3TB6A

Structure of the effector-binding domain of arabinose repressor arar from bacillus subtilis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
NKTIGVLTTYISDYIFPSIIRGIESYLSEQGYSMLLTSTNNNPDNERRGLENLLSQHIDGLIVEPTKSALQTPNIGYYLNLEKNGIPFAMINASYAELAAPSFTLDDVKGGMMAAEHLLSLGHTHMMGIFKADDTQGVKRMNGFIQAHRERELFPSPDMIVTFTTEEKESKLLEKVKATLEKNSKHMPTAILCYNDEIALKVIDMLREMDLKVPEDMSIVGYDDSHFAQISEVKLTSVKHPKSVLGKAAAKYVIDCLEHKKPKQEDVIFEPELIIRQSARKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the effector-binding domain of the arabinose repressor AraR from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords Arabinose metabolism transcriptional repressor
total genus 110
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tb6A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tb6A01
4EUKA 1DBWA 1E6MA 1TJYA 5CNIA 5IX8A 3UKJA 2FEKA 2FXIA 4G0YA 2E4ZA 4Q6BA 2HQBA 2PUEA 2E4XA 4MR9B 1Z26A 2RDMA 3NHZA 1P6QA 4UHJA 2FW0A 3KLNA 5ED4A 5CNJA 4MPTA 3MQ4A 3QEKA 5EWLA 3CKMA 3SAJA 3OLVA 3T6KA 1QQAA 4WWHA 3HO1A 5KQGA 2FMIA 3A0UA 2GX6A 4JB2A 5GQSA 3SNKA 2E4YA 1E6LA 4OLBA 5FWYB 5F64A 2WJWA 2VYCA 4B09A 2A9RA 1LJLA 3C97A 3LUFA 5TQ2B 3T8YA 1ZITA 3RH0A 3Q15C 4GNRA 3QLVC 5PNTA 1DRJA 3OMWA 4WXEA 4ETMA 2IPNA 1APBA 2FQWA 4Z9AA 3CTPA 1D4ZA 4NCBA 3OLZA 4KK3A 3K9CA 3QELA 4TLMB 4OATA 1EAYA 3CFYA 3GBPA 3O1HB 1P2FA 4LDZA 2NUBA 3O21A 3DGEC 1TVMA 1JH9A 4KNYA 3P9YA 1XWWA 3CZ5A 2QW1A 5EWJB 2PUAA 2PAFA 1P8AA 1Z2EA 2L17A 5IUKC 2WMYA 5IEBA 3MIZA 1BVHA 1ZY2A 3BBLA 1EHCA 2CD7A 3N0RA 2R25B 3Q41A 3HCWA 2TMYA 3JPWA 4H3HB 4WT7A 3EQ2A 3LKBA 4QPJC 4ZMRA 3RVPA 3HUUA 4S04A 5DTEA 3IPAA 1JFVA 1JLKA 1EWVA 4MAAA 3N0WA 4N0QA 4EY3A 1USIA 3H6HA 5B3JA 2R48A 4XARA 3I5AA 2I6FA 3LUDA 7ABPA 3GA5A 4Z4CA 4F11A 3HM9A 3C3WA 4QICA 1JFSA 4JP1A 1MVOA 1P6UA 3G1WA 5DCLA 2Q5CA 4KK4A 2QZJA 3EQZA 2PUFA 1F4VA 1JL3A 1BAPA 3O2SB 5FWXA 4N03A 3H5WA 4O5AA 2HSGA 4MR9A 4TLLB 5IULC 1KRXA 2BGGA 1NXXA 3LFTA 1D1QA 2GBPA 3GRCA 3VNAA 3JVIA 3Q7TA 2FTKE 2VUIB 4YV7A 4MGEA 2CHEA 1YMUA 4MQFB 1OXKB 4Q7EA 1XHEA 3KJXA 3JVDA 1SXHA 5TPWB 3QEMB 2OENG 3KCNA 1DRKA 2QR3A 1YK0A 3A0RB 4D6XA 5TQ0B 1TM2A 2JRLA 4NQRA 4MR7B 2IKSA 4EYKA 2ID7A 3UK0A 1LK0A 1GUBA 2IOYA 2JVIA 2XDYA 1NXSA 4KV7A 1YIOA 3CLKA 2FMFA 3ROFA 2PUBA 2AYZA 1DZ3A 3EJWA 3BRSA 3HDGA 3SG0A 2H3HA 2PKXA 3ILYA 4RY9A 5JNWA 2FMKA 2YHBA 1YVUA 4RK5A 4RK6A 3CU5A 5EWMA 2JB9A 4MS4B 3RVLA 4EYOA 2FEWB 5EWJA 3O2JA 4LE0A 4Z9BA 4Y9TA 2X7XA 4G97A 1FSPA 1U8TA 4Z0NA 3H6GA 3SM9A 3OQNA 1NXTA 1MIHA 1SXIA 1ZH4A 4YCSA 2IPLA 2JBAA 3FGZA 4RK7A 4KRFA 4PE5B 2L19A 1A04A 4DN6A 1DBPA 3KLOA 1BA2A 3MA0A 2MYUA 1TMYA 5TQ2A 3HS3A 5KQPA 4RXUA 2HJ9A 3MYYA 3EDCA 1PHRA 4XLTA 3H1FA 4O1IA 4YO7A 5FWYA 5HKOA 4XFKA 4OTZA 3O1JC 4G0MA 3IP9A 1PNRA 2JVJA 5IC5A 3TB6A 2FLKA 2NT4A 2YHAA 5KQMA 5TPWA 1L5YA 4D74A 4Q6WA 5KC8A 1JDNA 1B00A 3G85A 4LDAA 3M6MD 4RKRA 1QNLA 3N75A 3H5OA 4S05A 2JVKA 4G0QA 4RKQA 3HUTA 5TPZD 5BRJA 4RXTA 2QU7A 3H5TA 1D5WA 2FMHA 2R4QA 2GI4A 4IRXA 4Z4FA 2PUCA 2PJUA 1ZAYA 3B2NA 3IP7A 3OM0A 5TQJA 1DJMA 3FFWA 4EVSA 4Z99A 1JF8A 3KHTA 4ETIA 1MB3A 1Z13A 3HSYA 3MM4A 2MSWA 2HPHA 3L49A 5JS2A 4QYWA 1QMPA 4RWEA 4LE1A 3HXMA 4YLEA 4EGSA 2LUOA 3JTEA 2VK2A 3EAFA 2PUDA 1M2EA 3HV2A 3MF4A 3RVRA 5HSGA 4NCAA 1DCMA 4IGAA 5KWSA 3KYJB 3C3KA 4YWHA 4YRZA 1M2FA 1AB6A 2MYTA 3O1IC 4F06A 5ABPA 3OO0A 3QX9A 4MQEA 1W9HA 1QPZA 3BILA 2MSKA 4TN5A 4LE2A 2PUGA 1QQBA 5KQLA 5HQJA 3Q7SA 3DGFC 1PUXA 2MSLA 4FE4A 3LTEA 1WETA 2RJOA 3H75A 3EODA 2P9HA 1URPA 2A9PA 4M88A 2J48A 4JB0A 4YS6A 4IF4A 3Q9SA 3TD9A 3NHMA 4N76A 1ZGZA 1VKRA 4TMYA 3GV0A 3CRNA 1W25A 3KTOA 3JS5A 1GUDA 1KRWA 5FBKA 1RXIA 4HYEA 6CHYA 4MS4A 3QELB 2RGYA 3SY8A 3URMA 4XASA 4E7OA 5JNVA 4NICA 5JNSA 3QLUC 3HJFA 3D8UA 3HEBA 4W5NA 2A9OA 4EYGA 2F8SA 1JDPA 4RY8A 5JNTA 3DLHA 1QO0A 1J56A 1HEYA 1LBIA 3LKVA 4MQEB 4ZYLA 5T7BA 3CS3A 4Z4EA 4PYRA 3DZDA 5FBHA 3NBMA 3QX8A 3OQOA 3CG0A 1QP0A 1ABEA 4JA2A 1FFWA 4ETNA 3LUAA 3LUGA 3UUGA 3W9SA 1VPWA 3NNDA 3GT7A 2FN9A 2ZAYA 3N8IA 4LZLA 3FDFA 4ZPJA 3C6QA 3OLYA 1NXOA 4W5OA 2CWDA 3H5IA 2PL1A 2ID9A 1H9CA 2E4VA 4G0OA 5CNMA 1Z15A 3TMYA 3N53A 4DQDA 1JX6A 4MR8B 4PICA 1BDIA 4FB4A 4GPAA 5FWXB 4DADA 1JFTA 3HVRA 4XAQA 3LUCA 1VLZA 1YS7A 1D2AA 1I3CA 2M98A 3H1GA 3KKEA 1EFAA 3CHYA 1NY5A 2A9QA 3L6UA 4RXMA 3RQIA 2WB4A 4F12A 4G0PA 1Z25A 3KS9A 4G0ZA 1YK1A 4YGXB 3KG2A 1TLFA 5KC9A 1ABFA 1DCKA 1DBQA 2LBPA 1YMVA 3QLVA 2WJAA 5IEJA 5TPZA 1RZRD 3HDVA 3HZHA 3MMNA 2M1ZA 1F51E 4MS1A 5JNUA 3JY6A 4F3TA 1JYFA 4D6YA 1GCAA 1ZDMA 3RVMA 5C5EA 4L4UA 3EULA 2MYNA 5BR1A 2DRIA 2HQRA 1RNLA 2FLWA 3QLUA 1SXGA 1KGSA 4UHKA 5C5CA 4KFCA 4HNSA 2HQOA 4YR7A 4E7PA 1GLGA 2B4AA 3ILHA 5BQ3A 1UDRA 4OLAA 2LPMA 3RVKA 1Z12A 3IPCA 1EWKA 2GWRA 3H5VA 5CNKA 2IDMA 8ABPA 4W5RA 3LUJA 5BRAA 1USGA 4W5QA 3O75A 2ZWMA 3RVNA 5IUNC 4F8JA 1SRRA 4ZJPA 2V0NA 2FN8A 1YS6A 4HNQA 2P4UA 4MRMB 1MAVA 1ZH2A 1Z16A 3F7NA 2NZVG 3H5LA 4QYMA 2QSJA 1A0OA 4RK4A 3C3MA 4ML3A 4Z4IA 4MR7A 3LMKA 1FFGA 3E61A 4EVQA 1NTRA 3IDOA 4N0PA 5TQ0A 3LOPA 3RVJA 1SD5A 4H3KB 1E6KA 3RVQA 3OLXA 1Z2DA 4KPYA 3QEMA 2LP4Y 4MLCA 4PEVA 5GOTA 4EYQA 5EWLB 5KI6A 3LUKA 1C0EA 1GCGA 4RSMA 3GYBA 4LX8A 4MQFA 1DC8A 2FEPA 3BREA 3T95A 1USKA 1DC7A 4WZZA 2LIVA 1JYEA 3QLTA 1ZGGA 4RS3A 3FFTA 1LBHA 1ZN2A 5IUJC 1NATA 2WWVD 1RXEA 2VUHB 1XHFA 3TX6A 3F73A 3GBVA 1PEYA 1C4WA 4N47A 2E4UA 2FQYA 4JAVC 5DGCA 5T3YA 2QVCA 5DKFA 2KYRA 3JPYA 4FE7A 4RY0A 1RPJA 3CNBA 3I09A 3TO5A 3M9XA 3F6PA 1A2OA 2OQRA 2QXYA 1MB0A 4RK0A 1JBEA 2IPMA 5I4CA 4G0XA 1EWTA 2O20A 1JWLA 3FMVA 1DCFA 4MS3A 5DLEA 2FQXA 1U2PA 1Z17A 3KSMA 5E3JA 2PLNA 4Z4GA 4OBBA 4P98A 4ZMSA 5JS1A 4PZ0A 5JNRA 3OO1A 4IMIB 4KZKA 4MR8A 4RK1A 4O1HA 1FFSA 4LRQA 3M9WA 2QVGA 4RU1A 3O74A 4H60A 1Y1LA 1K66A 1JHZA 3N6VA 1E2BA 3OM1A 3A3KA 4IMJB 2IYNA 1ISSA 3IP6A 2NT3A 3N0XA 3F6CA 1NXPA 3VNBA 1R8JA 4RDCA 5IBQA 4CBVA 1M5TA 3CZCA 4HNRA 2IPAB 3A10A 3GWGA 3QK7A 2CHFA 2PL9A 3OLWA 2W42A 4IILA 5B3JC 1K68A 3S99A 1U04A 4KQ9A 3EGCA 4P1ZA 2GKGA 1DG9A 1ZESA 1PEAA 3LUHA 1AB5A 3IP5A 1QP7A 1FQWA 4MRMA 1KMIY 4MYRA 1LJUA 3Q7RA 2F8TA 6ABPA 2L18A 3HK2A 3BRQA 4W5TA 1M5UA 2AYXA 3D02A 1CHNA 2JBAB 1NXVA 4JASB 3RVSA 1BDHA 3I42A 4JOQA 2QV0A 4NV3A 1NXWA 2WRZA 2H0AA 4KMRA 1YTUA 1U0SY 2FVYA 2PMCA 1VRVA 4KREA 3K4HA 2NZUG 2MYPA 1IIBA 4XXHA 5EWMB 5CHYA 3RVOA 1OXBB 3DLBA 2JCGA 4G86A 3NNNA 4YP9A 4Z4HA 1Z18A 4WXMA 1T34A 2FKAA 3KYIB 1ZVVA 1L5ZA 1QP4A 3ROTA 3E3MA 4RV5A 4N41A 2PE5A 3T38A 1D1PA 3CG4A 4EVRA 1CEYA 3FFXA 4MLDA 1CYEA 3SQNA 4MS1B 5D2CA 3O2QB 1QO0D 4KVFA 5HM6A 4MS3B 3I45A 4KQCA 3OQMA 1U2QA 3H1EA 1BDJA 3R0JA 4OG2A 1S8NA 1DP4A 4RZSA 2L2QA 2B1JA 2FSPA 5TE9A 2RJNA 9ABPA 1ZHHA 2N9UA 2R47A 3GL9A 1RZRA 4L85A 2E4WA 1ISRA 3DBIA 2WY2D 3NNSA 3OMXA 1PNTA 1QKKA 2JK1A 4WUTA
chains in the Genus database with same CATH superfamily
4TZTA 1ZMRA 3PGXA 2C2HA 2KE5A 1DBWA 4OJTA 3S1AA 2QJTA 3CF2A 2IZ7A 3H13A 3GY0A 2FEKA 5JO9A 3T5CA 1VBFA 1AHIA 1N5OX 2HQBA 2EX4A 2GPBA 4BFVA 4EHHA 4MR9B 3ABQB 4W7IA 2A5JA 2BH9A 4G8JA 5LQKA 4WIAA 4TT3A 1XAJA 1P6QA 2MR5A 3OIGA 3ONWA 5THKA 3K0CC 3KTFA 4MHOA 2B1IA 5EHZA 3F3MA 4R0VA 4XB1A 3C5CA 3VYTB 2C78A 4D9EA 3N7TA 3CRZA 4RLHA 5K45A 2XTZA 2REQB 4Q82A 3O8NA 5KTNA 4FKMA 1N5RA 3NM6B 1DG1G 1RQGA 4PYMA 1L3BA 1CF2O 1MRSA 4GM0A 4ARBA 1PS8A 2XGJA 3OZBA 3LC0A 2TECE 2I2AA 3PCTA 1DADA 4IF6A 1UMBA 3KL2A 3QLVC 4I0WB 5JY6A 1KVQA 3NJ4A 2VATA 1M2GA 3MWJA 3T4UA 5L3QA 1Q84A 3T1YB 4RIIA 1TK3A 2QORA 3CTPA 2QL9A 2J4DA 3HY4A 4IKEA 4N1AA 3RI3A 3ZWBA 2BJVA 3GBPA 2Y99A 1C4KA 2FW1A 3BOSA 3S3TA 1XN1A 4D97A 1ATZA 1X42A 1RAAA 2NO9A 3R0ZA 5D5HA 1V11B 5EIFA 3VZPA 3KXIA 2VHYA 1MG0A 4F6LA 4RJIA 1CZNA 3GFFA 4BKQA 3RT1A 3LP5A 4PAQA 2J3LA 3G6KA 3B1XA 3QUCA 3TDMA 3UBMA 1ID8A 2CD7A 1MQSA 4WT7A 4IOMA 3HCWA 4ASUD 3JPWA 5C32A 4ZKEA 4DRXB 2G9RA 1BHSA 2ERCA 4M9XA 3QEBZ 2VJMA 1WBDA 4J7AA 2NO4A 3O03A 3P4YA 4YAOA 2KW5A 4HQKA 2ZRBA 4EJSB 2D0DA 5J4KA 3B6EA 1NW4A 3A7DA 1I2AA 1ZCFA 3IP3A 4DYDA 4AKIA 2V8OA 5KDLA 1ZKMA 3UA3A 2VC2B 1V5GA 2XMPA 4N65A 4YJFA 2NVOA 1TCUA 3LWZA 4OPMA 4MUXA 2QT0A 4DBLE 4F9FA 5T8KC 2VVTA 2H1VA 4B3MB 1WXIA 3C3WA 3AY0A 4YCBA 5LQCA 1MW8X 1WVMA 3B53X 3JQ7B 4I1YA 1O0BA 2Z3WA 4B80A 4ENTA 3ZNOA 5CDSA 2PFGA 3HC7A 4N7MA 4C4XA 1F5NA 2AQ8A 3GMDA 3H11A 3I01A 4HGPA 4DHWA 2JNWA 5FBQB 7ADHA 1DBVO 2OORA 1C81A 1UFQA 2XNDA 5I9IA 2L0XA 4FEYA 5FTJA 2ZUFA 4PVDA 4Y1EA 2GBPA 4XQGA 2AKAB 2EFDB 1FSFA 4DLBA 3QKSB 4C0XA 4FFDA 4CKCB 2JIDA 3ZS8A 4K2HA 3PX2A 2Q3LA 5L4LA 4D4MA 5ELXA 3HLYA 2F59A 4MGEA 4XPIB 5JD4A 4RD2A 2YFYA 4KIJA 3MUEA 1FDSA 4C2BA 3JVDA 4IJQA 2OB2A 1HE4A 3L84A 3TXXA 1EFHA 3DDWA 2I3AA 1YR3A 4BE4A 1YA6A 3RSZA 1VG9B 3E58A 3IUQA 4BBZA 2DULA 1TRHA 4E46A 4NK5A 4FYWA 2RONA 1FS5A 5CJPA 1KWGA 4XX1A 1TCBA 2FRDC 2E21A 1DWQA 4OMFG 2JHFA 4LZAA 2PX0A 4XEUA 4ECEA 5BN5A 4QE3A 5AVWA 3IBYA 4GF5A 5AIBA 1E2KA 3UUWA 4X45A 5EE0A 5KNDD 2PX5A 1WU7A 2WUEA 2WVAA 5K0CA 4BNZA 1EWYA 1F8UA 2C2WA 3AB3A 3GDHA 4EYOA 1SVNA 3ICVA 1CJTC 1W73A 3BXOA 3UJBA 1DGQA 1T4CB 3FRIA 2P2ZA 1E7QA 2W2KA 2AX4A 1JKMA 4M8KA 4F5DA 4ZDKA 3COWA 3NTLA 2EHJA 4OQDA 1U8TA 3PWKA 2H0QA 1VPLA 3RPEA 1ZWKA 2UXCB 5G40A 3AVWA 5B6JA 1DTSA 2C2BA 4IICA 1Z0KA 2FSVA 2OMKA 3TLGB 4RK7A 4HSEA 1X13A 3OPXA 3ODPA 2VLBA 1TKCA 4UZFA 3DKVA 1ZIXA 4PLFA 1YCFA 3AI7A 3KUCA 1O6FA 5I9NA 2YNMC 5AP9A 1D6JA 1ZI9A 5AI8A 3OCWA 5C34B 1U7OA 2J0EA 1AGXA 1WP9A 4MCIA 1MBZA 3OE7D 1AZLA 5A1JA 1PNRA 1Z5UA 2YHAA 4YTEA 3T15A 2Y3IA 1F0PA 1ZAKA 3CPEA 3DHEA 4XPIA 1B00A 1RLIA 2J9RA 2FI1A 1SCQA 2X8AA 5HGXA 1IE3A 1ZA1A 1EXNA 4FUTA 2FRVA 1E3IA 1QQ7A 3W5AA 4HVAA 4G5YA 2ZRGA 3FHCB 3RRBA 3HRHA 3R7DA 4KLNA 2V7BA 5JBQA 3IRVA 2OE2A 1VM6A 1DJMA 2H29A 1X7DA 4FI3F 4DG5A 4ROTA 4M7WA 1QPGA 3ZVNA 5A7FA 4JL5A 5GMOA 1G8MA 1J42A 1V8OA 3CT4A 4MMYB 4P2BA 5JVDB 4QPNA 2ID4A 3BH0A 3UC9A 2VRBA 4FU0A 2WWYA 1TKRA 1WCYA 3GPDG 1NVTA 2ZSEA 3WFZA 2CB0A 1YWGO 5C81A 3HXMA 1X0VA 3UQYS 3IULA 4OHPA 1ZINA 5BPFA 3U7GA 2V3CC 3UQZA 3GZNA 2XGOA 5DIZA 4JT8A 3LDFA 5G0UA 5CX1B 1GFZA 1P17A 1BEUB 5AK3A 5EKSA 5B6PA 5ABPA 1U65A 2YWRA 3FPHA 3EWAA 3QX9A 1W9HA 4KDCA 4NPHA 5FI1B 2V65A 5FYQA 4GECA 1T5IA 2Q9BA 3EFOA 2I8CA 3UM9A 4REMA 1OV6A 1BMTA 3TS1A 1XV5A 2JIZD 3DMNA 1PJRA 3U62A 3Q3CA 1KYZA 1GL3A 3DE7X 4TTVA 2PKWA 3VHQA 1N5DA 5AW7A 2ZZNA 2CW5A 1E8MA 1VLLA 1W85A 1V11A 1F2VA 1VCNA 2I9KA 3EODA 3GLVA 1TCVA 4V39A 2A9PA 3CLRC 1GPUA 3HMQA 4IIBA 2CXXA 4M88A 4MVCA 3ST7A 3X1WA 3P27A 5IHPA 5JXWA 1GU1A 4OQQA 3KKKA 1V4VA 3WGOA 4TV8F 4EKEA 2VTBA 3HZRA 4PSAA 2A92A 3B6MA 4HYEA 5BPHA 5JQGF 1HQDA 5JAHA 4ZV4A 4BQSA 4RULA 3KSUA 2JIOA 3H5NA 4JQZA 5A2QA 5LVAA 2PKQO 3UK1A 2OG1A 4HDKB 3HDTA 4PN3A 4J2OA 3T3HA 4EG4A 1TF2A 3JQAD 3J7AC 1Z5NA 1XK7A 5ESWA 1U28C 4YRGA 621PA 1CR0A 1KOJA 3LLSA 2C04A 2DP4E 3HHPA 4PBTA 1Q20A 4BQOA 1F4LA 4WL0A 4PLVA 2GCNA 1ORTA 2WVGA 1KEWA 2O2EA 3M4XA 1U2EA 1UBFA 4Q1FA 4ZO4A 5EZSA 4DCNA 1PT7A 3MHTA 2GFQA 5EIOA 3RABA 3V8VA 4OOEA 2MWMA 1JUDA 2ADFA 1NW3A 1UR5A 3A1SA 3OLYA 3EDQA 2XNDD 1CQJA 4ZEWA 3M4ZA 3TQIA 3ZU3A 4LOKA 3MW8A 4X97A 5EIXA 3AJAA 5CDFA 2GA8A 5CNMA 5KTSA 3CSSA 2FP3A 3HSKA 1UANA 1EUDB 4JZYA 4LX0A 3TMYA 3QUQA 4EELA 1PQYA 4ZJYA 5EJEA 4AT1A 1AGYA 3DA8A 4B73A 5C3MA 2JIQA 2FG6C 5JLJA 1YAHA 4GOKA 1XZQA 3AL0C 1E0KA 4ZK2A 4NHEA 2NO0A 3ZVMA 2GHIA 1E8DA 1ZLXA 2BJWA 2ZVJA 4NBKA 5CB4B 1JQEA 1H0KA 3L6UA 2ENWA 4RQTA 3DHWC 4G0PA 5HNKA 3VX4A 1GL7A 1E3WA 1U0HC 4JIMA 2BFBB 2J3KA 1PL6A 2PAAA 3HACA 4YB8A 3GLFB 3VU0A 4Q9HA 4H3SA 3IXMA 1R6DA 2WJAA 5H02A 5AHWA 4D0GA 4DIUA 1RZRD 1CD5A 1W0KA 4QOIA 3RUAA 1LPPA 4BV3A 1YOBA 4MQMA 1ZNWA 3AIMA 1EK0A 3SYLA 1RKXA 3RU7A 4YA6A 2K2QB 1TIKA 2YZNA 1GCAA 3IVRA 2GCGA 1CFZA 3EULA 5BR1A 4A8JB 2DRIA 4WN3A 5DCWA 2P35A 3RR2A 2HQRA 3STYA 4ZAFA 2WAMA 3OT1B 4CUZA 5C5CA 1YCHA 4A8JC 721PA 4WAUA 5F4ZA 2GRJA 3HA7A 1KH3A 1LCIA 3GXOA 4PYIA 3GLHA 1L5KA 3DDZX 4GWLA 2HJGA 2DR2A 2IXFA 4Y3UA 2QK4A 1POXA 1U3CA 1ENYA 3KOXA 3S70A 4NDNE 1MZPA 2JKZA 5F35A 1PKXA 3WLMA 1YCDA 2PS1A 4W5RA 4ZYYA 5I7HA 5CIQA 3MCVA 4D57A 5KOJA 2JG3A 4I9GA 4DV6B 3SSNA 2GDZA 2HHAA 2KLBA 2M6RA 3AY3A 4F8JA 2HT1A 2CV1A 4H1WA 5ANRB 3OFVA 3I9NA 2ZW9A 4NCNA 1GGMA 1UBUS 3DO8A 1PD1A 1ZH2A 4P4LA 1E58A 3ZXUB 3KBBA 3RJ9A 3NP7A 3I1JA 2IS1A 4FSHA 4CDMA 2PA0A 4LNUB 3H16A 3ZR4B 2VQEB 1SD5A 2GB4A 2FFRA 1EU1A 2G9VA 1CS0A 2GM9A 2V6JA 2Y93A 3PUXA 4LXQA 5G1OA 2J4FA 1Z75A 3HP1A 4JNCA 3D4OA 1I7DA 4PX2A 4Y1GA 5B36A 1NNLA 3WL3A 4PO3X 2VYND 1XEFA 5EG5A 3UJDA 4UOEA 4X7RA 4DCVA 3T34A 4GFDA 3HCNA 3NS7A 3QE4A 3CGGA 5A5GA 4C0SA 1FLVA 1Q7EA 2HIGA 5A02A 4A2CA 2YOFA 2VPQA 4LPSA 1UDXA 3SC6A 2ECKA 4EDFA 3MOIA 1KR2A 1YZUA 1JIKA 4POOA 2OQRA 1HDZA 2Y0EA 4WBNB 2PLAA 5FOWA 3DKPA 1U0NA 1H5NA 3MCZA 4G36A 3FMVA 4UBKA 2WHYA 1XZPA 4INPA 2HK8A 4BLSA 5L7YA 1IAVA 2B4YA 2OAQ1 1NMZA 3I05A 3KSMA 3VJMA 1DLIA 4FFLA 2VSYA 3RFXA 4DIFA 4OB7A 4JFRA 4R8LA 1PQ4A 1Q7RA 1W1UA 4G9GA 4RMHA 3QFFA 4RK1A 1NBME 3GJYA 4O1HA 1TCCA 4A82A 4CQMB 4DZTA 4EHNA 4EUFA 1BXGB 2HO4A 5F5NA 3KB8A 2Q4DA 3PFHA 5AKKA 4QDUA 3GLQA 2CL7X 2GTPA 2VWQA 3MINB 2QUIA 4HS4A 2Q62A 2XLCA 4O08A 3W4JA 4ZDIA 5IFKA 5LP1A 1NXPA 3EZ7A 2R5WA 1R8JA 1OT5A 1YSCA 3IMEA 4MUEA 1G3UA 5JSZB 1Q0SA 2YN4A 3ICEA 1VIAA 3KFVA 2CHFA 1PRYA 4KR7A 1R37A 2A0YA 2QUJA 3L1UA 5ADWA 4KQ9A 4DEXA 3GU3A 3JYLA 3FRJA 2A0FA 2FETA 3RUHA 3OFSA 1WPRA 4DLZA 3MMPA 2OCDA 4AAYA 1TJPB 3BJMA 1PFUA 4KHPB 3DMTA 3VPDA 1QZXA 4HN2A 1KAEA 3B52X 1YFLA 3ENVA 1IJFA 1DT3A 2XQFA 1HC7A 3FWPA 1ZH0A 2PU7A 3R3XA 3W1VA 4OCZA 3ADBA 3K71B 2DLCX 4YACA 2I2DA 2X6TA 3KQMA 4M0LA 5EJ5A 1DWOA 3L2OB 1ORVA 1PJ8A 4DM4A 3RRYA 4HI0E 5CJJA 4C3OB 4X1YB 5GZ6A 2IQIA 3GUUA 3KOYA 2GBCA 3QH4A 4OX9B 1S2IA 3HP4A 4G4GA 4NV3A 3ZWNA 3ZCUA 3UFXB 3P96A 4JLUA 2OBLA 5CM8B 4TKUB 2W5UA 5JBIA 1K6XA 4KMRA 4RF5A 5DYGA 3WSTA 1Q92A 3G68A 4YPOA 2I3BA 4X54A 3I83A 2AZXA 3Q0TA 4DF3A 4B3CA 3BDAA 4NENA 1OXBB 2FFHA 2P5UA 4AZTA 2ZBEA 5AK0A 1G66A 1KY2A 2JARA 3FJ1A 4WZAE 3QBEA 4GKAA 2AK3A 5H83A 2C8VA 1GZUA 1NPTO 3FI9A 2DCMA 1W52X 4QSHA 3S29A 2GFIA 3EGOA 2CKDA 5CLGA 1XJCA 3I73A 3QX7A 3FCCA 3GDFA 3OPYA 3DUWA 1U02A 2QN7A 3PR3A 4TKZA 4Q12A 2QRNA 5E4JA 3R9XB 3GFVA 4AF7A 3ZHQA 1QH1A 1SUAA 3G17A 4PLYA 1LPNA 3WKDA 1ZX1A 4D9FA 1I2DA 2XZPA 3DE3X 3LECA 1XF9A 4G5RA 3K9WA 4MTCA 3ZIAA 5A03A 5ER9A 2PVCA 3RW9A 2CMFA 1GZVA 1RZRA 1MG5A 2NV0A 2VG8A 4GNKA 3TGWA 3WJAA 5BV2P 2GWHA 1NN5A 3ZE8A 1NW8A 1D8TA 2O54A 5IM4A 3WFIA 1G5QA 5SICE 5ALWA 1G291 5FFFA 3IDFA 3RE1A 1KETA 3RIGA 4UXHA 1NC1A 1W9MA 2BDEA 1YB4A 2VXCA 1RRKA 3AR6A 4AZ3A 3HWRA 4LF6B 1ZD1A 2IJGX 4DQ0A 2OEPA 4E2WA 5I8WA 2A7XA 1D2CA 1QK4A 1XNGA 4R6WA 6Q21A 1G4HA 2OCKA 1RWOA 3NHZA 1GQSA 2PZKA 3Q3JB 4PIMA 1VE5A 2GHTA 5ED4A 2EFJA 4XVHA 2ONJA 4CIVA 1PYOA 3CKMA 5EZYF 4N5LA 3IA7A 1WUKS 4Y18A 2C4UA 3AXSA 3W04A 2PKRA 1T5BA 3WL5A 1XAHA 4JB2A 1QK3A 3L8EA 4M0FA 5DRYA 4JKOA 1A72A 4C4AA 1Y6GA 3BN3A 1NVDA 1T5OA 1X70A 2ZOSA 1E3MA 1EKXA 2DT5A 3I3OA 4TZKA 4PG7A 5DHSA 3K6KA 3V2IA 4I4NA 3WQHA 2ZCJA 4UQOA 5ICEA 2WW8A 3K9HA 1J09A 1ICEA 2WABA 4ZCPA 2EWMA 3BGSA 2GTHA 1PJQA 4GI3A 4PIPA 3RTBA 4MCAA 3GGDA 1APBA 1ILWA 1SH7A 4B4UA 5FNVB 1GZ3A 5NLLA 2WD9A 3TQFA 1ZRHA 3UJ9A 4NCHA 1TUBA 2VTVA 3GWZA 4CKEB 4ESHA 1OE0A 3K1AB 5C1PA 1UFKA 1V6SA 1MQAA 5CD1A 3A7EA 4H1UA 1SQFA 3DUFB 1GZ5A 2XECA 3JXEA 4QRIA 5K0NA 4JT2A 3SD7A 3WIVA 1R8YA 1XRQA 3OCYA 2YDXA 3ULKA 2DCUA 4Q4HA 3BBLA 5JNUA 4Q3EA 1HEUA 1E1MA 1SU8A 2HM7A 2PWZA 2QOEA 1SEPA 3R6LA 4QODA 3U4CA 3PUZA 4HUTA 1VE1A 2WEKA 2WK1A 3F2IA 4LRSB 4F4FA 3A2KA 1DC6A 4GRIA 3U9LA 3CNHA 4HP8A 5I7WA 3QVJA 5EKDA 3RT9A 4CLHA 3H6HA 2D6FA 1EVYA 2I5PO 4JFAA 3R7AA 2XGMA 3AERA 1W8IA 3F2VA 1BGWA 2EZ8A 1AUXA 2QE6A 4CW7A 3PJRA 1U98A 2R8EA 3HM9A 1HPLA 1ZEJA 5BMOA 1OAKA 1Q7BA 1HE8B 2ZU0C 1FK8A 2Z9CA 4AUKA 1PU2A 2H1RA 3F96A 1DMRA 2QRUA 3F90A 1F4VA 3DAPA 4KRGA 1GGJA 1PJ4A 1P74A 1BWSA 3OIUA 1F48A 1RBZA 4TTRA 3ROPA 4RKEA 3UV6A 3F71A 2Y67A 1NXXA 2C8KA 1JDSA 2P77A 1FYEA 2BI8A 3CZMA 3HJHA 1FFXA 3BGWA 4LOIA 4BRUA 1XTSA 3UGQA 5I8ZA 1PKEA 4X6LA 2AE2A 3OLQA 1YZFA 4KR9A 3B36A 1WXXA 1GT91 2CUKA 3ETHA 3F6YA 3QV2A 5HZKA 1U3DA 4OJNA 1EJ6A 1OXKB 1XHEA 2B69A 3D8BA 3OM8A 3Q10A 1HBJA 4YCDA 3TVTA 2J7PD 1VJ1A 2ZRNA 3VOSA 5IG2A 2NQ8A 3A70A 3HLKA 2IUUA 4DY6A 1GILA 3OZVA 4Y30A 5DULA 4C76A 4EYKA 2PSJA 1Q14A 3PD7A 1LLCA 4AS1A 5ALGA 1NXSA 1YRAA 4Z53A 3H86A 2WF6A 3FLBA 4I9NA 1T8SA 2X3UA 10MHA 1B2LA 1L8QA 4AP5A 2BEUA 3SWWA 5IMBA 4UC0A 2X8BA 4BWVA 4DV3B 2H3HA 1RIIA 3KCQA 1N5LA 3N28A 5GVSA 2CLEB 2VPZA 3DLPX 2FX2A 4P5PA 1OI7A 1Q57A 1C9DB 2YHBA 4O4IB 3V1UA 4YRTA 4E2XA 3PX7A 3NG1A 3RBZA 1Z0JA 1WBBA 1FBNA 3L8FA 3O2JA 1AK1A 3SXJA 4Z3KA 5HOQA 4ND7A 2WUGA 1E1QD 3K31A 4NRDA 1DPFA 1G8GA 4FIDA 3H6GA 5CA0A 3VO1A 1IN1A 1Q3KA 2QDKA 4IIYA 4M37A 1I6LA 1UKEA 2Y6UA 4KN8A 4NECA 3WX0A 1FX0B 3ZQJA 2ZIFA 3BHJA 1VL2A 1VL8A 1XJ5A 2HRBA 1JXAA 1K7CA 3Q3GE 1II8B 5EP3A 1G5IA 2EWVA 4CGYA 5TQ2A 3U3DA 3ZDAA 3QVOA 3MYYA 3LY8A 3RRXA 3MJVA 2JA2A 4P32A 4B7AA 2WWWA 3WYNA 4A10A 4Y6PA 2KJQA 4MWBA 4RA6A 3SZ3A 2J9ZB 2VP0A 2ZYHA 4C2UA 1WSDA 2RG1A 3OJLA 3ADPA 3O4FA 3PQCA 3B1VA 4IIFA 3ZIAD 2X1VA 3FTNA 4EJFA 4YHBA 2NT4A 4CQNA 3H8SA 1X1CA 1WRBA 3T41A 3CUTA 4B32A 1N7IA 2D0IA 1NBWB 3D0KA 1DXYA 3AETA 3PNLA 2YVAA 4IX9A 1XCBA 3HB9A 1F9AA 4S05A 3FYUA 3PGVA 2PANA 3EBPA 5KOHB 4RHTA 1F2UB 1VJ0A 1WZEA 3EXHB 4TRMA 1ZC4A 3ZLVA 3D6VA 2AFHB 2GI4A 5JCJA 4ZKDA 2HA6A 3A32A 3B2NA 3FFBA 3SSAA 1UZUA 5TQJA 3HR7A 4B4KA 4Y6OA 4BNDA 4E2FA 1DO2A 2HZ7A 1YCGA 4KJZA 3ANYB 2DR0A 3H3FA 2NNWB 4LW8A 5FTLA 1S9DA 1X7WA 1KJYA 5JJCA 2MSWA 3O91A 4S2EA 1RYMA 2G7ZA 2HPHA 1PWZA 2RMKA 4OB8A 4RHFA 3ZNQA 2FB9A 5K0FA 1O8BA 1CUVA 4ID9A 3UOWA 3LOUA 4JI2B 4EGSA 1F2TB 2IXAA 3MF4A 2XAUA 1WUTA 4ON9A 1P72A 4QUAA 5FTNA 8ADHA 1CVRA 1QYWA 2G3YA 1YE3A 3C3KA 5AXDA 4RJTA 3OO0A 2C2ZA 3I3SR 3D43A 3PDIA 1M7BA 3AVVA 1S8OA 5AJHA 4CT0A 4DMHA 2EBHX 4ND5A 2CY0A 2XH8A 3VU8A 3H2HA 2A67A 4L5AA 5BWCA 3LQ4A 2JLYA 4GMGA 3HNRA 2D74A 5CR9A 4OF4A 1H69A 3W5UA 2HN9A 1IXSB 1C4XA 4BJ1A 2RIRA 3VKVA 4N76A 2G5TA 3EVDA 2E3JA 3LOQA 2F3RA 1ACJA 4Z1MD 3WR5A 1YV9A 3LRPA 1ENOA 5FBKA 5HIIA 3V4RA 3KLPX 4JT4A 3WGJA 5DB4A 1E5DA 1R0BA 1YRYE 2IYAA 2PJDA 3AF5A 5AI5A 5DCUA 3QLUC 5A5EA 3O8OA 2WV9A 2JJ2A 3N2KA 4S0ZA 5F33A 3GP8A 1ZXBA 5JRJA 2Y1EA 3CX6A 1J56A 2Y0CA 4HY3A 5AVKA 5GWXA 5I9MA 1Z74A 4CM9A 4MQEB 3IEVA 1UK8A 2C9OA 2OV3A 3CS3A 2ZRIA 1OI2A 3H97A 4CG2A 1Y5MA 3BEDA 4B71A 3LA8A 3KPYA 3ANLA 3DBRA 4QECA 3EVFA 2FDXA 3LUGA 3UUGA 5LU8A 4D9JA 4Q4AB 3QE9Y 4WOKA 1BXRB 5DBGA 1N6NA 3R9WA 1AH2A 5E8JA 1AE1A 1WHTA 1T9BA 2XE4A 3A8TA 1VL6A 3DXFA 4ZRNA 3EUWA 3CCBA 3IMCA 5FL7A 4ZI5A 1M8FA 4YR9A 1KARA 1DCTA 3BGVA 4YCJA 3CR3C 4RWZA 5TJHA 4G0UA 3QWBA 1DRUA 2BUCA 5HS6A 4EPYA 1RP7A 2O48X 1HYHA 1TKAA 1PWEA 4L3WA 4WLVA 4XQ9A 2QLLA 1ATIA 4M87A 3GPCA 2WYOA 3FYUB 1RMYA 4EY8A 5HRCA 1JW9B 1KFBB 2V7XA 2NZYA 2XHZA 4F9GA 3H2IA 5AK4A 1KDYA 3RS9A 3STUA 3PWSA 3KS9A 1PV2A 1R4ZA 1IBRA 2B99A 3O7WA 4KU4A 5EVCA 4IOJA 4M9CA 4JUDX 3QYFA 3UKDA 4A26A 2IYYA 4BGUA 4RFVA 1DBQA 1KJZA 1JWBB 4KO2S 3V9AA 1VMKA 4EG0A 3KEOA 3WKCA 2AKYA 3ABRB 3BXHA 1VL5A 3OTHA 4P58A 4I9FA 1QC5A 4IRMA 2NGRA 4MP6A 5DN9A 2F6RA 1CJCA 4IDPA 1YIAA 3FZYA 3E8MA 4A9AA 5AIAA 3WGNA 2QR5A 2VJCA 1WCIA 1GHTA 4E4YA 2IYZA 3NDBB 3ORQA 5IC6A 3CEMA 4L4UA 5DTRA 4P35A 2PR2A 2N47A 4HFRA 2BGIA 3GEIA 1RNLA 3VH1A 3DTVB 2IYPA 4PFKA 3ZIDA 1SKMA 3AEQB 1E1YA 3C4VA 1CUCA 1G8JA 1WZUA 4NU8X 4Y1FA 2Q0QA 4EFNA 1LF0A 1MOQA 2EGUA 5CA0B 2C8LA 1FJXA 1NVFA 3VH4A 3CLUD 5FHRA 1R0WA 4RLQA 1T0IA 1NYRA 4LOAA 1YR1A 3C3YA 3PQ6A 5HGJA 4AYTA 2GUWA 2ZT8A 3M3HA 5EYPA 2EBWA 5BUQA 2Q7DA 2Y92A 1GNTA 3JWPA 1P2UA 4YP7A 4HMPA 4TVSA 1GA6A 2CF6A 2J9FB 1RRMA 1YA4A 3EIEA 3H3XA 4WXPA 5IYZF 3KDSE 3GJXC 3KTAA 3KP1A 4EEZA 3NHAA 4ZJPA 1YJAA 1JSRA 5LQRA 1PVOA 1J20A 1N2OA 4KUGA 3CLTC 3KZVA 3IO5A 1UM9B 4OXQA 2V4MA 1D2HA 8AT1A 1TA9A 1Q7TA 4QDJA 1L5QA 3RNOA 3E61A 3IDOA 3NHRA 4O33A 1Z2OX 2RAUA 1R8SA 1FYWA 4D81A 3OLXA 4KE8A 2F9LA 4LBWA 4KN5A 2G1KA 2W48A 1JEQB 4L5CA 4P86A 3RHFA 1A8PA 2R8ZA 4EL0A 4MUJA 1C0EA 1SVWA 1Z4NA 3QMWA 1LEHA 3EMKA 1E1KA 3MJRA 3SYRA 3PC6A 1XZBA 3DAFA 2P6PA 1YONA 3FVTA 4I55B 1B8UA 2HCTA 3DDOA 4KLCA 1SKYE 4KVAA 1IONA 3FBWA 5ECGC 2BF7A 3ZK9A 1MXHA 5FBLB 2BEWA 2WSSD 4LKOA 2NTYC 4N47A 2G76A 5HFAA 5DGCA 3MILA 3WLAA 5DXFA 2OQVA 4RCZA 1CE8A 5LM3A 3AFNA 4EJ6A 1N4AA 1JIIA 1I4DD 3LSYA 1V4BA 3MTBA 5JJIA 3NBYC 4UVHA 1WPXA 3OUTA 1EFTA 2N1MA 4EZEA 1OBCA 3ND9A 4DMUB 9LDBA 1PVVA 2D1RA 4H2DA 4MVJA 1O58A 3MRSA 3GB9A 5AH0A 3X1KA 1NF9A 1NNI1 2ZATA 3SS8A 1ONPA 1R3UA 1XI2A 2ZYIA 3LFHA 4KZKA 4EOGA 5HEKA 1DDIA 1NG1A 4QOFA 4TTAA 2GZMA 2IEYA 3P2OA 4QBHA 3GRKA 3EA4A 5IKEA 3WA6A 1MKYA 3N7AA 1CZLA 3BA6A 1PNVA 2HBQA 5A3QA 1WB9A 1VHTA 3ZGZA 5FOTA 4BLUA 1I01A 2PT7A 3TNFA 3EISA 3CISA 4Z1OA 2NUPB 1P4GA 4CEJB 4H7DA 1E77A 2RHMA 1Z7GA 2XSZD 1B1AA 1W0JD 2WTNA 2PKYX 3A4VA 3GMIA 4WD3A 1S3SA 2LR0A 1SUEA 2X6RA 2XDQA 1JEQA 3OLWA 5KNCH 2EU8A 2KM1A 3HPRA 4JI5B 3ITEA 4KYVA 3TQSA 3A4LA 3USES 1E2UA 3TOCA 2VL7A 1ZESA 4H4EA 3WOVA 5EJ2A 1WG8A 2O3TA 2YTZA 3ORFA 3C3CA 5CHEA 4NEGA 1QOZA 2CHQA 2HBYA 2PCJA 1N2CB 3M5PA 3VKFA 4YAIA 2O7SA 2L18A 2XUAA 1JALA 1NR1A 4W5TA 1EE1A 4YRQA 4Z51A 3IELA 3EZFA 3G3EA 2AYXA 3LRXA 3PGA1 2JJ1A 3RFFA 1GSOA 1SOUA 4AZVA 4UPEA 3CF4A 3OETA 1L7OA 1YMQA 5I3CA 1XTQA 4WINA 4HX2A 5IJ0B 4AJNA 3KJIA 1H8HA 2OCYC 4BLVA 1JTEA 4C29A 2WRZA 3QVGB 1IHPA 1BMFD 1M6WA 2WJ6A 4RS4A 1UC8A 3W79A 2RK3A 2QX6A 4KREA 4W5JA 3ZDFA 2QX4A 1UPBA 4XD7D 1J2EA 1THGA 3F4LA 3NHUA 5CHYA 1Z08A 1P4HA 2YOHA 1H4SA 2JD2A 4WFJA 4DLLA 3GLGE 4ENRA 2V74B 1BDBA 2C57A 1X80B 4BB5A 4HL6A 1VP3A 3WAGA 4RPHA 1CYEA 1SCJA 3T9DA 3EHDA 2IKQA 4IDFA 4CF6A 4DW8A 2C7RA 2GXSA 4B74A 3KKNA 3OJXA 2B1RA 3LC2O 4M3NA 1V9CA 5LNK6 3E9EA 3A26A 4QPPA 2IU0A 1CUXA 3KQWA 3DEIA 2XNKA 3WKAA 1MU0A 1D1TA 4RZSA 4UNIA 4TMTA 4LVNA 5ARDA 1A1SA 3K8OE 4NTZA 3VI4B 1FVXA 2Z04A 5B1DA 4Q34A 3IMGA 5E2IA 2MMCA 1QKIA 2ZXEA 3D8RA 3UWDA 4DDMA 4LDNA 2GYUA 1XELA 4K3UA 1HFJA 1XCJA 2VQSA 1EG7A 2ZQYA 4LKRA 1FDTA 4NBNA 3U3KA 1RYZA 3CW8X 3S7TA 1NVWQ 4R2XA 3ISTA 1P0CA 1QAMA 4AJ9A 2VHQA 2JRCA 1E66A 1VKJA 2C7QA 1A2QA 4FGLA 4UHJA 4F5ZA 2VSOA 2XCUA 2CC2A 2HXYA 4NBTA 1Z68A 2EQ5A 5TPWB 4BL5A 1GJRA 1KZ6A 1J0CA 1R6VA 1U2RA 2PGIA 3OLVA 4EPWA 5AM3A 3WP1B 4BNGA 3K70D 2CLCX 1TZ2A 1YVDA 2AVNA 1Y4UA 3KUKA 4JEMA 4CIWA 5LIPA 2RSLA 5KBYA 2LV8A 3CRVA 2UV8A 3MTEA 3NJRA 3N70A 4AN4A 1WF6A 4ND3A 3PYLA 5D1HA 4BE7B 4AQ7A 5EKUA 1FSGA 4BRZA 1XRPA 1EH5A 1JEJA 2C8JA 4JNKA 5DMXA 5F5LA 3NBZC 2OZEA 3OI7A 4E6EA 1E2PA 1DRJA 4WXEA 2QG6A 1TO2E 3PG5A 2CFOA 2AOUB 2QS9A 1N1EA 2YASA 4OATA 2UZ1A 1MX5A 3PK0A 1T35A 2JFXA 2JCVA 1NMYA 4MIKA 2VRCA 4HLNA 5E9WA 5A4JA 3FX2A 2UZ1B 3MWDB 5IRCD 2PAFA 2WD7B 4KOAA 3ORHA 1NUUA 2DBYA 3UJAA 1D03A 2P6NA 1GQYA 1AZSC 1T8PA 1K88A 2CBZA 2WMYA 2VPXA 3L0BA 3WXMA 4EG5A 4GQAA 3ID6C 3ZJVA 2X7HA 3TFOA 2AE1A 1GL9B 2ZYDA 4KACA 2Q2NA 1B16A 1KO4A 2XXBA 3OZWA 4LOLA 2XUHA 3DJYA 1A5AB 2O59A 5JCXA 2QJFA 1FUUA 3T3EA 4LRXA 2WUFA 4XARA 3THRA 4NE9A 3G5TA 1NN3A 3K2BA 1UJ6A 4Y2QA 3PXDA 1TYBE 3RHTA 3EC7A 2ZI3A 4MVJD 4NBLA 4QICA 3L0SA 3U4IA 3WADA 2LE0A 3O4HA 3G1WA 4FYPA 4M0UA 2Y8EA 2R6JA 1JG2A 1U0GA 3WGYA 4ERXA 1JL3A 1KYQA 3ETCA 4RPJA 5FWXA 1ISJA 4N03A 4YMSA 3TZBA 5IULC 1KYYA 2JASA 5A3VA 1KI4A 1AY0A 4WVLA 3VSAA 1GPH1 3LHDA 4HD8A 2DBVO 2PJRA 2G67A 4IOLA 4OUDA 1A5SB 4FX2A 3M9LA 4YP5A 4S1TA 1OA0A 2OUIA 1T4BA 1IVYA 5KYUA 1VE6A 4BVJA 1XZGA 3DCJA 1LBEA 3AUUA 1KZ1A 1Y9ZA 1W0JA 4HG2A 4HLCA 4PYKA 2HJRA 4EO4A 5KUTA 4QHSA 1G9TA 2TRSB 4XGIA 3FYHA 3FTCA 2YV3A 3K1YA 3UYKA 4L5IA 4K87A 1RCUA 5ICCA 2ODEA 1U5BA 1ZBQA 4QDXA 3IHKA 2XZDA 4NQRA 4WDRA 2IKSA 3AB8A 1JR2A 3C5HA 3NXKA 1YXMA 2OLEA 5BSUA 4YK7A 3T1OA 2PCLA 1W2GA 3NR2A 2JBHA 1NWCA 2O4UX 3D3WA 3NUQA 1Z29A 4LN1A 3UMFA 1E7RA 4YDQA 5TARA 4UTZA 3IP8A 4EL5A 3SS9X 4N48A 1KJ8A 2YXDA 2ZI4A 1N8KA 2QAGB 4CKZA 3G2JA 5HYVA 5EHGA 4JUFA 5F1OA 2IOQA 4E0BA 5E1OA 3CLUC 2FMKA 2PVPA 3FXAA 2QTNA 2WF7A 1GTG1 2JB9A 3CU5A 4PX3A 3RYTC 1QDEA 1IL0A 3CO5A 2FWRA 3D6MA 4LJ7A 4RL4A 3F98A 5G3ZA 2FK8A 2H4ZA 2FSSA 4W1PA 2HK9A 3U7RA 1DTWB 4G4SP 3G0GA 5ESDA 1A4UA 3HYRA 1PO7A 5HMMA 2HDNB 3MERA 1SRQA 2C5HA 2W2LA 1UBTS 2BI7A 4B6PA 3LG2A 3KNZA 3U3RA 1G6Q1 4N40A 2P3OA 4GLFA 1XYVA 3KWLA 2ZS9A 4X8MA 1N2CA 1E32A 1XZLA 3OECA 4TV9F 3LTNC 1DAKA 4WK2B 4OIMA 2Y71A 4DMCA 1G3QA 1KJNA 1NBHA 3ZJUA 3LT4A 4I3FA 3S2SA 2A35A 3I28A 1RC0A 2IU3A 2JCBA 1I7SB 1TEVA 2Q5FA 2QTZA 3MOGA 3UVEA 1CQIB 3QU2A 5ELLA 3TN7A 5TPWA 1EFUA 1LH0A 2ZRKA 3NBUA 5M3BA 5ARBA 4G89A 1RYNA 4Z8XA 4ZZ1A 3FPKA 3QVKA 1PJSA 5BOSB 3HB7A 3IOBA 5C51B 5A2GA 3PGLA 4H0CA 1IXKA 3TL6A 3ZQUA 4AI6A 5TS2A 3D8SA 2BTEA 1D5WA 3H5RA 2IHKA 2I03A 2RHGB 1C14A 2GAIA 2KPOA 1FFXB 1CJBA 3H4MA 4B84A 2PUCA 4NMXB 4EO9A 3EPRA 1NLZA 3TYXA 1L5RA 3TDNA 4ZI3A 2P90A 1QPBA 1FDRA 4HWOA 2XDWA 1CQJB 1JHDA 3JYOA 3AR2A 3H11B 2Y66A 5JS2A 5AHKA 5JCZA 1O08A 3DBHB 2GDJA 5FXMA 2EEZA 3WYAA 3TUJC 4CCAA 3ESYA 2A9KA 4JB3A 4WVFA 5JPIA 3R40A 1RRVA 3LUPA 2HXGA 2B9EA 3Q98A 3VU9A 3UAGA 1P2TA 4IGAA 3ASUA 1SAYA 4CCYA 3ORSA 1VJDA 2GSWA 3TQTA 3LU1A 1NP6A 4LF9B 3IQDB 3KPWA 3LO5A 4UAVA 3ZTTA 2B8TA 3EH2A 2GJ8A 3LQ1A 1E2NA 1S7CA 2QM7A 1P7WA 3PL1A 3UV3A 4X6XA 1TZCA 2J9XB 3RFUA 1VE3A 4EMSA 5K3DA 2FJ0A 1LSSA 1EUZA 1AN0A 1VRCA 2O3QA 1UBSB 3VOBA 3WGHA 2JJQA 4HJRA 1Z6YA 1EFLA 4ARAA 1LXCA 3LXUX 3IILA 1KFKB 3AR7A 3NT5A 1UDCA 2WWXA 3H2YA 4EAQA 1F0NA 2GPTA 3M33A 3ABIA 3JSXA 3KZKA 3I6MA 3N1UA 1P5JA 4TMYA 3O8BA 3EVCA 3EWIA 5ALUA 4B43A 3SLGA 4MYCA 1RXIA 1HURA 3DAGA 1CZUA 3JATB 3B3QA 5DTIA 5IDVA 5CA1A 5FNVA 4BBJA 1ESEA 4A6EA 2B83A 1TYDE 2WVHA 1P1CA 4NICA 5DYYA 3W9UA 3HJFA 5LOVA 1KEVA 1PD0A 1OWNA 2A9OA 4L4RA 3PEUA 3TQCA 2X3FA 3DLHA 1NT2A 4MUFA 4RZUA 5J9FA 4PQRA 4K6CA 1R16A 4L4ZA 3DZDA 1CF4A 4OU4A 1E64A 4DCSA 2R65A 4ALJA 1PJTA 3IERA 1KYVA 2HDHA 3BICA 3H84A 4FK8A 4HB2A 4MUAA 3MD0A 1TTPB 2OZVA 3NPAA 1W4RA 4HGQA 2R8YA 4MKGA 5CFNA 1IC6A 1E1RD 5FJJA 5ICGA 1J2YA 1GVHA 1FFEA 3BRCA 4EPVA 4DUZB 5DHTA 4M99A 1T5TA 2FFBA 1UC4B 1UMDB 3WTCA 5CA1B 3GA0A 5FWDA 4UM9D 2A5GA 3R44A 3NTVA 5C8XA 3K0AA 2D13A 4KAXA 2O0LA 3FOAA 3ROEA 4IWNA 3CX3A 2SNIE 1YI0A 4PICA 4X92A 2EFGA 3WHIA 3OZEA 5AUPB 2PA3A 4FB4A 3HXOA 3QMVA 4FHDA 4KUHA 2PGOA 4LJAA 2W37A 4ENVA 3F6RA 4XAQA 1VB3A 3LHKA 5L3SB 2HBZA 3CW2A 2HA0A 2ZPUA 3FOBA 4UBLA 3SHTA 4EW3A 1G21A 4DCPA 3BD9A 3PTZA 1NBIA 2XMDA 3DHNA 3L92A 3R6GA 2J6BA 1VCHA 4OP2A 3V4ZA 3WMFA 5A0TA 2GTIA 1ADYA 5FBZA 4A7PA 2NO7A 4ZT6A 3JQ6A 2GK7A 2GZ1A 2FYTA 1VECA 1YKGA 2I1VB 1BROA 2WT4A 1CUFA 2GZAA 3LX8A 1Y3CE 3QVMA 4Q21A 3VNQA 4ZZ0A 2VUSA 2VDNB 1DRWA 1Q3TA 4H6XA 1W4LA 2E6UX 3Q5DA 4B6FA 2YRWA 4YEDA 5FO1A 3M5WA 2B3TA 4LFBB 2VA9A 3KK0A 3MWGA 1A2BA 3T1HB 3AKEA 2FSVC 2B1QA 4FC7A 5E6UA 4F2PA 2JGMA 1LFAA 1Y6QA 2D7CA 2Z30A 3D6TB 3IGFA 5EKXA 2X2PA 3QVXA 4Q66C 3WK6A 4ZO9A 3ZWCA 4D9BA 5KDOA 1ZGAA 4H16A 3ILHA 4KLAA 1JTFA 1GUFA 2EBFX 2GZHA 4JYAB 2GNPA 2VHWA 5CTJA 3ZK8A 2OXTA 4BNNA 1H8EA 2OBYA 4CM8A 3EOBI 3AKYA 1Z3CA 5C2JB 2IYVA 3OQ1A 2HW8A 4F96A 1USGA 3Q9UA 3QG1A 3QTTA 3IAUA 4DUYB 2GF2A 2OMEA 4CF7A 3FPBA 2EKBA 3IIIA 4YDRA 3ZHBA 4QUHA 2DJ5A 4R4JA 2YCBA 3IH5A 4D79A 3O5AA 4U3JA 1PJBA 2PSSA 2QTMA 4ZOEA 2PPVA 1MAVA 3DZJA 4C6TB 1BEEA 2WFMA 2XD9A 2AJLI 2BSQA 5CT8A 4RESA 1N0HA 4F46A 4OXKA 2IVFA 4F3CA 1RFLA 4H3KB 2W6QA 2W7TA 1HO3A 4S35A 4V0QA 4WOPA 2I91A 5DO9A 4HNGA 4DKJA 2XWQA 3JVUA 4GXQA 1GCGA 3TZHA 4LZJA 4GHWA 3P4UA 3IRUA 4WZZA 1UPXA 4CLOA 2EATA 1IOZA 1IBCA 4FYKA 1XRSB 2ZI5A 3HWSA 3FZEA 3HJCA 1R5JA 4UJ5A 4WJZA 5KKNB 2HWXA 3GZJA 3PPIA 3V8MA 3Q88A 1SXPA 3KXKA 1P3DA 3UICA 2HF7A 4TPKA 4CQMA 4Q48A 1XRLA 4BNYA 2BFAA 5A3JA 2HJWA 4IGEA 3ON5A 2JLZA 3AEUA 4PN7A 4CYMA 3KZNA 1XJQA 1RJWA 4NJMB 1JNXX 2FWAA 3S68A 2YVUA 3T3OA 1AS3A 3HM2A 4WCFA 3SKVA 3GFBA 2IOFK 2JFQA 3AKZA 3WISA 3GP5A 4XIYA 2IU4A 5BN4A 1K7YA 3O74A 4QT4A 1LPAB 3LT5A 4G6ZA 3DHYA 5KOHA 1KRHA 1L1QA 3TG2A 1ILEA 3PHLA 1FZQA 4LFCB 5HWSA 3TVYA 3V8NA 3IQEA 1MABB 2FZCA 3LQQA 3W4KA 1ELOA 3IESA 4TS3A 2RHJA 3D6JA 4QQRA 3U48A 1GKLA 2H2FA 5FULA 3ZXSA 2YWDA 1E89A 4L0DA 4ND4A 4BEVA 5L40A 3K73O 2JLWA 1HZJA 1E7SA 3T3GA 1CUZA 3OAAD 2Z2IA 4GD3Q 2GT1A 4IHQA 5FPHA 4BNWA 4A2PA 3QF4A 4IH4A 2I3DA 2FN4A 1BYIA 3U40A 3MJCA 5HKKA 4B3SB 1R4MA 1XL0A 3HUFA 1Y37A 1Y1PA 4C7XA 1NFRA 4RGVA 2A0KA 4B45A 3SHWA 4D8XA 3HO6A 2ZBVA 4D41A 2C3YA 2W43A 4PZYA 3TW8A 2H59A 4QGBA 2EEPA 3FMPB 4H4DA 4NF2A 4V0RA 2VJOA 1I1QB 4MI1A 4ZI7A 2IHUA 5IJWA 2YYZA 4Y98A 1X77A 3C3XA 3CNEA 3OSUA 3IHWA 2VT6A 4PO9A 2B78A 3OJWA 1XMSA 3HV0A 3DEHA 3IDSA 1GPBA 3PEWA 4LJ8A 1U5CA 3WWYA 2D0OB 4I50F 4FR5A 2GN8A 2I3GA 4MDYA 2NSHA 2X76A 1DX6A 1U0BB 2MYPA 4NJEB 4ZOLB 1N78A 1Y6JA 4Z7QB 1FTNA 3N8DA 4F4HA 2REBA 2F90A 2HTFA 3GFOA 1NJGA 2PX6A 3QYAA 2R6CA 1QH8B 4DDKA 1MC8A 1P1BA 1Q0UA 2PMBA 4R83A 1JHRA 4Y6QA 5ERXA 5DM70 2XCSB 1ZVVA 1A5ZA 3AR4A 1SNYA 1ZVKA 3P71T 1SUIA 4UM9B 3OJEA 3CPSA 2Q1TA 2VQ3A 3S1AB 3WSVA 1ZM9A 1RRCA 2WU0A 3GT0A 3GLHE 3M70A 3ER6A 3PFCA 1GPDG 5IARA 1GV0A 3ZJ4A 1QTRA 2BISA 4D9HA 5GJBA 1M6VA 5LD2C 2VO1A 1T6XA 5HIMA 1I2CA 2BE7A 1KO1A 1JLLB 4AZWA 4XWWA 3OOJA 3E3NA 3CJQA 3L6BA 1N57A 1WA5A 5LKAA 3IUJA 1TYZA 2BW0A 2NUAA 3EB9A 4S1OA 2O19A 4DXHA 1CRWG 4L8GA 4ZO6A 3BSSA 2P11A 4MWCA 1ZNYA 1MENA 3IPRA 3L7MA 1CZKA 3LCRA 3OKAA 4OXRA 3IEPA 5A05A 4LZWA 1QWSA 4WNAA 1IM8A 3M3PA 3OCVA 2G07A 3U7JA 3K09A 4DHEA 1IY8A 3TLEA 4OL9A 4ZAWA 3ZV5A 2G17A 2R1ZA 5FBVB 4QL3A 5KTMA 1RQ7A 1A2KC 2E4ZA 1ZCAA 1F06A 3GP3A 2RE8A 1GAWA 3KWMA 1FL9A 1OLUA 5ER6A 1ZK1A 4L8VA 5KMGA 1U3GA 3AF2A 4OKNA 2YZKA 1J9ZA 4CT4B 2RG7A 2Y1OA 4MW0A 3VZDA 3W3AH 4ID3A 1EIZA 1OGYA 4IIEA 3RKRA 1SC6A 5FUQA 4FBMA 1D9ZA 3K3PA 2NQ2C 1JJFA 3AJ8A 3P2MA 5AESA 3IOEA 1XG5A 4NWIA 1F6WA 1VSTA 3SEZA 4DA0A 3GRUA 1H8ED 4E70A 3HO1A 1QWOA 3G0CA 1ODIA 4AVYA 3BMQA 4YCLA 3CNNA 3JQBC 4K6OA 5BSVA 1YR7A 3NIBA 2YV4A 2FEAA 2X4IA 5FPSA 3SVTA 2V6BA 4BEBA 1Y8CA 2CUZA 1U1GA 3PJEA 4XYBA 4KE6A 5A9SB 4G37A 1MRZA 4QXAA 3HNOA 1SZCA 2E55A 5PNTA 2FPPB 4ENPA 3U19A 3IQXA 4BQPA 3AY6A 1NW7A 2FQWA 2PLRA 1E1NA 3PRKE 2OA0A 5JYDA 3CX8A 2X9VA 4EHDA 5CDYA 4KMSA 1EAYA 2P9QA 1UDAA 3OQVA 3QBDA 4JELA 4GZ6A 2QRKA 4Z7JA 5EJIA 1JHYA 1ZUHA 2QLJA 2Y1KA 3AEKA 5DLDA 1NP3A 3RV4A 2RAFA 3IV7A 2B82A 1SZPA 2UUAB 1HTBA 1W85B 2WR8A 4QG7A 1OSNA 2CVFA 1JMVA 5CUQA 5F77A 4CODB 4PZ9A 4KAJA 2XXAA 2L17A 1OJ7A 3PJFA 2QE7A 4A0HA 5JASA 1KSGA 4OMUA 4TWRA 4YXWD 4K05A 4B3BA 4H3HB 2VRNA 4RZHA 4E33A 4POAA 2VYVD 1AO3A 4PPNA 3RVPA 3VHXA 5CK5A 1M2JA 1U9YA 2NYVA 1KL7A 1Z4LA 3BMOA 1WEHA 1J21A 1HX7A 3IB3A 3ETDA 1X1TA 1Y48E 1LWOA 4JP2A 3CF6R 3EXFB 3NCHA 3OZSA 3KZOA 5E9JA 3JRXA 4DQXA 1GSHA 2GYVA 3T3DA 3TE6A 4C04A 1V8FA 3CVXA 2KWIA 4RTOA 4DV1B 1WOYA 4R0NA 1ZK4A 4KK4A 2QZJA 2X1HA 1PFGA 2VJQA 3TEJA 2HA3A 3EWSA 2GBLA 1JQKA 2IXEA 3FMOB 1E79D 3H5WA 4L5JA 5T64A 4OHRA 5F7ZA 1MT3A 4WSOA 4ZI7F 1M8PA 2WJYA 1B0UA 2P6MA 3C5EA 5H3CA 5H59A 4ZHQB 1TU4A 1FP6A 1KC1A 5B7PA 4KITB 2H00A 1AKMA 2WKSA 3MS4A 1CV2A 2B30A 2FX5A 1U1FA 1YL6A 1L7RA 2HF8A 1KAOA 1P2BA 2HF2A 5GVRA 4EW6A 5JQGA 3VPFA 3BTUA 3EZ9A 4YV7A 3CB4A 3E2MA 1O96A 4LWOA 1OTXA 3SKXA 3JYNA 2TYSB 4N0DA 1TJNA 1IBMB 1VLVA 2APJA 3FUCA 3OAAA 4B3HA 2NXNA 1A71A 3UJ8A 2HU2A 1E5LA 2XVXA 3QEMB 4M1TA 4WMLA 4CTNA 1T1EA 3IQIX 4FNGA 3ZHYA 5JYEA 2H7XA 2RKWA 3PUYA 3RUEA 1E1QA 1E1DA 1F12A 1B93A 1AVTA 1WMAA 2JRLA 2ID7A 5DI3A 2WI8A 2IEZA 5U1PA 5IJ0A 1KVRA 3BE8A 4JBLA 2UUOA 1J2RA 1SXQA 1QRDA 4O29A 2OECA 2YXNA 1ZJ5A 2MOKA 2B25A 3DFMA 2Q41A 3GGPA 5GONB 2VOEA 5JWHA 3LPNA 2VXOA 2J87A 1T4DA 1A4IA 4UPVA 5LUAA 5JNWA 2EXXA 4Q47A 1B0ZA 3N3AC 5IH7A 3X1YA 2AR7A 1ECLA 3TLGA 4HFMA 1U9IC 5EWJA 1SHTX 3I0NA 3GUYA 1DAOA 3K05A 3R6DA 5KVVA 5T4FA 4AJKA 2X7XA 1WB4A 4CEHB 3ITDA 3R3WA 2W2KB 1YZYA 2GH1A 2ZE6A 1T36B 1W35A 2OO3A 3EGDA 4Z0NA 3K0EA 4BPRA 8ATCA 3VHLB 3HCDA 3IOYA 1SUBA 3WYCA 4DR5B 1P7CA 2NO5A 1AIPA 1V41E 5H3HA 2JBAA 3RYHB 4DWJA 1J39A 1MX1A 1M2NA 1TQ4A 2IHVA 4XX0B 1QYIA 1M66A 4BEJA 3M34A 3E15A 3V1YA 5HCIA 5MGNA 1IZ7A 4OQ4A 2I6XA 2AEFA 2LXNA 2RBGA 5C52B 2DTDA 4OREX 4PW0A 5A6VA 4CHTA 5KQPA 2HNAA 4KPUA 2BHSA 4AJ2A 3D8TA 1MO3A 4N5MA 4PFSA 3HBFA 1JJBA 2WTXA 2HPVA 3CVYA 2COUA 3D7MA 4Y2XA 1P8JA 4FZVA 3RHSA 3D2LA 4R2LA 4X95A 3REOA 2JHPA 4G2NA 3UK6A 4BLRA 3ZY2A 4MV9A 3VDXA 4EI2A 4J0DA 4YV0A 5FWNA 3QW2A 2IX3A 3H4VA 4LC1A 4CL0A 2O6HA 5CB4F 1H2XA 2QGZA 1L5YA 4Q6WA 3BCUA 4LDAA 4UD6A 2JLVA 2EKLA 4MI9A 2ZZMA 3N75A 4C7MA 1G8SA 4C7KA 2O3RA 4RKQA 4KIGA 1NMSA 1TM1E 4J1TA 5GADl 4WLFA 1HMPA 2IT1A 5AM4A 1PL8A 1BNCA 3TM5A 2PJUA 1JQ3A 2D5AA 1QZZA 3ZCVA 1D4AA 3E8XA 3HADA 3LI2A 3TSCA 3ZGXA 1P62B 3C3DA 3ENWA 2D8AA 2D2IA 3HN6A 3FHTA 4UM8B 5FAXA 1UEXC 3VR2D 1SBNE 3JQ7A 1MV5A 2AXEA 4J8PA 3MFQA 2AW3A 1XXLA 2X8LA 3E9YA 2GNOA 4V2IA 1OHHD 4EEKA 3L6OO 2WUWE 4S12A 5AVUA 4LE1A 1ESNA 4L6CA 4YLEA 3SICE 2LUOA 3E4CA 3JASA 3OIYA 1CQIA 1M74A 4KIFA 3FA2A 2IEDA 4R54A 1C9EA 3CX4A 4TTJA 5KWSA 1M10A 5JDIC 3ENZA 2PGDA 2R60A 4KPUB 2NZ2A 2HUPA 2PGAA 1QPZA 3SOZA 4W6ZA 2LKCA 1JN0A 5EXSA 3HG7A 1V35A 3BCHA 3WJ1A 1VXRA 1MORA 1SMKA 3JQFA 4PRYA 4BNIA 4CM9D 1CUHA 1PZNA 5T4EA 4DSZA 3E9MA 4F45A 3SQXA 1PUXA 2PRIA 1ZM3A 4BLWA 4ABTA 2ZJAA 5DNAA 3AVOA 4ZJUA 3T4XA 2WZQA 3P9XA 4LNUA 1X7XA 1NPDA 1H0HA 4ND2A 5BOVA 4GI5A 4NAUA 1WSAA 3TSAA 4UFPA 1DTWA 3FTFA 2QE7D 2GJ4A 1FW6A 2PMFA 1T5DX 1U1EA 3E7PA 4KGDA 1DUSA 3DONA 3TI9A 4LGMA 3V4LA 4E5VA 1TQ8A 1VGQA 2XF8A 4JJ4A 2IZOA 3AHHA 4MCJA 13PKA 4FVTA 1OUMA 3GVPA 4MAMA 4P0PB 4UKDA 2ZB7A 1P0QA 3NYQA 1XFAA 2JAHA 3I34X 4N8DA 3R5KA 5I4IA 3HEBA 1W5TA 2CEKA 4E88A 4TTQA 4C4SA 1ZHOA 2IE0A 4ZMBA 5JNTA 3I6ZA 1UMBB 3TWOA 3FMGA 2UYHA 1FVHA 1Y1SA 2YIJA 3HKEA 2GEBA 3GCWA 3EDMA 3Q0IA 3OQOA 2FZGA 1H42A 2R8BA 1QP0A 2VEDA 3SSOA 2WBLC 1XCMA 4MGKR 1XBTA 2ZK7A 1M1ZA 4X6UA 2XUPA 2QIPA 2X0FA 1XXHB 2O7NA 1E79A 4G9EA 1E9VA 1G8YA 4ZPJA 4MRSA 4LDPA 4PSKA 3L40A 1SURA 4AQYB 1EK1A 2PL1A 2G0NA 3UGTA 3HCAA 3K1JA 5A5FA 1TFRA 5JSYA 4B83A 3BB3A 2DFKB 4EKNB 4ADSG 2P65A 1VDMA 2H4FA 3M49A 1ZH6A 4Z0PA 4HDMA 1MTOA 1RE0A 4TRRA 3F46A 2WAXA 3NEAA 2QRQA 2ZI7A 2IYEA 4TWAA 1SCUB 2ZIXA 3W5VA 3BC1A 2QY9A 5DHUA 4CLEA 1TPYA 2GN6A 2PGXA 4JI7B 4DPLA 1EFAA 5C1IA 4IJ6A 1E3DA 3SFZA 5DF1A 2QQ5A 4V0ME 4X20B 5LMZA 4EM6A 3ZI7A 5HQTA 4JWTA 4WADA 2AI3A 4H77A 1L7NA 3WNZA 1X2BA 2WU8A 4FOOA 4QPDA 3FPCA 4OMDA 4DJ5X 1JU4A 2TS1A 4ZEMA 5SYAA 5H80A 4BB0A 3I12A 3IKLA 3LQ2A 1E7MA 4PPYA 1P2GA 5E7MA 2QX7A 1W75A 4AN0A 2J0QA 2O8DB 1P1KA 4F4JA 4LY0A 4G01B 1EXMA 4J16C 3F4BA 4B82A 3C7AA 3FLEA 1HTWA 4R3UC 2F7SA 5IJAA 1DIHA 1U7WA 2Y9MB 1P44A 2FLWA 4QU5A 4RKYA 4D96A 4MYDA 5LXTA 4C0JA 2CLSA 2HQOA 5ILOA 1FLDA 1NBMD 3V2GA 1GNPA 1E92A 1UMCA 5IWAB 4CKWA 3SNHA 4BFUA 1QIFA 1R18A 3EIWA 3QWIA 3IFSA 3CZAA 4JQYA 2IGTA 1WW2A 1XDWA 2QRVA 4P4SA 1MAWA 2GF9A 3QEJA 4IXNA 5FPTA 1LRJA 5SZJA 4LYJA 1FB5A 4E3ZA 1T6ZA 3HXPA 1KDVA 1EVJA 2PX4A 4O4HF 2XE6A 2MTBA 2XB9A 4JENA 5B4TA 2I66A 4HDKA 4I2NA 3WRXC 1XTIA 3NM5A 2IA5A 4NYMR 4WBSA 2I87A 5AVJA 2B8EA 1UKYA 2C5GA 2YWBA 2FPUA 3OA0A 4UNRA 1ZSVA 3EG9B 5LOVF 1C3LA 4A0RA 1OXSC 4Q1AA 5CDHA 3LMKA 3AHDA 4QQNA 1EVKA 2OV2A 1IHXA 2I7CA 3GUCA 4GOLD 4KJXA 5FQOA 4AJEA 5AVSA 3DBHA 3IAM1 1Z8HA 4M83A 4OHKA 4DUGA 1VQ1A 1KORA 3ZGVA 1K3FA 4YLYA 4RSMA 2YL2A 2CSUA 4DCMA 5JZVA 2XCIA 3R3YA 3INGA 3M6AA 1OFVA 3MNFA 5DVZA 1RC8A 4FYMA 2PLWA 4XYGA 3WRYC 1WDLA 1JVBA 2GPJA 2HL6A 1IN5A 2QUHA 2CLIB 2RGGA 3V4OA 2EVWX 3OIWA 3AM4A 5DSZA 3TX6A 3I61A 3MAAC 3OJ0A 4R2JA 1OWMA 4PSDA 4OJKA 3WMRA 1A97A 4DLVA 3LY5A 2V97A 2ZP1A 2E4UA 3E9RA 3BT7A 3D0RA 2J6CA 4HXEB 3JPYA 4ZVOA 4FDTA 3DOIA 3FYCA 1A7KA 3IVMA 4AFNA 2QMUA 3H42B 4YDSA 3NDJA 5GGYA 3AG6A 1ZJ4A 2CJFA 3VZQA 4UOQA 4G0XA 1N6KA 5EJGA 5C7LO 3G1TA 5CP8A 4ZZIA 5JVDA 3MT7A 3O4IA 1ULUA 1TMOA 4OB6A 4ZOCA 4TRNA 3K2IA 2K2WA 3OPYI 3L05A 4ZT2A 2Q6OA 3W2FA 2Z4SA 1DFGA 2IUEA 3ZW9A 5LDDC 4QX6A 4TMFA 4TUYA 2AKEA 1DJNA 2OP0A 2ZKLA 3MWEA 2ZRAA 3UWOA 1LGYA 2ACVA 1BJRE 4B2YA 2Y1GA 2FW9A 2QY6A 3E7DA 3GLKA 3GNLA 2BCGY 1Q17A 3R5XA 1XZNA 1ZZGA 1T0HB 2WJVA 4OXIA 4KQHA 1JAYA 1PLLA 2CMKA 3U37A 4Z9XA 3V8EA 4KR2A 4U6NA 2Z43A 5GOZA 4CBVA 4TTPA 2BEKA 5DM1A 2ZIGA 1PGPA 1ZS9A 1HETA 1UQUA 3QOWA 1R3DA 2X9LA 3L7AA 2FPOA 3P9KA 5DX8A 1JU3A 2YOGA 4COKA 4RC9A 2OAGA 3UJPA 5FO0A 1CUWA 1N2SA 1Z0AA 2QLBA 4NZZA 5F23A 3IBSA 2A9JA 1F2DA 2WC1A 2WF5A 2XYGA 3EIOA 2ONYA 3I32A 3QKWA 2ZYWX 5GTDA 3U56A 2CNNA 3RIYA 1TTHA 3LM8A 2OHFA 3AGPA 2J9GA 1YQ9A 2Q1UA 3H99A 3HYLA 4UASA 5CMLA 1XFDA 1YACA 3PNMA 4ZI7B 4U6QA 2ODAA 3N8GA 3NH9A 2HOQA 2BLNA 3KYBA 5AW0A 4PQYA 5JISA 3S1SA 3U4GA 1S8AA 2E37A 5LMUB 2L82A 2SKDA 1CHNA 2OORC 2JBAB 2PBZA 3FF4A 2IQ5A 5TGDA 5CCBA 2YV1A 1LTQA 2AWOA 1MJ5A 2O6LA 4L2IA 1AK2A 5WRFA 4ERNA 4BBAA 2PZGA 1FX1A 3GLHB 4B8WA 2OSBA 2OVBA 5K3AA 1E5QA 1B8NA 1Y7IA 1Z34A 2H2GA 2QJWA 3T7JA 4B2IA 1U3FA 1VRVA 2BEVA 4ICIA 3BIFA 3NLLA 3I39X 2RGEA 2H6EA 3IBGA 4OA5A 4PYLA 1DJOA 4BAGA 4CKYA 2P6OA 3WMWA 5HQ3A 4X44A 1NHGA 5JY1A 3IVXA 5DTJA 4XZ3A 2HIMA 4KB5A 2ZJBA 2AFIB 2WA1A 3C2QA 1T34A 4EB8A 1ZLYA 2GJKA 4ER6A 1GZ4A 1ZGJA 4IVRA 2Z9DA 2ZPAA 4L3OA 1ODFA 3KKZA 2XIQA 4OUDB 1ORHA 5HF8A 4GM4A 3H6KA 1EFDN 2VAMA 5D2CA 4Z0HO 1T9AA 3ILXA 5DWQA 4RMIA 1MN6A 3IBCA 3L79A 4UAJA 4KQ2A 5CVTA 4MQLA 1NJ6A 1FS4A 3U0BA 3ZXIA 1QIIA 1BDJA 5FBRB 3WSWA 1A8HA 1I51A 2JANA 1D04A 4HDRA 4OG2A 4QXOA 5L7TA 1B74A 4BVLA 3VOTA 4BZWA 3QTBA 2IEAA 2XLBA 2IPXA 4LHSA 2LTAA 2A33A 3WL7A 1T6YA 3CPHA 3HFGA 3K15A 3DE6X 5BR8B 2V4ZA 4NBVA 5KINB 4OI1A 5AFSA 2JK1A 4IQ4A 1P61B 1JJIA 1MGOA 3IQWA 1QHHB 1I7LA 1GYRA 1Q6ZA 4XGQA 3V3TA 5IX8A 2XRFA 3TD2A 3OVMA 3A2MA 4OSEA 4KZPA 1UBNA 3TLKA 1IHYA 2V98A 3R7WB 1VHLA 3GJ0A 2PQ2A 4K9RA 4AX8A 2ATEA 5HQ3B 3G2KA 2ISQA 4W9NC 4MA0A 3N5CA 3TLMA 4J6FA 4QELA 2ZRFA 1KK0A 3KQTA 5TY0A 4TLAA 3HA5A 3I0MA 3K1AA 3MUOA 1FDIA 3JQQA 3PC3A 3ZQ6A 1N4DA 2EFYA 1TZJA 5FWYB 2OB1A 4L4YA 3T7CA 2VYCA 4JVNA 1UM9A 1Y4AE 1HA3A 5AJZA 3PC7A 2EJCA 3OZ7A 3B70A 2ZUCA 2A1TS 3WIUA 4R41A 1GTZA 4I81A 1I4LD 3LSTA 4ZA2A 5K09A 1L4GA 3L9WA 3OQHA 3MTJA 3A37A 3V8PA 4C43A 2JGAA 2PK3A 4RIHA 3HDYA 4FCCA 2OKCA 2B4QA 4GC9A 3RKSA 4X7BA 1A88A 4GMFA 5JVDF 3WOHA 4OH1A 3G5AA 4RVOA 4HQ6A 4OLFA 2D06A 1LI5A 5BWLA 1JKIA 5HJEA 1RBYA 1DO8A 3CEJA 3NVKI 2ZWAA 3BWVA 4FZRA 1T9GR 1WCXA 1N9KA 3G2NA 3OE4A 4XM0A 3VMFA 2ORWA 4RPIA 4CUKA 4DMRA 4HNVA 3Q2KA 2ZIUB 1WD7A 5E7JA 2AN5A 1ISIA 2EFEB 1SC3A 4IPTA 4MW5A 4Q3AA 3RRJA 4A6PA 3WICA 3S2YA 3HE3A 3EVTA 2QPOA 4XCQA 2JKYA 4ZMRA 2ZUEA 4S04A 2ZB2A 3VPHA 1A98A 1K08A 1RCFA 4QGAA 3QITA 4NXMB 1H9AA 4OGKA 4Q9DA 1JFVA 3OG9A 3U1BA 3ADCA 3CKKA 1H0RA 3L6RA 1IMOA 1AQLA 1USIA 1SIOA 1XEWY 5AYVA 5U9CA 3GZNB 3VJRA 4MYTA 4ZV9A 1DAIA 3A1FA 3C15C 5LD2B 1G8HA 5AM0A 2F43B 2P1ZA 4ZYZA 2FPWA 4Z9YA 1YIDA 3ZE2B 5IABA 4UAGA 2VZ0A 1EVZA 1J70A 3GG9A 4GP6A 4Y2JA 1V9SA 4AN1A 1A7JA 1PJCA 1KXJA 1W8DA 2WIFA 1KK1A 2AZDA 4FOLA 5CFOA 3UY4A 5JS6A 3W9YA 4A8HA 3TUIC 2UDPA 2TSYB 2VYFA 3BSWA 3FUTA 3LS2A 2ZVDA 3MHPA 3K5HA 2ODQA 2XDAA 3LFTA 5CT9A 3EVNA 4P3XA 3BIOA 2HDOA 3G8YA 3PWTA 4UBOA 2VDOB 4OGLA 3ISVA 2QZ4A 1SHUX 1RPAA 2QTVA 5JROA 1G8KA 1D1SA 1KK3A 4Z6KA 1Q3HA 5BQOA 4BP3A 2JFUA 5K6AC 4Q7EA 1UZAA 3F47A 1EJBA 1SD1A 3IYLW 3M1IA 3MT8A 2NUAB 3C87A 3IV9A 2QPTA 3WTBA 1L5WA 3KT8A 3NOQA 2AJDA 1QV9A 2JS7A 1JPJA 4W8OA 2WYVA 4Q4AA 1OBOA 1XHLA 4O4LA 4AMGA 2VZLA 3EUAA 5FLYA 1TI7A 2PGNA 1G3IA 1SR8A 4BQIA 3DAYA 2QZPA 1ZUNA 3P94A 4BHTA 4FYVA 1GL6A 2H54A 3PI7A 2BBSA 4DCOA 4MMZB 1YZTA 2ZJ3A 1Q2UA 4M1ZA 2X0KA 2A84A 3AFMA 2P9YA 4QLAA 3CTMA 2P4SA 1UBOS 3K7EA 4L0MA 1RI1A 1Q12A 4ZVNA 5U4QA 3ZHXA 4CMIB 5ITZB 1Y89A 4TT3D 2XE7A 3SC3A 3UWPA 4FBLA 4RK6A 4ZOLA 4CM4A 3QWHA 3FWHA 4MA5A 2FEWB 2CLDX 3FFAA 3QE2A 4U2DA 4PANA 3W8FA 2MSCB 2E1RA 3AFIA 5KYWA 1PEKE 1H0SA 5TSDA 1K7FB 3BMNB 4TYQA 3H2GA 3WNCA 4ZC1A 4GX2A 1U4SA 4FINA 3ZGYA 4LC0A 3G2PA 4ZT7A 1J1IA 5BN1A 3RBXA 5HA5A 3OQNA 1MIHA 1UJ2A 4WACA 2GLTA 2F3TA 4Q1VA 2F1HA 3K6SB 1V5IA 3HCRA 2D2VA 2NACA 1GSAA 3JQGA 1TMYA 5ULLA 2FPIB 1MX9A 2OK8A 2F1IA 5ALYA 3GX1A 1TF7A 3MD9A 1B0AA 2IYSA 3EDCA 4HVTA 4KGXA 4O2RA 4XLTA 2ORYA 3RRFA 1BXGA 1MJGM 4MGIR 1DKLA 4TXHA 2BFCB 1YHYA 2V54A 3EPKA 1IPEA 4NBRA 4QNNA 4RZQA 1Z6GA 1P5HA 1A50B 2W6PA 2GAOA 2VHXA 2WNIA 4J0QA 5CVDA 5J5CA 5DNWA 7REQA 1JR6A 3FPAA 4AMUA 1AGPA 2QN6A 1TEHA 3RG8A 3X1MA 5KC8A 1WJGA 2C9DA 4KH1A 4N6OA 4N4AA 4PC1A 1WTAA 1DBIA 4RKRA 5ALTA 2X23A 3T12A 3RO7A 1UZLA 2VKTA 5T41A 1ZNXA 3UWKA 2HLHA 3FGNA 3KVNA 2MCFA 3HUTA 4RNCA 3ZGNA 2HO5A 5BW4A 1ZIDA 5DW0A 1PDWA 4JI8B 3R2JA 4MWSA 2BHTA 3K09C 2X3YA 4MEJA 4X3OA 3S5JA 2AFHA 1GA1A 1VJRA 4PTYA 3EBLA 4J3NA 3DMTC 4DXDA 2VCYA 2C4VA 5DHPA 3PJGA 2DHRA 2RH9B 4OIFA 1T3ZA 2P4QA 2Q9AA 5HRUA 2I22A 1QU3A 3DMPA 2GJSA 3UAOA 3F7TA 1ZQ1A 2RIPA 3DZ8A 2WM8A 4K9KA 1VE9A 4KXVA 2O2YA 2GUGA 5LUBA 3TL3A 4D8UA 1GKIA 2CHGA 2V7GA 3P1JA 4NFYA 1XCLA 3DL4A 5CEEA 3ZBUA 2Q0SA 3NKVA 1BU8A 2W4IA 4NFLA 4HNAB 3R4CA 1W46A 1M2FA 2VNJA 4UHDA 4YQZA 3UUEA 4CG3A 4EGFA 1PNQA 3DYIA 2XE8A 4NYJR 4R01A 4RVFA 3DW1X 1IUKA 1KU6A 2WWRA 1DZIA 1MJHA 1YS9A 2GZRA 5A62A 5UKDA 2HF9A 5K05A 4R1OA 5KOJB 3OHPA 2DHEA 1XALA 3X43A 1ZL2A 3VSEA 3K6SA 4FYYA 2QEQA 4ZQHA 4YO8A 3GJTA 5E6SB 3LLCA 1Z3IX 3EPHA 3NRJA 4Y2VA 1ZQ9A 3ICWA 2VFAA 2EJTA 3BFXA 1PSDA 2ZSAA 3RS0A 3DB2A 2BKVA 2GBLC 5IC4A 1N77A 4MVJH 1VKRA 2A9VA 4ZANA 4L6AA 4EENA 3L4KA 1XZCA 2V9ZA 3E9NA 4GLLA 1UINA 2CHVA 4XQEA 3UMJA 2H8KA 2PRSA 4J7UA 3HYNA 1V5EA 3FGPA 3KJZA 3COJA 3NP9A 4BEWA 3DMYA 4X8HA 5ITZA 2J33A 3GZ4A 3ZH2A 3UPTA 3R0QA 1MJFA 1JDPA 2ZYVX 4CM8B 2H16A 5K2MA 4OAPA 3ZJ5A 1NI5A 1U7XA 2QVXX 2GD1O 1HLFA 4EJSC 3H17A 4LSZA 1XA0A 2AI2A 5DGTA 3QJYA 3VVBA 1FFYA 3ETLA 4MKIA 4IV8A 5KSOA 4KRXA 3BGOS 1DQZA 4G8DA 3NNDA 2BMWA 5L3VA 3JQFC 2QTHA 1XP8A 1FPMA 1L7AA 3C43A 1M54A 4UUQA 2DYKA 2QP9X 3MUFA 1FCJA 4JITA 3EN0A 2Y4OA 3A1CA 1EP3B 2ID9A 1Y8RB 1H9CA 5J3JA 2JFNA 4RVUA 4WXHA