3BB3A

Crystal structure of toc33 from arabidopsis thaliana in complex with gdp and mg2+
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
242
Chain Sequence
EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords T7I23.11 protein
total genus 76
structure length 242
sequence length 245
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bb3A00
3SOPA 5EP2A 3GFPA 4O2LA 2GETA 1MO4A 3RLFA 3TIFA 1XTJA 2QL6A 4CEJA 2VP0A 2WWXA 1KZGB 1P72A 5DYIA 3BFXA 2IC5A 2IK8A 4C30A 1YU9A 4K8OA 1W47A 5FPTA 2PT7A 2CE2X 2AFIE 1OIVA 4MYCA 4OQXA 4A2PA 4KODA 2UVQA 4M0LA 1W36B 4KVGA 2TMKA 3W6OA 2AR7A 4TYYA 4BFYA 2RGDA 1H8EA 3DL0A 4LJ8A 1BS1A 1OKKA 1HY3A 1YZTA 2PLFA 4OI2A 4TLDA 4P3YA 1XNJA 521PA 2O8EB 4DLUA 3EWAA 2GNOA 3CNLA 1GOTA 1P9WA 4RFVA 4FCTA 1UPTA 5DHFA 4D81A 2DFKB 4EPYA 2J45A 5JEDA 3WHKA 5JCZA 3TJZA 4OQNA 1DADA 1S1CA 4LV8B 1XMVA 1CXZA 1P6XA 4UNNA 2BCJQ 4OHXA 2GZHA 1N6NA 1G9XA 2ZU0C 4OHWA 2YINC 4V0OA 4A15A 5KOYA 1AS2A 2HF8A 3H1TA 4MUAA 4B2PA 3EWSA 3GJ6A 4EFNA 5EUMA 1QHIA 5CB6A 4F4IA 4DCVA 1U9IC 3KXIA 4GRAA 3SYKA 2W0MA 3B8HA 3M0EA 1LTQA 4LHWA 3L0SA 4LHVA 1TQ2A 4PO1A 5CLLA 3ZH9B 1Z0IA 4LV5B 1J8MF 2GILA 2WWHA 4Q4AA 4KBFA 3QQ5A 5FOWA 2EFGA 3AUXA 2CL7X 3NC1C 4C7OB 1XDBA 3L8YA 2QMUA 1YE8A 4P33A 1NJGA 4ON9A 2XB2A 1SXJD 2DCUA 3UANA 4V0LA 1A82A 3A37A 2BOVA 1WXQA 4P31A 4CT5A 4R2IA 4MGZR 3GPLA 2OUKA 4URVR 2ZM5A 1G18A 3BH0A 3PV0A 4RVCA 4TL6A 4TYPA 1SXJB 2ZR0A 4V0ME 3SN6A 4UJ3A 2ZE5A 3AF4A 3TSZA 1VCMA 4BFVA 2C03A 3C16C 4QHSA 1HE8B 1OIWA 1MOZA 2VHJA 3RHFA 1ZVQA 3RSOA 1KZ7B 2WKQA 4HEJA 1RPZA 2VH5R 4MRNA 1E2HA 1T9HA 4JKIA 2H5EA 1G16A 4PPGA 2G1KA 4RD4A 4TWZA 4V03A 3VFDA 3ZZUA 2VRWA 1E2PA 4MRRA 1KSFX 2IUUA 3CH4B 3CZPA 1JQLB 5KDDA 4EPWA 3B78A 1F3OA 4NHOA 5EE9A 1DPFA 1LY1A 4HAXA 5DI9A 3K9NA 3AVWA 4ZIRB 4LYAA 1IHUA 4NCJA 3K09C 4KLZA 4BPBA 2QEQA 2F7SA 2GJKA 4Z8YA 4MRSA 1H8ED 1W44A 1FZQA 2PH1A 3R8FA 2DBYA 1AN0A 1FTNA 3DEFA 1GL9B 1U81A 1A2KC 4WVFA 2NPFA 2C9YA 3AVVA 3QKSA 2O8DA 4G5OA 3P32A 1DAGA 3TVDA 3AUYA 3M4YA 3FFAA 2C77A 3U44A 4D80A 4IEEA 3B60A 1TPZA 4Q7MB 2RH5A 3OAAD 3OEEA 4P4UA 3TW8B 3B85A 5JRJA 4C0QC 1G5TA 2D06A 4B73A 4DZZA 4AY2A 1D9ZA 4KV9A 4LJ7A 4PHFA 3F3YA 1XJCA 4YMUA 1XMSA 2GVDC 1NG9A 1NLYA 3RRZA 5FBVB 2ZRGA 5DSZA 1JXMA 2N1BA 3AH8A 4FW9A 2AWNA 3WMFA 3I73A 1GWNA 4CIDA 3VX3A 1P2VA 1M6NA 2WBLC 2DFLA 4QRHA 4HAWA 2R6AA 2I4IA 3A1VA 1NVVQ 2CXXA 3IKJA 1K5GA 1UDXA 4YMVA 2O8DB 1DAIA 2P3SA 1E9AA 4V02A 6Q21A 4EQ6B 5K8IA 3VR1A 4NONA 5JI2E 2BM1A 2X8AA 3W9YA 1KY3A 4FXPA 1BOFA 2CEAA 1CIPA 3QKSB 3ZIAD 2KJQA 4KAXA 3RS2A 1UEIA 4OQMA 4I99A 3THXB 3L43A 1HYQA 3NVAA 3K53A 4WBSA 1OH6A 3P27A 4ZDKA 1NLFA 3A1WA 3IUYA 3AV0B 4LHZA 4UJ5A 4DLWA 3K70B 4D2IA 1HTWA 2X19A 3RWMB 4QBFA 1JBKA 1G3QA 5SZIA 1NVXQ 1NG1A 2AKAB 2QN6A 4MKFA 5FPKA 1IN6A 3K9HA 3DZDA 4ASUA 1CRPA 5FBQB 2D62A 1IN7A 1ZD8A 4ZV4A 2WWYA 1IN5A 4V0NA 1ZMXA 1X8LA 3TQCA 3OE7D 1EK0A 3RS4A 3K70D 2ZR7A 1OF1A 1VIAA 3DHWC 3O8DA 4LJYA 4YC7A 3U5ZB 4Z8XA 3U4QA 2JJ1A 4GZMA 1WB9A 4G5QA 1SXJA 4ABYA 1QHXA 5KTYA 1KMQA 2YWHA 3LV8A 3U3OA 4RFSA 2ZSDA 5GVSA 2QZ4A 4I1VA 2ZSFA 3OZXA 2VP9A 2WIBA 5FPSA 2H1LA 2ZI3A 4GZLA 1QHHA 2GCOA 5CDFE 1FX0A 1VHLA 2GXUA 5K8LA 2FEMA 1DAEA 4JSYA 4MGKR 4DLYA 3PUXA 4DEYA 2HCBA 1VCOA 2XZOA 4BRWA 2A5JA 1OXUA 3QVUA 5HE8A 2QT0A 5KSPA 5GJBA 4EPTA 1EFRD 4LJAA 4H9GA 1HURA 1HQYE 1EFRA 2CLDX 1G8HA 3ETLA 1YZGA 3RANA 1QHNA 4YXWA 3OF5A 421PA 1B0UA 1QVRA 3RS7A 4KFSA 4C4PA 1CKEA 3U3MA 4DCSA 5BYKA 3MWYW 4Q00A 2FSIA 5JI3E 3QXCA 1W4AA 4CVNA 1PUJA 2IF0A 3IIKA 3IQWA 3LX8A 2H7VA 3REFA 2H17A 3UIEA 2ZI6A 1XRJA 4JBYA 1OH8A 4LX0A 4RZXA 4XWOA 2BKEA 4IDHA 1JECA 1BIFA 1G8GA 5TDHA 1RYHA 3ZJYA 1ZUIA 2PEYA 3WNCA 3CB4A 1DO2A 3GJXC 4DT1B 1Z0KA 3VU9A 2RHDA 4C0BA 1XTSA 1ZBDA 1EG7A 3TUJC 2OLJA 3RC8A 4XSGA 1R2QA 2HYIC 2YOGA 1ZCAA 1ZIOA 3H4MA 4LJ4A 4DDUA 3IGFA 4BWYA 1FMLA 1YR6A 2QRNA 4OQLA 3V00A 1COWA 2QI9C 4MITA 1OXSC 2F9LA 2JGNA 4Z54A 5CITA 3TNFA 2G77B 2ZJ8A 3QKTA 4GSYA 1MO6A 2JLQA 4C7OA 4YMWA 1Z2AA 1T3SA 4P0TA 4Q66C 2QBYA 1ZW6A 2E87A 5KSOA 1EFHA 3U60B 3L0OA 2ZRHA 4ZDIA 4TLAA 2CK3A 3CLVA 2CLSA 1XXHA 3QPUA 3DDCA 4Q4JA 4MDFA 1JNYA 3DOFA 3MJHA 2XZPA 4PSAA 4BGDA 2F1JA 1NIJA 4UNQA 3ZDQA 1SKYB 1MO5A 2BEJA 4Q9LA 3LO5A 1NLZA 3I62A 2RGBA 4FMDF 3X1WA 4WZ6A 4RD0A 4WA7A 1AS0A 1P3JA 4JZKA 1I2DA 4PR0A 5JCPA 1GUAA 2F43B 3Q9LA 4AG6A 2O8FB 1ZJ6A 4ZO4A 3QENA 2I1VB 3I61A 3QUSA 2IXEA 3K0EA 4B3DA 4NU0A 1AZTA 3WRYC 2J9RA 2FPLA 1EXMA 3QKRA 1XPUA 3QEJA 4JBWA 2F3RA 2FJUA 4ZCIA 4JLDA 3EZ7A 1PV4A 5FBRB 1ZD9A 2CCGA 3NIBA 1E2DA 2A2ZA 3TUIC 4UXIA 3CX8A 2IWHA 4L8GA 5DYGA 3ND9A 3NHBA 1MR3F 1FP7A 2NO7A 2QAGC 1R7RA 4GOXA 3NBZC 1KI7A 3KKOA 3U3KA 2J7KA 4AK9A 1E99A 3THXA 3THYB 4M1YA 4FD2A 4BFZA 1VHTA 1XD9A 3KFVA 2F43A 4C0SA 4PO9A 1GRQA 4Q7LA 5HCNA 4TYQA 4PZYA 1JB1A 1YQTA 3EC1A 1S4QA 1E0AA 1G3UA 3QOFA 5CK4A 5TB5A 4JLVA 5L3QA 1XD8A 2B21A 3B5JA 2BMFA 1JQJC 4LSGA 1G7CA 3N5CA 3QPVA 3TLXA 1JR3E 1N6RA 4W5WA 1ZIPA 4Q02A 3M6AA 4IOJA 2REXB 3GLFE 2P6UA 4AG5A 2Z83A 5KDLA 3ZLJA 1FNMA 1E9RA 4NMMA 1E2NA 4HZUA 1R5BA 2QENA 1QG4A 1U98A 3N2EA 4PC3A 3GLHA 2YJTD 1Z6GA 1U90A 2R8RA 2WSMA 1L8QA 4D4KA 3IILA 2GJ9A 4A36A 1JXOA 3UWKA 1TUEA 3RRMA 2V9PA 1Z6AA 1A2BA 5JBQA 3BH6A 1G3RA 1WBBA 3PFIA 1MRNA 2Q0HA 1SVMA 2ATVA 3GMTA 5JJKA 1UADA 3ZS8A 4IDOA 1WMSA 5C46F 3AGPA 4AIIA 1E79D 2D4HA 3PEUA 1E2EA 1HT1E 3LWNA 3RNLA 4BFWA 3EPJA 1YJ5A 2CJWB 4TSFA 2HF9A 2N46A 2VHQA 1JALA 1W4RA 4PQRA 3UATA 2XITA 4QM7A 3MMPA 3PVSA 4NCNA 2BC9A 2J1LA 3I1FA 1VECA 2IYVA 5L3SB 3FMPB 5EZ6B 1W4CA 1P5ZB 4DUGD 5ANRB 5L8VA 1XD2B 5EXXA 1NRJB 2ZRMA 3KJHA 2IYYA 4OI4A 1XMJA 3UG7A 1D2NA 4BECA 5A5GA 4B76A 1GSIA 2CMKA 1OB2A 1SXJC 2G3YA 2ODNA 5CB8A 1RRFA 1UKEA 2DPXA 5FTLA 3VR5A 2MSEB 4E09A 1ZUHA 2OBNA 1Z06A 4PO8A 4RY2A 4R98A 3B1VA 4URUR 4BZPA 5KSYA 1US8B 2EYQA 4BLQA 3D8BA 3GCGA 1AKYA 3H86A 1OW3B 1CJVC 3P20A 2DWQA 1JAIA 2ONJA 3HJNA 1L7VC 4JMPA 4DT1A 4AYTA 5TVKA 2REBA 2WMNB 3F8TA 1KO7A 4QGAA 4D26A 4B3XA 4EAQA 2WSSA 3SFZA 4DLSA 2QPOA 4GMXA 2DWOA 1SXJE 1IAQA 5FPHA 1WA5A 3LW8A 4M8NE 2Q9BA 5LPNA 4BLTA 4FWTA 3CPEA 4XWKA 1II8B 3VR4A 4WW0A 1SKYE 1IN4A 1UBCA 3AGQA 5C2JB 2KSQA 2C9CA 2GTPA 3CX7A 1X8KA 1TL7C 4P4SB 1MH1A 2BBSA 3V4FA 4MQBA 3VNUA 2QP4A 3U44B 4HLDA 4CYMA 5E95A 3SDZA 4L16A 3R20A 2IS6A 3GEHA 4X8LA 1WRBA 5FTMA 5H70A 2AXPA 1Q22A 5FTJA 3AKCA 4YQFA 1YKSA 3LD9A 2BHRA 4JLJA 1FL9A 3BRWD 1XCGB 5DN6D 2QGNA 1KK3A 2GBLC 3REGA 2PL3A 4Q1FA 4RKFA 3RRYA 1W36C 2IYQA 4OJKA 3L0PA 3DVLA 5B64A 4A0HA 3WMGA 1EWQA 1IQPA 3U7EB 5JFGA 4MYTA 4Q9JA 2J0UA 4IXNA 3IBGA 3TBKA 2WJYA 3W8RA 1J99A 2NGRA 1BO6A 1MABA 2DY1A 4LDJA 2GA8A 1Q20A 1U99A 2GK7A 5TMPA 3WP0A 2J5XA 1CJKC 2ZITA 3RSLA 1YZNA 4B33A 2IT1A 2ODBA 3O8CA 3RABA 2DFNA 2QQEA 4LJ5A 1OXVA 1G8YA 3HR7A 3LA6A 1B23P 1X86B 1E3MA 1R0ZA 4QBGB 2V6IA 4B6EA 2XGJA 1N5IA 4LZZA 3EAQA 4N0EA 3ND8A 4NCKA 2MMGA 4HZIA 2EVWX 1NN1A 1OH7A 4Y0AA 3EASA 4LJ6A 1N5LA 4CEJB 4DB2A 4Q1CA 3AP3A 3TVTA 2KBEA 2N42A 3AP2A 5JEEA 3C5HA 4DBLC 1Z6YA 2OLKA 4LYHA 5TXGA 2C04A 1SVIA 5HTKA 1XB2A 5EJEA 3K0SA 3LBHA 821PA 1Z07A 1LFDB 2ZXUA 5C4GB 1G8FA 1XEWX 1NIPA 2V1XA 3MCAA 2QY9A 4DDWA 1PUIA 2NO9A 2OAQ1 1R8QA 2XNSA 5LD2B 3SU8A 1GDDA 2J46A 1UKYA 3W8NA 3LXRA 2PZFA 4L4UA 1SVLA 5F9HA 1CR1A 2JLWA 3BXZA 4ZCMA 3T1QA 3V9PA 4DHEA 4TZ6A 1NL3A 3WNBA 4JT2A 4N3NA 3Q3JB 2QUZA 2GF0A 3MLEA 2ATXA 3T61A 3B1WA 3K9GA 4DJTA 5EE5B 3NG1A 2GZDA 3I92A 1U8YA 4PHTA 1DEKA 3SC3A 3I8SA 1Z5ZA 2B92A 5KPJA 3O8RA 1KO8A 1UKVY 3TGPA 4FIDA 3EPHA 1M8PA 3BD9A 4AC9A 5M04A 1K8RA 3QG5A 4O0MA 3ICEA 3OIWA 1R4AA 4QKQA 3LVRE 1GAJA 1D6JA 3PUYA 2QAGA 2XTNA 1XCMA 5FTKA 2OV2A 2P2LA 3BOSA 3JZAA 3WY9A 2J59A 4HB0A 2ZS8A 5DH9A 2ZQ5A 2NMVA 4D82A 4JVLA 1XMIA 3HU2A 3T34A 4C0AC 2QRZA 2ORWA 3OHMA 2Z4RA 5GADl 1HE1C 5DI3A 1BMFA 2ZUBA 1W4BA 1U8ZA 2A78A 4D4MA 1X3SA 4PHHA 4EKDA 1A7JA 2DFTA 2XEXA 3QE0A 1E0KA 1DVRA 2WSSD 2NZ8A 2Z5FA 4TMXA 2OM2A 1FOEB 1KHTA 2AFHE 4GMDA 1P7CA 4NYJQ 1G3IA 3RAPR 1E2LA 4CT4B 3GFOA 3J81k 4A92A 1G7SA 3SFVA 1IOZA 1HA3A 1T3LA 2Q9AA 3FGNA 1KDPA 2IXFA 2A30A 2EW1A 1KI2A 3QBTA 4OHZA 1OYYA 1ELOA 2ZI7A 2VTKA 2CVHA 3NTUA 2C95A 1CTQA 2PJRA 4B35A 2PEZA 4OK5A 3PEVA 4TLCA 5D3MA 2OCAA 4I4LA 4JJKA 1NMZA 4A0RA 1G8PA 1TQ4A 1GTVA 4TMZA 2IWRA 4FWIB 1KK0A 1BMFD 1M34E 4D4LA 3FMFA 3HPRA 3EW9A 3K0AA 3W90A 3K0CC 3AVQA 5K8UA 4NYIR 4YXWD 1BYIA 4U7DA 2CNWA 3HU1A 3IEVA 4HAYA 5KHOC 4NL4H 1XJ0A 2BKUA 2ZSEA 2X2EA 1WE2A 3PUWA 2UKDA 1KI8A 2P5SA 3GJ8A 2D7DA 4Q4JB 3BH7A 2BJVA 3ZD7A 2DR3A 2GEVA 4JVNA 2W6JA 2HLDA 4XD7D 2P0EA 3TRFA 2XSZA 3FVQA 4DIEA 3LLMA 3DM9B 4GOJA 4JLOA 1KO1A 1H65A 4Q9HA 5EXSA 4TQ9A 2NIPA 4M4SA 4EJSA 5KPDA 3QF4B 2F3TA 1E1RD 2NQ2C 3VR6A 1BYUA 5IRCD 3A4LA 1ONBA 3CRMA 3F5FA 3WBKA 1OFIA 3AVYA 1Q3TA 2EFDB 4Q19A 3TAHA 1OT3A 4PC6A 1M7HA 3K0AB 5DISB 1X1SA 2ZI9A 2HDNB 2WOOA 1UBFA 2PCJA 1Z63A 2WMOB 4URXR 4RCYA 1IBRA 4J0QA 3VAAA 4IVRA 5LBIA 1AJEA 3PUZA 1VG0B 1T8TA 3TMKA 3B7GA 1Z6XA 1GKYA 2HT6A 1W2HA 3EX7C 2ZRAA 1NVUQ 5JECA 3ZVLA 1EX6A 2FFBA 2IYLD 3BFKA 3EZ9A 4M9XA 2R2AA 4UKDA 3L82B 5FFMA 1DOAA 5JWRA 2O8BB 4RSGA 2GEDA 1G6HA 3Q7PA 4JYBA 3EIEA 2QAJA 2Z0MA 1S0UA 4QGHA 1E1RA 4GP6A 2IHYA 3RDPA 3IQXA 5EP1A 2VSFA 2ZIAA 1XPRA 4A0FA 3B82A 2ZU6A 1E2QA 2ZS9A 4DXAA 3AQ4A 2G1JA 2G88A 1G41A 1TUIA 2QG6A 1N0VC 3ASZA 3C14C 5CM8B 3ZS9A 4MA4A 5IT5A 4C2UA 3BS4A 3R8CA 3SR0A 1AZSC 2GKSA 4E22A 4PXAA 1VG9B 2J0QA 2OFWA 4MYHA 4HDOB 2Q21A 4MRPA 5DIFA 2J41A 5E3HA 2FA9A 3BWDD 3IHWA 2ERYA 1KMHA 2WWFA 3WMEA 3KL4A 4Q48A 1J90A 3QI2A 3AVTA 2ANCA 3GQBA 2W58A 4LPKA 1LW7A 1M7GA 3GLHB 4CDGA 3X1XA 3W5IA 1QBKC 3K1JA 5FBLB 4PANA 2ZYWX 4B44A 1KTVA 4BFUA 1TQDA 2FSGA 2PCLA 4FCVA 2RKOA 3NWJA 1GRRA 2LKCA 1KNXA 5HPYB 1WQ1R 2GCNA 4TYWA 1NVVR 2PBRA 1R6BX 4ZI2A 2RB4A 4Y0VA 4I1OA 4TMWA 4LBVA 4JYCA 4BEBA 4PPFA 3FKSD 4FINA 5L3QB 2J7PA 3BAFA 4B47A 4HLUC 4RD2A 4MGIR 1E2IA 1P4SA 2BIFA 2Z4SA 1RC8A 1V5WA 2GJ8A 4TT3A 1LS1A 1DAKA 2HJGA 2A5YB 4RFSB 2Z6VA 5JJIA 1QHGA 1JAHA 2D2FA 4M21A 1E2MA 1GNQA 2G9NA 4PSKA 5CJPA 1EGAA 1YR7A 2O0KA 1D2MA 4BFSA 2XJ9A 1FMJA 2QPTA 4GI7A 5BN5A 1XJQA 3FB4A 1XZPA 5JS7A 1Q1BA 2Q3MA 3KJEA 5FOXA 1CJTC 1DARA 2RGXA 4W5HA 4LC0A 4DLXA 4ESHA 2YVUA 1ZNYA 4WXRA 2D2EA 3N70A 1Q1QA 1ZCBA 2IF2A 3FWYA 2ZE7A 3E70C 3ZVRA 3FDIA 3LBIA 5CJ2A 1UFQA 1XEXB 3OIUA 4X8OA 2I3BA 5FBWB 1KSJA 2C78A 1DO0A 3SEAA 3UMFA 1W36D 3OIVA 2WHXA 1IY1A 1WF3A 3P1JA 1E2GA 4B6FA 3L0IB 3K8YA 3SJAA 1CBUA 2XB4A 4M9QA 3VMFA 3MG9A 4DB4A 1C1YA 1I4LD 3MAAC 1W48A 1PLLA 3ZZ0A 1ZP6A 3NDBB 1RJ9B 1HV8A 1I4TD 4JL8A 5AUOB 4M9ZA 1T0HB 1W0JD 4U00A 3CR8A 5FOVA 3TW4A 4EJSB 5TARA 1RRCA 1IXSB 4B74A 4ZDWA 2OCPA 1AIPA 3CRVA 1E79A 2JDIA 3DMDA 2PZEA 1UKZA 3BB4A 4ARZB 2OFOA 2F55A 3EZ2A 3QF7A 2CL6X 2VQSA 4LGMA 3KUCA 4TQAA 4CEHA 2WJJA 4LHXA 2F1HA 1G7RA 1W1WA 2ZUCA 3MD0A 1YZUA 1T5LA 3UMRA 2IX3A 2J0UB 5KDOA 3GLHE 1CJUC 4CZ2A 3PEYA 1EFCA 2QP3A 2XOKA 3NEJA 4UNSA 4L15A 1II0A 1YRBA 2VSOA 3BBPA 3LY5A 4HDQB 3UXMA 3KFXA 4DRZA 2IA5A 5F9FA 2HXYA 3C15C 3GLFA 4A6XA 4II7A 8OHMA 3VQTA 1KAGA 5EE1A 1GKIA 1JR3A 2ZRFA 3SNHA 4N0DA 5JRZA 3GJ5A 5FI0B 1P2UA 3TR0A 3CW2A 1RVDA 3CM0A 2ZRBA 1UBEA 1ZINA 2W2VA 5IK2D 1K6MA 1O3YA 2ZR9A 1PZNA 3NH6A 4P4SA 4LYJA 2VPPA 3GLGE 2ECKA 2JA1A 4URZR 5TV2A 4RZ2A 2JLYA 3WBJA 3GLGA 3GLGB 2I1QA 4Z51A 2IEYA 3JVUA 1YZQA 5KUTA 3CONA 2GHIA 3U61B 4M1KA 1R0XA 1N6HA 1KO4A 2R6CA 4CEIA 3NKVA 4XOIA 4E03A 1UDWA 2AD5A 3P4XA 2HT1A 1G21E 3S1AB 1TEVA 3IO3A 1U8AA 3PEWA 1GNRA 2ZJOA 5DLQC 1NN3A 3A1SA 5G3YA 1DELA 4Q47A 1E1QA 3U7FB 5LD2C 1II9A 1PLKA 2VO1A 5EE3A 1XCPA 4WAUA 1YZKA 3U4QB 5BN3A 4D0GA 4Q18A 3SI7A 2IXGA 5JJLA 1F60A 3HYTA 2JATA 3ADDA 4H1UA 2YZ2A 3W3AA 2WPDD 1MO3A 4HLUA 4A1FA 2P6RA 3KTAB 4XTRA 4A2QA 3G82C 1S96A 1G291 3CNNA 2AL7A 1XZQA 2ZRLA 3M1IA 1OB5A 1OHHD 3IPXA 1UM8A 1KY2A 3B1XA 1GIAA 2WICA 4M22A 4D0NA 2OCBA 4FMDB 5FUVA 3NBFA 3F0TA 4OYHA 2VSXA 1JEEA 2C98A 1KO5A 3GEIA 1G7TA 4M1OA 3R9XA 4GNKA 3VKGA 2HYDA 2L0XA 3ASYA 1XEFA 1E32A 4D6PA 2REOA 5KNBA 4UXHA 3B9QA 5DI3B 3NXSA 4B2IA 1N6IA 1KSGA 4JJZA 2XNDD 5KO2A 2JLZA 1D2EA 1RYFA 1N6PA 1RJ9A 3OEHD 1SQ5A 2ZANA 2YC2C 3SS8A 3H84A 2XXAB 2A3RA 3VTKA 5JHHB 2ZI5A 5HR5A 1A1VA 3ONWA 4BEJA 3HR8A 1R5OA 2OFXA 5FL7D 4KSCA 4AKEA 3PR1A 4I1SA 3QG1A 4O3MA 1XEXA 2UZIR 1FQKA 4TSFD 3HDTA 4MGYR 3RS0A 2BBWA 2FOLA 3CUEF 4JL5A 2FPKA 2BM0A 2ZJAA 4KCGA 4KITB 2MMCA 2ZJ5A 4FN5A 5KU1A 5EUQB 3AF3A 4B3FX 1VDZA 2JLSA 3LNCA 1NBME 4IEIA 1N6KA 3SZRA 2ZRKA 3Q7QA 1II8A 5FOTA 2JLVA 1GRNA 3UPUA 4LOAA 2QORA 4PQFA 4B2LA 2SHKA 3I72A 4NCIA 5J4LA 3LAWA 1HH4A 4BZXA 1G19A 1ZM9A 2VEDA 5AJVB 4LK2A 2BDTA 5FL7A 3D3QA 4JLPA 2QU8A 5L3SA 3WHLA 5CIWA 2FX3A 1OFUX 3MWJA 3CZQA 1YZLA 2JIZA 5JLJA 4I81A 4AI6A 3GJ0A 1J7KA 3GFTA 2F1IA 2ZVQX 2EFHB 2AHOA 2KB0A 4NYMQ 2O5VA 4X8HA 1W7AA 1E2FA 2IBMA 1Z3IX 4Q4HA 1VG1A 4M53A 1N0WA 4KO8A 1T3HA 2DWPA 4QOSA 4Z1MD 2UZ3A 3E1SA 2KI5A 4H1VA 3VHLB 4ACAA 4ERNA 4V0MA 1G6OA 4O2RA 3EA5A 4NE2A 2GXSA 2BBOA 3CWQA 1NKSA 2FMXA 2B8TA 3CPHA 3FHOA 2VYFA 1Y63A 4OI1A 3W34A 2WVJA 1EFTA 2QBYB 1DAHA 3FHTA 1F2TB 2D74A 1AM4D 3UMSA 2QPAA 1X6VA 2CCJA 3EZFA 1AQUA 3CNOA 4HUQB 3RS5A 3AEZA 1V43A 2R6GA 221PA 4QBIA 1XFAA 5FUWA 4C0LA 1ZUNB 2BVNA 2ODWA 4NKRA 3EARA 3KQHA 3I32A 4QNRA 4TT3D 3SE0A 2WIAA 4BFXA 2NPIA 1E1QD 1F5NA 3B1YA 1T0JB 3C8UA 1P2SA 4LY6A 4M1WA 2ZJ2A 3KZ1E 3FKSA 2IS1A 3OFNA 4JLNA 4HB2A 3VU9B 3PG5A 4BUJA 2FFAA 4BE7B 5BW8A 2O0JA 3EG5A 5DN6A 1MKYA 2IYTA 4Q4LA 3ZIAA 1QHYA 1JI0A 1EFUA 2WM9B 1TTTA 2GJAA 1S2MA 2PT5A 2ZSAA 3B9PA 3IBYA 1DBSA 5CK5A 3LBNA 4ITRC 4K81B 3CPJB 1G4UR 2QTFA 4RCZA 2J3EA 1A4RA 2IYUA 4OQFA 4TTQA 1VCNA 2R9VA 1G1MA 4XSHA 1OFHA 2BCGY 2VHUA 5A4JA 4QJ4A 3MUFA 2CVFA 1QVAA 3MWKA 4JS0A 4OBEA 3OFND 2ZAMA 3WYGA 5JHGB 1WDTA 2ANBA 1NSFA 3Q85A 4HLQB 2JAQA 1E4VA 2BEKA 4QBHA 4DVGA 4EUNA 2R62A 3DMNA 4MKIA 4GL2A 2XX3A 1JEDA 4IFEA 1MRSA 2JLUA 4PAQA 3DM5A 4EPXA 1KIMA 3E2IA 3C4JA 1KJZA 1NVWQ 1XTKA 1N0UA 4TL9A 1DAFA 1AKEA 1HEIA 4ZKEA 3SHFA 1FNNA 1I4DD 3Q8XB 1EX7A 2VL7A 5EP4A 5G3ZA 1M7BA 1Z0AA 2NO6A 4L9SA 5DHAA 4HZUB 1MT0A 1ZRHA 3K09A 5HE9A 4AWXA 5EP3A 4BASA 2CK3D 4DLZA 4GFDA 4AURA 4B32A 1GZSA 2WWIA 3VHXA 3KQUA 1E9CA 2BWJA 4TLEA 1KK2A 4GP7A 2QMHA 5CDFA 5EXTA 4BLRA 3OESA 1HQCA 1CU1A 3PUVA 5HZHA 4DDVA 2IUSA 3LQRA 1E6CA 3EC2A 1N25A 1KMHB 5AJZA 2CBZA 3LW7A 4DUGA 3TKLA 1SZPA 3KJGA 3SBDA 4B75A 1X8JA 3EXAA 3KKNA 1Z0JA 4GT1A 3RVBA 1AGPA 1QHHB 3CRQA 2WOJA 4Q03A 2YHSA 4QL3A 3SQWA 3THYA 3ADCA 1FW6A 3NHAA 4HAUA 2ZAOA 5D3MB 2C99A 1CEEA 3EIQA 3O8BA 4G01B 4Z1MA 3UWOA 3IDQA 1YVDA 1OJLA 2ZREA 4TYNA 4OI0A 4MDEA 4JVMA 3SQXA 4LRWA 5H68A 3Q72A 5C1BA 2BJWA 1M1YE 2RCNA 2P67A 4IDPA 2WZQA 3BJIC 4HUQA 3H2YA 1Q57A 3WYFA 1QF9A 1ZM2A 2FNAA 2WKRA 2IS4A 3GLIE 3HPQA 4PC1A 4AKHA 1VIYA 3CIOA 5SZHB 121PA 4EIWA 4KJZA 2GBLA 2V8OA 2HEIA 2IYZA 1GVNB 1ETUA 1Z28A 2OBMA 2RGNC 4U5XA 2ZRJA 3OEHA 3BB1A 2RGEA 1R0WA 2WTUA 4Q4HB 2XXAA 1T91A 1E2JA 5AR1A 3VKHA 5AUPB 1CR0A 1N5JA 1XXHE 3PQCA 3AF2A 2FG5A 1ZNXA 4Q21A 2OBLA 2FH5B 1HUQA 2OESA 3DO6A 3RYTC 2V6JA 3A4NA 1KK1A 2Z43A 4KFUA 1XBTA 2WJIA 4NYIQ 1KKMA 2ZYVX 3LLUA 5E7IA 4UXJA 2O8CB 3KKQA 2ORIA 1ZU5A 3UG6A 2F9MA 5FTNA 2ZJYA 4YMTA 2XNDA 3JZMA 4R71A 2CCKA 4IOLA 2IS2A 1SKQA 1Z0FA 2PJZA 5HCIA 5HZKA 4YDSA 4O25A 5DGXA 2JJ8A 1ESNA 1JJ7A 1D5CA 3EZ6A 3A8TA 4NP6A 2PMDA 1CJMA 3G0HA 1PVOA 1PJRA 3BC1A 4BLPA 4CW7A 4DCUA 4KFRA 3MWLA 3X1ZA 4HDCA 2D3WA 2WAYA 5AJXA 2QE7A 1NBMD 4V0KA 1YRAA 4AKIA 1TX4B 2GAOA 4D4JA 2YWEA 1L2TA 3FPAA 4RKEA 4DLTA 4PAMA 4F7WA 4X8MA 4US2R 3GJ7A 1GNPA 2CL0X 2OXCA 3NBXX 2C8VA 4NDZA 4CEIB 2VHTA 3K9LA 2QTVB 1QDEA 4IVPA 3OAAA 4AKGA 3FOZA 5BN4A 2V4ZA 2OAP1 5JS8A 3R9WA 3QF4A 5GVRA 2P65A 3B2EA 3V4RA 1U0JA 1ZM3A 4KFTA 3AKEA 1DAMA 2F1RA 4Q9KA 4CEHB 2ZI4A 4N1AA 1VCIA 1W5TA 4NPHA 5JMTA 5BQ5A 5BYJA 1RZ3A 1S3SA 3TH5A 5LB2A 3WRXC 1JR3D 3ZGXA 4M2LA 4JL6A 5AK0A 1M2OB 3SJBA 4D25A 5SZKB 3KB1A 3KTAA 4W7SA 2WAXA 5LDDC 2O52A 1FTSA 1MABB 1QRAA 1SVWA 3QEOA 1NN0A 2FU5C 4JLBA 1J2JA 1W2GA 3OEED 1LB1B 3GLFB 2BMDA 4ZPXA 3RWOA 2IYXA 3WP1B 3EPKA 5GJCA 1OXXK 2IEZA 4GPTA 1XF9A 3GJ4A 2OE2A 4G5RA 4PTLA 4TMKA 3CF6R 3IEUA 1T4GA 3LRPA 4YONB 1NF3A 4A8JC 4PZLA 3D6TB 1E96A 2GF9A 4OL0A 4U02A 1T8UA 3A36A 5KSZA 5FI1B 3NH9A 3U7HB 4Q01A 1GP2A 3I3SR 4LBWA 1WBDA 1DS6A 1N6LA 1ZD1A 3QPWA 5A0FA 1VKJA 3KKMA 2K5UA 2JDID 4KXFB 3SYNA 2ZRCA 1KI9A 3QXJA 4RZUA 2ZS7A 4B48A 4POAA 4KU4A 2P6NA 3CRW1 2JIZD 5FR1A 1W49A 2JLXA 2JJ2A 1E0JA 1XTQA 2QTHA 5IHPA 2V1UA 1ZU4A 1Q1ZA 1E9BA 3AKYA 3A1UA 2BV3A 2W0SA 1JPNA 5DE3A 3PIRA 3FYHA 1R10A 3K0CA 1ZM4A 4NH0A 2G6BA 3NEYA 2YOFA 2ZE8A 1XWIA 5E4FA 4BLOA 1NKTA 3QSYA 4S2EA 2OG2A 4PZZA 4XD7A 2AK2A 1QG2A 2OXRA 2B7BA 4TTPA 2QMOA 3QJYA 4ESVA 1JJVA 4R9UC 2JJ1D 2VP6A 2DB3A 4MH0R 3U2QA 3B1ZA 4B43A 1VTKA 2RMKA 1S9HA 4OK3A 3LVQE 1P9RA 4R2HA 1Q21A 4JIMA 2CHQA 4URWR 1DG3A 5P21A 4AYWA 2EYUA 2YV5A 3VR2A 5KYKA 3D31A 3BERA 4JT4A 3BORA 2A5DA 1CLUA 4JSTA 1R8SA 2V55B 3T35A 2AWOA 1XD2A 2LKDA 3GLIA 2QGZA 1VG8A 1DTSA 1XTIA 1LF5A 2BMJA 2EQBA 2EU8A 4QHTA 3KJIA 4QHYA 2X1VA 5CIQA 5B30A 3KQNA 3AM1A 1YR9A 3T15A 4A0GA 4NTZA 4QC2A 2JCSA 1E0SA 3ZYCA 3AVPA 1OHHA 3ZQJA 2VLIA 2EFCB 1KI1A 4LBZA 4TL7A 1TADA 5C18A 1IN8A 1IY0A 2QAGB 4WOPA 4E5UA 2FZLA 1LVGA 1IY2A 4US0R 2AK3A 4M1MA 5BXQC 4F92B 1Z08A 2QSYA 1AS3A 4A2WA 3TE6A 1NI3A 1Z22A 1P73A 1QHSA 4PPQA 3LQQA 2H8KA 4XVUA 3HYRA 4ZI3A 4ZDJA 1SHZA 3AF1A 3DPUA 5B57C 3ZD6A 3L8ZA 3BB3A 4Q4AB 1U0HC 5HKKD 2AD1A 5FPYA 1F2UA 4UQOA 3KB2A 2FSFA 1IONA 4IDNA 2IL1A 3K0FA 4C9BA 2HCJB 4HYYA 3THOA 1SGWA 4BRUA 3BGWA 4ACBA 4C0JA 2B8WA 1FPMA 5J40A 3NC0C 4G5GA 4QXAA 4NYMR 3X1YA 3D7MA 2EWVA 5F98A 2OO7A 3CF0A 1I2MA 2RGCA 1UEJA 2BBTA 5J4YA 2PMKA 1GITA 5FL3A 1GL7A 5C4MA 4IDQA 3I8XA 4QJ5A 3A58B 4IXMA 1G3MA 2P5TB 4IJMA 5CLQA 1GKUB 5BWMA 4ZCLA 2A5GA 1SULA 2GWHA 1G5PA 4DCTA 4MUBA 5L3VA 4P4TA 2J0SA 3PXGA 3ADKA 1ZNWA 3IPYA 5B58C 5B2ZA 1Z2CA 2VA8A 3IO5A 2B7CA 4HSEA 1KI6A 3EA0A 4IHQA 3T5GA 2YOHA 3ZVMA 2GJSA 5IDVA 4F38A 4Q7KA 4AD8A 1YHNA 3PITA 4K46A 2FFHA 4DCNA 3QVVA 2GK6A 1KDTA 2HJVA 3DKVA 2WWGA 2CHVA 2B6HA 4CF7A 1IXZA 1OFTA 1Q3HA 4B3BA 3AVUA 2ASEA 3KKPA 3BK7A 4A8JA 2WWWA 4HB3A 5F2EA 3X1DA 1XX6A 3CH5A 4BZQA 4QFMA 4NBSA 2FSHA 2OSBA 3Q5EA 3U6KA 5LB4A 4IFBA 5K8TA 3I5XA 1U0LA 1NN5A 1Y3AA 5CYPA 4FMCB 1BKDR 4RJLA 5AWFC 3R7WA 3KXKA 5IK2A 2Y8EA 3T5DA 3UKDA 4OHVA 2C96A 4AYXA 3U3RA 2F6RA 4IOKA 1FP6A 1N5KA 1NY5A 5UKDA 1Q12A 2HXSA 2FGKA 2XJ4A 3PJRA 4G5SA 3R7WB 2R65A 3C7KA 2ZJBA 4MKGA 2O8EA 2XTMA 4QGFA 1OIXA 1OH5A 2WKPA 4WXPA 2IHBA 4ILEA 1CULC 4PAOA 4PSVA 2OZEA 4TMTA 3PENA 2GDJA 5KNDA 1E94E 4LHYA 3G5UA 1ZC4A 2A5FA 2QMEA 3O47A 5E7MA 1GM5A 1FFHA 4JLMA 1H8HA 1ANKA 2NG1A 1G4AE 1C9KA 2R44A 4TN1A 4KHZA 3KX2A 1LV7A 621PA 4MKHA 5EE0A 2QROA 3AVXA 4XIGS 4I1UA 3VX4A 4A8JB 2O8BA 3SJZA 1L4UA 4MYUA 2YKGA 3L2OB 1Z47A 1FUUA 2KE5A 4LPSA 5SZJA 3FHCB 5GJWC 2XSZD 2VP4A 4WZAE 2HLDD 3MSXA 3N2IA 1W0JA 2ORVA 3MFYA 3RRNA 4RD6A 4NZYA 1U9IA 3TK1A 2RGGA 2D7CA 4QGGA 1S1MA 3W3ZB 4XVRA 3QXXA 1E9DA 1W0KA 2CNWD 3HWSA 3PCRB 4PQYA 2PLRA 2CHGA 2VIIA 3FMOB 2NO1A 3RC3A 1ESMA 1TF5A 3HU3A 1CR4A 2LCFA 2ZETA 4FCWA 2FPMA 3AP1A 4DSTA 1UF9A 1F2UB 1OKKD 1LNZA 3EIHA 5G53C 2AN9A 2EWWA 5D3QA 2YC4C 2YWFA 1XEWY 2HV8A 2J7PD 3CWZA 1W0KD 721PA 2W2XA 4DLVA 1U94A 4FMBB 2O8CA 1N2CE 1QZXA 2ZUDA 3MGCA 3DOEA 3HP1A 1XU4A 2QQ0A 3B6EA 4ARZA 5J4VA 1G64A 1Z8FA 3P26A 1NMXA 4HAVA 4UNPA 3NDPA 1ZC3A 3KDSE 1KDOA 1RIFA 1CP2A 2WPDA 2GCPA 3C5CA 2QM7A 2FFQA 1IM2A 3B13B 2CE7A 2GAAA 2Q3FA 4WIAA 1Q1EA 3VR3A 1RRGA 1TQ6A 2FE4A 2VP5A 1R0YA 4IRUB 1K5DA 1WCV1 4OK6A 3TAUA 2FN4A 2VBCA 2XAUA 1AGRA 2GZAA 1E4YA 3A4MA 3GD7A 4G3XA 3ZZTA 2BMEA 1C4OA 1DG1G 1GG2A 3P4YA 4LUCA 3GLIB 2V7QA 5G41A 3SJCA 2H92A 2YNMA 2ZSBA 1E9FA 2JJ2D 3LDAA 1FQJA 4Q1EA 4HUTA 3W6PA 4OKSA 5AJYA 2WV9A 2NTYC 3QBVA 1A5TA 1KDRA 3LH5A 2GRJA 1VPLA 3MRSA 3K0FB 2ZVPX 3LX5A 3VNVA 5JWOA 4MRVA 1F48A 4QJ3A 2QT1A 1RE0A 4NYJR 1OV4A 1U2RA 2LWIA 1KAOA 4HATA 2GXQA 2ODEA 2G0NA 2C2HA 5JSZB 3TUZC 2ZRPA 5AUNB 3QKUA 2FWRA 3E5HA 4BLSA 1KOFA 3IIMA 3H0KA 2GVZC 2G83A 5FOSA 3THWA 1VYTA 3THWB 3CRRA 3BIFA 4S35A 4KVAA 4KSBA 3ECCA 1O87A 3QY0A 5JWHA 4C3ZA 3FE2A 2VF8A 4DC9A 2Q6TA 1XP8A 1NY6A 3Q5DA 5AJWA 2OCYC 1ODFA 1TEXA 1OYWA 5DO9A 4KLNA 4TQUS 2XOKD 2ZYUX 1BH2A 1Z83A 3CBQA 3QXSA 4PHGA 4YMSA 1KKLA 2ZRDA 1IJEA 1P62B 2H57A 4Q1AA 3FKQA 2ZE6A 3RS3A 2QNRA 3W5JA 4IW3B 2XTZA 4JBXA 3CKLA 1T5IA 4A6PA 5JSZA 1NNEA 3VKWA 5H1YA 5J47A 5TY0A 2GXAA 2J0VA 4DKXA 2IYRA 4RD1A 1OPXA 2A7QA 2OEPA 4GOKA 4Q7JB 2QP9X 1X1RA 1HT2E 1KJWA 4M1TA 2IYWA 2GESA 1J70A 1XTRA 1W46A 3IHLA 2E1RA 4KYUA 2W2TA 5DNYB 3KUDA 2W6JD 4OJQA 2WJVA 1TMKA 1ZYUA 1E9EA 2QE7D 1OE0A 1VMAA 3FMIA 1T6NA 1F6BA 4LCBA 2RGNA 1P2TA 3AVOA 1LF0A 2X2FA 1KYIA 1G17A 2NZJA 3WNDA 3A6PC 4QNMA 5FUXA 2XZLA 2E9SA 4PC7A 3SBEA 4TZ0A 1TAGA 3FFBA 3R9IA 1Q0UA 4DLRA 4C0HA 2HUPA 2ZRIA 5F3WB 4L5BA 1KNQA 2FV8A 4EQ6A 1AQYA 4GDFA 1EWRA 1SVKA 1P60A 1UJ2A 2VHCA 3CR7A 3KQKA 1KI4A 4PC2A 3TQFA 5G40A 3AKDA 4B3GA 1TU4A 4PX9A 3T1VA 1GFIA 2YYZA 4TMVA 1E9SA 2R6DA 2G0TA 2H18A 1KJYA 4PFSA 4DSUA 1COWD 2GCOB 3NBYC 4G0NA 3BFVA 1TU3A 1GL6A 1S3GA 5GJVC 4XVQA 4B34A 2C5LA 2IUTA 2QM8A 3GJ3A 1S8FA 2CJWA 4M1SA 4B3CA 3WXMA 4UNRA 2MSCB 4M9SA 1G5RA 1L4YA 2V7QD 3T12A 5FH9A 1S9DA 5HKKA 4CRWB 3X2SA 2JASA 1CF4A 1M74A 3CX6A 4XTCS 1N6OA 1N3BA 1NSTA 2IYSA 4FI3C 4ZKDA 2KWIA 2JEOA 2V3CC 1CS4C 2JLRA 2RHMA 3DKPA 4LC1A 4W5JA 2FEOA 4KBGA 4LWZA 4C2TA 3U7GA 4W9MC 3I5YA 1DE0A 1E98A 5IF9A 4TLBA 4Q1BA 1US8A 4Q5IA 4OHYA 2FDCA 1IJFA 1P75A 3A1TA 2VP2A 2ZEJA 3LXXA 4XWAA 3W6NA 1RW4A 4BFTA 4DWJA 3KQLA 1R5NA 4TTRA 2OILA 4XJXA 1LS6A 2NO0A 3T1OA 4EDHA 3U6BA 3OIYA 1Q44A 3AB3A 4P32A 1J8YF 2MSDB 4XH9B 4Q1DA 1P61B 2R6FA 3I4LA 1GILA 1TNDA 1Z29A 1SVOA 1FX0B 1KGDA 1VYUA 5FUYA 5CM9C 5EXPA 2W83A 4HLCA 4GBMA 1UBGA 4KI0A 3TSOA 2FGJA 3FTQA 4E07A 1Z0DA 3ZVNA 1UAAA 4IOMA 1OXTA 1H8HD 4KYIB 4D0LB 2ZJZA 1VYVA 4EFLA 1WP9A 3CO5A 1G20E 2KBFA 4EJSC 2IW3A 4TL8A 3OE7A 4IVQA 2YWGA 2W00A 5CYOA 1FUKA 2ZYTX 1SVSA 1AA9A 1P9NA 3AF0A 4EPRA 3ADBA 2C9OA 5J4HA 3SHWA 4F4JA 1E69A 4RZ3A 5FR2A 4JVSB 5FOUA 1SHKA 2AXNA 4YDHB 2PX3A 1OSNA 5H8WA 2DHRA 3T06B 3K70C 4A82A 1OLOA 4HB4A 3U3JA 1F2TA 4DSOA 1RFLA 1TF7A 1ZAKA 2AKYA 2ERXA 4NCHA 3KXLA 5J4KA 2ZTSA 2ZROA 4HI0E 4IKEA 4LI0A 2QA5A 2CDNA 4BQSA 1YR8A 3QIAA 1KSHA 2V54A 3CF2A 2PX0A 1E2KA 2A9KA 5KNCA 2RGAA 4JLAA 4LV6A 2WJGA 1NP6A 3TSWA 3QXHA 4ASUD 1ZM7A 2WJHA 4F4CA 4DIDA 4DEXA 5EQTA 2X77A 2ZRNA 1D8TA 3UK6A 1JR6A 2OHFA 3JVVA 5L3RA 4QM6A 2O0HA 4YLGA 2AX4A 3C41J 4LYFA 4FMCF 4L9WA 4F93B 4DSNA 2Q3HA 4US1R 4ZIRA 2OT3B 1XXHB 1NJFA 2J87A 2PZGA 4EFMA 4LBYA 4CGZA 1PLJA 2ZPTX 4PPNA 2NOAA 4HAZA 4DDTA 2FZ4A 1RRPA 2GEUA 3WYAA 2QSZA 1AK2A 3TR5A 3BE4A 1EESA 4LJ9A 1W5SA 1D9XA 3DZ8A 2FF7A 3LFUA 3ICQB 1MV5A 4G1UC 3T1TA 1XPOA 3SYLA 2EFEB 2H16A 2VF7A 3QNUA 2CLCX 4URYR 4Q9IA 2O8FA 3EPLA 1RKBA 1NBMA 4RD3A 5JZVA 1Z6TA 5ELXA 2ONKA 3QKRB 1NMYA 1KI3A 1JPJA 5E7JA 3MJRA 1IXRC 2W6IA 2DYKA 2W6ID 3GEEA 5J5CA 1CRQA 4EPVA 1KI6B 1ZNZA 4A9AA 3GP8A 5AUQA 4JLKA 2Q9CA 3IIJA 3ZQ6A 4JKYA 4R7ZA 4F91B 1CR2A 4QG7A 3S1AA 2RAPA 4C0KA 4WZBE 1TF2A 5EZ5A 4A4DA 4B71A
chains in the Genus database with same CATH superfamily
1YI1A 3SHTA 4WA8A 3GFPA 4O2LA 4MDHA 3DQZA 3HO6A 4MUJA 3LX4A 4AF6A 4CKWB 2BT4A 1P19A 1DUVG 2QL6A 3D9QX 4YMLA 3CNEA 1YE5A 2Q0SA 1KZGB 4CF6A 2IPLA 2IK8A 2W2OA 3AOEA 3HMKA 4C30A 3ZHQA 3CKMA 2QWXA 1P44A 4IFTA 3U48A 5HIAA 1SQFA 1OIVA 2WF7A 3ANNA 3PHHA 4MYCA 3ZBPA 1ONOA 1Z5NA 4PVCA 1C2YA 2UVQA 2F2TA 3PC7A 1NLMA 2DQSA 4N5HX 4LRSB 4KVGA 3HN7A 5EOVA 4CM9A 4EY5A 4ENVA 5K8CA 3ZJVA 4C5BA 1ODJA 3M3PA 3W6OA 2ZIFA 3LCMA 2QLLA 3VBCA 1GU1A 1HF3A 1NUHA 5HJEA 3K30A 4JB0A 3F3MA 1G20A 721PA 3D6HA 1G1AA 3H11B 4B80A 1MW8X 1XNJA 521PA 1TECE 1J23A 3EWAA 3RUDA 3OU2A 1WOYA 1ZJ4A 3G0GA 3KRTA 1GOTA 3KQOA 3DWIA 3O2NA 4RFVA 5AVYA 5FT9A 4EHKA 4EPYA 2ZB2A 2CV0A 2MINB 3ANLA 5JEDA 2E5LB 4K6CA 2PK3A 3IUEA 1DADA 3R6GA 4MPJA 4BC1A 4UNNA 1W96A 3DMTC 2BCJQ 2JFPA 2GZHA 5KC8A 1G9XA 3TNJA 3PHBE 4V0OA 3KOMA 4FS3A 4GYYA 1UPAA 1Z4MA 2ARKA 3FDJA 3ROFA 4A15A 3NNNA 1KC3A 1RWNA 2SKCA 2GS9A 2D5LA 3G02A 4FGSA 4FDAA 3P7MA 3U16A 1PGJA 4KWHA 1B42A 3JWIA 3B8HA 2EHDA 5BPHA 3MT7A 4TWIA 4C29A 3QWAA 1HTTA 1GT6A 1TQ2A 1Q84A 1WABA 5CLLA 1G59A 3AR5A 1Z0IA 2XRMA 2A1UB 2GILA 1GTG1 4GIBA 5A4FS 4ZC1A 3DBHB 3CURA 1EQUA 4HT3B 4FQ5A 1YE8A 2NVUB 1NJGA 4ON9A 1KEEA 5LQUA 4CT5A 4R2IA 2I65A 1P29A 3I01M 1BCSB 2OKCA 1IULA 2PX6A 3N8HA 2ZM5A 3RRBA 3DLBA 3BH0A 5H0IA 2PSDA 2QAIA 3S40A 3AF4A 2VJDA 3C16C 3NQ41 1HE8B 4QHSA 3P45A 4G9GA 2UUCB 3OA0A 4KGZA 1IHDA 3ANTA 4MEJA 3WL4A 5KJFA 1YS6A 3WLNA 3ICWA 2VHJA 3BK2A 5ERGB 2YHIB 5LA6F 2VH5R 3AI2A 3A11A 5J2UB 3WKEA 4EKIA 2Z3ZA 4OBBA 3PD7A 3QE4A 3CW8X 2CFRA 2O5RA 2H5EA 1CUEA 5SYAA 1QC5B 1G16A 4PPGA 4QJIA 3ZZUA 3VFDA 3QU9A 2VRWA 4MRRA 3W9SA 4P4NA 5B2FA 1AZWA 1KSFX 1ZSYA 3CH4B 2IUUA 2NN3C 3IUNA 1JQLB 1R4MB 1HI9A 2VYVD 3DFKA 5IW8A 1YMQA 2I66A 1M2OA 4NHOA 1F3OA 4ZYYA 4JP8A 3HGQA 4JUFA 1RZRD 2OWDA 3R24A 1VL6A 4KL8S 3K9NA 5DI9A 4UU8A 3VO8A 1LSUA 1QTNA 2OAGA 3A9WA 3DZKA 4IP0A 3WWYA 5AVTA 2D1SA 2UYQA 2YZ7A 3ZU2A 2VK1A 3HTXA 2GT1A 2EGGA 4HYEA 1L1QA 1JKXA 3S4YA 2F7SA 4QU5A 5ECGC 4Z8YA 4MRSA 4P81A 3EUFA 5B1HA 4CF4A 2ACVA 2E4UA 3LXUX 2DBYA 1FTNA 1YRLA 2ENWA 4WVFA 3T1NA 4D9BA 3AW8A 2Q6LA 3OHSX 3QKSA 5EL0A 1AH2A 4OLAA 2FWJA 1DAGA 4PG5A 1YL5A 2ID4A 3NVDA 1BWRA 4PYRA 2C77A 1N3LA 3AL2A 2FLWA 3TEJA 2YXBA 5GINE 3G9XA 2VT3A 3HBMA 5TS3A 5AOBA 4EHAA 1R00A 4YGXB 5JRJA 3W2FA 2FEPA 4FN4A 2Z58A 3RE1A 3PT5A 4B6OA 1D9ZA 4KV9A 3GU3A 4LJ7A 3IPRA 4YRFA 1XJCA 3EVDA 1UMCA 4UQPA 4HK4A 1NG9A 3QEMA 2PL9A 3EE6A 4EYEA 5KKAA 1JXMA 1PJ3A 3AH8A 2AWNA 2BI8A 3P71T 3IE1A 1EGQA 2CZQA 2DFLA 1FTWA 1UMCB 3ICPA 5CFLA 2R6AA 5IRCD 1RBMA 1NVVQ 2B5WA 5CPFA 1E3QA 3ELYA 3PUIA 3RW9A 4RDIA 3RG2A 3GRVA 3NWOA 4KXWA 2BI7A 4Z1OA 2O8DB 4RIGA 5ENDA 1FBNA 1TJ5A 4J0GA 2OMKA 3P19A 6Q21A 1H05A 4FMPA 5C8YF 3EDYA 3VR1A 4CJXA 5BR8B 3Q7SA 2BM1A 4OMCA 3I64A 4FEAA 5H4HA 4GWKA 1IZ7A 1VSBA 3CEMA 3S2FA 4Z4EA 2YH2A 1QLJA 4PRZA 3UQYS 5HNKA 3W9YA 1KY3A 3CV3A 1YASA 5K7SA 2XUZA 4HF7A 3KYCB 1M0EA 4P3OA 3QKSB 3KS9A 4CG1A 5KQPA 3F4LA 5LIPA 1EUQA 4FYJA 1PX0A 1UFOA 2EJBA 3F98A 5THKA 5AVSA 3COJA 4UOQA 5BVHB 2BGTA 2F3QA 4RLQA 2WSLA 3L43A 4N40A 1HYQA 3A4YA 1VIMA 4M8KA 3RT7A 4BNNA 3E23A 3IUYA 2P9HA 3WV5A 4C22A 3KR9A 5F7ZA 1FQWA 4QSMA 4NPAA 1KXZA 5DHRA 3BICA 2BZ0A 2NVOA 2PUWA 3PNVA 4FR2A 3AJ8A 3TTVA 2GCEA 2AKAB 5JXWA 2DSTA 2QN6A 5E0OA 2B99A 3PSAA 5HBRA 4DUPA 1CT9A 1JIXA 4ASUA 2GD0A 5FBQB 1YC2A 2D62A 4JQZA 4ZV4A 3KQSA 1IN5A 1JHMA 1PD0A 4V0NA 1ZXXA 1PN3A 4YAFA 1X8LA 5AHXA 3T3MB 1PBTA 3TQCA 1QVVA 1TYEB 4BGIA 2CXPA 4BO5A 5BWLA 2ZR7A 4IDFA 2XIQA 2Q5JA 4RJKA 4BZZA 3U5ZB 3DXXA 3LYHA 3PKZA 1D1TA 1I0LA 4Z8XA 3U4QA 2HGSA 1M1XB 4GZMA 4Y6LA 1BHQ1 4M49A 5HF5A 4NBUA 2PKQO 1JAXA 1WTAA 4MV0A 1B0PA 3U3OA 1D4AA 4UM9D 1NXSA 1NONA 2ZSFA 3OZXA 3ETNA 3L6OO 4K03A 2GAJA 4I3FA 3OZGA 4RK6A 4WH0A 5FPSA 2H1LA 2K87A 2IY8A 2ZQYA 4GZLA 1JTFA 1YK1A 3IX7A 3QVJA 5A5FA 4UDOA 1OGJA 2AQIA 3W5VA 4QZVA 5K8LA 1O6ZA 2O2DA 2FR8C 4HDNA 3TIVA 3ZNOA 1KQGA 1FYWA 4GEGA 1KEEB 2NVUA 4RJ2A 3KOYA 3QVUA 3RFFA 1F6WA 2DLCX 3QLVA 1R6TA 3KCNA 2YWBA 3ZJ5A 4H9GA 1M0SA 1YIDA 2EOAA 1HQYE 1TUBB 2CLDX 1D7AA 3NCTA 1OV6A 5DBIA 3RANA 1R4NB 2GF2A 2IYNA 1B0UA 3VU0A 4KFSA 5FHRA 2VQDA 2YZMA 3OMWA 1O8BA 2E48A 3NHMA 1RCFA 1L9KA 5EWJA 1RXCA 4O2AA 4DV0B 3BE5A 1E7MA 3Q2KA 4QD3A 2C07A 1R27A 3F49S 4IDHA 4P35A 4PBTA 5TDHA 1RYHA 3SQOA 3E9RA 2XDQA 4C06A 4BNIA 4MWSA 1PR9A 1U2GA 2HR1A 2IQ5A 4C0BA 3V7WA 1SNYA 3OG9A 1ESZA 1XTSA 3C5EA 4FEEA 5CCXA 3TUJC 5FWYA 4L6CA 4MSUA 4MWDA 4XSGA 3DCNA 2OYCA 3H4MA 1ZIOA 2DLDA 2HYIC 4LZOA 4MDEA 3IGFA 4BWYA 2OL4A 4Y9TA 1COWA 4NFHA 4UBIA 4MITA 1OXSC 1D4FA 1M0TA 1IEWA 1NUUA 1O2DA 1SKAA 4Y67A 2VFAA 4UHEA 2ZJ8A 5AJHA 4GSYA 4BQPA 3ONVA 2X0NA 4TTAA 1JH8A 5HSGA 1JTVA 3ESXA 2KQUA 4YMWA 3OCZA 1VHDA 1T3SA 1DI0A 1GAWA 2GD2A 4WFIA 5KSOA 4BB0A 3R3VA 5T4HA 4MARA 1NX9A 1BEUB 4S04A 1N2EA 4UAJA 4ADSG 2CLSA 4I2NA 3G2HA 3HVUA 1EJBA 4Q4JA 3EZNA 4OA5A 5ALSA 1Q2UA 1SUBA 3MJHA 2XZPA 1XP5A 2VDNB 4PSAA 2IOHA 4WXEA 4UNQA 3R6WA 2YYAA 4GE3A 2XF2A 3IDAA 4ER6A 1AXEA 1J0BA 3CZCA 3PZRA 4TROA 2A9QA 3ROTA 1PD1A 3F4BA 1NLZA 3I62A 1HDZA 3BSFA 3D6NB 4FMDF 3N75A 2EBWA 3WB2A 1PYOA 2WU8A 2A6PA 3PQFA 4JZKA 1I2DA 4LQCA 2CDCA 3VM6A 5DWVA 2G9QA 1N1EA 2FPWA 1GUAA 1L5YA 2QRPA 5D87A 1W8DA 4K7JA 4L85A 2O8FB 3C3DA 2W6QA 2DP4E 2I1VB 2KLHA 1YE3A 3GBPA 2RGRA 4ZZIA 3WRYC 1O0SA 2O2GA 2FPLA 3OZBA 2XR1A 5JAIA 2E5FA 4KRFA 2R11A 1XPUA 3QEJA 1UK9A 4ZCIA 4YCBA 2PY6A 3EZ7A 1EFAA 3D3NA 4X71A 4CM8A 1RIIA 2CCGA 4FZ3A 3TUIC 2E7ZA 4AS3A 4S1TA 4JY7A 2AHRA 2B4TO 1CUSA 3I2JA 3ND9A 5JNUA 1MR3F 3M4ZA 3K9FC 4EB6A 1QLHA 2EX1A 4J43A 5AMXA 5CFPA 4ZO8A 1X39A 2Q2QA 4AK9A 4EG4A 1E6EA 4A91A 1E99A 3QFFA 4H6WA 1FDWA 4Q05A 3THXA 1WD7A 1W76A 4B3HA 1YVEI 1VHTA 4KFCA 2F43A 2FPXA 4C0SA 4Q7LA 2V45A 2QRVB 3PQDA 3IUJA 1IATA 4ED9A 4ABTA 2X2PA 1Q74A 2ZXEA 4B82A 4QTXA 4PZYA 1JB1A 4J4HA 3ZBUA 1Q1NA 3FETA 2HJ9A 1DTWB 2D59A 3G88A 4ZO7A 4KPFC 4F96A 1OT5A 1E0AA 1OWOA 3PFBA 4JLVA 4I50A 4KN9S 1HZJA 3NYRA 2C92A 4O2BB 3ZX4A 3PHLA 1XLTC 4NI5A 4DLPA 4QLAA 3WLEA 1QIGA 4MVJG 2TSYB 5F23A 1TEHA 1Z56C 3TLXA 1N6RA 4PAWA 2QL9A 3K9WA 3SZMA 3WLQA 4C4AA 5KX5B 4RTJA 4E5VA 1UOOA 2R97A 4MW7A 3GLFE 3AIOA 1K4MA 4MGEA 5KU7A 1ORTA 3S2SA 3W5UA 1C0PA 2C5EA 2Y1FA 5KDLA 4HRXA 1SG9A 1E9RA 4P5PA 3ZLJA 4EF5A 2O6LA 1JR4A 4HZUA 1ACLA 1LWOA 2QENA 3VYSB 3V97A 5EKUA 3B6ZA 1CY4A 3GLHA 1Z6GA 1U90A 5AI9A 5B1IA 1U6IA 2FUG6 3NO4A 3I9KA 3AKZA 3TR6A 2YX1A 1U11A 2V9PA 3CFYA 1PX2A 2J30A 4YN3A 2P41A 3OQBA 1B7GO 5LKAA 1TK9A 3KU4A 2Q0HA 4MWGA 3GMTA 5DRTA 2NUAB 2VYCA 2QTRA 3LUKA 3QITA 4IDOA 1DEAA 3RO7A 2C3UA 3DOIA 4IMPA 3G9TA 3IOYA 2BFDA 3CJRA 1H2RS 4GVXA 5HFAA 4QOFA 1YJ5A 5MGNA 3W78A 2N46A 5HILA 1NVTA 4DA4A 1JALA 2C2KA 1JKFA 4PQRA 1R6UA 4R8VA 2AG6A 4FDTA 4NCNA 1DJQA 2H2IA 4HH3C 1S8AA 1IBKB 2IYVA 3HP7A 4HDKB 4DUGD 1SXPA 2PSHA 3A6DA 5ANRB 1XD2B 7MHTA 2OV4A 1QHFA 3C3AA 5EXXA 2ZRMA 1JEJA 5NLLA 1I33A 4FFWA 4OI4A 1GTJ1 2XT0A 3EF3A 3OZSA 2ZJ1A 4FQ7A 4BECA 1YFZA 2DBQA 4GOND 3K6JA 2A0UA 4B76A 1SC4A 5JZBA 1DC8A 4FC6A 4I5DA 4UEOA 4E3ZA 1K63A 4BUZA 4TLMB 5B4TA 1OB2A 1GQYA 4R8RA 5HZGA 2V03A 3E35A 3FYUA 1B16A 1LRLA 2ODNA 1AZLA 1RRFA 3PNBA 4V0QA 3TMYA 3BXGA 2YFQA 2BDUA 3EISA 3HXLA 2MSEB 3VR5A 4EGAA 4G4JA 2R7NA 4PO8A 3M83A 4BZPA 4C5CA 5KSYA 2P35A 4GSKA 4MR7B 2LR0A 3UOWA 3D8BA 1AKYA 3H4IA 1NVBA 2Z8YM 1JAIA 4EHNA 4HDMA 4PGHA 1GPMA 3ECSA 3R5XA 4UVDA 3LG2A 1ZUWA 2X4DA 5TVKA 3F8TA 4GYWA 4QGAA 4JJGA 5DGHA 5JFTA 1I30A 3N0TA 5FO0A 3EG9B 2QN7A 4HNQA 4UTNA 1Q83A 5LVAA 1E58A 1ZWKA 1UT6A 3HYNA 1NW3A 1RHRA 2FW1A 5AVQA 1WKCA 1R0SA 2Q6VA 3C97A 3PC6A 4WGFA 3MTQA 3NDJA 4XCXA 5F4ZA 1C50A 3LW8A 4QU9A 4ZC8A 3BUSA 2V4UA 2EZUA 1CZHA 4ZQHA 3CPEA 2PBFA 1U7WA 3PE6A 2HLHA 3VR4A 4WEOA 5DM1A 2CLFB 3CTPA 4WPGA 1K9VF 2Y99A 4YI5A 3S81A 4MIEA 3ITDA 3A6KA 5G0WA 4CIXA 4EL0A 5JBIA 5KQGA 2PANA 3AY7A 1CW2B 2X40A 4XYMA 2KSQA 3SZ3A 2C9CA 3VNUA 2Y1WA 3IVGA 2QP4A 3AK4A 1T8RA 2GLTA 4FHFA 4HLDA 5E95A 3VYVA 4DMGA 4L16A 4PCLA 3QELA 3UXHA 2QD2A 2ZYSA 1KVRA 1TRKA 4X8LA 4IIJA 4XA8A 1O95A 3ODPA 4ML3A 5FTJA 2IZ1A 5K4AA 3ONDA 1D2RA 2NLOA 3PNOA 3EGXA 3WLRA 5JDIC 3SR3A 2HBYA 1MAAA 3EVFA 2O0MA 1OTXA 2GBLC 4L0DA 3REGA 2PL3A 3BQ9A 3M3HA 3H9GA 1L7AA 5DNYB 4KR3A 3D54D 1WB5A 1IOVA 3KPYA 5EC8A 4EUEA 4FOLA 2FYTA 2O0LA 2RSLA 1T1IA 4MS4B 4X1KB 5BVGA 1UKAA 4R8KA 1CEXA 1CUHA 4Q9JA 3UK0A 2WUGA 3ENVA 3RNOA 3F6PA 4BP9A 4F8EA 1PTJA 1QOQB 1BO6A 2QRUA 4KQMA 1L5WA 2VXYA 3DMFA 2XKJE 1U99A 1WKBA 5TMPA 4BLUA 5B55A 3CVXA 4MVJD 4EH1A 1PTKA 1JA9A 3A2MA 4LGYA 2HU2A 3WMRA 2Q07A 1EK5A 2EKBA 3GT4A 1U3FA 3S44A 2QLJA 2ZITA 3MPUA 4BX8A 3RSLA 1DWUA 2HU7A 5IXJA 2ODBA 1SC3A 3GY0A 1SOUA 3ELBA 2DFNA 4QIHA 2WU4A 1OXVA 4LJ5A 1B23P 1K7XB 3CISA 4WUVA 1LCIA 4B6EA 2XGJA 1KPGA 1N5IA 2PKWA 1O97C 3BGOS 4JEMA 4LZZA 2OGTA 3ND8A 3J80A 4LCEA 3IALA 4KXVA 5TPZD 1NN1A 2JGJA 3OKPA 4Q24A 2JBAA 4JSRA 1J22A 1ETHA 1YZYA 1V37A 3QVOA 4Q1CA 1DMRA 1Y9AA 1ZIDA 2N42A 3AP2A 5JG7A 1NQUA 4IBOA 4ZV7A 2OLKA 1QE0A 1SVIA 4YAGA 1E4EB 1X7ZA 2Y1XA 1Z07A 3C3PA 3RHZA 3RTGA 1G8FA 3DZIA 3PICA 1NIPA 4OMUA 4QYSA 4CDRA 3UN1A 2X9QA 1J8VA 2FY8A 1FXWA 2LXNA 1KS9A 4E4YA 1EVJA 2IYAA 3DXZA 1ATZA 4EB6B 3E18A 1GDDA 5KC9A 1UKYA 1OWLA 4PFJA 3EGWA 4FFRA 1Y7HA 4CCSA 3DKKA 2QE6A 4Z7OB 3KZMA 3AUJB 1JIQA 2JI9A 5F9HA 2JLWA 3H6KA 3QFHA 4AXXA 1AKWA 4PINA 4AY4A 1SXQA 3V9PA 1COZA 3GXOA 4CM8B 2XKKA 1YB5A 4QO7A 3HDQA 3QPBA 3R2JA 3ZDBA 1SC6A 2XCOA 2QUZA 2GF0A 4G8BA 1DCTA 4EDFA 5A1TA 3HO1A 3T61A 1XCJA 3B1WA 2FSPA 3K9GA 3E9EA 4R3NA 3NG1A 1YS2X 4LS3A 2HSDA 4W8OA 1GTRA 3G9ZA 3SC3A 1MAHA 1KO8A 2VAMA 4CKWA 1FNCA 3EPHA 2PXCA 2RK3A 2W7TA 4PSDA 3VO2A 3BD9A 4DEVA 4MULA 1YB6A 4UU7A 4AC9A 3U7QB 4BKRA 4EYOA 2RE8A 1NU8A 2XB8A 2IEGA 3QQPA 1PP4A 1BH6A 5JASA 4QKQA 2PU7A 2ZIXA 3LVRE 2B20A 2B4RO 1GAJA 1P7PA 2BPOA 2QAGA 3I58A 3PUYA 2XTNA 4TKVB 5DSTA 5FTKA 2ZLBA 2HRDA 5DCYA 3WY9A 1ZGHA 1D09A 3JZAA 3KYDB 2J59A 5AOCA 1HLPA 3O1LA 4HB0A 3T9EA 3TI9A 4QG3A 3EXEB 3UT6A 4XM2A 1XMIA 3EYWA 2WJ3A 1QE3A 2OHIA 3K72B 3GELA 1Y5LA 2BFPA 2OM6A 4G5FA 4YJ2F 1E7YA 5BRNA 1W59A 2I6QA 5GADl 2I3ZA 1HE1C 2QTWB 4PCVA 2ZBDA 5LZ5A 1U8ZA 3VHQA 1SCKA 1PJAA 4D4MA 4JWKA 2E37A 2OGUA 3WGNA 2K2QB 4X61A 2H31A 4JC4A 4CIAA 3D6FA 2I67A 2R1ZA 2XV1A 2Z5FA 2NZ8A 1T5HX 4HMPA 4TMXA 3HLTA 3IR6A 4NYJQ 1U0OC 1G3IA 1M67A 5KSWB 3CEJA 5HKLA 1UOQA 5T3YA 3U3XA 2EJWA 3V9AA 1JH9A 4YYEA 4BDTA 1HT0A 3RYFA 1G21A 1HA3A 3WLAA 2X1LA 3L1VA 3W5BA 2Q9AA 4OHZA 4Q16A 3T9BA 1ELOA 2ZI7A 4GPZA 3MUEA 2I29A 2VTKA 1ML3A 2X3UA 2WTXA 2H4ZA 3DP9A 4OK5A 1RI5A 5TQJA 1JHRA 1PJLA 1YDGA 1T5OA 3A6FA 1W85B 2FR0A 1G8PA 4YO8A 3KQQA 2J6IA 1Y6ZA 4D9FA 4TMZA 1HOXA 3QTBA 1BMFD 5EMLA 4AJPA 5KHLB 1M34E 3AFNA 3AR7A 3ONFA 3HPRA 3ISTA 8AT1A 2B36A 4C07A 3K0AA 2GCGA 4B7CA 2PJDA 3DBLB 3EN0A 3KOWA 4YXWD 5AQ1A 4ZT3A 5K0LA 2QMZA 3D6MA 4RHYA 2BMAA 3IEVA 5ABPA 1YMUA 2VH1A 2VG8A 3B1KA 3Q8WA 1XJ0A 2BKUA 2HPVA 3GLVA 5K6AA 3NBKA 3LBYA 4C4XA 3NJRA 3LPAA 3GJ8A 1N8KA 2NXJA 3OQHA 3LUPA 4JVNA 3DBVO 1ZK2A 1D07A 1Q0PA 2W6JA 3MAJA 1L8AA 3V55A 2FUKA 2H0QA 1P1HA 2XVMA 3DDHA 3OQJA 3TRFA 3VC1A 2FPGB 3DM9B 3C1OA 1H65A 4GEKA 3GJQA 1WHTA 1M2NA 1XTUA 3O73A 4OMFG 4TQ9A 2NVBA 4E70A 3MTGA 4M4SA 3QF4B 1E1RD 3URKA 1T2EA 3ME5A 3U6BA 1SA0A 3A4LA 1BXRB 3DYIA 3HI4A 3O84A 1DTWA 3IAM6 4H27A 3WBKA 3OC6A 4Q19A 5BOSB 1OT3A 1AX9A 1TGYA 4JD5A 5DISB 3CVOA 2WABA 4QEZA 5K09A 3QFTA 3C98A 2E4AA 1P33A 3VJKA 4J7UA 5JO9A 1GG8A 2IJGX 3RM3A 2QHXA 4URXR 1ADYA 2IYPA 1Z2DA 3AILA 4OGFA 1RJGA 4RHUA 3E3AA 3SKXA 2HHJA 4LYEA 1HORA 1JQ5A 3AESB 2Z2YA 5EZSA 5LBIA 2XADA 2HQOA 5HIJA 2OZLA 1PL7A 4QELA 1P7VA 2ZYDA 3B7GA 1N2OA 1MU0A 2HT6A 4ZAGA 5KTSA 3EX7C 1NVUQ 3F6CA 1FDSA 4AY3A 1W75A 1QX4A 4K3UA 1SBCA 4GD3Q 2G9UA 3BFKA 1OX4A 4TMYA 3VRHA 1KVUA 3KT0A 3IKMB 2PMBA 3LYLA 3ACCA 3A1DA 3FD8A 2O8BB 1LA2A 2GEDA 4CMIB 3EIEA 2GPBA 2Z0MA 4DABA 3NB0A 1ODSA 4G2NA 1OVGA 2W6OA 3G1TA 2WYWA 3FJ1A 1C0KA 3O8OB 1XPRA 3WJ7A 3PPYA 4HNVA 2FMFA 4ZZ0A 2QVCA 4DXAA 4EKEA 3I9LA 5DTQA 5BSKA 2N9UA 1CG6A 2QTVA 5A3RA 1UFVA 3N6RA 1TAQA 1MFZA 1N0VC 1BVRA 1X1CA 3ASZA 4IHJB 4MHSA 3N07A 1E20A 5CM8B 2WTMA 2DERA 4YRIA 1AZSC 3NIWA 2XA2A 2J0QA 1QRDA 5DYWA 4HDOB 5LM3A 1GQFA 3LIIA 4MRPA 4OQEA 2WY2D 5TF0A 3W2IA 3TX6A 1XRQA 1CUBA 5E3HA 5ARDA 2VATA 2VN8A 5WRFA 1SQ6A 1YTUA 3KL4A 4Q48A 3ZDZB 3AVTA 2BP7B 2Q62A 3WIEA 4LHEA 1D3AA 2FSUA 1KRWA 2B1JA 3FZGA 4TWAA 3K1JA 2J9GA 3VYUB 4PANA 1K66A 3W5IA 1CQIB 2YYSA 2Z9CA 3D6JA 3ND6A 4B44A 3RRJA 3PNKA 3V8BA 1JDNA 1KTVA 4B35A 5CDUA 3U4IA 2YXPX 5BWNA 4O4LB 1ONNA 3EVGA 3RRXA 3BG5A 4RTNA 1MGOA 3DTVD 1K75A 2PBRA 2YXLA 1VL8A 1XWFA 2PIDA 4E6EA 4Y0VA 2NSYA 2QR5A 4I1OA 1YVPA 5DTIA 5F7JA 4ZYLA 2XGGA 4PPFA 3FKSD 5KCZA 2J7PA 4HVTA 4R8SA 1J2UA 4XQCA 3KOXA 1O6CA 4MGIR 1P4SA 3E9YA 5C8DA 2BIFA 4AX8A 5I45A 1RC8A 2E4WA 1V5WA 1KHHA 4H7KA 4TT3A 5BN1A 2FQ1A 2A5YB 3BCHA 1FUIA 1YS1X 4RFSB 3REOA 4PRYA 2COKA 4YRDA 1X77A 3HB4X 2AZDA 4EW6A 2IP4A 4M21A 5JQGF 2J6HA 4PSKA 5IKEA 1AUOA 1A8PA 1D2MA 2ZWOA 3MBKA 3B6JA 2XJ9A 4JLWA 4UBLA 5LQAA 1PJ2A 1JE1A 2VP3A 3U7QA 2QUBA 4EHLA 4UW9A 3O03A 4Z2YA 2A8YA 1OZFA 2Q3MA 1ZOIA 2FXVA 1R88A 2X14A 2Z2KA 3R23A 2YVUA 5IJAA 4FDMA 4XYGA 4I4TF 1AU9A 3N70A 1Q1QA 1ZCBA 3V4PB 2A0WA 1KRXA 3QLUC 3SKYA 3I1JA 2FLKA 3HG7A 2H2DA 2ZSIA 4NRDA 4REQA 2A4MA 5JNSA 3VXKA 2YJ6A 2HA7A 1VSQA 2I3BA 3EEIA 5CXSA 1MW9X 2QIOA 4MEBA 1DO0A 1JHAA 1QAMA 2VA9A 3BPSA 4XM0A 3UMFA 1W36D 3KZNA 3U9SA 3SVZA 3VZRA 3P1JA 2P4QA 3TSCA 4B6FA 3L0IB 3SJAA 1CBUA 2AW3A 2Q1SA 3SYRA 3VMFA 1VFNA 4HQRA 3MG9A 1X7WA 2VUUA 3JVIA 1WU7A 1PGOA 3BL6A 3MWDB 1W48A 4IXTA 4AO8A 1PLLA 2VT2A 2H4FA 5AIBA 1BCSA 4X64B 3NDBB 1RJ9B 2OPHA 2ROQA 1HV8A 3VUEA 3IEMA 5A7FA 5IXSA 1T0HB 4U00A 3BMCA 3TW4A 1ST3A 1FJGB 3AERA 5FLXA 1HDRA 5TARA 4I1IA 5J2TF 1RRCA 2JFQA 5KVSA 3LWZA 1AIPA 4MB6A 1HE2A 1TMYA 2JDIA 3F6RA 2V59A 4W5NA 1N2JA 3BB4A 1E5TA 3F46A 1QIIA 1WW2A 2IOQA 3FCSB 3M9LA 4BKOA 5LMZA 1RNLA 3EZ2A 3QF7A 3TVYA 4GICA 2WTAA 4H6VA 1R37A 4OJYA 4Y1FA 3TZKA 5C7LO 3DEKA 3SAJA 1LX7A 1H0RA 2HHLA 5JH7F 1H1LB 2AJ8A 4XYBA 1G7RA 1W1WA 3KJNA 3MD0A 5AKXA 4RVFA 1HDGO 4EECA 2D5AA 4WFQA 2XDAA 4JGGA 1WNTA 2AZXA 2VDPB 4MUYA 2NZWA 3GLHE 5EQFA 5IKMA 5KDOA 2CNLA 3WGVA 1GPNA 1L5SA 3FVVA 2MTBA 1EFCA 5C1DA 3FNBA 1UBRS 4JKOA 1YRBA 2VSOA 3CX3A 4L7QA 1NX6A 3UXMA 2XUIA 2DCMA 2MYPA 4MWEA 1SOWA 4R9NA 3WJ1A 4DRZA 1B1CA 1HC7A 2HXYA 2VRBA 1YB2A 4BB6A 1CRLA 8OHMA 3VQTA 3ICOA 2I2DA 4M87A 3QTTA 1JR3A 4RTPA 3NPMA 4YALA 1X7XB 4GOLD 1Q11A 2PS9A 2W2NA 2XHEA 3GG2A 1DQZA 1WZCA 2HB6A 3MRTA 5D86A 2XOXA 1QPGA 3J7AC 2CHUA 1C9DB 2FQWA 2XRYA 4HSGA 3REQA 2GERA 5C34B 3OLWA 2PZMA 1G2IA 2P5UA 1WZIA 2ZR9A 2HWKA 3NH6A 4RC9A 4LYJA 2WSYB 1D1SA 9LDBA 2VXBA 4HN9A 2PLAA 2ZBUA 5KOJB 3E3LA 5EFZA 3GA0A 1MMFB 2NTEA 4XFJA 5TT0A 1QB8A 4HGNA 2IEYA 4GU5A 4LXQA 1PS9A 4QVIA 1E4OA 3ZWAA 5LMNB 4MB2A 2XQJA 1DBPA 3TQTA 3OKAA 3ONNA 4EUFA 5JBNA 5LR6A 1SHUX 1FLAA 1TM2A 3NC4A 2B2CA 1ZWLA 4MCHA 1L5GB 3S8YA 2N75A 4ND2A 3BTOA 1R0XA 1VHQA 4CF3A 3DZJA 1P5HA 3VISA 3NKVA 1LH0A 3PC3A 4XOIA 3TLGB 1G98A 4F5ZA 3S1AB 1TEVA 3DMGA 1QOPB 5DLQC 2H1SA 1DFGA 2KX7A 1J0DA 3A1SA 1UXIA 3OHPA 3QUCA 2IUYA 4PONA 4CM1A 3PDUA 2L19A 1TD1A 1II9A 1TTPB 2VO1A 3D8TA 1LJUA 2D6FA 1M5TA 3PE3A 1XCPA 3C7DB 4WAUA 5CB4F 3PTZA 5BN3A 4B4WA 1LEHA 4D0GA 1WVIA 4I5GA 5HEKA 3DLHA 2IXGA 1Q0QA 2ACWA 3PFKA 2WTNA 5AVOA 1LTKA 3KE9A 3ZHUA 2BKXA 3OY2A 5HOQA 1MO3A 4GX0A 4A1FA 1VLVA 4E2YA 2JCYA 3OSUA 5AM2A 3KSAC 3F47A 4XTRA 1MVNA 3GFVA 1GGEA 3GA5A 1OLUA 1UPUA 2ID8A 1S96A 3BMNB 1X42A 3CNNA 2OHXA 2D1FA 1L7EA 3TQHA 5AM3A 5BUZA 1UM8A 4M22A 3GH1A 2AC2A 3ZY2A 3BMOA 4FU0A 5THQA 2QU7A 3W5AA 4OYHA 2VSXA 3WLPA 1XZNA 1YULA 3GEIA 4M1OA 3HB7A 4URHA 1IUOA 2QXYA 5LBUA 3VKGA 1QRUA 1O6FA 4OXIA 4XUDA 4D6PA 4QARA 5KNBA 2Q8PA 4UXHA 1JVSA 4UTPA 2BGRA 1N9KA 4JLSA 2HK8A 4R6XA 3TM4A 2Q28A 7AT1A 3TFWA 2PKXA 3TXXA 3ETJA 4DV7B 1RJ9A 4CUJA 1K6EA 3F3KA 2VHEA 2Z57A 5A0VA 3K5HA 2P9TA 2Q6OA 3IJRA 3KSBC 4RELA 1C30A 1R12A 4YFYA 2XXAB 4L6IA 4NOMA 1GYRA 3UK1A 2PTGA 3RH0A 3PJEA 4XWGA 1YUMA 2HA0A 3TEMA 1P1BA 3A6HA 4G85A 1R5OA 2OFXA 4KSCA 1XIVA 4PZ0A 2PGXA 3PR1A 2K6GA 4Y2JA 4M54A 1FQKA 1Y98A 3EY9A 4MGYR 2BBWA 2QJFA 5MFZA 3OEYA 3ORSA 1E3DA 1QV9A 2FPKA 1GO2A 3TRKA 4KK3A 4FN5A 3W2EA 4UD2A 5GONF 4KITB 5KU1A 3MILA 4B3FX 2IPXA 3MERA 4XASA 3N6VA 5HA5A 4BGUA 1CX9B 1XFDA 2YJ4A 2VDOB 4F12A 4U9IS 4CIYA 3Q7QA 1WSBA 2JLVA 3FWKA 5JNWA 3HUTA 3PNYA 1C9JA 4BVFA 1RHMA 4LOAA 2QORA 4PQFA 3TB4A 4E2WA 2SHKA 3UPUA 4NCIA 3R5TA 3L0YA 1ORIA 1CUGA 1G19A 2FTKE 1ZM9A 2B0JA 2IXTA 2VEDA 2IPNA 3AEUB 3L0CA 3PBKA 2BDTA 4U2KA 2GK4A 4JLPA 4E7PA 4ZOQI 5L3SA 4G0VA 5CIWA 3SSNA 4F21A 4JP2A 3CZQA 1YZLA 1ADCA 4GMGA 4QBTA 1V16B 3KZXA 5KX5F 1QO7A 4I81A 3RB8A 3GMIA 4EVSA 4PS1A 1GTSA 1TC1A 1J7KA 3GJ0A 4X0EA 2HTEA 2JIOA 5AKHA 1DKRA 1LTHR 1UBUS 3SYTA 4Z3DA 2ZVQX 4LRUA 4JXXA 1T5TA 3L92A 3M6VA 4YRKA 1EA5A 4YRLA 3MAGA 3OPMA 1YGPA 2P9YA 1Z3IX 2IBMA 3C7CB 2HNKA 1T3HA 2DWPA 3ZY5A 1A04A 3B7PA 3SSOA 4EEXA 1Y9JA 1KF0A 3FROA 4LWOA 4AY5A 2AJTA 2BBOA 2O3SA 1TJPB 1NKSA 2B8TA 4YFVA 1HE4A 5CUQA 2HHCA 4U6QA 1C4XA 4N5NA 4OI1A 1K68A 4NJEA 1LQTA 1EFTA 4NG4A 2QBYB 3D8RA 4MX8A 1XZBA 3PFHA 2D74A 4PNZA 2N3ZA 3VH4A 2IHKA 1JYEA 4J0HA 4AO7A 4O4IA 4AULA 5DZSA 1AQUA 5K01A 3I0NA 1RWPA 2VJMA 4G67A 1VJ5A 4YXFA 4QDOA 2R6GA 5I9IA 3IUSA 1I10A 1C4KA 2H9AA 3T5PA 2RH8A 4JCCA 2YCBA 3KQHA 4M86A 4UHDA 2QN1A 5KTPA 5TMEA 3A31A 1GUBA 1IB0A 3HYCA 3P2MA 4YRZA 1T3ZA 4BFXA 1SUWA 2AUMA 1ISMA 2X5XA 4X95A 5I47A 3SM9A 2MR5A 2ZJ2A 3PGVA 4BMPB 5IDWA 3OFNA 1WF6A 1LVUA 5EHXA 1JQ3A 1BXKA 3A6LA 4FEGA 4EAAA 2DULA 3CCCA 4BUJA 4F3NA 1KEPA 2FFAA 4K88A 4KI7A 3CCBA 2AFIA 1NR5A 2PVSA 4I8XA 3ZIAA 2I22A 1TTTA 3EDOA 2PT5A 1S2MA 2WYVA 2ZXFA 2I7DA 5BV1A 3R9KA 3EOZA 4UM5A 4PSUA 4ITRC 4IJQA 4LZLA 4K81B 1AHIA 1XZDA 1ADFA 4IQ0A 3S8MA 4X20A 4RCZA 4O3FA 1A4RA 3ZHOA 1ZHHA 4Z4FA 3NUGA 5AESA 1VCNA 2W2LA 1CZNA 2FW7A 4J6EA 1UK7A 1WSWA 4YROA 3NGXA 4EWLA 3L7BA 5M3BA 3SDSA 4F2PA 1U0TA 3MUFA 2CVFA 4ZYUA 2Y05A 2C5HA 3MWKA 4OBEA 3OFND 2ZAMA 5E9QA 1YT5A 3N74A 3WYGA 5JHGB 1CEYA 2ANBA 4XR4A 1RR6A 3QHAA 1QX3A 2BKLA 2OQVA 1E4VA 4OBXA 5KKCA 2RHCA 3C74A 3V2UA 3CC8A 4CPDA 2R62A 3CLTD 3H1GA 3NOOA