3BB3A

Crystal structure of toc33 from arabidopsis thaliana in complex with gdp and mg2+
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
242
Chain Sequence
EWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQVVRVSPFGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSDSLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDVATNQRKAIHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords T7I23.11 protein
publication title The GTPase cycle of the chloroplast import receptors Toc33/Toc34: implications from monomeric and dimeric structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 76
structure length 242
sequence length 245
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bb3A00
5DIFA 4ZV4A 4HLQB 4M4SA 1MABB 3EXAA 4LJ7A 4QFMA 2RB4A 2IHBA 2C9CA 2QPTA 3I5XA 1TQ4A 1XXHA 4FMCF 4Z54A 4HDQB 4EDHA 2WSSA 3I8XA 1Y63A 4KAXA 3THWB 3QKRB 3PEVA 3BC1A 1XJ0A 2WWYA 4AWXA 1ZYUA 3SFVA 1ZVQA 2OEPA 3OE7A 4TMTA 2PCJA 3QF4A 4QBHA 4EJSA 4FIDA 2J0UB 3C41J 2DWQA 2VPPA 3PUXA 4OKSA 4B43A 1Z0DA 3THYA 2OHFA 2ZJYA 2WIAA 5KU1A 3REGA 4KV9A 1CRQA 2QMHA 5J47A 2VSOA 2RGBA 4FWIB 1OXXK 1QHHA 3CB4A 4BASA 1U8YA 2I1VB 4XWAA 4BZPA 2OCAA 3BORA 4HAYA 3W3ZB 3AV0B 5FBWB 1H8EA 4MGZR 3OF5A 2FV8A 2H57A 5AJWA 5EP2A 4Z1MD 2NO7A 2BCJQ 4AKEA 1WA5A 4BLOA 3KKPA 3RRYA 4TWZA 4DCTA 4X8HA 4QXAA 2RGEA 4LJYA 3U44B 3WMGA 2YWEA 1W4AA 2P65A 3C4JA 3C5CA 4NZYA 4R2IA 3TVDA 2D74A 5CJ2A 1NSTA 3KQNA 4QM7A 3LO5A 4C0JA 2G0TA 1KO1A 1EFRA 2QE7A 3L2OB 4GP6A 1RRCA 2R62A 4ZIRB 2QG6A 2J9RA 2DFNA 2HJGA 3K09C 3I1FA 1UKYA 1VCMA 4DCNA 2JJ1A 5E7IA 2QP3A 2PT5A 1OKKD 4XVUA 2QM7A 1IN7A 1O3YA 2JJ2D 3QKUA 2K5UA 4HDOB 3LVRE 4Q1AA 2IXGA 3AUYA 3KXLA 2ZUDA 2F1HA 3C16C 4QHYA 4EFNA 2AN9A 2ZS7A 4LYJA 4ZDKA 3MCAA 3PQCA 4JKYA 3GJ8A 1OXUA 3AVVA 4JYCA 4OI2A 3IKJA 1Z28A 2ZSEA 1IN6A 1BS1A 1UF9A 1M2OB 3OFNA 3LQRA 4GOKA 2QNRA 1E1QD 3AF1A 1R0YA 2OXCA 2OESA 4LYFA 4A82A 3SR0A 1FQKA 1OB5A 3RLFA 4G3XA 5LB2A 5JBQA 3U61B 3ZLJA 5FBVB 4TTRA 2OO7A 3ND9A 1Q1ZA 1TQDA 5D3MA 2W2VA 4WXPA 1QHNA 3I73A 4L8GA 4NCHA 4WXRA 1DTSA 1V5WA 2RH5A 1IONA 5TVKA 3FKQA 2F6RA 2FNAA 1JJVA 5FBQB 1XTSA 1KMHB 3GD7A 1IN5A 5IF9A 5KTYA 1W36D 2QAGA 2D06A 2EYUA 3SFZA 3B2EA 1SKQA 3VX4A 4DC9A 4PPFA 4TYWA 2BKEA 1P73A 1CEEA 1QG2A 4LC1A 2B92A 4HB0A 2O8DB 3FFBA 1Z0KA 1Z3IX 2BDTA 1GTVA 4PXAA 4XD7D 4AYWA 5KSZA 3EPLA 2Z0MA 4EQ6A 4CT5A 2R65A 5FL3A 1HH4A 1GNQA 5CYOA 4WZAE 2Z5FA 2OT3B 5AJVB 1QRAA 2ZI4A 4I81A 2W6JD 1D2EA 3QEOA 2GJSA 1SXJC 2G0NA 3AVOA 3AF4A 1KNQA 2C5LA 4Z51A 4PZZA 3ZIAA 3QIAA 3CNLA 4FMBB 1UDWA 1Z5ZA 3EA5A 3NHAA 3FTQA 4IXNA 2WVJA 4JLBA 8OHMA 1YVDA 3P32A 4HAVA 2O8EA 1KI7A 1ESMA 3H4MA 4C0KA 4BLSA 1GNRA 5L3SB 1ZNYA 4C0HA 5KHOC 2ZM5A 4IDNA 3U4QB 5EXPA 3AF3A 3OEHD 3GFOA 3ZVMA 1XD8A 1HV8A 1E2NA 3NBXX 4AG5A 2GDJA 3JVVA 4CVNA 3NBYC 4OHZA 1GDDA 1LW7A 3BGWA 1VECA 1ZMXA 2ORIA 1KO8A 4L9SA 5LD2B 2A2ZA 2WWFA 3LNCA 2BWJA 4URXR 2ZITA 3GJXC 4X8LA 1DAGA 1FP7A 1OIVA 2IUSA 4AI6A 4N0EA 2RMKA 2ZJ2A 1S96A 2OM2A 3G0HA 4M9QA 1OW3B 5L3RA 2ATXA 5FUVA 1EG7A 2VTKA 4BZXA 2XGJA 1TF2A 4TQAA 3BH6A 4HLCA 5DH9A 3PUWA 4RD0A 4AD8A 4HSEA 4US1R 4KCGA 3QKSB 421PA 5GJBA 2ZRGA 1KK0A 1Z07A 1E79D 2BBOA 4CT4B 4C2TA 5JWHA 2CL0X 2WSMA 1AIPA 3B1XA 1BO6A 4G5SA 4Z8XA 2O0JA 1NG9A 4LUCA 1KI9A 3BXZA 3SN6A 1GL9B 1NVWQ 1CJUC 4MQBA 5DI9A 4BFZA 1IBRA 4JJKA 5JMTA 3W8RA 1KK3A 3K9NA 2FEOA 4LJ9A 3O47A 4JL8A 4KBFA 2CHVA 4GMXA 4TN1A 2VP4A 3I5YA 1GOTA 2VBCA 3ZD7A 3R9WA 3O8RA 1N5IA 4YXWD 3K09A 3BWDD 4HZIA 1QHGA 3AVWA 3Q8XB 2V4ZA 1LS1A 3IBYA 5AJXA 4JBWA 3V4FA 3LXXA 2AHOA 2GKSA 4UNQA 3RS5A 3EARA 5KSOA 3TGPA 1UDXA 4F91B 5CM9C 2ZRHA 2WWIA 1EFUA 2C04A 3CNOA 4DLUA 2NO1A 3TSWA 1IN8A 4P4SB 1TEXA 3GJ3A 4DHEA 2GA8A 5BYJA 4LJ5A 1ZAKA 1NL3A 5IK2D 4G5RA 1VYTA 1G7TA 3L0IB 5FTKA 4TLCA 4G01B 1W1WA 4P32A 2NQ2C 2O8BA 2ZREA 3AVTA 4TLEA 1HY3A 4BECA 4WZ6A 4EPYA 1KI8A 2P67A 2GXQA 4NYIQ 1W2HA 3A36A 3PIRA 2ZI6A 4UNSA 3CRMA 4M22A 4NYJR 4BGDA 1RC8A 4YDHB 2P6UA 1G3MA 3EASA 2ZSAA 1R0ZA 4LYHA 1U0LA 1TPZA 1OFUX 5CIQA 3U60B 1EX7A 2WAXA 4AK9A 1W5TA 2ZRNA 1CULC 1Z6AA 1SXJB 2YHSA 3ETLA 2A5GA 4LGMA 2AFIE 5EE3A 5G3ZA 2QTFA 2IYLD 1SVKA 5LB4A 3KQHA 1K5GA 2VIIA 2D7CA 4NDZA 3ADKA 3F0TA 2HT1A 5KOYA 2I3BA 3OZXA 2ATVA 4BEJA 5JS8A 1VCNA 2DB3A 2V9PA 1G16A 1AGRA 1YZKA 2B7CA 2JCSA 1JQLB 5H70A 1YU9A 1E2QA 3G5UA 3LQQA 3QPUA 3RS0A 3GEHA 5AUPB 3B82A 3A1VA 2J41A 5BXQC 4D0LB 4BRWA 2ZIAA 3D31A 4HI0E 1N2CE 2V8OA 5JEEA 1TL7C 3KTAB 2WIBA 4PC1A 3WBKA 4B3XA 221PA 1ZM7A 4C7OB 3LV8A 3E70C 1DVRA 1ZUHA 2REOA 4TT3D 3B9PA 4CW7A 1P62B 2IYSA 1JI0A 1NIPA 2J45A 4N1AA 1RE0A 4JMPA 5FOUA 3S1AB 1HE1C 4PSKA 4B32A 5JWOA 4O2LA 1CF4A 2BBWA 3UWOA 5HR5A 4U5XA 1OHHD 3Q5DA 5TMPA 3OEEA 2J7PA 2V7QD 1D8TA 4B35A 2IYVA 3EW9A 1WE2A 3D7MA 1N5LA 2HLDA 1XEXA 4A6PA 1O87A 1ZM4A 3IBGA 1G17A 5AUQA 5CLLA 5KNBA 3NEJA 1G7RA 1CTQA 2ANCA 2WPDA 3C14C 4PC2A 4Q03A 1RRFA 5FI1B 1EESA 4M1TA 3W6PA 4DDVA 1KY2A 4EPWA 2JJ8A 1E69A 4JSTA 1XCMA 2FEMA 1M8PA 2F3RA 3U6BA 3KJHA 4ERNA 4BQSA 5HZKA 3N2EA 1E0SA 1ZCBA 2RGNC 4Q66C 5AUNB 1G8YA 3NBZC 2Y8EA 3SU8A 1W7AA 2GAOA 1RZ3A 1S1MA 4HB2A 4DIEA 1D2MA 2PZGA 4TYQA 5BN3A 2ZRAA 4JT2A 2BJWA 5GVRA 2ODWA 3NDBB 4G5QA 3CM0A 2ZYWX 1TX4B 1D6JA 4LX0A 2R6DA 3PEYA 3KB1A 3UXMA 1GL7A 3MUFA 4DWJA 2XXAB 2JA1A 3FHTA 2VHJA 1KSJA 3DKPA 3NVAA 4LJ4A 1E2PA 2BBSA 5FPTA 2IF2A 2WWXA 3EA0A 4Q1BA 821PA 5KDLA 2ZJBA 4A8JC 2FWRA 4A4DA 1P9WA 2Z83A 4JSYA 4I1SA 1II9A 1IXSB 4W9MC 1W4RA 1A82A 2GAAA 1VG0B 2OUKA 3VKHA 4UQOA 4M9SA 4DBLC 3ZZTA 2RGAA 1WQ1R 4C9BA 3LVQE 4CEJA 1E9FA 3QG5A 1NLZA 1QHXA 5DSZA 1N6OA 1XX6A 4F4IA 1GNPA 2GVZC 1VKJA 2CK3A 1N6HA 3B8HA 1CS4C 2XAUA 1BMFD 1FUUA 1RYFA 2ZRCA 3AGPA 2QTHA 4PSVA 1EFTA 3FMOB 3THXB 1E9DA 1DG1G 1G5RA 1NMYA 2ZXUA 4HATA 2E9SA 3CF6R 4Q4HA 3VFDA 4DSUA 2ZJAA 3DM9B 3MWYW 1F2UB 4DSTA 2WTUA 3DMDA 4DKXA 2GZAA 1FMJA 2QT1A 1T0HB 3W3AA 4PC3A 2VP5A 1OB2A 4B44A 5A4JA 3PFIA 3U7FB 1PLLA 2AK2A 2GF0A 5JRJA 1RYHA 1WMSA 1KI3A 3K0FA 2GK6A 4TMKA 4UXJA 4BLRA 3RSOA 621PA 3ZZ0A 3CH4B 3IQWA 1Z06A 3B85A 1PVOA 5FH9A 2AX4A 4EFLA 3MGCA 3U2QA 1YRBA 2ZU6A 2X77A 3M1IA 4HAWA 3F8TA 1EWRA 2Z43A 1M7GA 1KMQA 4OHVA 4BPBA 3R8FA 4Q19A 3VQTA 4A2WA 1RVDA 4IOKA 4GBMA 4HB4A 1BH2A 2B6HA 3C5HA 4MYTA 3RS3A 3TSZA 2JDIA 1MRNA 1GKYA 1NN0A 3WMFA 1JALA 3ADDA 3U3MA 4EJSC 2OG2A 1G8GA 1PUIA 1E2MA 5JHHB 5HZHA 4A15A 2F1JA 3R8CA 2P6NA 4IFBA 3WYAA 3QBVA 4G1UC 1XD2A 1GRRA 1VPLA 3BK7A 1OIWA 2ZJOA 3MFYA 4PAQA 3KJIA 4TYNA 2ONJA 3HP1A 1VCIA 1FX0B 2R6GA 1FW6A 3UMRA 4AKGA 3A1UA 3OIUA 1P75A 2EU8A 4DCVA 4DZZA 2FSFA 2WHXA 2BMDA 1PLJA 1FNNA 4Q4JA 3A37A 4TMWA 3VNVA 1Q1BA 1QHYA 2J1LA 1ZU5A 3KQUA 1N25A 4ARZB 4XIGS 1OFTA 2GJKA 4E03A 1S9HA 2O5VA 2BEJA 2YC2C 4KJZA 2R9VA 4JT4A 4K81B 1CJVC 4NU0A 4B47A 3L0OA 4D80A 5G41A 1M34E 5GJCA 3BIFA 5EP1A 4NCKA 2QORA 3QQ5A 4PPNA 3BFKA 4DDTA 2IEYA 1VHTA 5H1YA 1HE8B 3EIEA 3VR5A 1YZUA 4B74A 2P0EA 3RWMB 3SS8A 3GFPA 3QXHA 2IS2A 2VRWA 1ZCAA 4MUBA 3GLFB 1EX6A 2F1RA 5FOTA 3QXXA 5FR2A 1IN4A 4IOJA 1A1VA 1R8QA 1K5DA 4U00A 2GJAA 3QJYA 4HEJA 1R7RA 1SQ5A 2AFHE 1JEEA 4UXHA 1J99A 1ZM9A 4OQMA 4W5WA 3L8YA 2VQSA 1N5JA 2IYYA 3MG9A 4TSFA 4A8JB 1Z6XA 4KFSA 5J4KA 1T5LA 1U8AA 4A0GA 2VF8A 4BEBA 1W0JA 3EPHA 4D6PA 1N6KA 4RD2A 5KSYA 4HLUC 3MD0A 4HZUB 1T6NA 5EE1A 721PA 5C4GB 3AGQA 2O8FB 4F4CA 1II8A 2ZAMA 1TNDA 3X2SA 5KDOA 2ZQ5A 3IEUA 3WRXC 3ZS9A 1DO0A 1QVAA 1Z2CA 4IVRA 2F1IA 4IW3B 4B2PA 2G3YA 3WYGA 1E9CA 2Q3FA 1GKIA 2OXRA 3QOFA 5B64A 1OSNA 3HU1A 3UMSA 3BD9A 4M1MA 2J46A 2ERYA 3SHFA 5TDHA 2QEQA 3WXMA 2O52A 3QUSA 3K0AB 1OPXA 3VR1A 1G20E 2VYFA 4GPTA 2WWHA 1P60A 1Q21A 1GILA 1XEWX 3BAFA 3HWSA 1JJ7A 3GQBA 1T9HA 4NL4H 2NZJA 2O0HA 4M2LA 3TW4A 1ZRHA 2FZLA 1GSIA 1TU4A 1BIFA 3LY5A 4NH0A 2QGNA 3V9PA 2QSZA 4PANA 1NMZA 2NO6A 4OQLA 3CZQA 4PFSA 2WM9B 3UG7A 2C96A 2ZI9A 4QNRA 1PZNA 5GJVC 5JJLA 5EQTA 1R10A 4BFYA 1ODFA 2GK7A 3BS4A 4JIMA 1XXHB 2WWGA 3Q85A 4UNPA 5F98A 4IEIA 4EPVA 3TQFA 1G7SA 4OBEA 1C1YA 3MRSA 4FMDB 4Q00A 2LWIA 3QF4B 5FTNA 3LW7A 2XNDD 4EJSB 3GLHA 4A92A 1S1CA 3FMPB 4HYYA 4OHXA 3PEWA 3THYB 2ZRPA 4POAA 3FB4A 1U8ZA 1C4OA 1QHHB 3HR8A 4TTQA 1E2FA 1KK2A 2YOHA 4M1YA 1X1RA 2XJ9A 5CDFA 5J40A 1E9EA 2Z4RA 2NPFA 5BN5A 1K6MA 2JAQA 1ZD1A 2FFQA 2W6IA 2BMEA 1N6IA 3OAAA 3CUEF 3A1SA 1J90A 1DAMA 3Q9LA 3GLGA 4JLNA 2FX3A 4R98A 4BFSA 1OJLA 1JR6A 3IO5A 3QVUA 3ICQB 4WZBE 2PH1A 4L9WA 4LV5B 4Q47A 4IDQA 1Z47A 1S3SA 4Q7JB 1OH5A 1US8A 4JVLA 3WHLA 1Z2AA 3W6NA 3L8ZA 2IS1A 3SJBA 2CL6X 3AVPA 1LNZA 5JWRA 3QBTA 5FOVA 2MSEB 3LAWA 1SVIA 2E1RA 1Q44A 5BQ5A 2ZRBA 3VAAA 4YQFA 3ZDQA 3DZDA 3K53A 2ZUCA 2ZUBA 1AK2A 1CJKC 2Q21A 1P4SA 3VKWA 4QM6A 5JRZA 2QE7D 1XEFA 5FL7A 1A4RA 2EWWA 121PA 4G0NA 1B0UA 1CU1A 1ZU4A 2WWWA 4Z1MA 4LJ8A 2QUZA 2GJ9A 1E4VA 4DEYA 5FUXA 2R2AA 3F5FA 4YMVA 1EFHA 2ZR0A 3QXSA 2Q6TA 1ZBDA 3GEEA 5A0FA 1AKEA 4AIIA 5AJYA 1YZTA 2Q0HA 4URUR 1ZW6A 1QBKC 1XZQA 2FOLA 5F9FA 1Q3TA 3QXCA 1I4TD 1D2NA 2FSHA 3U3KA 3EWAA 2GF9A 2NTYC 5D3MB 4OK5A 3SOPA 2AXNA 2I4IA 1XMIA 2BMFA 2REBA 2X2EA 5HCIA 2Q9CA 1SKYB 1TUEA 2GCOA 1FTSA 2QMEA 4DCUA 3IHWA 5EE9A 4IFEA 4AYTA 1R0XA 4HDCA 3KZ1E 3SYKA 2J0QA 3GPLA 5J4HA 4HLUA 4QHSA 4D26A 2PZFA 4FW9A 2CL7X 4MRPA 4DUGD 5JSZA 3OIWA 5C18A 2P5TB 3K70C 2QAGB 4A0HA 3U3RA 2E87A 4B3CA 1ZUNB 2VP9A 1AS3A 4L4UA 1FPMA 5KNDA 3P20A 3VHLB 1H65A 1Z8FA 2CLDX 1ZD8A 2CVFA 3CRVA 2QP4A 4EQ6B 2PLFA 4WW0A 4KODA 4GDFA 2AKYA 1G8HA 3SDZA 4DSOA 3Q7QA 4KO8A 4MRNA 2B7BA 3SNHA 4D82A 2GXSA 1W0KD 5JZVA 4EPXA 5C2JB 1P72A 1ZNWA 3AP1A 4QKQA 5DN6D 2A5FA 3LLMA 1E1QA 1E2HA 3CX6A 3EIHA 4R2HA 3WNDA 3EPJA 2FA9A 1JNYA 4V0MA 2IS4A 2PMDA 2O8EB 2XEXA 1E2JA 1N6RA 1T3LA 1Z29A 2XZLA 3RC8A 1VG8A 2JATA 4ZKEA 2IX3A 4QBFA 2R6FA 5GADl 4O0MA 5SZIA 2DFTA 4RKFA 3DDCA 1GL6A 4Q18A 5HE8A 2A9KA 3HYTA 2YJTD 3THOA 3ZIAD 1NVUQ 4YMSA 1HTWA 1N5KA 4NKRA 1G8PA 1MO3A 2FN4A 4UNRA 4BFUA 1MO4A 1ZIOA 1JXMA 1UEJA 2NOAA 3T12A 1P7CA 2YC4C 2CLSA 3VNUA 3KJEA 1HUQA 1IHUA 1CXZA 5DYGA 3HU3A 3RAPR 3UWKA 4L15A 4WAUA 4Q9JA 1YHNA 3LH5A 5C4MA 2ZRLA 4GI7A 5CB6A 3BFXA 3OHMA 4TQUS 2OFWA 1E2EA 1KAOA 3EAQA 5F9HA 3VKGA 1JAIA 2QAJA 2ZRDA 4I1UA 3RABA 2PEYA 4LDJA 2AK3A 4I4LA 4MYCA 1X8LA 5AK0A 2OCPA 3H84A 4PC7A 1TEVA 4RD4A 2QBYA 4B3GA 2W00A 1RRGA 2QRNA 4CEIB 4OI4A 3BJIC 1OF1A 4BFVA 3ZVNA 3TUZC 3AM1A 1I4DD 2QTVB 2QSYA 4K46A 2NZ8A 2XTZA 1KKMA 4PHFA 1EFCA 3BOSA 1F2TA 1SXJE 2C9YA 2JLRA 3QE0A 2WJIA 1NY6A 1UBGA 3OEHA 4DLZA 4KFUA 3T5DA 1GAJA 3QI2A 4IOLA 4LJAA 1JAHA 1G64A 2BJVA 3U7GA 4URVR 5CM8B 4FINA 1KO4A 4RZ2A 3CZPA 2CE7A 2WKQA 5C1BA 4IHQA 1DARA 1E2KA 4Q7LA 5FR1A 5CK5A 3SC3A 5DGXA 1SVLA 4LYAA 1AQYA 1SHZA 3QF7A 3RNLA 1U0HC 1TU3A 1J70A 3CNNA 1OYYA 1N0WA 1LFDB 1FTNA 3X1WA 4B6FA 2ZI3A 4A2PA 3UG6A 4PZYA 5HKKD 1WB9A 1MOZA 2FPMA 3O8BA 2YOFA 4Q4LA 1AM4D 5EXTA 5FOWA 4WA7A 2W58A 3SJCA 4EKDA 3CF0A 1QHIA 3U5ZB 4B3DA 4A0RA 2H18A 3SQXA 1Q57A 4I1OA 1XFAA 3V00A 1WRBA 1XRJA 4HUQA 5DYIA 5BYKA 4TZ6A 1J7KA 1GFIA 1ZNXA 2DPXA 3T1TA 4YDSA 2GJ8A 4JLJA 1E79A 4CEHA 2ZRKA 2O8BB 1W46A 3TUIC 5JLJA 4B34A 4MH0R 3NKVA 3TAUA 4Q1FA 3CPHA 3ADCA 1UKEA 1QHSA 2X2FA 1G3IA 1GWNA 2IBMA 3B1ZA 4KHZA 2QY9A 3O8CA 1NN1A 2DFLA 2XB2A 3RSLA 5EP3A 4ILEA 4TL7A 1FOEB 4XVRA 2IC5A 4CYMA 3U6KA 1X6VA 4GFDA 4DLVA 2EFGA 3QKSA 1Q0UA 2XZOA 2H17A 1J8MF 1KDRA 4YXWA 1M7BA 2P3SA 1CBUA 1E1RA 1U90A 2EFDB 3CX7A 1Z0IA 2PX3A 4ACBA 4NPHA 2BCGY 2ODNA 2OFXA 4FCVA 3NH9A 5TXGA 2LKDA 1KDOA 1KY3A 1OLOA 4KLNA 4D4KA 2WJJA 4NYMR 4OJQA 1VCOA 5IRCD 3F3YA 2EFEB 1JECA 2IYQA 1E98A 4RSGA 2DBYA 2CXXA 4GL2A 3CWZA 2KB0A 4QOSA 1M6NA 3SBEA 3T1OA 4UNNA 4YMWA 2ZETA 3Q3JB 3U3JA 4Q4AA 5J4LA 1NVVR 3QNUA 3LX8A 1OT3A 4M1KA 3HPQA 4B48A 2HT6A 1E0JA 2PLRA 3RANA 1UKZA 3BRWD 4I99A 2A78A 2UZ3A 2J7KA 2QZ4A 1P6XA 4TLAA 4XWOA 1RPZA 2DHRA 4OK3A 4B2LA 1Z08A 4D4JA 1Z0FA 2KJQA 2J3EA 1SXJD 2XITA 2IS6A 2CE2X 4V0NA 3A4NA 5JJIA 1VTKA 4DXAA 4LOAA 3AVYA 3K9HA 3RS2A 4TL6A 1XEXB 3RYTC 3T1VA 3B1WA 2ZU0C 4PPGA 3M4YA 2ANBA 2EFHB 2FGKA 2HF8A 5FPKA 4CF7A 1KO7A 2J0SA 2JLVA 2JLSA 4A0FA 5FOXA 4P31A 3B1VA 4DLWA 1CRPA 1UBCA 2J7PD 4S2EA 2IYTA 5EZ6B 3GLIE 2Z6VA 4HUTA 3VR4A 3K0CC 3OESA 1LS6A 2P6RA 2MMCA 3H0KA 2D2EA 4PR0A 3IUYA 4W7SA 4E22A 2GEUA 3AKDA 2IWHA 2OSBA 4LPSA 2GZDA 1T0JB 2F43A 1OXVA 3QY0A 4JLOA 4LRWA 2QQ0A 3EC2A 3CPEA 5KPJA 4BFXA 4G5GA 5HE9A 1U9IC 4Q9IA 4YONB 3B60A 2ZR9A 4B2IA 1NSFA 1GIAA 3K9LA 2HDNB 4PO1A 3LXRA 1D5CA 1MO5A 4IDOA 3WNBA 4ESHA 3UATA 4D81A 3IPYA 3I4LA 2DWPA 1NJGA 1EXMA 4P4UA 3VTKA 4DT1A 1NBME 2BEKA 4F38A 2V7QA 3TNFA 3LBNA 3QVVA 3IIMA 2AD1A 3GJ0A 5D3QA 2R6CA 3VR2A 1DBSA 4RVCA 3IEVA 3Q5EA 3WMEA 4PPQA 4URYR 1CLUA 3JVUA 2ECKA 4C0QC 1U81A 5K8LA 3M6AA 3IPXA 3AF2A 2RGDA 4LHWA 5FTLA 2MMGA 1SVMA 2OE2A 1ZP6A 4ON9A 1COWA 4O25A 1Z83A 4PQFA 1XTKA 3I92A 2IUTA 2GEVA 1N6NA 3LW8A 3FMFA 2BMJA 3CWQA 1E4YA 4CEJB 3A1WA 1HA3A 2SHKA 4GMDA 2C2HA 1ZIPA 3E2IA 3P4XA 3PVSA 4FMDF 4QBIA 4DB2A 2VLIA 4XSGA 1VYVA 1DAFA 2Q3HA 4V03A 2WJGA 3HR7A 1CJTC 4JLKA 1P9NA 5E7MA 1OH8A 3E5HA 4TLDA 1GG2A 4QGAA 1XMVA 4TMXA 4R9UC 1HQCA 4KITB 1AA9A 4PHTA 2A5DA 2HV8A 2IA5A 4GRAA 2G1KA 4C2UA 2D7DA 4QGHA 4Q4HB 3TVTA 3TKLA 3KB2A 3SQWA 4Q7MB 1OH7A 3EZ9A 5CJPA 2GVDC 4ABYA 2GEDA 2O0KA 4KSCA 4KLZA 1RJ9A 1DAEA 2WJVA 1KHTA 3LA6A 4WBSA 2ZRIA 2AL7A 2ASEA 2CK3D 1PLKA 2FPKA 1G6OA 2VEDA 3K0FB 3R7WA 4GZLA 4E5UA 4JVNA 3BH7A 1KK1A 1VIYA 2ZPTX 5L3QA 2HYDA 1CR1A 3GLFE 2NPIA 3I3SR 1TUIA 2QP9X 3PITA 4US2R 3TH5A 1AZSC 5TV2A 4LJ6A 4AKHA 1HURA 3BFVA 5J4YA 2IL1A 1XF9A 1ZC4A 4N3NA 3AUXA 4URZR 4MRRA 3AKYA 1XPUA 4JL6A 2W83A 3GFTA 2R8RA 2DYKA 1CJMA 1P61B 2XNSA 3LRPA 3PEUA 2UZIR 1YZGA 2XZPA 4MDEA 1E0AA 1YR8A 2L0XA 1BMFA 1F5NA 1XD2B 2IHYA 2OBMA 2ZVPX 4PO8A 1B23P 3UMFA 2YYZA 3D8BA 1MH1A 1T3SA 1UADA 1YR9A 2WJYA 4ZCMA 1G291 3A4MA 5EP4A 3FWYA 3HYRA 4WOPA 3AEZA 3HDTA 4PQRA 2CNWD 4Q4JB 4RFSA 4NTZA 2N42A 3AF0A 4GT1A 2XSZA 1A2KC 1I4LD 1AN0A 4JLMA 3FPAA 4US0R 3CW2A 3IQXA 4EUNA 3GLIA 1IM2A 2KSQA 3FVQA 4NMMA 1NBMD 2CCKA 2IEZA 1VIAA 4O3MA 1FZQA 1RIFA 3RRNA 3GEIA 2NIPA 4D25A 2WBLC 3ZH9B 2BM0A 3LFUA 1CR2A 2QN6A 1GVNB 1L4UA 2OAQ1 1T3HA 3KUCA 1J8YF 4NP6A 1WBDA 1TTTA 3LBIA 4PZLA 4UXIA 2JLZA 1JR3D 3LLUA 1E2IA 1OXTA 1XBTA 1II0A 4Y0AA 5DI3A 2FPLA 2HJVA 3IDQA 3K0CA 2FSGA 1OFIA 2JASA 3PUZA 3FKSA 2D2FA 4LSGA 1XP8A 2B8WA 3TJZA 3TIFA 4LI0A 5IHPA 3A58B 1SZPA 4RD1A 2AD5A 3BB1A 2AWNA 3L0PA 3N2IA 5KDDA 3AVXA 1SVOA 1XD9A 5M04A 1LV7A 4B3BA 2YZ2A 3G82C 1U9IA 1ETUA 4Q21A 4DB4A 1LF0A 3KXKA 5F2EA 4NBSA 2DR3A 2ZSBA 3IIJA 4XTRA 2F9MA 3W6OA 4QHTA 2IYUA 4D4MA 1KYIA 1KJWA 1KZ7B 1KAGA 4TL9A 4TYPA 2GTPA 4BWYA 4E07A 1YRAA 4FN5A 3TRFA 1KGDA 4JL5A 1DE0A 1A5TA 1E99A 1IY2A 1II8B 3K8YA 4ASUA 4MKGA 2B21A 4DCSA 3BBPA 3QPVA 3BE4A 2Z4SA 2GWHA 1FFHA 2ORVA 2RKOA 2V1XA 2GBLC 4TSFD 3TR0A 4QJ3A 3PG5A 1U94A 2EVWX 1GRQA 3Q72A 1NJFA 4DEXA 3WBJA 3NHBA 2G1JA 1AGPA 2A5JA 3N70A 3PJRA 1YZQA 4BLTA 4C0AC 1R6BX 4NYIR 4MA4A 3W5IA 4B6EA 3CRRA 4MGYR 1Q1EA 4DRZA 4II7A 4OQXA 2IXEA 5DISB 1EK0A 4M9XA 3MWLA 4IVQA 5LDDC 5FPYA 2GXUA 3RRZA 1VMAA 2HCJB 1HT2E 1IXZA 3HPRA 1Z22A 3AKCA 3MSXA 3IILA 1E9SA 4KYUA 3VR6A 3LX5A 3WY9A 4WVFA 2A5YB 4F92B 5E4FA 1M74A 4Q1CA 2NGRA 6Q21A 5JI3E 4JLVA 2HYIC 1G5TA 1Q1QA 3H1TA 1ELOA 2XOKD 3EPKA 1WDTA 1KI6A 2ORWA 4H1VA 5H8WA 3GLHB 1VHLA 2VO1A 3U7HB 2D3WA 1T4GA 3H86A 4A6XA 3I32A 1BOFA 5IDVA 3LBHA 4ZO4A 2G77B 2FZ4A 3W90A 1QVRA 1HEIA 2IT1A 3QXJA 4FI3C 3K0EA 3KDSE 3MAAC 4FWTA 4UJ3A 4P3YA 3DOEA 4EAQA 3P26A 1Z6YA 4HAZA 1RW4A 3PUYA 2IYZA 3IHLA 1W36C 4C3ZA 2KI5A 2OLJA 5LPNA 4D0NA 1SKYE 3EC1A 3VU9A 1NN3A 3FYHA 3WHKA 1XB2A 5EXXA 2BBTA 1N0VC 2JIZD 3KKOA 4TYYA 4L5BA 5K8UA 5DE3A 1NKSA 1UPTA 2OCYC 4PC6A 4C4PA 3GLGB 3Q7PA 5G40A 2GXAA 4JZKA 3KFXA 3R20A 4A2QA 3CKLA 4B76A 4A9AA 2WSSD 3SZRA 1KJYA 2FFHA 1XTJA 3SI7A 1F6BA 4HLDA 1LTQA 1SGWA 2ODEA 1V43A 4LHXA 3OE7D 4MKFA 1US8B 1H8HA 1JPNA 4NYJQ 1W2GA 1DOAA 1NF3A 2OV2A 4NYMQ 4BFTA 4LHZA 1Y3AA 2FGJA 3RWOA 3KXIA 1RFLA 4M8NE 2XNDA 4GP7A 1G21E 1NP6A 2ZYUX 3K9GA 4OL0A 4OI0A 1CP2A 3FDIA 5DHAA 1A2BA 3PCRB 3NIBA 3QKTA 3CRQA 3B9QA 2O8CA 2W2TA 4BLQA 4M21A 1NVVQ 4ACAA 1H8ED 4F4JA 2ZE8A 3I62A 3W8NA 3TW8B 1L7VC 3CO5A 4ZPXA 5DNYB 2DCUA 1QG4A 3B5JA 4OHWA 3DKVA 5IT5A 3DHWC 1ESNA 1S4QA 4Q9KA 2OBNA 1E0KA 4JLPA 4M9ZA 2CJWA 3MJHA 2W2XA 4IDHA 1NMXA 4MITA 3NEYA 1GKUB 1E9AA 1KNXA 2QROA 1MABA 3OIVA 5TARA 5B30A 3AVQA 2QPOA 3I72A 1G3QA 3NXSA 2G9NA 3EX7C 4N0DA 1SVSA 2ZROA 4KBGA 2YWFA 1EFRD 5FL7D 4RCYA 4QBGB 3ZJYA 5LD2C 4KI0A 1G19A 4ZDIA 1AJEA 2WJHA 1DG3A 1RKBA 3QKRA 3SEAA 3THWA 1G41A 1JQJC 2W0SA 2GCOB 4TL8A 2TMKA 2JJ1D 1L2TA 3RS7A 1AS0A 2V6IA 2JLYA 2J0UA 4I1VA 1IXRC 1OE0A 1UM8A 1YR7A 5JSZB 1UAAA 4BZQA 3GJ5A 4Q1DA 3AP2A 3X1YA 4P4TA 3FFAA 4V0KA 1KSFX 5JCZA 4DLSA 2RAPA 3IGFA 2BVNA 2WICA 4OJKA 3DPUA 4M1SA 1KIMA 2GBLA 3D6TB 4XJXA 1FP6A 2ZTSA 3SJZA 3FHOA 1J2JA 1IAQA 4JBYA 4KFRA 2XX3A 1XJQA 1Z63A 1KI2A 2RGXA 3REFA 1P3JA 3OFND 4LBZA 4PAOA 1FNMA 1ZUIA 4AG6A 2FFAA 1E9BA 2GILA 1OKKA 3E1SA 3GJ6A 5HTKA 3U44A 2RCNA 2JJ2A 4O2RA 4ZCLA 2X1VA 4E09A 4DDWA 4F93B 1E96A 3GCGA 3DL0A 5CYPA 2UKDA 3KFVA 2GCPA 4GSYA 3WNCA 4YLGA 3QSYA 5EUMA 1W48A 1R8SA 1T8UA 3T61A 2CLCX 3X1DA 4ZIRA 2VHQA 1NKTA 2DY1A 5KNCA 4GOXA 1NIJA 1Z6TA 4QG7A 4EPRA 5E3HA 4GOJA 4OHYA 3BB4A 3DZ8A 2IK8A 2YNMA 3GJ4A 2IYXA 4GZMA 4IJMA 2CVHA 4RZXA 2QQEA 2I1QA 3CLVA 4DUGA 1W36B 2Q9AA 1IY0A 3MWJA 5BN4A 5L3VA 1JXOA 3TK1A 3GP8A 2REXB 4PAMA 4ESVA 1T91A 3HJNA 1S0UA 3FGNA 4JJZA 2JEOA 2C9OA 4YMUA 1GRNA 3ASYA 1S3GA 4RJLA 1IOZA 2VF7A 2AR7A 1TADA 4MKHA 3DM5A 1AKYA 1HT1E 1JB1A 1Q3HA 1TQ2A 2CCJA 1W0KA 4WIAA 1NLYA 4PHHA 1W5SA 2QPAA 5DN6A 3MMPA 1VYUA 2QBYB 1U99A 2IW3A 2J59A 1CR0A 2J5XA 2KWIA 1OFHA 3L43A 3ONWA 2FE4A 4PHGA 1G9XA 4EPTA 4XD7A 1F2TB 1SVWA 3UIEA 1R0WA 3AH8A 5JS7A 3B7GA 2QMUA 3EZ6A 1ZM2A 1DADA 4TTPA 4A36A 4URWR 2W6JA 3A4LA 1KMHA 2QENA 5E95A 1NY5A 3TLXA 3N5CA 2ZRMA 2YVUA 3RS4A 3KJGA 2CEAA 5B57C 3A8TA 5EZ5A 4M1OA 2PL3A 1NVXQ 1S2MA 3CIOA 2O8DA 2P5SA 2V1UA 1YKSA 1P2TA 2J0VA 3VMFA 3T15A 1KJZA 2FFBA 5SZKB 1XCGB 2ZJZA 2HXYA 2EWVA 3I8SA 5ELXA 4AY2A 1T8TA 2CCGA 2ERXA 2WOJA 5SZJA 2C8VA 4ZCIA 1XMJA 3JZAA 1M7HA 4HUQB 4TZ0A 3ZVRA 1F48A 1T5IA 4B3FX 1PUJA 3MWKA 5K8IA 3EG5A 2C77A 1CIPA 2D62A 3KKMA 2ZYTX 2BV3A 521PA 4CEHB 5L3SA 2Q3MA 1UEIA 5A5GA 3U4QA 1JBKA 5EE0A 2VL7A 1UKVY 5EE5B 3B1YA 1NN5A 3PXGA 1CR4A 1R5NA 2N46A 4JVMA 2VP0A 2C78A 3PV0A 2QT0A 4JBXA 3C8UA 3ECCA 4AC9A 4GNKA 4F7WA 3CPJB 3NG1A 4KSBA 4K8OA 4LBYA 4Q02A 4BRUA 4RZ3A 4CEIA 1F3OA 1MV5A 3BH0A 3R9XA 3VX3A 1G8FA 3TAHA 3NBFA 4C30A 1YQTA 2PEZA 3TE6A 2BKUA 4QC2A 2VH5R 2MSCB 4MGIR 3K70B 5CB8A 4U02A 3P1JA 3QG1A 2QMOA 2XTNA 3O8DA 4PX9A 5HKKA 3WP0A 1XMSA 4AURA 1BKDR 2QL6A 1XEWY 3MLEA 4FMCB 2QU8A 4Z8YA 1DS6A 4OQNA 3T1QA 3A1TA 2ZYVX 5LBIA 4CZ2A 4IDPA 1E2LA 1M1YE 1G3RA 3LDAA 3WYFA 4ZI2A 2N1BA 1CKEA 1P2UA 3SE0A 4LK2A 1UJ2A 3ND8A 4LBVA 5CIWA 5C46F 1E1RD 3NH6A 1WCV1 5TB5A 3K0SA 4Q4AB 5KYKA 1HQYE 3K70D 1GP2A 3KL4A 2AKAB 5TY0A 2GETA 3W34A 2EYQA 4NCNA 2CMKA 1G4AE 3LWNA 2MSDB 2QI9C 4XWKA 3NTUA 3EZFA 2YKGA 5JFGA 2WV9A 1P2SA 5FBLB 1ONBA 1C9KA 4PSAA 1R5BA 3CONA 3TUJC 2X19A 2AXPA 3IO3A 4TMZA 1DELA 1G1MA 2OBLA 3SYLA 2GZHA 1P2VA 2C99A 5IK2A 3UKDA 5CITA 3EZ2A 2X8AA 4LHYA 4IKEA 5EUQB 5EJEA 3KKQA 1EWQA 2PMKA 4AYXA 2LKCA 4DJTA 3ZGXA 1W44A 1Z0AA 1Q20A 4L16A 2EQBA 4JVSB 4V0LA 1A7JA 4ZI3A 1L4YA 4V0OA 1LF5A 4P4SA 3RDPA 4W5JA 4RY2A 1U98A 1KSHA 1OXSC 2OLKA 3PUVA 2A30A 1KTVA 1HYQA 4MGKR 4QRHA 1GZSA 3P4YA 2IUUA 4B71A 5KSPA 5ANRB 2F43B 3DMNA 4HAXA 4J0QA 2WAYA 4LHVA 4QJ4A 4NCIA 4P0TA 1OIXA 1MKYA 1LY1A 1X8JA 3RHFA 2PZEA 2P2LA 2OFOA 1Z0JA 4HB3A 3OEED 3U7EB 1IJFA 2YV5A 2ZRFA 3H2YA 4C0BA 4DLTA 2BM1A 2PCLA 4RD6A 1G6HA 4C0LA 1WXQA 4DT1B 1G4UR 1SXJA 2EW1A 2F3TA 2VA8A 1G3UA 2HLDD 4Q9LA 4X8OA 2YWGA 4QGFA 2DWOA 3P27A 1E9RA 1TQ6A 1ZNZA 4TT3A 1JEDA 2WPDD 2QM8A 3OIYA 2OZEA 4LWZA 4M0LA 3BERA 5AR1A 3UANA 3ZQ6A 2XJ4A 1LVGA 1I2MA 1KI1A 4Q5IA 5F3WB 1W4CA 1VG9B 1D9ZA 2EFCB 4ITRC 5L8VA 1R2QA 1XZPA 4KFTA 1OHHA 4LY6A 1QF9A 3I61A 3SYNA 1DAIA 2V54A 2CHQA 3BB3A 3KTAA 4R71A 5J5CA 4C7OA 1KO5A 4QJ5A 2H5EA 2HEIA 2ZSFA 2LCFA 3EWSA 2FMXA 4MUAA 5P21A 5J4VA 1JR3E 1FQJA 2KE5A 3R9IA 3S1AA 3ZD6A 5AUOB 2R44A 1E2DA 5GJWC 5JI2E 2IYWA 5BW8A 4OK6A 5JJKA 3NDPA 1QZXA 1AS2A 1COWD 2F7SA 2PT7A 1PV4A 3EIQA 1XNJA 2OCBA 4DVGA 4NHOA 1KKLA 3D3QA 2HUPA 1L8QA 3DOFA 4PO9A 5FOSA 3VR3A 2GHIA 3B6EA 4LZZA 1Z6GA 4CGZA 3K1JA 2V6JA 4RZUA 1RJ9B 3FE2A 1XWIA 4CDGA 3CRW1 1IY1A 4OI1A 3ADBA 1GM5A 1TF7A 4TMVA 3R7WB 1YZLA 3L82B 4DLRA 1NI3A 3GJ7A 2NG1A 4D4LA 1N0UA 2Q9BA 5L3QB 1IJEA 2BIFA 3QPWA 2DFKB 2RGCA 2XB4A 2ZAOA 5B58C 2F9LA 3A6PC 2ZE5A 5E7JA 1MR3F 1U2RA 5HCNA 1KDTA 4UKDA 1BYUA 1QDEA 1XDBA 2CBZA 1F60A 2A3RA 2C98A 3ZZUA 3JZMA 4KYIB 1UBFA 4NONA 2FSIA 2JLXA 3X1XA 3TR5A 3AKEA 3HU2A 2BOVA 3CR8A 3IIKA 4JLDA 4ZDWA 4M53A 3C15C 4QGGA 3DVLA 5JEDA 1MO6A 1NG1A 4IXMA 5JCPA 4MYHA 1OH6A 1R4AA 2CDNA 3ASZA 2QRZA 4B73A 1S9DA 4XVQA 4LC0A 3KQLA 4BLPA 4EIWA 2XXAA 4RFVA 3CF2A 4Q01A 2NO0A 5FBRB 4RFSB 4DLYA 5FTMA 2FJUA 1YE8A 1MRSA 2BHRA 2YWHA 4JYBA 2ZR7A 3V4RA 5G3YA 1SULA 2KBEA 3GLIB 1XPOA 4KVAA 4B75A 4DLXA 3RRMA 2FF7A 4EFMA 4CRWB 4U7DA 3UPUA 1ZC3A 5DO9A 1OV4A 1VG1A 1Q22A 2H92A 4QL3A 5G53C 2RHMA 5H68A 2H16A 2VP2A 3VHXA 3WP1B 4RD3A 4BE7B 2KBFA 1ZD9A 2NO9A 4G5OA 2FDCA 2JDID 4UJ5A 4Q1EA 1UFQA 2VHCA 3GMTA 2QA5A 4Q7KA 2XSZD 4MYUA 1JPJA 2WKPA 1X1SA 4KXFB 5DI3B 1ZJ6A 1P9RA 3X1ZA 3TQCA 1G18A 1WBBA 3NWJA 4NE2A 4IEEA 2H1LA 3QENA 4XSHA 2GNOA 3THXA 2RGGA 1WP9A 1YZNA 2ZE7A 4OQFA 3SJAA 4XH9B 2UVQA 5K8TA 4JKIA 1DEKA 2H8KA 1XPRA 1XU4A 1E94E 1F2UA 2JLWA 4Q9HA 1DO2A 1W4BA 3GLHE 1FMLA 1OYWA 4C0SA 4DDUA 4YMTA 1TMKA 4RKEA 2CNWA 4BFWA 3FKSD 4W5HA 2GCNA 2V55B 5FPHA 3T06B 1ZINA 1W47A 2ZJ8A 1XXHE 2YINC 3NC0C 3QEJA 3J81k 3FOZA 2PJZA 3CBQA 4H9GA 5FPSA 2IWRA 5CDFE 2HXSA 4H1UA 2F55A 1NBMA 1Q12A 2H7VA 2WOOA 5AWFC 2ZE6A 1TAGA 4X8MA 5DLQC 3KKNA 1AQUA 1X3SA 1E32A 3T35A 4D2IA 5FUWA 2PX0A 1XCPA 4JLAA 2W0MA 1BYIA 2FH5B 3MJRA 4Y0VA 1JR3A 1W49A 3GLGE 1N3BA 2FU5C 2D4HA 1G5PA 1N6LA 1SHKA 3ZVLA 2JGNA 2A7QA 2ZRJA 4TLBA 2ZANA 4RCZA 1KDPA 1GITA 4LPKA 2HF9A 1XTIA 4IOMA 4IRUB 4ASUD 1K8RA 5FTJA 4Q48A 3B13B 2GESA 5B2ZA 1E2GA 4OYHA 2JLUA 2AWOA 4LCBA 1FX0A 3RVBA 2ZS9A 3M0EA 3ZS8A 2ZSDA 2VSXA 1UBEA 4XTCS 3CR7A 4YC7A 3CH5A 3AVUA 1XJCA 1W0JD 3SHWA 3W9YA 3WRYC 3T5GA 4MDFA 1X86B 4V02A 5GVSA 4MKIA 1KZGB 4ARZA 5KPDA 4LV8B 4TQ9A 3RC3A 2WMNB 2RHDA 1KI4A 1S8FA 1DAHA 1ZM3A 2RGNA 2ZI7A 1X8KA 5DHFA 1IQPA 1KI6B 2G83A 3KUDA 4FXPA 2VSFA 3KQKA 5KUTA 1E6CA 2IYRA 1RRPA 3AQ4A 2ZS8A 4D0GA 1YJ5A 2WMOB 2VP6A 4ZKDA 1D9XA 4HAUA 3W5JA 3ZQJA 4P33A 2R6AA 3SBDA 1KSGA 1VDZA 3GLFA 2PBRA 1NNEA 3FHCB 2ODBA 4DIDA 2FG5A 2IF0A 4KU4A 5FI0B 4XOIA 4BUJA 4ZDJA 4AKIA 3CX8A 2QGZA 2YOGA 4MRVA 3VU9B 4IVPA 4PQYA 2XTMA 2ZVQX 3L0SA 4PTLA 3EZ7A 2V3CC 4M1WA 3TBKA 4MRSA 2ZI5A 3PR1A 3TSOA 4A8JA 2J87A 3U3OA 1EGAA 1TF5A 2IXFA 1DPFA 4FCTA 2PJRA 1XTRA 1NRJB 2C03A 3AB3A 5AJZA 3DEFA 2GRJA 2B8TA 4HZUA 2G6BA 3TMKA 4R7ZA 2O8FA 2ZJ5A 2G88A 2QAGC 4CIDA 2BC9A 1NLFA 3AP3A 2JLQA 4FD2A 1I2DA 3T34A 2CHGA 1KOFA 1P5ZB 2VHTA 5CLQA 4QNMA 2XOKA 1E3MA 4S35A 1N6PA 5CK4A 1R5OA 2OAP1 5UKDA 5FFMA 3UK6A 3LD9A 2OILA 2ONKA 2NMVA 5JHGB 1U0JA 2WKRA 4B33A 4A1FA 5SZHB 5BWMA 4NCJA 2VHUA 1XTQA 5KO2A 2O8CB 4JS0A 1YR6A 4V0ME 3ZYCA 5EXSA 1FL9A 1AZTA 1DAKA 3PENA 3K0AA 3ICEA 5HPYB 2WZQA 1H8HD 3C7KA 3KX2A 4FCWA 3FMIA 4DSNA 1FUKA 1WF3A 3B78A 2HCBA 4LBWA 4LV6A 2W6ID 3NC1C 5JECA 1GUAA 3OAAD 4KVGA 5FUYA 1G7CA 1ANKA 2CJWB 1PJRA 2ZEJA 2C95A 1LB1B 2JIZA 3DO6A 1MT0A
chains in the Genus database with same CATH superfamily
3PUHA 4R54A 3MT9A 5DIFA 3Q2OA 4HLQB 1PW5A 4L51A 4M4SA 5A7HA 3UMJA 2LBPA 4Q16A 3U37A 4BO7A 2NTNA 2VOEA 1Y7LA 2C9CA 1IG3A 1XXHA 2DHDA 4FMCF 1AV6A 1FTYA 3A10A 3CLTD 1QO7A 2WSSA 4HDQB 5DEIA 4Z54A 3I8XA 1OT5A 1QIFA 1ZIYA 2R3SA 4AJ2A 1YZFA 4ZU6X 1A9RA 1H2AS 1SUAA 3V8QA 2OEPA 4TMTA 1N77A 3QF4A 4CMIA 3Q3GE 2ADOA 2PSHA 2QRPA 3DBRA 4A03A 4FIDA 2OHGA 1GFZA 5B36A 3M7IA 4ZAZA 1D1QA 4M8SA 4OKSA 2RIRA 2OHFA 3TL6A 4MPDA 2VSOA 1IU9A 1NW6A 5ISMA 4QYWA 2JKYA 2QRVB 2QNBA 3KL2A 2OAEA 5LA6B 3VJMA 4F5DA 5C5EA 2OCAA 3FETA 3IMCA 1SURA 2RARA 1PYDA 2WF6A 3B6MA 3LKVA 5FBWB 2AV6A 1H8EA 1QTRA 2BFMA 3CZ5A 2A4KA 1BAPA 2JBAB 2YHIA 3QHPA 4B85A 5JIBA 1FRQA 2AOUB 3WQHA 1RC0A 2CLFB 3SZGA 4AKEA 4N6GA 2O5RA 4OVKA 5F5XA 4WKCA 5JCOA 1WQ4A 3BRQA 4IJVA 4HXFB 4CI9A 5A04A 3IOYA 4DWOA 2G9RA 4X8HA 4AQYB 3FOCA 4QXAA 1U7UA 4LJYA 3RK0A 1U8XX 1ECPA 1S8OA 2Y1WA 3E22B 3WMGA 4QTZA 4D8VA 3TVDA 4QARA 3MFQA 3T5BA 3CSDA 1NSTA 3HDQA 1KYTA 1FW8A 2C9MA 2N9UA 3HKCB 3JQBC 3LO5A 4PCVA 5DSXA 2E6UX 1D2CA 4ZZIA 2G0TA 2WILA 4GC9A 4RHXA 1EFRA 2ZQYA 5FWAA 3H11B 4KXYA 4ZIRB 3TI7A 1EYZA 4FZVA 4KE7A 3CUYA 1JNXX 1T0IA 3CF4G 3KT8A 2HA3A 3WBFA 3I1FA 4ZAVA 4GOLD 1Y8QB 4IDGA 2A5LA 3H9JA 1I1NA 4XVUA 4RTKA 6REQB 3SKXA 2IUEA 3QKUA 1QIHA 2FX5A 2K5UA 2G4CA 3LVRE 3QTTA 2X40A 3CWCA 4MA0A 4MW6A 1D5WA 1JEQA 3KXLA 2CNKA 2ZUDA 3K7EA 3C16C 2X8WA 4FGSA 4HDRB 4II2A 3EZLA 2ZS7A 5CD9A 3H9EO 3MCAA 5AI9A 1QXSA 3GJ8A 5KNCD 4KRFA 1R0BA 1XVIA 3R7LA 5EHXA 1R9MA 3G2QA 4YB8A 7REQB 4FWBA 2C7BA 2R4QA 4JYCA 1LQTA 4A7PA 2H1RA 1ONNA 4FR5A 4F3RA 2VK1A 4DCPA 2A9PA 2O1EA 2R85A 4YAGA 1M2OB 1D2AA 2CXRA 2I8LA 4KZPA 3ANMA 4NNPA 4G23A 1P2BA 3VYUB 4OATA 1E1QD 3AF1A 3JAKA 4TROA 3DYVA 4WLFA 9ABPA 1OB5A 4K6FA 4WCFA 4CIBA 1QP0A 5T4FA 5JBQA 2V9CA 5AW0A 3U61B 4TTRA 2HO4A 1OBFO 1LD3A 1Q1ZA 1C3VA 1K3UB 1A9TA 2YCBA 2PWYA 4X1OA 1QHNA 2VWQA 2ZB8A 3UK2A 5TVKA 2RH5A 4E5DA 5FO0A 2F6RA 3FPKA 3HA2A 3HYCA 5IMBA 1YJ8A 1E3LA 3C74A 1IZ9A 3FZQA 3IYLW 4J0IA 2JGMA 1XN1A 2Y2VA 1LDEA 1XTSA 3L9WA 4ZEOA 3UQYS 4JEMA 4QPCA 3GD7A 4FE7A 2B0JA 4G9EA 4DA6A 4IIJB 4UU1A 2QAGA 1IZZA 1PZEA 2D0PB 2NTJA 4TV8A 1SKQA 5DYNA 3SFZA 5CEJA 1X7WA 2JFYA 3O8NA 3TGLA 1CUCA 1P73A 2BKEA 4LYDA 1EKXA 1YA4A 2BY4A 3EY9A 3LY9A 3OCVA 1CEEA 2B92A 2FB9A 4HB0A 4R3NA 4H0NA 1U2GC 1VHWA 1Z3IX 2AFRA 2DC1A 2RKBA 4XD7D 3HXPA 2X1MA 5KSZA 5EJ7A 3FOEC 1ZHOA 4XQ0A 4CT5A 2B20A 5FL3A 1LX6A 4TPKA 2DBQA 2DOKA 4RYLA 2H9YA 4K28A 1QRAA 4FSDA 4WLEA 3DVRX 1THMA 4NENB 2PAFA 3IAM1 3RNOA 1U7ZA 4BV9A 3ABQB 2JNWA 5EUCA 2XKAA 4MUXA 4K9KA 3JQ7A 1XRRA 2EP5A 4PZZA 3QIAA 8OHMA 1UDWA 2H2HA 3EA5A 4JLBA 3GNQA 5HF5A 3L7DA 4AAYA 2PL5A 1YVDA 3P32A 5K2OA 1ZCZA 4DMKA 3GLUA 2FPUA 4JEHA 3VR0A 3AWIA 3SY8A 2FZCA 1GNRA 2YN4A 2QN2A 3ED5A 1H0KA 3ZXYA 5KHOC 5HKOA 4IDNA 5EXPA 3GNSA 1YDEA 3OEHD 1ACLA 2I7CA 3ELUA 4CG2A 1YDHA 1HV8A 4EELA 4C01A 5IDQA 4ZGWA 2H2FA 1QZTA 1S2LA 4HSGA 2FUCA 1DUVG 3D6AA 3DB2A 4AMVA 3BGWA 3SD7A 3QHAA 2HEGA 3GZNB 1RPJA 3C2QA 5A0TA 3VYWA 1TFUA 1E4EB 4C4AA 4ZAXA 5KYUA 4ZOQI 4EFKA 2C4VA 3C3DA 3LNCA 3H5TA 1W85B 2GD0A 3GN2A 3MWEA 4X8LA 2PIAA 5EHNA 4ZHSA 1H23A 5COQA 5BW6B 5KYTA 2EEPA 2P5UA 3MT7A 1F4LA 4XUDA 1R0LA 1UWVA 2ZJ2A 4DGQA 3H5NA 5FADA 1Y9AA 4Z0HO 3CEAA 5FUVA 3W6ZA 1XZNA 2VTKA 4H59A 1MIOB 4BFLA 1QHEA 2C2WA 3H0CA 1DHRA 3K3PA 4TS3A 4HLCA 4FFDA 2H2IA 4KEAA 3DR3A 4TWIA 1RI1A 4PY2A 5DH9A 3WL3A 3ZHBA 4HDMA 1DGQA 1SPBS 2TSYB 3GXOA 3KPYA 3TW6A 4KCGA 1ESEA 1LNSA 3QKSB 3MJTA 4N7MA 2JLBA 3WNZA 3NKLA 3OF2A 4C2TA 1D4FA 1M1NA 2QRHA 5JWHA 4E7PA 1B1CA 4A26A 2WSYB 2V74B 4ZT7A 2EFYA 4D4HA 5IKXA 2G8NA 2GLTA 1CUGA 4ARCA 3I2FA 2O0JA 4LUCA 3GBPA 2FW6A 1WCIA 4H0FA 2FPSA 1NVWQ 4MQBA 4MUEA 5DI9A 4BFZA 3ISTA 2WTXA 3PC6A 4YR9A 1GLNA 2F8LA 2OM6A 4D9CA 3GU3A 5TMBA 1GGJA 1NQTA 4GMXA 2BGWA 3QNWA 1QFZA 2F64A 2CLHB 2VP4A 4U7JA 2X22A 1ICIA 1HZZC 1Q7BA 4GS5A 3TZEA 3QEBZ 2OQ2A 2O59A 1N5IA 1SUWA 4YXWD 4EMSA 4OHPA 3K09A 4HZIA 2ONYA 3AVWA 4HNAB 3JVDA 4ZO7A 1LS1A 1L7OA 1TYZA 2JHAA 3IBYA 1U9CA 4GR5A 1DXHA 4DIUA 1HDZA 5DGHA 1WOYA 3V4SA 3IEIA 3WQRA 3ZWMA 5IDXA 3RS5A 3EARA 1SA0B 3JQ9A 5KSOA 1ZK4A 3GEGA 3SE7A 3ZCUA 1EVYA 2FQQA 3SKVA 3HBLA 4B83A 1TEHA 1U3DA 1I4OA 2DUMA 5IWAB 3CNOA 4PFKA 5HRAA 4DV7B 4DLUA 3TZQA 4AUNA 3OG9A 1IN8A 5IAOA 5ARDA 2NVUA 4YCBA 3UNXA 3QEMA 3L4SO 5A3JA 1ZAKA 1NL3A 4XEHA 1HK7A 3EG9A 4LDRA 4MDYA 3S2GA 1G7TA 2PJUA 3TLJA 4NZPA 1JG2A 2HBRA 1U0RA 3MCTA 1W1WA 3ENVA 1U2SA 2B0CA 4TLCA 1MJGA 1YBMA 2M2IA 2ZREA 1GSOA 3IVRA 1YB7A 3PDIA 2GPWA 3ORQA 5DNCA 4KUHA 1SY7A 1HY3A 1LTKA 3UPTA 2GXQA 3SVZA 2ACKA 1NRIA 4CN9A 3RVOA 3I09A 3RC7A 1PT5A 3ROQA 2OO5C 1WCXA 2P6UA 3LUKA 3EASA 5AVJA 1GNVA 3H9GA 4I6EA 5EIOA 2FMKA 3CLSC 3JV7A 3Q0IA 3LY8A 1U0LA 3MLBA 4LYHA 1FIUA 3EMBA 1OFUX 2H7YA 3OJ0A 4O4LF 3NOOA 1EFVB 3RKRA 4YQEA 4AN4A 3KCNA 4D4IA 3LE8A 3F67A 2YHSA 2ZBVA 3ETLA 2A5GA 4Z1OA 2AFIE 5EE3A 3RJTA 4UUBA 1SVKA 5CLGA 1L5YA 4G2NA 5LB4A 2XBUA 3EGWA 3F0TA 1VRWA 4JOSA 3AHGA 4G09A 2DB3A 1ISPA 1VCNA 2GAJA 2B37A 1AGRA 2B7CA 4TVSA 4DMMA 3LQQA 2QK4A 4K9OA 1RHKA 4R9NA 3GEHA 3KVNA 5AUPB 3M1YA 3Q15C 2JANA 4K6GA 5BXQC 3I23A 5K51A 3KNZA 3F6PA 3CRZA 3H3FA 3R74A 4C6RA 5FX2A 2I99A 1NMSA 1CD5A 1R6UA 1EGVB 3E8XA 3EVBA 5JEEA 4JI0B 2FR1A 2DMRA 4C7OB 3AR6A 3LV8A 2WU4A 4MTCA 4L75A 1I3LA 4RL4A 4Y2HA 2REOA 3WQSB 1C50A 3B9PA 1OLXA 1PFGA 2FZWA 2BGKA 3PC7A 3UH1A 1QIKA 3UJ8A 3VZRA 1WXXA 1QC5B 4B32A 4F3TA 4PSKA 2HDWA 5JU6A 1CF4A 3NHKA 4RF3A 3UWOA 1K5HA 5I51A 1OHHD 4OIFA 3Q5DA 4IWXA 3FCUB 5D1HA 3SC4A 4HT3B 3QW2A 1R4MA 3KXDA 4IICA 4R2JA 3HEAA 4OSPA 3ZWDA 3GGCA 3KQOA 4LQCA 4OB7A 4P58A 3VH2A 1N5LA 3R0ZA 3NORA 2HLDA 2B98A 1I2CA 1E7WA 4PGHA 2ZBRA 1ZM4A 1G17A 1QFMA 4WNAA 5CLLA 1OI2A 1KDZA 2Z2IA 2ANCA 5FV7A 5AYVA 3VPCA 2PQ2A 2WQZA 3MOGA 3P0FA 1EFPB 1RRFA 2C07A 3M8KA 5JCJD 3WFZA 3DO8A 5FI1B 1EESA 4HJRA 1Q7RA 3JU3A 3R23A 4CMGA 4JBNA 3JQ8B 4DDVA 3N2ZB 2PGJA 3KQWA 2A1UA 1E69A 1L8AA 2JJ8A 3LPLA 4JSTA 1Y0BA 2CUTA 3AEKB 4OFZA 1XCMA 2FEMA 1M8PA 3N86A 5EHZA 2UUCB 2AC7A 1M2NA 3U6BA 1HE2A 1FTWA 4B7UA 4BQSA 1ZCBA 1K7XB 1KZYC 1V1RB 3PGKA 3FKJA 2ZZMA 3IP1A 4YALA 2BFBB 2HA4A 2VAVA 1HE5A 4MIEA 3IIEA 3Q8LA 4ZCTA 1W7AA 1L5ZA 2PZ8A 2X5XA 1HG0A 3L4KA 1S1MA 4XR4A 4HB2A 3L7IA 1M1YA 4O4IF 5AESA 3RJ9A 4UCWA 4DS3A 5BN3A 2HWYA 4JT2A 4LA4A 4FFOA 2BJWA 5GVRA 3BGSA 2BUBA 3RUDA 1B3BA 1KP2A 2XQGA 3CM0A 3DZGA 3IV6A 2ZYWX 4G5QA 3NDBB 4RAQA 1X19A 4LMBA 4TV9B 3L01A 4IDDA 3MUFA 4DWJA 3HV2A 4OIMA 4Y98A 3MA0A 2OPBA 1P19A 3DKPA 5AXBA 3PPYA 2G04A 4LJ4A 5BQFA 3S0JA 2HL6A 2OV1A 4O2AF 4A8JC 2P9FA 1NBHA 3SOZA 1P9WA 3FSJX 1ZVVA 1T2FA 4QOFA 1IXSB 4X90A 4BNFA 4C4TA 1WMBA 2GAAA 4X3OA 2OUKA 3VKHA 1SU8A 1GGEA 4M9SA 1LPBB 4KH1A 1WL8A 3ZZTA 4ALMA 3E9ZA 2J9ZB 5I9MA 3ENQA 1WQ1R 3V5NA 2W8BB 4MV1A 4AULA 1KFJB 2RH8A 2PX4A 3AZOA 4CEJA 2XA9A 1XK7A 3L5OA 1NLZA 1COZA 1AZLA 3N5KA 4EKNB 1PTKA 2JB9A 4M1EA 4PS0A 3FZEA 3B8HA 5MF6A 3EOZA 1YH3A 2NUAB 2ID8A 5LVAA 1MX9A 2QTHA 2WSBA 1NR5A 1GQFA 3QTBA 3RKUA 1E9DA 2XMQA 3IDOA 3CW8X 1P9LA 3CIFA 4PGGA 3CF6R 1CUJA 3ZXIA 3VFDA 1WXFA 2C5SA 1NKVA 2ZJAA 3DM9B 3ZI0A 2I54A 1YBFA 4RVHA 1FE8A 1P2GA 2OCGA 1I33A 1FMJA 3MERA 5HS6A 5SYMA 3A06A 2NZYA 5DKFA 3INTA 3PFIA 3RT9A 5KVVA 4CLRB 2JFVA 1W5BA 1RYHA 2Q6VA 621PA 2Q6LA 2NU6B 3LYUA 5FWXA 3CH4B 3M4JA 3NFYA 5BR4A 1DC3A 3MGCA 1ZCJA 4Y1RB 3IHKA 2MTBA 5F23A 1Z8HA 3L7LA 4JGIA 2X7JA 5JROA 3A6EA 3LPNA 3BTOA 4YRCA 1W75A 3HBFA 1RI2A 3SEZA 4GBMA 2H4YA 5CPFA 3DUWA 1K97A 4V38A 1JU4A 4GRDA 4MYTA 4CETA 4OP3A 3TKAA 1MAVA 1FK8A 1MRNA 1PQPA 1FDOA 2XMBA 3U3MA 1O57A 4ZVOA 2OG2A 1PUIA 4TQGA 3JWHA 3I9V1 5HZHA 1E5XA 3LF2A 1XRLA 4YRRA 1CVIA 2IHNA 5EWMA 2P6NA 5K3SA 3QBVA 4S12A 1XD2A 1GZ7A 3OZIA 3MFYA 3HM9A 1W9HA 5EPUA 2D7JA 3K05A 2W2LA 1IHDA 4FEGA 1RM0A 4EUSA 3HP1A 4UBOA 4BN0A 3UMRA 3B3JA 4L28A 4MV7A 1K7YA 5JBIA 3OIUA 1P75A 2EJTA 2Q3BA 4KIFA 4DCVA 5A4FS 5A5VA 2D8MA 4RETA 3WB9A 4UUPA 3GOQA 1V3TA 3EZXA 1OI4A 4Q4JA 2JGEA 5CB4F 4TMWA 1AUQA 2WRZA 5DLYA 2J1LA 4AZVA 4JOQA 3KVOA 1N25A 1QWSA 4ARZB 2C4WA 2FAXA 3QHQA 1DJQA 1E6UA 4AN1A 3PT5A 5BMVA 1S9HA 3ASUA 4R9VA 1O1YA 2JIPA 2MJLA 1YNSA 3MT0A 3L0ZA 4YFYA 2GZ3A 4JT4A 4NU0A 4B47A 3LL4A 2AMYA 5A4IS 2ZBUA 4ZQIA 4BGVA 5GJCA 3BIFA 4BQNA 4C20A 2VJMB 4QELA 4NCKA 3QQ5A 4PPNA 5AW9A 1SBHA 2D54A 3BFKA 2XCSB 2P7IA 4MR8B 5LQDA 1HE8B 3EIEA 4EG6A 4I8DA 3QXHA 2JFNA 4B31A 1MUUA 4MUBA 3F97A 4MQEA 4ZAWA 1WSWA 3V2UA 4B3TB 5FOTA 1MOSA 4ZCQA 5FR2A 4YCCA 5TIIA 1IN4A 2DLCX 4F8YA 3FY4A 3LHIA 4YP0A 4GO1A 3Q1LA 1RQ2A 1YS6A 4MB0A 1PV1A 3EJWA 3QJYA 4H6PA 3O4VA 3OSUA 1ZM9A 4OQMA 3SYRA 4R1UA 4W5WA 4UZSA 1VJ0A 3ZHZA 1N5JA 3ZIUA 4A8JB 1C5KA 4GW3A 2O3TA 4U3JA 1T5LA 4EKYA 5J4KA 1O89A 2VF8A 1XNHA 5U1PA 1Q0QA 5FUBA 4D6PA 2PG3A 4MLPA 5KSYA 4KMSA 3MD0A 5C9ZA 1RLIA 1T6NA 2GDZA 2XUAA 3BXOA 3KTFA 2FHSA 3N8KA 3NGXA 5H80A 721PA 2O8FB 2ECQA 1KRWA 4RV5A 2PS0A 4WLNA 4GMKA 2ZQ5A 3IEUA 4P36A 4U4AA 3WRXC 3ZS9A 1Y9ZA 3R0IA 1QVAA 2MSNA 3KLPX 3QE2A 3GYGA 2WK1A 3P96A 1Z33A 4K86A 2PUGA 3Q41A 5EA2A 3WYGA 1GKIA 2OXRA 1N1GA 3M5PA 3ZI4A 4GE3A 5B64A 1OSNA 4QUIA 2HFJA 4EQZA 5CFNA 4RVGA 1SCUB 1GU1A 2RK4A 2CNOA 4Y9SA 1L5FA 2O52A 3HL0A 4ZAYA 2ZIUB 3FPHA 3QUSA 3QBEA 4MUGA 3VR1A 5BSUA 2XCQA 3WL7A 1G20E 3VPGA 1P60A 2OHHA 3OMWA 1T36B 3DC2A 4JCOA 1L5HB 1M8JA 4QGBA 2HRBA 4R6WA 4R8RA 3TD6A 4M2LA 3ROKA 5FNVF 1ZRHA 1T0PA 3ZK7A 5GZ3A 4OFXA 1BIFA 2YFHA 4FYYA 3V2IA 3G5AA 4YJ2F 3LY5A 4NH0A 3ON5A 3C39A 3H2KA 1NMZA 4Q3AA 2R60A 3AXSA 4O4IB 2VDWA 3PC2A 2WTMA 4MV0A 1YTUA 1CE8A 3LPAA 4D3SA 2GK7A 3I6IA 5JZMA 3BG5A 3LIIA 3Q85A 3D5EA 4IEIA 4N4AA 1ENOA 3OOWA 1ZJ4A 5I7VA 1QKJA 1RM4A 1UFOA 1ZZEA 3AUUA 1ILWA 1G7SA 2XEDA 3MJCA 3NS7A 3P8ZA 3WYNA 1SUCA 5HQ3B 4AJ1A 3EPRA 2AZTA 1YKGA 2H2WA 3E0QA 4FMDB 3LW7A 1F06A 4ZOAA 5CCEA 5B53A 4O4HF 2FUKA 4HKTA 3VYRB 4JXXA 1WF6A 4WNCA 1VPDA 1K6IA 2AMJA 2G06A 2ZJ0A 1O6FA 3FB4A 5B6JA 2V5VA 2ZJ4A 3FDXA 1T9KA 3DPIA 1F0NA 5WRFA 4A27A 2PYDA 3IUJA 4JA2A 2R6R1 3JS5A 3HR8A 2XKKA 2QD4A 1E2FA 4DQLA 4QUKA 3UWPA 3ZEIA 5CDFA 1SG0A 1TTQB 2OXEA 1E9EA 3KYCA 5J40A 3ANNA 3HU5A 2PQ6A 2P35A 3GMDA 1E18A 2KW5A 3HKBA 4R05A 5K20A 2GFQA 5BN5A 3H04A 8LDHA 1GZHB 1C9DB 1K6MA 3MZ0A 4A23A 2N1MA 4JUBA 4YPVA 3PDWA 1ONPA 2VUSA 1EWVA 3IEPA 4F2GA 1N6IA 4DW8A 3CUEF 2WFMA 2X6RA 1MH9A 3LDFA 4PYJA 3FYUA 3A1SA 1Y82A 1J90A 1DAMA 2NT3A 2O8NA 3QMPA 3QVGA 5DIZA 3GLGA 4PG4A 3RFFA 2I7XA 4Q34A 4R98A 4IIUA 1LSSA 4BX3A 2VT3A 2Y05A 1ADJA 1JRLA 1UJNA 1VRCA 1ULTA 2Q5IA 4J0HA 2PTGA 3GB9A 1XO1A 4WZBE 2Q45A 3A9RA 3ZU6A 1ZK3A 4L9WA 4LV5B 4RADA 4U1RA 5DVZA 1IEQA 1Z4KA 3AF5A 4JA0A 4EGAA 2I6GA 3PNBA 4JVLA 1JV2B 4IIEA 3PYXA 4PZUA 3SR3A 1QNLA 3AVPA 4CLOA 2ODQA 3F6YA 3OPVA 1EXVA 1NU8A 2GNPA 1BGWA 1PGQA 1SVIA 4RK0A 4LXUA 3OH8A 2I3DA 3ZW9A 4L6AA 1Y4UA 5JXJA 2ZRBA 4YV1A 3ZDQA 5B58T 1YK0A 2CYCA 3K53A 3LT2A 3OFSA 3TCXB 3W2EA 1EFDN 3Q40A 2ZUEA 4KHPB 5TQVA 3O82A 1CJKC 1AF4A 2QE7D 1CK4A 5CDSA 4FQ7A 3DDWA 2FY8A 1CERA 3CMCO 1XEFA 4KQCA 4ARUA 1A4RA 2EWWA 4N9WA 1OAOA 1NC1A 1ZICA 3OC6A 4H77A 3TW8A 2WWWA 4CM4B 1ZVKA 1E1CA 1RHRA 4HWSA 2WFZA 1WJGA 1YDWA 2W2QA 2X76A 3TD9A 1VJ1A 2O2JA 1O94A 4M55A 2Q6TA 2ZIXB 3WWYA 2VBFA 1MNQA 2HRDA 3GEEA 3VAYA 2WQ7A 3CZ9A 4AIIA 3G0OA 2A0UA 4URUR 1ZW6A 2WM3A 2PPLA 2NPOA 3V48A 3TL2A 1XZQA 1QRUA 2FOLA 2X4GA 1MEOA 3AR3A 3HGQA 3K1AB 3UEOA 3BA1A 1D2NA 2FSHA 1AZWA 3U3KA 5DBHX 5KOHB 3PFHA 2NTYC 4RYDA 4XIYA 4OK5A 4PG6A 2QN1A 2VDOB 4D02A 5ECDA 1EX1A 3PXDA 2X2EA 3LRXA 5HCIA 3A3NA 5CFQA 1XVLA 4JCCA 2O8EB 1RR6A 2M6LA 2F8TA 2YHAA 4R81A 4AYTA 2IS4A 1M1UA 3HB9A 3OETA 2AN4A 3D3WA 5BQ3A 2MYNA 5IM4A 3SYKA 1Y1LA 1HFEL 1L7PA 2GR9A 4RENA 2ISSD 5J4HA 4O0LA 3GPLA 3WKAA 4DUGD 1WXWA 2JIRA 2NT4A 3KSRA 2P5TB 3R75A 4BQFA 1JLSA 5BUSA 3LU1A 1EG2A 3UT0A 2MSKA 4ENWA 2H0QA 1XYYA 1RPTA 1AS3A 1W5EA 3PA6A 2QRQA 3TIIA 4YT2A 4UEOA 1H65A 1NYQA 4QDZA 1Z8FA 4YP5A 1ZD8A 4DABA 3U4IA 1KQ3A 1Y48E 3KK0A 1ULSA 1UZMA 2VTEA 3RFTA 1AQ6A 2HQBA 1LZLA 1P6UA 3PNKA 3DE7X 1MGPA 3SDZA 3TIGA 5A4KA 1R18A 4ZV7A 2J6BA 3SNHA 1W0KD 5JZVA 1PJCA 1N7HA 1UMKA 2IV3A 5FI3A 5JV5A 1P72A 4QJBA 1KAHA 4M76B 1OWLA 2E4UA 3LJKA 2R1VA 1JNYA 4V0MA 4XUCA 2PMDA 5K3AA 5C5DA 2Q7DA 3IQZA 4C3OB 1E2JA 4D42A 2G17A 1T3LA 3BQMB 2QRGA 5IYZF 1Z29A 5FWNA 2XZLA 5IZCA 3Q7EA 3UJDA 4NMWA 3PRJA 1JXQA 3NJRA 3FDJA 4H4DA 2R6FA 2ZBPA 4HQ0A 3WAJA 1H9CA 1P74A 4RDCA 5I7WA 2H0AA 3I01A 5SZIA 2DFTA 7REQA 5I7AA 4FUQA 3LDHA 5HE8A 2UZ1A 2GTHA 1ATIA 1ZIXA 4AZ3B 2YMLA 3U09A 1KQFA 2UYHA 1WDLA 3EQ2A 4N5LA 1KARA 1HTWA 1N5KA 4NKRA 3ZLVA 3D6JA 4B8YA 5KWIA 3C6QA 1QGED 2V58A 2WFAA 3IAAA 4UNRA 4WSOA 3CVWA 1ZIOA 1RYBA 3T12A 1UEJA 1V9LA 4CG1A 2CLSA 1T0BA 4RGVA 5GAJA 3KJEA 4MVJH 4TUYA 1HUQA 3IELA 2FZEA 5DX0A 5DYGA 2X5NA 3F96A 3UWKA 3IEKA 4I7EA 4WAUA 1JYSA 3QJGA 2BUAA 2W6QA 5CB6A 3BFXA 3OHMA 2ASVA 2VNJA 3H75A 1XRQA 1E2EA 2CXSA 3L6UA 1NPYA 4TQUS 4WBNA 3NVKI 4W5NA 2V3WA 1M0SA 3QVOA 5C8YB 3RABA 5ALMA 4LDJA 4E2FA 3W7AA 4Q0MA 2C4TA 1ECJA 3MN1A 1X8LA 3NB0A 3JR3A 3QMWA 1CFJA 4HRYA 4IIJA 3EGDB 3SXUB 4BP9A 4EO9A 4FLMA 4ALJA 1PJLA 2W00A 5JVDF 3KSBC 2QRNA 3STWA 1KBQA 4BFVA 3DNMA 3BL6A 3TF5A 1I4DD 1CPYA 1VJCA 2AEFA 3L93A 4RTMA 1J5EB 3QWAA 5EWJA 2D2XA 3R3SA 3TX2A 3BOSA 1SXJE 1CWUA 3CINA 2WJIA 1DHTA 1R9JA 1J2UA 1AV7A 1UR5A 3SIRA 3QI2A 2PXCA 1G64A 4GG1A 4LG1A 4OBWA 3DA8A 5KYNA 2YZNA 4FINA 1H9AA 4H7PA 5DM0A 2DR2A 4CFZA 4LX8A 1FNCA 4XI9A 3G5LA 3LSTA 2AUTA 2J5RA 3NWPA 2WJAA 5FR1A 1JP7A 3VPBA 4HH1A 5A2GA 1XAJA 2JGAA 4Y6LA 2ISQA 3RNLA 1SHZA 1T9DA 1TU3A 2Y77A 1YA6A 2DKNA 1RTKA 2JEYA 2RI1A 2WFLB 1MMFB 3UICA 4DRXA 5K8VA 1WSDA 1ZG3A 3OUZA 4ZTUB 3NTLA 4KQJA 3WISA 1DC7A 1BWSA 3C98A 5IBPA 3H19A 2Q1XA 3DD1A 4PONA 3UG6A 1WB9A 3DVAB 4MQMA 1MOZA 1NR7A 2YOFA 5EXTA 3ZY4A 3TOVA 4HN9A 3FR8A 4QASA 3CF0A 4Q15A 3IDZA 4RNDB 4B3DA 4DKJA 3B8EA 2PXHA 4AT1A 3SQXA 1Q57A 1YMQA 1X39A 1XRJA 3L7BA 4HUQA 5DYIA 3BHJA 1EH5A 3G8DA 4TZ6A 1GFIA 2DPXA 3GGGA 4C43A 1RE1A 1EXNA 4YJ3A 1V48A 2QXTA 3QVTA 3OQ1A 3ZGZA 1E79A 3S29A 2ZRKA 4BYMA 1V95A 4DR2B 1KFEB 1C4KA 3SC2A 2WB2A 2F1OA 4EY5A 1W46A 1E61A 3KTOA 1QTQA 2G67A 2PKQO 4MH0R 3RIMA 1KP9A 1M76A 3U26A 3FLMA 3NKVA 5EPEA 3DNFA 3ET5A 2IBMA 4I6JA 2QY9A 3O8CA 3ONEA 4ZO8A 2GFHA 1Q6YA 1Z3CA 1CHNA 1RMTA 4OQPA 3ZLUA 3RSLA 4XVRA 4KTTE 2CB9A 3QRWA 3WGLA 4CYMA 2XRFA 3U6KA 3ZJUA 1X6VA 1L6RA 1NV8A 1BFKA 3QKSA 1LRLA 4PBTA 2P2SA 3W5HA 4RE5A 5F77A 1KZ9A 2OV4A 4LOLA 4YXFA 2H17A 3OBBA 3ZD8A 2Q4RA 2P3SA 3OICA 1SO8A 1PV2A 2WC1A 4ND5A 3NU1A 2IU6A 1NW4A 2QPLA 3NETA 3CX7A 4HGYA 4G24A 1SHLA 2XECA 3QE3A 4ACBA 4B0OA 4QYIB 4N3AA 2ODNA 4B3IA 3I2HA 1TK2A 2OFXA 5C3MA 5I9NA 2WUGA 3HTXA 5TXGA 4X3CA 1REQA 3KEFA 3E3MA 4ABTA 4Z0TA 5TPZA 4PCAA 1G2QA 2VAMA 5FA6A 4D4KA 1VCOA 2EWMA 4JLSA 3H2HA 3F3YA 2EFEB 1JECA 3BA6A 1RXCA 3I2IA 3MD9A 4CKBB 4GL2A 2DERA 3PJDA 3IALA 2EIXA 3CWZA 3FUXA 1M6NA 1F1JA 2Q9UA 1U5BB 2YL2A 3CLRD 4QOSA 4UNNA 5ALHA 3T1OA 2ZETA 3HUEA 4WZAA 2BZSA 1NVVR 3WWDA 1HFWA 5EIHA 4B48A 5JAIA 4RHTA 5KREA 1JEYB 3RANA 3PF8A 1RTTA 4UAJA 4FX5A 2E4XA 4XYMA 1YCDA 3BRWD 3TINA 5AW7A 5HVNA 3ZTWA 4LF5B 4CF4A 1D6SA 3ZCRA 3TQHA 1EE1A 1AUVA 4RQTA 3WAGA 1P6XA 2WP0A 2ZPUA 2NU7B 3BCRA 2AA3A 3GGPA 2R7LA 1AX9A 3SEQA 3ZWPA 3GUVA 2KJQA 1SXJD 1TK9A 4FE3A 4WN3A 3L7AA 4V0NA 2A9JA 2BD0A 3T7IA 4OYLA 2C1EA 3DFZA 4LOAA 4X44A 4DA8A 3AVYA 4HO1X 3KETA 1NUSA 4IINA 4TL6A 1XEXB 3GW8A 1HDOA 5AVKA 3BWVA 2ZU0C 1V8FA 3SLRA 1U65A 4OBBA 2ECOA 2W90A 2XUIA 3INGA 2ANBA 4ZV4A 4HDKA 1IUNA 1GNSA 3ZHQA 5K6TA 2H4WA 1SVUA 3JQDA 4E14A 2BRUA 1YQUA 3NV9A 3L40A 5FOXA 3DTVD 1XNQB 2R5FA 2XNHA 6GPBA 1X94A 2JS7A 3VR4A 3G5TA 2XMZA 3KKLA 2MMCA 4C76A 2PUTA 4ND8A 5LJLA 4MS3B 1WB5A 3A6LA 2D2EA 1BXGB 2GPYA 4PR0A 3HVHA 5BYAA 3AKDA 5TPWA 3AG5A 3PZBA 3TLEA 2F43A 2X0KA 3PFNA 5DTIA 1QK3A 1KMNA 2C3OA 1NDHA 1W2WB 3RO7A 2DQSA 2C61A 1E3EA 1NVKA 4G5GA 2R25B 2XYGA 3I9NA 4BFXA 4YONB 3ZWCA 2ZR9A 5IYZB 5AVYA 2OENG 5K3DA 4X1YA 2XR1A 3LXRA 4P2GA 1D5CA 2V7PA 2NP7A 4IDOA 2H0RA 3FBWA 4NX2A 1JG1A 4Y6PA 1KMMA 3UATA 2FMTA 4KR9A 1NJGA 5K0LA 1NVAA 9MHTA 2V7QA 5LLSA 3TNFA 4QD3A 2W9XA 3PD1A 1H1LB 3QVVA 4D79A 2J4CA 4A73A 1J33A 4BO4A 3TBFA 1V71A 3ITDA 1FXWF 4HEQA 4E46A 4RVCA 2Q2OA 4M0MA 2CSUA 5E3JA 5G1PA 3WMEA 2PMBA 1UZLA 6NULA 1CLUA 3NV7A 4MW1A 2BTEA 1CVLA 1WO8A 4H27A 2ECKA 3UKOA 4K6KA 1F51E 3ED1A 1DWPA 2RGDA 3CY6A 4LHWA 2WINI 5FTLA 2MMGA 4U7GA 4YO8A 5AVVA 2I3AA 1CQXA 3GI1A 4CDMA 1BEZA 1NXXA 1ZSYA 1NXOA 2P9ZA 3NNSA 3WGQA 1ID8A 2DTXA 3PE3A 3KU1A 3G8CA 1VSQA 1FXUA 4O25A 5CAEB 4LWPA 1JKFA 9ATCA 3I92A 4LRXA 5KJFA 1NT2A 1HKHA 1W52X 2FWNA 2QLJA 3IDFA 3LW8A 4QUHA 5HF9A 4EY4A 2BMJA 3CWQA 4PO3X 2C7PA 2IOHA 1HA3A 2XUQA 3FJ1A 2C2HA 1ZIPA 4XE5A 3P4XA 5JT1A 3OLXA 4F3NA 4S1OA 1USIA 1JDTA 1RIIA 3NAZA 5GOTA 1DAFA 5JVDB 2UXCB 1JDZA 1IPFA 1P9NA 3P9PA 3ZHSA 4TLDA 2B6NA 3FNQA 3BHIA 4MVJE 2V6MA 3JVEA 2P1DA 3FD8A 4R9UC 4KITB 4GRAA 1L5NA 3DWFA 5AM2A 2JFOA 4J0DA 2IDMA 1RLJA 4TXNA 3TVTA 3E53A 3R09A 1NE7A 1ZW1A 1T2CA 5AQ1A 1VP9A 3CHYA 4IRMA 5CJPA 2SKCA 1KY5A 1BWQA 3QU7A 2K2WA 4DLBA 5KQPA 3BEDA 2WJVA 1FRVA 1QVVA 3LA6A 1V1RA 5TJ9A 2AL7A 2ASEA 3RD5A 1BVUA 4KLAA 1JT9A 1GPH1 3LY7A 3K0FB 3HUDA 3IA2A 3V7NA 1IPEA 3EOBI 3OJCA 4GZLA 5BV0A 4AZSA 4OX9B 2JBWA 3BH7A 1VIYA 3IXMA 1THGA 5IWCA 3GLFE 3CKKA 3JWEA 1Y1SA 2NPIA 2C0PA 3SQDA 1Z7YA 3LKBA 3JD2A 4Q7QA 4IUDS 1GAEO 4Y6GB 4US2R 3QUAA 5TV2A 2O7SA 3NCHA 5J4YA 4XQGA 3BMQA 1ZC4A 1XP5A 3PQEA 4N3NA 4KDCA 2O2GA 2ACVA 3IE0A 2ZSJA 1EAYA 1Z5PA 2DYKA 2W42A 5B55A 3K73O 1ZA1A 2XNSA 4DLAA 4FW8A 1ZQ9A 1RHUA 1TC2A 4FUTA 5G1OA 2C1ZA 2FW8A 4CF3A 1YR8A 2L0XA 2QVLA 3TLAA 4RVFA 5JW6A 1E7QA 2VT7A 1T1IA 2ZVPX 3S5JA 1ZCFA 2WWTA 3S27A 2BL4A 2YYZA 3A7DA 3H5WA 1QE5A 4OXRA 1T3SA 1UADA 1USUA 1MEJA 1YR9A 4ZVPA 1PT8A 5DT2A 3WI7A 4M7PA 4YP9A 2WJYA 2Z2ZA 2X0IA 3A4MA 3CJRA 3HI6A 4EJ0A 4W7IA 1UXKA 1BROA 3V7UA 4WOPA 4PNEA 4D3YA 1T1SA 2X9QA 2DULA 2QTAA 4ZK6A 2CNWD 1N9GA 4RFSA 1KETA 3MRTA 4GT1A 4FP9A 1RYEA 1FP2A 2DLNA 2FPIB 3HCRA 5KBYA 2ZBQA 2ZW9A 1VB5A 4X71A 4US0R 3IQXA 4DV6B 2PZBA 1IDN1 2KSQA 1NF8A 1KH1A 4H4CA 4WK4B 3RRNA 4CHGA 3WJ1A 1JZSA 5E0OA 1ML3A 4Y1GA 3WYCA 3TNLA 4YUAA 4C2UA 1U11A 1XHEA 2BM0A 1A72A 2DFPA 5ALIA 2QN6A 1L4UA 1QKIA 3CLTC 4NP6A 1V8OA 5LXTB 3KZVA