3BB3A

Crystal structure of toc33 from arabidopsis thaliana in complex with gdp and mg2+
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
242
Chain Sequence
EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T7I23.11 protein
publication title The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 76
structure length 242
sequence length 245
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bb3A00
3UMSA 2DYKA 3MJHA 1V43A 2HT1A 3RC8A 1EFRD 3CLVA 2Q3FA 2ZPTX 4D26A 4JSYA 4KYUA 3BGWA 1OFHA 2HYDA 4GL2A 2FN4A 3WRYC 5CIWA 2NPFA 2FWRA 1LVGA 2JASA 2GETA 2QTVB 1XBTA 3FFBA 4R7ZA 1KGDA 3K70C 5JFGA 4MYCA 4J0QA 2VLIA 1ZM7A 5UKDA 1IJFA 4URXR 2IHBA 1XXHE 3TAHA 2WKQA 1U81A 1IHUA 3DL0A 5FBLB 1JJ7A 2D4HA 5K8LA 4OHVA 2C9OA 2Z6VA 4BZXA 3OHMA 2J0UB 3HPRA 1NVVQ 2VHJA 3EXAA 2SHKA 4OJKA 4DEYA 3R9WA 4BZQA 2RGNC 1ESMA 4JVLA 3A36A 1H8EA 1YR9A 1NY6A 4OQLA 4ZDKA 2GF9A 2ZE8A 5FI0B 3K09C 1NN0A 1H8HD 5TARA 2JAQA 4DSTA 3GJ3A 3RWOA 3KL4A 4YMTA 1UDWA 4NHOA 2WWIA 4Z8XA 2AKAB 3QBTA 1P2TA 2HYIC 2A5GA 4YMSA 2GJ9A 5BN5A 3B9PA 4RCZA 3MJRA 4TZ6A 1TUEA 5H70A 1OIWA 4JZKA 1YZTA 3X1XA 5DYGA 3QI2A 5E3HA 1BOFA 1E9RA 1XMVA 2WJYA 1XD2A 4C0KA 1IXSB 2ZSAA 3CBQA 2LKDA 1HY3A 4UXJA 4LBYA 2ZE7A 3B13B 4NCNA 4JL6A 4YONB 1TTTA 4PAMA 4Q21A 3GJ4A 4QM6A 2WZQA 5JLJA 2PEZA 3U3JA 4ZO4A 5EP2A 3QXSA 3PV0A 4BLRA 1CBUA 3VTKA 1KI4A 2B21A 4KODA 4A8JB 3HYTA 2IUUA 3KXLA 3U3OA 2OEPA 2GXSA 1E9FA 3KQKA 3AP1A 3EA0A 3T1OA 4A82A 3PEWA 3NTUA 1EX6A 5BYKA 4XWKA 1S9HA 2BM0A 2W0MA 3EX7C 3GMTA 2JIZA 3BORA 5FOUA 1E2IA 3WNBA 2NO1A 5BN4A 3UG7A 5EJEA 3U2QA 2PLFA 4H1VA 2YKGA 3B1WA 2W2VA 5AUNB 4DSNA 2GXAA 3KXKA 3B6EA 1OFUX 1E9CA 3BC1A 5G40A 4UKDA 3VHLB 2FGKA 4BRUA 5FTMA 3ND9A 4DIEA 3ADCA 1P5ZB 3WP0A 1G5TA 3ZYCA 4N0DA 3RSLA 5HR5A 5AWFC 2P6UA 4RY2A 1K5DA 2OZEA 4ESHA 1TPZA 2WBLC 1FFHA 1Z5ZA 4C0BA 3T5DA 5JECA 1T5LA 2ONKA 4A15A 1T0HB 2PZGA 4JVMA 4DDUA 4NTZA 3ZZTA 4KSCA 4B3CA 2VHQA 3DO6A 4Q7LA 1KJYA 2R65A 4M1TA 4W7SA 1A82A 2EFGA 2X2EA 1EWQA 4ZV4A 1YE8A 1ZIPA 2FPLA 2V6JA 3HR8A 3ZVMA 5FBVB 5CYPA 4D2IA 2NZJA 3EWSA 1OXUA 2ZRAA 4JVSB 1D2MA 2YC4C 4V0KA 5IF9A 1NN1A 4A0HA 2W6ID 1F48A 1FL9A 1NG1A 1SHZA 2OFXA 4OI2A 3BFVA 5BXQC 3M0EA 3TVDA 2QMOA 4XJXA 1SZPA 4QM7A 3LBHA 2H7VA 4M53A 1E2HA 3TKLA 3K70B 2OV2A 4LV5B 2FNAA 2WJHA 3DOEA 1OXTA 4KVAA 2IK8A 4HAUA 1OIVA 4P4TA 4PHTA 2XAUA 2ODWA 4E22A 1NBME 1ELOA 1KZ7B 2GZAA 2G6BA 5C4GB 4LRWA 2HJVA 1G3RA 3TUIC 3CR8A 4KO8A 5KPJA 2O8CA 4H1UA 1Z6YA 2A3RA 1E4VA 1DAGA 3B7GA 4BZPA 4XVQA 3TUJC 3I72A 3DZDA 1SQ5A 2WSSD 3NHAA 1A5TA 1TQ6A 1R7RA 3L0OA 3I3SR 2FV8A 1A1VA 3PENA 2RGBA 2V4ZA 4AKGA 1SULA 1GNQA 2FZLA 2P0EA 1WF3A 2OSBA 3DDCA 3IHWA 1XZPA 2CBZA 4DVGA 4W9MC 1N6OA 5G3YA 4JYCA 2O8EA 1LFDB 3CRRA 1PV4A 4D0LB 2P6RA 3ASZA 4MKHA 3QKSB 3NC1C 4ASUA 3FDIA 5EP4A 5CB6A 2CL6X 2D3WA 3EW9A 1KY3A 2OUKA 3IKJA 3R8CA 4CVNA 5KYKA 1RZ3A 3F3YA 4QNRA 2YWEA 1AIPA 1YZGA 2GBLA 5DE3A 4HB0A 1CJTC 3MMPA 1NSTA 4E09A 4F92B 1NJFA 2P67A 4DT1B 1MRNA 1MO5A 1JEEA 5EP3A 4AYWA 4DBLC 1CULC 1JQJC 3IO3A 5M04A 4AIIA 2H8KA 3PEVA 1ZJ6A 4DUGD 2H17A 1GL7A 5DIFA 5JJIA 4B3FX 3EA5A 1DOAA 2ZUBA 1N5KA 4FINA 1NI3A 2KWIA 1T9HA 3DPUA 2C8VA 3K1JA 5EXPA 2XZPA 2QPAA 2NMVA 3IIKA 2WOOA 2ZQ5A 4I1UA 4ZI2A 2A2ZA 2ZYUX 3D6TB 3ZLJA 5SZKB 4MUAA 2RHDA 2GXUA 4DLWA 4GZMA 4BLSA 3L82B 3KZ1E 2J3EA 1AS2A 1ZUNB 3WYFA 4O25A 2AXNA 2VEDA 1JPJA 3QUSA 4C0AC 1N3BA 2QPOA 1SKQA 2H5EA 2J0VA 3KKQA 3CIOA 3QBVA 1Q1EA 1GTVA 5AJYA 1OH6A 3X1WA 2W0SA 2VP9A 4IJMA 3SHFA 5B64A 4HYYA 2IYVA 2Z0MA 1ZNYA 1I4DD 2BMDA 2DFTA 1AJEA 1NMYA 3B60A 3EARA 1VKJA 1N25A 3HR7A 3EC1A 2DPXA 5BWMA 5JHGB 3D3QA 4GBMA 1DARA 1LB1B 2WWFA 1FX0B 4LJAA 4V0MA 4PHHA 1II9A 3O8BA 4EPVA 3AP3A 5KNDA 4B76A 5KDOA 2B7CA 5C2JB 4IVQA 1SVIA 1WRBA 4LJ4A 4MYHA 3C16C 3THWB 4F91B 1JR6A 1U90A 1HT2E 2ONJA 3BH6A 5H8WA 3QOFA 4FCTA 2QQ0A 4JVNA 4M9XA 4TL7A 1KI6A 4KLNA 2RGNA 5KPDA 2O52A 2CLDX 4HDQB 3MAAC 2WWYA 4DCVA 4CRWB 1P2UA 3PUZA 2X77A 1E0AA 1G7TA 3K09A 4V0NA 2KBFA 5BYJA 1W7AA 3Q7QA 1U0LA 1XTRA 1E3MA 3NHBA 1S1MA 4NYMR 2EU8A 3DM5A 5SZHB 2FSGA 1HT1E 2ZJYA 2ZJAA 3PR1A 3Q7PA 3QKSA 4YXWA 4L9SA 1JXMA 3QKRA 5BN3A 1ZM3A 4IEEA 4C7OA 3W34A 4TTPA 2H92A 2WPDA 1Z6XA 4KITB 1U8ZA 3W9YA 1TADA 3BK7A 4Q00A 1SXJA 3GJ8A 4IOMA 2FGJA 4Q4HA 1Z83A 4JMPA 2B8TA 2GAAA 1ZP6A 2QMEA 3SJZA 2BEJA 4XSHA 3UMFA 1OKKD 4MGZR 4XD7A 4RD0A 4B43A 1D6JA 4PQRA 4YDSA 3I5YA 2TMKA 4ITRC 5DHAA 1COWD 2GTPA 3EPKA 4TYPA 4QHTA 3TJZA 1FOEB 1Z06A 3BXZA 3PCRB 1OYWA 2XTNA 1VIAA 2VO1A 1FPMA 3QEOA 1CJUC 2CNWA 3IDQA 4DB2A 4GMDA 4YMWA 4A1FA 1NMXA 2WJIA 4G01B 3AVQA 4IKEA 5JRJA 4Q48A 3W3AA 1D5CA 4FMCF 5FTNA 1U2RA 4W5WA 3VMFA 2QG6A 1OSNA 2AWNA 3NBZC 2AR7A 1XDBA 2IEYA 4M1OA 3ONWA 4GOJA 2XXAB 1I2MA 1L7VC 2VA8A 2QMUA 3DOFA 4GT1A 1KOFA 2IS2A 1ZMXA 4YC7A 1QBKC 2F9MA 2EWVA 4QBHA 2F55A 2A30A 4Q9LA 1I4LD 3C15C 1XCGB 2AD1A 2YHSA 1EESA 4PSVA 1KJWA 1CLUA 3DZ8A 3HU1A 3RHFA 3TQFA 1PLKA 5A0FA 1NNEA 1US8B 4PZLA 5DO9A 4P33A 4LUCA 1RFLA 5CDFE 1DTSA 2HXYA 3C4JA 2J45A 1E9BA 3THYB 2JIZD 3RSOA 1CJMA 1GDDA 2O5VA 1W47A 1E2DA 1M74A 1P2SA 3A1SA 3ZZUA 3THOA 1NJGA 1TNDA 2YOHA 2IXEA 1RW4A 3U7GA 2N42A 4Q5IA 4KFRA 1IBRA 4DWJA 2ZRLA 3I4LA 4IFEA 3TVTA 2V3CC 4DLYA 1VECA 1CP2A 4QBGB 4HB2A 2ZSEA 2NGRA 2AD5A 3QQ5A 3QIAA 3VFDA 2WJGA 4M21A 2A5JA 1FQKA 1EK0A 1H8HA 2OLJA 3CPJB 1ZUHA 2ZR7A 3SBDA 1OHHD 3CM0A 4Q7JB 4US0R 3RRMA 4FCWA 4BASA 1OIXA 1E98A 4F4JA 4TT3A 2NTYC 2XB4A 1ESNA 1G9XA 3A58B 3VR3A 4TMZA 3U6KA 4ON9A 1F2UB 1P75A 4FW9A 4G5SA 5FPKA 3VNVA 1Q3TA 2EYQA 2VIIA 3MWYW 4P31A 1KSFX 1P6XA 3AVYA 1E2MA 1O3YA 4AURA 4PO9A 2RHMA 1EWRA 1C4OA 2A7QA 3WRXC 5GJWC 1RE0A 1CRPA 2MSEB 3CONA 1KKLA 1JAIA 1Q57A 1II8B 4R71A 2ZRMA 3FMPB 4N3NA 2WWHA 4TQAA 3VKGA 1A2KC 1N0VC 2C78A 1KK0A 2DY1A 3QPUA 4Z54A 1QVRA 5CM8B 2XXAA 1Z22A 1UADA 2IA5A 4BLPA 1E79D 2JJ2D 4TZ0A 2ZYVX 4WVFA 3WYGA 3KB1A 3EZ6A 1UBGA 4JJZA 3SYKA 5F9FA 4HDOB 2V55B 3AP2A 2QEQA 5FUXA 3LW8A 3O47A 1KO8A 4HAZA 1Q1BA 2LWIA 1RRCA 1TAGA 4KLZA 1LF0A 4MRPA 5IDVA 3W8RA 2OILA 4NU0A 4BGDA 3LLMA 5H1YA 1K5GA 5DNYB 1ZC4A 4NYMQ 2FJUA 5IT5A 1NVVR 1XNJA 1F2TB 1KDRA 3UWOA 2FFHA 2VPPA 5HKKD 3A1WA 4DSOA 1K8RA 1JR3D 3PUVA 2C98A 3RAPR 1T91A 3QSYA 4OKSA 1SKYB 2OCPA 4TMXA 5G41A 2W6IA 4XWOA 3D8BA 4QG7A 2ZYTX 4RD1A 1MOZA 2RGCA 2MMCA 3KTAB 1G7RA 4EPTA 4HDCA 3TSOA 3EC2A 4YMVA 2ANCA 2BJWA 4KU4A 1PUJA 3LBNA 2V9PA 2Z83A 5LD2C 2OCBA 1VCIA 4LBZA 4ARZB 3B78A 2RMKA 1JQLB 1JXOA 4G5GA 1D8TA 4TSFD 1X8KA 1OV4A 1TQDA 4C0QC 5AUPB 5F9HA 2Z43A 4Q4JA 5IHPA 4R98A 5KO2A 3FE2A 1HA3A 2ZS7A 2ANBA 3ZS8A 4C30A 5L3VA 1NIJA 2Q0HA 2YC2C 3AV0B 4TLCA 3TE6A 2IYSA 4EKDA 2WSSA 4NZYA 5FBQB 4NYIR 5KNCA 1FMLA 2BBTA 1UBFA 4A0GA 2ZRHA 3ZDQA 1G3QA 2GDJA 2GZDA 2BBWA 3IILA 3VNUA 3I32A 2ZE5A 3VU9A 1PZNA 2XB2A 3PEYA 1D9XA 5HE9A 2QT1A 1IN5A 2BMEA 1RYFA 2DR3A 1E32A 2VHUA 3ZH9B 1Z2CA 2GEUA 3T35A 4LV6A 1JBKA 1XTQA 3IEUA 4WZBE 1KMHA 2ATXA 4EPRA 2RAPA 1SGWA 4I4LA 4Q1DA 3JVUA 1ZM4A 2FDCA 4OQNA 5FPSA 3WMEA 3CUEF 1PUIA 4JLAA 3H4MA 3BB1A 2W00A 4C0LA 3ADDA 1R0XA 5CITA 4AKIA 1M7HA 2GKSA 1AZTA 3IEVA 1OB5A 4DDTA 2IT1A 2IXGA 2D74A 5FBRB 5HZKA 2IW3A 1S3GA 4R2HA 4DCUA 4XVUA 4CEHA 4LHXA 4IVPA 3ZGXA 2MSDB 4G0NA 2FZ4A 3OEHD 3ZQJA 4U7DA 1Z2AA 1VCOA 2CHQA 3L8YA 4EFLA 3KQUA 5HCNA 4UXIA 3W90A 1DAHA 1IN8A 1XEFA 3GPLA 1C9KA 4QHYA 5FFMA 2Q3MA 4MRVA 1CF4A 3SS8A 2QM7A 3W3ZB 3NKVA 2X8AA 2GBLC 2C96A 3RNLA 4B3BA 1E69A 2G0NA 3ASYA 4QGGA 3KJEA 1Z0FA 1YKSA 1U0JA 1E9SA 1KI3A 4NONA 1XD2B 1OFTA 1E2FA 4GSYA 4Q01A 1K6MA 3RC3A 4RKEA 1AK2A 2PJZA 5FUYA 2ZI6A 3RS5A 3SFVA 1CIPA 3LFUA 4A36A 4NP6A 5EUMA 4AY2A 2FE4A 2X1VA 2ZRBA 5LDDC 5C1BA 1S3SA 2DWQA 2QRNA 4M8NE 2P3SA 1G7CA 1RJ9A 4B6FA 2GF0A 1WP9A 5JWRA 3NH6A 3WHKA 1IY2A 2WTUA 4MDFA 1T3LA 2WM9B 2ZU6A 3BH7A 4G5QA 1GKIA 3LO5A 5FPYA 3TUZC 4ZPXA 3LD9A 4CGZA 2AHOA 4CZ2A 8OHMA 3U61B 1X6VA 5LD2B 4ZCMA 3LV8A 1P2VA 3BRWD 4B3DA 1E6CA 2R6FA 3IIMA 1N6PA 2I4IA 2IYXA 3I8XA 3VAAA 2QBYA 1VTKA 2AN9A 2ASEA 2BEKA 3WP1B 4B2IA 3E2IA 1CR2A 2IL1A 1XRJA 4IXMA 4QGAA 5DISB 3GLFA 4M9QA 5JS8A 2V7QD 4LHVA 5FL3A 4CDGA 2EFEB 2JLSA 4JLKA 4AYTA 2NO9A 3GLHA 3NVAA 3OEED 1KDTA 1W0JD 3R9XA 1DAEA 1Z6AA 1E4YA 4DLUA 2R6CA 3VR1A 3GFTA 4OBEA 1KTVA 1N6RA 1SHKA 1OKKA 4RZUA 4BEBA 2IX3A 3KFVA 1L2TA 3L2OB 4D0NA 2X2FA 1G1MA 1YR6A 1SVOA 5DI3A 1COWA 1KI1A 1Q3HA 4LJ7A 1GRQA 1SKYE 1BMFD 2ZANA 1X1RA 3IBGA 4B74A 4IEIA 4GOKA 4B32A 2HF9A 3F8TA 2QENA 3WXMA 3ZVRA 2C77A 1QHGA 4RD4A 3I92A 5GJBA 1D9ZA 1N5JA 1XTJA 3RWMB 3AVWA 5EE3A 3AVOA 3MFYA 221PA 1KO5A 3SQWA 4PPQA 4F38A 3TBKA 3CW2A 2IHYA 4TT3D 5H68A 3UK6A 4KSBA 5CLQA 3NBFA 1RRPA 3OIYA 1G6OA 2O8CB 2DWOA 5AK0A 4TLDA 2ODEA 3LBIA 3N70A 4CT4B 1GRRA 4KFSA 2F7SA 4RFSA 1SXJC 1G21E 1R10A 5G3ZA 1Z63A 1YHNA 4XTRA 5SZJA 3CNNA 2PCJA 5FUVA 4DLSA 1G3MA 4QBFA 3SOPA 3WNDA 4KFUA 2O8EB 2WIBA 2ZI9A 2WV9A 2A9KA 4NYIQ 4V0OA 1AM4D 1QHYA 2BBSA 2IYRA 4A4DA 1M8PA 4JBXA 2VL7A 5JS7A 3QVUA 4PAOA 3RS7A 2YINC 1GSIA 2C2HA 4LJ5A 1YU9A 2QI9C 1NBMA 3TK1A 3EZ2A 2A5YB 4U5XA 5DH9A 3BE4A 2ZM5A 1U94A 3W5JA 1ZVQA 1FTSA 2WWGA 1N5LA 2JCSA 2G83A 821PA 4QJ4A 5B58C 721PA 4V03A 2D7CA 3AKYA 2ZRGA 2ZSFA 3IBYA 1QHSA 2PMKA 2HCBA 1G291 3OIUA 1E2NA 2PCLA 2XTZA 4WZ6A 4HUQA 4BE7B 4KBGA 4NDZA 3AVVA 1TUIA 1KI9A 1FNNA 1OHHA 4JLOA 1LS1A 2AK2A 3SN6A 3VKHA 1L4YA 3B8HA 1R8SA 4HI0E 1YR7A 4IDPA 1G5PA 1U0HC 1XMJA 3GJ7A 3C7KA 3K9NA 3WBJA 1U9IA 4BWYA 3PITA 3CWQA 2R44A 4EFMA 3R8FA 4TL8A 2GK7A 2P6NA 2ZTSA 4NMMA 1OFIA 1W5TA 1UBCA 3PUYA 5EZ5A 3CNLA 2IUTA 5FOSA 2HJGA 2VYFA 3TMKA 4OHYA 3QENA 1E9DA 1M6NA 5FPTA 3K0SA 4QJ5A 4KCGA 2GJKA 5JJKA 4FXPA 4ESVA 1DO2A 1T8UA 3K0EA 4NL4H 1BO6A 3A4LA 3TNFA 4NCIA 4XOIA 5P21A 4TL9A 1UAAA 3FMOB 4HLDA 5KU1A 3DMNA 2XNDA 1VYUA 3I8SA 1EFUA 2QROA 4BRWA 3AUYA 4LV8B 4IW3B 4U02A 4AKEA 1ZW6A 5J5CA 4HLQB 5AJXA 3I5XA 1Z29A 4TQ9A 1RVDA 1WQ1R 3LXXA 4LX0A 2IWRA 2REOA 4JT2A 4JBWA 1KI6B 1N6LA 3BBPA 1E79A 2V6IA 2JJ2A 2RGEA 2GHIA 3FKSD 5DHFA 2ZS8A 2EVWX 2VP6A 1T8TA 1KK1A 1R0WA 1P4SA 4G5OA 1KK3A 1DAIA 4DEXA 3AF3A 1XPUA 4FMDB 4L4UA 1XJ0A 1BH2A 1N0WA 3KB2A 4HAYA 5CK5A 3RS4A 4IDHA 3UMRA 3EPJA 4LYJA 4QC2A 1QDEA 3QKRB 2R6DA 4US1R 1TF5A 3U4QA 4C7OB 2ZSDA 2ZJ8A 5JSZA 1N0UA 3BB3A 4II7A 3EZFA 2HCJB 5HKKA 2KI5A 4E03A 2FFBA 3TGPA 2XGJA 1VDZA 2JJ8A 1JR3A 3CRVA 3QKUA 1SXJB 1T3HA 3SJBA 3FHTA 4Q4HB 3N5CA 1XP8A 4Q4AA 3AF4A 3O8CA 1YVDA 3T34A 2BWJA 4QKQA 4ZIRA 2KB0A 2GXQA 1I4TD 2AXPA 2XOKD 3I73A 5CK4A 5C46F 5KSZA 4A2QA 2DHRA 1AGPA 3MCAA 1J7KA 2ZI5A 3LA6A 4UQOA 1LS6A 4DDVA 4WA7A 4IDNA 5AUOB 3B9QA 3AF2A 1X3SA 4ZDWA 3H1TA 1WBDA 1NSFA 5L3QA 2UVQA 4MGKR 5TB5A 1GWNA 4BFTA 2F1HA 3L0IB 1MABA 2ZYWX 1CU1A 2J46A 4TSFA 4URUR 4EIWA 4IDQA 1OH7A 2RB4A 2WVJA 1R5BA 4R9UC 1XEWX 2F1JA 1ZNXA 4QNMA 2R2AA 2XZOA 4GPTA 3VKWA 1G64A 4RZ3A 3C8UA 3AKDA 2F3TA 1WXQA 2ZROA 1LF5A 2R6AA 2FF7A 2NOAA 1T0JB 3KJHA 4RKFA 2VP0A 2FSFA 2GZHA 1KDOA 4URZR 1BKDR 1IQPA 5CJ2A 5DLQC 3UWKA 3K9LA 4M0LA 1CJVC 1A7JA 1QHXA 1CR1A 1AS3A 4JT4A 4MQBA 3EPHA 4IOLA 1EFTA 2IBMA 2KBEA 2CJWA 3GEEA 3K9HA 3HU3A 3NH9A 2QP4A 1DVRA 4GRAA 4OI4A 4PPFA 1YR8A 3EAQA 3BERA 3OZXA 4P0TA 3V4FA 4I1VA 4BFZA 2QUZA 4QXAA 2QAGA 4DCSA 4NPHA 1GILA 1QG4A 2OO7A 1WDTA 2ZR0A 3ZIAD 2ZRCA 3FWYA 4JKYA 3ZS9A 4BLQA 4D4JA 4MRSA 5HE8A 3SC3A 1Q44A 2R6GA 2ZREA 4NCJA 2XX3A 4LHZA 4C0SA 2VHTA 4O0MA 4BLTA 2XSZD 5BQ5A 1NLZA 3A37A 3CX6A 1W4RA 3R20A 2UZ3A 2FG5A 2IEZA 1QVAA 3R7WA 1QHIA 2CL0X 1G16A 1LY1A 3Q5DA 3UIEA 4BFYA 1HUQA 1KI8A 4I1SA 5E7MA 2YOGA 4DZZA 1ZNWA 4XTCS 3QNUA 4D4MA 3MWLA 4K46A 2A5DA 2QA5A 2OT3B 3OEHA 1KK2A 2QP3A 4LJ8A 3QF4A 4LPKA 1HE1C 2EYUA 2ZUCA 4C9BA 5FOWA 4BECA 1RPZA 4X8OA 4LOAA 1OYYA 3FMIA 4EPYA 4FMBB 2NQ2C 1OT3A 1ZU4A 2YNMA 2OFOA 1DBSA 5EUQB 2BC9A 3VR4A 4JJKA 2ZEJA 3VR5A 5B57C 4PTLA 2D2EA 1GKYA 3NC0C 1NVWQ 4MDEA 1UEJA 3CX7A 3PG5A 1J2JA 2WJJA 2H1LA 5LBIA 2OBNA 4V0LA 1DG3A 2JDID 2KJQA 2VBCA 2IS1A 1TF2A 5TMPA 2ZJ2A 2Z5FA 1XF9A 3BJIC 5DN6D 2B92A 2ZVQX 4US2R 2OAP1 2Q9CA 4V0ME 2VH5R 4LYFA 3A1TA 4ABYA 1QG2A 1UJ2A 5JZVA 1BYIA 1N6IA 4XWAA 4PR0A 1KSGA 2G1KA 3M4YA 5C4MA 4MKIA 5TY0A 3KKNA 2RH5A 2GCOA 4B48A 5KSPA 1IN7A 4Y0VA 4B6EA 1P3JA 2OE2A 1U8YA 3GLIA 4HB3A 1NVUQ 2G0TA 3T06B 3OF5A 3TIFA 4DLVA 2J9RA 1UM8A 2ORWA 3K0AA 5B2ZA 4P4UA 2EQBA 3IGFA 1VCNA 2V7QA 3EPLA 4MA4A 4JS0A 5E7JA 4TYNA 4Q9JA 3OEEA 1W0JA 1FP7A 1G3UA 2JJ1A 3SYNA 3X1YA 1W36D 2O8BA 1NBMD 2LCFA 4LJYA 2GILA 4OI1A 1KYIA 5JCPA 1S0UA 2PT5A 4GFDA 3NEJA 4KVGA 2XTMA 4LJ6A 1SXJE 4Q19A 4RD2A 3T15A 2VF8A 1CXZA 4S2EA 1G3IA 1SVLA 2QNRA 4YLGA 1WE2A 5L3SA 3I61A 2BKEA 2WWXA 1BMFA 1GM5A 2G77B 4FD2A 3U44B 2ORIA 5FL7A 3GQBA 4I1OA 2VSXA 4O2LA 1WB9A 3ADKA 1LNZA 2DWPA 4MKFA 2EFDB 2D06A 2HEIA 2REBA 4HAXA 1G7SA 1SVKA 2J7PA 3SQXA 4A2WA 1DG1G 1TEXA 4D80A 1KZGB 1KJZA 2P5TB 4JLMA 3RDPA 2HLDD 2V54A 1AGRA 1CEEA 1VCMA 2DFKB 4Q4JB 1XFAA 2EW1A 5ANRB 2O8DA 5KUTA 4UNRA 2H16A 5G53C 4QJ3A 5TV2A 3CB4A 3W6NA 1CKEA 3MLEA 2NO7A 1GIAA 2IYQA 2OM2A 3EZ7A 3P27A 3N2IA 3P20A 2ZRNA 3P26A 4KJZA 5J4KA 1Z47A 3U3MA 2FA9A 2JGNA 2Q3HA 4ZCIA 1KO7A 1W46A 4OHWA 3IPXA 3QXHA 1TF7A 2XNDD 4CYMA 3HJNA 4MGYR 3CR7A 3T61A 1UKYA 3NIBA 3VU9B 3P1JA 1G4AE 1VPLA 4HZUA 4PAQA 1Z0KA 2XJ9A 3C41J 3OIWA 3EIQA 3H0KA 1CTQA 1XMSA 2QQEA 1Z28A 2HF8A 4MYTA 4YDHB 4ZCLA 1KMHB 1NKTA 4A6XA 1WCV1 5J40A 1GUAA 1X8LA 1IONA 4LGMA 3RRYA 1Q0UA 1KI2A 1UKZA 3BIFA 3FB4A 1FP6A 3B1VA 3MWKA 4JLDA 2RGAA 3PUWA 3CH4B 2VP5A 4ZI3A 4M1SA 4B71A 3PIRA 3MSXA 4B3GA 5CJPA 2OHFA 3CPEA 4PFSA 1JNYA 5F98A 2IYWA 4A0RA 4HZIA 3THXA 2WMOB 4CEHB 2IF2A 3TR0A 2R9VA 1W1WA 2ZETA 1Q1ZA 1R5NA 3LX5A 4QGHA 5F3WB 2I3BA 2DBYA 3K9GA 2F1IA 2YV5A 1FUKA 4KAXA 5EZ6B 4LHWA 3BB4A 3K53A 4N0EA 3Q72A 2A78A 2JLXA 3SEAA 3AVUA 4B2LA 1HQYE 2H18A 4TYQA 5FOXA 4HAVA 3B1ZA 3OE7A 5AJZA 1MO6A 2CDNA 4FWTA 1KDPA 3TW4A 4DRZA 2LKCA 2ODNA 2C04A 2IYLD 4TLBA 5JBQA 3U44A 1E2PA 1IOZA 5F2EA 2IUSA 1AKEA 1KO1A 1S1CA 1XCPA 4IVRA 2G1JA 4HEJA 1XXHB 1W36C 2VTKA 3DKVA 4B73A 5J4LA 1F5NA 1JECA 1OJLA 2CHGA 1W44A 4OQMA 4OQXA 1D2EA 3W5IA 4A2PA 3GFPA 3OESA 5E95A 2NZ8A 2JLVA 4A92A 1SVWA 1RC8A 4BFXA 4D25A 2JEOA 4TMWA 3Q3JB 3AVTA 4W5HA 3WMFA 4IOKA 4TL6A 2WICA 1E2EA 1E1RD 4NCKA 1RJ9B 5D3MA 2ZXUA 2GESA 3GLGA 1NLFA 3K0CA 1O87A 5J4VA 1LV7A 2NO0A 5IRCD 3FKSA 3AGQA 2AWOA 4RZXA 4HB4A 4NH0A 521PA 3DVLA 4EQ6A 1OE0A 3AM1A 4LSGA 2WKPA 1ZNZA 1PLJA 1U9IC 3LLUA 3LNCA 3KJIA 3OAAD 4NYJR 1HTWA 3NEYA 5A5GA 4TMVA 3VQTA 2RGGA 4LY6A 4BFSA 2ZE6A 1NN3A 3P4XA 4LDJA 1F60A 2QTHA 4DLXA 2F6RA 2QBYB 2GNOA 1CR4A 4TLEA 3LW7A 1R8QA 3CF2A 1XZQA 2F1RA 4PSAA 1ONBA 1E2GA 3GLFB 3IQXA 2W83A 2BMFA 4QHSA 2O8FA 1N6HA 2BM1A 5FUWA 3GLHB 3T5GA 4I81A 2JLZA 1UKVY 4RCYA 2ZJOA 5J47A 3K70D 1BS1A 2REXB 3C14C 5GVRA 2GAOA 1J8MF 3W6OA 1Z0DA 3PXGA 1M7GA 2PLRA 1GRNA 2QPTA 3PEUA 4F4IA 4UJ3A 3OIVA 2VQSA 4CEIB 1KAOA 4FWIB 2XOKA 1VIYA 5DI3B 1MO3A 3E1SA 1XTKA 1E1QA 3SE0A 4GI7A 1FW6A 2WJVA 1QHHA 1W4CA 4PQYA 1G8PA 4TWZA 4Q9HA 2ZVPX 3RS2A 1R6BX 4PZYA 3EIHA 2FU5C 3TQCA 1J90A 3GJ6A 2W58A 2D7DA 1D2NA 3QG5A 1N5IA 4LC0A 1TQ2A 1GAJA 1ZIOA 2IF0A 2E9SA 3FMFA 4KYIB 5LB4A 1KNXA 3ICEA 1A2BA 2FSHA 3CO5A 1ODFA 4PZZA 1NN5A 5DYIA 3A1UA 4BPBA 3AKCA 1DS6A 4A9AA 2CMKA 4PO1A 4H9GA 1B23P 1DEKA 1W0KD 2F43A 1XXHA 4P4SA 2ZITA 2QAJA 3IUYA 2ZRDA 1GOTA 4GP6A 4Z1MD 4RFSB 2VSFA 2I1QA 4TTRA 4UNPA 2G3YA 4ILEA 4MITA 2WHXA 1ZINA 2KSQA 2PL3A 3TRFA 2C5LA 2ERYA 1MR3F 3HU2A 5A4JA 2GEVA 3K0FA 5K8TA 1F6BA 1KY2A 2HDNB 1TL7C 5KTYA 3HPQA 4L9WA 2ZJ5A 1YRAA 3ZIAA 4AD8A 4EPWA 4TYYA 1FUUA 3AF0A 4WIAA 3ZVNA 3DEFA 1GL6A 3ZZ0A 2J1LA 4E07A 5JHHB 2E87A 2GCNA 2J0SA 4Z8YA 1P9RA 1JALA 1FMJA 1Q22A 2YYZA 1UEIA 1Y3AA 4HSEA 3QJYA 3TLXA 5HZHA 3V00A 2XSZA 3PUXA 1JI0A 3KXIA 4TQUS 3DM9B 1JPNA 1QZXA 4FMDF 3ZVLA 1N6NA 3Q8XB 5EP1A 1IN4A 1KAGA 5AJWA 1ZRHA 2ZI4A 3G5UA 1HEIA 4EJSA 2CE7A 6Q21A 1LTQA 1E2QA 1ETUA 1EX7A 4RD6A 1U98A 2OXRA 2QL6A 4KI0A 1ZD9A 3KKMA 4HUQB 1KSHA 1YZLA 1G4UR 2EWWA 4KXFB 2UZIR 4Q1AA 4DXAA 3H84A 2Q9BA 5EQTA 2JJ1D 3B2EA 3KQNA 3Q9LA 3MRSA 4CEJA 1XEXA 2IYZA 2N1BA 5L3RA 4CEIA 2QAGC 1FQJA 2BCJQ 3CPHA 2OBLA 3QKTA 2BV3A 3LAWA 4BEJA 5JRZA 5FH9A 4KV9A 4RSGA 4LHYA 4N1AA 2ORVA 2ZR9A 4Q1EA 2CK3A 4MH0R 5FL7D 4U00A 4WAUA 2JDIA 3N2EA 3S1AA 3CZQA 2DFNA 3JVVA 1KMQA 2P5SA 5KSOA 2ZS9A 1NIPA 4XSGA 1E9EA 2B6HA 1NRJB 2WOJA 5FOVA 5DN6A 3UG6A 2J7PD 4TMKA 3GEHA 5D3QA 1CS4C 2QTFA 5J4YA 1VMAA 4JKIA 5DGXA 4D82A 3MGCA 4OYHA 2QT0A 1U8AA 4UNSA 1W4BA 3RRZA 3SNHA 3NDPA 4JIMA 4O2RA 4EDHA 2J0QA 3JZAA 2PX3A 1JEDA 2CEAA 3A1VA 3CKLA 2QU8A 4IOJA 2OCYC 2ZRPA 3QEJA 4K8OA 1NL3A 2XNSA 1HYQA 4LBWA 1Z0AA 4Q9IA 3WYAA 1G20E 4L15A 3ADBA 3U5ZB 4GZLA 2IS4A 5GJCA 2YOFA 1Z6TA 3GCGA 3ZQ6A 1U99A 4WXRA 3U4QB 4V02A 4NYJQ 5JSZB 3P32A 1KIMA 1ZM2A 4URWR 3GLFE 121PA 2QE7A 3A4NA 3GJXC 3QVVA 3UXMA 3RLFA 2GJ8A 1OXVA 4L16A 2CE2X 3GLHE 2RCNA 2ZSBA 4PANA 4Q4AB 3JZMA 4WBSA 1QF9A 4WZAE 1DO0A 4ZIRB 1M1YE 2FFAA 3VR2A 3K8YA 4XIGS 2QGNA 1PJRA 4AKHA 5EE1A 3CRW1 2J7KA 3VHXA 2IS6A 3C5HA 5FR2A 1OH5A 4IXNA 2YWHA 4HLUA 1AS0A 1Z0IA 3CZPA 4DC9A 2AFHE 3B1XA 3TAUA 5L3QB 4IHQA 2JLYA 3HDTA 2FEOA 3SHWA 3L8ZA 1AZSC 3RABA 2BDTA 2V1UA 2PJRA 1IXRC 2ZAMA 3EIEA 1MABB 1X8JA 2B8WA 2CVHA 3U6BA 2HLDA 2D62A 4LYHA 4POAA 5JWHA 3U3KA 2PZEA 2DCUA 4IDOA 1OF1A 4DCNA 3OE7D 3CRMA 4MYUA 1E2KA 3BWDD 4UNQA 2HXSA 4C2TA 1RRFA 3LXRA 2C9CA 3KQLA 1F3OA 4JLBA 1HQCA 4LCBA 3MG9A 1ZCBA 2R8RA 3NBYC 3OFND 3F5FA 4P32A 1E0JA 1GG2A 2GJSA 3I62A 2HV8A 1J70A 1GZSA 4PC6A 3GEIA 3KFXA 3RVBA 4PXAA 1N6KA 2CJWB 2V1XA 3I1FA 1FTNA 1NVXQ 1G8HA 1XCMA 3IIJA 3KKOA 2J0UA 4HATA 3FHCB 5IK2A 2JLQA 2QAGB 4CIDA 2PH1A 4PPGA 4B75A 4DSUA 1IY1A 4B34A 3UANA 2Q9AA 2A5FA 3X1ZA 4RFVA 5FTKA 1PVOA 3AKEA 3KJGA 2WKRA 4WXPA 2CLSA 1SVSA 4MRRA 2WSMA 1T5IA 4M22A 4EAQA 4M1KA 1ZM9A 4XH9B 1FZQA 3CNOA 1P61B 4M1WA 1AN0A 5L8VA 4GOXA 2CHVA 3WHLA 3AEZA 2ERXA 3R7WB 2FOLA 2GK6A 2JLUA 1EFCA 2QORA 3CF6R 3SJAA 3ECCA 2VF7A 1EXMA 5AUQA 1Z08A 3ZJYA 1MRSA 2PZFA 4KFTA 5KHOC 3QF4B 2B7BA 5J4HA 1GFIA 2QSYA 1VG8A 1E2JA 1GNPA 1KHTA 3WNCA 2J87A 4JLVA 1Z0JA 2PX0A 3SJCA 4WOPA 5EE5B 4OQFA 2ZRJA 3CX8A 4QOSA 2CCJA 2RGDA 4M2LA 4Q03A 1RKBA 4X8MA 4A8JA 5TVKA 4BFVA 4DCTA 4YMUA 2VP2A 1E1QD 5EE0A 2X19A 2V8OA 1W49A 3SBEA 2W6JD 4AI6A 5KNBA 1BIFA 4Y0AA 1E0SA 1HE8B 1ZYUA 3CWZA 5TDHA 2IC5A 4S35A 1VG9B 1N2CE 1RYHA 1YJ5A 3KUDA 5FTLA 3QXCA 4OHZA 3BAFA 5CM9C 3SI7A 4PHFA 1G6HA 1M2OB 3SR0A 1UBEA 3PQCA 4WW0A 3AVXA 2Y8EA 4BQSA 1E1RA 3U7HB 1NMZA 2OBMA 4Q7MB 3DMDA 4AK9A 2F9LA 5JJLA 2GCOB 1XU4A 3E70C 1AQUA 1ZAKA 1G18A 4OHXA 1R0YA 1S8FA 1L8QA 2HT6A 1NP6A 3O8DA 2GVDC 1AA9A 3OAAA 3F0TA 4OL0A 1ZD8A 2MMGA 1NF3A 3VX3A 4ACBA 3GLIB 1Z3IX 1IXZA 2WIAA 4G5RA 3CF0A 2GWHA 3ICQB 4RJLA 1EGAA 3K0AB 1DADA 3ND8A 2JLWA 1ANKA 4DLZA 1MO4A 1P9NA 3AUXA 4LI0A 1YZQA 2J41A 4K81B 4Q66C 4Q9KA 4C0HA 1MKYA 3FOZA 3LH5A 2BJVA 3Q85A 2J59A 2NIPA 1P9WA 2QM8A 2YWFA 4URVR 1GP2A 3ZD6A 2WAXA 2O8BB 5K8IA 3D7MA 1FNMA 1KO4A 2ZRFA 4AYXA 1JR3E 1XD8A 3M6AA 5L3SB 3LY5A 3QY0A 3L43A 1W5SA 1M34E 4MGIR 1ZCAA 3K0CC 5CB8A 1G8FA 1NLYA 4EPXA 1G19A 2Z4SA 4BFUA 4F7WA 3E5HA 3LWNA 1Q1QA 1VYVA 4KBFA 3LDAA 3UPUA 2YJTD 2QGZA 4OJQA 2PMDA 4TTQA 2JATA 1J8YF 1OPXA 4Q7KA 1GITA 2ZJBA 1TEVA 4JLJA 1DAFA 4R2IA 3T12A 1ZD1A 2C99A 1Z8FA 4P3YA 2O8DB 5CDFA 1SVMA 4B3XA 5ELXA 5EXXA 1DELA 1KNQA 1WMSA 2PBRA 3DHWC 1R5OA 1W0KA 4IRUB 2EFHB 3TR5A 4C3ZA 1B0UA 5LPNA 3LRPA 3NWJA 4HLCA 3LVRE 5FPHA 4Z1MA 2CK3D 2IYYA 2C9YA 4DT1A 4F4CA 5K8UA 3LQRA 1CRQA 2JA1A 4GP7A 2YVUA 1TU4A 4JYBA 2OESA 3SZRA 4PPNA 1XWIA 3L0SA 1S4QA 2FSIA 1QRAA 2IYUA 1C1YA 1GNRA 2IWHA 4DIDA 4PC7A 2VSOA 3BFXA 1J99A 3Q5EA 1CR0A 1R0ZA 1KI7A 4HZUB 1MT0A 2CXXA 3LQQA 1PLLA 4BUJA 5FR1A 5E4FA 4L8GA 2BMJA 3W8NA 3BH0A 1H8ED 2BIFA 4JL5A 1VG0B 4OK6A 3GJ0A 1ZUIA 3PJRA 4DLTA 1XPOA 1R4AA 4DLRA 1VG1A 4EFNA 3G0HA 3FFAA 2O0HA 4MKGA 2QY9A 4IFBA 5E7IA 2UKDA 1IJEA 3WY9A 4EUNA 1X1SA 4DHEA 5FI1B 1AKYA 3H2YA 3THXB 4RD3A 4KHZA 3R9IA 4QGFA 1UDXA 3KKPA 3X2SA 4GDFA 2CLCX 1YZUA 2W2XA 2WAYA 1RRGA 3FGNA 5AJVB 2AFIE 2QE7D 1EG7A 4JL8A 4B47A 1EFRA 1FX0A 4NCHA 2KE5A 4FCVA 1W2GA 2IXFA 1XX6A 2GVZC 2QZ4A 2H57A 1IN6A 1BYUA 1G8YA 3NG1A 2QP9X 1IAQA 3SYLA 4DB4A 3THWA 5JI3E 5EXSA 2Q6TA 5GJVC 3W6PA 1WA5A 2I1VB 4PC1A 3WMGA 1XTIA 4LZZA 1JAHA 2GA8A 2OAQ1 3QG1A 1A4RA 2NPIA 4LWZA 3REGA 5KDDA 4C2UA 2PEYA 2FMXA 1YRBA 4NBSA 4X8LA 3TSWA 5JI2E 1DAMA 2EFCB 4EJSC 1JB1A 1XB2A 2YZ2A 1X86B 4TN1A 1XTSA 5D3MB 4HUTA 4ZKDA 3GLGB 4PO8A 3T1VA 5JEDA 3MD0A 3U7FB 5HTKA 1G41A 3BD9A 1OXSC 3D31A 3GFOA 2XEXA 1TQ4A 4EQ6B 2QMHA 4FN5A 1XPRA 1T4GA 1MH1A 3NXSA 4Q02A 3KDSE 3X1DA 4OK3A 1L4UA 2XJ4A 3RS0A 5HPYB 5IK2D 4YQFA 3GLIE 1UF9A 3LX8A 4W5JA 3TSZA 4M1MA 4M9SA 4DDWA 2CL7X 4CT5A 4AG5A 1GL9B 2ZUDA 2O8FB 2AL7A 4G1UC 2BOVA 4Q4LA 3U7EB 4GNKA 4L5BA 4UNNA 2C03A 1P60A 3ETLA 1DPFA 3BFKA 4JSTA 2FH5B 1UKEA 2GEDA 4F93B 2G9NA 5GVSA 2BVNA 2E1RA 5KSYA 3A4MA 3EASA 4CF7A 1P73A 1QHHB 2OLKA 3FPAA 3M1IA 3PFIA 4ZKEA 3EG5A 2NG1A 5C18A 2D2FA 2RKOA 3SDZA 4DKXA 1OLOA 2VRWA 4PC2A 4ACAA 2BKUA 421PA 3FYHA 2OFWA 5EE9A 3REFA 2DFLA 1MV5A 4QL3A 2ECKA 4B2PA 2CCKA 2C95A 3KUCA 4ERNA 2XZLA 4A0FA 4B35A 2O0JA 1E9AA 3CH5A 3MUFA 4D81A 2VHCA 4MRNA 1GKUB 3HP1A 3KX2A 4PC3A 3U3RA 5DSZA 1KKMA 1Z6GA 1US8A 3AGPA 3IPYA 2AX4A 1W2HA 4LK2A 4ASUD 4ZDIA 4URYR 1VHTA 2ZRKA 4XVRA 4D4KA 2F43B 4P4SB 4OI0A 5CLLA 4C0JA 3OFNA 5JEEA 3THYA 3GJ5A 4G3XA 1S96A 4NKRA 2R62A 4TYWA 1G17A 3RANA 4AC9A 1HV8A 3QPWA 3TW8B 2FPKA 2ZJZA 5FOTA 2RGXA 2ATVA 1HURA 1XJCA 3V4RA 1ZU5A 2JLRA 1G5RA 3FTQA 3K0FB 3AF1A 4ZDJA 5GADl 1OW3B 4UXHA 1HH4A 2WWWA 2ZI3A 3IHLA 2CVFA 4BLOA 5LB2A 4HLUC 1XJQA 2QN6A 2PT7A 2VP4A 5FBWB 4CW7A 3T1TA 3VX4A 3FHOA 4HAWA 3RRNA 4A6PA 4FIDA 1AQYA 1P72A 3H86A 4UJ5A 3G82C 3U60B 1ZBDA 4X8HA 3J81k 3T1QA 1P7CA 4LJ9A 1WBBA 3B82A 1QHNA 2BCGY 4RZ2A 3QF7A 5JCZA 4M1YA 4LBVA 4B33A 3EWAA 3FVQA 1TMKA 4FMCB 1S9DA 2FPMA 3IQWA 5BW8A 4Q1CA 3NDBB 4D4LA 1F2UA 2Z4RA 4EJSB 5CIQA 3UKDA 3AVPA 1W48A 3BS4A 4QFMA 1Q12A 2P2LA 1NG9A 4TMTA 3MWJA 4NE2A 2AK3A 4Q47A 5DI9A 621PA 1Z07A 3RS3A 2W2TA 3SFZA 1Q21A 1T3SA 1E94E 1DAKA 4D6PA 3BOSA 5B30A 1E96A 3B5JA 3DKPA 3QXXA 1OB2A 4CEJB 2P65A 2FFQA 4M4SA 1XEXB 1II8A 1E99A 3NBXX 3B1YA 1Q20A 4JLPA 1TX4B 1W4AA 1YZKA 3SU8A 2DB3A 5TXGA 4QRHA 4Q1BA 3P4YA 4LYAA 2OXCA 4AG6A 1R2QA 2QRZA 2W6JA 4QBIA 4AWXA 3S1AB 1V5WA 2XITA 1UFQA 2O0KA 5SZIA 5JWOA 3V9PA 2NO6A 4B44A 4DUGA 3AB3A 3FKQA 3LVQE 1OH8A 2F3RA 2J5XA 1T6NA 2CCGA 2ZU0C 3O8RA 3AH8A 1XEWY 2BHRA 4D0GA 4I99A 5KOYA 5FTJA 3HWSA 3QE0A 1NY5A 4YXWD 4LPSA 1CJKC 3HYRA 1YQTA 3AQ4A 5HCIA 2GJAA 2ZAOA 4O3MA 1IY0A 2K5UA 4LC1A 2WPDD 1YZNA 1F2TA 4PHGA 5JMTA 3C5CA 4Q18A 3GLGE 3EZ9A 3WBKA 1IM2A 4PQFA 2OG2A 5CYOA 2L0XA 1P62B 1LW7A 1SXJD 2HUPA 4DJTA 3KQHA 1E2LA 4MUBA 2WMNB 4OK5A 1II0A 4A8JC 3RYTC 2GRJA 3QPVA 2OCAA 2N46A 4XD7D 4M9ZA 3ZD7A 1VHLA 1S2MA 1I2DA 1GVNB 3GD7A 3L0PA 5AR1A 3A6PC 3KTAA 3B85A 1OXXK 1TU3A 2FX3A 4BFWA 4Z51A 1VYTA 1XD9A 4GMXA 5EXTA 2ZRIA 3IO5A 2AKYA 2IYTA 2YWGA 1W36B 3QXJA 2FEMA 4TLAA 1G8GA 4ARZA 3UATA 4JLNA 1Y63A 2G88A 2QSZA 4PX9A 2GCPA 1ZC3A 2CNWD 3VR6A 1EFHA 3A8TA 1E0KA 3CRQA 1M7BA 2ODBA 5KDLA 1DE0A 2ZIAA 1RIFA 4RVCA 3PVSA 1JJVA 3TH5A 1XMIA 1H65A 4E5UA 2Q21A 4FI3C 4C4PA 4Q1FA 1KSJA 2ZI7A 4JBYA 4PSKA 2BBOA 3GP8A 1UPTA 1NKSA 2MSCB
chains in the Genus database with same CATH superfamily
2UYQA 1K7FB 3A1CA 1ORTA 1USGA 3MJHA 3QFRA 5JD6A 1V43A 3HKBA 4G41A 3SSNA 4BNUA 1EFRD 1ND6A 1T9AA 5KKCA 5KNCH 3QHPA 4QEZA 1YZFA 2Q3FA 2SKEA 1T8PA 1AY0A 3S4YA 3GJYA 1C30A 1M3SA 4DV3B 3ZDDA 2ZYHA 3B2QA 2CV2A 5AKGA 4EG5A 1C1DA 1QH0A 4M54A 4ZT4A 4BVAA 1YB6A 5D6NA 3WKBA 3HR4A 4LXYA 3CVJA 1CUYA 2GETA 1XL1A 2VAWA 4HVAA 3RGGA 4MYCA 3B51X 3OM9A 4J0QA 1WKBA 2X41A 1JIJA 1IJFA 3GDHA 3K8OE 1OWMA 4NZ9A 1ZKDA 5CA1B 5JQGB 5C81A 2GN2A 3OF2A 2I33A 3I0MA 4XCVA 4D3XA 1IHUA 1QE5A 1G42A 1U02A 1YS2X 3DL0A 5JMPA 2M6LA 4RYLA 3IVMA 1JJ7A 3K0KA 1NJ5A 2NZWA 4B8ZA 5K8LA 1M0TA 3OZRA 1VJRA 4OHVA 2DPMA 3QE4A 1QIEA 3DTVD 3GNQA 3ZCSA 1R0RE 3GMDA 1Z38A 3CSSA 2AFHA 5ILGA 1MXFA 1BZYA 5BWLA 1NWCA 1BCRA 1MGPA 1ESMA 4JVLA 1Z6QA 3A36A 4LF4B 1YR9A 1NY6A 2NX2A 2GF9A 4KE6A 5FI0B 3K09C 1U1CA 2POQX 1H8HD 4BJHB 1W34A 5KWIA 5GONB 1C3OA 1BE1A 1I33A 1FMTA 1NVMB 2FKAA 4JBLA 3SE7A 4YMTA 1RRVA 1KQPA 1FXSA 2DAPA 2Z8XA 2AKAB 2O2EA 4I08A 1KEPA 2A5GA 2A7XA 2GJ9A 1PGQA 1QJCA 4XVHA 2YBEA 3AFOA 5EZYB 5F12A 1J24A 3RAJA 4RFLA 4A73A 1IQRA 1TUEA 1B6RA 4F71A 4PZEA 2X86A 2OVBA 1YZTA 2ZPUA 1Z4NA 2O2ZA 4W5RA 3X1XA 3W7VA 3KD3A 2QT9A 2C8JA 3EXHC 4I3FA 2EZUA 5KYTA 3IQEA 1E9RA 2WJYA 3M83A 4ARBA 3T9DA 1HTBA 1IXSB 2ZSAA 2FETA 3PUJA 3ND7A 4UXJA 4NCNA 3B13B 5SYAA 1GTL1 4PAMA 3QEMB 3SZUA 2PEZA 4DAEA 1MN6A 1BRMA 1W4LA 4ZO4A 3QXSA 3V8MA 2NYRA 2I99A 1WSWA 3KTFA 2K2QB 1QANA 1HDZA 2ZSKA 4QUGA 3DZFA 4FYIA 3CJQA 4PBRA 2BJHA 2GXSA 2TYSB 3AP1A 3ELYA 3GXOA 5DHSA 4M0PA 3PEWA 3NTUA 1EX6A 1YQEA 2IEIA 1S2DA 3KQSA 2EL9A 1EDOA 1S9HA 2WP0A 3BIWA 3WSWA 4QFCA 2H1VA 5BN4A 2JIZA 5I4CA 5K0GA 3EX7C 2NO1A 1I2AA 4W6ZA 5KMGA 5E9AA 5EJEA 1Q0SA 2IHVA 3BZBA 4Z7NB 3LE8A 6ABPA 1HEUA 4EFKA 1TM7E 3B6EA 5AW7A 5FTMA 5BQXA 2QRUA 3IAAA 4L7QA 4R2MA 2YUIA 3ADCA 1ZZGA 1ML3A 4DJEC 5HR5A 4N0DA 2IXDA 4YN3A 3RSLA 4DIBA 2P6UA 4RY2A 4CLOA 1TPZA 4BE4A 1FFHA 2ONKA 2FEWB 3D64A 4DDUA 3ZZTA 4KSCA 4L8LA 1J8VA 1C3XA 2VHQA 4B3CA 3K9QO 2R65A 7ADHA 1A82A 1M10A 2P7HA 1N7JA 5M5BA 1TO1E 1Y4SA 1ZIPA 4KIUA 5CYPA 3BL8A 2NZJA 4FDVA 3EWSA 2QL9A 4JI7B 1PK8A 4NXNB 4HNSA 4IYRA 4JVSB 3SZOA 1D2MA 2ZUUA 1RPNA 5IF9A 4LW8A 1E5VA 2H5IA 3T1HB 2W6ID 3UT5A 5CG2A 2OFXA 1NG1A 1WUJS 1SIWA 3INRA 3COZA 2J30A 4X20A 1ORIA 5IMBA 5HKAA 4ABTA 3M0EA 1TDJA 3TVDA 3UOGA 4RMIA 2ZLBA 4OQPA 5A1TA 3SEZA 4P7BA 2R8OA 1HDCA 2ZVDA 5KAPA 4LV5B 1AXEA 4KR3A 2WJHA 2ZB4A 5L7TA 1OXTA 2FE1A 1A2OA 1QYDA 3E3LA 3EWNA 3HH8A 1YCFA 4KQEA 2E4YA 2VJCA 4WKOA 5C8DA 1W5BA 1W6UA 1VRWA 2WT9A 5B1DA 3CKKA 3ZW9A 4P0QB 3HDVA 2JD2A 1OJ7A 1SCBA 2YXEA 4ID3A 1ELOA 4LRUA 4WXHA 1XOIA 3HJCA 4D41A 4EHBA 3JAWA 3ZR4B 3H7AA 5I9IA 4HC4A 5CHEA 2HJVA 2AN4A 1G3RA 3CR8A 3DP7A 2VFAA 4NCBA 3FM9A 1DIGA 4HDRA 2A3RA 3IRVA 2C3UA 3B7GA 1WPXA 4XVQA 4BZPA 3I72A 3DZDA 1UDAA 3FAZA 1R9MA 1SQ5A 4QQRA 3A1NA 3JASA 1R4ZA 4UREA 1E61A 1R7RA 1CQZA 1TQ6A 4CODB 3L7BA 2QDXA 4RQUA 4GHWA 4Y2XA 4NZPA 4EEZA 4NZOA 4P82A 3HI4A 3P9XA 2YTZA 4DVGA 4X65B 4W9MC 3D7NA 4LZOA 1T3TA 1GPKA 2BZSA 2G08A 1I1OA 4KWCA 3LYLA 4R2JA 3N75A 4RY0A 1M2EA 5JH7F 5ILOA 3I34X 3NC1C 4ASUA 1YCGA 2IV2X 2CL6X 3EW9A 4QOIA 2VVTA 3F3YA 2NXEA 4QNRA 4B87A 2YWEA 3IB6A 3I9KA 4E11A 2N47A 4HB0A 3EY9A 1NSTA 4FGKA 2FPIB 1Y7TA 3UAVA 4DT1B 2MCFA 2L19A 3LKVA 4ZT7A 4WLEA 4ZK6A 1M72A 2Z6UA 5C3UA 5KTRA 1L4LA 2HSZA 1Q2XA 1CULC 1Q7RA 4WE3A 4ZVPA 5M04A 5KTKA 3PR3A 2OXIA 2EIXA 1BDJA 2GYWA 5KC8A 2GPYA 1JSXA 3PYXA 1M2NA 2XAAA 4G63A 1WUKS 2ID4A 2KWIA 3H9BA 4JUBA 4PGMA 5CP8A 2P75A 5EXPA 1Q1AA 2QPAA 2I34A 2XZPA 5E0KB 1K27A 4FYKA 2GEBA 2WOOA 3TIXB 3WGOA 4DZRA 2IIBA 2AG8A 3PJDA 4OF4A 1D8AA 1V11A 4ZI2A 4NV1A 1NQXA 3C3BA 2J09A 4P7KA 2QRVA 3CVOA 3OHPA 5SZKB 4G4SO 5HNKA 4MS3B 1GAWA 4GZMA 1YFKA 4QYIA 3MQ2A 3WYFA 5HIIA 3RTCA 4BMPB 3E7DA 4A10A 1GYPA 4FOOA 3T3IA 3V1MA 1KJQA 3AHIA 2AXNA 3B36A 4G97A 2P1RA 3S1LA 5JZMA 1GZ4A 3QUSA 2BHTA 2QPOA 1JSLA 1RQNA 2J0VA 3KKQA 5H7XA 5SYMA 1NBIA 3PKJA 1ADCA 5IEJA 3IKMB 3LBFA 4FGLA 4O4LB 3T52A 3WZLA 2W0SA 1SKAA 5BSTA 4IJMA 3GUYA 3N2GA 3AJ8A 3WRYA 1NR1A 2Z0MA 3MA0A 1ZNYA 4UOEA 5B64A 3O2QB 1I4DD 5FHRA 2BMDA 4JY7A 1WL8A 2J6IA 3SICE 2XKJE 2V96A 3A6FA 2DPXA 4ITVA 3VNRA 5ICMA 4GBMA 3CO0S 1LB1B 2WWFA 4O4JB 4DCOA 4EI2A 2B98A 3HL4A 3L46A 3DGEC 3O8BA 3ZYCA 1FYDA 4EPVA 2CXUA 4Q6WA 3IIEA 4YECA 2A1UB 3VVBA 4B76A 5KDOA 2B7CA 5C2JB 3H4IA 3KVVA 1K9SA 4DJ5X 3NTRA 1WRBA 1ZMTA 2RHBA 3KQMA 3P9SA 4LJ4A 3THWB 4X1YA 4BB9A 1V3TA 4F91B 3P0RA 1HT2E 1T0BA 1JFFB 4NJMA 3F9IA 4ZAZA 2YJGA 2Z8YA 4TL7A 4JVNA 1JIVA 1DXYA 1F2VA 3OOEA 1WZEA 2GLUA 5CCBA 2RGNA 3HZOA 3IUPA 3PQ8A 4HDQB 4KW7A 3A7EA 3GP5A 2FI1A 2OFFA 3K30A 3TG8A 4CRWB 3HSKA 3ETHA 4FKBA 4PBSA 2PZJA 3IOBA 1EPUA 5KREA 1E0AA 1HZJA 2KBFA 2X7JA 2VT7A 3Q7QA 4WLNA 5D01A 5FO1A 1XTRA 4RSHA 4DMKA 4V3BA 1S1MA 4DG8A 4NYMR 5CVJA 4B3RB 1Y9DA 3CE6A 4MAFA 3DM5A 3PQ5A 5DP1A 1X38A 1OREA 3DBHB 3F5QA 1RAGA 4TV8B 1UFVA 4R41A 2OLEA 3ZCUA 1MBZA 1RRMA 4RNCA 4L9SA 4H1HA 3WKAA 3T3HA 2Q3JA 2CFSA 4J9UE 3B20A 4JHLA 4C7OA 3LK6A 2EJBA 4FHEA 3R7AA 4QO7A 4TTPA 3RC9A 3S2IA 3W34A 5FWXA 4KITB 3IRUA 3DB2A 3PXCX 4HQOA 4MUEA 3W9YA 4ZZ3A 3HNOA 1SUAA 4GMFA 4MCHA 3T41A 3FOCA 4IZIA 4Q00A 3PXXA 2H2HA 1MXHA 4Q4HA 3VDNB 2B8TA 3Q2IA 4C05A 4OV6B 3AUJB 1KH3A 2GUGA 4XSHA 2X5JO 3NHZA 1OKKD 3FYUA 1NW4A 1QRDA 1FNSA 5K0ZA 1WXEA 1D6JA 4YDSA 2HO4A 4X60A 5IX8A 4RTPA 1CF9A 1W0CA 5DHAA 1COWD 1TFRA 1BROA 4JOCA 5ULLA 2GTPA 3P2MA 1F4LA 2ZIZA 3O2NA 2A33A 1XQYA 2GCIA 3HGTA 3MOIA 4R7GA 4I55B 4ZEVA 2WPNA 3LY7A 3TECE 4IX1A 4W82A 2R68A 3TJZA 1V1RA 1X80A 4RPHA 1QZZA 3I9V1 5E2IA 3VJMA 1X1CA 4BNNA 3TQSA 2H4XA 3SF8B 1VIAA 4LY0A 2VO1A 1ZBQA 1OAAA 3QWHA 4DB2A 3IDQA 3MBOA 2PWPA 4YMWA 1Z5NA 4PXYA 1VFPA 5FFFA 4NATA 1MAVA 3PPYA 3UJAA 1U2RA 3QNMA 1M2KA 3VSEA 2QG6A 3NEAA 5IAOA 5E9QA 4E5MA 1UJ4A 4ISBA 4CHTA 2IEYA 4DABA 2DLDA 2F8LA 2TMDA 3PXUA 2NO5A 3AI2A 4YCAA 1VJDA 1QH1B 4IBOA 3GRRA 4XB2A 4EP1A 4YAFA 2VHZA 1C29B 2ZSUA 1IHOA 5A9RA 2EWVA 3VO8A 2RIRA 3CBGA 3T9BA 1RLOA 3CFYA 3V8QA 3C15C 1H0HA 1XROA 1EH5A 3L6DA 4PSVA 3TTTA 2IY8A 3ABQB 2P3LA 4UCFA 3A10A 4KQ9A 3V42A 4DEVA 1THTA 4BQNA 1P1RA 1XYYA 1ENYA 1OMOA 2IPXA 4WDRA 3TQFA 1R50A 3HLKA 1XZDA 1QAMA 1NNEA 4KXMA 1U2PA 4XQGA 4EYQA 5K0NA 5KQGA 3JYOA 3QMMA 3ELUA 2NQTA 3JWJA 1GPJA 4CKWB 2ET6A 3KEQA 1FU4A 3THYB 1FBTA 1GO2A 2H4WA 3VGJA 2PUAA 3IBFA 4CMKA 1GDDA 3O1HB 4AXXA 2ZSJA 4XYEA 1W8DA 4EY5A 1X70A 2XMZA 1M74A 3A1SA 2JG3A 5D3ZA 3THOA 1NJGA 1TNDA 5IW8A 1PCXA 3GUZA 1EVKA 3VHRA 2RKBA 5LJLA 3NMUF 1Q0RA 1QG0A 4KFRA 2V3CC 4DWJA 2ZRLA 3I4LA 3O9VA 3DOOA 1R15A 2CZQA 1OWLA 4QBGB 4A7PA 1VM6A 2WM8A 1JQAA 4RANA 3I04M 2AD5A 4JQZA 4CPDA 1VPWA 3VFDA 3TKAA 2WJGA 1RWNA 2WYIA 1RPAA 4W5TA 1EK0A 1H8HA 2OLJA 1YS9A 3CPJB 1REQA 2OBBA 1ZUHA 5HKLA 4F96A 3AUAA 1YCDA 2HREA 2ZT8A 4U2DA 4WBXC 2A35A 1PSZA 4US0R 1UK8A 3EG9B 4IQ8A 5F3DA 4FCWA 4KPFC 1OIXA 3R3XA 4BASA 4EB3A 4CMGA 4PNEA 1M6YA 1UIRA 3HDQA 4MIYA 4DMUB 1KH2A 2XB4A 1G9XA 3TSAA 1GPDG 2R25B 4BMVA 4YV0A 2LRHA 1RYMA 4TMZA 4I4NA 2QUHA 4UDOA 3FPKA 3HMKA 3DT8A 4ON9A 1MJHA 4H7EA 5K03A 3S8EA 5FXMA 3HCCA 1XMPA 1Q3TA 1S2IA 3DQZA 2VJBA 1Z4QA 3HP4A 1AC5A 4PICA 2EYQA 3VR4H 1D09A 4RZHA 4B4DA 1CY0A 2RAUA 4Z1OA 1P5FA 3DE4X 1SPXA 4LJSA 3NKLA 2G40A 1EA5A 1RI2A 2ZTUA 4G24A 3WQQA 4CG1A 5LQUA 4U2GA 3ELDA 3CONA 1X7YA 3WDKA 1UP7A 2XXBA 4BQEA 1KKLA 5DYNA 5I8ZA 4R1UA 3T3NA 2ZRMA 3FMPB 4N3NA 3ZE1B 4BVFA 3VKGA 2R5NA 1WXHA 2GYVA 1WB5A 4R1QA 3QPUA 3IULA 4C6RA 5I9NA 1CJCA 1JMKC 2J9XB 1RYDA 2VDLB 3E22B 4BLPA 4PWZA 4CM4B 2QSJA 3EBPA 4N41A 5AI8A 3KB1A 2HK9A 4BXOA 1GPH1 1X92A 2ES4A 4KOEC 7AT1A 3A31A 3QUTA 4H7KA 4A8HA 5BY2A 4OFBA 4PYQA 5I8WA 4I6EA 2JFYA 3ZBUA 2V55B 3OZSA 5FUXA 1CUSA 1T9KA 3LW8A 1V9CA 3O47A 1RRCA 1EU1A 3UNXA 1TAGA 3FDZB 3IVRA 3QVTA 4MRPA 3RV3A 4IDEA 1AHIA 4QGSA 4MWTA 3CVXA 2PKYX 4C14A 4NU0A 4OL9A 2IHUA 1QPZA 3P2YA 4OUKX 5ALOA 4ND1A 3NNSA 2LW7A 1K5GA 4NZMA 5H1YA 5A02A 1YMVA 1CUZA 2JBWA 4HDAA 5IUKC 2I66A 2FJUA 2IGTA 1NVVR 3TL2A 5IT5A 4BAZA 2EJUA 2D6FA 3UWOA 5HKKD 5CVEA 1K8RA 2UU9B 4LXQA 3RAPR 4RO0A 1SIBE 4BKMA 5KHLB 3H11B 3G0DA 2WYWA 3WK6A 3BXEA 3L92A 2OCPA 1F4PA 1Z4JA 4B3IA 3HO1A 5G41A 2W6IA 3DHEA 3CLTC 4GSKA 2BM8A 1F6WA 2CC2A 2ZYTX 4RD1A 1SNYA 1M8JA 3COPA 3FVWA 2GB4A 3W06A 4GPZA 3I2KA 4M49A 4HRXA 2OUIA 4ZCPA 2PL9A 2X8JA 3SYRA 1A8IA 2X0KA 3WB0A 2ZDGA 2WHPB 1C50A 1ZMOA 2DUJA 1JLLA 2Z83A 4YJ3B 4JA0A 4BBZA 3U26A 4Z9YA 4DNOA 2PS0A 1EI9A 3B78A 2FFJA 3OPYB 1T4CB 1XU9A 4G5GA 2DQSA 3OETA 3S3TA 3U0VA 1R8YA 1YF3A 1X8KA 1TQDA 3DD1A 4UULA 3F7OA 4P3OA 4R98A 1Y5NA 3K6KA 1CE8A 3AESB 4FP9A 3CLSD 4PTZA 4KQCA 4BOYA 2FMHA 2P9QA 3OOHA 4CKEA 2HL6A 3TCKA 2Q0HA 5B12A 4MV5A 4AZ3A 4TLCA 4EI9A 1S2GA 3TE6A 4BQIA 4PQGA 3ZXIA 4UTRA 2BBTA 4N65A 2C2BA 1WCXA 4NS4A 4TSKA 1YASA 5AM1A 4A0GA 3IAS6 5FF9A 4ZJZA 2VH2A 3GLSA 4DCPA 3OWXA 3HKBB 3NTOA 4L3WA 2HA0A 4NOMA 4KDCA 3I32A 1C30B 3BA6A 3H1BA 4ZQFA 1SG6A 2BP7A 3ITKA 5H81A 5IZ4A 4DR6B 1D9XA 1C1DB 3ZOKA 5DYYA 1RYFA 3ZH9B 1E32A 3A9TA 1Z2CA 2GEUA 1R66A 1NSYA 3MS4A 5MN6A 4LV6A 3RRXA 1GPLA 1DC7A 1NV9A 1ODTC 2VNHA 1KMHA 4OPMA 4WZBE 5K6AA 4I4LA 4ZZ0A 5KWEA 4H6WA 5ESRA 1EGVB 2AR9A 4CM9D 2WY2D 3JATA 3BMQA 1D1SA 2HUNA 3COWA 4ZT2A 1YS6A 1PUIA 3UUFA 4NMLA 3KALA 4JLAA 1BKSB 3M3HA 4C0LA 5BRJA 2VPIA 3ADDA 1K63A 2A0UA 3OU2A 1R0XA 3JCZA 1J2EA 4YPVA 3UWDA 1ISRA 3NV9A 4J0IA 3IEVA 4KX5A 3X2FA 4XGIA 3MMSA 4DN6A 1TC2A 1Z45A 2P2DA 3K71B 2IT1A 3D3KA 4P5DA 2AFHB 4DJJA 3WISA 2IW3A 3D6VA 4UATA 4CEHA 4L8VA 1BCRB 4Z0PA 3G49A 4IVPA 3V55A 2FQWA 4M0CA 1GGHA 4G0NA 2XXJA 4PG4A 1LDNA 3OEHD 3RLIA 2MOKA 2B99A 2MSWA 2YY5A 4HN9A 5FEUA 4X64B 3I9LA 1RCTE 2NNWB 3OZFA 3RRJA 4EFLA 4CTMA 1C3OB 3FXAA 3IMCA 4BO9A 1DAHA 3I83A 4CG2A 1NVDA 1C7JA 1C9KA 2B34A 5FFMA 5HJ5A 4L2IA 1V8BA 3KKLA 3PHLA 2IDZA 4PYJA 3W3ZB 4N5LA 2X0FA 2YR0A 3U3XA 2YNMD 4E94A 1NJ1A 4G2TA 1BDBA 1DRKA 2X8AA 3F6EX 2GBLC 2C96A 5AKLA 3NRJA 5EVCA 1E69A 3EVZA 3ASYA 4WY5A 2H2IA 2B8NA 3MTQA 3WK4A 3BHMA 3ZJVA 2C5FA 1E9SA 1KI3A 2WSBA 1JTFA 2H3EA 5ER6A 4BZWA 1OFTA 1XL0A 1E2FA 2ZIGA 4WGFA 4Q01A 1HE5A 2H65A 5DX0A 1KDVA 3RC3A 3FDJA 2AE2A 1AK2A 3BSYA 5ERXA 4BKRA 5AVZA 2DX7A 2ZI6A 3NJ8A 1CIPA 1L8XA 4A36A 4DV7B 3AR4A 1DDGA 2OFPA 4AY2A 1H6CA 3SM3A 4D9CA 5LDDC 3TTSA 3D81A 1L8LA 1OY1A 2EIHA 1G7CA 1XFDA 2EG5A 2OGZA 3EF0A 3I5AA 2CVPA 1FYXA 1N57A 3FTDA 3NH6A 1EQAA 3QHQA 5L7WA 2YWXA 2WTUA 1T3LA 4G5QA 2LV8A 1BMDA 1X9IA 2IGBA 2VTVA 1DWUA 2AOXA 2BLLA 3R0QA 4OOEA 5BV8A 2C8KA 5ITWA 4M0DA 5KMGB 2CXPA 2AHOA 3RFXA 4E51A 1VBFA 3N7AA 5H0IA 1G20A 1TECE 3KWMA 3LV8A 4NR0A 5CCEA 1E6CA 2R6FA 3D5EA 5JU6A 2JFXA 4IUCS 4WVLA 3R8XA 1UMCA 1AHHA 1XVTA 1HYEA 1VTKA 1P0PA 2BEKA 3C5WP 3MB8A 3NIFB 5H4HA 3UV7A 4CLOB 4D9FA 4QGAA 1VL8A 2OHVA 4IIXA 1JEOA 2ZQYA 4P92A 1CUGA 2NSJA 2XDQA 2PH5A 5H4GA 2EFEB 2O2DA 2V0CA 3GLHA 2H0AA 3T0IA 4I50A 5I9TA 5JDCA 4RETA 2M32A 3PU6A 3QA3E 4BGEA 2WWTA 5CVTA 1SHKA 2EP5A 1OKKA 3KYJB 1PT5A 2X2FA 2WF7A 3X3HA 3EXEA 1SVOA 1PZEA 1COWA 5A2GA 2WDZA 4JU8A 1IE3A 3TJMA 3UT5B 7MDHA 1U8XX 1BMFD 4AO6A 2PGNA 4MGHA 3LOUA 4X20B 4GOKA 3PJGA 4G9GA 2HF9A 3F8TA 3WXMA 4M9CA 5GZ6A 4Z5XA 1O58A 2EJCA 5TJHA 2O1XA 3V7NA 1M83A 2JRLA 4YP5A 4LJRA 3R40A 5FNZA 4BN5A 1Z8HA 1KXZA 4HPWA 2G4CA 3KV1A 3MFYA 1SQFA 221PA 3WZ2A 3VPCA 1ORRA 3GNLA 4XYMA 3DAFA 4F38A 3LG2A 1X7DA 1OI3A 4UTOA 4ZAWA 4C4YA 5LFAA 5H68A 1WDMA 2PKQO 3RS9A 5MN4A 3SWWA 2QMYA 1D2CA 3D8TA 5HS4A 3P9IA 4OHMA 3M3DA 3OIYA 2NP7A 1G6OA 1T1SA 2D3TA 2DWOA 4PYLA 4OJYA 4HDRB 4UUPA 2H2AA 3L06A 4RFSA 4TKUA 1DX9A 1O4WA 1SXJC 1R10A 3HWWA 3IALA 3JASB 3SEFA 5SZJA 3CNNA 4NQRA 4PN3A 5JTTA 4QWWA 5IDQA 4EO9A 1P6QA 5EZSA 3GLUA 4NESA 3V33A 4FGJA 2UV8A 2HX1A 3T3MB 5HFNA 4RF4A 3WNDA 3REQA 1NF2A 3RCBA 1ZL0A 4P3KA 4UAJA 4U1RA 5CXQA 1K08A 1B8VA 1TK9A 5DHUA 2FLVA 5C5EA 2O6LA 3LDFA 2IYRA 3PFCA 1HBJA 1T29A 1UT5A 2CZCA 3TZ6A 1UXGA 4PHCA 1UBOS 1FLDA 2QV0A 3QVWA 3NYQA 3PNVA 1L1RA 3MBKA 3QVUA 4N3CA 4PAOA 4Y30A 2XQJA 1L1FA 3A3KA 2C2HA 2OV1A 1I7DA 1YU9A 4OXKA 3TK1A 4FNMA 4HNQA 3FFXA 1C7QA 3TMYA 1VL0A 5C52B 1VLQA 2P0YA 1QIIA 2VJYA 2IHJA 1ZVQA 1FS6A 1PV1A 1I4OA 1N5LA 1OVMA 2JCSA 2Q5HA 1E7WA 3MM4A 4NNPA 2BR5A 2DM6A 5AQEA 1JVNA 2ODQA 4V03A 3B12A 5EJ2A 2ZRGA 3IL2A 1BCSA 4IIVA 5E2AA 1QHSA 1CDOA 4DR3B 3H2BA 2UUBB 5K51A 1HL3A 1BWPA 4HUQA 3HE3A 4BE7B 1V11B 5IXYA 1DINA 1N5OX 4NDZA 3J7AC 2FYTA 3QVSA 1NVTA 1TUIA 2QRVB 4PLHA 3SN6A 2AK2A 1ACJA 5DCUA 1H2ZA 2RD2A 3VKHA 1EWTA 1L4YA 5ENDA 4D8VA 3OU6A 4QYIB 3MHTA 5DDIP 1MQSA 1R8XA 2P9ZA 4CMIA 2HLNA 1CVRA 2HNAA 4R68A 2QUIA 3FZNA 4R2XA 5ICGA 4L0QA 2R44A 2VXCA 3A9VA 1T15A 1HMPA 4I4IA 3SVZA 1EE9A 3DT6A 3VVLA 4EFMA 8AT1A 2ZTSA 3KVOA 5D85A 4RHFA 3GQVA 2CYAA 3D8SA 3PUYA 4CUJA 5FOSA 2VYFA 4YMHA 4CNQA 2GM5A 3QENA 1RJGA 3PT5A 5JJKA 4ESVA 1DO2A 1U0TA 3N2GB 1QV7A 3K0EA 4I7EA 5JANA 1YRHA 2X2OA 1MA3A 3TNFA 1UAAA 1UPCA 3FMOB 3N05A 3I04A 3UT6A 3IUNA 3WB9A 4RIGA 5BQ3A 2G0AA 2PQ2A 5FLYA 1PL8A 4XRGA 2JAPA 3HRKA 2AZDA 1XVVA 3H8JA 1RP7A 1Z7EA 1DKLA 4IW3B 4PLWA 5C7YA 1MPTA 3R44A 3COVA 4O0LA 5CB4F 3WJAA 3NOOA 2IH4A 1A71A 3PNYA 5AJXA 5NULA 1L1EA 4RIIA 1QLHA 1Y6QA 5K0EA 1JN0A 1CYEA 2XUQA 1RVDA 4TQ9A 1NRXA 3NONA 2OZLA 4HRAA 1JHYA 4NJMB 1IMOA 1L7EA 1YIDA 3H1AA 4JBWA 3BBPA 3VR0A 3AF6A 3V8VA 1JWLA 2AHRA 3BWCA 3KB6A 3PE6A 3CVUA 1KAQA 4P4LA 2WM3A 3FKSD 4WOKA 5DHFA 3OKPA 2EVWX 2IDJA 5EJ8A 1P91A 2VP6A 3URMA 3AUFA 2ZZNA 4RPJA 4PSDA 1DTEA 3MWEA 3QEKA 3BWEA 3SC4A 4ENUA 3WJ7A 1JS1X 2PJUA 3EGOA 3AF3A 1XPUA 2V4UA 2E18A 3L7OA 4L4UA 3ZV6A 5CLIA 3H9UA 3UMVA 5ICEA 4RM3A 3UMRA 2JANA 3E8MA 4D45A 4RF2A 1E1YA 4Z7QB 4KB5A 3TSCA 2GBIA 3RB8A 3ZBPA 2NT4A 1TF5A 1NW9B 1TM5E 3ENZA 4YT4A 4C7OB 4LC9A 2ZSDA 2EAUA 3NQ41 2Y1LA 4M8KA 3BB3A 4MUHA 5IM5A 5HKKA 4HL6A 4P4GA 5EJ7A 3TGPA 5DNEA 2JJ8A 3P45A 4JP1A 4W7IA 1NMSA 4LF8B 5HW0A 4G9BA 4Q4HB 1K6XA 3FKJA 1QVVA 3C3EA 1YVRA 4Q4AA 2DT8A 1EDDA 5A4DA 4QUKA 1M34A 1XLVA 3K31A 2GZSA 2WKWA 1FDWA 3FYUB 3OT4A 4FFPA 4INZA 3K3PA 1L5WA 3FCXA 4PCVA 5EIBD 2G76A 2AXPA 1EUYA 5CK4A 2Y99A 5C46F 5EQFA 5F2NA 4GGMX 1J7KA 3BGDA 1IBKB 3H04A 2JIQA 2YV3A 1DLIA 2L42A 2O7SA 1J00A 1SKMA 4MQ6A 2YXNA 2OMKA 3B9QA 2EWMA 3HADA 2ECFA 4P34A 4PGFA 4BQRA 1NVAA 3H1TA 4F0JA 1YRWA 1V1RB 1LK0A 1TJ3A 1X80B 2HMTA 2HZ7A 3L07A 4BFTA 3VAZA 1T0IA 1XKQA 3BGOS 3HDYA 4OBBA 2B1JA 4QUBA 1U7DA 2VSNA 1MABA 1QGOA 2AJTA 2J46A 4E14A 4IDQA 2A57A 1OH7A 2PYIA 5FQNA 3LL4A 1K75A 4R9UC 1XEWX 4MVJI 1UINA 5HS6A 1WU8A 3ZJTA 2D5IA 2R2AA 2YQ4A 4LZJA 2XZOA 1PFYA 2FJPA 4D6YA 2IKQA 3AKDA 1Z4KA 1ISJA 1R00A 2ZROA 1LF5A 4UHDA 1DCTA 2NOAA 3A0UA 2NZUG 1U0EA 4RKFA 2VP0A 2GZHA 4QOHA 1KDOA 4URZR 1Y37A 3UWKA 2D59A 1DJMA 4X6YA 4UFNA 3I1YA 4EUHA 1G60A 5KKNB 2JCYA 3PFWO 1CR1A 1JG7A 4JT4A 3SDBA 1T36A 5JXJA 2JC3A 1RWBA 1B8OA 1EFTA 2IBMA 3GEEA 4GRAA 3K9HA 4IOLA 5TB5A 4PPFA 4OYYA 1QFMA 3UICA 1A1SA 4P0TA 3V4FA 4I1VA 4QOGA 2IU6A 1G59A 2QAGA 3OC6A 5ARCA 3BILA 1C9JA 1E58A 3BBLA 3INYA 2MT9A 4O2AA 3ZIAD 3CZAA 2OQ2A 4C20A 3FWYA 2GAFA 4DLPA 3LKDA 4YY3B 4MVCA 2JH3A 3RF6A 2J48A 3ZS9A 4TX1A 3BTUA 1T4BA 5LOVF 2HA6A 4ENWA 2IODA 2V45A 4V0RA 3ZDZB 2J85A 4FB5A 1RXEA 3P9RA 1CSEE 4XYBA 1KPGA 2YMMA 3QFSA 2GR9A 4EZEA 1PS9A 1Y6RA 3IXMA 1XV5A 4FQ5A 1NLZA 1J21A 1PP4A 3A37A 3CQ9A 4TM8A 3K4QA 3R20A 2UZ3A 1EGMB 1LC0A 2GD6A 3R7WA 5ICSA 2CL0X 1LY1A 3LF2A 4YRLA 3UIEA 4OFXA 5LP6A 4P0PB 3LX6A 5E7MA 3OZCA 3ZKWA 2IYAA 3QNUA 3GWZA 4OP2A 5NLLA 5LXTF 3D2LA 4L5IA 1QP0A 3OEHA 4K6HA 3UUWA 3N53A 3FLAA 5D51S 4B0OA 1DC8A 3QF4A 4LPKA 1REQB 5AMXA 3C45A 3SHVA 1GGJA 4IIBA 1YQXA 3LC1O 4IDDA 4Y1GA 5CJ2A 4X62B 5T6MA 2AEEA 1RHJA 2QTLA 2B78A 2FCAA 4FMBB 3T3EA 2ROQA 4R84A 1U0BB 2FR1A 2YNMA 5B4VA 2J4FA 3E0XA 2OHHA 1JLRA 2G36A 3H8SA 3T7CA 2H07A 4KPEC 1UBHS 1UWKA 2EARA 4L6CA 1N9ZA 3D5TA 1LBTA 1Q7GA 1ECBA 1J2JA 3E7FA 1QPGA 5GM1A 3TDMA 2H1LA 2WU0A 2C9ZA 2OBNA 1DG3A 2KJQA 2JAUA 3H9EO 4DLLA 4P9NA 1JWBB 1ZONA 3DDHA 4B3TB 1AUVA 1SBCA 1AMNA 3DWIA 5KQRA 2XMCA 4C88A 4A23A 5DN6D 5A7HA 1Z33A 2DBVO 1M2OA 3GFGA 3STHA 1WR8A 3D9QX 3W2IA 2ZVQX 4US2R 1P0MA 5EA2A 2Q9CA 2VH5R 3OQJA 4ABYA 1UJ2A 4DSZA 3ZNPA 5DN9A 2G1KA 1QR2A 2PUHA 3M6MD 4D3DA 1C7ZA 2C31A 5TY0A 3KKNA 2GCOA 3ID6C 4HGZA 2WD7A 2DPHA 3LUKA 3GAZA 4RH3A 4Y0VA 4M36A 1P3JA 1LCIA 4E1BA 4BXOB 2OE2A 1E4OA 3ANYB 1J9EA 2C2XA 3DZCA 4IAOA 1I0ZA 1NVUQ 1GN9A 2OGWA 3TIFA 4UC0A 4DLVA 3K8ZA 1M5UA 2JGEA 4OMUA 2IHZA 5B2ZA 2AC2A 4JB2A 3IGFA 4QPPA 4BC0A 4YEDA 1GXSB 1UC4B 4R1SA 2HSEA 2GF2A 2XIQA 3GLRA 1YFZA 3TPZA 5J2UF 2OD9A 4AICA 3M2TA 2WZBA 1G3UA 2JJ1A 1KMCA 3OZIA 3A6HA 3M70A 3ORSA 4R8KA 5DNAA 3HJAA 4RTOA 4X54A 2G9QA 3OPXA 2FXIA 3VUEA 1S0UA 1TVEA 4YALA 5KI6A 1N7GA 4Q19A 4LJ6A 2XTMA 1SXJE 3T15A 3VSAA 2VF8A 4S2EA 2AZXA 4L51A 2BKEA 3SXUA 2AFRA 2V6BA 2RGRA 1BMFA 4NY1A 3TOCA 1GM5A 1R0BA 5KNDH 3LPDA 1NPYA 4IO0A 5FL7A 3ZV3A 5KX5A 3GQBA 3N0VA 2ACKA 4H59A 1FSSA 2X8JB 4O2LA 4OLHA 3AIKA 4CKBA 2Z2YA 1WB9A 2W48A 2EFDB 2D06A 2B1QA 1B8NA 4GH5A 1JLLB 4HAXA 2JGFA 3KG2A 4C5BA 5COQA 1PL0A 3EEBA 1U1EA 1OWOA 4CN9A 2GQ0A 2P5TB 3STXA 2GEFA 2V54A 4M89A 1BN7A 4MV3A 3O8LA 3JQCA 5ANRB 4ES6A 1Y8CA 3PRJA 1CE8B 3N0RA 4D8TA 2R7LA 4V3CA 2NU8B 4CKEB 3FETA 1MC1A 5TV2A 3EVEA 1J7JA 3CB4A 2WG0A 4C78A 1NRWA 2IYQA 2KLBA 3I39X 3P27A 2Y9PB 4PR3A 3VZQA 3S70A 4EG6A 4BV9A 4CQLA 1NZJA 4RQBA 4LY9A 3EGCA 4HH0A 2JGNA 3U3MA 1KO7A 4BAUA 4ETNA 2WQ6A 1Y5RA 5IN5A 1U3DA 2WF6A 1G5HA 5GIPE 1DUSA 1UKYA 4CKZA 3KZXA 2BP7B 1P3Y1 4PAQA 3I01A 1AA6A 3DDSA 4H16A 3HN7A 3OIWA 3QLVC 2D5CA 2QQEA 1EVJA 3I52A 5B2FA 5I6DA 4L08A 4YDHB 4QVGA 3O1LA 4ROTA 1KMHB 4A6XA 2VJAA 4DQUA 4ODIA 1ETHA 3QU7A 1JYEA 4BO0A 3Q15C 1E1NA 3JATB 3BMQB 4KAFA 1IONA 1U0SY 2KQUA 3SYTA 3W77A 1Q0UA 4TRJA 1N92A 4NZNA 5E6RA 2PTHA 3U4DA 1FP6A 2RBKA 3B1VA 3I9MA 2VYVD 2GK3A 2RGAA 3CH4B 4M87A 3PHIA 4M1SA 3PIRA 1HC7A 2PBLA 3L1VA 3R6LA 2Z04A 3NIGB 3TTYA 2OHFA 4UZEA 4PFSA 1K9VF 3QKIA 4TZTA 1WAMA 2XDAA 4J7AA 2WLTA 4GS5A 4IDGA 4MQEB 4CEHB 2AI3A 1EWVA 2WA1A 2JK0A 1O4VA 3TR0A 2VBGA 3R4CA 3HDHA 3HM9A 1R5NA 1SH7A 4UTZA 4EAAA 1ZD2P 2Z57A 4FUQA 1Z37A 4FDAA 1FUKA 4JBIA 5EZ6B 4ZMBA 2CDCA 5K4AA 3RAFC 1GTSA 2C7GA 4N0EA 2I4MA 3Q72A 3QITA 2JLXA 3AVUA 3BD7A 1HQYE 2H18A 1K6EA 2NU6A 3QJ5A 4L2IB 5FOXA 4HAVA 3U7QA 2J5RA 2QLMA 2YWRA 1YFJA