3TB6A

Structure of the effector-binding domain of arabinose repressor arar from bacillus subtilis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
283
structure length
283
Chain Sequence
NKTIGVLTTYISDYIFPSIIRGIESYLSEQGYSMLLTSTNNNPDNERRGLENLLSQHIDGLIVEPTKSALQTPNIGYYLNLEKNGIPFAMINASYAELAAPSFTLDDVKGGMMAAEHLLSLGHTHMMGIFKADDTQGVKRMNGFIQAHRERELFPSPDMIVTFTTEEKESKLLEKVKATLEKNSKHMPTAILCYNDEIALKVIDMLREMDLKVPEDMSIVGYDDSHFAQISEVKLTSVKHPKSVLGKAAAKYVIDCLEHKKPKQEDVIFEPELIIRQSARKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the effector-binding domain of the arabinose repressor AraR from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords Arabinose metabolism transcriptional repressor
total genus 110
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tb6A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tb6A01
2E4YA 3UK0A 1M2FA 1QP0A 2IDMA 5D2CA 5EWMB 1YVUA 5HM6A 4N0PA 3TO5A 1EFAA 2P9HA 3C3WA 5FBHA 2IOYA 3VNBA 4HNQA 1XHEA 3M9WA 3O2SB 4WWHA 5IUJC 1SXIA 1JFTA 4PICA 6ABPA 1KRWA 1KGSA 3C3MA 4L85A 2H3HA 3RVPA 5FWYB 1D1PA 4JB2A 1BDJA 5GOTA 4RV5A 1M5UA 2PUBA 2PUDA 3HM9A 3BRSA 1NXPA 1NXWA 5JS1A 3TMYA 5C5EA 4JB0A 5EWLB 4L4UA 2CWDA 3Q41A 3UUGA 3FGZA 2LPMA 2FTKE 1TMYA 2QW1A 4HNRA 1JF8A 2GX6A 2BGGA 1C0EA 3KYIB 2M1ZA 1JFVA 4YO7A 4KRFA 4UHJA 1EHCA 2HPHA 3EAFA 3LFTA 3LUDA 1K66A 1I3CA 1XWWA 3CLKA 3H6GA 3MQ4A 3GWGA 3CU5A 3FFXA 3C97A 5HQJA 1F4VA 3VNAA 2X7XA 2YHBA 4MQEB 5JNRA 4RK5A 1J56A 3H5LA 1ZGZA 2IPAB 4LZLA 3N0RA 3HV2A 3QEKA 2DRIA 1TLFA 4ZPJA 5GQSA 2FQYA 1JHZA 3A0UA 4JOQA 4PEVA 3O2QB 1DG9A 4G0ZA 1A0OA 3T95A 2MYNA 1KRXA 1L5ZA 3CG0A 3L49A 1ZY2A 4G0QA 4NQRA 4WT7A 4XLTA 4TMYA 5ABPA 5DGCA 3KLOA 2PUAA 3O1JC 4MYRA 5FBKA 2ZAYA 2RDMA 2LP4Y 3RH0A 3MA0A 4ZJPA 3HJFA 4P98A 2OQRA 4YGXB 1YMVA 1BDHA 4PZ0A 4H60A 3ROTA 3SY8A 3T38A 1ZH4A 1FFWA 1LBIA 4RK0A 5IUKC 1QO0D 3CHYA 3Q7SA 4PYRA 3G1WA 3HVRA 1DBWA 3RVJA 3M9XA 2QV0A 2FMIA 4IILA 3SAJA 5JNUA 1A2OA 5DTEA 3E3MA 3T8YA 1BAPA 1LK0A 4YS6A 4F3TA 3OM1A 4MQFA 3C6QA 3IPCA 4RXMA 4N47A 1SRRA 5E3JA 5CNKA 3SQNA 3TB6A 1YK0A 3NHZA 1ZGGA 4MPTA 5IEJA 1JL3A 3OM0A 1KMIY 1JWLA 2W42A 1GCGA 1MIHA 1NXTA 3LUHA 5EWJB 3F6CA 3GBVA 1Z12A 2JVJA 4YP9A 3ILYA 2I6FA 2MYTA 4QPJC 3DLHA 3O75A 1L5YA 1NXXA 8ABPA 1AB5A 2A9RA 2QU7A 3MMNA 2QZJA 3HEBA 4S05A 3OQOA 3HDGA 4HNSA 4Z99A 2LUOA 5CHYA 5TPZA 3LUGA 2NT4A 3GL9A 1U2QA 4Q6BA 5CNJA 2VUHB 1TJYA 3KLNA 5TQ0B 3Q9SA 3SNKA 3OMWA 2JBAB 6CHYA 4PE5B 3P9YA 1OXBB 1P8AA 3OO0A 3N53A 2JVKA 5BR1A 5TE9A 3BBLA 2F8SA 3BREA 2OENG 4Q6WA 4Y9TA 1PNTA 1UDRA 3QX8A 1USGA 1USIA 2A9OA 2A9QA 3UKJA 4DADA 2R25B 4O1HA 4EVRA 4KK4A 5DLEA 1MAVA 4MS3A 5KQPA 4KREA 1ISRA 2PL1A 3K4HA 5TPZD 1MB0A 3LKVA 1APBA 4IMJB 2R48A 4DN6A 5JNVA 3LKBA 3HZHA 2N9UA 2IPLA 4KNYA 4G0MA 3TX6A 4KMRA 3K9CA 1H9CA 1YK1A 3RVNA 3RVSA 3MF4A 2MYPA 3I5AA 4EVSA 1B00A 1ZDMA 3CKMA 3EDCA 1DCMA 1RNLA 3FMVA 1JFSA 4KVFA 3LOPA 1FSPA 1E6LA 4JP1A 4ZMSA 2R47A 1SD5A 3H75A 3JPYA 1FQWA 4IMIB 3IP5A 5JNSA 3QELB 1IIBA 2FKAA 1R8JA 5B3JC 2FLWA 1MB3A 2WMYA 4W5NA 1LJUA 3H6HA 4YCSA 2ID7A 4D6XA 4LRQA 4RK6A 2YHAA 2AYZA 4KPYA 4NICA 3B2NA 2CD7A 3N6VA 2MSLA 3QLUA 4IRXA 1D5WA 1NY5A 3DGEC 5F64A 4EUKA 1D4ZA 2PUGA 1DC7A 2JVIA 3H5WA 2MSWA 4F12A 3O21A 4RDCA 3IP7A 3M6MD 2B4AA 3OLVA 3F6PA 1W9HA 2JRLA 4N76A 2WY2D 4RY0A 2CHFA 4NCBA 1U2PA 4ETIA 1EWKA 4FE4A 2GBPA 4MS4A 2KYRA 1P6UA 2E4WA 3I42A 1QQAA 1RXEA 2L19A 1Z15A 1DP4A 1P6QA 2WJWA 4ZMRA 3Q15C 3EGCA 4NV3A 2E4UA 1LBHA 2HQRA 2TMYA 1BVHA 2VK2A 2FMKA 5T7BA 2FMHA 5HKOA 4W5TA 4S04A 2L18A 4EYOA 4LE2A 3URMA 1Z25A 4F11A 4NCAA 2E4XA 2VUIB 5JNTA 2J48A 2NUBA 1DRJA 4MS4B 1JBEA 3ILHA 2WWVD 2LIVA 4ML3A 3FDFA 5DKFA 4JASB 4Z4IA 1YS6A 1EAYA 2WJAA 2ZWMA 3QLVC 1D1QA 3HUTA 3A10A 2FEKA 3DZDA 5BRJA 3QEMA 4OBBA 4RU1A 4MAAA 3H5VA 1T34A 1CYEA 4KQCA 3R0JA 5HSGA 2PMCA 4LE1A 2HSGA 4RWEA 4MR9A 5I4CA 5IULC 3GRCA 1AB6A 3OO1A 5CNIA 4B09A 2QR3A 3FFWA 3DLBA 3NBMA 3GT7A 4QYWA 4RSMA 4Z0NA 3RVOA 1PEAA 7ABPA 2E4ZA 1JX6A 3SM9A 5KC9A 4EGSA 2V0NA 5TPWB 5IX8A 3CRNA 2VYCA 4N0QA 4MR7A 3SG0A 3HSYA 4YLEA 3HDVA 4QYMA 3LUKA 2IPMA 3NNDA 2GI4A 1NXVA 3QELA 3LTEA 4Z9BA 1W25A 2FN9A 4KQ9A 3JVDA 3CTPA 4GNRA 2JK1A 1GLGA 1E6MA 2NT3A 4RKQA 1D2AA 1CHNA 3JPWA 1HEYA 3GA5A 3LUCA 5FWXA 3JY6A 4E7OA 3IDOA 3HS3A 1JH9A 1DBPA 1ZITA 1PNRA 4TLMB 3IP6A 4YR7A 3MM4A 4OG2A 4MS3B 2FEWB 3N75A 2QXYA 1URPA 4JA2A 5KWSA 2QSJA 1ZESA 2MYUA 3HK2A 3RVMA 4O1IA 4Z4GA 4OLAA 3RVQA 4D74A 2NZUG 4XFKA 5JNWA 5IBQA 4TLLB 4G0XA 1QP4A 1JDPA 3LUJA 3O1HB 3HXMA 4W5OA 3D8UA 4O5AA 1Z2EA 2QVCA 5PNTA 4M88A 2FEPA 2JBAA 4GPAA 3NNSA 2FSPA 5CNMA 1YS7A 4IGAA 4WUTA 3RVRA 5C5CA 3NHMA 3KS9A 2PJUA 3EQZA 3A3KA 2WB4A 3MYYA 3OQMA 2LBPA 3LMKA 5JS2A 3EQ2A 1Z13A 2GKGA 4FE7A 4MS1B 4G0OA 1QKKA 3QLVA 4WZZA 2Q5CA 3RVLA 3QLUC 4LDAA 2CHEA 3KJXA 4RKRA 4N41A 3I09A 4JAVC 4G86A 4KZKA 2FN8A 1NXOA 4W5QA 2L17A 1S8NA 5BQ3A 4TN5A 2PL9A 1DBQA 3GBPA 2AYXA 5KQLA 1DJMA 2IKSA 4DQDA 4MQFB 3E61A 3NNNA 1TM2A 4QICA 4MLCA 4ZYLA 3GV0A 1ZH2A 1DCKA 3A0RB 1QNLA 3JVIA 2RGYA 3DBIA 5IUNC 4LDZA 4MGEA 4RK7A 1Z17A 3S99A 1QP7A 1Z16A 1Z2DA 3N8IA 5TQ0A 2B1JA 4KFCA 2IYNA 3OQNA 1VKRA 3W9SA 3H5TA 3N0WA 3HCWA 3MIZA 4W5RA 3OMXA 4KK3A 1DCFA 1A04A 3O74A 3GYBA 4RY9A 1FFSA 9ABPA 1NXSA 3IP9A 1QQBA 2P4UA 2RJOA 4IF4A 5KI6A 3JTEA 3H1GA 3L6UA 4RK1A 2FQWA 4G0YA 1MVOA 5EWJA 4OTZA 1VPWA 1LJLA 4LE0A 1PHRA 1NTRA 2FXIA 4H3KB 4XARA 2M98A 2WRZA 4XASA 3KYJB 4Z9AA 3HO1A 3JS5A 2HQOA 4MQEA 3BILA 3EODA 4D6YA 3CNBA 3BRQA 2FQXA 1ZHHA 1EWVA 1ISSA 4G0PA 4Z4FA 1F51E 1PEYA 3KCNA 3OLZA 4RXTA 2PAFA 1E2BA 2A9PA 1JYFA 3LUAA 3QLTA 4RXUA 2HJ9A 1M5TA 4OATA 1K68A 4WXEA 5TQJA 1Y1LA 2FLKA 4RY8A 5ED4A 1NATA 1Z26A 4XXHA 5EWLA 4YRZA 3QX9A 3OLWA 1YIOA 2JB9A 3FFTA 2ID9A 1YMUA 4MS1A 4RS3A 3Q7TA 1RZRA 1FFGA 1QO0A 3G85A 1DZ3A 1U8TA 5KC8A 4MLDA 3KTOA 1DC8A 3LUFA 2PKXA 4RK4A 2H0AA 5B3JA 2NZVG 4EY3A 3IPAA 3KG2A 3OLYA 2FW0A 3RVKA 1JDNA 3KSMA 1GUDA 1ZN2A 4F8JA 4MR7B 4ETMA 1JLKA 3T6KA 5EWMA 1QMPA 1E6KA 2MSKA 1WETA 4Z4EA 4YV7A 3H1EA 1ZVVA 3H5IA 1ZAYA 3OLXA 2PUEA 1RXIA 2L2QA 4OLBA 1VLZA 4H3HB 3F73A 3RQIA 1P2FA 4E7PA 5T3YA 2FMFA 1ABEA 3KKEA 5IC5A 3F7NA 4MR9B 2PUCA 2PUFA 4XAQA 1QPZA 2QVGA 2FVYA 1USKA 1JYEA 1YTUA 3HUUA 4LX8A 1DRKA 1GCAA 4P1ZA 4Z4CA 1U04A 3CFYA 4KV7A 1VRVA 3ROFA 1U0SY 3CZ5A 4HYEA 5FWXB 1CEYA 3O1IC 4MRMA 3CG4A 1EWTA 2RJNA 3Q7RA 4WXMA 3TD9A 1XHFA 5FWYA 5TQ2B 1BDIA 3EULA 1M2EA 2JCGA 4Q7EA 5DCLA 4EYGA 2HQBA 4UHKA 5TQ2A 4Z4HA 1ABFA 5BRAA 2GWRA 1OXKB 4MRMB 4CBVA 4EYQA 3CS3A 2PE5A 2IPNA 4ETNA 1TVMA 3N0XA 1SXHA 5TPWA 3D02A 4EVQA 3C3KA 1GUBA 2XDYA 3H5OA 2O20A 3CZCA 2R4QA 3QK7A 4G97A 2PLNA 4MR8B 4EYKA 5KQGA 3KHTA 2F8TA 3O2JA 3DGFC 1RZRD 4F06A 1BA2A 1C4WA 3H1FA 4RZSA 4FB4A 5IEBA 2E4VA 3I45A 4N03A 1RPJA 3QEMB 3EJWA 4MR8A 4YWHA 5KQMA 1Z18A 1PUXA 1SXGA
chains in the Genus database with same CATH superfamily
2EAUA 2PKQP 4A0FA 3TZLA 3LECA 1H0HA 1OFUA 3HB4X 4REQB 4V2UA 2ZATA 4RELA 2QVLA 4Z0TA 3OQIA 1P2UA 4G09A 4BU1A 2VJMA 2EIHA 3TCNA 4IV5A 5I3ZA 1QE3A 4H08A 3Q0EA 2D4AA 2LR0A 4GMFA 2XNSA 4OI0A 5JCZA 3SDSA 5A71A 1CUIA 5EXPA 1OLXA 3IAFA 4C78A 4JEIA 3ZNPA 3C3MA 3OPQA 4E5DA 1UT6A 4V24A 1IN6A 3DBOB 2RFLA 1ZVQA 1W5BA 3ENZA 2R79A 3BTOA 1GSOA 3QF4A 4LGMA 1Q50A 3IEKA 4LDQA 2WKSA 2I66A 1KU6A 4S1PA 4UVGA 2HRDA 4KVZA 2HDWA 5FLKA 4IIBA 1N4AA 4HNRA 1KY4A 1JE0A 3H2BA 3HKDA 2GX6A 3JRWA 2DTEA 2P9ZA 5CIWA 2HLPA 2JFHA 5BWOA 1LLDA 5DYWA 4KHZA 1G7RA 2XLCA 4YDRA 1H5UA 5I9TA 2C95A 1F5SA 5DRTA 3WDMA 4PYQA 1FF9A 1XWWA 1OI2A 2ZU0C 1N6OA 4JYAB 2WV9A 1UR5A 3CBQA 1R8QA 2JCXA 5CA0A 2ZM6B 3DS8A 4BJHB 4HVTA 3T1YB 4B46A 1DEOA 1QKIA 4FMPA 5F5XA 5JNRA 1ZGJA 1V4BA 2VCEA 1YL7A 1ZGZA 1U3UA 3EDMA 4TMFA 4KR0A 5DT2A 4WCFB 1MT3A 4RLSA 3W4JA 4FB5A 2BI4A 4OH1A 4WL0A 1ILWA 1XZHA 1K7FB 1SCIA 1JG6A 3M4JA 1BNCA 1CRZA 3L0DA 3CLHA 3PDJA 4G0ZA 3WKEA 1T2CA 1A0OA 2BZ0A 2MYNA 3CEPB 4U2CA 5JNLA 4LF6B 2DWCA 2FK8A 1QGED 3H2GA 4G4SP 1ZY2A 5FNVA 5ABPA 1F8UA 1XDUA 3NXSA 1SCQA 3D1JA 1XA4A 5IT9A 3OQHA 1EFVB 2WTAA 2HXSA 5FNVF 3AF5A 5IRCD 4MWTA 1TPYA 1NBME 4DOMA 1DO2A 2AFHA 1NQWA 2FETA 1Q84A 1W9MA 4H60A 1NVGA 3N7AA 4N5NA 4P2BA 3V1LA 2C8LA 3EQ7A 4G4SO 2P2CA 4I1RA 4NPCA 4S1OA 1P3Y1 4WZAA 5FJJA 1L3IA 1G21E 3W6OA 3GFQA 1OAOC 2CMKA 1Z6QA 2QV0A 3ZWOA 3MGKA 5E3IA 5KTSA 2NO4A 3E2IA 5DBGA 1M67A 4DDUA 4UE6A 3BB3A 4L95C 1IY8A 5FH9A 2DKFA 4B3HA 3KALA 4GXTA 3BTSA 3BZWA 3I9NA 3DDNA 1HFJA 4WUVA 4E09A 5FV4A 1EB8A 4RKFA 2RGBA 3L8ZA 1WZUA 2QRZA 4LISA 4M76B 3N3AC 4Y9SA 2ECKA 2AEJA 5HIMA 1GNVA 3ACBA 5LYJB 1Z6PA 5K9ZA 4WOPA 2NNLD 2Q5IA 5CM2Z 2HF9A 2I6FA 4IDOA 1ADGA 1VMIA 1N2EA 2CB0A 3LJKA 3TQHA 2ILTA 3U48A 2XXAA 2NP6A 2G7ZA 3BCHA 1TU4A 1U1CA 5BY2A 4KOAA 2Y1WA 2PNJA 1MPTA 4EF5A 2ZWPA 1PWYE 1N1GA 2Y2VA 3TMAA 2EU8A 2Q5LA 2PQ6A 1T6BY 3M1AA 3RSQA 3F4KA 2PX5A 4OQQA 3BMNA 3SNKA 3UWDA 4NCJA 4C4ZA 3PCTA 5TEVA 3NAZA 2QN8A 3ZNQA 3IEVA 1MA0A 1NLUA 2CNLA 3HUFA 1NNSA 4GZ5A 1RXVA 3FNEA 2SKCA 1EK6A 4HGRA 1QZXA 1YCGA 2JRCA 4A92A 1PDWA 5C1IA 3REGA 3NVAA 1V1RA 4FGSA 3UMYA 5BMOA 2PMDA 5FTMA 2QXUA 4AQ7A 3U44B 3CYFA 1DG3A 4WDRA 1I14A 1S4QA 2QK4A 5CFOA 4YUAA 3VNUA 1GQRA 1WUYA 4EUFA 4G07A 3Q3EA 1NKSA 4AQYB 2D7DA 5EP4A 1APBA 2Q6LA 2H9AA 4P58A 3LKBA 4XYBA 5AM5A 5C8YB 3WGMA 4G63A 2WT8A 2XEXA 3E84A 3K0FB 3MBKA 5TJHA 1H6BA 1CZKA 3FDZB 4CKCA 4B6FA 2FWJA 3BXEA 3I5AA 3C87A 4IXMA 3DLPX 5KDLA 1BYIA 4F92B 2P4QA 1E0AA 3SEFA 4M7WA 4DREA 3UXHA 2IWRA 2WOOA 4Y1RA 2EW1A 5FPHA 3H11B 2Q1TA 3LBNA 4QSMA 4KXWA 4AN1A 1RPZA 1OXXK 1SU8A 2HA6A 3DFZA 3H8SA 3D8HA 2GF9A 4L07A 4ND7A 4I55A 1E6EA 2FKAA 4Q66C 5EJ2A 1KBOA 3HJTA 4BMOB 4EPWA 2XQVA 4BQIA 3UH0A 4LXIA 3X1DA 1E98A 1CDDA 1RJEA 3O03A 5K4AA 4AFNA 4YCSA 4CIDA 3U09A 2UYHA 1J7KA 1IHYA 5LD2B 1X7HA 2R3SA 2IF2A 3L6CA 3I64A 4Y2XA 4NICA 2W6MA 4ZO6A 3FZQA 3S55A 4LJ5A 4Q1FA 5DISB 5AQ1A 2PD3A 2C07A 5E6UB 3KB1A 4MNTA 4F3CA 1DRVA 1IG3A 1XOIA 4IHQA 4FZRA 4RMJA 4WLNA 1JHDA 5FLXA 3U17A 2ZJZA 2WY2D 4DV2B 5TRTA 1G8SA 2CHFA 3E3LA 2FG6C 3CLRC 1E2HA 1IM5A 4H27A 4RZIA 4A8TA 3PC2A 5LD2C 1Z0AA 2P3SA 1KJ8A 5JFGA 4F71A 4PV7A 3G8BA 4XIIA 2C4VA 3IJ5A 3OA0A 4C03A 3EGXB 4IG4A 4CVNA 1Q7RA 3DDWA 2B8TA 3ABOB 3RUFA 2DYKA 3EEFA 2PVSA 4JGGA 3WK9A 2UUOA 3HDQA 3NBFA 1F38A 2WA1A 4G85A 3SX4A 5HRUA 3LK6A 4C9BA 3M83A 4W5TA 1VE3A 4EYOA 3IQEA 1VYHA 1YRAA 4BLQA 3K8ZA 1ZS9A 4B4KA 1WF3A 4O2BF 3IOEA 3OX4A 2NPOA 5CM8B 4HB2A 3HXPA 2ZWMA 5BSGA 5CYPA 4MUNA 4RIIA 1DADA 4YYZA 5A9SB 2A5GA 1KO5A 2VJDA 2ZSHA 3AM4A 3C3AA 4KN9S 3NV9A 3DVQX 3DPIA 1NVVR 3H0CA 4ZQBA 1C0KA 3ESAA 4C0BA 4UTVA 3GRCA 4N3GA 3G2QA 3ZY6A 1M0WA 1KSHA 4KYVA 1H1LA 3SM9A 5B30A 3T7SA 4OV6B 4EJMA 1XDZA 4MIEA 3AP2A 5JXJA 1F3LA 2GXQA 5TPWB 3VKGA 3AONB 1POXA 3FDIA 3QSGA 1T3TA 1UDAA 2C2BA 3HWX1 4E6PA 8ADHA 5L6LB 3LDAA 4L2IB 4YTEA 1ZM9A 5ALEA 4ER7A 5AJUA 2QV7A 1WP9A 4HLQB 1UBCA 2EJUA 1ECFA 1R50A 3VSBA 3OUZA 3RGGA 3DEYX 3WHPA 1KO8A 4CF3A 3JVDA 3GUYA 3BERA 2HDHA 1CS0B 3CTPA 3KYBA 4PLCA 1VKZA 2JFXA 4L4RA 3Q8XB 5IP5A 2JFQA 2QX7A 3HEMA 4E21A 2MSNA 2YVQA 4LXXA 3KT3A 2RGNC 4R1TA 3WMGA 2V7XA 3PF8A 1KE1A 1P60A 5L6MB 2F43A 4QQFA 1NPDA 4YACA 3NR2A 1HLDA 1QRRA 4H0CA 3UB4A 4MGIR 5JZSA 1COZA 1Y9JA 5I7SA 4YB8A 2RAFA 2BH2A 1EVLA 4O2AF 1ZOOA 1ZN8A 4JYCA 3MCZA 4YR7A 3RRFA 1EIZA 2YMQA 1C8KA 4HD8A 221PA 1U81A 1V8DA 2J0VA 2QT0A 1E1DA 2L82A 3GEPA 5DGIA 2I76A 3GGOA 4ZC8A 1J9ZA 3HK2A 3W5SA 4Z4GA 4C3OB 5LIPA 2ZB7A 4EHNA 2IS4A 5ALQA 4RIGA 1E79A 1QRAA 1SBTA 3BSFA 3CISA 1Y7LA 3LDHA 4ZQGA 4NLLA 5JAIA 3LGAA 4H17A 4NCKA 1N5OX 1OFUX 1ZCAA 3AHIA 4EJSA 1RRCA 4B87A 1FLVA 1TYZA 2DZDA 4HT3B 1CF9A 3EARA 5DO9A 3W4KA 1K8ZB 3LHIA 1QYDA 4V1CI 3EAQA 5GJWC 9LDTA 2BEWA 2X4GA 1V5GA 3UGTA 2B5WA 4X90A 5CDFE 4Q1VA 1E3EA 2AKAB 4FFRA 1NNI1 3ZWXA 4TTRA 3R77A 4YALA 4P81A 3EYWA 3V8BA 5F35A 4ZEWA 3AQ4A 1RMQA 1Q22A 2R6ZA 2DM6A 3C1TA 1CQWA 3EXFB 1WXEA 5U1PA 2LCQA 5JS2A 3WZ2A 4WSOA 2I2DA 4MS1B 1QH1A 2RGNA 5AD1A 2D7JA 4ZANA 1MO5A 3K9GA 3AMVA 1IN4A 4B5KA 5DTRA 1MTZA 4N41A 5K8LA 2EG5A 2QP3A 4B3SB 2RHJA 4Z2YA 3Q1KA 5JMPA 4BN0A 4O4HB 4BVEA 1H22A 4HH0A 2IYUA 4XQCA 1DIOB 1JKJA 1H5NA 2IGTA 2ZETA 3CF0A 2AOUA 4FK8A 1VXOA 1T24A 3N8NA 5AJTA 3S1AB 2GERA 1CR1A 4KAFA 1QG4A 1WP4A 4EBBA 2P8SA 2XRFA 3L5KA 1ZUNA 4FDLA 2ZYTX 2QLMA 2BH9A 4PLGA 4PG5A 3TMKA 1WCIB 1N1MA 2AE1A 2ZWIA 3ZWCA 4BKQA 1CQXA 3DEJA 1VSBA 2VPTA 3CW9A 4Y6RA 2XZTA 3QPWA 2GCGA 2DHDA 3K9QO 2ST1A 3GX1A 4BCCA 1OXSC 5DM1A 3ZE9A 2PKQO 3U4DA 3JAKB 4KSCA 2PM8A 2CL5A 3HCWA 4LNUA 3DE2X 4PXSA 5MF6A 1E7QA 3NEYA 5AOCA 3NHWA 3S2YA 1MXHA 2WKWA 2W70A 5BW5A 3EUWA 2X42A 4HQRA 3QFCA 2HJWA 3VU3A 1NVAA 5I7UA 1L4HA 2VEDA 1YDWA 4DDVA 2E49A 1OGIA 2NTYC 2Q6TA 4OTZA 5ALUA 2V45A 2OXIA 4D3ZA 1UXHA 1I13A 5B1SA 3OZEA 5CEEA 1X7DA 2X8BA 1DIHA 3TTSA 4D5GA 4FNAA 3R7WB 3T9AA 3NV7A 4D6YA 1Z3IX 4RTJA 2PS9A 2B5VA 5JAOA 3A9UA 2R1VA 4K6OA 3FYSA 5FTJA 5CRIA 1UAGA 4BOYA 3Q3IA 5KREA 3S7TA 4M0LA 1ESNA 5KIAA 3QV2A 3UG6A 1X1BA 1GPNA 2Q4EA 2FRDA 1TUBA 2PN1A 1GA1A 2ZWVA 3LS2A 1UAYA 3NEAA 4IIDA 4LJAA 4BWGA 4URZR 1OXMA 1K68A 1CU1A 1HT1E 3C3PA 5BWCA 3GEDA 3WDKA 1YVPA 4Y1GA 3JARA 5ECWA 3S7ZA 2OBYA 1Z2NX 2C78A 4JITA 2M6SA 3A7EA 4IZHA 4GT1A 1OROA 1PT5A 2HW8A 3PE3A 1IN1A 1T6YA 1FMLA 1V9CA 3HPRA 1N7IA 3LYAA 4X1YB 3LVFO 3RS5A 2W6ID 3WO1A 4U6QA 4YCMA 3KYDA 2QD4A 2AR0A 3EMBA 2XUPA 3X1WA 1RP7A 1KR5A 1UBHS 1T8TA 1EE9A 2AMYA 1J2JA 1IOZA 1XF9A 2A88A 3IPAA 4RLFA 5JBNA 3BULA 1P9WA 4ZQCB 2XCTB 4KXQA 2GF2A 2P9JA 1UXIA 4BMSA 1K98A 1MJGM 2PZEA 4IICA 2XGJA 1VL5A 1PGJA 1XTJA 3VKFA 1W2GA 1L5HB 1ZL2A 4S1NA 4X20A 4KITB 621PA 4FYIA 2GZMA 2JAHA 1QXSA 4KIUA 2FJPA 2QM0A 1YXMA 1CS4C 2Y1LA 4I81A 4AROA 2JAUA 2NAFA 1TYCA 2HRZA 1L9XA 3QW4B 3QGMA 3LX8A 3Q7EA 4Q1EA 4RA6A 3PFKA 3RQIA 2GEUA 1Y8ZA 4CLEA 3FNGA 3RYHB 1H3NA 3GCDA 1T6NA 1Z0FA 3OHMA 4ENWA 1X1DA 2ZUUA 3L4EA 4HDCA 3HI6A 4P7KA 3SIPA 4UE2A 3GLHE 3N0VA 4JVOA 1P61B 3CCFA 4Q4HB 4HATA 2VPIA 3QOWA 5KJEA 3TPZA 1TF7A 4TLBA 4C5BA 1JKFA 3I52A 2XOEA 2P79A 3KQOA 4C08A 1GDHA 2OAGA 1E4VA 1G1AA 2ZS7A 3EIEA 1EE2A 1DZIA 3KZCA 3A2NA 4KE8A 4UHCA 5FCDA 1M6HA 4R2IA 1G1MA 3TINA 1X15A 2NXWA 3PNQA 1CF2O 2XDQB 3AUUA 1EX7A 2ZJFA 4JL5A 4KWHA 4CV3A 3NX4A 1KEKA 1WD7A 5BP7A 5JAHA 4KPGA 3ICWA 3ZKWB 4AZTA 2C0CA 5B6IA 1PSZA 1QTNA 4PVDA 3RREA 1PVDA 4AXXA 4D0LB 3T7JA 1OU0A 5BUCA 3DD1A 4JT4A 1OXKB 4LC1A 4MWDA 4HWRA 3LRTA 5KUTA 2Q8NA 3OBBA 4ZU1X 3AGQA 1E1KA 1WTAA 2CK3D 3P2KA 3DOIA 2ET6A 4ZZIA 5AM4A 3I62A 1YUBA 3KHTA 3WGGA 1UKZA 3I04A 3N70A 3JQFC 4HEA1 1XD2B 1P5HA 1RWOA 4NBLA 5ALKA 3WGYA 4AKEA 2XBMA 3X2SA 2E4AA 2ZFUA 1PKEA 1QOQB 4FLMA 3T3IA 3AI3A 2B92A 4B2PA 4BRSA 5A2GA 3UJ3X 2WFLB 4N0DA 3DBLA 3OPMA 4RH0A 1HE8B 5M34A 3ADBA 1E1RA 5JS8A 5ERYA 2B2XA 4YXWA 1YVUA 2MSDB 4Y2UA 3K2IA 2XWJI 1EK0A 1KFKB 5AVXA 1I4WA 2P9HA 4YY3B 2DULA 2WKPA 3MUFA 5F9MA 5FBHA 1DXHA 3JXEA 3JALA 3VHLB 4BYGA 1SXIA 2YYAA 1IB0A 3I23A 3K0BA 2QLBA 2HEGA 1JFLA 4M60A 3UHAA 1H2EA 4PYNA 4LF8B 4O6VA 1GQFA 2H3HA 5DHRA 3ITNA 4G8BA 1AZWA 2OA0A 1I7QB 4JB8A 3W1VA 3TQSA 2ZLBA 3EUAA 3L1IA 4WESA 1NXPA 4BFZA 5IBCA 4WE3A 2R1UA 3WIVA 4C7VA 4HXFB 3JVVA 2XAAA 1VBNA 4X00A 4B6PA 3AHCA 4X94A 4OX9B 1NVKA 1VMAA 3BWMA 4ZGWA 1IOLA 1H6CA 2UVDA 1BHO1 1XZLA 3BZBA 3KYIB 3SFVA 4DIKA 2AEMA 2CHUA 2ODAA 2P65A 2YZMA 5H02A 1KORA 3SFTA 2RCYA 1EHCA 5GGXA 5KX5F 2AXPA 1NF9A 1DMSA 2LNDA 2R1TA 2DETA 3A37A 5B37A 1LZLA 1H9AA 1B8PA 2EFEB 2Q5HA 2IVZA 1KVRA 1GV1A 2RHBA 5K6AA 3MWEA 4O4IB 4C07A 4X7PA 4PC6A 4OGKA 5IHPA 4JQZA 2X7XA 1B7GO 4ZCSA 1KQNA 1MAAA 1Q0SA 1R0ZA 1SIBE 3P20A 3H5LA 5CK4A 2ID8A 4BATA 2R4UA 3HV2A 3WISA 2QTRA 1TLFA 5HK8A 3QPVA 1VJ1A 3IX7A 3FTPA 2PE5A 1I2ZA 1OBCA 2Z9BA 3OP1A 2OZLA 2PD4A 4I1UA 4QPNA 2IHVA 4LF4B 2I4MA 1HUQA 1O2DA 1H2WA 2O23A 2B8NA 2A35A 1GCOA 3H42B 3MAAC 4EO4A 1NIPA 3FG9A 3O4JA 1OBHA 4UM9B 2QVYX 2YJ3A 4YVFA 1V3VA 3NWBA 1PV4A 3EIFA 1S2NA 1G6KA 13PKA 4AZVA 1X8JA 1YJ8A 3RH0A 4ZJPA 5HTOA 1MV5A 3E9EA 4I5GA 4P98A 1YQQA 1YA6A 1YMVA 2NYAA 1OF1A 1T43A 3EYAA 5I4BA 3K31A 3ZU5A 3QPUA 3WYFA 5KSPA 1FFWA 2E9SA 5IN5A 1RQNA 1YGYA 5DTMA 3FCEA 2BMVA 4JI1B 1P33A 2VNSA 3M9XA 3VR4H 1YHNA 2W37A 3N2NA 4BVJA 4NE9A 2VZEA 1PDOA 2QE7A 1U7TA 1I30A 3M5CA 3NDIA 2NYUA 3EZFA 4LYAA 3SJUA 3MGGA 4UNNA 1SH7A 4Q15A 1MJ5A 2FU5C 4TSKA 4G41A 1QDLB 3RYIA 1BTOA 2O2DA 3R5SA 2E37A 2J5QA 5K20A 2FSVA 3L7DA 1DUSA 1Q5PA 4DSOA 3B1VA 4H7JA 2GB4A 2QTBA 3ELUA 4BNNA 2PL5A 3BYZA 3MN1A 2AJBA 4HAIA 5ENDA 1NW3A 4QA9A 4QPJC 5TF4A 1WJGA 4HDNA 1AB5A 3UATA 2BMDA 3EZYA 1INLA 2I80A 4KB5A 4L16A 4LOJA 3MMNA 4B4VA 2RK6A 5CM9C 4DCMA 3WLKX 4DRZA 1KQPA 1NG9A 1FUYB 1ZGBA 2CW5A 1DKQA 3KFXA 4MVJD 5CURA 4CMKA 5A9RA 1AKRA 5KQSA 1A1SA 2IV2X 1V43A 3JAMA 2VHWA 2Y66A 1P0IA 3GGSA 1ISHA 1JLMA 1WMDA 3O73A 3ZWWA 5T41A 3RIMA 4K46A 2X1HA 3IR6A 4QEZA 4U4AA 2IRWA 1OVGA 1L7QA 2IUSA 1RLIA 4Q6WA 1VGQA 5JAUA 3SGLA 1H23A 2HNKA 1I3MA 4C7OA 4WVLA 2MINB 2A9OA 4F04A 4N01A 3RT7A 3CF6R 1EGQA 1TQ6A 1FP1D 1V4NA 2AGVA 1U3VA 1SFRA 2W8BB 4H6WA 4MHSA 5AT1A 4CMEA 5LFAA 2PL1A 1RKBA 5JYDA 4HPJB 2V74B 2G1JA 5JNVA 2WZCA 1XMQB 2P77A 1VC2A 1ISPA 4N1AA 2ORWA 2VT2A 4UDOA 1ZUWA 1OX6A 3P9ZA 2XVXA 1C7QA 4K40A 2IZ0A 5TS2A 5KTTA 3A58B 2CT8A 3VKUA 1ML3A 1XPJA 3II6X 1VBKA 4WIAA 3NHFA 3QG1A 3ROGA 1MPXA 4BQPA 3ODGA 4KUHA 2DWPA 1W4AA 4IMIB 4KFTA 3ID6C 2OSVA 1JTFA 1IIBA 3HBFA 1R8JA 2J4FA 5DX1A 2QX4A 5BQFA 3OY2A 1J5PA 4N18A 4MGKR 1DC5A 3IQDB 4XVQA 2OYCA 3RS4A 3H6HA 3PFHA 3ZUGA 5JAZA 2JH9A 2IIBA 5EMLA 4BFLA 4HZUB 3EY4A 1B74A 3KE9A 2YHAA 4FOTA 4ND5A 3W7AA 5DMHA 4QO7A 2VG8A 2VP4A 5IHXA 4EIWA 2X4DA 3DBLB 1JQAA 2CFSA 1O54A 1O97C 3FR8A 5TR9A 2ARKA 3T9EA 5HIKA 3M3DA 1JKMA 4X8MA 1GNPA 4XB6B 1W4LA 3VR6D 1YAJA 2JANA 3D4OA 1DDOA 3FGPA 3O21A 4RD4A 2X15A 1CJVC 2ZJ4A 3OLVA 1JZQA 1PJAA 1N6LA 1CKEA 3F6PA 4MWEA 3V7WA 4C6TA 3QLJA 2WG0A 4KUEA 5L4NA 1Z4MA 3ONDA 2R6CA 2HADA 5KWJA 4IS2A 2HV8A 1T5IA 3L82B 1I4DD 4NHOA 5KOHA 2ZIAA 3FYHA 4JMLA 4NEQA 1LCIA 3ES9A 3TGLA 3COZA 3HR4A 4LYEA 5J2UB 4QOGA 5F1YA 4WNYA 5K2OA 1RLUA 3IUJA 4LYFA 2VRNA 2B7LA 3R6WA 3RIXA 3OH8A 4DR5B 4S04A 3E35A 1KFBB 3GBSA 3X1YA 4BLTA 1CPYA 1W36D 2J6BA 1VHDA 3WMXA 4CHTA 4OJNA 3ZC3A 5LMZA 1H9BA 2FSIA 1DFGA 3H9EO 1KETA 5CA1F 1X86B 4LBWA 3SJBA 3QWHA 5KMGA 5K0TA 5KEIA 3QI7A 4JU9A 4UOEA 3DHYA 5BRJA 5KNBH 1KQ3A 1XMVA 4OBBA 4JJFA 4RPIA 4HN2A 4WW0A 2HA3A 3GAAA 2IP1A 5ETJA 3D6JA 1XYYA 1YB5A 4X64B 1LI5A 4KWTA 4DSUA 5HS4A 4OM7A 1KZHA 3IOMA 1JX6A 2GYUA 4C06A 4YRRA 3MT9A 4FBGA 3HB9A 3P5SA 3UTDA 2QW8A 3C5HA 5K0FA 5IVDA 1VB5A 2PLFA 1HTBA 2JAPA 5FL7A 3DV0B 4UBLA 1A9ZA 5F76A 3TYXA 4UTPA 4PGGA 3QHPA 2ZRPA 4FZ5A 1QFMA 2WU4A 1U9JA 2VHVA 3HKCB 2CSXA 2XD4A 3OZBA 3C3EA 3NNDA 4DYVA 5FOWA 4NYJQ 2ZRGA 4P92A 5B3LA 3GJRA 2OECA 4JJKA 2RGDA 1GLGA 1H2BA 2ZSJA 1Z0SA 2OCYC 3FHCB 4X1YA 4BX8A 3VU8A 4OHYA 1IN7A 2Q49A 4TTTS 3TH5A 3PPXA 4IHKA 4IJMA 3C2QA 4LVOA 1UEJA 4PCLA 2EQAA 1E61A 2WJVA 5CG1A 5JCJA 1FDRA 2VT6A 5F1KA 3HS3A 3N0TA 2ZJ6A 3O91A 4W1PA 5A3RA 5FAKA 3CUKA 4MVJH 1L4LA 5BR7A 3CUSA 4NKRA 1VFPA 2GESA 4UEKA 5F1PA 2Y1OA 1CQZA 3RF6A 3RUEA 4CUKA 1KAQA 3MM4A 3ENVA 4QUKA 2ZQZA 2QQGA 2A5YB 3PEVA 3PT5A 4QT4A 1Q1BA 4CM6A 1IB6A 4DCNA 1SM4A 1PR2A 2OWEA 2WP0A 2YXNA 3K30A 3NASA 3BD7A 4B7CA 2N42A 4CFSA 1ZQ1A 3DNFA 5JNWA 1VI5A 4F5DA 4BO4A 4QDXA 5IBQA 1QZUA 2BGLA 3HO6A 3DR3A 3UT5A 4OX9Y 4JLJA 4UNQA 1KFEB 2VNJA 2W2QA 1BD3A 1IDN1 3G2MA 4DCVA 4ALLA 5DXFA 4KPFC 3OHPA 5IT4A 1JDBB 1W581 1QPBA 3NNSA 3U7FB 1HDYA 1Q7TA 2FN3A 1GV0A 1HM5A 3AB7A 1BKDR 4YUYA 2UYQA 1HQDA 1B15A 1XPOA 2HH9A 3VAAA 4DLXA 3KZOA 1UC5B 3C8DA 1BMTA 3HV0A 5EXDA 1GJRA 2H29A 2LBPA 1MNAA 1VE6A 2GKGA 2QDKA 1YRBA 4YC7A 1I4TD 3KU4A 5AI9A 5E0KB 3WKBA 4BFXA 1ODTC 2E55A 2QTMA 4CXMA 4FYXA 4C2UA 1GAEO 1QCCA 4NAVA 3A4MA 4KOEC 5C1BA 3UW3A 1EFKA 3FAKA 3OJEA 4U7TB 2I71A 4TVSA 2ZRCA 1P77A 1NQAO 4IJ6A 3WO0A 3WP0A 1C3EA 4BNIA 1W35A 5AFSA 5BV2P 2DLNA 1OBFO 4QWWA 1ZUNB 3TD2A 2C8JA 1EJ0A 4Q93A 3KQQA 5K99A 1CIJA 5DEOA 2WSBA 1ORHA 2RE8A 1YQXA 2XBLA 2FE4A 4CR6A 3TKAA 2FSSA 4P4UA 1QGUA 3SBEA 2CVHA 4G65A 3PGA1 1V9LA 2FOIA 1UT8A 2FFAA 1SU4A 3ZKAA 2CVQA 2J5BA 4RQTA 2RHWA 1SC6A 1KOLA 3GFRA 3VHXB 3M3HA 4LDZA 4PLHA 4RVUA 1Z17A 4UUAA 1C7FA 2WG1A 1G8GA 4V0QA 3L01A 3KKMA 3TJZA 4L0MA 1NE7A 4WLUA 5F5NA 4BS9A 2O1SA 1ZIOA 2Y9MB 3U7EB 5FOXA 2XCLA 2HIMA 4GAEA 3GG9A 1WOMA 4HNHA 3E05A 1X80B 3MIZA 1LW7A 5FLEX 1N2ZA 4N0EA 2GBLA 4Y2SA 1CZUA 2GJKA 1U3FA 2PGLA 3JVEA 3OLCX 1COWA 3VYWA 1SZCA 5BNIA 3WOVA 4ZZ1A 2ZE6A 2RJOA 3EG5A 2DHEA 4MVYA 1SC3A 2PJZA 3OZXA 4MCAA 3D0KA 3IUSA 4RK1A 1DVRA 4IDPA 4OKSA 2OORA 4NMXB 5DK6A 5AVRA 4BX2A 4O2AB 1IONA 4NNJA 1HDRA 3BAZA 4EHFA 1WSBA 2GK6A 4FD2A 3V8MA 2LIPA 1GQOA 2P9CA 2CFTA 3A9CA 5DLYA 1TEHA 3ZQ4A 1G7SA 1Y8CA 1YQ9A 2A0WA 3T5DA 3U4QA 2AOVA 2E89A 2HM7A 2Y77A 4QU8A 1G5IA 2GJ9A 4QUIA 4UDNA 1KZ4A 2O0LA 3U40A 4AJHA 4TYWA 4ECAA 1FS5A 4J76A 2C3MA 5B1EA 1V11B 4UM9D 4JY7A 4ZKEA 5FI1B 5CA0F 1ULSA 3N3BC 1Z26A 1TCVA 1ZD5A 2YS6A 3W6UA 3WOHA 3TQOA 3EZLA 3R3JA 2XZOA 1KU0A 4PXYA 4RZUA 5EVJA 3ZE2B 1SBHA 4MV9A 3ZX5A 3IQHX 3BE4A 1A9RA 3VDQA 2VNAA 4JD5A 1BVYF 3STTA 4C1BA 3M6XA 3S1LA 4DUGA 1LTQA 5IT5A 5DIFA 3WYBA 1DMRA 5H3CA 2BD0A 1CS0A 1G3QA 1HDCA 1VE9A 3HGTA 3HN6A 4MLDA 2BT4A 2RGGA 2WA2A 1ZH8A 1ECJA 1NONA 3OQ6A 3RG2A 2I2XB 2EOAA 1L7AA 2NPFA 3CJRA 2I54A 4TV8F 4IQ0A 4TLEA 1WXIA 2F62A 2VDWB 1BRTA 4ZI2A 3H2SA 4EUSA 1G0OA 3AB3A 3VR2D 4LYHA 2PLRA 1ZMOA 1JHOA 1ZVVA 1A72A 5AKIA 4EW6A 1EFPB 1L8OA 2GPAA 3I92A 2VJCA 1RXIA 2WJPA 3DJFA 3EOBI 3JWGA 4FWIB 1VLZA 4R7TA 3IAHA 3HG7A 3LY7A 2ACVA 2ZRKA 1YQTA 4WNAB 3FBWA 3S81A 4MR9B 1A7KA 2WF8A 2O5CA 2FW1A 2GBFA 2CJXA 2EDAA 1ZM2A 4NR0A 2KB0A 2R7MA 5SY9A 1L1FA 2JLRA 4ZP1A 3P4XA 1CULC 4K3VA 2BJVA 3ECAA 2X23A 1R66A 1FRVA 2INGX 2HGZA 5SY6A 2QRHA 3KUDA 1TO2E 1E92A 3ORFA 2GNPA 3RHFA 3G2KA 3QVJA 2R65A 1FW8A 1PX0A 4OFZA 1I01A 1V5EA 3AEUB 1G8JA 3MCWA 1PI3A 4B2YA 3ZIAD 3R7BA 5C4GB 5ALVA 2AXQA 2P30A 4BUCA 2Q6VA 1ABFA 4KG7A 1BYUA 2H08A 2C7QA 3DMYA 4L5AA 3U80A 1YA4A 2XUDA 3NUZA 4UFOA 4GP6A 4HSEA 1NNEA 2H8GA 3EQ9A 5I9SA 3HJCA 4X63A 4MW2A 3C6BA 3U2QA 5FEUA 2WP8J 2EKZA 3WK5A 4DMFA 2ZIUB 3H5OA 4K05A 4UTZA 1BDBA 2Y1EA 2C61A 4NTZA 4W8HA 2JFYA 3S5UA 1SCUB 2VWGA 3PKJA 1E2NA 3BWCA 3M1IA 3BA6A 2PMWB 3JQ9A 4EM6A 1JXOA 3GU3A 1SIOA 2X8LA 3KL2A 3TSZA 3UJ6A 3W6ZA 2QU8A 4WNAA 2PH7A 4CCYA 2B61A 5EE9A 1ENZA 4KXYA 4HPXB 3ENKA 1SKBA 2ADMA 1AXEA 4B81A 2AKEA 1C0IA 3COVA 1T5SA 2WICA 3VOTA 1RBZA 3FNFA 1O9GA 4G8JA 3LK7A 3RUDA 2OQIA 2Q3FA 3D2BA 4NJEA 1I3NA 1ZEJA 1LI4A 1AURA 4QFBA 2IOHA 2FCAA 2P0EA 3JV7A 5AKGA 1U94A 1QFSA 4HNQA 1JWBB 1W5AA 3FJ1A 1OJLA 4KQFA 4MUGA 5CLLA 3V55A 5BVHA 4F4IA 2QX6A 2RAPA 3S8MA 4MQMA 5BQPA 4FW9A 1S3IA 3DT9A 2H1HA 2C04A 1KGSA 4QTTB 4R2WA 3WLTA 3AP3A 5IU6A 1QORA 1A27A 3O8LA 1KIMA 3K05A 5IJZA 1H3EA 3X0DA 4UHDA 1MRZA 3REQA 3EMDA 2ICAA 3SC2B 3W04A 1OBVA 1E4OA 3ESYA 3HDYA 3H3JA 1IUPA 3NTRA 3BF7A 4M0DA 3CE6A 5JVDA 3MLAA 1ZJYA 1KMHB 2BGGA 3R75A 1TMYA 1Q1QA 3RUIA 1LDBA 3TRDA 1ZLXA 4Q4JA 4YO7A 4BWVA 1YA8A 3RAFC 3IEMA 3N59A 1N7JA 3AU9A 2I6XA 1V45E 2WTMA 3NKVA 4GZ3A 5AW5A 3FYUB 2ENWA 2C2MA 3CWCA 4E2FA 1TZKA 4F2PA 3FFXA 3N2KA 4DLKA 2BBSA 3U4QB 3PWKA 5CGZA 4UPDA 4CV2A 1X87A 1Q0TA 4DXHA 2O3TA 1CJCA 1D6JA 4B7UA 2IS6A 3CZ4A 1U5CA 1FTSA 2Q46A 4HZGA 5BUQA 1IG0A 1WDMA 1GWNA 2FLVA 3WK7A 2IEYA 1NVMB 3GROA 3JQCA 1ZSVA 5K0GA 1L5NA 4Y2YA 3IH5A 3IJPA 4YXFA 3PXEA 3UPTA 3WNQA 1JV2B 3G88A 4YMSA 5C1PA 5DHTA 4TMYA 4C4PA 4YT4A 4M8SA 5HIIA 1MC8A 3VGPA 5KAPA 1K4KA 3I28A 3TLYA 2GLUA 4WOCA 2OQRA 1CUCA 4YGXB 3D6FA 1JMKC 4GI2A 4JYZA 1KAEA 3JQPA 5AVSA 1CY4A 3IAEA 1JJAA 1ZMRA 2XD9A 3TJRA 5IUKC 1O94A 2O6HA 4DUGD 3ZDCA 3CZRA 1YMQA 4PYRA 3BQ9A 4FTWA 3RVJA 1FP7A 1VIYA 3BWBA 2BHRA 4B9AA 3T0GA 1XDWA 3G8YA 1A7UA 1ZNYA 1N57A 3AW8A 4K6CA 5FP0A 4UULA 3NIBA 2JH3A 1FU8A 3PWTA 1HL7A 3T3NA 3ZD8A 4WOBA 2ZVQX 3PFBA 2A2ZA 2VPYA 3OU6A 1M1UA 4W63A 1U2TA 3DT6A 4RHFA 4W8GA 1JLLB 5BN3B 5CT9A 2IV7A 4EPTA 1LDNA 4BXOA 4IDGA 4PPGA 2A4KA 1ZJ5A 5HIJA 2ZBRA 1SEPA 3WQRA 3BJMA 1GR1A 2QKYA 3L0BA 3GOHA 3ZVKA 4QZVA 1R8YA 4YAOA 2C29D 2V3VA 1P3DA 3ND8A 1YUMA 4UPEA 4FQ8A 3HDGA 5ALXA 1NLFA 1ILEA 4FI3F 1TIBA 2C4KA 1YR7A 3ILXA 3WQSB 5J23A 2BGTA 1G4AE 3ANYB 3I8XA 2WU8A 4Q6BA 1YZHA 2QRUA 3HBLA 1N8NA 1F17A 1NYTA 2WHYA 3ESQA 3OC6A 3F6YA 1E79D 1JHUA 3GNQA 4FQ5A 3G0GA 4PE5B 1Z6ZA 2VOJA 3CLUD 4Y2QA 5JG7A 3BKWA 4X6LA 3WMWA 3PV0A 1KK0A 1ZICA 2IYWA 2O7SA 3BJEA 3HB1A 4NF2A 1J9EA 1W44A 4R31A 3X1MA 3PXDA 5HDQA 2WWXA 5DM0A 3PX7A 1USWA 2FZ5A 3NVDA 1GGKA 4YONB 1UXKA 5IKXA 4CEHA 2A9QA 3KDSE 3T5PA 3NDBB 2W4MA 3N2GB 4YBZA 3C3DA 2VBGA 5DLEA 4BQNA 4JXZA 5FUXA 1WB5A 3TNJA 4IMJB 2WKRA 2O8DA 1YOBA 2Z1DA 4I9UA 1BE0A 3IAM6 2RKWA 3GQBB 2OXTA 1CLUA 3TX6A 1NUPA 4QE3A 1KZ1A 3I04M 5F52A 3HP1A 4W6ZA 3VOSA 2OCDA 4KAXA 5CFZA 1QQTA 2B4RO 3AINA 4OFXA 1WO8A 1UIMA 4C5AA 4WPGA 4KVFA 2F4VB 1I6WA 5KDOA 2DU8A 1R3DA 3ICVA 2FYTA 3PEUA 3WYAA 3BQMB 1LLUA 4K2HA 5JDCA 1QB7A 2XGMA 2VJMB 1QS0A 3NBZC 2PGJA 4J7CA 4IJQA 3AZQA 3JWHA 1A8IA 3B6MA 4IFIA 4QUGA 3A06A 1XMXA 3B1JA 3EF1A 3P9NA 1BFUA 1SD1A 3E6AA 3A4NA 3ELBA 3UK7A 2IK8A 1OYWA 3DCJA 4PLZA 4ZI7F 3N6VA 1GKLA 1KYYA 4JWKA 5JZOA 3L05A 1GTRA 4YR9A 3RC1A 5HPYB 5LLSA 3ZZTA 3TE6A 4WKGA 4MV0A 4F72A 4PPQA 5TLSA 3NP7A 3R09A 1TM4E 4IVPA 3ZWPA 4F12A 2WQ6A 3G9XA 2P3OA 1XJ0A 1ML4A 1NI3A 2D00A 3S4YA 3VUFA 2FEAA 4XWYA 2JRLA 3L6RA 4ZN6A 5A4JA 4WK2B 3TQRA 1CRWG 1IVYA 2J33A 5EXSA 3UBTA 2IZOA 2O2YA 4JEMA 3KHKA 3FX2A 3ZGXA 5CAEB 1T3SA 5EKUA 3Q10A 3JQGA 5K51A 2G7MC 4TRMA 5LNK1 1FJXA 2ORED 4JT9A 1Z4LA 3AGPA 4O2LA 3PCRB 3AR8A 3I76A 1ENYA 1IEWA 3P9SA 4PTZA 3EXEA 3TSWA 3ZI7A 4DLVA 3FMOB 3H65A 4A9AA 3DL0A 3SJ7A 3EAGA 5DNYB 3SZ3A 1YKSA 2PH5A 2ZYVX 1P7VA 3GGGA 3FCSB 3OZWA 4F11A 1R9MA 5KOHB 1Q91A 2VUIB 3BWEA 4HH1A 4XDZA 2E21A 4RD0A 2OV4A 3SLRA 3I12A 1KYVA 2CL0X 2EYQA 4MDHA 4MVJP 3UAZA 1EFLA 2JGEA 4DSZA 5HJEA 2WJAA 1X6VA 3WWEA 2DPGA 1DAMA 3QLVC 4GICA 1YHZA 3DZDA 3S2GA 1EGMB 5EJ4A 3ZCRA 1ENOA 1XKLA 3LLVA 2ZR0A 3OD5A 4NHEA 1ZEMA 5DW3A 3SXJA 3FLAA 1AB6A 3LY8A 4UVHA 3BIOA 4BC0A 2ATXA 2QRVA 3FFWA 4RSMA 4S0XA 1X14A 4JP3A 1F0YA 5FAXA 4Y6LA 1NXQA 4ZAFA 2ZTUA 2ALJA 5FUYA 4ZVQA 2ZULA 3ZBUA 3RFFA 2W2KB 1JDJA 1KDRA 4K03A 2W8ZA 5IMSA 1L7EA 1BHJA 2PRSA 3FSEA 5IX8A 5LQMA 1MO2A 4P86A 1V35A 4MR7A 1YVDA 3BH0A 2Z9CA 2WD8A 4MQLA 1NQVA 3RJTA 3CNHA 4MYDA 1C14A 5BT9A 2X3YA 4DR2B 1RYYA 3OJXA 5TSDA 2VXCA 3CPEA 3O9VA 5F2OA 4Z3DA 4P0PB 3DH0A 2P67A 3OQVA 4RV4A 1C4XA 3L02A 2IZ5A 3KKQA 5E4JA 1HDOA 3EB9A 3WWDA 4BYMA 4D8XA 1R4NB 2P6RA 2OORC 3Q0TA 1WDTA 4RGYA 6REQB 5D3ZA 2ESRA 5C5EA 4QQKA 2N1MA 2QN9A 2R60A 2BBOA 3D0QA 3BVPA 4WY2A 2QVZX 3FWPA 3RLIA 4F3RA 3ZYZA 3BPSA 4GGMX 3BD8A 2JI4A 3FHTA 4EOGA 4QQRA 3DL2A 3KWFA 3SEZA 1GZ5A 3BFKA 1RQRA 1K2WA 5FF9A 3WNBA 1XL1A 1PZFA 3H8WA 5KNLA 2QZSA 2VH2A 3H3XA 3ZDEA 4TT8A 4FFBA 4FUQA 4PW0A 2MIIA 4PYMA 3W9YA 3T5AA 2A0UA 4LYGA 1DTWB 1M33A 3SLGA 1Z2EA 4I1OA 1L8XA 1HQKA 2AR7A 4KZPA 1MTOA 2X9LA 4RKWA 2ID4A 4HB4A 4KWEA 4YJHA 2GZ2A 3VM6A 4HTAA 1KYTA 5JDIA 5C31A 4X84A 4ARSA 5CIYA 1NY6A 1XJCA 2QLTA 2IPOA 1YS7A 4K9PA 1HNWB 4ND8B 1V8BA 5JTTA 4MGZR 4LSWA 2ERCA 1KOGA 4D1YA 4RADA 1KL7A 3QTTA 3ABZA 1AX9A 1U4SA 2EVWX 4FMDF 2GPYA 3AFOA 4C01A 1E6CA 1SELA 3RAPR 4JHLA 3GNSA 5B7NA 4LDAA 4I46A 3DDHA 1UKYA 2Q3HA 1U7HA 4U63A 1U2DA 3IMGA 3WADA 1IE3A 2DC1A 3MRXA 4OHBA 1Y6ZA 1FYFA 4MK4A 2XYGA 3LIPA 1JGTA 1WCXA 3B9PA 4PHGA 4G1UC 4CCWA 5BUZA 3KEGA 4D0GA 4L7QA 3RWBA 2W58A 4TRJA 3ZVMA 1YH3A 2OESA 3VPDA 4LVCA 3PDWA 2WHPB 4Y7CA 1ISGA 2D06A 4MLCA 5FOQA 5LKAA 4YRIA 4MZDA 3DUWA 5IUNC 1V47A 3MTBA 4YRPA 2DQKA 3UTCA 5TQ0A 3N8IA 3I5YA 1T2FA 1H6DA 4Q9NA 5CITA 1RJDA 2GEVA 2OHJA 1ZD8A 3D6UA 3N07A 3NIWA 1OA1A 3ORQA 2I2FA 3D8NA 1GGFA 4RESA 4Y18A 1MW8X 1QYCA 3DMNA 3B82A 1THMA 2BEVA 1UP7A 3ZGVA 3LFUA 5BWMA 5DP1A 4J16A 2ZBQA 3T52A 2JIQA 2JW5A 2DAPA 4P93A 3R7DA 3TDMA 2QG6A 5AJHA 3W5CA 2VJBA 1J23A 5JE8A 3TQFA 1A5TA 4II3A 3FLEA 1O6CA 2YW2A 1U9YA 1I7LA 1GG5A 2J0SA 3I2GA 3KBBA 1TO6A 4GQBA 4GLJA 3HO1A 2HSWA 1QH8A 2HQOA 2JHFA 3JS5A 4PRYA 3V1NA 1W49A 4ER6A 4QYIB 3E9ZA 5EESA 1Q3TA 2PSSA 3AEZA 4LFCB 3RASA 3RSHA 4XVRA 5L3SB 4AVYA 5BMVA 2JKZA 1M6VA 3HCNA 4G0PA 4M9SA 4ZO7A 1U63A 3J7AC 4QXPA 1EVQA 2WJYA 3HCFA 1EMDA 3EXG1 4IIJA 1JLHA 4BP8A 1T1RA 1KVUA 3FSRA 3LL7A 3UFXA 2YQ5A 3VPSA 5AVWA 5EJ6A 3R2JA 5FWAA 4NBUA 2JIMA 1SKUA 4GL4A 2Z3WA 3MFYA 3PNOA 1ZFNA 3ND7A 1ZA2A 3AH8A 4U7GA 3OZSA 4QTUB 1M1XB 4FX5A 2VI5A 3GLGA 4N4AA 2ZYAA 2HXYA 3WDLA 3NW9A 4CIAA 4IV8A 3G85A 5IJ0B 1OWLA 1RRMA 3NDRA 3ECCA 5KC8A 3EA4A 4ILEA 2JG3A 1H93A 1K92A 2H4XA 2H7XA 2C9ZA 4MUJA 1KZYC 4QDOA 6PFKA 4WH0A 1E6WA 2OD9A 2OCPA 1SR8A 2V6GA 4UUOA 4RFLA 4TXLA 2CF6A 4RETA 4LS3A 2M1XA 1TZ2A 1IU9A 1BXRB 4PLWA 3TNFA 2IBSA 1JEQB 3N87A 2EJTA 2BI8A 1B14A 2WLTA 1CVLA 3ZBPA 3TRIA 2QGNA 3PD7A 5LCXA 4BGVA 4BGDA 2WPDD 4BNTA 4GI1A 4UQPA 3AR2A 4UDYX 1P9OA 1UM9A 1PFUA 4EPYA 1P0CA 3QUBA 2H59A 1CUEA 4OAOA 1CQJB 2FMFA 3HH8A 3KKEA 4AZ0B 5F4BA 3ZHZA 3MTIA 5DBEX 3F2VA 2V7PA 3OZGA 5COAA 4GX5A 4XUEA 3QBEA 5KINB 1HYGA 1G19A 4LI3X 3FPEA 4RPCA 4KV7A 1QQ5A 1EA5A 4FWBA 1WPRA 1U8UA 2COUA 1O8CA 1USVA 4HV4A 3B8EA 4LXTA 1VCHA 3DONA 1YBFA 5BRNA 1WDWB 4PPFA 1JECA 1CLEA 4TMKA 4W7SA 4BL5A 1N2SA 3T3HA 4D45A 1FNCA 4DG5A 1THGA 1HLPA 3OFJA 1KO1A 4BLWA 4QJ5A 4JLSA 4O8ZA 2B2NA 3PFWO 4DG9A 1Z4OA 3KOWA 5JC1A 2JIRA 3LF1A 1CWUA 3VPBA 5C8VA 1DIBA 3AOEA 1S3GA 1EINA 4K6MA 4QUBA 4IJUA 3C3KA 1EDBA 1EG7A 3QK7A 5CCEA 5M29A 1MP0A 1U0GA 1P7YA 3TR5A 1A77A 3I61A 2UZ1A 4W9NC 5A0FA 3S2UA 4M0MA 3KJFA 3EJWA 4AUKA 2IP2A 3SX0A 1LV7A 1SXGA 4FCWA 4DV4B 4X3PA 5CLGA 5FFNA 5LXTF 3SQMA 3N5CA 1THTA 5HM6A 1RJWA 2XE8A 3EEBA 3DA8A 4MH0R 3RU2A 2YVLA 4MYUA 4C7JA 3IXQA 4RCZA 5BNFA 4BNMA 1SOVA 4TTAA 4YYEA 4A0HA 2ODNA 2XZLA 4WDQA 3EASA 4YCJA 2DPMA 5L40A 4LWZA 4DR4B 2VJOA 4R2XA 1ECBA 1JFTA 4YRMA 4JQYA 2JI6A 4DNQA 1B3BA 3KYDB 2O07A 4X1KA 4A36A 2XUKA 4NZPA 5H81A 2WZQA 3ETCA 1YBAA 4K7JA 3T3EA 1IY9A 2NO0A 2OFFA 1QHXA 3U0BA 3LYUA 3PNBA 3KEFA 3GF4A 3GZNA 2I8LA 4WEOA 4EA8A 1CUJA 1XI2A 3A6GA 4AUNA 3IPLA 2PXXA 3GA7A 3DLCA 2CWDA 1XDBA 5J9FA 3A70A 2R8PA 8AT1A 4FCTA 4HQ0A 1MDFA 5HTKA 1RU3A 1TUBB 4CKBB 4Z7NB 4MHTA 4JI8B 4KC0A 5CVCA 3EXIA 2GA9A 1DLJA 1XTVA 2PSEA 3B6EA 3EDYA 2BKXA 1I3CA 2WIDA 5LU8A 4Q9JA 1U1GA 1Q0UA 2H2DA 5J5AA 2YNMD 1OW3B 2NUTB 3HU3A 3IOBA 3PITA 4KXLA 4L0QA 2OGZA 4BP3A 3GD5A 4HFMA 1RQPA 1RPAA 2WC1A 4S0ZA 1Z36A 5HOEA 3C7AA 3HCCA 3MMPA 2O2GA 4G8CA 4JL6A 1NI4A 2PX4A 4OXYA 3GP3A 3OQBA 2GILA 2EFDB 3F78A 2HHHB 1MB4A 2FPPB 1KIFA 1PNQA 5KNCH 1CZRA 4YFVA 1NUSA 3JASA 4ZC1A 4Z3KA 3IBGA 1NP3A 4Q19A 1JQBA 2WWWA 3R3WA 1ODSA 2Z0MA 3SIXA 1R9NA 2NU7B 4BO0A 2DFVA 2OY0A 1DEAA 1K8RA 1M2OB 1M73E 1NJ1A 2RGEA 2QB5A 2Y4NA 3AILA 3CB4A 3FPHA 3KT6A 1B43A 4LNUB 4CJXA 5FBZA 1HO3A 3AW9A 3COYA 4L8YA 4RTLA 2F1KA 3H0KA 3NBAA 3OEEA 1DBVO 3TNDA 1GTJ1 3ZQUA 4US0R 1TVKA 1SUSA 4HYYA 1PNVA 7MHTA 4LJYA 4EKNB 1EQUA 2C92A 4NVRA 4LHSA 1UJCA 4D80A 4LFAB 3CHYA 1GGJA 3G1WA 2DEUA 3X1KA 1IAQA 2FMIA 4YS6A 3C6QA 1L8LA 4MKRA 4EYEA 1DS6A 4H6XA 3R3XA 4I8IA 4EAAA 4BNXA 1XVAA 1XZKA 3RRYA 1AO0A 1M8FA 1L4BA 1JKJB 3M4YA 1C7IA 3QVSA 4ZT2A 2A0YA 1LKZA 3B6IA 2O0HA 1TA9A 4IUBS 3VR6H 1GCGA 2W42A 4QBIA 5EWJB 1OHHD 1PT8A 1T9CA 3ISTA 1WG8A 2NUPA 4LV8B 2D62A 1ZIDA 4QNNA 5EHXA 2GNOA 4ZXPA 1MLDA 4YRNA 2YC2C 3C6MA 1RQLA 2G3YA 2WAOA 3ODPA 5DW0A 1E9BA 3DDZX 3PNYA 2A58A 1U0BB 1DELA 2XUQA 4TQGA 4B6RA 4X9XA 1P75A 2D0DA 3VZBA 4NE2A 1OU4A 3WLEA 4HSGA 1GNLA 3E8XA 4M86A 4NECA 2I2BA 5GWXA 5IYZF 2QMZA 2FZ4A 2CLOB 1PHPA 1IMOA 1R64A 1U28C 2OV8A 2BEWB 4L4SA 4QOIA 1RYNA 2J09A 4XR4A 3ZTTA 4U3JB 1P8AA 1RC1A 4HUTA 4BRUA 5BQOA 1VL6A 4U7JA 3EQ8A 5EGNA 2ZUWA 2R84A 2GXSA 1XYGA 3FYTA 1BWSA 1I32A 2K2QB 3BN3A 3ZXXA 2FH5B 3G02A 3HMKA 4J9VA 4Y9TA 4EENA 3AJEA 1ZBQA 4TL7A 4A8JA 4DIEA 1NTOA 2O1EA 2ZOSA 1I5RA 3EUEA 4JI7B 1HX7A 1W30A 5HJ7A 2YINC 4M87A 4MROA 1Q7GA 4KYTA 4KREA 3G9ZA 4IO0A 4Q4DA 5LQUA 3WK6A 1R5OA 2QPAA 1TM7E 1YWGO 2OXEA 3KO8A 3HZHA 4AKHA 8LDHA 1M83A 2VC2B 1UXGA 1IATA 3HEAA 3TBKA 4EHKA 5B58T 1QIIA 1CUSA 5BVGB 3E3NA 1M34A 3OPYA 4XX0B 5G40A 1I7SB 2CFIA 3UC9A 4BDSA 2D1QA 2ZQYA 3RANA 1OXTA 4FGWA 4LPKA 1E6LA 3CZMA 3RJ9A 3H75A 4N0MA 1N8TA 1XSEA 4RFSA 1Z4JA 1T8PA 4KACA 1AXRA 1JZSA 2EJVA 5DX0A 1GILA 3G17A 4EG4A 1PQWA 4PX9A 5KSOA 3PZRA 2O2HA 3HQ4O 1OGJA 3KELA 5FIUA 2BMJA 1ZK3A 2Y99A 3TWOA 4BZWA 5EEGA 4D42A 2J45A 1M66A 4UVEA 5LOVA 1F6BA 3O8OA 1CR4A 4NPHA 3V3KA 2CJFA 4TOIA 1QTQA 1TJ4A 3D43A 1LQ2A 2MSLA 1FYDA 2OCLA 2X8JA 2WDZA 1C3VA 3LLUA 1W0KA 3VTFA 1X1RA 4UVDA 3UMFA 3V33A 1L7PA 2W43A 5CB4F 5D87A 2YHIB 4LSMA 3H5WA 1Y6JA 4PZDA 1CR6A 3ZWNA 4IAOA 1P4HA 1Z22A 1SUCA 4D2IA 5KKCA 5FPKA 1BW9B 4QG3A 5DRYA 4TSRA 1AK9A 1C7ZA 2JHPA 1HT0A 1NNLA 3MWDA 3GY0A 1A4UA 5EC8A 2AFVA 2R1ZA 3J81k 1FRQA 2BFCA 1XZMA 2AYYA 2NSDA 4CMCA 2AJDA 3WB9A 2PJRA 5AUQA 3PL5A 4HEQA 2G0NA 3P71T 5DF1A 3AY0A 4QDJA 2Q2VA 4YQFA 4AJLA 4BPBA 1WUTA 2OBLA 1TQDA 3DTYA 3W5IA 4YLYA 5HK9A 5KWIA 1STOA 2XEDA 3N39C 4R81A 2VK2A 2FMKA 4DWJA 1EDZA 1MOZA 5I9BA 2F6RA 1ZD1A 3I2HA 3LV8A 3U0VA 4F38A 2V3CC 5CTAA 5F2KA 1CUWA 3L41A 1EBUA 3E9RA 4K9OA 4HMPA 2BM0A 2YFQA 2OGWA 2Z8YM 3QW2A 4KQ1A 3WV5A 5LN1A 1XCOA 4LWPA 4RBNA 5BSTA 4R68A 3FSJX 4K9QA 4DNOA 2R2AA 4WERA 3AR7A 3OM8A 3PC4A 4OLJA 4IG9A 1PFYA 2HI0A 2WIGA 3LHKA 3B3AA 2W2OA 3L8YA 3LKDA 2CJWB 5JANA 4O8CA 3IT0A 1F8YA 3OIYA 2GN0A 4XFDA 1YZQA 3OO1A 1F7UA 3B1KA 2M2IA 4F1JA 4ND2A 2EHJA 2V5UA 4FDUA 4M53A 1AKNA 4O0MA 5LQRA 2B9VA 1G4UR 3KZKA 3HJRA 1L4MA 2OM6A 4HX5A 1CDEA 4S12A 1FYWA 3ZCUA 4CKYA 4EGSA 4ZJUA 4D9GA 1PL0A 2BE7A 2II6A 3CM0A 4I4TA 4ISBA 1F06A 2VYCA 3LUBA 4MW1A 3H4IA 3T12A 3SG0A 4MDFA 4Y3UA 1UPCA 3N05A 3U3RA 1GDTA 1ZH0A 3RAEC 4JVLA 3FBGA 1P1RA 2ZRIA 3C0KA 3OEHA 4G81A 1ESEA 3P9QA 4AMZA 1GAQA 5IFLA 2J59A 1R8XA 1G5TA 4LJ7A 3TW6A 3DD5A 3U6BA 4ZAVA 1T8RA 2J4DA 2JGDB 1GQSA 4FYYA 1PLJA 1JP7A 1E77A 2JK1A 3GK3A 3IO5A 4RKQA 4HWOA 4TS4A 4D8YA 5LKRA 2OK7A 4EFLA 3CEJA 1CCWA 1WZCA 3GJ0A 2FW7A 4FR2A 1GLVA 4EEXA 3H16A 2D1FA 1C81A 3JWEA 2VSFA 5ALYA 3GPLA 1AF7A 1DIRA 2QL5A 1AA9A 1F2TA 1TC2A 2COEA 2GHIA 2Z8XA 1T0IA 4QFMA 2AMJA 4R40A 3T5GA 4DQXA 3OTOB 2H2HA 3IP6A 3NH9A 4E88A 2QA5A 4K6GA 2X5NA 1HT2E 3CA8A 4E12A 2NSJA 6YASA 1M0TA 3GH3A 3GUCA 3ZEIA 3SE7A 1UWKA 2OBNA 3DMGA 3GJTA 4HHEA 5AM1A 3GP5A 3CQ9A 3IAS6 2G9UA 4B3GA 1NBIA 3IR7A 4OLAA 3ITDA 1U0LA 3NALA 1VDMA 2ZBEA 3ZOZA 1G18A 4B84A 3AI7A 2OUKA 1GUFA 4KYIB 4RORA 2XR1A 5AR1A 1QP4A 1JDPA 5B7QA 1MF7A 3O1HB 3Q1LA 4QUDA 4WKNA 4O5AA 3MOIA 1PQYA 1NW4A 4D02A 4HXGA 4KDRA 2ZZNA 4MKZA 5HMMA 4IVRA 4L9SA 3T9DA 2BV3A 2OYSA 3LP5A 3A4YA 1J2UA 2FSPA 3KUKA 3HA7A 3K1AA 4BV9A 4LA4A 1HYQA 2NTJA 2NU9A 4MWGA 1GL7A 3GFTA 4L3WA 3STHA 2PUJA 3RR2A 2GBLC 2WJ6A 3JAWA 1T0HB 2Z1NA 3NEJA 3T4EA 1WZNA 3H83A 2YCBA 1ZIXA 3URKA 1H8ED 3JD3A 5F7ZA 5BR8B 5BNTA 1A5AB 1SUFA 1LSOA 1Y7TA 2OO7A 2V0GA 4BFWA 3KJNA 3OZCA 1Z62A 2X5XA 3WWCA 1EVKA 5LYJA 3SHFA 1AU9A 3BHIA 5IWAB 1G8AA 4KGZA 1J22A 1M8GA 4YCLA 4RZ2A 4D25A 3DZ8A 4Q82A 1NXOA 1BXZA 3PS9A 1UJ4A 2OCIA 2YWFA 3GAFA 2WU3A 3OVMA 3R1IA 4G3XA 1AF4A 3WIBA 2Q1YA 2EP7A 3MJEA 4DT1A 2PT6A 2P1ZA 3BRCA 3ZV4A 1CW2B 1Y5LA 1U8FO 4MQFB 3KP1A 2ZBUA 5IW8A 4PZ9A 2B6HA 2FSHA 3LQYA 5IJXA 3RCBA 4CFZA 1OH8A 4QVKA 4MV8A 721PA 2MU1A 3TCXB 3VPXA 3R5TA 2F7SA 5AKZA 3JQ7B 1YR9A 3P94A 4UD6A 5CK5A 3W78A 1VDZA 2JLAA 1AKQA 3BL6A 1C9KA 3DW1X 3QTBA 4FYKA 1NVVQ 4D79A 5KNBA 2JJ8A 1AHPA 2AN1A 3Q3VA 3U6KA 1HOXA 1KK3A 2NVWA 2QQ0A 2XE4A 3EH1A 4KK3A 1QZTA 5UKDA 1GAWA 2O6LA 4ZYXA 1OB2A 4P83A 5EPUA 2R751 1SULA 1E1QD 4X41A 2DR0A 5C8ZA 2BKAA 1JA9A 2X2OA 4FFWA 4MA0A 4Y9RA 3RI3A 1M34E 2JJ2D 2NXNA 4MLZA 5JRJA 3PQ3A 2QN7A 5EJEA 5JO0A 3UENA 5G02A 1Y81A 1T26A 1XR3A 4J4BA 2C4HA 4ON9A 4Z51A 3OQPA 4DQLA 5KTOA 2FXIA 1KWGA 4RE5A 3E81A 2YWJA 3KYJB 2OAP1 2FEMA 1CJSA 1Z8NA 1RJ9A 2O48X 1AE1A 3R7AA 3WGNA 1T1GA 4Y6SA 2CNWA 3TAUA 5CA0B 1Z39A 1ZCBA 3PA8A 2X76A 2IEAA 1A5BB 3I58A 1YUNA 2G08A 1YZLA 3D7KA 3A1CA 3KR2A 4EMSA 1KVQA 3DV9A 1DC3A 3HVKA 3DE6X 3LLSA 2PZBA 1E5TA 1KH2A 3LUAA 4MUIA 1Y34E 1D1SA 1UQRA 1TKRA 3HKDB 2SKEA 3IURA 3QJ5A 3OX3A 1DQRA 4RY8A 3RJMA 1AKMA 1ABBA 2AD5A 4R8VA 3L7YA 2O2SA 5J43A 4JJ4A 1P44A 1ZH6A 3FFTA 4DA8A 4GOLD 3DOEA 2HR1A 4V0RA 2IFTA 1TKBA 3HNPA 2JS7A 1UFKA 4P53A 3TCKA 4NIMA 1R0CA 5T4BA 2DMRA 2PT7A 1DC8A 4DANA 4YRJA 3DMDA 1D9XA 1N7HA 1F2DA 4K9DA 1X94A 2QN6A 4E31A 4EY3A 5KOJA 3T5MA 1A4IA 1CNFA 1L4FA 3OLYA 5AUNB 2ZIXA 4TWZA 4RYLA 3V80A 2J6IA 5JECA 1E2PA 1QLWA 2GK4A 4DJJA 1SUIA 2I2CA 2Z2JA 1L5VA 3I6IA 5KBYA 1W2HA 5KTYA 4ETMA 4HO1X 4JGBA 2WT9A 4DPKA 1DQPA 1HNNA 3MWKA 1WETA 2YWDA 1BX0A 3KOYA 2CFOA 2PS1A 2ZPAA 4URFA 2XE7A 3FJOA 3GRYA 4KQKA 2FRXA 2I2AA 2MHCA 3DKRA 3LSYA 3OY7A 4HDAA 4OI2A 5DMXA 2NG1A 2IU0A 3KVOA 1E2QA 5EZYB 1CP2A 1MV8A 2PUCA 4ZRDA 2R7NA 4DW8A 2W93A 3Q98A 4ESHA 3A4VA 4HTFA 1UMDB 1YB7A 3Q85A 4DHWA 4PU0A 4ZT5A 2XTNA 3FW1A 3F5MA 2JJ2A 1IHPA 3C5VA 1EFRA 4WADA 4DLPA 1T9KA 4JDPA 5BPFA 3O4RA 5AJVB 1Y8QA 1YOVA 4ZA2A 3SM3A 4C2TA 3PX3A 4BFSA 3IKLA 3R7NA 2PAAA 1DAGA 2N3ZA 4D92A 4QGAA 5KU1A 2CZGA 2Y1CA 3C7CB 3AF2A 1QCDA 4M22A 1D1TA 1QX3A 2Q0QA 3A1SA 3HBNA 3L1UA 2DBVO 4FGLA 5D7NA 4Z4HA 3DHEA 4P4GA 1NM5C 1TM3E 4I0WB 1XMSA 3TL2A 3WGTA 4W8OA 3CS3A 1FPQA 1P74A 2QM3A 4YO8A 4A8PA 1JPVA 1VL1A 2DBQA 3MMXA 3PNKA 3VU9B 3M4ZA 4I3FA 4W9RA 3MQFA 2IV3A 2VSNA 4BQRA 3CZCA 1W0JD 3OD1A 3SXPA 1XCLA 1GPYA 2ZI5A 1D2GA 1XNGA 3C14C 4F06A 1BA2A 6GPBA 2JHAA 4J2TA 4D3DA 3L43A 5HP4A 2RBGA 2C42A 3ANTA 3OF5A 4TKLA 1K5GA 5TGZA 1JU9A 1IMJA 4DNXA 4M1QA 3FPAA 2WWRA 5T4FA 2FP3A 2QN3A 1ZMTA 4DLNA 3L04A 4HNTA 1FTWA 4CYMA 2VPPA 1II0A 4FPXA 4D41A 4DRXB 4M1KA 2HHJA 3O2SB 5IKEA 5JEEA 1QCZA 1NJ2A 4JODA 1F8XA 1Y7PA 3KZ1E 3K94A 4G1EB 5LM3A 4ND4A 3HRIA 4E5YA 9LDBA 2BKEA 1E5XA 2GAFA 1U8CB 4I4TF 4JLAA 4QRDA 4Y2HA 5D5PA 1R0SA 5KCZA 3SLKA 1O6BA 2NSYA 3CUEF 3OP4A 3ZCVA 5DV9A 1QV9A 1FS4A 3PR2B 1IHUA 4AX8A 2AOTA 3PYMA 3RFUA 4MLPA 5EIBD 5E6RB 4YJGA 3A32A 3SC3A 5JWRA 5AXBA 1BX1A 5L4SA 2KS6A 3UICA 3R7SA 2YIJA 3QKUA 1JR3D 4MUAA 3UAGA 1ADFA 2WJJA 2PJDA 3OFVA 5IVHA 1LFDB 3FVVA 2VOEA 2D5IA 4R8LA 3H2ZA 1K06A 1V16A 4QXRA 1XXHA 4JP2A 3T15A 4H18A 1E3WB 4BNDA 4MGYR 1U6JA 2GR9A 3MTDA 4M6WB 3S2SA 1B26A 4LXUA 3G2JA 2OXFA 3IEPA 3OUUA 3ZI4A 1NAIA 1J56A 3BMQB 5GONA 1GL6A 1AOXA 3DTNA 4MRRA 1U8EA 4DLRA 1JJ7A 1RWWA 2HCBA 5DHQA 5DNUA 2XQJA 2FZWA 1JMYA 2JJ1A 2UZ4A 2H1VA 2BM1A 2VP0A 1JHZA 2HWKA 2Y1FA 2ZBPA 4Y0NA 4PEVA 2P78A 4ZVPA 4YDHB 4QIHA 2I6SA 4J0KA 3NHYA 5A7FA 4HAXA 5C80A 4JQOA 4LHZA 2BFDA 3H6KA 4FNGA 2R6DA 4F4UA 1TCUA 3PSHA 2F1RA 1RABA 2LRHA 4Y1EA 2QF7A 1IBLB 2JASA 2WD9A 4AYXA 1JALA 1RM0A 1A9TA 3CZPA 4TWRA 3WVNA 1TUEA 1QFZA 4L5BA 2GEBA 1JHQA 1J0AA 4TKVB 4WGFA 4FBMA 4B6SA 1TJNA 3T3OA 3SY8A 1EP3B 2ZAOA 5KX5A 4L5IA 1JE1A 3NH6A 4AP9A 2AW5A 1IHDA 3BFPA 3CUTA 3F9CA 3SJAA 4ENTA 2BMAA 5B6JA 1IVNA 2DFPA 2IYLD 4F3TA 2POQX 1QC5A 1ZKMA 2B1RA 4ZREA 4N47A 4B47A 3IT2A 4GO1A 2REQB 5LBTA 1NZJA 3I4CA 4J7UA 2BZGA 2NADA 2BFNA 5C3MA 5A0VA 3I9V6 1ZNWA 2AK2A 2CNDA 4J4TA 3HACA 3KYCB 4O2BA 1CZLA 3VU1A 4YX9A 4GR9A 1IXRC 1TZMA 3ZQJA 2XMCA 5DJ5A 5LBIA 4TMVA 4GI7A 2FFQA 3DPSA 5EQTA 5AW9A 1V3TA 2R7LA 5HBRA 4EEZA 1RWPA 1XNJA 4HI0E 4TXJA 2EF0A 2LUOA 2CVZA 5IDXA 1E32A 4MWCA 1EJ2A 4OL9A 3GUZA 1U2QA 2WU0A 4JR2A 4JV5B 1TK3A 2VUHB 5KYYA 3FUVA 4MVJG 2W9XA 3EEOA 2CUKA 1NURA 2ZJ7A 1J2TA 1NVUQ 3W8DA 1KYWA 2G1PA 2EQBA 1PG0A 2FPOA 1YF3A 3HBMA 4G5RA 3R8CA 1TMKA 3FUCA 4MEJA 5G0UA 5CB0A 1H5QA 3BBLA 5AK5A 2DFTA 2AOXA 2OENG 3AX6A 1GZ6A 3QX8A 5F3RA 2CJPA 4XFJA 1D0SA 2XKAA 3ENQA 2ZYUX 1D6NA 3WV4A 3KQWA 4DADA 3GLIE 1R0LA 3OM9A 3SIRA 2QAGB 4W6QA 1EZ4A 2H8KA 3UJPA 1MAVA 3EFOB 2CDBA 1WNTA 3F67A 1TECE 2VF8A 2DH6A 1HYBA 3BGVA 1LDYA 2R48A 3MYRA 1HI9A 2BGKA 3BMOB 4GRIA 4ZO4A 2ZCUA 4A8HA 1VE7A 1VCMA 2ZRJA 2WJ4A 1HXHA 3UXYA 1HE1C 2BGNA 1NQUA 2XDAA 2P1RA 1EFDN 3P9IA 4O4JB 5JI2E 3TKLA 1U65A 5E9QA 3ESDA 3U1VA 1SUWA 4F60A 4ARBA 1Y1SA 3QWBA 4Q7KA 1KPGA 2R47A 1RM4A 4IIHA 3IP5A 1WUHS 4WKPA 3UMVA 4UNRA 2IJGX 1NX9A 1U7WA 4G5SA 3I39X 4E14A 1GQ2A 2WMYA 3HZZA 1U0RA 5ARDA 4P4TA 3L7CA 1DQZA 1DLIA 5JIBA 1D2NA 4R71A 5FB3A 4MHOA 2Y0CA 1NYRA 3BFJA 3OBIA 2GKOA 5COQA 2G9VA 3RC7A 2W98A 5AI4A 4CIBA 1PK8A 4F9EA 5EHZA 4HB3A 1U90A 4IWYA 1O95A 1R5JA 2TMDA 4UZFA 5KYWB 3LSTA 3DKVA 3P26A 1T8YA 3AERA 3QWFA 2YMPA 3DVAB 3U4MA 1A8QA 3I1JA 4FYVA 4PSUA 3THSA 1Q2XA 3IP7A 1ICEA 2C58A 4U9IS 3GLGE 4N76A 2VQDA 4GRAA 2POCA 1P1KA 2OVFA 2Q21A 2X1MA 1FOEB 3K5WA 3IDZA 2ZAIA 2VRWA 1ITZA 5KTRA 3KQUA 5AI5A 3NHLA 5FT9A 5IAEA 3ZR4B 3V42A 3KJIA 1JHPA 1UPAA 4PHHA 4WINA 7ADHA 3PXXA 4QLAA 4CM4A 3KSRA 3OE7D 1NYLA 1P6QA 5G4KB 4QYXA 2AD1A 3C8ZA 1V1MA 4JKYA 4NV3A 1DQSA 4D4HA 2O8FB 1U5AA 2REXB 3KEQA 3JYPA 4H9GA 4HVLA 1A9XB 4C0SA 1HF3A 2P27A 1K3TA 1SUEA 4I1YA 4MPPA 4G36A 4U0JA 2ZB8A 1X1TA 4GMDA 4RULA 5AKHA 3U4AA 1OFGA 2VUUA 2A0FA 3TQIA 5I8PA 4PC2A 1VIAA 1DRJA 4ZAGA 1XPUA 3SSAA 1M9NA 3A11A 1C4OA 3GEBA 3MJDA 1XVUA 2R96A 3MOGA 4MS4B 4NATA 4WJZA 5J2TA 5FUWA 4RCVA 5K6RA 3UT6A 3EIWA 4UC0A 5EMMA 3ZCSA 3BB1A 3HU5A 9MHTA 3A10A 4DJAA 4RH1A 4LV5B 3WAGA 1Z7WA 3V00A 3M7IA 3O82A 2X0RA 3OAAD 4BVAA 2WE8A 2XWQA 4KI0A 1K75A 3DF7A 3R0JA 1W1IA 2VK4A 1ZKDA 4F5EA 4OJKA 3V8NA 1RW4A 4B09A 1XZGA 4N7BA 2HHAA 4Z0NA 4PONA 3RVOA 2WYVA 2ZUDA 3OPYI 2VHTA 1UEIA 2ZUSA 4LQCA 3A25A 3LU1A 2AFIB 4WN9B 2G28A 3HVJA 3EXAA 3T4PA 2A5DA 3W8FA 5BV1A 2XHZA 2G6BA 4HWTA 4NFHA 3UJBA 4QGBA 4IVQA 3AM1A 2A1TS 3ELYA 3BORA 5J40A 5JARA 1BS2A 2BONA 1LWOA 4LDRA 2ZJAA 3N9IA 4C3UA 4EATA 1ZVMA 2HWYA 3QVTA 5LOVF 1WXWA 2JFZA 1XTUA 1VLMA 2IXFA 2W2XA 2IEDA 4GNRA 4LJ8A 5EY5B 4PGFA 1CYDA 1O9HA 5SYMA 4C14A 3UFBA 1SURA 5I8WA 1CHNA 4KIGA 4MB6A 3VR5H 1PGPA 5KSZA 5IJ9A 2QD1A 3T1HB 1TW3A 1QQ6A 1A7AA 1CERA 1DBPA 1EVJA 2J3MA 3JD2A 5AJZA 4F6RA 2AMFA 2H11A 1LB1B 4MS3B 1NHWA 1H9CA 4EITA 2Q5QA 3QE3A 4ME6A 4POAA 5KWSA 1SCNE 2YL2A 1IK4A 4LVUA