3TB6A

Structure of the effector-binding domain of arabinose repressor arar from bacillus subtilis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
NKTIGVLTTYISDYIFPSIIRGIESYLSEQGYSMLLTSTNNNPDNERRGLENLLSQHIDGLIVEPTKSALQTPNIGYYLNLEKNGIPFAMINASYAELAAPSFTLDDVKGGMMAAEHLLSLGHTHMMGIFKADDTQGVKRMNGFIQAHRERELFPSPDMIVTFTTEEKESKLLEKVKATLEKNSKHMPTAILCYNDEIALKVIDMLREMDLKVPEDMSIVGYDDSHFAQISEVKLTSVKHPKSVLGKAAAKYVIDCLEHKKPKQEDVIFEPELIIRQSARKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the effector-binding domain of the arabinose repressor AraR from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords Arabinose metabolism transcriptional repressor
total genus 110
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tb6A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tb6A01
1JLKA 3EGCA 2E4VA 3DLBA 2ZAYA 3CG0A 5EWMA 5B3JA 4N76A 2PAFA 4EYKA 3BRQA 1U8TA 2ID9A 3LUGA 1RNLA 3HJFA 4MLCA 1VKRA 2PUBA 1DC7A 2M1ZA 1C4WA 4KRFA 3GV0A 4HNRA 4QICA 1BDHA 1P2FA 3TO5A 2PUGA 4PZ0A 3LUKA 4KQ9A 1PEAA 2P4UA 4ZJPA 2N9UA 2V0NA 3G85A 3H5VA 3VNAA 1PNRA 4F8JA 5DLEA 3E61A 3A0RB 2FVYA 5TQ2B 1JH9A 3GT7A 4MR8A 3C6QA 1CEYA 1E2BA 3C3KA 1A2OA 1MIHA 3FDFA 4DN6A 4KPYA 3CNBA 3QLUA 3GBPA 4QPJC 3OLVA 2FQYA 1KRWA 2IPNA 4NCBA 3IP6A 3JY6A 3MM4A 4LDZA 4LRQA 1ISSA 5T3YA 1Z25A 3RVRA 1JFSA 1ZH2A 1PUXA 4Z4CA 2QW1A 1D4ZA 3Q7RA 1TMYA 1Z15A 4EVRA 4S04A 3QLUC 4F3TA 2QXYA 2FN8A 1XWWA 9ABPA 1YIOA 1YS6A 2RDMA 3KG2A 4G0YA 4N47A 5JNWA 5KC8A 3HCWA 2LIVA 5KWSA 3CTPA 4KFCA 3W9SA 4G0MA 3O75A 1Z2DA 1RZRA 5DKFA 3H6GA 4Q7EA 3MIZA 1QQBA 2IPMA 3JPWA 1QO0D 4F06A 3JS5A 1Z13A 3H1GA 1L5ZA 1VRVA 1JYFA 3F6PA 3FGZA 4RK7A 4YS6A 1E6MA 3EQ2A 2OENG 3SM9A 4KREA 4JB0A 2QVCA 3SAJA 1MB3A 1LBIA 4IGAA 3LUHA 2E4XA 1DP4A 3HUUA 2WY2D 4DQDA 3IPCA 2LP4Y 4NCAA 2FXIA 8ABPA 3H1EA 3LTEA 2MSWA 3KYJB 3LUDA 1DBQA 1M2EA 2IPLA 3E3MA 4IMIB 4MR9B 4XLTA 4QYWA 3EAFA 2ID7A 5TQ2A 2WJWA 3OO1A 5JNTA 4IF4A 2P9HA 4KQCA 1U2PA 4H3KB 1VPWA 1LK0A 1ZITA 2IYNA 2PL1A 3GWGA 4CBVA 3RVOA 5JNVA 5EWJA 3ROTA 1TM2A 4YLEA 4OTZA 2WRZA 1RZRD 3S99A 4Z4HA 1DCKA 4IILA 1URPA 1SD5A 3HUTA 1NY5A 3KHTA 1ZESA 4G0OA 4NV3A 5TPWA 1FFSA 4HNSA 2GKGA 4JB2A 5TPWB 4MRMB 5HKOA 3CU5A 5KI6A 5GQSA 3G1WA 1LJLA 2QVGA 3T6KA 3H5WA 4MRMA 3OQOA 3HM9A 1K66A 3QEMB 3Q9SA 1BVHA 4P1ZA 3O21A 4MGEA 4RZSA 2JCGA 3FFXA 2E4UA 3I45A 1LBHA 3L49A 4JASB 3RQIA 5IX8A 1U2QA 4ETMA 4RY8A 1Z12A 2FLKA 1PEYA 1FQWA 3URMA 2PKXA 5B3JC 5JNSA 2PUDA 3F6CA 1DRJA 1EAYA 2PUEA 1XHFA 1F4VA 1AB5A 2FMIA 2PMCA 3GA5A 4N0PA 2MSKA 4RKQA 1WETA 4XASA 2E4WA 4HYEA 1P6UA 4G0QA 1EFAA 5E3JA 5IBQA 4NQRA 4RS3A 1D2AA 3DGEC 5KQLA 2RGYA 1JDNA 2MYNA 4XXHA 1DZ3A 4E7PA 1B00A 1SXHA 3BRSA 3JVIA 2PJUA 2A9RA 4MS4A 2MYTA 3H6HA 1JF8A 1QPZA 5EWLB 1JHZA 1QP7A 2JVIA 4KNYA 2ZWMA 4Z99A 3DBIA 1S8NA 4W5QA 4IRXA 5JNRA 3F73A 4ETIA 4W5NA 3CG4A 1NXOA 2QV0A 3HS3A 3OM1A 1YTUA 2MYPA 5I4CA 5FBHA 2PE5A 3KYIB 5JS1A 3JVDA 5TQJA 4O1IA 4EVSA 3O74A 1QP0A 1D1PA 4MQFA 1KGSA 2CHEA 5DCLA 3QELA 3MMNA 2H3HA 1Y1LA 4MQFB 4JAVC 5TPZA 4LE0A 1DBWA 4RXUA 4FE4A 3RH0A 2HQOA 4RV5A 5IC5A 3H5IA 2R47A 3GL9A 3H5LA 4M88A 3SG0A 5D2CA 1TVMA 2FMFA 1AB6A 3HDVA 1FFGA 1GCGA 1ISRA 1MAVA 3QK7A 4D6YA 4Y9TA 4EYGA 1GCAA 3OM0A 4EY3A 5KQPA 3Q15C 2DRIA 4EGSA 4WWHA 3RVJA 1BDIA 3NHMA 1ZAYA 3Q7TA 3O1HB 3OLXA 4FE7A 5TQ0B 1SXGA 2QSJA 2CWDA 1NXXA 4YRZA 3EODA 4UHJA 4MS3B 3A0UA 3H75A 1A04A 3GYBA 4RXMA 3NHZA 4NICA 1ZGZA 3QLVA 2VYCA 3T95A 3L6UA 4JOQA 4OG2A 2MYUA 2LBPA 3KLOA 4F11A 1XHEA 4OBBA 5EWLA 3OQMA 5BRJA 1M2FA 1K68A 1I3CA 3FFWA 5CHYA 2A9OA 3I42A 2AYXA 3KKEA 3VNBA 2NT4A 4Z4EA 5TPZD 1P8AA 3GBVA 4N0QA 4Q6WA 4H3HB 1C0EA 4LZLA 4RK1A 2VUIB 2WMYA 5FWXB 1W9HA 4YO7A 5HQJA 4S05A 3UK0A 3ILYA 5DTEA 1EWKA 1JFVA 1CYEA 1A0OA 3OO0A 4W5TA 4IMJB 3QEMA 4ZMSA 3IPAA 1QKKA 3IDOA 4Z4IA 1NXVA 3EJWA 3LUFA 2FEWB 3LKVA 4MR7A 1YVUA 2FMKA 3HV2A 2FQWA 3BILA 4EUKA 4MPTA 5EWMB 4G0XA 1YK0A 1ABFA 2CD7A 4Z4GA 3O2QB 4RY0A 1ZH4A 3D02A 2GBPA 3ROFA 2PL9A 4DADA 3QLTA 3K4HA 2JBAA 3KS9A 2YHBA 2WJAA 4Q6BA 1QMPA 1D1QA 3C3MA 2FQXA 1JBEA 1USGA 4KVFA 3UUGA 2Q5CA 2L2QA 2YHAA 2E4ZA 4WUTA 5KC9A 3BBLA 2HPHA 4ML3A 3OQNA 1DG9A 5TQ0A 1EWTA 2JK1A 3HDGA 3RVKA 1SXIA 1L5YA 4YGXB 3CLKA 4QYMA 3UKJA 2W42A 1JWLA 2RJOA 2VUHB 2IPAB 2H0AA 3KTOA 1JDPA 1ZGGA 3QX8A 5KQGA 3CFYA 2F8SA 5CNIA 4O1HA 5IEBA 3OLYA 3EQZA 1GUDA 4N41A 1H9CA 2FMHA 2WWVD 3KCNA 2QZJA 1U0SY 3BREA 4G86A 4RK0A 1Z26A 3MQ4A 4EYQA 2R48A 3N6VA 3TB6A 4RSMA 4F12A 5HM6A 1EWVA 3A3KA 3N53A 5KQMA 3HXMA 1Z16A 1DBPA 3H5OA 2GX6A 4ZMRA 2I6FA 4MS1A 3CS3A 3O1JC 4KMRA 5IUNC 4RKRA 4YR7A 3N8IA 4MR7B 3HK2A 2LUOA 1QO0A 2E4YA 3I5AA 2FEPA 3RVPA 4D6XA 4OLAA 4G0ZA 1GLGA 1Z2EA 3R0JA 1KRXA 4RDCA 3M9WA 1OXBB 7ABPA 3OLWA 5BRAA 4JP1A 1F51E 3NNDA 4XARA 2FKAA 1ABEA 3LUCA 2X7XA 3JTEA 2CHFA 1NATA 2MSLA 3K9CA 1Z18A 1DRKA 4LE1A 1ZVVA 1FSPA 1E6KA 4RWEA 3EDCA 5TE9A 2FSPA 4JA2A 4MR8B 1NXPA 5IUKC 4MS3A 3O1IC 4G97A 5JS2A 1USKA 3C3WA 2J48A 3OMWA 1JX6A 3HSYA 4MLDA 4ZYLA 3RVLA 1NXWA 3CZCA 1M5TA 3FFTA 4WXEA 1ZHHA 1FFWA 2JVKA 3ILHA 3KJXA 3MYYA 1RXEA 3NNSA 1M5UA 5ABPA 3GRCA 2FN9A 3EULA 2HSGA 1NXTA 4XFKA 1QQAA 1IIBA 4XAQA 4KV7A 2NZVG 3LKBA 5FWXA 2PLNA 3QLVC 4RY9A 3RVMA 1D5WA 4WZZA 3MF4A 3RVNA 2TMYA 3Q41A 5HSGA 2NUBA 1GUBA 3LMKA 2LPMA 1BAPA 4H60A 4RXTA 3RVSA 1QP4A 3QEKA 3LUJA 5F64A 4YV7A 1YMVA 4W5OA 5BR1A 4MS1B 2FEKA 3QELB 4PEVA 4RK4A 2NZUG 1TLFA 5CNJA 3TMYA 1DJMA 4OATA 5CNMA 3N75A 2AYZA 3RVQA 2HJ9A 3FMVA 1J56A 2R25B 2OQRA 3JPYA 3CHYA 5C5CA 2L18A 4FB4A 1ZN2A 4KK4A 3N0WA 2GWRA 2QR3A 4TN5A 4UHKA 4RK5A 3IP5A 3DGFC 4KK3A 3TX6A 1DCFA 1EHCA 4LDAA 5BQ3A 1W25A 4YWHA 3H5TA 2WB4A 4Z0NA 1ZY2A 1YK1A 3LUAA 2FLWA 4MR9A 2L19A 5T7BA 2B4AA 2HQBA 1LJUA 4P98A 3SQNA 3A10A 4YCSA 4PE5B 4OLBA 1Z17A 3KLNA 4EVQA 3QX9A 4Z9BA 2PUAA 4LX8A 5GOTA 4RK6A 3HVRA 1APBA 1DC8A 1P6QA 1JYEA 1YS7A 1E6LA 3M9XA 3TD9A 4RU1A 6ABPA 4G0PA 5EWJB 3LOPA 3OLZA 1USIA 2GI4A 4YP9A 3T8YA 4WXMA 1MB0A 4MYRA 5FWYA 1MVOA 4B09A 2IOYA 2JB9A 1SRRA 1CHNA 1RXIA 4N03A 1T34A 3KSMA 1BDJA 4GPAA 1JFTA 4O5AA 3P9YA 3HEBA 5IUJC 1PNTA 3SNKA 2A9QA 3CZ5A 3B2NA 5DGCA 3SY8A 3T38A 1KMIY 1HEYA 1R8JA 4E7OA 4EYOA 2XDYA 4Z4FA 4L4UA 2JBAB 3C97A 3I09A 3MA0A 3O2SB 1PHRA 1UDRA 3NNNA 6CHYA 4D74A 3IP9A 4L85A 5IULC 2HQRA 2F8TA 1JL3A 2B1JA 2QU7A 1QNLA 2FTKE 4ETNA 3OMXA 3HO1A 2JRLA 2PUFA 1RPJA 4PICA 5CNKA 2IDMA 3DLHA 2JVJA 3N0RA 2A9PA 2KYRA 4LE2A 1BA2A 1OXKB 4W5RA 2BGGA 1U04A 3N0XA 1YMUA 4TLMB 3CRNA 3H1FA 3IP7A 5C5EA 3O2JA 5FBKA 3DZDA 4MS4B 4ZPJA 4MQEB 5PNTA 5ED4A 3D8UA 3HZHA 4MAAA 3CKMA 4MQEA 4TMYA 2IKSA 2L17A 3M6MD 2NT3A 4TLLB 1TJYA 4Z9AA 3LFTA 4WT7A 4KZKA 2M98A 5JNUA 3Q7SA 2FW0A 2R4QA 1ZDMA 5FWYB 4GNRA 3NBMA 1NTRA 2PUCA 5IEJA 2O20A 4PYRA 4HNQA 3F7NA 1NXSA 1DCMA 1VLZA 2RJNA 2VK2A
chains in the Genus database with same CATH superfamily
1V11A 1XMSA 1ZXXA 3LQ2A 4E1BA 4F8EA 1R6BX 4EYKA 2VH1A 1M2VB 4ZT2A 2PUBA 4RH1A 3GMIA 4GPTA 4OMUA 4EA8A 1PU2A 2HNKA 1CY2A 1ZLXA 2E89A 2NW6A 2AFRA 3HYTA 3H11A 3WMWA 4N7BA 5BMVF 3C85A 2PGJA 2W00A 3AEYA 3Q2KA 4K0RA 3WMFA 1CY4A 2ZRLA 4PZDA 3U4DA 1E79A 4ZI7F 5FYDA 5KQRA 3R1IA 2CVHA 4B31A 3B3QA 1U11A 1FTNA 1B43A 5DFAA 1KSHA 2YOGA 3A0RB 4DKXA 1KZ4A 3FDFA 5JS8A 3GB9A 3M3PA 3GRUA 4EGFA 2QIPA 3GBPA 4W9RA 1VDMA 3FH0A 5JAHA 3DOJA 2ZJ3A 2CNDA 3PNBA 1NA5A 4UNSA 3GVXA 3EWIA 3FWHA 3JY6A 3KZVA 2GLTA 4TTTS 4J4BA 4BVBA 3GUVA 4X6UA 3ORQA 3M34A 3WGZA 4GPIB 3TD2A 2ONZA 5CLLA 3DZJA 1D4ZA 1TQHA 1JIIA 4LHYA 5J1SB 2LTAA 2Q5JA 4UXIA 2O8EA 3HDJA 4O63O 1RJDA 9ABPA 1I80A 8LDHA 1F6BA 3F97A 2ZSUA 2J9ZB 1WPQA 4HTAA 2OWEA 1XDDA 2VA9A 2YDXA 4X41A 4CCYA 3HCWA 3QOXA 1DADA 4CCYB 2WNHA 3CTPA 3D7LA 1D09A 3N2KA 1CVLA 4RA6A 4UNQA 3ZH2A 3VNQA 1CUSA 2VQFB 1GAWA 1HFJA 1TAQA 2FRVA 1EINA 1PDWA 2GPJA 2V7QD 4HZGA 4Q7EA 4BMXA 4IFTA 5CIQA 1JG3A 4PSCA 1H9BA 1ZK2A 5AJHA 3VR4D 3W05A 1ZA2A 1T8UA 4F5YA 1GZ7A 1Y7TA 1BCRA 3SKYA 3UY4A 1RI2A 4X1YB 2JGAA 5T41A 1IPHA 1UEIA 4X1YA 1QYIA 3QVOA 1UFKA 4KFRA 3RD5A 2JGFA 2WUWE 4WGGA 2C31A 5C51B 2C1ZA 3MWJA 3DQPA 4AJPA 1OH6A 4XEHA 2YJ5A 2AMYA 4YMTA 3L6CA 3F9IA 2LP4Y 4XM2A 3HKCA 1LSJA 1UJ6A 4RZQA 2Z8YA 5LUBA 1J42A 3U7QB 2J8ZA 2CV2A 1ZEJA 3BWMA 4XLTA 2VNKA 4KDEA 2OFWA 3L82B 2H85A 2CFCA 2HBZA 2P2NA 3ONDA 2AKEA 1UBGA 2AG8A 3NANA 2MIIA 1NBHA 4FSHA 3B5EA 2EARA 4K2HA 3ZCVA 2JJMA 3OZGA 1CUEA 4X1IB 3W5VA 1VPWA 2WWYA 3A25A 5DM2A 3ZCXA 2OQIA 4AIRA 4JJZA 4LF8B 4A8TA 3WZMA 3SX2A 4AJ4A 3ZD6A 2A58A 3HN6A 1EVKA 5LA6B 3S99A 2UXCB 2GZDA 4TKVB 1HNWB 4HDAA 5TPWA 1N7HA 3PUWA 2JFNA 4AZSA 1XNRB 5IDXA 1H9AA 2XNJA 2FOLA 2J7PA 3PLNA 4ZN6A 2X5KO 4LNAA 2D0OB 1F9AA 1U63A 4GOJA 3WISA 3W5BA 3H04A 1YB7A 2C9OA 4FFNA 4KGDA 1KOFA 4D9IA 1JPVA 2DFNA 5CT9A 1CUIA 2B0JA 5AW7A 4WCFA 1YBAA 1DJOA 3BXGA 3OQPA 5LLSA 4ZAWA 1GTJ1 1XTKA 2JCGA 4UUAA 3LVRE 1JJIA 2O3RA 3I45A 1MH9A 4WKGA 2QTZA 3L7KA 3EN0A 2NV2B 3GRFA 1OLUB 3IUQA 4DC9A 3BZBA 5DLYA 1Y89A 3BL5A 1W8IA 1MW9X 3PA8A 2QQ0A 2Z56A 3PXAA 4MW4A 4Q7JB 4GGOA 2IOFA 3NIBA 4D26A 3GK3A 4X6LA 1CJCA 4ANFA 1RW4A 4D9FA 2GBFA 3M6FA 1F4VA 1W49A 1EBUA 5ALOA 4ZZ2A 1PJ3A 4TYYA 2XZDA 3WQSB 2SKEA 3A3YA 1BGXT 1Q3HA 2Q1WA 2YFKA 4WFIA 3VAZA 4EQZA 1NI3A 5KKAA 4DL9A 3AVXA 1KK3A 2JIPA 2QPOA 4RMJA 3SC2A 1PZMA 5LXTB 5LMUB 1UKYA 3PTLA 1I1NA 4FCVA 1H93A 4QLBA 4QT4A 1V1RA 2Y1XA 5AP9A 3BTOA 2FFJA 1ACJA 2VPXA 3MWFA 4XKJA 2IDKA 3CC8A 1T6BY 4MWCA 1S8OA 5BOSB 1JA0A 1RWKA 1WSDA 5G3YA 4B47A 1KGDA 1UPBA 1NUSA 4RH3A 4K28A 2RGGA 4C87A 4B4WA 4ETIA 5HKKA 4Y2RA 2WA2A 2Y3IA 5I9NA 2WWTA 3PJEA 4LZWA 3OM1A 1IHPA 1NULA 2E7ZA 4GZ5A 4J75A 1QLJA 1YHYA 1IN6A 4REOA 1IM2A 5KYUA 2OUKA 1KU0A 2Y1EA 1H69A 2WNIA 1IY9A 4UCFA 4UOZA 3ZEIA 3QF4B 5D86A 1E2MA 1XRSB 3MS2A 3OPXA 3ACBA 1ZO8A 1EYZA 3LK6A 1XYYA 2NU8B 4GRDA 1EUQA 4FN4A 4RXUA 3AM5A 4FLEA 3AG5A 3UJPA 4JSTA 1L1RA 3HHPA 4RGQA 1RRFA 1LBSA 2Z3VA 3URKA 1K8XB 1E3MA 4DC0A 2ZJ6A 3OQBA 2X1HA 1RKBA 2FMFA 5CCDA 4YRBA 1E2KA 3T7EA 4EUNA 2G77B 3PR1A 4LYHA 1GL6A 3ZWMA 5EJ5A 4G8DA 2QUIA 1VIAA 1YZNA 3WYBA 4ZICA 2AHOA 2HKIA 3CR8A 4LWOA 1QGOA 4OKNA 2QRNA 4QQKA 3OU7A 4P4NA 4CKEA 3E22A 3O1HB 4CKEB 2HK8A 1G6Q1 4UEQA 3R2JA 4UVHA 1C9DB 3ZK8A 3N1UA 4Q4AB 3UBTA 4LDPA 2VPPA 1X8JA 1XMQB 1VYHA 4EX7A 3KQYA 5CMLA 4EDFA 2BWJA 2UUBB 2GM5A 4ZVKA 5I9SA 2XGOA 5FV7A 3O95A 4NMXB 1YHZA 3NHZA 3EXFB 1Z6XA 2F43B 2OBYA 2BJVA 5J2TB 5FOUA 1W85B 5T4HA 5DF1A 3M4JA 4ZO4A 2LBPA 1U3CA 2Q45A 2Y1DA 4P7JA 2AGVA 1FFYA 3ETEA 3OIGA 2CFOA 5EWLA 3EBPA 5FJIA 3V4RA 2YTZA 3DE2X 3GH3A 3CPEA 4HEHA 3WIUA 1E7RA 1WULS 2EKPA 2AYXA 1PJSA 4RYDA 2VQ6A 1C0EA 2XBUA 4ZHQA 2Y9MB 4YMLA 2XCQA 1WD7A 1SCUB 4IEFB 3IP3A 1VL8A 4J49A 3G88A 1JFVA 3KPJA 4U7DA 1RQLA 1SCUA 3FHLA 1G20E 1LLQA 3IJRA 2JHFA 3G0DA 5F52A 4CMCA 2G5GX 3J81A 4X66B 1IFXA 1L3BA 2PV7A 2RE8A 1KSFX 2Y0BA 4TXNA 3AR7A 2A14A 5FEUA 3IDSA 4EHHA 3PPWA 4CETA 1N9GA 2AVDA 4BRSA 4ZXFA 3S2SA 3O2QB 1RBMA 1IDOA 2JD2A 3ZV4A 1H2ZA 1C3OB 2VI5A 3I5MA 1KA9H 1Z4MA 4BFSA 1JEQA 4IG4A 2FRDA 1EX1A 4ISBA 2R751 1PYGA 3CIOA 3RUIA 3WGVA 1JIVA 4CMGA 3CBQA 5KC9A 5KUTA 2VHTA 1VL6A 3WMXA 1FU4A 4A7PA 1GRCA 1UPXA 2D1FA 1E6WA 3K9BA 1T13A 1UODA 3NTXA 4DDUA 2LVBA 3A6ZA 5LQCA 3VJRA 1FPQA 1X7YB 3AF4A 3U7GA 4UCWA 4O1HA 1Y9ZA 3DLCA 3STWA 4N41A 3JARB 1OWOA 3OLYA 1KTVA 5HFJA 4B33A 1X8LA 3U0BA 2WWVD 4GIBA 1I7DA 4U7TB 1N2OA 1QG6A 1O57A 4D5GA 3TAUA 4WZBA 1ECPA 4IMRA 3TZLA 3OQHA 1VLQA 3WL3A 1Z26A 3NBFA 4UHFA 1Z4KA 1VGRA 2Z0MA 3DH0A 5ERYA 1U5AA 1ILWA 4N3BA 4Q05A 4R9NA 1T36A 3E5NA 4RSMA 1A2QA 4WCDA 3SHFA 1CUJA 2YC2C 1Z16A 5TNXA 1Q0TA 2XOEA 2WWXA 3NBAA 1YACA 1HT0A 3KKMA 3S2YA 4L5CA 2Y4NA 3TMKA 4F38A 1RWXA 4KMRA 4J7AA 1JMKC 4L8WB 2ZAOA 2FRDC 3ABIA 4RKRA 5BORA 1N2HA 4OSOA 1JDBC 1ZKMA 2VJKA 3P2JA 5E9JA 1BS9A 1RT9A 3MWEB 2GAJA 3CCFA 3GJ5A 3KWMA 2ZYHA 3W8RA 4YT4A 4MVJD 3GJXC 2R1VA 3HBMA 1DTWA 2C57A 2J6HA 3TW8B 3VDNB 1U9IC 3OOJA 5U4QA 1OH5A 3E23A 1W7AA 2YFYA 3K9CA 1FDSA 2WLTA 4P3NA 2RMKA 3V8EA 4ZTBA 1U7ZA 3G23A 3IAS1 3CSUA 3KWJA 5FF9A 5FO1A 3S27A 3KUXA 1W6UA 1XRLA 2ZI9A 2OD9A 3S44A 1VCIA 5SV2A 3ED5A 2EVWX 1CR1A 1UJ5A 1JX6A 2BR5A 1XDGA 2BY4A 3HSYA 1VP9A 3ND6A 4BNUA 4ZYLA 3IE0A 3FI9A 3MT8A 2RHGB 3GRKA 1LQ2A 5LMZA 5EKUA 2FN9A 3LCUA 5K8UA 3NW9A 4GVPA 1MFZA 2R3SA 3AIMA 4KC0A 1XLTA 3O1LA 4JBHA 3GT0A 2A0KA 1QVVA 3B9QA 1WZEA 5EIWA 2X8JA 3FYUC 3OUTA 1IVSA 5CB4A 1ONOA 2NUBA 4QQRA 2AC7A 1IM8A 1TK2A 4OGWA 4E2XA 3EZ9A 3RVSA 4ARZB 2LRHA 4FNGA 2RGAA 1SG9A 4MINA 3OHMA 1T4CA 3EVZA 3IIEA 4NE7A 4LC1A 2YH2A 2XLCA 4RANA 3TDKA 3VH3A 4AYWA 3E9CA 4BQPA 1FS4A 2ZM6B 3W5AA 1FE8A 3UJHA 1H2AS 4CLEA 2G17A 3FSJX 3IHTA 3I28A 4N65A 4OATA 4BKQA 3BWCA 2GZMA 4FKBA 5EJFA 4XIFA 1PVOA 1WEHA 4CG2A 3MRSA 1OIVA 1R4MA 4NU8X 5CM9C 3ZGXA 2OECA 2QR3A 3UV7A 4R98A 4GMKA 1RRCA 3SVLA 1G21B 2P2GA 1LTHR 4GICA 3P94A 1EHCA 2JI4A 3IMKA 1WKVA 1IY1A 2CNWD 4YWHA 4ALIA 3ETGA 4DCMA 5I4IA 2N42A 4Z0NA 3RRXA 3HLYA 3G82C 2LD4A 1MEOA 2W4IA 1MP0A 2C54A 2XYQA 3HYLA 4QE3A 2I2DA 3H2YA 3KB1A 2NXJA 4ZZ1A 5FBRB 5ENZA 4GZ3A 4JQYA 4P98A 5CG2A 1TAGA 3ON5A 1G3UA 3X2SA 4EL0A 4C3OB 4YPFA 5FNVF 5DYTA 5LA6F 3W5DA 1QM5A 5JH7B 1H0RA 5EHNA 5AWFC 4IAOA 2JEZA 3HI6A 4Q39A 4ZHQF 1DXQA 2P9TA 2PO7A 3ZHSA 3GP8A 1Z0SA 2EL7A 1LDBA 3M8KA 2JH9A 1Z68A 4F4UA 1L3CA 4IM7A 3AR3A 3IA2A 1WABA 1FB5A 1VA4A 1IZ0A 3BMQA 3EVDA 4GXNA 4NS4A 4PC2A 4R1TA 4BMVA 1SBYA 1LFDB 4HDMB 5LL6P 3F3SA 5LM3A 4LDJA 5A1TA 1DHTA 2ZI4A 3G5LA 1XQWA 1WXHA 1BG6A 2IOYA 5FI5A 1W5TA 1JHYA 4F9FA 4OX9B 2UVQA 3KZXA 3WICA 3D6AA 1B3RA 4BJ3A 2P2SA 1BDJA 4HSGA 1FJ2A 3OX1A 4H77A 2NO9A 1JFTA 3DYVA 4LWQA 4GFDA 2PJRA 2A9QA 3FRIA 1UJ2A 2CMGA 4Y67A 1X3LA 1W94A 2Q0QA 1C1DB 4IFEA 2JAHA 1JJFA 2JZNA 1X87A 4F21A 1EFKA 1EDBA 1JUDA 1TDJA 4O0LA 1GAEO 2JI7A 1PHRA 4Z7JA 2F4VB 1QIIA 3LP5A 3LRPA 1YCHA 4R8LA 4U6QA 3EWNA 3EAQA 3SWWA 4NZZA 2PGXA 4YMVA 2IHVA 3BMCB 1E3WA 2QRPA 2YXEA 3R9IA 3TGLA 1R66A 2WI8A 4ETNA 3R4VA 2FZWA 4JJ4A 4FDUA 4O2LA 1TTQB 3RFVA 4OGGA 2FKNA 4PICA 1AD2A 1O9BA 2IDMA 4PPYA 4DXDA 4KXMA 4BYGA 1E3TA 2QL6A 1HXHA 2PX2A 5GJVC 5CXXA 1LNZA 4I9UA 1XPUA 2R79A 3DL0A 5DNWA 2HQSA 2FFAA 3NYIA 3ZHUA 2BZ1A 3D5EA 1O77A 3VX4A 3MYRA 2ZB7A 3HZHA 1XJ5A 4MUHA 1QC5B 1PJLA 3ZJYA 4KBYA 2PAAA 1OR8A 1SCQA 1MRNA 1ZJZA 2XGSA 3JWPA 5KSZA 1BZYA 2FPGB 4PR0A 1DGQA 2M6LA 2NIPA 2ZLBA 4RVDA 1UM9B 3HGTA 2AUMA 2EDCA 4UBOA 4QXMA 4LZPA 4Q12A 1D9ZA 1Q1QA 1T4BA 3D4OA 4X71A 3GNTA 4CFYA 4FFBA 1XKTA 2BIFA 1GYPA 3L0PA 2JIZA 2QKYA 4TS9A 1HG1A 1EK6A 2YZ2A 3AU9A 4X95A 1TX4B 2E4VA 1N3IA 2ZT8A 4PONA 2Y92A 3D6HA 4B44A 3LBHA 3KWFA 4H6PA 2BN4A 1SGWA 1XZPA 3RG8A 4BN4A 1AQYA 2R00A 4KXXA 3ICQB 1IEWA 1U0OC 3DBVO 1Q17A 3IC5A 4MSUA 1VCOA 5CEEA 1RXWA 1E5DA 2K87A 4IX9A 5L4LA 3OFNA 1EDOA 5K45A 1KE1A 3ZE7A 4PO1A 1JNXX 3DEIA 3T9CA 4XR9A 3G9UA 1QBGA 3EZYA 4MEAA 1A7KA 1B16A 2J7PD 3OCZA 2VYQA 3H5AA 3N7TA 4LMRA 4Y30A 2ZOSA 5BSTA 3OCXA 1DIOB 1YUNA 1KNXA 3KDPA 3UH1A 2YWXA 4N6NA 3PHCA 2IZ7A 3AHDA 3E61A 4HAUA 4U2FA 5D84A 4BP3A 4F8JA 4ER3A 5BWCA 1H0KA 1EVYA 3A9VA 3PDWA 1CEYA 4N82A 4R9SA 2QROA 4L57A 4NOKA 4Q9IA 3VHRA 4TZTA 3IDAA 4D81A 5I45A 2RSLA 4E33A 3R24A 1U9YA 4XDHA 1Q0RA 2WF9A 1P7PA 1T25A 1QONA 5KYWA 4JITA 4V3BA 3KP1A 1GTZA 4MRNA 1YJ5A 2AXNA 3AHHA 4X1IA 4O2BB 4BKRA 5ILGA 4F5WA 5B7PA 3OG9A 4U7WA 4Q5IA 2QN1A 4ZU1X 5T6MA 4Y6PA 2H2GA 3TLXA 3BX1A 4CKCA 3VBEA 1KYQA 2W2TA 4X3PA 4EI9A 1GPH1 4NY1A 3C3XA 3AR5A 1TEVA 4KI7A 4YDHB 3TKAA 2GRJA 3DULA 5MFPA 2Q1XA 1NBME 3Q98A 3IS3A 4HEJA 3KG2A 4IZHA 2VBFA 3FZEA 3QTBA 2P41A 2R85A 4NJMB 1LI4A 1QGUB 1XUOA 4XGIA 10MHA 1NI4B 2JEYA 3CLTC 4BP8A 3GLHB 3O75A 3RRMA 2O0MA 4ZOQI 3TK1A 4B3FX 1LRJA 2PRJA 1KVQA 2YCLA 5H82A 1QQBA 2W6ID 2HDHA 3WK5A 3NAMA 4FXOA 3U4QA 4EGCB 2AD5A 1E6UA 2ODNA 3GEIA 3CY6A 2VZLA 1YZKA 3HABA 3JZIA 1KVTA 1CUYA 2YQZA 1KVUA 2A7QA 1IJKA 1CFJA 2H5IA 1GIAA 2O1SA 2YOFA 3OU6A 5FOVA 3ZTYA 4CIVA 3T1YB 2IW1A 1IPFA 1OFTA 4ZAYA 4FD3A 1M75A 3R3UA 3G5AA 4JEMA 3EXG2 4TSFD 4BO4A 1NYLA 4LVCA 4DLZA 3E9RA 2W0MA 5KNLA 1MQAA 4NCAA 4MYCA 3JYLA 2CLOB 1VGQA 4GPD1 5AVOA 1C4OA 4CM8B 1D7OA 1LDMA 2OAGA 4Y2JA 1PDVA 4QNMA 1DKPA 1UOOA 4IFIA 1WNTA 1NNEA 2I55A 3JAKB 4KFUA 3PLAE 1BVRA 2CDRA 4NJEA 1C7ZA 2IRWA 3W4KA 4ABYA 1N2SA 3S7TA 4HXYA 4IF4A 1BFKA 1G2QA 2Y76A 3KPUA 2MOKA 5DI3B 4TUYA 2QA5A 1L5WA 4CG1A 4CMAA 1ODLA 5A7GA 5A7HA 1DB3A 5C31A 2XVXA 3D8TA 2IPXA 4N1AA 5CVCA 1AXGA 3V00A 3S28A 5FUVA 4EKNB 4KR3A 2BFCB 4BFZA 4BO6A 1NY5A 3ZHZA 5MFZA 4M1EA 1OPXA 3CWCA 4HNSA 2BONA 3ADCA 2BHTA 2TSYB 2ZKIA 5EMLA 3SHTA 5KI6A 2ZPUA 3HB4X 1NNI1 2PR2A 3KQWA 4XVQA 3T6KA 3V4LA 5J58A 2UXBB 4M86A 2WMNB 5LUAA 1Z47A 4HY3A 4RZSA 2VNJA 4UPEA 4XOUA 4WINA 2PLWA 4C3UA 3ICVA 1R8SA 5DOZA 3TOXA 4RY8A 2OC4A 5IJZA 2UAGA 1RZUA 2EXXA 4IIJB 4DJJA 3DMFA 1DKNA 4IIJF 4OQNA 4QOGA 2PKXA 3BJRA 3URMA 4F4JA 3NX4A 3U2QA 4HLQB 2OILA 1CUBA 2V7BA 1N2GA 2FMIA 2PMCA 3IP1A 4WNCA 1P9OA 3UUFA 3PUJA 1WETA 4HN4B 4YIKA 3SHQA 2V1UA 3T99A 5EUQB 1ORDA 3WQRA 1JDSA 1NYQA 3L8FA 4Y8VA 3ZDXB 1ICEA 1OX4A 5B4VA 4EDHA 3EQ7A 1AQJA 1VG8A 4MP8A 4YJ2F 1T8PA 3PI7A 1WSAA 4L51A 3NKLA 1NJ2A 4QGSA 2HSWA 4YV0A 1GUFA 2R2AA 5ADWA 2B94A 3FVWA 1JF8A 4ZJUA 1ZGAA 4OYYA 2FEXA 3O8QA 1IUOA 3VYTB 3T3PB 2MT9A 5AI9A 4B45A 1SKBA 3WLRA 1KAGA 4K03A 4NZOA 4ZK6A 3VOAA 5KQSA 3ZVMA 1LLDA 2B2CA 1KEKA 1T0UA 3I5XA 3HN7A 2YN4A 3IAEA 4ARCA 4Z1MA 3DWFA 1A71A 3E7PA 2CB0A 2OAP1 1SA0B 1HYQA 1NFRA 4FI3F 1QCDA 2Q41A 3IQHX 4G5FA 1LC3A 4O4IF 5EEGA 4Z9XA 1S2NA 1WSWA 3C0KA 4LQDA 5IAJA 3IVMA 4RIFA 1AVTA 1EWRA 4P4TA 1EEXB 4DLNA 3TWOA 1U5BB 1RYEA 3ZDAA 2G67A 1EZ1A 1N8KA 2YWHA 3X1JA 4CDMA 4Y6GB 1ISPA 1NKTA 2AUNA 2DKNA 2PZFA 4P33A 4TS3A 2PV0A 3I73A 4Y0NA 3R5TA 1L4FA 1OX6A 2J9XB 2PG3A 2R47A 5AD1A 1P0PA 1LX7A 1S89A 2D5AA 1DV2A 1IUKA 2PT5A 3CMMA 5JVDB 4ER0A 4KDCA 1IM5A 5HZMA 1V2GA 5ALRA 4Y9TA 2NO6A 2VT2A 4KACA 4EY3A 2HPAA 5FLYA 1M1YB 2O48X 1G21A 4OEHA 4DXAA 1LB1B 3AR8A 4WOKA 4I4TB 2PS3A 2YXNA 2JARA 3FOBA 3SF0A 1IZZA 2GKSA 5IF3A 4KWCA 5B64A 5FR2A 1XZGA 3FVQA 4TV8B 5KDOA 4LDQA 3RLIA 1OYWA 1CY0A 2COKA 1T6XA 1WZCA 2H1VA 2C88A 1NQTA 2BUAA 3ICWA 4MS3B 4YP1A 3A0UA 3Q11A 2AW5A 4MIOA 1TZ2A 4FVTA 1Y8QA 1AQNA 4K86A 5EZYF 4BN0A 4PIVA 1X1TA 4RAOA 4JBLA 4OYRA 3V1NA 2PYZA 3SFVA 1JHAA 3BWVA 3ORRA 4OGLA 1PL6A 4AP6A 3FFAA 2LCQA 4OHYA 4IGKA 3O83A 3LECA 2QP4A 5HNKA 4ABTA 4LMBA 4TV9B 1BCSB 5U4XA 5I01A 1AH2A 5FTJA 3OC0A 3VC3A 3U4CA 2QUKA 4J94A 4IWXA 2D13A 4LZLA 2JLWA 4TM8A 4S05A 2GUGA 1MPXA 4IICA 5A5FA 3ILYA 4MMZB 4QBIA 3W3ZB 4I46A 2REBA 4TMXA 3K6SA 1VCHA 4TSRA 4CMIB 2X8BA 3G9TA 3HB5X 1M0SA 3I1IA 3MJHA 4M22A 2WVHA 1QKKA 1HDOA 3KB8A 2BZGA 4Z4IA 3VPHA 3ZUGA 5H70A 1ZN8A 2NO0A 1IY0A 1K6JA 5ETJA 3V4ZA 1M34E 1PSZA 1XQYA 3GLKA 2J9FB 1O0BA 1O5TA 2WICA 4EF5A 3B1ZA 1E9DA 4NQZA 5CBPB 4EZBA 2HLNA 4QM7A 1ZH4A 4JFRA 1CG6A 4GAEA 4Y9RA 3KVOA 1AHHA 2QEQA 5CFQA 1WBJB 5C3MA 4QYXA 3DSRA 3B52X 4GLJA 1B1CA 1F38A 4JIGA 2VXYA 4A23A 1LI5A 4EF4A 2L2QA 2E4ZA 4RESA 3BN3A 2VQEB 3GR6A 3QMMA 3U7EB 1DG9A 1PJ2A 3DMPA 2CVPA 4ZCSA 3TTYA 2XJ9A 2VSNA 2I8LA 3JALA 2E5FA 3MT0A 1N2BA 3ZD9A 3T0FA 3H9EO 1JDPA 1UXKA 2AK2A 5IW8A 4C0AC 4AX8A 4MQ6A 2AFIB 3RROA 1W73A 2IGBA 4ZXPA 3JAMA 2F90A 1WXQA 2XDWA 2XA9A 1ILEA 1TIPA 2ZGVA 2GBIA 1O6FA 2YYSA 5I7UA 5KNBH 3GRYA 4JHLA 1RC8A 1UBTS 4TL8A 3KM0A 2BDEA 1AUOA 1ZNQO 3KD2A 1G4HA 5E1MA 3ZY2A 4URUR 1KJ8A 2PSHA 2C5BA 2QTMA 3I6QA 1SC3A 2NNLD 5EP4A 3RS5A 3UJ7A 5KJFA 1LLFA 1QIEA 2ATVA 4HX9A 5EA2A 1TMOA 2ETVA 2XMGA 4HQ6A 3AKDA 4G8JA 4QBHA 2R6JA 5B53A 1QKJA 1QGUA 5K9ZA 5KNDH 2CK3D 1MC4A 4I50A 2BKLA 2WYVA 1F3OA 2G9QA 3IQIX 4DR4B 1N0VC 3H2KA 5BURA 4DWOA 3W0LB 5AIBA 1QO0A 4ZQBA 3I5AA 1KYZA 1Z3CA 1I5RA 4OLAA 3R6DA 2HF2A 4TYWA 3ICPA 2BGIA 3A4YA 7ABPA 1Y9JA 3AZPA 2RGNA 3O8LA 1DC4A 3HKEA 1HE4A 2ZVPX 5JC8A 3Q3CA 1Z18A 2IHBA 3COWA 1KEUA 2ZB4A 3RRFA 3PHHA 5F7JA 2D1YA 2V7TA 5JFOA 4RTMA 4LWPA 5F23A 2IS4A 4M0KA 5IASA 1E8DA 4D8VA 1P3JA 3NXSA 1DWQA 5SICE 1AHNA 4F4HA 3PEFA 1E9AA 2JKVA 1CNFA 4GS5A 3CZCA 1IMOA 4MB0A 4NVRA 5A3VA 1XEXB 3QVXA 3UXYA 4FHEA 3F3YA 4ZOEA 3EXHA 5SZIA 4EUHA 2EFYA 1VJRA 2F67A 2LR0A 3PT5A 4HGPA 9LDBA 3FHJA 2D1RA 2Q49A 4ZAZA 1UXGA 1IPEA 3NGMA 1UEXC 1DFGA 5IVIA 3SJCA 3QX7A 5F3WB 4B6FA 4QDUA 3KSZO 4CN9A 1SUEA 1Z0JA 1TA4A 1X92A 4DS3A 1Y6GA 1Y98A 3TPFA 1IN7A 1Z63A 2QENA 4XB1A 4G37A 2C84A 2IDJA 4J0FA 4E32A 4MS1B 4HB3A 3UV6A 4QOIA 3PR3A 3G7SA 1AQIA 2H0QA 3FMFA 4JGBA 3LGSA 5CNJA 1IN1A 1XZDA 3FGOA 3N75A 1OHHD 3RSQA 3B1FA 2GJKA 1VPEA 1W2GA 1DNPA 2N75A 3E1SA 3OEYA 4C0BA 3CHYA 4FIDA 4KK4A 4CIXA 3OZUA 4KPFC 2AKAB 4TN5A 4DNXA 4F3CA 1OA1A 4FYYA 3VKVA 1L6IA 2GK3A 4GLOA 2BJWA 4CV3A 2YN2A 1OXTA 2ZBDA 2HGSA 4EHBA 4N12A 1EM6A 2HWYA 1XRNA 1QGZA 3DGFC 2EIHA 3PPYA 1Q22A 4AJLA 5JZMA 2RBEA 4HYTA 2EW2A 3SHOA 5B1HA 3G5TA 1MRSA 1ZXBA 3DBLB 2PRSA 1ZU4A 3H8JA 1C9MA 4S24A 2VR1A 4BMYA 4HVCA 1G63A 1ZOPA 2OCGA 1TW2A 5H4GA 1BWRA 3ESBA 2H7VA 3A10A 1AGPA 2ZR8A 4NWIA 2FDCA 1X9IA 2JAUA 5JATA 4LX8A 3QE3A 4DSOA 4MWGA 4MWSA 4X3OA 1TECE 3TEJA 4H0CA 2SKCA 4Q4HA 4Z2YA 4CF7A 4FOLA 3E8MA 4GO1A 4PG4A 4RVNA 2YKGA 5ERGB 2BUBA 3HUDA 5EZ6B 3LOPA 3DE0X 1RKVA 1W5EA 2C5GA 2JBHA 3AJDA 3DTVD 3X3HA 5BW4A 2RD2A 3ZN2A 4AY4A 1N36B 1T91A 4DYHA 3OU2A 4QPNA 2NLOA 2H57A 1F12A 3QVMA 2EP7A 4F6RA 3PWSA 1VLVA 4EY7A 4B7XA 1KZ7B 2C95A 3NPAA 1T2EA 1T35A 1IAQA 1RFLA 1NE7A 4JQSA 4KQHA 1CW2B 3ZE1B 3VA7A 2JCXA 2TRSB 2A1TS 2PIAA 3VC1A 5JADA 2BKXA 4E2YA 3OLCX 4XE5A 3PUYA 5EHGA 4Q18A 2ZRCA 3F7TA 1W59A 1TU4A 4D74A 1V8FA 4L85A 4B35A 3H13A 6REQB 1WOYA 1MOPA 4QJIA 4Q4DA 3L3BA 1FVOA 3P9NA 3VDRA 2OXIA 2XSZD 5F9FA 3R3YA 4RL6A 1DZIA 2H29A 5FA5A 5JJLA 3ZDZB 2AN1A 1JB9A 4BZWA 3DDOA 3AR2A 1S1MA 1DJPA 2OO5A 4GOMD 4HG2A 2RGDA 2RAPA 5BXQC 3N0RA 4H3SA 2HBQA 1Q95A 4ERXA 1U04A 4BCCA 1Y8QB 3BFJA 1G4AE 3H1FA 4DMHA 3PDIB 1SU7A 2PZJA 5EIBD 4TQAA 2C5FA 4A3SA 1RHRA 1U28C 2BGUA 3W6ZA 1ORWA 5LR6A 1KDTA 4PAGA 2G82A 3VTAA 2PTGA 3LKZA 1XO1A 3TX2A 5KNBA 3HKDA 1H3EA 2HX1A 2NT3A 2QM8A 3T7CA 5MGNA 5ALDA 4QXPA 2BFWA 1QF9A 1BXKA 3CO0S 4QUKA 5K8VA 3BJMA 3HGQA 2UKDA 4K26A 2I7TA 1AKQA 2OK7A 3PG5A 3VZSA 3G79A 3IOYA 3P97A 1BU5A 2WAXA 3ZS8A 3ZY6A 4X7RA 1X7XB 1YUMA 2FPXA 2H18A 2ZZNA 4NBLA 1JDVA 5HTOA 1MD9A 3CEAA 4MGZR 1ZK0A 1VLZA 3GFRA 5I48A 4DR7B 3UT5B 4ND2A 5KTYA 1XOIA 2GZRA 1HI9A 3M4ZA 4CMBA 1LH0A 3PF9A 8MHTA 2JAQA 3BRQA 1Q7CA 4KLRA 3O3MB 4GX2A 5TGDA 3LO5A 4NCIA 1RXVA 1S2LA 1VI2A 1NW8A 1CWUA 3B7GA 5HIKA 4Y1FA 4G09A 5ALPA 2WPNA 1P2FA 3AHEA 1TCVA 3CF6R 1X7ZA 1K92A 2CDAA 2FP4A 5AT1A 3OJXA 4CMJA 2H2HA 4RENA 3CUTA 2ZB3A 1TUIA 3OZVA 1J20A 3LHKA 4MQLA 3TUIC 2D62A 1MA0A 3OKAA 1FEZA 5DHFA 4F92B 1HMYA 2C2HA 1CNMA 5BNFA 4YX9A 2JLXA 1XCOA 1ES9A 3W1VA 1P74A 3HVJA 2X4IA 4KPYA 3ZHTA 2BM8A 4PFSA 4AICA 4MUEA 1NKVA 3H83A 4B0PA 3UG7A 4Y2GA 3FNBA 3AETB 4R69A 3JQCA 5ALTA 2X1VA 4LDZA 2PH5A 4Q9JA 3ZZ1A 4KITB 3OOEA 3I0MA 1C9JA 1PUXA 2ZSBA 1I0IA 4XCVA 5EYPB 1JTEA 1PTJC 3QLUC 3ZWKA 2C8VA 1ECFA 2C2BA 1B6RA 4M89A 4N9QA 3AERB 3QU5A 4MKZA 2PLFA 4H7JA 2VHQA 4KQ2A 4X45A 3NZEA 4XTRA 4E6PA 4CMEA 5I51A 1O96B 2WJHA 2IYXA 2OVBA 3PIRA 5E6SB 2JH8A 3L7LA 2YR0A 4V0RA 4HD8A 4GXQA 1CVIA 3MJVA 5DKFA 2QTNA 2HFKA 3N2KB 4UATA 2H3EA 5MN5A 1YS4A 2IZ1A 2C1EA 1FBTA 1P2BA 3M6IA 2X9NA 1WOMA 2HTFA 4R6WA 2W90A 3ZTTA 1PO7A 2IGTA 3QE4A 4PHHA 2G7ZA 4B8WA 1ZD4A 4BNFA 4O4JA 4OQMA 1I3OA 4OHOA 4HUTA 3VFDA 1DC6A 5C8XA 2JJQA 4H31A 4KREA 3FWZA 4OHVA 1I6MA 4TTIA 1ZUNB 3RBZA 3SAJA 3ZQ6A 1XZHA 4UBNA 4AF8A 4C7VA 1UMCB 5IBRA 1TKBA 2TYSB 4KTVE 4MVJP 3GPIA 3GXBA 1FFXA 3OF3A 2WD8A 3OJEA 4KIFA 5FLKA 3UWPA 4FDLA 3WNDA 2CKMA 2AEEA 1KDVA 4J1TA 1ZQ1A 4B48A 3KTFA 2XA2A 3IQZA 3H84A 4QJBA 1M2EA 4O4HA 1FUEA 3K0KA 5FTKA 5LC1A 5LNK1 2M32A 3IKJA 3P0IA 3S68A 1FYFA 1HTTA 4CI9A 5IC4A 2O05A 3DAPA 3JQRA 2W5UA 1JHMA 3M82A 4QEZA 1CIPA 4H3KB 3ENZA 4AY3A 2ZVQX 2C9ZA 4FLFA 3WKAA 2VBGA 1QFYA 2RGBA 2X5NA 3AL2A 3CN9A 3WL5A 1AUVA 1DKOA 3FETA 5HBRA 5EVJA 4WTOA 4CVNA 2AQIA 2DWQA 1RZRD 1NF3A 2PXXA 3SQXA 3L0IB 4FWTA 3DDNA 3H19A 1TC2A 1YFZA 5CK4A 1B76A 1QGED 4D6PA 5IABA 3ZQJA 2X4LA 4OHXA 2QVGA 2DR2A 2HXSA 1DPFA 2OFXA 4MV1A 1CHDA 1W0JD 2EOAA 521PA 1M8PA 2NTVA 3TI9A 3IEIA 3AI7A 1ORRA 2XAUA 2ZWAA 1K8ZB 5KJ1A 1QJ4A 2NU9A 5CYGA 3INTA 3V7WA 1FQWA 2NZYA 1YGYA 1NQWA 3ZBQA 2KLHA 1XR3A 1XQ1A 2JLRA 1M67A 1O9GA 4QTZA 4Q1VA 2ACKA 2G70A 2H1IA 1T8RA 3FCSB 3CKLA 1UKCA 5BUZA 1US8A 3B85A 3VO8A 4E4TA 4C89A 4J0QA 2XITA 4YGYA 2ZCUA 3T7SA 4JVLA 1Z83A 1SU4A 2W8BA 3MGKA 4I7EA 5EI5A 4RS3A 2G08A 4GVLA 2WVGA 3SC2B 4ZCRA 4XXHA 2IX9A 4I5FA 1FFBA 1W85A 2B78A 1NF8A 5L95A 4YRNA 1ZC4A 3GT4A 4FGWA 3CINA 1ZW6A 2X0IA 4CR8A 4R1UA 4PU0A 2JLBA 5AXCA 3CX3A 2ORWA 3OD1A 2PSJA 4DLXA 3DO5A 3DBIA 2I6TA 1ZNYA 2JC3A 2RCYA 1ESZA 4YECA 4EA6A 5AW6A 4HNAB 1K8QA 1YKGA 3I2FA 2VRBA 3CR7A 4NPAA 3TTVA 2W2NA 1YTUA 1JAHA 1GV1A 3FYSA 5FBHA 1UFVA 3ADKA 1J9EA 1V47A 3BD9A 1VRWA 1FQKA 5C3UA 4BEBA 5BNWA 2VKQA 4O59O 5KJCA 4MVJH 2EQAA 4R1PA 3I83A 4KAAA 2JFVA 4XJXA 5JMOA 1MENA 1ISMA 3LWNA 1U9JA 3NBXX 3I05A 5ER6A 4EYEA 1U0FA 3C8MA 2NU8A 2DJIA 4KR9A 1XSEA 3GL9A 3P32A 1E2PA 4MW9A 2ZIFA 4KO1S 4MA5A 3IV7A 4XRGA 1KQOA 1RXCA 3SOPA 2Q2WA 4R0NA 5AW3A 4KG7A 1BDIA 4C6HA 5EPEA 5B1DA 1NOKA 2BV3A 4C03A 2ZPTX 3BEOA 3HH8A 4ZVOA 4Q24A 4LGMA 1NX6A 4J29A 1VXRA 1SBZA 4G85A 3WLNA 4BWVA 3DDZX 1OI4A 2DE0X 1XMXA 2YOHA 4KLZA 3THOA 1UC4B 1XD2B 1JI3A 2AT1A 3QMPA 4OVKA 1YJ8A 5C1DA 3GX1A 3H75A 3KQPA 1O95A 1QCCA 2WPDA 2OTCA 4RXMA 4JYMA 2PD4A 4DOMA 4E21A 4IV0A 1IU9A 1LDYA 4YCCA 3ZU2A 5LQJA 2DHQA 1N34B 3N2IA 3I9FA 1G5FA 4FS3A 4WOCA 3V2UA 4OBBA 4GOXA 3H87A 4ME6A 4D42A 1VHQA 3FSGA 1VYUA 2J9GA 2FWJA 4BTVA 4J2TA 3DWGA 4DCNA 3G9XA 5A3QA 3ZZ0A 2JFZA 1OB5A 1SUFA 3VNBA 4TVBA 1KO8A 2HXGA 4ZRMA 3NBZC 3V4OA 2HA5A 1P8AA 2ONKA 4V0KA 1ZM9A 3X1DA 2VPTA 4A73A 2IA5A 5C32A 4BAZA 5KAMA 2WMYA 3H2HA 3G17A 4P3KA 3ONNA 1GRRA 1Q7GA 1KIFA 3I92A 4JA0A 1UF9A 4OK6A 4XQEA 4BP9A 1BGWA 4JZYA 4KMOA 4B3RB 3GLRA 5EJ8A 2G1KA 1A9SA 3MLAA 4C0HA 4MUNA 1CRLA 3RRYA 2IHUA 4DTIA 1FNMA 1PGNA 1V35A 4KN6A 3EIUA 4PNZA 3ZWOA 3LKVA 2QJTA 3WLEA 4BGVA 5I7EA 1W1IA 3UK6A 4AM8A 2BFEA 1ZM4A 3IODA 2PWYA 5A0FA 1SUBA 2FE4A 5I5GA 5M34A 1C0KA 1L4UA 1UUFA 4S1VA 4JKYA 5I7SA 3L0OA 1WCXA 1U8EA 2YWBA 1J21A 2IYRA 1Z0UA 2PL9A 1E96A 3K4HA 3WGNA 1BGVA 3B1JA 1JDZA 3ECSA 4L73A 4RF3A 1Z45A 4D9MA 3GNSA 1U3VA 1YZUA 3UB4A 2Q5CA 5K01A 1GQ2A 1I3KA 1XRQA 2XTAA 1NBMA 2QM7A 3R8XA 1Q12A 3G2HA 5TQ0A 3TNDA 3FR7A 1A5AB 4BMNA 1K7FB 3FTCA 3JATB 3LPLA 3UKJA 1M1NB 4DMKA 1DWUA 1SEPA 3SLKA 5DISB 5CFZA 1QDLB 3USCS 1FDRA 1M1NA 3VSDA 1JR3D 2REQA 4QASA 2I99A 4AVYA 2A1UA 5CITA 4P8RA 1QE0A 2GN6A 4TV9F 5DXAA 4UBIA 3K5PA 3R76A 1BWQA 1F5NA 1LDGA 1NUTA 3AFHA 1PJBA 5FBZA 3AFMA 3TIXB 3EVCA 4JLNA 2CXHA 2GK7A 3GY0A 4UHEA 5BQ5A 1MVLA 1F8YA 3Q8XB 1ZWKA 1J7JA 3ISVA 3ZHRA 1Z3IX 4REMA 4R0MA 4AKTA 3H18A 2Y9PB 4NYIQ 4BXOA 3FYDA 3HZRA 4EHLA 4CIWA 2W2KA 2RHWA 1YDEA 4BXOB 3ZU3A 1Y33E 4PHFA 3EMKA 3ZXUB 1A8SA 5B55A 1P4JA 4UCQA 5B58C 3HXOA 3B5JA 2WE8A 4Q1CA 2Q50A 2H1WA 1KZHA 3NAQA 4CMHA 2ZYSA 3VR6A 2VP0A 2QQGA 2C99A 1GL3A 2PWPA 2QDXA 4MV6A 1VE6A 3Q3IA 4JLSA 4C7XA 2G40A 3IULA 4MR7B 5B3KA 4D0SA 5AI8A 3SZLA 2JLYA 5HJ7A 2W58A 5CJJA 4J90A 5LQSA 3TVTA 1Z2EA 4EHFA 4ZI7A 2D5BA 3DL4A 2OQVA 4BNTA 2C7RA 3Q6MA 1DXYA 1EK0A 3U9LA 5CW1A 3KJEA 1GDTA 1VIDA 3LUCA 4RIIA 4A8JA 3PC7A 3PXEA 1AHIA 1VHJA 4J16C 4E3WA 1J1UA 4M0UA 3T1TA 1U80A 3AV3A 4OU5A 1GPWB 3CA8A 2GK4A 3CKYA 4O02B 4A27A 5DNCA 5JDIC 1A27A 1YMQA 2FCRA 5LJIA 1ZISA 2N46A 4GMDA 3PX3A 4PINA 2OC9A 4J1SA 4X8OA 1KOLA 5LKAA 4DCVA 1LF0A 4ON9A 4MVJF 3T5PA 2GPSA 1U6JA 3NJ8A 1WB4A 1Z2PX 2HHHB 2VJCA 4IVRA 1GPMA 1J9GA 5I9TA 2FUG1 3X1MA 2RB4A 4HKTA 5D5QA 3FCUB 2QRKA 1NXTA 4QPDA 2BGWA 5CK5A 1JWAB 3KYDA 1XV5A 1E3EA 1JTVA 1PEDA 1T2UA 2HCJB 2V6JA 3I4FA 3I5YA 5H3CA 4BLUA 1AK9A 1U3UA 2EZTA 3GD5A 3QTTA 3OAAD 2QN6A 4IJUA 2VF5X 1UDCA 4I2VA 4MEJA 3TOSA 3DF7A 4LISA 3TZQA 2PANA 4ZV4A 1MJHA 1RCUA 2O7NA 2Z2KA 4IKPA 1JZTA 3MW8A 5B57C 1BAPA 3T3DA 4BY9E 5CR9A 1G291 5A5DA 1EI9A 3PGLA 5A4AA 5C46F 1Q0SA 5CB8A 4LC9A 1N0IA 4H3VA 3WWYA 2FWNA 2RGEA 3HBAA 4IDDA 3SMQA 1GL7A 4UOEA 1E1YA 2FFRA 2GKOA 3DXZA 3OX3A 3ZEAA 1DJMA 4JR0A 5SYNA 1BC5A 3AT1A 2X0DA 1KAOA 2B5OA 1DJNA 2B92A 2P9FA 4GSYA 4KLNA 1C7JA 1FMJA 1UT6A 3CBGA 4NBUA 4DEXA 3CVWA 4K9OA 3EGXA 4DQXA 5BN4A 1YVPA 3AI3A 2BE7A 3MG9A 1SHJA 3KT6A 2EJWA 1XZKA 2GJSA 1WU8A 2PNFA 4I99A 5D87A 3RHTA 3RS8A 1WP4A 1YC5A 1VG1A 1L1FA 4EB6A 5TX7A 1L7QA 3TX6A 1N32B 4P4SA 4YI5A 1RI5A 2WB4A 3RS3A 2Q27A 3OQIA 2X14A 3HCEA 4I66A 4FFSA 1XTJA 2L0XA 5HZKA 4FMBB 1P5HA 1ZMOA 4Q15A 5ALVA 3ZHOA 4CDNA 2C07A 1KDZA 1P0QA 2CHVA 2Q9CA 4Y6QA 1JG1A 1OYVA 3BCHA 1JEOA 2JFHA 3B78A 3UMJA 4CMEC 4YCSA 1GKYA 2A2ZA 8OHMA 1G2IA 3SI7A 3D54D 1ZU5A 3ECAA 1KPGA 5KYKA 4BO1A 1C9NA 4RPGA 3GD7A 3THRA 3LPMA 5IC6A 4DIKA 3ZKAA 3CNOA 5L3SA 1TF7A 1UJ4A 3D4PA 3ESYA 1G21E 5DM1A 2EBHX 4TGLA 2UZ0A 4UQLA 4QJ4A 4J9VA 3GRVA 2OB2A 3OUUA 4FWBA 5ITSA 2NMVA 1ULHA 2DH6A 3UJ8A 2D06A 1DLIA 4CM9A 1IK4A 1SC1A 3F2IA 4X84A 3OIVA 4RD0A 4QATA 4EGAA 4QPPA 4JI4B 1F8XA 1T3ZA 1KSGA 3I4LA 5JAZA 4NJMA 4J8PA 1B23P 3T4EA 3LWZA 2F9LA 5CJPA 4Q7QA 2O3TA 4KWEA 1N0WA 1PTJA 2PS0A 1NJ1A 3HEBA 1PNTA 1YNSA 3P0FA 2CLSA 3GPLA 1ISFA 2HWXA 4MPDA 3GZTB 3NTRA 1RBYA 2I9PA 5LQKA 3SDZA 4L5BA 4ZU6X 1QRTA 2D8MA 4F0JA 3D4NA 1R0KA 3V2HA 1JPUA 3IP9A 5FI3A 2HRRA 2XODA 3T35A 2QU7A 2FTKE 5EJ9A 2P6NA 3CJTA 3KQTA 5LB2A 1HETA 1E3LA 1YR6A 1D2EA 2VDQB 2J5QA 1XT6A 1PJCA 4Z9FA 1FXSA 5BSFA 2V98A 3DLHA 2O5RA 1X14A 2AKYA 4E5NA 2WJ3A 3A3OA 4M1MA 1ECLA 3IP7A 4S1TA 5A71A 5C5EA 3O2JA 4JYPA 4KDFA 4RLQA 3K3PA 3RFUA 1KZYC 4KYTA 3U4AA 5ED4A 1FFHA 2C9YA 5JCPA 4JOSA 4J3JA 2P35A 4UUNA 4CKCB 3E27A 1S5PA 5DE3A 1O03A 2IT1A 1M6HA 2MSNA 3ITNA 4LN1A 4NK5A 3ZQ4A 2AG0A 3KETA 3BMQB 5AOCA 3ZU6A 3Q7SA 5DW3A 2FW0A 1TT5B 5FWDA 1IHOA 1FYEA 2HUNA 3OCVA 4WZAA 2WWRA 2C04A 3TQHA 4Q4CA 1U9IA 2IHYA 3CLRC 5ADVA 5K3OA 3WLAA 1RZ3A 2BGRA 2JGIA 1I6LA 4DA4A 3MJSA 3LNTA 3EVGA 5EERA 5CD9A 1JQ3A 5GINE 4H4CA 1OLUA 2HMAA 5B3JA 3C5CA 3SS7X 2Y8EA 3AZQA 3VSBA 4L4XA 3AI1A 2ZUFA 4P0QB 2QY6A 2RHCA 3KEMA 4JC8A 3FWPA 1VKRA 2BTQA 5I7VA 3HYCA 2AN5A 3N8GA 3E53A 1Z35A 3RGWS 1N0UA 3PEUA 4BNKA 2RH4A 3HUFA 1WMSA 3F5QA 3REOA 5INTA 3M6VA 4LGYA 2BKUA 3T41A 1YQDA 3BF7A 4PS1A 3VR0A 3OZRA 3BB3A 5FBWB 4EB3A 2WK1A 5LIPA 3ZNPA 1XZLA 3HADA 3TEMA 2JHPA 4WMLA 4C2AA 3DD1A 3AUXA 1DAKA 5TQ2B 4JZKA 2IXGA 3GT7A 3HCPA 3LJKA 1A2OA 4DCCA 1R3UA 2J3KA 2W48A 2IXBA 1M2OB 1M34A 2XYRA 1FC0A 3KCQA 3IBTA 1KDYA 3RU7A 2WQ7A 5CM8B 1AUQA 4WIAA 1ACLA 3MM4A 2ZIGA 1LLUA 1PD1A 1DIAA 4F72A 2ENWA 3G2NA 3HNOA 3TEFA 1GAQA 4Z4CA 5BN5B 5A04A 1Y1SA 3HDTA 3SVZA 4W5WA 4F3TA 4NH4A 1V5FA 5DTJA 4IWNA 3PQ4A 2ANBA 5ECDA 3KZ1E 3WV4A 3CH6A 3CGGA 2XWQA 1QZXA 3DQQA 2RDMA 4I3GA 4EHNA 2QR2A 4EW3A 2FP3A 5KDDA 5HKKD 2FPIB 4I5IA 2ORYA 1V1MA 1N75A 4FYKA 4M7PA 3W9SA 2FG6C 2YZMA 4BTEA 3A28A 5FOWA 1SC6A 3EGDA 3R40A 2W6OA 2AFIE 1D04A 4EPYA 3Q3EA 4BPRA 3H7IA 4ZQFA 4AKHA 4K9QA 2NQTA 1ZLYA 1YL7A 2ID8A 2RFLA 1LWOA 1R3DA 4HC4A 4KVGA 2HZBA 5FAXA 3U26A 4DRZA 4U6NA 4Y9SA 4YS6A 3BUSA 1VMDA 5KMGB 5BSUA 1XZJA 2Z9DA 4TLBA 2C82A 2ZJ8A 4V0QA 5I7HA 4DLAA 1YVDA 1WLYA 2P69A 4YLGA 4IRMA 2GZ1A 5D3QA 3KXDA 1QIJA 4LA4A 3QJYA 2OHJA 4NCNA 3ND7A 1ZAKA 5L3RA 5AKHA 2Q1TA 2HCRA 4M8LA 4QEKA 2II6A 4GOLD 1KEWA 5HA5A 2NUAA 2A1UB 3PC2A 1K8YB 1L7BA 4K05A 3ZGLA 3NEPX 4F3KA 4R2HA 4TKZA 3JAKA 5C7IO 5ECYA 2P9HA 3W2EA 3K70B 3DPIA 2EJVA 3VKFA 5L3QA 3U3XA 3RS7A 4FINA 4CKBB 2AOVA 3RYHA 1HE8B 2IEIA 3MJDA 1UEJA 5BN3B 1DCKA 2F1KA 1ESCA 2PMEA 3IHKA 3ZDQA 3Q9UA 4OF4A 1V96A 4Q0MA 5HKOA 3IGFA 1GDHA 2EWMA 1GN9A 5FUMA 3BFXA 1G8JA 1V7ZA 1UOPA 1KMHB 4BRZA 5IVKA 3AW8A 3FVVA 1OD6A 1DQRA 4QXOA 3QEMB 5JMTA 2V5VA 1DOZA 1RP1A 1WXXA 3RC9A 4MUMA 4DBLC 4YMUA 3T7IA 3CLTD 1XK6A 4PPQA 1Q0UA 3G2MA 1G7TA 4LY0A 1CRPA 1N1MA 4YUVA 1J5PA 8ATCA 3PKIA 4H0FA 3CURA 1MFPA 1Q1GA 1YR1A 3F6EX 4N0EA 5BMVA 1EAYA 2YRWA 4BWFB 1GVNB 1C80A 1XHFA 2B5VA 5JECA 4OYLA 4ARIA 4NONA 2O7SA 2JASA 4AB1A 4Q3NA 4DMCA 3ZWYA 3O8NA 3RTGA 2BR4A 3KHKA 3P9IA 3PTZA 3O3NB 3O4IA 4BNWA 1RVDA 3N0TA 1EFAA 4KMMA 5DXFA 2O8CB 4EATA 1MX3A 1OX4B 2XEXA 3BGSA 2RGYA 2H52A 2BH9A 3IVRA 4G4GA 4JBGA 4TKUA 2YRXA 1F0YA 3L0BA 1H6DA 3PQ3A 4LFAB 4WKNA 1U2GA 4ARBA 1NPTO 1JHZA 3CZRA 2R7LA 1E2NA 2YXBA 3EZFA 2LE0A 2PH3A 3MBOA 4P86A 2Q5LA 4MUGA 1LPAB 4U02A 5AM0A 2JFXA 2FXVA 3WB9A 4DR1B 1W76A 1NXOA 1II9A 5IWAB 1ZGBA 1E5XA 1A8IA 1TJ5A 4JK3A 3H4IA 4Y7DA 2CHUA 2I67A 4YRQA 2B8NA 5AK6A 3LC0A 5FOXA 5KVVA 4I55B 1M7GA 3NFYA 4R83A 5CUQA 4YUXA 4PYQA 1EVLA 5FJJA 4HWPA 3U13A 3FUTA 2PGOA 1TOAA 4JAVC 4EPTA 1Y6FA 1NN0A 3PC3A 1X0VA 4JKOA 4P31A 4XFDA 4AS3A 3A70A 1S2GA 5DTIA 1GQYA 2H5EA 1OC2A 1VSTA 3H5IA 2C7QA 3FTDA 4P34A 1YASA 1ZCJA 1WL8A 2IE0A 1ISGA 4OLHA 2KBFA 4QGAA 4URFA 3EH2A 1DDGA 3SG0A 5K20A 2BM0A 1KEEA 3FOEC 2H17A 4B3BA 4ZTUB 3O4JA 4R9UC 2J0EA 2QL7A 4INZA 2WVAA 3IOCA 5JSZB 4IHJB 3N70A 2IDZA 4UUMA 3S2EA 4PHTA 1PCXA 4ZOLA 5FBQB 2AOTB 2E4AA 4R2KA 1K2VN 1NMZA 3DDHA 1GR0A 4OA8A 1RSZA 2E55A 2ODQA 2WJGA 2IIBA 2JAWA 3DOCA 1CJKC 4GEGA 4K5QA 3BMOA 1M6YA 5F98A 3TQTA 4N3AA 4PC6A 4CU5A 4M0MA 1DBSA 4HDRB 4MZXA 4ZC1A 1PWHA 3DPSA 1QR2A 3FLBA 2HZ7A 3L8DA 3RRJA 4FFWA 4IDFA 1A4IA 4KE8A 1N5KA 1PZFA 2HC9A 5DM4A 4BJ6A 3QWHA 1XDWA 1CQWA 3F8WA 1Z56C 1CIVA 2HHJA 2JJ8A 4KXWA 1HUQA 1I7QB 4TMKA 3ZI0A 1W19A 3W2FA 2X2FA 3LHSA 4MH0R 4BB0A 1OX5A 3UK0A 3CWZA 1NFQA 2CB9A 3VPFA 2RAFA 2PYDA 2XMBA 4MPRA 3VU0A 3U19A 1OREA 1LSSA 4BEWA 3ZKWA 1TM1E 1TKRA 4LEIA 1PJQA 4AJ9A 4E5UA 4MV4A 1L3IA 5FV4A 1NXVA 1Q0PA 4X44A 3B9PA 3EJWA 3HKBA 3PD0A 4HLUA 1VG9B 3CO5A 3HV2A 3HU5A 4FK8A 5EMNA 3DFFA 3GCGA 4P53A 2A33A 4KCGA 2E0IA 2ATXA 1ZCZA 5K0TA 4OHMA 5JZ9A 4TYNA 1ZIDA 1D0IA 1QH0A 1TYAE 4V3CA 1FYXA 4INJA 4R5MA 3NDPA 1Z8HA 4U2CA 1NX9A 1R6XA 3MD9A 4BQNA 2XPCA 3OTHA 2O1WA 3OQNA 1BXZA 3S5UA 3PHBE 4YJGB 4F5DA 4PZPA 2XUGA 3RVKA 4ESHA 2A67A 2W42A 3FNRA 4TLDA 4DWJA 1R16A 5FYQA 4HMPA 1W93A 1ZI8A 3MOGA 3NYWA 3UH0A 3DPUA 1M0TA 3K0FB 3PNOA 1T15A 1QIMA 3IBSA 2O8DA 2X0RA 4LBZA 4N5NA 2AWNA 4G1EB 3C7CB 1B4DA 2XCLA 3HM2A 1EFLA 4WVFA 5LIRA 4OK5A 1G8PA 3KWLA 1DFIA 2H2AA 4WOPA 3VTKA 3TTUA 4V1CI 5JS6A 1U81A 5EYPA 5AVKA 2QJFA 3RSCA 2ZDHA 3R23A 4ODIA 1FW6A 1J0BA 1TFRA 4G86A 4U2DA 2OGWA 1V4BA 2H7XA 4HWTA 1WLSA 1QOZA 2HJRA 4DGQA 3AJAA 3IA7A 4OXYA 3A4VA 1JQLB 3FHOA 5CIYA 3ND5A 3C15C 4YC7A 1M6NA 1EA5A 2CZCA 3GEGA 3QF4A 1G16A 5JPDA 4WQMA 3DCJA 4RCZA 3HXLA 1KP9A 1JB1A 2OCIA 4TPKA 4DILA 5F78A 3LZ6A 2NYUA 3MGCA 4NNOA 4G67A 3T7DA 1T2CA 1T2NA 4GE3A 5FHQA 5JBIA 3STUA 5HHTA 2LCIA 4G0ZA 4X90A 5EZ5A 4CKXA 1V37A 1KU6A 1OXBB 2PZBA 2W11A 3VR5D 1J97A 1OU4A 4BFYA 2PZAA 4TZ0A 3LXXA 4ZAGA 4JYAB 1NATA 1TM7E 3V1UA 3LNCA 5CURA 1BIFA 3OQVA 4J0HA 1G41A 2O50A 1I4LD 1T3GA 1UFQA 1ZD2P 2C2YA 1AN9A 1WVGA 2B7CA 1JMYA 2FMUA 4KB5A 2B2XA 4OB7A 4IOMA 4AWXA 1YR3A 3JALB 2IY9A 3LLMA 4WHMA 5IM4F 1L7NA 3BHJA 1C4XA 1E9RA 4KYUA 4Z7OB 3W8EA 4RAQA 2GRUA 2W71A 4KQWA 4R8MA 2IYAA 3QP9A 4HDKA 2IF2A 2YY7A 1WUHS 2ZULA 2G1UA 4U9UA 1B8UA 4OAOA 4LHVA 4ZV9A 3PUXA 5DP1A 1I5EA 5ULLA 2K4MA 1XIVA 4G1CA 3WTCA 1KYXA 2PLNA 3QLVC 2B30A 5BY2A 2PU5A 2BFBA 2C83A 1D5WA 1ZSNA 4JN6B 4ZCQA 5ELXA 4YMGA 1Y3DE 1SCNE 3H86A 3O9VA 5K0ZA 2C3PA 2PS1A 1CUCA 4W6QA 4P80A 1ZA1A 4Z5XA 3A2LA 1WBBA 4KPGA 6AT1A 3D8HA 1BXGA 2G6TA 4C0JA 3Q85A 2QYTA 5LYYA 5BXYA 4B32A 3C3DA 1FXWA 3DDWA 4J1NA 1OFVA 1YBFA 2NZUG 4KPEC 3T3GA 3K5HA 1P33A 5IT5A 4YNBA 3S29A 3M5DA 2DFKB 4DUGA 3GCWA 3JX9A 3U7RA 4TVKA 3CUVA 3UMRA 3BH6A 2X8LA 2DX7A 1XZ8A 1ISIA 3BTUA 2R1VB 2DZDA 1M74A 4BU1A 2OT3B 6REQA 4G0QA 1PFKA 3REQB 4IYRA 2NYVA 2F3TA 3Q7EA 3PENA 2C2XA 2XE4A 1K4KA 4JC5A 4W8HA 3P7MA 3JQGB 3IURA 5IJAA 1G60A 2FQ1A 1IVYA 2PGDA 5IU6A 2KHZA 3WBBA 3SJ7A 3WQBA 4EARA 2YY6A 2I3AA 2L19A 2V74B 4KIJA 4KN8A 4UEKA 4XIYA 5LNK6 1EUYA 2VXBA 4YAGA 4NE9A 2XB4A 2A30A 2EGGA 3VKWA 1Q2XA 1P6XA 1F06A 1TVEA 4KBGA 1PNQA 1XCLA 4PSVA 2QLNA 5DWQA 3U60B 4NH0A 3ZU4A 2IYEA 5EG5A 1OLOA 3MT9A 4GPZA 2ZYUX 1ULSA 3QV2A 3MWGA 1JT9A 2OZLA 2PBZA 3DFMA 2BKEA 1LTKA 3NPMA 2H1FA 2PUWA 2IOHA 4G0PA 3LT5A 3RW9A 2MTBA 4EUSA 4MYRA 4DMFA 1R64A 2GCEA 1OHHA 2GD2A 1BD3A 2J4DA 1TT5A 3ZDRA 2PGNA 1XAGA 1EK2A 1TYDE 3QVVA 4PRYA 1QJCA 1VE3A 2XWBF 4M49A 3QMWA 1FP7A 1X77A 2TMGA 1EE1A 4IF6A 4DR5B 3LY8A 4D9NA 3CZ5A 4OY3A 3HYNA 3KU4A 4M9QA 1BJKA 3BEDA 4MW7A 4R1MA 4Y18A 5D6OA 3WJAA 4PX3A 3MCAA 3RJZA 4F56A 2CGEA 2B4KA 3DZFA 3GJ6A 1GM5A 4PGMA 3I1JA 2HBYA 3O84A 1CTQA 1RMQA 3KOXA 4PLVA 2RHJA 5CA0B 3MWYW 1O8CA 6CHYA 1KAHA 1SVLA 5E6RB 1T9KA 4YPVA 1SQFA 1ADYA 1WQ4A 3WJ7A 3ZK7A 1JE0A 4DF3A 4GKBA 4QNRA 4Q1AA 2BEKA 4LQCA 4ZVTA 2F6RA 1NJSA 5LJLA 2GO7A 4PM4A 2J3JA 2JRLA 3P0RA 2P7HA 4LJYA 4H4DA 4M9XA 5DNDA 5D5HA 4CKZA 1PJTA 2GR9A 4LRWA 4E46A 2NVWA 4JJ8A 4PV7A 1ND6A 1ZVKA 4WCVA 1DKQA 3N0XA 3I3SR 5HXAA 1A82A 4N6GA 2ZQ5A 5E8JA 4A82A 5IMSA 4GL2A 4PZLA 1IXYA 4DIEA 1CRWG 3CKMA 3BZUA 1DAFA 2IKSA 1JQEA 1JSZA 3MXTA 5HQ3B 1GZSA 2JS7A 2ATEA 3LSTA 3UJ9A 1TUEA 2BUCA 1GPLA 1TJYA 2WP8J 4LHWA 4MICA 4TMVA 3CIFA 3SBDA 4I19A 3SF8B 2A0UA 5K6AA 3NHAA 1RD4A 4DANA 2D2IA 3SQMA 3ZLJA 1JYSA 4UE2A 1THMA 4ESVA 1TEZA 3HP7A 4LSGA 1JKJA 4EQ6A 3HMQA 4XR4A 4M3NA 5BSMA 1ATIA 2G5TA 1RJ9B 5TGTA 5IZ4A 3ZDDA 1W44A 1LPBB 1P7CA 2V7PA 4A6EA 4I0WB 4RQAA 1MJFA 2EZ8A 2WOJA 3QYAA 3S81A 4FDAA 1X3SA 5EQJB 4D8TA 4N3GA 1SVWA 2V1XA 4IINA 5CB0A 3H6KA 4UTXA 2I4RA 3UJ3X 1FTYA 4FHGA 4BASA 3R7FA 1FRFS 2XQJA 3QWFA 4I5GA 5E0OA 1QHHA 5H9VA 2V6FA 3EIFA 1C4WA 1JIJA 3PFWO 5AOAA 4PANA 4C7BA 3ETLA 3MMXA 2AN4A 5CT5A 1R37A 2AJTA 5TVKA 4IPTA 4AZ0B 3A9WA 2GLXA 2ZBQA 4XB6B 1D7AA 3WSTA 5A9RA 5BYBA 4ZKDA 3R3ZA 1ULBA 4FFLA 4FW8A 1NVMB 4D96A 1L7MA 4FJ0A 2IVFA 2BBSA 3HCAA 4NYJR 1NF2A 4HQ0A 5JAOA 1UH5A 3A6DA 3NT2A 4YRTA 1SCIA 3NIWA 4XX1A 1MXFA 4RIGA 4ENTA 3IB3A 4YASA 5EC8A 3ZDFA 3SZ3A 4DIFA 1HOXA 1YQTA 3K0FA 3PQFA 2ZR0A 4DDMA 3IP6A 5IJ9A 1EVZA 2ZSFA 1YB2A 1IE3A 3HJNA 4EFKA 4EG5A 4CE6A 3RVRA 5DGTA 1FUKA 4I8XA 5CLJA 2NU7A 1UM9A 3V46A 1ADFA 1UJBA 1TA9A 2C4VA 3EA4A 3KRTA 4MTLA 3W3AD 1PJRA 3AMVA 3LOQA 2B6HA 4RFLA 3DAYA 5GV8A 2LXNA 5TMEA 1J8FA 1NAHA 1QIKA 2J4FA 5KC8A 4JT4A 3TIGA 4AQ7A 1F8FA 2XV1A 1FTGA 3A6JA 4FEGA 1QCYA 1VRCA 3MLBA 4R2JA 4HDOB 4B3CA 4I4TF 1KVRA 5LQDA 3WSWA 4P5PA 1PZNA 3DBRB 2FWMX 2QL9A 3D8NA 3LA6A 4JLPA 4BGIA 4ENQA 3CVJA 3KJFA 3CNLA 1RYNA 3OJLA 4RK7A 5KJ6A 5KTOA 1GSHA 2GO1A 4QX6A 4O2AB 4GX1A 2ZANA 1NP7A 1GT6A 4OI1A 13PKA 1JEEA 2OENG 2GNAA 2Y0PA 2QVCA 4JVMA 1UPCA 4Q19A 5DYNA 3SXJA 2KPOA 4BO3A 2BFPA 4PO8A 4L16A 4ID3A 4ILKA 1N5OX 4RMNA 1NW9B 1P45A 3VI4B 3KQLA 5EXSA 1YZYA 1MX5A 1SIUA 2XNKA 5BR4A 2W83A 1V3QE 4C7KA 3BF8A 4H7KA 3IILA 3ZXXA 3CJQA 4BLSA 7MHTA 1A1VA 5IVPA 4ZMSA 1RRPA 5JCZA 2AWOA 3AUJB 3OO1A 3WIDA 5IHPA 2WTNA 1SB8A 3QQPA 4KQCA 3SXPA 1B8VA 1U2PA 2QD1A 2Y68A 2SBTA 5DYIA 1LXCA 1ZJ6A 4OJKA 4NBKA 5EE3A 3FOZA 3I2GA 5JXHA 4ZQIA 3ROTA 5AQEA 4B6RA 3KE8A 4EMBA 1IUNA 1FZTA 1SJ9A 3P5SA 4M6WA 4XDGA 2AF3C 3T4UA 5CLGA 2QI9F 1J5XA 3NBUA 1QMGA 2HEGA 4MRMB 1CR2A 3CU5A 1XU4A 3DAHA 1ZC3A 5EZYA 4N8EA 1U0NA 4LCJA 5GZ6A 5IN4A 5DNVA 2JHGA 1UWLA 2NQ2C 3GW8A 3IT0A 2DULA 3LGAA 3VUEA 1IN8A 5F21A 1U2QA 4FZVA 3WGOA 4D57A 2XNCA 5CBPA 2FLKA 3EZ6A 1MA3A 2BISA 4RO0A 5KVAA 4YP5A 4PRKA 2VT6A 4HQLA 4RF5A 2SCUA 1XZCA 4RSRA 5JNSA 2J6IA 4DY4A 4K3VA 1DRJA 2BFFA 1PFVA 3DP7A 3ZU5A 4HSEA 5AKXA 4LF4B 3RU9A 1RYHA 2YINC 4KU4A 1SXQA 1J39A 3BXFA 4J7UA 1Q84A 5ALZA 2Q0SA 3I04A 4KO3S 5LXTA 3UPUA 3MB5A 1D2CA 4N01A 1AKWA 3R9WA 1SMKA 1Z6TA 2A5DA 3CGWA 2C8KA 3EXEB 3MINB 3BDIA 1TTHA 4FTWA 1NVAA 4MWEA 4E7PA 3BRSA 2YJ4A 3RWBA 2ZDGA 3QWBA 4HLCA 4B43A 5BOSA 5JD4A 4DCOA 4YROA 1NOIA 2WIJA 4ICIA 4NENA 3HYSA 4D0LB 1ND5A 1T4MA 1NP3A 3FNFA 1NGSA 5CT4A 1G5RA 3WOHA 2AZDA 5JAMA 3CG4A 3WWCA 1ZJWA 2CMDA 3F6SA 4O4HF 3C48A 3EQ6A 2GDZA 4Q9KA 1XNJA 4YQYA 3KYIB 1E3IA 3C3AA 4IW3B 3VSAA 5K3EA 1L2TA 2ZE6A 4CTOA 1PLKA 3EXHC 2Y71A 1BXGB 4G5RA 4RGBA 5LDGA 4M2LA 3UOWA 2D7JA 4ACAA 2FZ4A 4CUKA 1EXVA 4XPZA 3VGJA 4Q37A 1BXRB 4QSHA 1YO6A 1XJWA 1XPRA 5K3AA 3MMNA 2ECKA 3TJRA 1XNQB 1ZNWA 4P2GA 4MV9A 1XQVA 2PKQP 2Y1KA 4FX5A 1E1CA 3GA0A 1RLIA 5EL0A 2VT3A 5HCNA 1V8OA 2W7TA 3PQ8A 1G5IA 3QUTA 1XTZA 1OT5A 1X7WB 1W88A 1WUIS 2X5XA 1RBQA 3QK7A 4PQYA 1QQ6A 4RVOA 2VF8A 4GSLA 1BS1A 3WGQA 1GCAA 3GLIB 2AJLI 2ZUTA 1ZM7A 1JT2A 2IP2A 1GILA 4JVSB 4UMDA 3RVJA 1QE3A 1SOWA 2ODEA 3PUKA 2EJTA 4MUFA 2CLEB 3N6RA 4N9WA 3VNRA 5CA1B 5KPDA 1J2EA 1MQ8B 1Z37A 3EF3A 2P9GA 1E5QA 1Z5NA 2XBLA 2QSJA 4RKEA 3WFJA 1FJGB 3K9HA 4MW6A 2IH2A 3C3YA 1BE1A 5ESXA 3KXLA 1A2KC 4FEEA 4GR9A 4PIMA 1B93A 3X2FA 4CKYA 4DGSA 4R3WA 3OCCA 3BE5A 2HB6A 1N2JA 2B6NA 3GYBA 3K2BA 4DLUA 4KXUA 4QUAA 2DPXA 2QM3A 1QU2A 1ZGZA 5JBNA 3UAXA 3PL1A 1QRDA 2CNLA 5AKLA 2OFPA 2X7HA 4O2BF 2WYHA 1D2NA 3AILA 4I55F 3TNJA 2DBYA 2HMTA 1B0ZA 2J31A 3OE7A 4H7HA 1FL9A 4O1MA 4BNLA 3A4IA 3FFWA 2LW7A 3ME5A 4UHCA 3A7DA 1JDJA 1LC0A 2HHCA 1EUCA 3I9OA 4S2EA 3FJOA 1L7VC 4M8NE 3L0CA 2BEWB 5K0LA 5HZHA 3RAFC 1PT6A 4IVQA 3L07A 2RGCA 4J6FA 2HW8A 1O6GA 1ABBA 4JS0A 1WB5A 3AM1A 1AKUA 1SBQA 3P0EA 3M4XA 1A0OA 4K6HA 3ZYCA 4CTKA 1RC1A 4UQOA 4WH0A 4YEDA 1YC2A 1HE3A 3BT7A 4DDWA 1Q1ZA 2V65A 4FDMA 4UZEA 1RLOA 5E95A 4WL0A 2Z04A 4WN3A 1JQDA 1NTOA 4OQ4A 2FEWB 4X65B 5FULA 3ONWA 3DKVA 2OHGA 4CT0A 3WIVA 5HP4A 5HWSA 1JU3A 4CG0A 2O4CA 3QEBZ 3BB1A 2YZGA 2ZWVA 1PG2A 1WCWA 4YR9A 1SVKA 2PKYX 4YP6A 5K0GA 4DRXB 1PGQA 3COJA 2YBEA 3V3KA 1NLYA 4Q7LA 2C2ZA 1YZTA 2EKQA 4EOGA 1T5BA 4YYEA 3VR4H 2FPUA 2R0QC 3BGIA 2DH5A 2N47A 3ELBA 2A5JA 4FFOA 4U6SA 1XMPA 5JT1A 2B1GA 2XVZA 2K5UA 2Q7XA 2QGNA 4EI7A 3ZW7A 1SXPA 2NUPA 4R16A 1XCJA 3VOSA 3ACDA 5CXUA 4TRJA 1XXHA 5HJ2A 5EP3A 4EB0A 1Z4OA 3G89A 3AO0B 1PS9A 4LJLA 3HFSA 4LXQA 3VVLA 4HGZA 4EAAA 5JFGA 1XCMA 3WP1B 4AO7A 2VQ3A 3AGQA 4KO2S 2R48A 3BGWA 4QAQA 4I14A 2O8EB 1QK4A 4ZEMA 2BMJA 721PA 2IIVA 3UAYA 1EJ0A 3QEAZ 4XYGA 3TJMA 3B48A 1DBPA 1XZBA 4HZUB 4BMCA 1PZGA 2EJCA 1GPBA 2DUMA