVA 2RGGA 3EQ2A 1Q74A 3B82A 4S1WA 1V43A 3QPWA 4OHMA 4N8SA 4HNTA 2OM6A 3HPQA 2FSFA 4KE9A 4D4LA 1ADFA 3IQGX 5HOEA 3OWXA 1T2VA 3OBBA 3R3JA 3PQ3A 4TVSA 2ZIFA 1VPWA 3QKRA 3BTOA 3I2FA 4A8TA 4BLWA 2FX3A 1QGAA 2OFXA 3NHSA 1JHUA 3I64A 4JHLA 4RE6A 1C1DA 2P1RA 1AXEA 2PZJA 1ORTA 2YXPX 2ZAGA 3O4GA 4YAWA 4A10A 4X6YA 1T3TA 3OKAA 4QQRA 4BZWA 1DUSA 3EG5A 1DIHA 4N6OA 3S0JA 4PLHA 3W79A 3ZCQA 4ENPA 2FZCA 2W2XA 5DNVA 2PJRA 2NMVA 1T35A 5TQ0A 2VLIA 2C7QA 1EB9A 4H15A 3EPHA 3ABIA 4PAGA 5FBQB 3GGPA 2PIAA 3A2MA 1NXWA 3MOIA 1OPRA 4GAEA 3RSSA 3DE6X 1QVVA 2QD3A 2XVAA 1YCGA 2ID8A 1N0IA 3A4YA 2GCEA 1QGUA 1Q0QA 1MOPA 3CRQA 1R8QA 3NGXA 3D7LA 1SAYA 2I4IA 3OLQA 3PHGA 3E1GA 2AFHB 4XSGA 3TX6A 3VYRB 3IKMB 1CNFA 1LS1A 4GVLA 1D1SA 2HU7A 2QSYA 3HKBA 4IFIA 2CHVA 1O3YA 2KB0A 2AJLI 3OIYA 4O29A 3VC7A 4I55B 3ZI7A 4IDNA 4B76A 4EUHA 5C1BA 2I0FA 2A0YA 4ITRC 4JLAA 4UVHA 4MR8A 5GY7A 5KTMA 1B16A 3LBHA 4B4VA 4BGEA 4HGQA 3TD6A 5T6MA 3TFQA 4U5XA 4YREA 1T36A 2FPGA 2AMLA 3WYDA 4E5PA 2P9FA 4DGQA 3D4OA 2HLNA 3KUUA 4X61A 4BLPA 1E5DA 4UUOA 1CZRA 4N65A 2PFSA 4AMBA 4DSAA 1U0EA 4JOQA 1QG0A 3VJRA 1OFUX 1OZGA 2QEQA 4FEGA 1A2KC 1X7ZA 2I7DA 3LGSA 1ST2A 1M2HA 2H2IA 1YE5A 2C20A 3EG9B 4FMPA 4JJZA 4PC6A 4QDKA 4TLMB 1MIHA 4WT7A 4ZVTA 4PN7A 1SUBA 2Y1EA 2YWEA 3NXKA 3Q15C 5BRAA 1K1EA 1DBRA 4HZIA 1NV8A 3S29A 1J09A 1Q12A 3KCNA 3RFTA 4ALKA 3NVKI 4AWXA 2IBSA 2R7MA 5KREA 5A4DA 5BYJA 4PPNA 3CC8A 3EY9A 1YQWA 4Q4JB 3RC7A 2RIPA 4FHCA 3OIGA 1I33A 3PNKA 2Z2IA 3UHPA 2KLBA 4GG1A 4AQYB 4RKFA 2YX1A 3KLNA 3P19A 4RJIA 2QKYA 4UVDA 4CKXA 3QG5A 3X1ZA 1IMOA 2YNMA 5DKFA 3RFUA 4B75A 4UM8B 4CKWB 5JBIA 3K2IA 1MGOA 3GNLA 2W8BA 2O0KA 3H7IA 3R1IA 1RJFA 1SUPA 2F43A 3GR6A 5A4KA 4I8XA 3TWOA 1FLDA 1L7VC 4I1SA 2W2TA 3HCRA 3Q88A 2QTLA 3ELUA 5DHRA 3ESDA 3SJCA 3H99A 1LK5A 1SVMA 4GP7A 4RTOA 3K70D 3JQ7A 3R5TA 4P84A 1RKQA 1KF0A 3NANA 4NCKA 1QOQB 3O8OA 4G0NA 4RUKA 1NL3A 5EIOA 3OQMA 1FJGB 4KBYA 3WGGA 4BAZA 1Y4ZA 5C4IA 4M1QA 1KYZA 1ZHOA 1CJUC 3I23A 1T9DA 3CRRA 1UK9A 2CV1A 2NU7B 3EIUA 5AK6A 1SUDA 5K5EA 5LNK6 3HSKA 2UYYA 1F5NA 2YS7A 2MSCB 2A5DA 3CX6A 3MJVA 4N40A 3DHWC 5F9MA 3FOEC 3NC1C 3VPBA 4J91A 1LC0A 7GPBA 5AVUA 4KV7A 4OUDA 1GARA 4RD4A 1K7EB 1DO8A 1FNBA 4R6WA 4H0NA 5FP0A 3LPLA 2CD9A 3COZA 1JEYA 1L7AA 2IXEA 3BJZA 3H8SA 4MW9A 3UJ6A 2QRVB 2JFFA 4OHKA 1U8CB 2AJDA 4GE0A 3TZKA 4DQ0A 2F8MA 2I7VA 1SBCA 2RC5A 4TV8A 1IDN1 1RTTA 1G8PA 2WJ6A 1ZW1A 4K3VA 1X7XB 4HWPA 3FKQA 5D5QA 2HQRA 4DCCA 4EPXA 3HFRA 5DM4A 2PGXA 3IUSA 4B34A 1X1QA 5CYGA 1WTCA 1FTGA 1Z4PX 1NPDA 1NVGA 1N7IA 1OFIA 5D3MA 1KIAA 4DLKA 1EVQA 4WLEA 1O8CA 3CW8X 5DEIA 1Z6YA 2WSMA 4DDTA 3WLSA 3KVYA 4A3SA 4MWEA 4EYEA 4EVQA 2ZG6A 5KIAA 1C2YA 1T5BA 3W6ZA 4YRKA 4Y3UA 3JQDA 1UBLS 4ZOLB 1CJKC 1DAGA 3AKEA 1LDBA 4RC9A 5KOJB 4YI5A 2DAPA 2GDZA 1U8YA 4KOAA 1IBKB 3ENWA 3H0KA 2D2IA 3AHIA 2XT9A 4F86A 2BDUA 5IK2D 5JLJA 4E31A 5A7FA 5JJLA 2GJ9A 1IQRA 1P1KA 4RGQA 3V8MA 4YHHB 2OBNA 1YACA 4EG0A 3AY6A 1B26A 4KMMA 5A9SB 3ONFA 5G4KA 1NXSA 1N9GA 5EG5A 4NC9A 4UDNA 5H1YA 3M8KA 3V8BA 1P8JA 5MDHA 4RTKA 4W9NC 1E1CB 1P5JA 1QF9A 2CF6A 4K0KB 3O95A 2HWWA 2WHPA 2E4WA 3M0EA 4NKRA 4O2BB 5EHZA 4N1AA 2QM0A 1FC0A 4EW6A 2HJVA 3UYLA 5IJ9B 4W9RA 4N0DA 3VI4B 1T1GA 4C14A 2HSWA 2R85A 3KU1A 5DHSA 4Z4EA 3VSCA 1Z12A 3PQDA 4FUTA 3BXZA 4EELA 4OM7A 4ZCRA 1BH2A 1I4WA 3JQEA 1M0WA 4JJ7A 4I50A 3EIOA 4KXWA 3KKNA 1FNCA 1N1EA 3I9V1 4TS1A 4OHBA 4MQ5A 4FLEA 5IYZB 1O94D 4U9IS 1W76A 5ALJA 1B8OA 1OSNA 1DXOA 4RIEA 5D00A 5HQ3B 4Z9AA 2AOWA 3GP5A 4LWPA 1XE3A 3EVGA 2GN0A 4KR0A 1CULC 4BC1A 2PLAA 1KBZA 5AKIA 3WQQA 3E9EA 1Z8HA 3T94A 2ADOA 2ZIUB 2PX0A 2ZWAA 4BXOA 2YXBA 1R3DA 2P0EA 4XD7D 1N8KA 3KPJA 3LVBA 3KQPA 3RUIA 2PRJA 3AM3A 4H4DA 1FLNA 1UMBB 5DF1A 5TJ9A 5F2NA 5HDQA 3D1LA 5J5CA 4AC9A 5LXTA 2QNIA 5CEEA 3R7BA 2Z9DA 3BE5A 1U0GA 3DAFA 1EFVA 4M8SA 1WCIA 2H92A 4GMHA 4J0QA 3DLIA 1CQXA 1PJAA 4JP1A 3W78A 4F45A 2PWZA 2VAVA 1I7DA 2C07A 2IZZA 3B70A 3OPQA 3SMVA 2EFDB 3E7WA 4JI3B 2E4YA 2I4NA 4N82A 1L6RA 4LSWA 3RYHA 3SLKA 3B7GA 5C3MA 3ZVMA 1UANA 2AR7A 1GFIA 1ODIA 4ENWA 1RI5A 4F5WA 1QIGA 5IABA 3UXYA 5F2KA 4B71A 2O3RA 3AHDA 1U5BA 2J45A 1VDMA 3K1AB 3IV7A 5BOSA 5H16A 4HH3C 4G0MA 1K8RA 5DNWA 4CM8A 1I7SB 1SCAA 3DKPA 3EY4A 4MS1B 1OVMA 3HA5A 1BYIA 4ZRNA 3TW8B 1DOZA 3BQMB 3UT6A 4D96A 4ZI7B 5FAKA 1A8SA 3HZOA 2XUFA 4FLFA 3WLOA 2ZIZA 3FYUB 4TUYB 3PGVA 4UE6A 4WCFA 2I91A 3FPCA 3HY4A 3G5AA 1FUKA 2BKVA 1JJAA 2PUJA 4JIMA 4WLUA 3CPJB 1V6SA 4P7JA 2C4WA 1UPBA 3LIIA 1K27A 4CKCA 4BNKA 3B6IA 2LGJA 4D2IA 2ZBVA 3LO8A 2G06A 2PA3A 4ZZ0A 5J4YA 2D2EA 1D2MA 1NW5A 1S2DA 3GJXC 4GLJA 7REQA 2K7FA 1JR3A 1TW3A 4GP9A 4I8IA 4HDRA 3UAYA 2XZOA 1NVXQ 2F9LA 3Q3EA 3CISA 4IV0A 2WIKA 3REOA 4W1RA 4EEXA 2VXOA 1JI3A 1YA6A 5FUYA 4JENA 4BASA 2YQ5A 1TECE 1VRCA 3CG4A 3V3TA 4KOEC 3ZIUA 4RULA 1QHNA 4WZAE 4QWWA 4EHKA 4MR9B 1KQNA 1CJCA 1Z7YA 2FPIA 3VO2A 3TXAA 1YK1A 2IVZA 5JY1A 4OGWA 1JLLB 1OZHA 5KJFA 4FIZA 2AA3A 2FW7A 3GC6A 5AT1A 2XZPA 3EPLA 3ZUGA 4NYMQ 3BT7A 1UBCA 1Y5LA 3OP1A 2D5IA 3LZCA 3NX4A 4X6UA 1KJZA 2WUGA 3TNFA 5HE8A 3LDFA 1P9WA 3F96A 4XH9B 4A73A 3G2OA 1ML4A 1IBMB 1I24A 2FOXA 4G1EB 1WSDA 3N8IA 3OCYA 3BG5A 4RORA 5F1YA 2GWRA 4HQFA 5ITVA 1W35A 3T7JA 4FK8A 4EFNA 2JD0A 5JZVA 4AP9A 1MC8A 4B9AA 1I5OA 2I99A 3IJ5A 4Q48A 4R2LA 3DZHA 1LNQA 3K73O 4O59O 3IPLA 1ZIYA 4YDSA 4Q3NA 3ONDA 4GLFA 4C3ZA 3R9XB 1ZI9A 2BFBB 1V8PA 4NEGA 4AJIA 1MF7A 1S96A 2BGIA 3N8NA 1E4EA 1U7UA 2YNMD 2ZE6A 3O1LA 4JGGA 4LE1A 3WRYC 1F51E 3DBRA 3KOUA 1QM5A 1OGIA 2DFTA 2H4WA 4RQAA 4S24A 1W29A 4BX0A 2GJSA 3MD9A 4CEJA 4TLAA 1S6YA 1D03A 3B3QA 4L8FA 4W9NA 4FYKA 1C3EA 5FJIA 1RRKA 3WO0A 4NPHA 5CHYA 4OFBA 1KETA 4BO7A 2BEKA 1W4BA 4JR0A 4TS3A 4KAAA 1U4SA 2BTQB 1X86B 1BX0A 1W4LA 3N6XA 1YRHA 1J07A 3MT7A 4ECEA 4DDHA 4DSTA 4DR2B 4OD0A 1DRJA 4MQEA 1KDZA 1TYZA 3KXKA 4DZRA 1B0AA 1W1WA 4X8OA 2VRWA 1G55A 3T52A 4HQRA 2BR3A 4BO4A 1JG4A 2B8NA 2J3KA 3EGXA 1Y3DE 1KYYA 1YSCA 1TL7C 1ZJJA 2AEEA 3DBOB 3EVCA 5DYWA 3TSZA 3L1VA 4CQMA 4C7OB 4JASB 5IM4A 1EM8B 3UW1A 1FX1A 1KH2A 3AJ8A 3BGIA 1P6XA 4QPJC 1FFGA 2VAWA 4OQDA 2O2CA 2WUWE 1R0XA 3CX4A 3QX8A 3ZI0A 4ZGGA 4JBWA 3C8MA 4UE2A 1E8MA 1PUXA 2VDWA 4F8JA 4YV7A 2A9VA 3OCUA 2CKMA 4P5PA 4DUGA 5EZYF 2D5LA 2PH1A 3GEPA 2O8CB 1EUQA 2GKOA 3RABA 1K2VN 3ENZA 3U48A 4UULA 1QH9A 3CE9A 5B1SA 5C18A 3FTNA 1Z75A 3OQPA 3PX3A 4XRRA 2OK7A 2NYAA 2ZYDA 3V48A