3BB3A

Crystal structure of toc33 from arabidopsis thaliana in complex with gdp and mg2+
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
242
Chain Sequence
b'EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T7I23.11 protein
publication title The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 76
structure length 242
sequence length 245
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bb3A00
2AFHE 4AG6A 4LC0A 2MSEB 2ZJ2A 1FTNA 1MO4A 1M8PA 2ZREA 3EIEA 3BBPA 2HV8A 3I73A 1KY3A 3GD7A 2NQ2C 1GZSA 3ND9A 2Q3FA 3Q5EA 5FUXA 5CB6A 4CEHA 1PLJA 1KDOA 3B85A 3AV0B 4NPHA 4Q4JB 5CYOA 4GMXA 3N2EA 3OFNA 3VR5A 2H92A 3RLFA 4CDGA 2XB2A 1XCMA 3ZD7A 1U9IA 4B35A 2GJKA 3SFVA 1TF7A 1OLOA 3THYB 4D4KA 3ZLJA 3RVBA 3RAPR 3RRMA 1SVLA 4J0QA 4PHFA 1Z8FA 2D06A 5FPSA 4Z8XA 1VG8A 4JYCA 2X1VA 1XRJA 1G7RA 2ZI5A 4G3XA 1M74A 1NIJA 3JVVA 4RY2A 2F1IA 4Q21A 1YHNA 1CTQA 1XJ0A 2HYIC 5HPYB 1WXQA 3HP1A 3E5HA 3VU9B 4Q03A 2F43B 3SBDA 1G3RA 2GEVA 2C77A 2OUKA 1VG0B 3C16C 4TYWA 4OQNA 1WBBA 3GLGA 3I8XA 4TTQA 1OIVA 4YMUA 4Q4HA 4Q4HB 2QPOA 1UF9A 2CXXA 5G40A 2C04A 3RS7A 4OQLA 1XTIA 2BM1A 1E0JA 5AUNB 4QBFA 2A5FA 3EAQA 4KODA 3SNHA 4P4UA 3LDAA 3K70C 3HJNA 2ZE8A 3NH9A 1XMIA 3VNVA 1W4RA 2R62A 4H1UA 3BXZA 2QP3A 1GFIA 1JALA 1HURA 1MO6A 3QNUA 4D0NA 2WWYA 1YZKA 1P6XA 1ZYUA 4C0AC 1UADA 5BXQC 1OSNA 1CJKC 1ESMA 1O3YA 1S1MA 3L43A 4HUQA 4PO1A 4A82A 2QTHA 5HKKA 4ESVA 4BWYA 1MR3F 3CW2A 2QP4A 4QBHA 2GK6A 3VR2A 2QG6A 3P20A 2H17A 2GAAA 1XD8A 1YE8A 2ZSBA 2CLDX 5JS7A 5JMTA 2XOKA 5H1YA 3RS5A 4E22A 5CK4A 4KYUA 1XMVA 2IK8A 2P2LA 1KAOA 1E69A 1M34E 2HLDA 2ZRMA 4JJKA 4IDOA 1E0AA 2GDJA 4LOAA 5KU1A 4L16A 2EFEB 4KAXA 1YJ5A 2Q9CA 4TN1A 2VEDA 5KDDA 4PC6A 3IQWA 3CB4A 1F2UA 2ZETA 1S0UA 5HTKA 5BW8A 3EA0A 4QC2A 1SULA 2BEKA 1E79A 2ZUCA 3DMDA 4Z51A 3FTQA 4Q47A 1RW4A 2QSZA 2YWFA 2ZSFA 2ZTSA 3X1YA 1Q3HA 3GFOA 4DLWA 1SXJA 1JR3A 1SXJB 3IO3A 5CDFA 3DOFA 4BLTA 4RZXA 4LRWA 5HZHA 2X8AA 3GJ4A 1N5IA 3CIOA 4IDHA 3MFYA 4NH0A 3T35A 3HR7A 2C96A 3KKNA 4P31A 3HU3A 1LY1A 1VYUA 1OYYA 4YQFA 3ZD6A 2RMKA 1XNJA 2ZXUA 3BFXA 5FUWA 2QBYB 3FFAA 3GEEA 5FPYA 3KXIA 1MRSA 2ZANA 4B3CA 2QMEA 1XD2B 5JI2E 4ZPXA 2F9LA 1ZW6A 5KDLA 4ERNA 5CJ2A 4TSFD 4E5UA 1KZGB 1NY6A 5CLLA 4RD0A 3THWA 4UNNA 3W8NA 1CR4A 1X8KA 2R65A 4QNMA 5FTKA 2WKPA 1RPZA 1VCOA 1XDBA 3AUYA 1MH1A 3U2QA 1HY3A 2WPDD 4TMWA 1ZP6A 3ZH9B 1W1WA 1KDPA 2OCYC 4XWAA 3SOPA 5E3HA 4BFYA 4EAQA 1MO5A 4UJ5A 1TQ2A 3M1IA 3QVVA 1XMSA 4KBFA 3U3OA 2ZPTX 5FOSA 4PC7A 1WMSA 4XJXA 4LJ6A 4LI0A 1K6MA 5HCIA 2CE2X 3TSWA 5IK2D 3H86A 3PEYA 4C0KA 4LPSA 4LV8B 3ADBA 1TF2A 1Z28A 2ORIA 3I32A 5EP4A 3KQLA 3CPJB 3V4RA 2PEZA 1BIFA 2CHQA 4AG5A 4QNRA 4CEIB 4L4UA 5FOVA 4JLJA 3SBEA 1P61B 4UJ3A 4LBVA 2WJHA 4R9UC 1E98A 4TL9A 3EZ9A 1U2RA 5EP1A 4A36A 2IS6A 1DAIA 1VYTA 1VIAA 2IYLD 5L3RA 2Z0MA 5AUPB 3DKPA 2XB4A 1K5GA 2G6BA 4Q7JB 4UXIA 1OKKA 3VX3A 4CIDA 5FUYA 2WOJA 2OLKA 4DHEA 5EXTA 3C41J 1DAKA 1QHIA 5DN6A 1KK3A 3O8RA 2YKGA 2WSSA 2QMOA 3BB1A 1WQ1R 2QTFA 4LJAA 4TMZA 1KO7A 2Z4RA 3ZIAD 1X8LA 2VA8A 3R7WA 1E6CA 3BRWD 1NN3A 3K9HA 1RKBA 1UDWA 4DT1A 1P2SA 2ZI4A 4AI6A 4EJSA 2IYYA 4B32A 2EFGA 4YONB 3OEHA 1DELA 1NVUQ 1U81A 2CJWA 2O8EB 2QT0A 4YMSA 4LHXA 3F5FA 2VP2A 2OG2A 2WIAA 2O0HA 4OJQA 3QJYA 3AP1A 3LAWA 1X8JA 3TUZC 4DWJA 1US8A 3THXA 3THXB 1T3SA 1Q1EA 2IA5A 4D82A 1W4CA 4G5QA 4LSGA 4DBLC 4JBWA 5DIFA 1P2UA 3SN6A 5KNDA 1UBGA 1DOAA 4NONA 1II8B 3QXHA 1A1VA 2F3TA 1NN5A 5FPHA 3EZFA 1OHHA 2HYDA 1ZRHA 2KBEA 5B58C 4AKHA 2XZLA 1HQCA 1COWD 4B6EA 2ZAOA 4MRSA 1HH4A 1F5NA 4TLEA 1G7TA 3FHCB 3T34A 4TWZA 4A0FA 3C15C 3T61A 2QRNA 1AIPA 5CB8A 1NVWQ 2YWEA 2R6CA 4Z54A 1G3QA 4PSAA 3QKRA 3PR1A 4OHWA 1LF0A 3ETLA 5JSZB 4R2HA 5JHHB 1FUKA 1ZNZA 3W90A 4Q1EA 3K9NA 2GILA 2MMGA 2UZ3A 2J9RA 3SU8A 1AGRA 4PPQA 3MJHA 1ZNXA 1GNPA 4B73A 2A7QA 3I1FA 3EIHA 1GNRA 4JKYA 4DUGD 1KNXA 3K70D 2CK3D 4IOKA 4TLCA 4HLDA 4LUCA 2ZYTX 1F2TA 1F2TB 3AGPA 2RGNA 4KLNA 4FMDF 1P72A 3LLMA 4UQOA 5JZVA 2QGNA 3A4NA 1EFRD 1W5TA 3A1UA 3KFXA 3GLIB 3AUXA 4ABYA 5JFGA 5HE9A 2WMNB 1WF3A 3CF6R 5HZKA 2ZSDA 1Z22A 4GZMA 2WAXA 1P5ZB 3OE7D 4E09A 1D6JA 2E1RA 2G77B 1RC8A 1IXRC 4M0LA 1VTKA 1D8TA 1X86B 1N6PA 4WIAA 3V4FA 4BASA 4NYIR 1NF3A 4A2WA 1NMYA 4IOMA 4QGHA 3DPUA 1ZMXA 2CCJA 1Z83A 4XVQA 821PA 1KSFX 1D9XA 2WKRA 2BEJA 4MKHA 2KJQA 4C0SA 2F1RA 1MV5A 2ZR0A 3CRQA 3PUZA 1S96A 1E2JA 3CH5A 2WICA 1G20E 4K8OA 1SGWA 2PZGA 4PHGA 4A8JA 4LC1A 1XJQA 1T5LA 3VKGA 1BKDR 5KTYA 3LBHA 3QG5A 4M53A 1Q1ZA 1RYHA 3IKJA 1OT3A 2XNDA 4Q1DA 5KOYA 1AJEA 1RJ9A 3KUCA 3GLHE 1J7KA 4OK5A 4NYMR 2OAQ1 4A9AA 4MYTA 1KI6A 3MG9A 2JLZA 4MUAA 5EQTA 3WYFA 4AIIA 3FKSA 1QBKC 2B8TA 3PCRB 4M1OA 2BHRA 4NCIA 4D4LA 1XEWY 5AJYA 4M1WA 2IT1A 2F9MA 4UNRA 1D2NA 2GVDC 3QSYA 1J99A 2X2FA 1NSTA 3WRYC 4II7A 2IYRA 3L8ZA 5FOUA 4DCNA 2IS4A 2WJVA 1Z29A 2ZIAA 3HPRA 4Q00A 3QKSB 4ON9A 2GCOB 5UKDA 1Z0FA 4OK6A 2NO7A 5DISB 1JBKA 4JL5A 1ZM4A 4A2PA 4EFLA 4L9SA 4Q9JA 4I81A 1K5DA 2BWJA 1M7BA 4TT3A 4YLGA 1BOFA 1CU1A 2XTZA 2AWNA 1KO1A 2PL3A 2UKDA 3QENA 4US0R 1C1YA 1LVGA 1GRQA 2WBLC 2P6RA 1KMHB 2C9OA 3W6PA 1XTSA 4QRHA 4RD2A 1U99A 4NCHA 4W5JA 3F0TA 3F8TA 4LYHA 4O2RA 3H2YA 3AVTA 4GT1A 4M1MA 4TLDA 1U90A 2O5VA 4MYHA 4MUBA 3SDZA 1VCIA 1Z0JA 2R6DA 3TBKA 3TSZA 3KKPA 2ZUBA 5FTNA 3AF2A 5JEDA 4HAUA 1ZD1A 1NP6A 2PX3A 1R5NA 1T8TA 5JCZA 1UKVY 1E2KA 2V7QA 2P5SA 3RS0A 4RD4A 1VHTA 5L8VA 5JJLA 3V00A 3D3QA 4C3ZA 2JLUA 3CONA 2O8CB 1BS1A 2VHTA 1U94A 2ZI9A 3LVRE 3CLVA 4AWXA 1LB1B 5FPKA 1GAJA 1XX6A 3GJ7A 4A0GA 5FBLB 1RRGA 4UNQA 3UMSA 4AYTA 1JPNA 2G3YA 8OHMA 2QPTA 1N6KA 4IHQA 4PC1A 2FFAA 5AJXA 3VAAA 1KSJA 4QGFA 5CYPA 1Q12A 4YDHB 1ZU4A 4B44A 4CVNA 1R0XA 4LY6A 2VHJA 3BJIC 1G8FA 2VSOA 4XD7A 4BUJA 4S2EA 2DFLA 1R2QA 1KJWA 2RH5A 3OAAA 4C30A 2J7PD 2AD5A 4GFDA 4C4PA 3WYAA 4RD3A 4TQ9A 1CRPA 2OXCA 2QENA 4Y0AA 1QG4A 3UANA 3QF7A 5FUVA 2IC5A 4A0HA 4B76A 1W36B 1YKSA 3FYHA 5E95A 3I92A 1LTQA 4KU4A 1GSIA 4P4SB 1RE0A 1OXVA 2MSCB 4KFRA 1KO8A 2PJRA 3ADDA 4FW9A 2ORVA 5FR1A 2A5GA 4B47A 1YZUA 1G8HA 1G21E 3NKVA 2G0TA 4ZI2A 3A1WA 1T5IA 1DARA 4QGAA 1E32A 4DB4A 1IY1A 5KSOA 4FWIB 1J90A 1GG2A 1K8RA 2HXYA 2W2TA 4I1VA 4K81B 4X8MA 3KJEA 3QEOA 3GLIE 5DGXA 5FH9A 3B60A 2C8VA 1CJTC 2BBSA 1PJRA 2ZE6A 3FMFA 5AK0A 2IF0A 1YU9A 3IDQA 2JJ1D 2WHXA 4YMTA 4Q48A 2JASA 5JJIA 1Q0UA 3OESA 3EARA 2ZEJA 5K8TA 1NKTA 3WP1B 2EW1A 2D7DA 4BRUA 3I61A 4URYR 1TX4B 4JJZA 2ERXA 4HYYA 2CDNA 3W5IA 2BC9A 3VFDA 4E03A 3U7FB 3KB1A 1R8SA 3TR5A 3MMPA 4AKGA 4KVAA 4O0MA 4Q1CA 1FP7A 2ZITA 4M4SA 3K0AA 4URZR 4LHZA 3RYTC 1XEXB 4RFSA 4RFSB 4IXNA 4JKIA 1IN6A 2RGAA 3I8SA 3KXKA 2RGDA 5FL7D 3K0FB 3CM0A 4XOIA 2W58A 4MGYR 3AP2A 1LNZA 2B7CA 1GDDA 2XTMA 2CVFA 2YWHA 2A9KA 5J5CA 2H1LA 1A7JA 3GFTA 3U7EB 1SXJD 3LY5A 4FINA 3L82B 4MGZR 1EX7A 1KAGA 1NLFA 1QHHA 1QHHB 4WOPA 4PSVA 1ZIOA 2YOHA 3KTAA 1JAHA 3QPVA 5EZ6B 4U5XA 2GBLC 3T12A 1ZAKA 2QSYA 3G0HA 1G6OA 5ANRB 2WWWA 3O8CA 2IEYA 1NSFA 2P0EA 1E2LA 1CP2A 2X2EA 3ND8A 3K9LA 3VHXA 3IBGA 3ICEA 1OFUX 1VCMA 3IPYA 2A3RA 2NO6A 2PLRA 4IOLA 1II0A 2ZS7A 3CNLA 4WZAE 4B3FX 2HT1A 2C98A 2N42A 4POAA 5JRZA 3T5GA 2I1QA 2G88A 3X1DA 2ZYWX 1LS6A 1NRJB 4DCSA 2K5UA 1W0JD 1XEFA 1CBUA 2OV2A 4NYIQ 2FH5B 3L0SA 4P33A 5E7MA 5EJEA 2ZYUX 1E2EA 1XTRA 1M7GA 1YR8A 3P27A 2HCBA 4RD1A 2DY1A 4RKEA 3PUWA 1LS1A 3TLXA 1SHKA 1XTJA 2AD1A 2BMDA 2KI5A 3NHBA 4GBMA 1Z2CA 4PANA 2JDIA 3DO6A 5IDVA 3SR0A 4FCTA 1XXHB 4A6XA 3B6EA 3QF4A 3ZZ0A 3UMFA 3FHOA 4LK2A 3FDIA 2B92A 1KK2A 2J0VA 3B9PA 3DOEA 4NYMQ 3RNLA 2GCNA 2GF0A 4JLDA 4OI0A 3NTUA 2OEPA 2RGGA 1HE1C 1L8QA 3B78A 2XSZA 3SYNA 4QJ3A 3BORA 3U4QB 5JWRA 1UKZA 2RKOA 2QQ0A 3HPQA 1NY5A 4BZQA 4I99A 4A0RA 1XP8A 1DO0A 3NBYC 4XWOA 1P4SA 2GHIA 4JLOA 1FL9A 2IL1A 2I1VB 4PTLA 1AN0A 1M7HA 2SHKA 2VQSA 3K0EA 2VTKA 4RZUA 1GM5A 1E9AA 3IHWA 4TL7A 4DCTA 3ZVRA 3GQBA 4KITB 3K0CA 4QHTA 1KNQA 1TQDA 1HTWA 3A1TA 4CRWB 2FGJA 3WMFA 2JJ2D 3Q72A 2O52A 5FL3A 1KKMA 4O25A 4QJ5A 2WSSD 3PITA 1PUJA 2WVJA 4P3YA 1QVRA 5B57C 1W36C 5BN3A 2ZJAA 4YXWD 3R20A 1GIAA 2VP4A 4CEHB 4IW3B 1M1YE 3BB3A 5SZJA 4QM6A 4G5GA 2HJGA 3T5DA 4G01B 4CZ2A 2ZSEA 1QF9A 3VNUA 1DADA 3U6KA 1CS4C 2GF9A 5JECA 3AVXA 3QE0A 4LJ4A 4ILEA 1ONBA 5EXXA 5TB5A 5FR2A 4JLMA 5D3MA 5EP3A 1NJFA 4KBGA 1E1RD 3LW8A 2FSGA 2ERYA 2IXEA 3I62A 3KZ1E 1VIYA 4OHXA 4B43A 5GADl 1EFHA 3OIUA 2YZ2A 1OB5A 1DAGA 1T4GA 2ZI3A 4MGIR 4URVR 2UVQA 2QNRA 5A5GA 2RHMA 3EZ6A 4RZ3A 2EYUA 1H8ED 5LDDC 3H4MA 3OIVA 3PG5A 2JIZA 2O0JA 1L7VC 4KXFB 2Q9BA 3MD0A 3QPUA 3K8YA 2IYUA 1J8YF 4X8OA 1FX0A 3IGFA 2GEUA 4PHTA 3UG6A 4NMMA 3U3MA 2ZI7A 3AVPA 1OHHD 1CF4A 3KJHA 5AJZA 3A6PC 3C4JA 3BOSA 1OJLA 2OLJA 3TJZA 3KJIA 4ZDJA 4QOSA 1IBRA 3ECCA 3QXJA 3GLGB 2AXNA 2VIIA 1TL7C 2P5TB 4R71A 2EWVA 3CR7A 1IOZA 4IFBA 2WWXA 3AKDA 2ZJOA 1E9FA 2QE7A 1TPZA 1NJGA 2GXAA 1J8MF 1I2MA 4MGKR 4V02A 1C4OA 4EPXA 3UWKA 3EC1A 5BWMA 3LV8A 3FVQA 1IXZA 1IXSB 1E1QD 4QGGA 4DDTA 4B48A 3KXLA 1R4AA 2F3RA 3EPJA 4WAUA 1VMAA 4HUQB 4DSUA 1DO2A 1T3LA 2WAYA 4L15A 3SYLA 4IKEA 2J87A 2QAGA 2ZRAA 2C9CA 2CHGA 2RGCA 4PFSA 4Q1BA 2IUUA 3WYGA 3ADCA 3EW9A 1L4UA 1SKYB 2WJIA 1BMFD 5AUQA 1S2MA 2H18A 3OIYA 1IY2A 1N3BA 2PMDA 4DCVA 3GLFA 1G6HA 3FMOB 3GEIA 1OH7A 2PEYA 4IVRA 2B7BA 4Q19A 2ZE5A 4JVLA 1QHNA 3P26A 3BIFA 2OCAA 2OZEA 2BIFA 5FFMA 2FEMA 2FEOA 2RGBA 4XVRA 3SI7A 2IHBA 3ZQ6A 2J0QA 4US2R 1B23P 1Z6XA 3ZS9A 3IUYA 4JL6A 1CXZA 1PLLA 3DM9B 4AYXA 1F2UB 4CW7A 2OHFA 4FIDA 1YZLA 1KKLA 3CX7A 1NN1A 1NLYA 2QGZA 2ZRIA 1NBME 1OXSC 3B7GA 1XPOA 3K1JA 3QQ5A 1UM8A 3NC0C 4M9ZA 5E7IA 4OHVA 3I3SR 1ZNYA 1KSGA 2HJVA 2JLQA 4KHZA 4Q18A 421PA 4DKXA 5JJKA 3HYTA 1G5RA 1TUIA 4CEJA 3PFIA 2KWIA 4ACAA 4NP6A 2GAOA 2OCPA 1B0UA 3PEWA 5FTMA 2FMXA 2GZHA 1D2EA 4Q5IA 4PXAA 2NMVA 1S4QA 4UKDA 4O3MA 4A92A 4TMKA 4Q9IA 2A78A 2F1HA 2BJVA 2NO1A 1AK2A 3ZZTA 3KKOA 1A2KC 2V8OA 3BWDD 1UEIA 3C8UA 3TUJC 1TQ6A 1S1CA 3EASA 4FCWA 521PA 1FTSA 2NZJA 4OI4A 3DZ8A 5K8LA 1GRNA 4IDQA 3THWB 2WSMA 4JBXA 2GESA 4G1UC 1N6HA 1JECA 3B1VA 5IHPA 4TZ6A 3M4YA 1MKYA 3GJ3A 4PX9A 5L3SA 4TT3D 1H8HD 4B75A 1RRPA 4GOXA 1N5KA 5H70A 1I4DD 1ZM2A 2HDNB 2FN4A 3EA5A 4QL3A 4UXHA 2KE5A 2VSFA 1JQJC 4RFVA 2XZPA 4RVCA 3VHLB 1YRAA 3L0IB 1R5BA 2QY9A 1CR1A 2Z5FA 2OFOA 2RAPA 2N46A 4BFVA 1MOZA 4KYIB 4Q1FA 4B3GA 3MLEA 2IUSA 1NVVR 3SFZA 1Z63A 3TR0A 2CNWA 3A4MA 4HAZA 3TE6A 1AM4D 4PZYA 1DAFA 2B8WA 1WBDA 1N6NA 1NI3A 1U9IC 4BFUA 2FPMA 3MJRA 3MSXA 3EPHA 3NDBB 2GZAA 3IIMA 3AM1A 5A4JA 3M0EA 3MUFA 5DH9A 3P4YA 2BVNA 4LX0A 1EFUA 3NEJA 4V0MA 3GLHA 3Q8XB 2QORA 5FTLA 1T8UA 3CRMA 4DSOA 1BYIA 1UPTA 2BBOA 4LJYA 5LBIA 1E9CA 3BFKA 2FDCA 2D2EA 2P3SA 2VLIA 5KSZA 2FE4A 2ZJ5A 1E2IA 3BD9A 1SVIA 1HUQA 1DE0A 2BKUA 2ZI6A 1W0KD 1R0YA 2YINC 4HZUB 4HZUA 4TZ0A 3BGWA 2FNAA 2WM9B 4M1YA 4HB2A 5FOXA 5G3YA 3DZDA 3R7WB 2LKCA 2IBMA 4DT1B 3W3ZB 3UMRA 2OCBA 3V9PA 3GCGA 4EJSB 1PZNA 1U8AA 4GDFA 3ASZA 4C2TA 2DWPA 2REBA 2GKSA 2Q9AA 1MO3A 1HQYE 2CJWB 5H8WA 1JAIA 3D8BA 2V6JA 4OKSA 3T1QA 2QL6A 3B1WA 1W36D 4XSGA 1AS2A 4QHYA 3TK1A 1E9SA 4ZKDA 2ZAMA 1G9XA 2BMJA 3L0PA 2NPIA 3QXXA 1W5SA 4HLUA 1GWNA 2WKQA 4LJ8A 2V1UA 3GEHA 3R9WA 5LB2A 3BS4A 1UDXA 2YC2C 2CCGA 4F4JA 1US8B 1NIPA 3OZXA 3JVUA 3KUDA 4Q7MB 4ASUD 2D4HA 4PR0A 5LD2B 3IPXA 2J5XA 1N2CE 1OFHA 1SKYE 4BFZA 1VECA 2V3CC 1AZTA 3R9IA 2ORWA 4GI7A 4C9BA 4LJ5A 4EKDA 4KFUA 2JCSA 3TAUA 2ZJYA 2HEIA 5DHFA 3HR8A 1JI0A 3OEEA 4Z8YA 3HWSA 4BLPA 3TIFA 1X1SA 2GRJA 1EESA 3AVVA 1NVXQ 3LBIA 3ZYCA 2J7KA 2DWQA 3QY0A 2ZYVX 2ZVQX 1HT2E 1KI7A 5DI9A 2FZ4A 1G1MA 1VDZA 2PZEA 1TUEA 4TLBA 3SS8A 3QKRB 3UG7A 1GKYA 3X1ZA 3J81k 3S1AA 3TNFA 1OXUA 1EWQA 1SXJC 1E2MA 2OXRA 3CO5A 4LJ9A 3TQCA 5FOTA 3WP0A 4B2IA 1SXJE 1JR3E 1ZUHA 5CDFE 4DLRA 5JRJA 3LFUA 1QHSA 2BCGY 1HE8B 3CX6A 4MKFA 5BQ5A 4JL8A 4GP6A 2IX3A 2WWHA 621PA 4IRUB 1XWIA 4F93B 2V4ZA 4D26A 4HDCA 2W6IA 4F7WA 4HZIA 1VCNA 1JR6A 4N1AA 3FMIA 3ADKA 2ASEA 2YC4C 3BH7A 3KX2A 4IDNA 5GVRA 1TF5A 4L9WA 4WW0A 3K9GA 3SC3A 3ZDQA 3ZS8A 4D0GA 1G8YA 3L2OB 3P4XA 4EPWA 4C7OA 3UKDA 1XZQA 5GJWC 2KSQA 2WJYA 5BN4A 2AK3A 1AS3A 3AGQA 2YYZA 4M1KA 3E2IA 1TEVA 4FMCB 4KVGA 5DI3A 5C46F 2JATA 5GVSA 2O8BA 1XPRA 2O8BB 1KK1A 6Q21A 1ZNWA 3KKMA 2HCJB 4KO8A 3N5CA 4MRNA 3KL4A 4QXAA 3AQ4A 3BC1A 3K09A 3LA6A 2J0SA 4BLRA 1MABA 1GOTA 2PCJA 5CLQA 3BH0A 3SZRA 1NG1A 1WDTA 4PZZA 1WCV1 1H65A 4EFMA 4XTRA 3O47A 4W7SA 5AR1A 4LBWA 1GTVA 1KJYA 1Q3TA 1ZVQA 4A8JB 4EPYA 4FWTA 3B1YA 4B2PA 1I4LD 2VRWA 1RJ9B 5A0FA 2CL0X 1NBMD 3BERA 3AKCA 1CRQA 4WZ6A 1AZSC 4XH9B 4EDHA 4HAWA 2IEZA 2WJGA 1FUUA 1KI6B 2AKYA 2EVWX 2WWGA 1RIFA 1XPUA 5GJVC 1N5JA 5EP2A 3WHLA 2JDID 5DLQC 4HAVA 3CRW1 4JBYA 2FA9A 4C0JA 3UATA 2IXFA 3CKLA 3M6AA 2W2XA 1IAQA 1RFLA 2P67A 1GL6A 1E4VA 2YWGA 4QBGB 3WMEA 1GP2A 1GL9B 4RJLA 3WNDA 2EQBA 4HI0E 4DIEA 3B82A 5GJBA 1IY0A 2JLSA 2ZVPX 3A1VA 4XVUA 1KK0A 2EU8A 3GJ6A 4D4JA 3H1TA 3ASYA 2QAJA 3Q7QA 1KSHA 1R8QA 3GMTA 1XU4A 2QU8A 2QROA 3PIRA 1N5LA 3Q9LA 1GKUB 2G1KA 1G16A 3WBKA 2GJAA 1QVAA 2XX3A 1RRCA 1OH8A 3LD9A 1R6BX 5DO9A 4EQ6A 2FWRA 2W6JD 3DMNA 4Q1AA 3CPHA 1KI2A 3ZJYA 2J46A 3Q3JB 1WE2A 4JLKA 1R5OA 4TSFA 4QKQA 4JMPA 1CJMA 2FPLA 4EJSC 2PCLA 4G5OA 1ZD8A 3EIQA 2AWOA 3U44A 1MRNA 2PLFA 3LNCA 1IQPA 1X1RA 2ZS8A 3IHLA 2OBNA 5JHGB 4D25A 1M2OB 2WPDA 4MYUA 4PO8A 1U8YA 2YNMA 3UPUA 2QM7A 3KQHA 3LX8A 2BBWA 5TY0A 3OFND 4LYFA 1NVVQ 1OH6A 1IJFA 4BFXA 1V43A 3IILA 4EPRA 3LRPA 5IK2A 4AKIA 3RSLA 1Z07A 1NL3A 3NVAA 2OO7A 2ZE7A 3SJAA 4ESHA 5KNBA 4N0EA 2YV5A 4DLYA 3DM5A 1S8FA 3T1VA 4TYYA 1ODFA 1BYUA 1Z5ZA 3CF2A 3ZVLA 2FG5A 4V0LA 1OH5A 2ZJBA 1N0WA 1Z47A 4MITA 4DCUA 2VP5A 2ANBA 2JIZD 1OIWA 2YOFA 3AH8A 4NE2A 2DBYA 2NO9A 4ZCMA 4G5SA 2XJ4A 4BFSA 4B2LA 1E0SA 1U0LA 4ZI3A 2VP0A 3CUEF 2H5EA 4NU0A 1II9A 5EE3A 2HUPA 1G8GA 2RHDA 1CKEA 3QBVA 4BLSA 4FXPA 2JLYA 2IXGA 3CR8A 2YOGA 4LCBA 3LWNA 4JT4A 1SVOA 2ATVA 2CL7X 4OJKA 3ZZUA 1Q57A 2R2AA 2G0NA 4MRVA 1RZ3A 3BAFA 3SYKA 1U0JA 1ZC4A 5M04A 4FMDB 5KUTA 3EPKA 1XTQA 1ZU5A 5AJVB 5F3WB 4IEEA 1GRRA 3AKEA 1R7RA 1QG2A 1UEJA 1JEDA 3TAHA 4DC9A 2C95A 2XEXA 3QUSA 3BFVA 3ZIAA 2BMFA 2MSDB 5TDHA 2E87A 3C7KA 3W34A 1OXTA 4FI3C 2RGNC 2KB0A 1CJVC 5CJPA 1E2QA 3SJCA 1JJVA 3RRNA 1XZPA 2A5JA 2JJ8A 2D3WA 3NEYA 2QMHA 5HKKD 2FZLA 4LWZA 3SQWA 1QDEA 4FN5A 1T9HA 4ZCIA 5FI0B 3UK6A 4PZLA 4GOKA 3QVUA 2CE7A 3EZ2A 3PVSA 1UJ2A 1F3OA 1EX6A 3FHTA 2H8KA 3U3RA 2ODBA 2PMKA 2XOKD 5IT5A 3GJXC 1BH2A 1QHGA 4PQRA 4TMXA 2HLDD 3L0OA 4W9MC 1P60A 2F7SA 1N25A 4HSEA 2ZR7A 4RCYA 3TRFA 1P7CA 4OQMA 3MWLA 1KY2A 4Z1MA 4BE7B 1L4YA 3K0AB 3Q7PA 1COWA 3TGPA 2VF8A 1A5TA 1EWRA 4AY2A 3TMKA 4RCZA 1W2HA 3FPAA 4DLTA 1W2GA 5L3VA 1E79D 4IVPA 2JLWA 2ZJZA 4M9QA 1N6OA 2Y8EA 2VSXA 3DDCA 1E0KA 1Q44A 2W0MA 4V03A 3BB4A 5B30A 3FE2A 1OPXA 2IHYA 1NKSA 3DEFA 4D2IA 4D81A 2BM0A 2PX0A 1JR3D 2NOAA 2PT7A 3PQCA 5DSZA 1KMQA 1W4BA 4BFWA 1Q1QA 1Z0KA 1TTTA 2QN6A 3QPWA 3MWKA 3K0SA 4DLZA 4C2UA 4HATA 2LKDA 3KTAB 3TQFA 3B9QA 1NNEA 2ZRCA 5FBRB 2PZFA 5D3QA 4EIWA 2X19A 1PVOA 1E2NA 4DXAA 4DUGA 3K70B 2CK3A 3NBFA 4NBSA 2OBLA 4AK9A 1Z0IA 3T15A 1L2TA 1W48A 5EE1A 1EFRA 3LW7A 2A5YB 3AF3A 3KJGA 1ZM9A 1AA9A 2LWIA 1G64A 1CJUC 2OM2A 4OI2A 3OE7A 4OL0A 1UKYA 3IEUA 4M2LA 3RS3A 3KFVA 2IW3A 2QEQA 2ZR9A 3A58B 1VPLA 1YZNA 2BDTA 3KB2A 3SHFA 1JXOA 5F9HA 4GRAA 2IWRA 1UBCA 4B6FA 3CF0A 2BOVA 1HEIA 2D7CA 4BLOA 3QF4B 3NDPA 5G41A 2TMKA 2C03A 1T3HA 1TADA 1FFHA 4HB4A 1EFCA 3LVQE 1F60A 4CF7A 2J41A 1O87A 3X1XA 3A8TA 4DLVA 2WWIA 4B34A 1YQTA 3RWOA 2IF2A 1P73A 5DYGA 4BRWA 1A2BA 1HA3A 2DB3A 3PENA 1GVNB 2E9SA 1YR9A 1MT0A 4URWR 1KJZA 3WNBA 1G19A 3AVQA 2JLVA 1W4AA 3KQKA 2WOOA 3RSOA 1HT1E 2AN9A 4ACBA 4D6PA 5J4VA 5L3QA 3CWQA 4Q4AA 1Z2AA 4HDQB 4H1VA 3UWOA 4B3BA 1ZUIA 4KI0A 1ESNA 1ZUNB 2O8FA 3G82C 4NYJR 1OKKD 3U7HB 3VR4A 1GUAA 1FQJA 3A1SA 4PQYA 4R7ZA 1FMJA 5C4MA 4N0DA 5DN6D 5E4FA 1D2MA 4ZDKA 3RC8A 2W83A 1ZM3A 3GJ8A 3OIWA 1IN7A 2GTPA 3U3JA 2XITA 3O8BA 1Z3IX 2YJTD 4ARZA 2ZRHA 3GFPA 1P2VA 4I1UA 3QI2A 2YHSA 2HF9A 1Q21A 4DLUA 2KBFA 2P6UA 2ATXA 1ZBDA 3WNCA 4A2QA 4BEJA 3GP8A 4TMTA 5H68A 4KSCA 3QIAA 5TXGA 2FFHA 3OEHD 1N6LA 4LHVA 4MA4A 4US1R 2RGEA 4GPTA 5SZHB 1FZQA 4F91B 2GZDA 5D3MB 4ITRC 4D80A 2ZJ8A 3A36A 2DWOA 2R6GA 1E9RA 3KKQA 3O8DA 4TTRA 3R8CA 1OFIA 3C5HA 1KO5A 4D4MA 3ZVMA 3U6BA 4LBZA 2FU5C 4AURA 1JB1A 2CCKA 2C99A 2ZUDA 1AKEA 4NCJA 4Q4JA 2WMOB 4A4DA 2C78A 3AF4A 1RVDA 4BEBA 5JWOA 3LQRA 4BPBA 5LB4A 2J1LA 2QA5A 3OF5A 2V55B 1FX0B 2FSHA 2EWWA 1SVSA 2WV9A 1TQ4A 2V9PA 3THYA 1FNNA 4ZO4A 2FF7A 4DSTA 1WRBA 5C4GB 3OEED 4W5WA 2BBTA 1CR2A 4W5HA 4ZCLA 1CLUA 3AKYA 4JLBA 4LYJA 1OF1A 2VBCA 3TUIC 4C0LA 5AJWA 5EUMA 3RANA 4Q9KA 3H0KA 3REGA 5J4KA 1KO4A 1P3JA 1E9EA 1JQLB 4Q7KA 4URUR 2QTVB 4KCGA 2IYVA 2J7PA 4V0OA 4LHYA 2GEDA 4QBIA 3VU9A 2EFDB 121PA 2AXPA 2F43A 1Z6YA 3RC3A 4XWKA 3A4LA 3QKUA 4NHOA 2W0SA 3SEAA 1XB2A 4WXPA 1Z0DA 2YVUA 1E9BA 2DR3A 4RD6A 3TVTA 2ZRDA 3TSOA 4HEJA 1E2PA 2VH5R 2QAGB 1IONA 2DPXA 3NWJA 1D9ZA 2QM8A 1E2FA 4FMBB 3VMFA 2W6ID 3Q5DA 4OHZA 4BLQA 4ZDIA 1FW6A 3AVUA 2IS2A 3P32A 3LQQA 3QXCA 1VKJA 4BQSA 3U61B 4X8LA 3GLFB 1R10A 1T6NA 5KHOC 4IVQA 3BK7A 5EXPA 4XSHA 5F2EA 2FV8A 1Y3AA 1AS0A 2VL7A 3W6OA 4M1TA 5J4YA 4YDSA 5G3ZA 1IN8A 2W00A 3WXMA 5FBVB 5SZKB 3ZGXA 4F4CA 4JLNA 4PPGA 5CK5A 3B5JA 3CNNA 5FPTA 2Z83A 2JJ1A 4YMVA 4TL8A 1EG7A 1LF5A 2CEAA 4LYAA 3X1WA 1KI8A 2Z43A 5JWHA 3NBXX 4X8HA 1XEWX 1GNQA 4RSGA 4GP7A 4OBEA 4TQAA 3RRZA 4TYNA 2VHCA 3AF0A 4HDOB 1KGDA 1G17A 1J70A 5IF9A 1P62B 4C0BA 1XXHE 2A2ZA 2XNDD 3B8HA 3IBYA 4PQFA 4XIGS 2BKEA 4FCVA 1TU4A 1G7CA 4Q4LA 1DTSA 1WP9A 3AVYA 1IN4A 1UBFA 3GJ5A 4U02A 4I1SA 3NIBA 4CEJB 3U60B 2NG1A 2ZM5A 1D5CA 3FKSD 1NMXA 3JZAA 5K8UA 2C5LA 3ZVNA 4GL2A 1Y63A 1G3IA 1KZ7B 2REOA 5FL7A 4OQXA 3PJRA 1G4AE 4AYWA 3SHWA 2ONKA 3A37A 5JCPA 5JS8A 2FOLA 2W2VA 3FGNA 4L5BA 1XBTA 1UBEA 4A6PA 5CM9C 4TMVA 3OHMA 4GNKA 2AR7A 3ICQB 1P75A 2ZQ5A 1U98A 4A1FA 3L8YA 4AC9A 1A4RA 2Q21A 3K0CC 1P9NA 4PAMA 3MAAC 4WVFA 2OFXA 1C9KA 1E2GA 1XCPA 1TMKA 4LZZA 5BN5A 5L3SB 1E3MA 4JIMA 2UZIR 2QBYA 5KPJA 2V54A 1N6RA 2CLSA 5G53C 2ZRNA 5CIQA 1XD2A 3D7MA 4TYPA 2QQEA 1KI9A 1ZC3A 2VO1A 2P6NA 4BZPA 1W0JA 3EZ7A 1LW7A 5DNYB 1UAAA 1I4TD 1SKQA 3CX8A 1Z06A 4PPNA 2JA1A 1AQYA 1FMLA 2ZRFA 1LV7A 3FFBA 1N0UA 1DS6A 2JLXA 2ZU6A 4FMCF 2GCPA 3CH4B 4O2LA 1KI4A 2ECKA 2ZROA 2V7QD 3TW8B 3VTKA 1P9RA 1DAHA 3N70A 3W5JA 1SHZA 4CT4B 1IHUA 1WA5A 5IRCD 3EPLA 1SQ5A 3GLHB 4R2IA 2CVHA 4LHWA 1QZXA 2XXAB 2XXAA 2NTYC 3AVWA 2LCFA 2AX4A 4DJTA 5FI1B 2ZU0C 3B1ZA 4DIDA 4LGMA 5FOWA 3MWYW 3W8RA 4ZIRA 4ZIRB 2DFTA 2WIBA 2QZ4A 2OT3B 1AQUA 2ZRJA 2IYQA 4KV9A 2JGNA 5ELXA 1G4UR 4HB0A 1W7AA 3MWJA 1TNDA 1OW3B 5C1BA 4CEIA 1TAGA 2ANCA 3W9YA 1UFQA 4PPFA 5FBQB 2JAQA 1XFAA 1JPJA 1DAEA 2C2HA 2DYKA 2VYFA 5K8IA 4XD7D 3SJZA 2Z6VA 4PSKA 3GLGE 3E1SA 2N1BA 4B3XA 2QPAA 5TMPA 4JLPA 3OAAD 4NYJQ 4DDUA 2ODEA 3NH6A 2ZSAA 4UXJA 4HLQB 3RS4A 1XMJA 3K53A 2PT5A 1YR6A 4LPKA 2JJ2A 4L8GA 1Z6TA 5HR5A 4DDVA 3EX7C 2IYWA 2ZRPA 1WB9A 2A30A 3D31A 1P2TA 1LFDB 1DEKA 4YXWA 2PJZA 2ZRKA 2QAGC 2WWFA 2PBRA 4PAQA 1OFTA 2R8RA 4PO9A 3QG1A 4MDFA 4MQBA 1OV4A 3HU1A 5FBWB 3R9XA 2VHQA 1TEXA 3AVOA 3QXSA 2G1JA 4KFTA 4DRZA 3Q85A 4R98A 2O8EA 1AGPA 2CMKA 4PC3A 3GLFE 1AKYA 1ZCBA 1E1RA 3NHAA 3PUYA 3WRXC 4JVNA 4JLVA 1DG1G 1XCGB 4I1OA 1Z0AA 4M9SA 3JZMA 4MYCA 1OXXK 1H8EA 5BYKA 3IIKA 1KDRA 5J4HA 1GILA 3NXSA 4OHYA 4BZXA 2H57A 4NDZA 5DYIA 1II8A 3MGCA 2DFNA 4QJ4A 4PHHA 3N2IA 1YRBA 5CITA 4JSYA 3QKTA 3S1AB 3TW4A 3EWAA 3WBJA 4Z1MD 4DDWA 1U8ZA 4G0NA 3QEJA 4GSYA 3MRSA 2FGKA 2GA8A 4IDPA 2GWHA 1E94E 1E99A 4CT5A 4EUNA 2O0KA 3LO5A 4RKFA 1HYQA 5HE8A 2IUTA 5KNCA 4QHSA 1OYWA 3SJBA 1SZPA 3DHWC 1E2HA 3CNOA 4LDJA 2B21A 5JSZA 5FTJA 2JLRA 1E1QA 3THOA 3U7GA 4JZKA 4C7OB 5EXSA 1EK0A 5E7JA 4IOJA 3FB4A 5TARA 4TQUS 5DI3B 2BMEA 2EYQA 5TV2A 1YZTA 2L0XA 3IEVA 2P65A 1RRFA 4JS0A 2FPKA 4DSNA 3NG1A 1XJCA 3FOZA 2J0UA 1FP6A 2J0UB 4ZKEA 1BMFA 1MABB 4JT2A 1S3SA 1ZD9A 2GJ9A 2H7VA 5KSYA 5KPDA 3HYRA 4DB2A 3VQTA 3GLIA 1NMZA 2VP6A 1T0HB 2NO0A 1E9DA 3CWZA 5TVKA 2F1JA 2F6RA 3BE4A 2RGXA 4GZLA 4M21A 3AB3A 2DCUA 3P1JA 2R6AA 4NL4H 2I3BA 1DVRA 2PH1A 1S9DA 3AF1A 1ETUA 4V0NA 3CRRA 5J4LA 3HU2A 3REFA 4BFTA 4JLAA 5HCNA 4PAOA 4YMWA 2JEOA 3TKLA 3R8FA 3CRVA 4KFSA 2ODNA 2R44A 4PC2A 3KQNA 1A82A 5EZ5A 4RZ2A 3U5ZB 4Q02A 1P9WA 1NN0A 2WJJA 1Z08A 4ZV4A 2J3EA 4NZYA 4TLAA 3WY9A 4F4IA 4JYBA 4WXRA 2AK2A 3PEUA 2FFBA 3KDSE 1EFTA 3ZQJA 5KYKA 2QT1A 2HF8A 1QHXA 1NLZA 2FX3A 2OE2A 4P0TA 4V0ME 2V6IA 4NCKA 2Q0HA 2OBMA 1U0HC 2XSZD 3IIJA 2NPFA 1KYIA 1GL7A 1PLKA 4I4LA 4U00A 2HT6A 5AWFC 1YVDA 3I72A 4IXMA 1OIXA 1VHLA 1W49A 2A5DA 4HLCA 721PA 1GITA 2NGRA 4XTCS 1G3UA 3RABA 3HDTA 2FJUA 4TYQA 3H84A 4Q9HA 5DE3A 4EQ6B 3LLUA 1G18A 2BCJQ 3UXMA 1IM2A 2QRZA 3QKSA 5LPNA 2IWHA 4LV6A 2GCOA 3SE0A 2IYSA 1HV8A 2GBLA 5SZIA 4M8NE 1F48A 1Z6AA 3U44B 1CR0A 2J45A 2REXB 4JSTA 4KLZA 3E70C 4MDEA 4B71A 2DFKB 1H8HA 1XTKA 3VR3A 2D74A 3GJ0A 2R9VA 4HLUC 1DG3A 4YC7A 4B33A 1E2DA 2OAP1 2G9NA 2ZS9A 3PUXA 1T91A 4HB3A 3VR1A 3GPLA 2WTUA 1KMHA 1IJEA 4DVGA 4U7DA 5JBQA 3FKQA 4NCNA 4DEXA 2QI9C 5EUQB 2GNOA 2OSBA 4FD2A 2FSFA 4Q7LA 4V0KA 1F6BA 4JVSB 3EXAA 1M6NA 5LD2C 1R0WA 1G7SA 3PV0A 1DAMA 4G5RA 1DBSA 2BV3A 4MRRA 1PUIA 2I4IA 2D2FA 2ZRBA 1ZCAA 3C14C 1ZJ6A 1EGAA 5AUOB 5J40A 4BGDA 2XGJA 5P21A 1KOFA 3B1XA 1OE0A 2H16A 1BO6A 4K46A 3PUVA 3W3AA 4GOJA 2O8CA 4A15A 2CHVA 5DHAA 3AP3A 4F92B 2GXSA 4KSBA 1G8PA 4EFNA 2IS1A 4P4TA 1YR7A 1ZIPA 3RWMB 1T0JB 4LV5B 5KO2A 3EC2A 5KSPA 3NBZC 3DL0A 5BYJA 3TVDA 5C18A 3NC1C 4M22A 3B2EA 1W0KA 4DLSA 4WA7A 4OQFA 4UNSA 3F3YA 1ZINA 1SVKA 2QE7D 4MRPA 3VKHA 1YZGA 5CM8B 3PEVA 3I5XA 1JEEA 3FMPB 1JNYA 2J59A 4M9XA 2DHRA 4P32A 2EFHB 1FOEB 1J2JA 1QHYA 2GVZC 1CEEA 3VR6A 1CULC 1S3GA 3D6TB 4QG7A 2NIPA 1JXMA 2CBZA 3IO5A 2GXQA 4P4SA 2AKAB 4HAYA 4WZBE 1G5PA 1FPMA 3W6NA 4B74A 5F9FA 3VX4A 1ZM7A 2GJSA 2Q3HA 1XD9A 4WBSA 4ASUA 3K09C 1E96A 3U3KA 2NZ8A 5EE9A 2IYZA 3LH5A 4E07A 4Q66C 2F55A 3LX5A 1FQKA 4TTPA 2AHOA 4IJMA 4GMDA 4F38A 3LXXA 4A8JC 1X3SA 2ODWA 5B2ZA 4OI1A 4ZDWA 2VP9A 1ELOA 4C0HA 4DZZA 5C2JB 1TU3A 1Q22A 3CZPA 1W46A 1RYFA 3EG5A 2OILA 2Z4SA 4LBYA 4LJ7A 3RDPA 4TL6A 4HAXA 1GKIA 4OK3A 3UIEA 2BJWA 2VHUA 4NKRA 1Z6GA 2CL6X 2V1XA 2VF7A 3IQXA 1KIMA 1KTVA 2Q3MA 3CZQA 4Y0VA 4DLXA 2QUZA 2XTNA 2Q6TA 1Q20A 2HXSA 2WZQA 3I5YA 4Q01A 4EPTA 4QM7A 2XZOA 1XEXA 4IFEA 1VG9B 1W47A 3K0FA 1XF9A 5KDOA 1DPFA 3C5CA 2GXUA 5EE0A 2OESA 3QBTA 2FFQA 3MCAA 2G83A 3ONWA 1R0ZA 3X2SA 1UKEA 4JVMA 3I4LA 1KI3A 4CYMA 2FSIA 4BECA 1W44A 4IEIA 4EPVA 4C0QC 1KDTA 2CLCX 5GJCA 4AD8A 5JEEA 3T1TA 1I2DA 1KI1A 3KQUA 1CIPA 5JI3E 4M1SA 1V5WA 1N0VC 1G3MA 2AFIE 5F98A 1EXMA 1X6VA 2QP9X 2O8DA 2O8DB 4Q9LA 1G5TA 3B13B 3VKWA 1PV4A 3LBNA 1VYVA 2IYXA 3LXRA 2ZRGA 5JLJA 4OYHA 2B6HA 4MH0R 2R6FA 3CBQA 1E4YA 4B3DA 3DVLA 2CNWD 2XJ9A 2GK7A 2AL7A 3T1OA 4HUTA 4D0LB 5CIWA 2QMUA 3G5UA 1NBMA 3SQXA 5B64A 3DKVA 4N3NA 4QFMA 1OB2A 4S35A 2C9YA 1Q1BA 2XAUA 2ONJA 1FNMA 1VG1A 1XXHA 4URXR 4MKIA 2X77A 5L3QB 3AEZA 4MKGA 3RS2A 4Q4AB 2GJ8A 1N6IA 1QRAA 2D62A 1S9HA 1SVWA 1JJ7A 3WMGA 1ANKA 2EFCB 2O8FB 3EWSA 3RRYA 1G291 2OFWA 1NG9A 3WHKA 1G41A 2IYTA 2VPPA 1IN5A 2ZRLA 3U4QA 1YZQA 3BH6A 4KJZA 1KHTA 3FWYA 5EE5B 3PXGA 4UNPA 4AKEA 4ARZB 4DEYA 2MMCA 3QOFA 1SVMA 2GETA 2W6JA 4H9GA 3T06B 4NTZA 3TH5A 3RHFA 4CGZA 2RCNA 3CPEA 5J47A 2XNSA 221PA 2RB4A
chains in the Genus database with same CATH superfamily
3OU6A 1EEHA 2AFHE 1NM5A 1GGJA 2QWXA 2RDMA 4H4DA 4LC0A 1EGMB 3IJ5A 1DEHA 2IH5A 1IDN1 3TTUA 1J2RA 1NI5A 2WIKA 2JI7A 1ORVA 1E1CA 1C8VB 1KY3A 3L01A 4HDSA 3Q11A 3ZDYB 4UTRA 1HE3A 3GAFA 4DLKA 1PLJA 3JVEA 2RKWA 3CH6A 4UHCA 1CY1A 4FEGA 2RGRA 2QUKA 3B85A 1XL1A 3MHPA 4Q4JB 3I2YX 3N2EA 3OFNA 4PRKA 2JF0A 3RLFA 4JBGA 5K0FA 1RSZA 2WG2A 1XCMA 1ZJ4A 3K2IA 3GNSA 3MTJA 3GFFA 1U9IA 3OTGA 5ELMA 4TRRA 4YAWA 4B35A 3ZD7A 3SFVA 3B9BA 3M7IA 3THYB 5K0GA 4D4KA 1L5NA 4MQUA 4O4HF 2HNBA 4X85A 3ZHUA 4D4IA 3RAPR 3ZLJA 3RRMA 3SLRA 1M83A 4J0QA 1TD1A 4PHFA 2FX5A 2Q62A 2YY5A 3KOZA 3HDJA 4R8LA 5FPSA 5FWAA 3SGLA 3UKOA 5KYXA 2G71A 2HM7A 4B8ZA 2X1VA 5LNK1 3JQAA 2GNPA 3P45A 3H9GA 1XRJA 3ILHA 4F7DA 3AEUB 5SY4A 2ZI5A 3KSDO 3LC1O 2BZ1A 1NIJA 4RC9A 2PGXA 4Q21A 1UPFA 1ZRMA 4X94A 2IHZA 1Z5OA 3WV4A 4BRZA 2FRVA 5A06A 1CTQA 2Q3BA 1XJ0A 3M83A 3GJQA 5HPYB 1WXQA 2E4UA 3HP1A 4ZVUA 1LJ8A 1Y4ZA 2UYYA 3OBBA 4GP9A 4QTTB 4Q03A 4DWOA 3A6HA 2OUKA 1VG0B 3L9WA 5COQA 4OQNA 5CT9A 5KX5F 1D7OA 2WKWA 4QJIA 4GX5A 3D0RA 1WBBA 4TTQA 1QC5A 1V6AA 1TYCA 3MT8A 4Q4HA 4CL2A 2VSYA 1CUIA 2QPOA 1M75A 1ZHOA 5G40A 2C04A 3DWFA 2AOVA 2RGUA 1XTIA 1U2QA 4UOEA 1QH8B 4EUSA 4MQ4A 2BDEA 4RBNA 3UW3A 3F6YA 3SNHA 1M10A 3LDAA 4KBYA 3KR2A 1FFXA 5IM4F 1C80A 4YRSA 5FFNA 5AKHA 3Q9NA 1HLGA 2XKKA 4H1UA 1PZHA 1H85A 3FBWA 1NLMA 2C2MA 1HURA 4D0NA 4PSDA 2BTQB 5DULA 5E1MA 1SA0B 4TKVB 1UADA 1RPTA 1GLGA 1S1MA 1O3YA 4ALKA 1RMTA 3DV0A 5A4DA 3UB3A 5LBTA 2H2DA 1FP1D 4BO6A 4ESVA 1DC6A 3D4OA 3WOHA 5A4FS 4DLAA 2I80A 2QG6A 4IZIA 3P20A 2H17A 4G89A 4E2WA 2XGOA 5ARBA 2GPAA 3DQQA 4C6SA 4RQUA 4EGQA 2K6GA 3OOEA 1J22A 1KJIA 1Y4DE 1ZSYA 1L8OA 3KKEA 2IK8A 5GMOA 1EE2A 1U1EA 1Z8HA 2P2LA 4JHXA 3JPYA 3DT8A 2HLDA 3S2YA 3TD6A 3KJZA 5HMLA 4IDOA 4D9JA 1DQSA 2XD9A 1LDGA 2P2SA 4FP9A 4LOAA 2IYNA 2LD4A 1O4WA 4L28A 4R5MA 1EBFA 3I23A 5E3JA 4O4JF 4DLBA 1YJ5A 1SFRA 2Q9CA 2R7AA 2YJNA 2G5PA 1UH5A 3QEMA 3CB4A 3TNLA 1P2FA 3DBRA 3VO1A 4YHHB 2YMLA 5FP0A 1V47A 3R8XA 4DIOA 4B5KA 4CIYA 4GBED 1IBMB 3KYDA 2FWBA 2W42A 4Z51A 5DN9A 1M2VA 2SBTA 4JOSA 2JJMA 1RW4A 2ZSFA 2XUDA 3GP3A 4N39A 4BYGA 5CDFA 3OKCA 4XEUA 2YS6A 3ANMA 4HOYA 5JT1A 1NR7A 2WA1A 3PRHA 3AR7A 4UFNA 4X60A 2HBRA 3EXFB 4IDHA 5DSTA 3VBEA 3LX6A 1DX9A 1EDEA 2Q7DA 1WKBA 2PS1A 3QWHA 1L7RA 1NXQA 1NQAO 4HTFA 3TTTA 3KKZA 4GE3A 4MLZA 2GT1A 4Z0PA 4KN6A 3F74A 5I7UA 1XAGA 4WMLA 2QLTA 3GEEA 3I9JA 3KXIA 4FFBB 5BRAA 3RFFA 3BD8A 2IY7A 3RTDA 1C8LA 3L02A 3DVAB 2EBHX 5JI2E 4JCOA 2O7SA 1M67A 2A1UA 2F9LA 4ZPXA 5ENZA 5DGHA 5CJ2A 3FTPA 2PNJA 1NY6A 3UWMA 5B7PA 4R4JA 4DV0B 1YQ9A 2QZZA 3ITEA 4UNNA 4PR3A 1X8KA 4M0KA 2WKPA 3AILA 8ATCA 1XDBA 1SBHA 5IP5A 3NGMA 3U2QA 4AJJA 2I9PA 2VWPA 4WX2B 1Z5PA 2HA0A 3IVAA 3T9CA 5CFRA 4RTRA 3ILSA 4B3MB 4UJ5A 1SK9A 3M1IA 5DIZA 3KOXA 2OYRA 3ZDEA 4DILA 2EWMA 3EPRA 1X1CA 5FOSA 4ECEA 1RJEA 5JALA 5BSEA 4XJXA 5IK2D 1K6MA 5HCIA 2D5AA 5MFZA 1KEKA 4ALLA 5IJ0A 4C0KA 3ADBA 2BF4A 1TF2A 2C2XA 4CCAA 2ORIA 3I32A 4M7OA 3OZTA 4G8CA 1E6MA 3CPJB 2OCDA 3ROGA 1IVNA 3CV3A 3SZMA 3V4RA 4HV4A 2PEZA 2Y93A 1W19A 2W4QA 1FYXA 3QPDA 4AG5A 2I91A 1MN6A 5I51A 2WIDA 1NASA 2QTAA 1T0IA 2ZQYA 3SBEA 3LQ2A 5IVKA 4R9UC 1CP3A 3O7MA 3LP6A 4QT4A 1UDBA 4MW1A 1I3MA 5M7EA 4HWOA 1G2PA 2CXSA 2JIDA 1DAIA 1VYTA 2XHEA 1YRLA 5BO5A 4A36A 1GA6A 1SC6A 3SMVA 2MSNA 1QH1B 1XTPA 2Z0MA 1Q2XA 4IYJA 1NOKA 2P2GA 2G9ZA 1K5GA 2G6BA 4L07A 4XB6B 3UJ7A 4BO4A 4DA7A 5KX5A 4DQVA 1OKKA 2RJNA 4K3UA 2WOJA 5DBFA 3DMPA 3LIPA 1Z25A 4QU0A 5B55A 5CVCA 4UD2A 3IPCA 3D5EA 3GVCA 1VPTA 4JKOA 5IHXA 4UU0A 2V96A 3BB1A 1EQ2A 4IAOA 4RQTA 4BX3A 5IM4A 4KYVA 1QCCA 3BMNA 5AXAA 4AQDA 3TPZA 1UL1X 4TMZA 4CQMB 5BOSA 1SBYA 3GUVA 3LGAA 3ET4A 1M73E 2QYTA 2CDRA 4RYLA 3CMCO 1ZOPA 4GOOD 4TOIA 3ZIAD 4Z49A 4HYQA 4CG0A 2NVUA 5JDIA 4EJSA 1C1XB 1EP3B 2IYYA 1YHYA 4GPD1 1NDHA 4P7BA 1JDBB 4YONB 2CWWA 1T1SA 3OEHA 4CMHA 5KTOA 5DF1A 1VHQA 1NVUQ 1J2EA 3QW4B 4F2GA 4K8RB 3ZE1B 2O8EB 3ZK7A 1XQVA 3CLTC 5T67A 1QWOA 2J32A 4G41A 4BB5A 2VTDA 3JQ7A 2O0HA 1JHXA 1G4HA 3QJYA 4IGEA 4L2IB 2QL5A 3ZZMA 4G0ZA 3AP1A 5AHWA 3TUZC 3D4BA 4CQJA 4K7JA 2D1RA 3ESBA 2AOTA 3IHKA 3DE1X 3DE7X 4ZEXA 3THXA 5CVJA 2JHPA 1RKVA 1NA5A 2GEBA 2OMKA 1HNNA 1GEEA 4LSGA 3FCEA 3KHSA 4MV4A 5EVCA 4E5PA 4JBWA 5DIFA 1PZMA 1UBGA 4DBLE 5BPFA 4HTAA 1DWQA 4B7CA 5D2CA 1V7ZA 3HKCB 5DOZA 3KTDA 5K6TA 4I8DA 3UCFA 5C8XA 5B58C 4QFCA 5HFJA 4OV6B 2YASA 2XZLA 5AO9A 5JAQA 1JA9A 1PX2A 2ZAOA 1KYQA 2EZ8A 3PNVA 2QX4A 1H0RA 3TZEA 3II6X 1FUEA 4K9SA 3RNOA 3EVCA 1F5NA 4WY8A 1TK2A 3JD0A 1E1DA 3FHCB 3Q5GA 4WJZA 3T34A 2BEWA 3SEQA 1W88A 5G4KB 5EYPB 5BY2A 4C78A 2DVMA 4TXJA 3M1YA 3PFHA 2ZJFA 4PSAA 4X54A 3RSQA 1ZNZA 3D3KA 1RD4A 2G0AA 1GFWA 3I2GA 3W90A 1CQXA 4TKZA 4DA4A 2PVSA 1CUVA 5SY6A 3LU1A 3WQQA 3ZGLA 2UZ3A 1KZ9A 2DZDA 2J9RA 4EBFA 2CYBA 5I4CA 2ZJ6A 3SQOA 1CW2B 4EAAA 4IXTA 3G49A 2XRZA 5F9HA 4BC1A 2A7QA 5AKYA 3MRVA 4QOHA 4TLCA 4U2FA 1MUUA 4M0MA 4HGRA 2HSZA 5CCDA 4UQOA 4W8OA 4AZ0A 4TXNA 5JZVA 4EJ6A 1EFRD 3X43A 2XOEA 4FTWA 4KXVA 4ABYA 1BC5A 1E1MA 4E08A 4Y2YA 2LP4Y 4N9WA 5D84A 1XK7A 5JFGA 5HE9A 1WF3A 3BMOA 4B4DA 5HZKA 2ZSDA 2BE7A 2QT9A 4P7GA 3OE7D 4QEKA 2Q2OA 3NV7A 2FUG1 3MTAA 3MB5A 3QVGA 1K97A 2CZQA 2OTCA 3VR0A 3C3KA 3WKDA 4WIAA 2AGVA 3OJ0A 3IAFA 5BT9A 3V4FA 4F8JA 5KQGA 2AEMA 1Z38A 1DKUA 4DIBA 3EY4A 1MX3A 2QUHA 5I9LA 1FFYA 4XVQA 821PA 3RYCB 3SX0A 3ZW8A 1KXZA 1L3CA 2IYAA 3U7QB 2YW9A 1YDWA 2KJQA 2HPZA 3O90A 4JB3A 5JOQA 4J9VA 4H4CA 1IBCA 3BWCA 4JB2A 2LDXA 3O8DA 3UHFA 4ND8A 3WLFA 5KJ6A 3AEKB 4N7JA 1CX9B 2EATA 1ZA1A 5THQA 1BKDR 2JGMA 2DLDA 2XNDA 3F47A 4DYVA 1QUFA 1ODIA 3OQPA 2K4MA 3ZW7A 4PGMA 3ZTYA 4JEMA 3L05A 1U5BB 2IZZA 4LQCA 3COSA 4MUAA 4UAVA 2G28A 4XX0B 1BEEA 2ESRA 5AP9A 4YRKA 1V35A 2F9MA 3ZI7A 3QSGA 1D2NA 4GUDA 3QSYA 2PM8A 3FI9A 1J99A 2VAWA 2X2FA 1HX7A 2ROQA 2GHRA 2NT4A 2YZMA 4NF2A 2FPIA 1BHO1 4PIMA 1MXHA 3I0NA 3L8ZA 1LWNA 2IS4A 1OYVA 5IBQA 1ULAA 2OOKA 3NP9A 3MRXA 2ZIAA 3P97A 1MPXA 2IXDA 2HWKA 5KSWB 3QKSB 4R8MA 2OORA 5AW8A 3VR4D 4XJVA 3LPAA 1K3UB 1Z0FA 2NO7A 2V9ZA 3K0HA 3DLTA 4G6ZA 4H7FA 4OK6A 4UM7A 5DISB 4FYJA 4EG5A 3HEAA 9LDTA 2ZZNA 2W8BA 4WZAB 2JAHA 3WIEA 4KPYA 3RC2A 4GOMD 3NDIA 1Z68A 2BWJA 3PFFA 1FLDA 2NXWA 3DCIA 2CN1A 4DA8A 2JG3A 4TT3A 4YLGA 1BOFA 3C48A 2AWNA 2PL3A 3G9UA 5JASA 3EA4A 3EVGA 4OM7A 4MDHA 3RTAA 1SQSA 2WU4A 4UCQA 3M4ZA 5ALEA 4IZOA 1WQ3A 4LYGA 2P6RA 3H11A 2CYCA 2C9OA 3PC3A 1DQRA 3SP1A 3W6PA 5JDCA 3A4YA 3I9V6 4EKGA 1AH2A 1CLEA 4REQA 3F3MA 4NU8X 1XTTA 1CJSA 3F0TA 4MV5A 1QH9A 1JDBC 4GT1A 4LISA 4MVYA 3BQMB 1U0GA 1U90A 3FNQA 4MUBA 5ESDA 3TBKA 2FPPA 5F7XA 4YJ3B 4QYWA 2ZUBA 2BKXA 1JTEA 3NI2A 4MVJE 1ZD1A 2FW9A 1NP6A 3ZE9A 1QK4A 4HMPA 2ETVA 5LMZA 4KE9A 3LTNC 2H0QA 4FJ2A 5FV4A 4LQ4A 3QMPA 2BHLA 4MX8A 2YHIB 1RHRA 3K31A 1AY0A 3EEYA 4Q12A 3TEMA 4C3ZA 1T5HX 2HR1A 1QLHA 1XA0A 1R0RE 3OFSA 1MAAA 1L4BA 2ZI9A 1PEKE 3LVRE 3E7DA 3PD7A 5T6MA 4AP9A 4BAZA 4F5EA 1C9EA 1UBOS 3E48A 3GJ7A 3QYJA 4KAAA 4WFIA 2ZUEA 3DMTC 3F67A 4AYTA 5CT4A 1ZCFA 3I2KA 2BHSA 1RTTA 2P75A 4PC1A 4ZQFA 2PXXA 2M1ZA 3G9XA 5AJXA 4AZVA 4OD0A 1KSJA 4QGFA 1NVEA 5A5VA 2QN3A 2YWJA 1OAAA 3KAJA 4IWXA 1E63A 1ZU4A 1XTZA 1A76A 4LSMA 3BJIC 4R5HA 4ZT7A 1E4EA 1QTNA 2AX3A 4MS3B 4BUJA 4S2EA 2I67A 4H0NA 5JZBA 4Z3DA 4C03A 1R2QA 4TSKA 3AOEA 3HXKA 5I4BA 5JD6A 4C30A 4HJXA 2AD5A 5NLLA 1KKUA 5JD3A 3G2OA 5A5EA 4HQFA 1IPEA 4MW5A 1VZ2A 4K86A 2O20A 1D1QA 3G9QA 5AMXA 1CCWA 4Q7QA 1Q77A 3OKFA 5E6SB 3RPEA 3T5PA 1VA5A 3U1BA 2QENA 1YGPA 2CMFA 2DC1A 3FYDA 1QG4A 1JIIA 4LXGA 1CUDA 2A6PA 1N9GA 3BGDA 4B76A 4BVLA 4E30A 1M1UA 3EFEA 2O9JA 3GRZA 1XLTC 3FYHA 5TQVA 3EMKA 3I92A 2LR0A 3UXYA 2G8LA 3ZGOA 3P9YA 4MS4B 2ZBQA 3NYRA 3TR6A 3F8WA 5H3CA 1ZONA 3IIIA 1OXVA 1YBFA 4WK6A 4KFRA 2PJRA 1SEVA 2AFHA 2FWIA 2ORVA 4B84A 4GR5A 5FR1A 2A5GA 2P8SA 4F5YA 1ZHHA 2BZ0A 3DNMA 3ROPA 4S24A 5AW4A 4ZI2A 4X97A 2FW8A 1J42A 4UW9A 1DARA 1WXHA 4F1WA 4RADA 1IY1A 3L1KA 1A0OA 1JG6A 2OYSA 5F12A 4EGSA 4KXQA 1J90A 1GG2A 1NYLA 5DHTA 1M72A 1YOVB 3CJQA 4K81B 3VBCA 3GLIE 1WV0A 3QEOA 5DWDA 1ZX1A 2NXCA 4Q6BA 5T4HA 1CJTC 4LN1A 5I5GA 1NNSA 1ZICA 5EKSA 5AK0A 4P35A 4RACA 4Q9AA 1UZNA 5C1IA 4DY6A 2XQGA 4XAQA 4MGHA 5CT6A 5HF6A 2HJWA 3OESA 1GTL1 2ZEJA 5A6SA 1TIPA 1F9AA 3SK0A 5K8TA 1KQ3A 4U7JA 2QUIA 3KTOA 4YT8A 4V2IA 3I61A 2HTEA 1KU6A 2D1YA 4URYR 1B6SA 5G1PA 2CDNA 1HORA 4IQGA 4KV7A 4D8YA 4OHCA 1BXRB 1LBQA 1Y8RA 1PF7E 3BYZA 4RXTA 5DBOA 5JANA 1NP3A 4CMBA 3MYRA 2NQTA 3OSZA 3MMPA 1XQXA 2WDZA 4S1WA 2V5VA 5TQ2B 3TLJA 2H4ZA 2V4UA 3BIXA 1FP7A 4JBLA 4JNKA 3DDNA 4CLOA 1VJ1A 1ULUA 3R0IA 3K0AA 4ID3A 2C00A 4M4SA 4URZR 3SC6A 1EUDB 5A3RA 1M6VB 2FPGB 4NC9A 4RFSA 4TKUB 3LWZA 4IXNA 1N78A 2IZ6A 4C3UA 5BSKA 4R1OA 3CM0A 4Q37A 3AP2A 4JOBA 4RQAA 4UDNA 1LNZA 1FBNA 2B7CA 1GDDA 2HCRA 2WZCA 3A7EA 3PXDA 4LW8A 4RK6A 2XTMA 5DCYA 3AYXB 3LP5A 5FV7A 3D54D 1UJ4A 1VZ3A 3GFTA 2RAVA 4OLBA 3A14A 4QFBA 3LY5A 4BX0A 2D5LA 3FUXA 4I1PA 1QQBA 1RCUA 1K63A 1QHHA 3EG9A 3GW8A 1C3OA 2BEVB 3ZIUA 3DJFA 3KTAA 1I6MA 5EN4A 3VZPA 1JAHA 3BTSA 3ZCUA 1YWGO 1XVVA 2W2NA 1W52X 1G6OA 1SPXA 2WWWA 4ISCA 5J2TB 2P0EA 1R8JA 1N4DA 3VHXA 4ZHQF 2QTBA 5CH3A 1FPQA 1OFUX 3HYCA 1H6AA 3GGOA 4LVUA 1II0A 2ZS7A 5CJJA 3VYSB 4OAPA 2N42A 1WZIA 1NPDA 2HIAA 3R3WA 3T5GA 3G7UA 3H7IA 4EJFA 1DKOA 2JEYA 3X1DA 3FYUB 3K9QO 4ML3A 5GQSA 2CNDA 2M98A 2HWYA 1NRJB 1OA0A 2YJ3A 1RCFA 4DCSA 2K5UA 1W0JD 2C8KA 1L5HB 1ZK0A 3G8AA 1MZVA 1A95A 1PR3A 1TJ3A 3O4JA 4EKIA 5JD5A 2P3LA 3L0SA 4X65B 5JYCA 2X5XA 2XADA 2VUHB 1KJQA 5A3SA 3WS7A 3P27A 5IYZF 1ES9A 2DY1A 2IYPA 1IQ0A 5HYVA 4BP1A 5DM70 2V7WA 2XYRA 1SHKA 2AD1A 2PT9A 3GCXA 3ILXA 3NFRA 5LCXA 3HMKA 4GBMA 1NNUA 1KP9A 2O4CA 2RBEA 2GQ0A 3DO6A 1FDVA 4E3ZA 3SR0A 1HLPA 3ASVA 1CHDA 1VHWA 1XXHB 2WJWA 3CRZA 2WU3A 1Z82A 3B6EA 3JRXA 4NENA 1I51A 4JWKA 1IUOA 4AJ9A 3ZR4B 3OG9A 2XCUA 5E9WA 3VM6A 6LDHA 3R23A 3PPIA 3MOSA 3OPMA 4BHTA 1M6EX 3JD4A 3QOXA 4JI3B 3O75A 4X63A 4NYMQ 2WP8J 4K40A 1GTMA 2ZIZA 4OAOA 1NFRA 4KACA 4PGAA 2D13A 3NTUA 1DKNA 4M8IA 4OI0A 1HE1C 3QU9A 4OKNA 2PBFA 3AR4A 3TYXA 2BGGA 3VMMA 2WIJA 1G2QA 4HNVA 3U4QB 1UKZA 4QSMA 3PFCA 3GI1A 4FFNA 1GGMA 3RQSA 1MP0A 3SXUA 4EG4A 3TG8A 3HPQA 4NFSA 4BZQA 1N9ZA 4JUBA 1L7MA 1JHPA 2FTKE 1Z74A 2QZJA 4IRMA 3T4XA 3NBYC 4XFDA 3X1JA 3D6NB 4YASA 5AJHA 4P86A 4A10A 4XWOA 1W94A 1FL9A 4YIKA 2RHJA 5BR8B 6ABPA 4PTLA 3QFHA 4FHFA 2SHKA 1YXMA 1T2UA 3NHYA 2HHCA 3TLAA 3VOSA 2Z1MA 3IHWA 4TL7A 4DCTA 3G2KA 3GQBA 2UXBB 1KNQA 2IE0A 1TQDA 2MTBA 2ZTVA 1P7ZA 3AUTA 3DUFA 3OUTA 5C31A 4MHTA 4CRWB 3CBGA 3WMFA 4MIOA 2GKGA 2O52A 1Z62A 1KKMA 1KYWA 4BNZA 2Z9CA 4BQNA 3AK4A 3Q6MA 4OJNA 5DYNA 4Y2HA 1PUJA 4M8KA 3WV5A 1E1CB 1K08A 1E3JA 4HDSB 4RPLA 2JZNA 2ORYA 4YT2A 4KUEA 3W2HA 5BN3A 1OWNA 3R20A 4P9NA 4D57A 1O97D 4L5JA 1XQWA 4RDCA 2CHUA 4UULA 1F12A 1GEGA 5D6NA 4QM6A 2GD2A 4R6WA 3GFRA 2HJGA 3IQFA 3T5DA 3VJKA 5EA2A 1U2DA 2P0YA 1WULS 2ZSEA 3E58A 1I3KA 5JAPA 1CS4C 1PL0A 1SOMA 2W6PA 4MWTA 5JECA 1LLCA 1ONBA 2W6NA 3VZQA 1ORTA 2ZWOA 4JLMA 3P0RA 1E92A 5D3MA 4P7KA 1QGUA 1NJFA 2Y99A 4KBGA 2IZ0A 3GT4A 3LW8A 3R7LA 4DVJA 5B3AA 4F3RA 2FSGA 4A27A 5IT0A 3AU8A 1H4QA 2FB9A 4OHXA 3O4IA 4B43A 2EGGA 2YZ2A 3VR4H 2ZI3A 1RXIA 3LBFA 2H9YA 2FZWA 2VBIA 3EZ6A 3MNFA 3JQAB 3QYPA 2IP2A 4RZ3A 3OIVA 1Y5MA 2ZDQA 1PEDA 3K4QA 3PG5A 1SOWA 2JIZA 1DDGA 2BGNA 1MPTA 4L5AA 1L7VC 3M33A 2Q9BA 3MD0A 1YIOA 2B4AA 2A0XA 2IYUA 4AW9A 1U8UA 4TMFA 1LLQA 3PF8A 4XM2A 4ZC1A 2JHGA 1Z6QA 2GEUA 3UG6A 4JI7B 5DWVA 1MDFA 2C1ZA 3IR5A 5J5VA 1OHHD 1CF4A 2WSIA 4KWCA 3VNRA 1ESZA 1KFBB 3EGIA 5KI6A 1OJLA 3A1EA 3VSEA 1XE3A 3BXHA 3ECCA 3QXJA 4F97A 3UAZA 1VI2A 1QC5B 1SXHA 2RGWA 2WAAA 1LH0A 3HB1A 4BV9A 1VKRA 3LOQA 1SUDA 5LJLA 2R7NA 5KNCD 2FN7A 2Y27A 2QOEA 1EDBA 3QBEA 4CM8B 4B9AA 2BGJA 7MHTA 2XQKA 4W9RA 2GXAA 3A0UA 3S70A 1J8MF 5JD4A 1FFXB 4RWZA 5J2UA 1C4OA 3GHYA 3P0JA 3UWKA 4EPXA 1JIQA 3BQNB 3DC2A 5I7FA 5LQJA 2HU8A 3FVQA 4MWDA 2HHJA 1IXSB 4XQCA 4B48A 2P62A 4FUTA 4IIEA 1FYEA 4LZJA 4WAUA 1GZVA 3JQFA 3P71T 4JU9A 3WL7A 1HG1A 1KERA 1XZIA 2EKDA 1FJGB 2WAYA 4IIVA 5IJXA 3IOYA 4ARVA 4MCJA 4CTOA 4YJ2F 1JFLA 1D2AA 3A9RA 1L1RA 2C9CA 2CHGA 5CCEA 1UZLA 1O6BA 3OCXA 1BMFD 3OLCX 2PSFA 5AUQA 1YAJA 1U2GA 1WUJS 4PU0A 4O2BF 1SCBA 1X9HA 1N3BA 1IU9A 2E4VA 3FOBA 3GEIA 5ICCA 1WM1A 2PGDA 4K6GA 1QHNA 2BMWA 4REMA 3TW6A 2OCAA 2RK4A 3D8HA 3FYUC 3SZLA 5IYZA 2I4NA 4AN1A 1H66A 3UHJA 3Q87B 4MVJF 2WU0A 3HJHA 3ZBQA 5EMJA 1AF4A 2J0QA 1J5EB 2UYHA 2GTHA 2HHHB 5JSHA 2VDUE 5HEKA 3QEMB 1CXZA 1PLLA 2GO7A 4R2XA 2OHFA 3DBRB 3L0BA 1PVVA 5A1JA 3ZKWA 3AFIA 1KKLA 4QYSA 5AKEA 2H1CA 4Z9FA 3RVKA 4J7XA 3OC6A 4RVHA 4XLZA 2EJBA 1HE4A 4NWIA 3KYDB 2P5UA 1OR8A 3ZHYA 4R0MA 1XPOA 3L7MA 1M2VB 3RARA 3QQ5A 1SCKA 2Q4EA 3ANYB 1X0XA 2PTGA 4KO3S 1WG8A 1Y1RA 3I5MA 4OHVA 4Z7QB 5JAHA 2IBSA 4JGIA 1V16B 3KVVA 2HJVA 4LOLA 4Q18A 3L41A 4F9TA 1GQSA 3COJA 4RE5A 3HYTA 5HRUA 3H2JA 1TUIA 4PFJA 2A35A 1IHYA 3JPWA 4JQSA 1CIVA 2OOSA 2NV6A 4MUFA 1XSEA 4IG4A 3O83A 2W2QA 1QIEA 4XUDA 4CCSA 2FJPA 1T2DA 3TLGA 2FMXA 2FW6A 2I1WA 5GONF 5EJ6A 1U28C 4Q5IA 4J3JA 4OTZA 1S4QA 2AG5A 2YN0A 5E38A 3T1YB 3H1EA 2A78A 2F1HA 3IV7A 4BNKA 3AR6A 5BSVA 2NO1A 1K8YB 3ZZTA 3KKOA 1A2KC 3TUJC 1X9GA 2A1UB 1KH3A 2QTGA 3EASA 5EFZA 1I1NA 3LRTA 4J2OA 521PA 4EATA 2Z30A 4ZYVA 1EP1B 3AY7A 1NPYA 3KLPX 3ZJUA 1ZWKA 4IDQA 1JHDA 2WSMA 3CUVA 3GDHA 4XM1A 2XNJA 4DCJA 4G1UC 1JR4A 1N6HA 3K8OE 5IHPA 3M4YA 1NM5C 3R6DA 1NP7A 1H8HD 5EJ4A 1PX0A 1ZDMA 3Q9SA 3VR3D 1QIKA 1N5KA 5H70A 1I4DD 4NZNA 4HNTA 5AW2A 5FXMA 4UFPA 3NP7A 1QQAA 1W6UA 2KE5A 3AM4A 1DHRA 2XZPA 4HRYA 1YRAA 1R5BA 1RQGA 2QY9A 3UGKA 3V1TC 3V8VA 2Z5FA 2RAPA 3C87A 1FDIA 2B2XA 3QVWA 4PX2A 1C29B 5DTMA 3CEHA 3ZWDA 3D4LA 1WSDA 2C3MA 2QY6A 2YXNA 2B6NA 4O4HB 1P0FA 1AOXA 1I1QB 2CNWA 2WLTA 4NXNB 1TJNA 4I50F 1I30A 3T4PA 1RWVA 4GGPA 1BWSA 1C1HA 1T2NA 4MZDA 1U9IC 4BFUA 3MJRA 2ECFA 3MSXA 4WI1A 3KPYA 1U0FA 2QW1A 3ITDA 4BQIA 3ASUA 1N3LA 1W25A 3JQDA 3M0EA 4HBGA 1SHLA 3COWA 3RFCA 4U7GA 3N05A 5AKZA 1EFUA 3W3AD 2GNAA 2P7HA 1Q95A 4V0MA 3BILA 3Q4GA 2HLNA 2QORA 5FTLA 5D8DA 2PKEA 1E58A 1UPUA 4ZEMA 1S3IA 4DSOA 4LJYA 3ZXIA 1E9CA 1X14A 3I6YA 5KX5B 2D2EA 3ENQA 4R7TA 5ESXA 1P4GA 2B20A 2PRZA 1DC8A 1C7JA 4F12A 3STTA 1I0ZA 4QICA 3TTXA 2A9VA 1CDOA 4NZMA 1PR0A 3FFXA 3GAMA 3EEOA 1DE0A 3LT2A 4LK3A 2C0QA 1BMQA 1QF7A 4BBJA 3E9QA 1UBUS 4IUYA 2DQZA 3GJYA 1AO3A 2YINC 4HZUB 4WRRA 4TZ0A 1RYBA 3BMNB 2R00A 2UZ1B 3CTPA 5K4AA 1RXWA 2FNAA 1KVSA 1SHUX 3RT9A 4DF3A 5FX2A 2PH5A 5E8JA 3FPFA 5HQJA 3GRKA 4IIUA 3ZGZA 1EK6A 2ZW9A 1KPIA 1C30B 2IBMA 3COYA 5TT1A 3T5BA 1ZLYA 2FX2A 3W3ZB 2NYAA 2GZSA 1SIWA 3AJEA 2NVUB 1ISIA 1ZFNA 3V9PA 1J09A 4A6DA 1BRMA 4EJSB 1PJSA 3ASZA 3PI6A 4ND6A 4QXPA 4AL4A 3HVKA 4C2TA 2Y1EA 4DNFA 4YJ2A 3INRA 1NW9B 1L1EA 2Q9AA 1Y48E 1B0PA 2FDRA 5IEJA 3T1QA 1AS2A 3S4YA 4XYEA 1QTIA 1QGED 2ZAMA 4EZIA 5KOHA 2NPIA 1ILWA 3N0VA 1JIKA 1M0TA 3DGEC 3IBCA 2XDWA 3LSYA 4L9RA 1A9XA 2CLIB 1V37A 3DJYA 1A8HA 4L51A 1RKUA 1Z75A 2AOTB 2CCGA 3B5EA 4P3PA 5TMBA 5FRDA 1MTZA 2Z2KA 1NIPA 1QRRA 5LD2B 3HJFA 4IILA 3K6JA 4O4JB 3SKXA 2YRWA 3ZNPA 4BFZA 2V3CC 2I2FA 4LJ5A 3C7AA 1GARA 3U0VA 5B7NA 3HGQA 4EQZA 3CVXA 1OOEA 2APJA 3LZCA 4FJ0A 1A9YA 3HO8A 3ND7A 3ZXYA 2EP8A 3HWSA 3HRKA 4BLPA 1PTKA 5KVCA 1MG5A 2ONYA 1GCUA 2WHRA 4H31A 2Y0PA 4AG3A 2P9GA 2AZXA 3OQ6A 2Q1YA 3LK6A 4UMEA 4HRXA 3G88A 2BEWB 3IV9A 3QY0A 1U3WA 4QRDA 1KI7A 5DI9A 2FZ4A 1G1MA 2RSLA 2PZEA 4TLBA 5EESA 3SS8A 5ITWA 5B6PA 2B98A 3L79A 1Y1LA 1T1GA 4HVLA 4JEIA 4J03A 5CA1F 3J81k 2UUCB 3BIWA 1BU8A 2GBGA 2OXRA 4FLFA 4LJ9A 5GONA 4I3HA 1E5QA 5FOTA 1AHHA 1SXJE 5JRJA 4ODIA 1QHSA 1P80A 1EHIA 1S2LA 5BQ5A 4HH4A 3TQRA 4GP6A 2IX3A 621PA 1QIFA 1ZOOA 2P6PA 4NG5A 4HDCA 5JAIA 2F8MA 1VCNA 4DQUA 1NDUA 3NAQA 1CNFA 3LBAA 1NJ1A 1CUAA 3BH7A 3KX2A 4IDNA 1IULA 5GVRA 4QDTA 3V4SA 1OX6A 3U9TA 3ZDQA 1I3OA 1X94A 4G09A 4PZCA 3FY4A 2HHAA 3IPLA 3GDWA 3LDGA 4ZYLA 5MN6A 1LC0A 2R7MA 1ODTC 4CMCA 4ER7A 4WKOA 5HA5A 5K99A 2YYZA 3KOWA 3E2IA 4M1KA 4MK4A 1I7QB 5GVSA 2O8BB 2JATA 1P17A 1EUCA 3LXMA 4IMIB 3EMVA 4K2HA 3JR3A 4KO8A 3CUYA 1Q6YA 2UUBB 1KBZA 3KL4A 1TIKA 4INZA 4X66B 4JGBA 1MG0A 1GPDG 1X1AA 2F00A 4GXNA 3LA6A 3A6FA 2JFFA 1ZXLA 3EQ8A 3MTQA 4TWIA 1QHFA 3ZOKA 4U6SA 3LPCA 3VTZA 3VISA 3M9WA 4IIHA 4B09A 3FWHA 4WBXC 1VBMA 1ICIA 3BH0A 2VDQB 4GECA 4NS4A 3SZRA 5HOQA 4ND8B 2HY7A 4FCCA 1WCV1 5CBPA 1AGYA 2H7CA 3W9BA 5JXIA 1KJYA 4B40A 2HMTA 2XQIA 2GD1O 4YA6A 3WQRA 2QN1A 1I4LD 1W87A 1LQUA 2OECA 2NU9A 2J3DA 2O23A 2OXEA 1J0XO 2WZBA 2ZOSA 2B0JA 3BERA 4FEYA 4IRXA 3CLHA 4C20A 5I9IA 1EM8A 4B8WA 2GN6A 3VU3A 4RF2A 4AXBA 3EULA 3WLJA 1WTCA 4BUZA 3T0FA 4RK4A 3VSCA 3QYFA 3DP7A 4B6GA 3GOQA 4J49A 1L5MA 3M5DA 3SOZA 5JNVA 1KYVA 1VL8A 1HE2A 3EF3A 5FULA 3UATA 3M6FA 2FPIB 4JP2A 1IAQA 1RFLA 2P67A 1GL6A 1E4VA 1GZ5A 3HBLA 1NBHA 3NYQA 4RJLA 5GJBA 1USKA 1IY0A 2JLSA 1FYDA 2VPXA 1GZ4A 2EBFX 3K96A 2EU8A 4EHHA 1V3UA 3BZUA 4HXGA 4MW2A 4ZVMA 3ASYA 4UHKA 1KSHA 1R8QA 4IJVA 5CVVA 4XVHA 2DBQA 1UMDA 3FCSB 5CH5A 3FD8A 3NETA 3Q9LA 2X0FA 1GKUB 1UOPA 2G1KA 2W2KA 3MK31 1WCIA 1Y4AE 3C3BA 2GJAA 2JAOA 3LQFA 3JYOA 6YASA 2IXBA 3PDHA 2GTIA 5DO9A 4QLAA 4EQ6A 4XYMA 1PCXA 4F06A 4XGNA 3DMNA 3FSJX 1HDIA 3MAJA 4Q1AA 3SHQA 3IERA 3H11B 3N1UA 1J0CA 3H97A 4CV2A 1PW5A 1QV7A 1R5OA 4KQEA 3MT9A 1R50A 2XA2A 3ICVA 4REQB 2NSDA 3ONNA 4H17A 2OB2A 4JMPA 3E7FA 5JDIC 4EJSC 1BOOA 4DQKA 3AF6A 1ZD8A 4MQFA 5JCJA 1TAQA 5LKRA 4L5CA 1W1IA 1MRNA 2O6HA 1NJSA 1P1RA 1ZZEA 4CNQA 2FPPB 2VXYA 5JHGB 1MVOA 2VUIB 2ZB2A 3EBOA 3MLBA 2B30A 2D8MA 2DPLA 4IH9A 4ZYYA 3O31A 2PA3A 4RKQA 5C7OO 3WI7A 1WABA 3WJ1A 4OHPA 4NOLA 3PLAE 1L4HA 1XA3A 2YNMA 4RNCA 2QM7A 1QS0A 4YUVA 3H9CA 1ZH8A 1KU0A 4UFOA 4NZPA 2C4VA 4H59A 4HFNA 2FOIA 1T0BA 4CCWA 3PNQA 3L7NA 4Q34A 2JKZA 4QEZA 3SJAA 1E66A 2XXBA 5CG1A 5TIIA 4DLYA 3TDKA 4E70A 2D59A 1VJGA 3B3QA 1C14A 4ZI7F 2Y9PB 3T1VA 4BQPA 4P3KA 4MV1A 4A91A 4UEOA 2IU0A 1WSWA 2YIMA 2OV4A 3C5VA 3CF2A 4NEGA 5EJIA 3B6MA 2ZBEA 3ZQKA 4JASB 4B6OA 2FZGA 1N0WA 5JG7A 1Z47A 2VP5A 3IUPA 3RB8A 1E4EB 3GF4A 1UPCA 3WNQA 4NE2A 2DBYA 2NO9A 4XDYA 2HCTA 2QW0X 5FT9A 4F5WA 1D4ZA 2I33A 1E0SA 3KC2A 3Q3IA 4L95C 4MW4A 3E8SA 4YMGA 2CLKB 3NDRA 3OUZA 1G8GA 3AUKA 2JLYA 4FXPA 1WDKA 1H2WA 3CR8A 3I30X 2X7JA 1LD3A 1JMYA 4K9NA 3UF0A 1H2B