3P1JA

Crystal structure of human gtpase imap family member 2 in the nucleotide-free state
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
190
Chain Sequence
b'SELRIILVGKTGTGKSAAGNSILRKQAFTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKGSLMDYMHDSDNKALSKLVAACGGRICAFNNGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase IMAP family member 2
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal structure of human GTPase IMAP family member 2 in the nucleotide-free state
rcsb
total genus 72
structure length 190
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3p1jA00
2CEAA 1G8GA 1G16A 4BPBA 4K46A 2ZJ5A 3E5HA 1N6KA 2ZRGA 3IBYA 4MRPA 3NC0C 3THWA 3IILA 4OQXA 2W6JA 2ZXUA 2CCGA 1FX0B 3RNLA 1JPNA 3WP0A 5D3MA 5HKKD 1BS1A 3P1JA 4B6EA 2WJGA 4DLZA 3EZ6A 2ZS9A 4QM6A 1WB9A 2B21A 1ZCAA 4IOLA 5KSPA 4LPSA 2V4ZA 1XMJA 2EYQA 4B2PA 1IHUA 4EIWA 1GZSA 4C0QC 2YOFA 5DNYB 3IHWA 2PMKA 1FX0A 4WVFA 1N6RA 1S4QA 4BFSA 4BZXA 2OBNA 2Q9BA 1E1RA 4FIDA 3GLHA 4OHWA 4R7ZA 3ZIAD 1JEEA 3KFXA 1OIVA 2W58A 4JLKA 1FTSA 4PZLA 3U3MA 5EXPA 2Z83A 2EU8A 3FMIA 3HR8A 1XJCA 1RVDA 4JBWA 3KL4A 4LUCA 4C2TA 5JRJA 3QKUA 4URUR 3CPJB 2XAUA 2JEOA 4CZ2A 1DAHA 4V0OA 3KFVA 3CR8A 3QKRB 1KMHB 1T6NA 5SZJA 2AK3A 3N5CA 2FWRA 3SC3A 3GLFA 2D2FA 4DDWA 3GLGA 2HJVA 1T8UA 4A9AA 2EWWA 5JSZB 1NN0A 1IY0A 2P65A 3C15C 2CXXA 4LSGA 5FTMA 4EPWA 2OBLA 3QSYA 2PLRA 1HH4A 3ZS8A 2C99A 1IN6A 1N5KA 4M22A 1JBKA 2GEVA 4M9SA 1SVLA 5AWFC 4DUGA 4LYJA 3GJ6A 4POAA 2GA8A 5J4VA 1EFRD 5CM8B 4G5QA 1Z83A 3B6EA 2JJ8A 2WHXA 2R8RA 2IHBA 3U3OA 4OK6A 3DZDA 1K8RA 3CKLA 2WJJA 4G3XA 2V54A 3HPQA 3LWNA 2A3RA 2IYXA 3Q72A 4O25A 3EAQA 1G17A 4KFTA 5JWHA 3WYAA 1G3RA 5JWRA 4IVQA 4FINA 3RYTC 3BH7A 4ARZB 5K8LA 2ZRMA 4ASUD 3HJNA 2NO6A 4DSUA 3PFIA 1NN3A 3K70B 2WWHA 3FGNA 2IA5A 2SHKA 1T8TA 3PV0A 2RB4A 4XVQA 2Q0HA 1QF9A 1W2HA 4LGMA 1M1YE 4RKEA 4BE7B 3VKHA 5DSZA 1QVAA 3LXXA 4EJSB 4U02A 2CNWA 2GEDA 3QY0A 3RRMA 2RGNC 2V8OA 4PTLA 2O8CB 2ODWA 4A2PA 3KKOA 3OIVA 3KQLA 4JL8A 1P62B 4JLMA 1KO8A 2WWWA 1CIPA 4HAUA 2WTUA 5DO9A 3F3YA 4LBYA 5BYKA 3G0HA 3BD9A 4P4TA 4UKDA 5FPYA 1E2GA 1ANKA 1D9ZA 3H1TA 4FCWA 2HXSA 1LS1A 2AKYA 1VHTA 1EWRA 2J59A 3BC1A 1J99A 1Q22A 1LTQA 2QPOA 2LWIA 3D8BA 3SN6A 4M9QA 3CF2A 1M74A 4PAOA 5FOTA 3QPUA 1A4RA 3AGPA 1U8YA 1MRNA 4NZYA 4LBZA 2CVFA 1HURA 1R2QA 1Z6YA 2HT1A 1LY1A 2I3BA 1NMZA 3RABA 3QI2A 2RHMA 1ZIPA 4MUAA 4JYCA 4Q1BA 3B7GA 2ZPTX 4I1OA 4KVAA 2OESA 2IUUA 1G7RA 4TMTA 2ZETA 4FMDB 3H86A 5K8TA 1JR3E 4A8JB 1KKLA 1E79D 3GLIA 1FQKA 1OYYA 1YHNA 3FVQA 2O8CA 3CWQA 4ERNA 2AN9A 2RGEA 1KDRA 2PEZA 3I4LA 3VR2A 4B43A 4BZQA 3O8DA 3AVYA 1LS6A 1YZLA 2HYDA 4BUJA 2V3CC 4PPQA 2HV8A 3KTAA 3N2IA 1EG7A 1R7RA 5EUMA 1XDBA 2WPDA 2K5UA 2GESA 2F1RA 2DFKB 3OIWA 5DIFA 4ACBA 1VG9B 3BFXA 4UXIA 2B6HA 3NHAA 1A82A 1JR3D 1O87A 2JJ1A 3PEYA 4TZ6A 1VIYA 2QY9A 1DOAA 1LF0A 4E07A 5IK2A 3EIQA 3UG7A 4DCUA 4TLDA 2XZOA 4DSOA 1W4AA 2F3RA 2JLZA 4W5HA 2NIPA 3AKCA 4Q03A 5FBRB 2GXAA 1XF9A 2GF9A 1G8FA 4DSTA 1TTTA 3KKNA 5FBWB 1M2OB 1Q44A 4HAZA 5K8UA 2KB0A 3W3AA 3AUYA 5KSOA 1GFIA 5JJLA 2HUPA 1KK2A 1IY1A 1XTQA 4B34A 1G8YA 1QHXA 1R0ZA 1YU9A 1UKEA 1H65A 1XWIA 1ZUIA 2BJVA 3NH9A 4A92A 1Z08A 3TK1A 1ESMA 1XTSA 2C78A 4L8GA 4C30A 1ZNXA 4YXWA 3RVBA 2CJWB 1SZPA 4D82A 1N6PA 2ZU6A 4BWYA 4F4JA 3EIHA 4XWKA 5KO2A 1IXZA 4B3BA 5AUNB 2XSZD 3R7WB 4YONB 2JIZA 4JLNA 2FGJA 2QQEA 3ZLJA 5AJXA 4B73A 1Q12A 3FMFA 4PAMA 3EX7C 1E2NA 4J0QA 3CZQA 4PC1A 1P7CA 3VX4A 2OAP1 3NEJA 3VR6A 3DDCA 4RD3A 4CEIA 2DFTA 2IYTA 5LD2B 3P26A 3QF4B 3CF6R 5JCZA 1G7CA 1VKJA 4PHFA 4JZKA 5DYIA 2W83A 4PSAA 4TZ0A 3RRYA 3RRNA 2VL7A 2IYQA 4OHVA 4XH9B 1G8PA 4P0TA 5CJPA 1GKYA 2VIIA 3OAAA 4HLDA 1Z0FA 4W5WA 2ERYA 3L0PA 2P3SA 4JLDA 1CRQA 1U9IC 1QHIA 5M04A 2XTNA 4TTPA 4B47A 4BECA 2ZE5A 4Z8XA 1YZUA 1BIFA 2QTFA 1NVVQ 1TUEA 2NO9A 2ZUDA 3IKJA 5E95A 4EPXA 3U6BA 2DBYA 3IO3A 1X8JA 1XD2A 1G1MA 4JVLA 4BRUA 1IONA 2GJ8A 3PUZA 3ADCA 4HLQB 4I81A 5JECA 2JDID 3AQ4A 2ORIA 3IQXA 5L3RA 3SR0A 4EKDA 4C7OA 2ZYWX 3UXMA 3GLFB 4JKYA 3TLXA 1Y3AA 2QMHA 3I73A 3QENA 2CLSA 2FF7A 2GEUA 5CJ2A 1W7AA 1ZM4A 2IUSA 1SXJA 2C04A 1N3BA 1AKEA 1S1MA 4XVRA 4D25A 1VECA 5KHOC 3OEEA 4OK3A 4QG7A 2EFDB 2IC5A 3CRRA 3I32A 3N70A 4JS0A 3OFNA 3TE6A 2YNMA 3KQUA 2CCKA 1RJ9B 3NIBA 1G4UR 2FZ4A 4LC1A 5TV2A 1RYHA 3Q5EA 4ZKEA 5FOVA 2YOGA 1NF3A 5HTKA 4RD1A 1QZXA 2GXQA 2G0TA 3CWZA 3GEEA 4LJ8A 4O2LA 4RVCA 4TWZA 4YDSA 2IF0A 4CW7A 3EIEA 3FHTA 1IN8A 4N0DA 1D2EA 4WZBE 3WMFA 1F5NA 2VTKA 4BFYA 1G3IA 5E7JA 4M21A 2OAQ1 1N0UA 2GK7A 4U5XA 2Q21A 1KI3A 4Z8YA 1P2SA 3LLUA 1MO3A 3KJEA 4DHEA 2ZSEA 3G5UA 1DAIA 2GVZC 4TL8A 2JLSA 3KQNA 3K0SA 4FW9A 4XD7D 4TT3A 4UJ5A 5E4FA 2VPPA 4IOJA 2WJHA 3S1AA 2IS4A 1TPZA 2GZAA 2QTHA 2ZAMA 1SVOA 4MYHA 4M8NE 3H2YA 3A4MA 3GFTA 2KWIA 4B3XA 3WBKA 4PHHA 1XU4A 2QZ4A 4D4JA 1IXRC 5KUTA 2XX3A 4WIAA 4EFNA 5EE5B 2IWRA 1JAIA 2QP3A 4MYUA 4QGFA 2F3TA 3MUFA 5CYPA 4DIDA 3TSWA 3PQCA 1M7BA 4NHOA 3RSOA 4A36A 2IEYA 1N6IA 2CLDX 2ZEJA 1V43A 2WKPA 4Q7JB 2XTMA 1T9HA 1ZYUA 5J5CA 1NLZA 1G3UA 4ZI2A 3CM0A 2ZYVX 1CJKC 1ZW6A 5DHAA 3FKQA 1E1RD 2WKRA 2FJUA 3AB3A 4OBEA 3ZIAA 3E70C 1XJ0A 3QJYA 4OKSA 4DLTA 1DAMA 1BH2A 1IBRA 4GOXA 2CE7A 2GRJA 5FTLA 5IHPA 4IFEA 5HZHA 2ODEA 3PEVA 3VR1A 2QAGA 3CRMA 2BJWA 1QHHB 3KUDA 4CGZA 2P6NA 1UKYA 2BVNA 2YWGA 4WBSA 5JJIA 1F2TB 1R5NA 1A2BA 2QM8A 3AVVA 1WF3A 3EARA 1NVXQ 1H8EA 4QRHA 221PA 2WMOB 4GDFA 3WP1B 1RJ9A 3EZ2A 4KBGA 4C4PA 5H70A 4GSYA 1PLKA 4ARZA 4WW0A 4CRWB 3AF3A 3B13B 5KPDA 3FHOA 4DBLC 3NDBB 2ODNA 4AKHA 5JHHB 4JLOA 4BFVA 1RE0A 2EVWX 4QHTA 3U7FB 5AUOB 4W9MC 3IIKA 2QUZA 4L16A 3EWSA 4DSNA 1E9CA 2UKDA 1P2VA 1E2HA 1HYQA 1W4CA 1YJ5A 2CK3A 4NCNA 1II8A 1NN1A 2IYRA 1OHHD 3GJ3A 1DAKA 4Q19A 1WDTA 2VBCA 4MKHA 2YYZA 2VSFA 2AX4A 3IO5A 4B48A 4JLJA 4HSEA 3LO5A 4IVRA 2MSEB 3CNOA 1CR4A 1ZP6A 3EWAA 3CO5A 2A78A 5JHGB 3GP8A 2CE2X 1KI1A 1HV8A 1Q0UA 2IYUA 4TN1A 3T5GA 4BEJA 3W6NA 2I4IA 1KO4A 1S96A 4MYTA 5L3QB 4XOIA 3OESA 1JJVA 2PX3A 3BRWD 2O0KA 2OCPA 2WWIA 2JLXA 1QRAA 3U3RA 2BEKA 2IYZA 3GLHE 3QXXA 2J41A 4AD8A 5F9FA 2X8AA 3BB3A 1ONBA 2FX3A 3CBQA 2BIFA 4YLGA 4GBMA 1NSFA 4CIDA 1CTQA 3G82C 2J45A 2IEZA 5L3SB 3DVLA 1R6BX 1CKEA 1DAGA 2FOLA 3HYRA 3CONA 2EW1A 4EPRA 3K1JA 1ZC3A 4KFSA 5EUQB 1XCGB 1E2MA 4NYMQ 4NCKA 3DZ8A 3WNBA 2QBYB 2WM9B 4BLSA 1E2QA 4WOPA 1N6HA 1KHTA 5L3SA 3RS0A 2AWOA 2QNRA 4Z54A 3T5DA 1OB2A 2X1VA 4M1YA 4QNMA 2ZI7A 3QPVA 1ZBDA 1UBGA 2VF8A 3NBZC 4D6PA 4CEJA 1QHHA 1M7GA 4WAUA 1Q1QA 3F0TA 2V55B 4DEXA 3RWOA 2G1JA 3QBTA 3I8XA 2JAQA 4PHTA 5FOSA 2YV5A 3UANA 1COWA 3QQ5A 1D6JA 5CB6A 1E3MA 4LCBA 2O52A 3RS7A 2FG5A 3PEUA 1EK0A 1E2IA 3M4YA 2YWHA 3FFBA 5SZIA 4X8OA 3ZZUA 3TAUA 1GP2A 2ZSBA 4OYHA 4RKFA 6Q21A 721PA 4NTZA 4FWIB 5CIQA 3TUZC 4TYPA 3QVVA 3K9NA 1LB1B 1MH1A 5FPSA 4PC6A 3X2SA 4P4UA 5C4MA 3AP1A 4MKGA 1DO2A 4RZUA 2BMDA 1DBSA 4Q4AA 4NKRA 1K5DA 2ZAOA 3SDZA 1IN5A 4ZKDA 2D62A 2FNAA 2HCBA 1JXMA 2NZ8A 2O5VA 2BBWA 4N1AA 4TYWA 2TMKA 4TLAA 4A0HA 5KNBA 3EPJA 3SU8A 4NL4H 2B8WA 2OCBA 5JI3E 4QNRA 3ADBA 2QP9X 4R98A 1WMSA 5GJVC 2H92A 1JEDA 1F2TA 1E99A 2ZM5A 4JSYA 2QRZA 1KZ7B 1UJ2A 2V9PA 3WYFA 5L3VA 5JS7A 4S2EA 1RC8A 1OKKA 3WRXC 1RRCA 1E98A 2AFIE 3X1YA 3P32A 3A1VA 2O8FA 1HA3A 3CZPA 1AJEA 4XD7A 3L8ZA 4US0R 4WXPA 2RH5A 3CNLA 1XZQA 2C9YA 4HDCA 2J0UA 2XGJA 2ZI4A 5EJEA 5JJKA 2I1QA 3H0KA 3THYA 4A8JA 4E22A 2VRWA 1JECA 1U0HC 4I1VA 2GCNA 3RAPR 2CJWA 4NP6A 2EFCB 2QBYA 2JJ1D 2YVUA 1LFDB 3AH8A 3HR7A 1EWQA 1KK3A 3ECCA 4A0RA 1BKDR 2FH5B 4TMZA 1G64A 4Q1CA 1W0JD 2YJTD 1SXJE 2KSQA 3VKGA 1PJRA 1SVMA 4D4LA 1SULA 2ZJBA 1UDWA 4PO1A 2WAXA 4HDQB 4K8OA 4M1KA 3A36A 1XXHA 1GL6A 1GNRA 2H8KA 3X1ZA 3I72A 2PZFA 2WBLC 2ECKA 3T1TA 2FFAA 4G5RA 2XNDA 3JZAA 4KAXA 5DI9A 5LB2A 4TQ9A 1U9IA 3CRVA 3BERA 4KSBA 4Q48A 4TMWA 2NTYC 5DI3B 3VQTA 2WVJA 2YINC 3IBGA 4F93B 5FPKA 4Z1MA 2ZITA 4UQOA 2QGZA 4B3DA 4BLOA 1NNEA 2D7DA 1XCMA 4FCVA 3K70C 2ZQ5A 5CK4A 2JLWA 4IHQA 3VKWA 3VAAA 4ZO4A 4D0NA 4CEIB 3A58B 4LYHA 2IYYA 5EE1A 1TEVA 4PX9A 4CYMA 2OUKA 3IQWA 2ORVA 1G7SA 1P5ZB 2QN6A 4GL2A 4B2IA 1G4AE 1X1RA 2OLJA 1M6NA 4DLSA 1XEXA 2F43A 1KTVA 4URZR 2A2ZA 4PPGA 2ZJ2A 4Q4HA 3O8CA 1KAOA 2CMKA 1HQYE 4Q47A 1NVUQ 1OF1A 3HU3A 4HB3A 2FSFA 1JJ7A 3O47A 4PQRA 3BOSA 5KNCA 2QROA 4ESHA 1TQ6A 1ZU4A 3AVUA 2F7SA 4M53A 4MUBA 2BWJA 1N0WA 2QAGC 3AF1A 1HUQA 4D0LB 2XB4A 3ASZA 5BN4A 2ZI5A 2HJGA 2DR3A 2P0EA 4JSTA 3TR0A 4QGAA 4DIEA 1WCV1 4B3CA 2MSCB 3ND9A 2A5DA 2GILA 2JDIA 4P32A 1FQJA 1GRQA 1E0KA 3LQQA 3P4XA 4DWJA 5EQTA 5C4GB 1SQ5A 2PZGA 3MJRA 3LX5A 3PJRA 1T3HA 3QEJA 5EP1A 1OIWA 4DRZA 2CK3D 1SVWA 1UAAA 4UNNA 1COWD 1IJFA 3UMSA 2VHUA 2PJRA 3GD7A 4HB0A 5GJCA 2G1KA 2XNSA 1R5BA 4X8HA 3DO6A 4DKXA 3CX8A 3MMPA 4YQFA 5KSZA 4MH0R 4TQAA 3QXHA 1VMAA 4WZ6A 1VCNA 1VG1A 1SKQA 2R65A 2X19A 2ZRNA 1WXQA 3LRPA 4B3FX 2JLRA 2XTZA 1QBKC 5CK5A 5TMPA 2RGGA 2P6UA 1TUIA 1DADA 3BS4A 2IK8A 3GJ8A 4YC7A 1N5JA 1KI6A 1RRGA 1DARA 2G88A 3RS2A 3KJIA 3LDAA 3C5HA 2RAPA 1N6OA 1TX4B 3WNCA 2GAOA 1ZIOA 3TBKA 4IXNA 2IYLD 4L4UA 1JNYA 2QTVB 5D3MB 4DLRA 2FSIA 1XPUA 2JASA 4D0GA 3FKSA 2O8DB 4B6FA 2BMJA 3BH0A 1N2CE 1QHYA 1JR3A 4KFRA 5JEDA 521PA 4RCYA 1E96A 4ASUA 3CUEF 3F8TA 5AR1A 3AVWA 2JLYA 1CP2A 2H16A 1AZTA 2QSZA 3WMGA 2VP0A 2W0MA 4I99A 1M8PA 5FL7A 1DS6A 2PCJA 2F1IA 5DISB 3CPHA 1E2LA 4QXAA 5FUYA 4RFVA 4HEJA 3QKTA 5FR2A 1EFTA 1YZTA 4KYIB 5SZKB 2AK2A 2REXB 4AYWA 5TVKA 1A2KC 4TLCA 4Q9IA 1SGWA 2QSYA 1F60A 3T61A 1S0UA 1UEIA 4AK9A 3THOA 2Q3MA 4AYXA 3K70D 3SQXA 4AYTA 3LVQE 1CS4C 1TADA 5GVSA 4GMXA 2C77A 4NU0A 4EPYA 3AVXA 2QEQA 2JCSA 3QKRA 3A1SA 1E9FA 2H5EA 3GFPA 2Q9AA 4FXPA 4KFUA 4M0LA 3R9WA 1VCOA 2R2AA 4LJ7A 1KY3A 3K9GA 3CPEA 2V6IA 2J3EA 1JAHA 4BLTA 1U2RA 2XJ4A 4QJ3A 4C7OB 2UVQA 2XSZA 2VHQA 1DG1G 1MKYA 1UF9A 1U8AA 1Y63A 2AHOA 1K6MA 1TF5A 5C46F 3ND8A 3VR4A 4H9GA 5KDLA 1C4OA 4H1UA 3REFA 5C18A 3CB4A 4TLEA 3RS5A 1OIXA 1P61B 3MWLA 3SJBA 5HPYB 4I1UA 2CVHA 3T1QA 1W2GA 1G21E 3PR1A 1B23P 3HWSA 2R6CA 1AGRA 1MRSA 2C95A 3SJAA 1R5OA 2IXGA 4G5GA 4LJ9A 2OILA 5F3WB 1Q3TA 1XTJA 2YWEA 3IGFA 4I1SA 5JEEA 2F1HA 1ZC4A 5FOUA 4BFUA 1O3YA 4TL6A 3WBJA 2XJ9A 1X6VA 4XWAA 3RHFA 4W7SA 2VP6A 3KXLA 3QXSA 4LZZA 3J81k 1B0UA 1G6OA 1XJQA 2JLQA 4JLPA 2IBMA 4R2HA 1US8A 2QPTA 2W0SA 3A1TA 1AQYA 4HB2A 4URWR 3LNCA 4O2RA 1ELOA 1UFQA 2ZJ8A 3KXIA 4HZUB 1U0JA 4V0NA 2FMXA 3QPWA 3R20A 2XB2A 1BYUA 4JVMA 2QU8A 2F9LA 3W90A 1SKYE 2GZDA 4DB2A 3W8NA 1W44A 4TMXA 1OT3A 2J1LA 3DKPA 4D81A 5JWOA 1I4DD 1P4SA 1G3MA 3CF0A 4HUQB 2IYVA 2KBFA 4LX0A 4F91B 5C2JB 3SBDA 1R4AA 3VFDA 2ANBA 4KODA 5TXGA 3B1YA 5KOYA 4V0MA 4PC7A 4B33A 3W6OA 1XCPA 4D4KA 4MYCA 2FU5C 1WBBA 2IT1A 3AKYA 2PT5A 1KMHA 5EP2A 2ORWA 4HAVA 3FMOB 4RFSA 3I62A 2CDNA 2QP4A 3T1VA 2L0XA 1KGDA 621PA 3QXCA 2XEXA 4X8MA 1G291 2WWFA 1L4UA 1U81A 4JLVA 1JR6A 1F2UB 3WY9A 2CHGA 4AI6A 4LYAA 1Z28A 4AURA 2W00A 1P2UA 3B1XA 4OI2A 2WMNB 4LV5B 2PZEA 5IT5A 1T3SA 3ZD7A 5HE8A 5HCNA 1TQ2A 1W4RA 3LBIA 4IFBA 1EXMA 5BXQC 1NG1A 1KZGB 4B32A 5EP3A 4LBVA 2GBLA 1FP6A 1JB1A 4JKIA 4RY2A 2JIZD 3BH6A 3V4FA 1RZ3A 1SXJC 4C0JA 5JLJA 4QFMA 5DLQC 2GJKA 1IJEA 1VHLA 2DWOA 1D5CA 2OM2A 3O8BA 1XBTA 3ONWA 1WA5A 5BN3A 4LDJA 4MKIA 1NLYA 5G3YA 1Q1BA 2RCNA 4M4SA 1E9DA 4C3ZA 4L9SA 4ZDIA 2OEPA 3AEZA 2JGNA 5G3ZA 4CEHA 2WSSA 1NBME 4MDEA 5J4LA 3TSOA 2AXNA 2NZJA 3GQBA 1VCIA 1P60A 3LXRA 3RLFA 1ZNZA 4OJKA 5TY0A 2AKAB 5J4HA 1X86B 2NG1A 3BORA 1MO4A 1BMFA 5FOWA 2AL7A 5GJWC 4EPVA 4V02A 4WZAE 1FMJA 1WQ1R 1OH7A 5CDFE 1NMXA 3TVDA 1Z5ZA 2EFHB 5J4YA 1H8HA 4C9BA 5BQ5A 1E2KA 1IY2A 4ZDKA 5KU1A 4A15A 1NJFA 2A7QA 2WOOA 1E4YA 2ZRHA 2QENA 4GP7A 3SFZA 4GPTA 4C0SA 2BOVA 4AKGA 2ATXA 4A82A 2JLUA 1JQJC 3ZQJA 1ZM7A 5H1YA 2J7PA 2ZROA 3EPLA 3QUSA 3K53A 1TAGA 5JI2E 3LH5A 1OH6A 3TJZA 4ZI3A 5EZ6B 5FI1B 5IDVA 4S35A 3NC1C 5F9HA 4NCIA 4P4SA 3GEIA 3SJCA 1DG3A 3BGWA 1VYVA 1ZINA 3OF5A 2FPMA 3Q3JB 1P2TA 1FOEB 2GWHA 3BB4A 1W48A 2LKCA 2J0UB 2DFLA 5EXSA 3KKQA 4F38A 3KJHA 4C0BA 5BW8A 4A6XA 2Q6TA 1U98A 3GLIE 3I5XA 2G3YA 1YRAA 1DVRA 3CLVA 3OEHA 5EE9A 1TL7C 2GCOB 1JQLB 5L3QA 1E0SA 2QPAA 4A6PA 2W6ID 3HDTA 3IIMA 2VO1A 1IAQA 1Z6TA 3DOEA 5E7MA 3R7WA 2DCUA 3FTQA 3MCAA 2BBTA 3JVUA 3U4QA 2AR7A 1K5GA 4E5UA 4HATA 1ZM3A 2CBZA 2EWVA 1Q1EA 3FKSD 3DOFA 5JRZA 5CB8A 1I4TD 4AC9A 3I1FA 1X8KA 1RIFA 3EC2A 1KMQA 4QJ4A 4RD0A 5AUQA 4K81B 3TRFA 1VCMA 4UXJA 4O3MA 3NKVA 1T0HB 1E79A 2BM1A 5LBIA 4YMVA 3KQKA 3Q7PA 4DLXA 2VF7A 4E03A 4HB4A 1UBCA 4JVNA 1HQCA 2ZS7A 5LPNA 2GHIA 4PZYA 2NPFA 2V7QA 4CEHB 3L0OA 1Z2CA 4XTCS 1AQUA 4XVUA 4P33A 2ZRDA 2GJAA 3QF7A 1NMYA 4Q4HB 3VU9B 1QHGA 1W5SA 4E09A 5B57C 4LV6A 2QQ0A 4TT3D 4Q1EA 4JVSB 2WIAA 1RYFA 1SVKA 3TAHA 1NIPA 2H57A 1GG2A 1KSJA 2C2HA 1MOZA 1TMKA 5AJWA 2AFHE 3QKSA 4HAYA 5AUPB 4FMDF 1E9AA 4ZIRA 5BWMA 3EZ7A 2ZI6A 2ZE8A 1Q21A 5DHFA 4BEBA 1LW7A 3AF4A 3BFVA 4IXMA 4PO8A 3D7MA 2HLDD 2YZ2A 3GLFE 3PCRB 2J0QA 4G1UC 3REGA 3T12A 4GMDA 1RW4A 1YZNA 3L2OB 1W46A 3BWDD 1EFHA 2B7CA 2QI9C 3K0FA 3ETLA 4PPFA 4TL9A 4DLWA 3Q7QA 1Z06A 2J9RA 2DHRA 1TF7A 2W6IA 3SHWA 2RGCA 4H1VA 4JJZA 4EAQA 1GM5A 4EFLA 2O8EA 3K0AA 3IEUA 3U7HB 1ZD8A 4IW3B 2CHVA 4IOKA 3RDPA 1OH8A 1QHSA 2BDTA 1YR8A 1TU3A 1Z0AA 5HR5A 2GTPA 4L9WA 2J46A 3K09A 4TMKA 2FSGA 1UBEA 3BAFA 2WJIA 3FFAA 2WWGA 5FTNA 1D2MA 4FMCB 2G77B 1PLJA 2H18A 3TMKA 3K0AB 1CR2A 5HE9A 3NG1A 1AS3A 1RKBA 3LBHA 2JJ2A 3WMEA 2IXFA 4MRVA 1UADA 5L8VA 4KBFA 1OYWA 1NBMA 2NPIA 4LJYA 2D3WA 3LBNA 3U3KA 3UPUA 2IYWA 3T1OA 2ERXA 4KVGA 1J7KA 5CYOA 4V0KA 1NSTA 4KXFB 4WA7A 4MRSA 4ZCLA 3SE0A 4AY2A 4QM7A 3PUVA 4TSFA 1US8B 5G41A 4G0NA 4CEJB 1G18A 4M1WA 3U44B 3PIRA 4RZXA 1CU1A 4JJKA 1WE2A 5FTKA 1KI7A 2CLCX 2GXSA 1RFLA 4JYBA 2XOKD 4L5BA 3A8TA 5JZVA 1ZU5A 1D8TA 4AG5A 1P72A 2FDCA 2QG6A 2RGXA 1AA9A 2HLDA 4MGZR 4AWXA 2XITA 3OZXA 2C96A 4XSHA 4OI0A 2HXYA 1S1CA 2R6DA 4II7A 2PL3A 3FYHA 5FPTA 4DCTA 3ZVRA 1R10A 2FFHA 4Q7LA 2OLKA 3C41J 3QF4A 1ZD1A 4KHZA 2BBSA 4OQLA 1HE1C 1G5TA 4GZLA 4YMUA 4LI0A 3UWOA 3TNFA 5SZHB 2MMGA 5LB4A 3WYGA 2P6RA 3TUIC 2OXCA 2YC2C 1W47A 2WJVA 3MG9A 1ZNWA 2FGKA 2RGAA 3AVOA 4QBHA 4RZ3A 5HZKA 1T5LA 2PEYA 2ZIAA 5DE3A 4PQFA 1J70A 1ZM9A 4LHXA 4C2UA 5FL7D 1KO7A 2NO1A 2W2TA 5CITA 4PSVA 2VA8A 4A2QA 1II0A 3ZVMA 4Q7KA 2GK6A 4C0HA 4EFMA 1E9BA 1W49A 3ZGXA 2OFOA 4N3NA 3I8SA 3OFND 4Q9KA 4LWZA 1PVOA 4MA4A 2IX3A 2W2XA 2O0JA 3DM5A 2AWNA 1SVSA 3U7GA 4GP6A 4LV8B 2ZS8A 3VR5A 1N6NA 2AD1A 1D2NA 4R71A 3HP1A 4P3YA 4DB4A 1T0JB 1Z0KA 4IDOA 5EE3A 3X1WA 2FN4A 2GBLC 4NBSA 1MV5A 2QMOA 4OHXA 1E2EA 1GL9B 2G0NA 3K9HA 3LW8A 4MKFA 5LD2C 3MSXA 1XD2B 4NYJR 2HT6A 3PENA 4F4IA 1W36B 3MLEA 2BCJQ 1DE0A 1NY6A 1OFIA 1VTKA 1CBUA 4EQ6A 2ZRCA 3FB4A 3SQWA 2EYUA 1P9WA 1X1SA 4L15A 4NMMA 1SKYB 1WBDA 3U60B 1BMFD 1GSIA 5C1BA 3THYB 3SYKA 4XTRA 2ZSDA 2UZ3A 4CT4B 5DN6A 4X8LA 2BMEA 2WZQA 2RMKA 3UWKA 4G5OA 2V7QD 4PFSA 1G5PA 4RCZA 1S8FA 4ESVA 1RRPA 2VP4A 2FZLA 421PA 4AKIA 5AJVB 3KKPA 1LNZA 3LW7A 2HF8A 4Q4LA 2NO0A 1A1VA 2WSMA 1TQ4A 2FE4A 2IW3A 1KI4A 4Q1AA 4GFDA 1FL9A 2VHJA 4NDZA 4IKEA 5H68A 2X2EA 1NL3A 3ZDQA 4U7DA 4LHYA 2B7BA 3TKLA 1J8MF 3OAAD 2BBOA 2HYIC 4LHWA 1UM8A 4PC2A 3VMFA 3SOPA 4OHYA 4UNSA 1ZMXA 3P20A 4ACAA 2E87A 1NJGA 2ZR7A 2ZU0C 3RANA 4ZIRB 2CNWD 1Z6AA 2ZUBA 3A1UA 2PT7A 4M9XA 1CRPA 3SBEA 1Q20A 2LKDA 2GVDC 4C0LA 4UNQA 2KJQA 2QORA 2OXRA 1GILA 1OJLA 3TH5A 3R8CA 2XZPA 3SYLA 3EW9A 2J0SA 1ZD9A 1IOZA 3VU9A 2MSDB 2Q3FA 2W6JD 1YVDA 3B5JA 4Y0VA 4LOAA 1XTKA 3W5IA 1KDOA 5FBQB 4B71A 2IF2A 3DM9B 4KJZA 2KBEA 3MRSA 2O8BA 1YR6A 4ITRC 1R0YA 4A2WA 3GLHB 1FNMA 3OEED 4A8JC 2A5JA 1LV7A 1XNJA 4TTRA 1OXVA 3KUCA 2Z4SA 1XEWY 1QG2A 4BFZA 4DZZA 1AS0A 4NONA 3NTUA 1I4LD 5FUVA 2QM7A 1NN5A 3OE7A 2A9KA 1Q1ZA 3K0CA 1AM4D 2GDJA 4B35A 1E69A 1CULC 2XNDD 1S3SA 3KXKA 2WICA 1KSFX 1CJUC 1MO6A 1ESNA 3T35A 3UG6A 3QG5A 2GZHA 1KKMA 4BZPA 2QL6A 4ZV4A 2WSSD 5E3HA 1BYIA 1G41A 3PXGA 4TTQA 1S9HA 1Z29A 3NEYA 3ZVNA 2VLIA 3WNDA 4JLBA 4AIIA 4WXRA 4TMVA 3DHWC 2QAJA 3Q5DA 1TF2A 1DELA 3CW2A 4DEYA 2Z43A 4Q7MB 4NYMR 1EFUA 5DH9A 1VDZA 1H8HD 2ZYTX 4P4SB 3A4NA 3AGQA 5H8WA 3AP3A 1IQPA 2DYKA 1P6XA 1AKYA 4TQUS 4Q21A 4R9UC 1HE8B 5DI3A 5FFMA 3UIEA 2VYFA 2R6FA 2RGDA 1MT0A 3C14C 3VX3A 3BBPA 1FUKA 3QOFA 1QG4A 2G83A 2HF9A 2GKSA 4IJMA 2ZJOA 5EXXA 4ZCMA 1Z22A 4JL6A 2MMCA 2CL7X 4LBWA 2WKQA 1HEIA 5FUWA 3B1ZA 5FL3A 4TSFD 2WOJA 1IN7A 2J87A 4F7WA 3TQFA 3AF0A 2D06A 5BN5A 5UKDA 3K0EA 4UNPA 2XXAB 3LY5A 3D6TB 4V0LA 1ZCBA 3QBVA 3S1AB 3D31A 4B2LA 5B58C 3QVUA 4DJTA 4CVNA 2ZRFA 5BYJA 1MO5A 3U5ZB 3LQRA 2OT3B 4HAWA 1Z6GA 4JT2A 1XMVA 4B74A 1W4BA 3UATA 2IS6A 2ZVQX 2J7PD 3K09C 4LPKA 3OEHD 3RC8A 5LDDC 2VSXA 3U61B 3PUWA 4URVR 1E1QD 1VYTA 1S2MA 3RSLA 1P9NA 1E94E 4OJQA 4V0ME 3ZD6A 4PAQA 1CF4A 1YZGA 4DCVA 4HUTA 2NO7A 5B30A 4ABYA 2BV3A 2QMUA 2CCJA 1AZSC 5HKKA 1XFAA 3D3QA 1KI9A 4XJXA 3EC1A 2BM0A 3OHMA 3SI7A 5HCIA 1YE8A 2YC4C 3IIJA 4PQYA 4TYQA 3AVQA 3ZH9B 3JZMA 3ZZTA 3QEOA 3JVVA 1E2PA 4A0GA 2KE5A 3IUYA 4FI3C 1W1WA 1XB2A 4YMTA 1Z47A 2BC9A 3NBFA 2YKGA 1Q3HA 4IEEA 3NHBA 3PEWA 5FBLB 4RFSB 2OFXA 2ZTSA 5FUXA 4F92B 1XD8A 4QBFA 4RZ2A 1WP9A 3KKMA 3NDPA 3KJGA 4BRWA 2ZR9A 2NMVA 1MABB 4B44A 5B2ZA 5EP4A 4PC3A 2VP2A 1FP7A 1KNQA 3C7KA 3K9LA 4IRUB 1OFTA 1KJZA 5AJYA 2QE7D 1E2JA 2BHRA 3MWYW 3B2EA 4RD2A 4BQSA 4DDUA 1NVWQ 4DLVA 2ZRLA 1EESA 3L8YA 3BE4A 1KIMA 4QKQA 1KO1A 3LA6A 1OKKD 3FWYA 3W9YA 4GOKA 4NCHA 1Z0DA 3AF2A 3PUYA 2QRNA 2PJZA 2QT0A 1GRNA 2V6JA 4M1MA 3NBXX 4IDNA 2O8EB 5CLLA 4B76A 4MITA 1KJWA 2W2VA 2C98A 5P21A 3KQHA 3EA5A 1OXXK 1UPTA 3T15A 1E2FA 4LK2A 3MGCA 4KSCA 5J40A 3GJ5A 1PUIA 3ZJYA 4AG6A 4JBYA 4DT1A 2ZYUX 4M9ZA 1KDPA 5FOXA 1KAGA 3GEHA 2C9CA 1XD9A 1OV4A 1QVRA 1RPZA 1TU4A 1QDEA 1SXJD 2P5SA 1P9RA 2WWXA 5JBQA 2A30A 1XEFA 1J90A 4DLUA 4N0EA 2GNOA 2IYSA 4CT5A 1U94A 4FMCF 5CLQA 4LJ6A 3KTAB 4KYUA 2REOA 3NH6A 4MRNA 3EPKA 1PUJA 1Z6XA 2ZR0A 1G9XA 5EE0A 4OQMA 1W36D 2GJ9A 2ZRIA 4UXHA 4EJSC 1CXZA 1GRRA 3NXSA 4RD4A 3KB1A 2ZRAA 3VNVA 4NPHA 1J2JA 3A1WA 1EX6A 1DAFA 1NP6A 2N46A 1KI2A 3MWKA 4MGKR 5D3QA 2Z6VA 4NYJQ 4NH0A 3U7EB 2YOHA 4FMBB 3TUJC 2ZE7A 4IVPA 3M1IA 3NBYC 2H1LA 1G3QA 3EASA 4JMPA 2N42A 2IHYA 3IEVA 1Z3IX 4M1SA 4HDOB 2X77A 2RGNA 4HUQA 5TDHA 1MABA 1XRJA 1T3LA 2XOKA 1XXHE 4HLUA 3RS3A 3CNNA 3R9XA 1NY5A 3FHCB 4JT4A 3BFKA 3L0SA 3IPXA 3I92A 3CRW1 1GOTA 1YR9A 4BFWA 2FEMA 3GFOA 4Q5IA 2BMFA 3PVSA 1A5TA 1YR7A 1R8SA 1G20E 4DXAA 3PG5A 3A4LA 3IHLA 2QMEA 3QE0A 5FTJA 3M6AA 4LRWA 3ZYCA 1OPXA 3DL0A 1VYUA 3LV8A 3GLGB 3I5YA 4KO8A 3ZZ0A 2OV2A 4GZMA 4LHVA 2YWFA 2OBMA 3RRZA 3GPLA 2FSHA 2OFWA 4HYYA 3WHLA 2EFGA 4P31A 5FI0B 2VQSA 3MWJA 4JIMA 2ANCA 4OQNA 1W5TA 2C8VA 5FR1A 1NG9A 4EJSA 2PCLA 121PA 2OCAA 1ZUHA 1G19A 2HDNB 2FFQA 2YHSA 1EGAA 1U0LA 1M34E 5EZ5A 2Q9CA 4MQBA 1ZAKA 2BEJA 1CLUA 3B82A 1P73A 2ZREA 1R8QA 1TNDA 2REBA 3W8RA 5A4JA 4M1OA 3E1SA 2ZRKA 1Z07A 2NQ2C 5E7IA 4D4MA 1FFHA 1T91A 2GETA 3F5FA 2CHQA 2O0HA 2WWYA 2Z0MA 3GCGA 1NKSA 1XPOA 4OQFA 3GLIB 1E2DA 2O8BB 4D2IA 4URXR 1KI6B 1D9XA 3PUXA 3SHFA 3CX7A 2FA9A 3FDIA 4LJAA 2X2FA 3TVTA 4LHZA 4ON9A 4R2IA 1XTIA 1XZPA 4RJLA 5CM9C 4JLAA 1E4VA 2R9VA 2OG2A 1X8LA 2ZI9A 3LFUA 3TW8B 1JALA 1H8ED 4US1R 1E9SA 1XMSA 4MGYR 3THXA 5F98A 3B60A 3CX6A 1M7HA 1YQTA 4HI0E 5DYGA 2JATA 1L4YA 2FEOA 3TGPA 1L7VC 3WHKA 3CIOA 3BB1A 3H84A 1NRJB 1XMIA 5DN6D 5KDOA 1E0JA 2PH1A 4Q4JA 1PV4A 3THXB 2DB3A 5JMTA 1SVIA 4CDGA 3Q85A 3LD9A 3B1VA 4U00A 3GJ0A 1JXOA 4XWOA 3ADDA 3U2QA 5KNDA 4Z1MD 2KI5A 4HZUA 1U8ZA 5GVRA 1GAJA 2CL0X 2HCJB 1F48A 1MR3F 1Z0JA 3KDSE 4BLPA 1U90A 1XEXB 2F43B 4KI0A 4V03A 1G6HA 4F4CA 3V4RA 3C5CA 3EZ9A 1NIJA 3EG5A 3LVRE 3UMFA 4M1TA 1VG0B 2WV9A 3OIYA 5AK0A 4TLBA 3B8HA 5GJBA 3L0IB 5FPHA 2B8TA 1HT2E 1W0KA 2QAGB 1Z0IA 4Q00A 3AKEA 3ASYA 4PXAA 4DUGD 1XPRA 2O8FB 1EFCA 2E9SA 4BFTA 4DDTA 1ZJ6A 2JA1A 3TIFA 4A4DA 2DPXA 1N5IA 3U3JA 5TB5A 3MD0A 1C1YA 3B1WA 5J47A 1FUUA 1VG8A 4HLUC 3WXMA 3L43A 1E1QA 3I3SR 2LCFA 4M2LA 3R8FA 3P27A 4US2R 4A0FA 1V5WA 4BLRA 1UEJA 3CH5A 4MGIR 5F2EA 1L8QA 4LY6A 4QBGB 1KDTA 2C5LA 3EA0A 8OHMA 1KNXA 1FW6A 2WJYA 1T4GA 4Q4AB 2PBRA 4O0MA 2DWPA 2OHFA 3ICQB 2QT1A 3WRYC 2ODBA 3RS4A 2DY1A 2NGRA 3U44A 2IS2A 3TW4A 3B85A 4OI1A 1TQDA 1FTNA 1R0WA 5A0FA 5CDFA 5ANRB 1KY2A 5KYKA 1SXJB 1L2TA 4Q66C 4TYNA 1P75A 2RKOA 4PPNA 1OXSC 3GJ7A 3DKVA 5KSYA 2R44A 1Q57A 2UZIR 2JJ2D 4FCTA 4QJ5A 3W3ZB 3SS8A 1GIAA 3TSZA 2D4HA 4ZDJA 1EX7A 2FPLA 4LC0A 1KYIA 1XXHB 2D7CA 2Y8EA 4W5JA 4DDVA 2CL6X 4YDHB 4B75A 4B3GA 4NE2A 4HLCA 2V1XA 1GITA 2GJSA 3LX8A 2PLFA 3C8UA 3AP2A 4Q18A 1II8B 4A1FA 3HU2A 2ZRPA 1LF5A 1KSGA 4EPTA 4GT1A 2Q3HA 2WAYA 3A6PC 1ZM2A 4OL0A 1HT1E 3K0FB 4Q1FA 4QBIA 4ZCIA 1PZNA 2FV8A 1N0VC 5JS8A 1FZQA 1OE0A 1YRBA 4HAXA 1OFHA 4KV9A 3OIUA 3OE7D 5IF9A 4BLQA 1N5LA 1U99A 1JI0A 1GDDA 2R6GA 1QHNA 1OXTA 4Q9LA 3RWMB 3TQCA 2O8DA 5FH9A 1XEWX 3NVAA 3GJXC 1W0KD 3SEAA 3T06B 1OSNA 1ZNYA 2R6AA 2NOAA 4MRRA 2VP9A 1GWNA 2Z4RA 1P3JA 1TEXA 3R9IA 1F6BA 1JPJA 1OH5A 4YMSA 4EUNA 1X3SA 4BFXA 1YKSA 2VEDA 2BCGY 3M0EA 4DCNA 1AIPA 3AV0B 2EQBA 4NYIQ 1ODFA 2G6BA 4FD2A 2N1BA 2XZLA 4G01B 3BIFA 3KB2A 1S3GA 4DLYA 3THWB 3ZS9A 4BASA 1OFUX 4FN5A 1E9RA 4QHYA 4CF7A 4GOJA 4KITB 1AN0A 3ZQ6A 3B9PA 3Q8XB 1FPMA 2F9MA 2IL1A 3A37A 2IS1A 4GRAA 3U6KA 3AKDA 4ZPXA 1GKIA 1CEEA 2VHCA 1E32A 4GNKA 3H4MA 4I4LA 4HZIA 3MJHA 3LAWA 4MDFA 1KSHA 4IDQA 2H7VA 4QGGA 5JSZA 3GJ4A 1F3OA 1IN4A 1HY3A 3FE2A 2ZRJA 4GI7A 1GL7A 3FOZA 5B64A 2ZVPX 3VR3A 3SZRA 3V9PA 3KZ1E 3VTKA 3GLGE 4DCSA 1S9DA 5IK2D 2ATVA 2BKEA 4OI4A 3ADKA 1Z63A 2IXEA 3AVTA 3VHXA 3IPYA 2AD5A 4URYR 3ICEA 1GNPA 5FBVB 4Q9JA 3DPUA 1KOFA 4DC9A 3N2EA 1BOFA 5G53C 5IRCD 4XIGS 4QOSA 2ZJYA 2F55A 2R62A 5KDDA 4KCGA 5DGXA 2IWHA 3B78A 1DAEA 4FWTA 3E2IA 1E6CA 2J7KA 2ZJAA 1KO5A 2ZJZA 3EPHA 1UDXA 4EDHA 4PANA 1CJTC 3PITA 1UKVY 3MAAC 2P5TB 1FNNA 1IXSB 1NBMD 1XX6A 3CR7A 1C9KA 1G8HA 4Q9HA 2RHDA 2H17A 3SNHA 3AVPA 5KPJA 4LJ4A 2I1VB 4NCJA 1CJVC 3EXAA 4PR0A 1E9EA 2WIBA 1GUAA 1T5IA 3QIAA 3QKSB 3VHLB 1J8YF 4YXWD 4DT1B 1KI8A 2A5YB 1ZVQA 3C4JA 1NVVR 1F2UA 3LLMA 4Y0AA 1RRFA 4Q01A 5CIWA 3DEFA 1OLOA 4IDPA 4Q1DA 2ZRBA 1SHKA 4UNRA 4YMWA 3B9QA 5KTYA 1Z8FA 2A5FA 2IUTA 5ELXA 1EFRA 4AKEA 4Z51A 3K8YA 1I2MA 1OW3B 3Q9LA 4IEIA 1GNQA 2J5XA 4IOMA 1CJMA 1ZUNB 821PA 2ONJA 3AUXA 1OB5A 2AXPA 1DO0A 3W6PA 3NWJA 2ZE6A 4IDHA 4QHSA 5JFGA 1R0XA 1YZKA 2QE7A 2JLVA 1I2DA 1OHHA 2OSBA 3BJIC 1GVNB 3T34A 1PLLA 3L82B 2OE2A 3QNUA 4PZZA 1W36C 1DPFA 1GKUB 1NKTA 3TR5A 2D74A 2GF0A 2OZEA 1CR0A 2ZSAA 2FFBA 4RD6A 2G9NA 3UKDA 1CR1A 3K0CC 4JL5A 2QGNA 3DMNA 5TARA 3ZVLA 1KJYA 3O8RA 1AS2A 1DEKA 4KLNA 4RSGA 4OHZA 4ILEA 1KK1A 5JCPA 4ZDWA 3MFYA 3FMPB 1VPLA 3C16C 3EZFA 1SHZA 4NYIR 3I61A 2F1JA 2GCPA 4KU4A 2C03A 1N25A 2ZI3A 3QXJA 3VNUA 2Z5FA 3BXZA 2VP5A 2ZUCA 1G7TA 2D2EA 3BK7A 5AJZA 4C0KA 3QG1A 1IM2A 1OXUA 2GCOA 5A5GA 2VSOA 3HYTA 3AM1A 2P67A 4TYYA 4UJ3A 3FPAA 3GMTA 1XTRA 3DMDA 4KLZA 1NI3A 4QL3A 3P4YA 4QGHA 4XSGA 1VIAA 3SJZA 5J4KA 1G5RA 3KX2A 2ZANA 4BGDA 2PMDA 1Z2AA 1W0JA 2EFEB 1A7JA 4G5SA 1ZRHA 1GTVA 1WRBA 4QC2A 2DWQA 1ETUA 2A5GA 4EQ6B 1E0AA 4PSKA 1KK0A 3X1DA 2OO7A 2GXUA 3SYNA 2BKUA 2GAAA 4D26A 1BO6A 1HTWA 1UKZA 2C9OA 2PX0A 5GADl 2XXAA 1N6LA 2WPDD 4OK5A 3SFVA 3W5JA 4JBXA 1LVGA 2B92A 3HPRA 3HU1A 4C0AC 3IDQA 2OCYC 2HEIA 1II9A 5G40A 5K8IA 2ASEA 1DTSA 1UBFA 2QA5A 3W34A 4TL7A 4D80A 1XP8A 2ZSFA 4LJ5A 2V1UA 5EXTA 3U4QB 2J0VA 2RGBA 4LYFA 4PHGA 4PO9A 2P2LA 1FMLA 2DFNA 2VH5R 4Q4JB 4Q02A 3CH4B 3UK6A 2ONKA 1NLFA 1YZQA 3CRQA 3X1XA 2E1RA 1AK2A 2FPKA 1AGPA 3V00A 4DVGA 3RC3A 2F6RA 3UMRA 2VHTA
chains in the Genus database with same CATH superfamily
2GRAA 3UOWA 4CIBA 1N1DA 1B1CA 1I9CA 5AHRA 1YQQA 2R7AA 3JTMA 3KQWA 3L8MA 3ABOB 2CLFB 4UEQA 3UKOA 4CI0B 1M1NA 3LCJA 4CM6A 3QMPA 4IWNA 4ENVA 1FYVA 4INPA 3R74A 2R00A 3IBYA 1RBYA 2A9VA 3LZ6A 2CFSA 2JLAA 1WCIA 2H9YA 3UB2A 4UAVA 3IILA 3NKLA 1FSGA 2QHXA 2CCGA 4UUPA 1CDOA 4CF3A 3LQFA 4OVKA 4TXJA 3WP0A 3CX4A 3RLIA 1U6IA 1BS1A 1JA1A 2VH2A 3EZ6A 2OA0A 2XNCA 1BXGB 4JI3B 5E2IA 2FWPA 4RTKA 1WB9A 1OTXA 1F8GA 2HMTA 1B2RA 2X13A 1IYZA 4ZTUB 1A8QA 1NQWA 4B2PA 1HRKA 3KYIB 3UOAB 2QD3A 2PMKA 1FX0A 2ZYSA 1C1DA 3KSUA 4CM8A 1N6RA 3EZXA 1GTSA 4BFSA 3T9FA 2VHZA 1XXLA 1HLGA 1OFVA 2OBNA 4EF4A 4E12A 3ZIAD 3F4LA 3GCDA 3KVNA 4P3KA 2VDUE 4K6KA 3KFXA 4UDXX 5AOAA 3EEYA 3HNOA 4JLKA 1F9AA 1Q11A 3U3MA 2EU8A 2OSVA 3C98A 1XJCA 3AJEA 4TS3A 3OQHA 4X6YA 4PZ9A 2XAUA 2B3DA 1VE3A 1XR3A 3Q7RA 1XL1A 2JK1A 3KFVA 1ADJA 2K7FA 3O73A 1J5PA 1KMHB 1PZMA 2PQ6A 3M5DA 1BC5A 4CTJA 1Y5LA 3SC3A 3KR9A 1GTG1 3V4PB 2D2FA 4DDWA 1I2ZA 4TWJA 4YUZA 1NN0A 4O2AB 4F5EA 2HZBA 3QSYA 3MIIA 2VYCA 3WFJA 2F1KA 3I45A 4EB0A 2POQX 3C97A 1HH4A 1IN6A 4DUGA 3QU4A 4M22A 5BUZA 1SVLA 2JFNA 3MB5A 2J31A 1UAGA 4LYJA 3GW8A 2PR7A 3R23A 3LO8A 2RH9B 2BGMA 3UCEA 4TSRA 2FRXA 4C7BA 5DBIA 2WHXA 5T4HA 2R8RA 3IEXA 5AW2A 1V1MB 4HWRA 2IHBA 1IUKA 1FJHA 3MNFA 2OUIA 3O4JA 3ONEA 4ME6A 4OK6A 2WJJA 3JQGB 5DK4A 4D3XA 1CUJA 2JZNA 3DXYA 4HQRA 4HN9A 4H6PA 3EAQA 2AEMA 2G9ZA 1JTEA 3C8ZA 3A25A 2V5AA 4KWHA 3TN7A 3OPYA 1KIFA 4MW9A 5E1MA 3RF7A 4ARZB 4AU1A 1HG0A 1IXKA 4BV3A 5K8LA 2JW5A 1CS0A 3IKMB 4DSUA 3PFIA 4MV5A 3BG5A 2WY2D 1NRXA 2XDQA 2ZW9A 4QREA 1XF1A 2P5YA 4P7GA 4RUKA 4AROA 1QNLA 2IA5A 1T8TA 2VTDA 1DUIA 4XVQA 4ZVQA 3SKXA 3NETA 4A8PA 1QRTA 4CTNA 1M1YE 5DSZA 4P58A 4X93A 4O4IB 3VC3A 4EJSB 2WILA 3LXUX 3NHKA 1G38A 1H1LA 3UAXA 3D8HA 2V8OA 3FBTA 2ODWA 3SX0A 1J8FA 2GN8A 1Z74A 2NV0A 4P8RA 4JL8A 5AT1A 3H5TA 1BVUA 1KO8A 1RQLA 4JLMA 3SYRA 4P3XA 4B85A 3WGQA 3V8BA 1Y1PA 2WTUA 4FE4A 3F5SA 4K88A 5DO9A 3F3YA 4C4YA 4OFXA 1EP3B 4NDNE 5BYKA 4IIJF 2Q2NA 1T2EA 3I5MA 3BD9A 2FDXA 4P4TA 4UKDA 3UFXB 4A8HA 5IDQA 1ANKA 1D9ZA 1W6RA 3H1TA 2HXSA 3A9CA 3JQAB 1XAJA 4FCWA 4J1NA 3VJMA 3ZDRA 3L7LA 3O74A 4CQMD 2VQEB 1U0BB 1ACJA 1ACMA 2WZBA 3U1VA 1THTA 2V59A 4OP3A 1Q22A 5KJFA 3GMDA 3P9NA 1VFPA 1VL1A 2JH9A 4ED9A 1Z36A 4QBTA 4KN9S 1FMFA 4J2TA 2G71A 3CF2A 3G0HA 5FOTA 1S7CA 4MKZA 1A4RA 4PQGA 1U8YA 2D0DA 4WV3A 3DJYA 4RPCA 3C4VA 4TMFA 1R2QA 1ML4A 3I6BA 3JSXA 4IUYA 1LY1A 4MR9B 1O97C 3RABA 3ROFA 3QI2A 5EUCA 1WMDA 1CEXA 1I51A 1ZIPA 3IEIA 2GO7A 4C08A 2OZLA 4UOEA 4BP8A 4GR5A 1Y6QA 4JYCA 3VAYA 4MI1A 2DR2A 1N92A 2ZPTX 4I1OA 4WA8A 5EIHA 2NXNA 1EUCB 3BD7A 1NPTO 1G7RA 3G88A 4LIPD 4RLFA 4TMTA 4ZT7A 1XO1A 3H13A 1PJCA 2FQXA 3ZWMA 1XJ5A 3GRPA 3EB9A 3JYHA 3QV2A 4HVTA 2GZ2A 2C9MA 4ND4A 1KKLA 3QFHA 1E79D 3E5MA 3L4BA 1QJ4A 4L3VA 4RA9B 4ERNA 2BEWB 2FN8A 1AQ6A 2AN9A 5EWJB 5L4NA 2RGEA 1KDRA 1KZ1A 1R8XA 1MB2A 4B43A 4LCJA 3O8DA 1NMQA 3Q7TA 4UDYX 1O6CA 1YDHA 4PPQA 1HYEA 8ATCA 1GU0A 4PSCA 3DUFB 3VR6D 4GBGA 3EFHA 2VRNA 1ZONA 5DCLA 7YASA 1EG7A 3KM0A 2K5UA 1WPRA 2IIVA 4KQCA 4ACBA 4LF6B 1T0BA 5JNRA 5CX1B 3E3AA 2DE0X 1USKA 2IZ1A 3NWOA 1LKZA 3DWIA 1QWSA 1VG9B 3BFXA 4UXIA 2B6HA 3NHAA 4H0NA 5BR4A 1JR3D 3D4PA 3DZJA 3LQ2A 1ECCA 1KORA 2JGDB 2UZ1B 3PEYA 5EWJA 2BUAA 2QY9A 2OP1A 3FYUA 4P3OA 3QVKA 1SBQA 3A2MA 4E07A 5KYUA 2B61A 4GIBA 5H16A 1YBVA 4GEGA 1TCVA 1YU6A 4JC5A 4BFLA 4D02A 1H1DA 2JARA 2OQ2A 2N47A 4Q03A 5FBRB 1U1EA 4GOND 5KTSA 1UIMA 1YQWA 2Q2QA 4DSTA 3H2SA 5FBWB 1M2OB 4EG3A 4UAGA 1Q44A 4HAZA 5AM0A 2EJVA 5ADWA 4S05A 3CVYA 1G59A 4MR8A 3OY2A 3W79A 1KWGA 1HNWB 5JU6A 5TSDA 3ERCA 4MVJI 1HYBA 1IY1A 2QR3A 1XTQA 3BWBA 3IUPA 1G8YA 1QHXA 1QS0A 1R0ZA 2E6UX 3E7WA 4JCOA 4JXJA 4ZAGA 1NYQA 1UKEA 1XWIA 4G1VA 4LGYA 4QXMA 5L4LA 5A2QA 2BJVA 5DGCA 3NH9A 5G1NA 2AYYA 3CLTD 5K0JA 1LBTA 3KR0A 2P9QA 3TK1A 1GN9A 2XCSB 2AZ4A 2JNWA 4C30A 2QM3A 5JXHA 1ZNXA 2I22A 4YXWA 3RVBA 4Z49A 4KYTA 3RRJA 1EVYA 1KVSA 1O89A 3NASA 3T7EA 2D5CA 1EP1B 3NKFA 4HEQA 4YONB 1N5OX 3TRJA 4BJ1A 4HH3C 5NLLA 4S2UA 1RKVA 1ZD4A 1QF7A 3H5VA 1PJ8A 1ID8A 3AERB 2PKWA 2PGOA 4XIFA 4K0RA 3ZBPA 3QPBA 3OWHA 1UK9A 3F3MA 1QF6A 2OVBA 3G7SA 3NEJA 3QZUA 4EW1A 3M81A 3D6AA 4LYEA 2I67A 2J3HA 4MXDA 1JVBA 2X42A 3AILA 3VKUA 1PVVA 2C3YA 2UUBB 1JAYA 3PDUA 1KU6A 3KOXA 5FB3A 3STHA 1KL7A 2QG4A 3ESCA 3E8MA 1PEDA 1GYQA 3LYUA 4V1CB 5DYIA 1K92A 4RK4A 3OCVA 1RZRA 2VL7A 4Y3UA 1NQOA 4X1KB 1ISJA 3NBKA 4RLHA 4EEXA 4ZU1X 1O5TA 4U7FA 3GZNA 3FUUA 1NDUA 4D44A 4DHWA 1TVMA 5AKEA 4GO1A 2ERYA 1LPNA 3DMRA 4JLDA 1XZDA 5JXWA 5G1OA 1TJYA 1M76A 3NBUA 3E8XA 4TTPA 4B47A 1P91A 2PTGA 1P80A 4Z8XA 1EP2B 3OQ1A 2KLBA 2QTFA 3WLEA 4UMFA 3E9QA 5DMXA 5KQPA 3BJEA 2DBYA 4DC1A 1H69A 3IO3A 1X8JA 3H2JA 2YN0A 3LGAA 3UJ8A 5IMSA 1EB8A 1R9MA 3RBZA 1IONA 5JECA 2DLDA 4JX9A 4NSNA 3AQ4A 2X9QA 5L3RA 1T4BA 3SR0A 4PYOA 3GLFB 4JKYA 2I2AA 1ZX1A 1U7PA 3R0VA 3SS9X 1NP7A 3SF0A 3QENA 1Y3CE 2GEUA 2HBYA 2XA1A 3P2OA 3I05A 1AKRA 3ZLTA 1W59A 2C8KA 1J9EA 4XQ9A 5JSHA 3W3AH 2PS0A 4OJYA 1P17A 3ESYA 1N3BA 5DX0A 5C37A 3LSTA 4D25A 1AQNA 1P33A 3FGOA 5B1EA 4CQMA 3OEEA 4N7RA 4OK3A 2R1ZA 4RACA 2QRGA 4DNXA 5A0TA 1CUDA 2IC5A 3CRRA 2CNNA 2B78A 3I32A 3TE6A 3ESXA 4X7PA 4H7EA 5IVDA 3QU5A 4E5VA 4ENRA 1C2YA 1T9ZA 1WOYA 4Y2VA 4LNUB 1ODSA 1ZR4A 2CCKA 1PSWA 4LDQA 4V1CA 4BQEA 1RJ9B 1U5AA 3RYHA 1JQEA 1G4UR 5HGXA 2FZ4A 4OAQA 1V48A 2PZKA 4RK5A 5BW4A 5AO9A 1RYHA 3DL7A 2VATA 5HTKA 3IHTA 2QTCA 3Q3EA 4WZBA 2C88A 2Y0PA 4WESB 4G0UA 1QZXA 4RVCA 3T5MA 4CW7A 4E3WA 3KQPA 1PFQA 4P5PA 4TWZA 3FHTA 1U11A 3L0ZA 4FEEA 3TTTA 2O3TA 1IN8A 2QTAA 4BBJA 1J0AA 4N0DA 1D1QA 1PEYA 3BBLA 3G13A 2PK3A 1DWPA 2VTKA 1JIUA 2A9OA 4EHHA 4M21A 2GK7A 2AJLI 3KCNA 3M9LA 4U5XA 5I45A 3R6WA 4Z8YA 4L6IA 3ZBTA 2XDAA 2ZYRA 3KYJB 4OU4A 3LLUA 1DI0A 1FUYB 1T2UA 1I3NA 2PIDA 5PNTA 4OHMA 4C78A 1G0OA 3OJEA 1KVTA 2DUJA 2GAFA 4XD7D 1Y6JA 5IKOA 4DA9A 1GA4A 3RK1A 1SFRA 3B7WA 3I9KA 3KBBA 3RU7A 4PNZA 4QEZA 1EFKA 4DJJA 5JMWA 1VHJA 5LU8A 2ABWA 5FUMA 2GBGA 2IS4A 2ZAMA 1H2RS 4M8NE 3LP8A 3TMYA 2Z3ZA 1UK8A 2LIVA 4UMVA 2KWIA 4TX1A 4B3XA 5CX4A 3W5AA 1UBKS 4D4JA 4LYYA 3C85A 5ECWA 1AXGA 1JRLA 3KV3O 1QIFA 1Y1KE 2EV9A 5LMUB 1W96A 3ONFA 1Z4JA 1RHRA 2QP3A 4MYUA 2F3TA 3RFXA 3KHSA 4DIDA 3TSWA 2Q3CA 3PQCA 1M7BA 1EDDA 3KAQA 1N6IA 1C9EA 2QZZA 1WXDA 1QRRA 3RAJA 2WA2A 2H4WA 4FHZA 2EF1A 2FE1A 1E7WA 3G5AA 2J4FA 2R2GA 1ZW6A 2C5AA 5IAGA 1T5SA 2V7WA 1ZJJA 1E1RD 4AQYB 2FJUA 4BB9A 4KFCA 3F6BX 3QJYA 4OKSA 2Z5GA 3L77A 4WECA 3RUHA 2OCGA 4RDIA 3SMQA 1AZLA 3TOXA 3ZWBA 5FTLA 4I7EA 1EZ4A 4IFEA 3C45A 5HZHA 1R6UA 5IHPA 2NW6A 4QAQA 2EBUA 3V9AA 3CRMA 1LC3A 3A26A 4BNHA 1Y3HA 1ZZEA 4HDRB 1UKYA 5K0FA 5JJIA 2IDZA 1CUUA 1Z56C 4OCZA 4DYHA 3HO8A 2NVWA 4JA2A 3AVVA 2VK1A 3PCTA 5H0IA 4QRHA 221PA 2WMOB 3BCUA 4GYKA 5MN5A 4K28A 1PI3A 1RJ9A 3EZ2A 4J3FA 4IWYA 3SLRA 3ORSA 4BO6A 4GSYA 4U3JB 2W98A 3Q9SA 1T0PA 2X8JA 5JAIA 3K15A 5C3MA 4AKIA 3PD0A 4BFVA 4AKHA 1T36B 1AKWA 3KAKA 4YUWA 3B53X 3U7FB 1KY5A 1C29B 1H5UA 3EWSA 3IIKA 4L16A 2UKDA 2WSBA 3OCJA 4KRXA 1DL5A 1MA3A 1W4CA 4J6FA 1Q2UA 1YRWA 4KIFA 4NCNA 1II8A 4UZFA 5IM5A 3GJ3A 1DAKA 1JLLB 5I5GA 1YDMA 3RT9A 2BGJA 4D9FA 4MKHA 1PR9A 1IRIA 1I5EA 1SVNA 4PTZA 1KKUA 4UAUA 3RV3A 1XP5A 3UOGA 4HBGA 5H9VA 2YHBA 4IVRA 1MX3A 1RYMA 2MSEB 1QV9A 1ZP6A 4YCDA 1ZLYA 4Z5XA 4IUBS 5JHGB 4Q3EA 4LF9B 1OAOA 5B1IA 2QRMA 1USUA 1FZTA 4OXKA 4AZ3A 2H11A 3PT9A 3W6NA 3HI4A 3NHMA 4MYTA 4XOIA 1PBNA 1RHKA 1B3BA 4K1LA 3KAJA 1P45A 3FPLA 2H63A 2Z5VA 5IJWA 1IMJA 2JLXA 1FS5A 1QRAA 3F7OA 2HIMA 3U3RA 2FFRA 4AUMA 5FNVB 5BV2P 3HXQA 1J5XA 5IEJA 3DAOA 3EUEA 2J41A 3FNRA 4RGVA 3SIWA 3VPDA 2C3PA 2X8AA 3BB3A 4W8OA 2P2GA 4YLGA 5LP6C 5C4IA 4GBMA 5JMOA 2XDYA 4CIDA 5LR6A 3G82C 1CZLA 1V3QE 3DVLA 1R6BX 5C5IA 1CKEA 3MA0A 1CUBA 3D1JA 3WIUA 1GGKA 2Q5OA 2PYZA 4FYXA 4KFSA 3PX3A 2BGWA 1H4SA 4NYMQ 4NENB 4FQ7A 3FCXA 3V8EA 2QBYB 1PR4A 3U40A 4BLSA 2VCHA 3PUIA 4Q3OA 3RS0A 3ZKWB 1ZESA 4IYRA 1U8TA 1OXMA 1R50A 3OC6A 4XCXA 2XF8A 4ZOEA 2ZI7A 4CLOB 1ZBDA 1CT9A 3EVTA 1UBGA 1Z0SA 3NBZC 4CEJA 2ZCUA 3QUBA 1ADCA 3ZXIA 1Q1QA 4TLMB 1RLOA 2PUWA 4F3KA 1YR1A 2V55B 5F76A 1AUVA 4O33A 4I1YA 3CQ9A 2G1JA 4NBUA 4BU0A 4PHTA 1JQBA 3WZ2A 1TZMA 3MAJA 1K97A 2JFOA 3QQ5A 4Q3NA 4I5GA 1MD9A 3RS7A 2IELA 1L6RA 3MTBA 2O7VA 3M4YA 3FFBA 3ZZUA 2C2GA 721PA 1I94B 1AC5A 4NTZA 5CIQA 5LMCA 4TYPA 1X92A 4MJLA 1LB1B 3UBMA 4DLAA 1SHJA 3CBGA 5KYNA 5F52A 3FHLA 4NU5A 1DO2A 1MOQA 5G4LA 1DBSA 4MVJP 3SDZA 1D0IA 3LHDA 4ZKDA 5B3JC 2LPMA 4WKPA 5DN9A 1TTQB 2FNAA 1LRJA 4DE5A 5I51A 1CUAA 1OAKA 4QLOA 1I2BA 4Y30A 3RSFA 2NZ8A 2Q50A 4DUPA 5D00A 4MUMA 5CT4A 1JBQA 3AYZB 4W1RA 4IHAA 3SU8A 2B8WA 4UBNA 5EESA 4EY6A 2OCBA 1M2HA 4ETWA 5JI3E 4QNRA 3VPCA 5B1SA 4RPLA 1DJNA 5GJVC 1OBOA 1JEDA 3CT6A 3DLTA 2QYOA 2ZJ6A 4RVUA 1AUPA 4NV3A 1RLIA 4MGEA 3ZE0B 2QRZA 3ED1A 4NEQA 1KZ7B 1UFKA 3OQBA 5F33A 1HOTA 2Q29A 1G0NA 1M54A 2AJBA 2QTTA 2HPVA 4GDMA 4XX0A 1GFWA 5JS7A 5L3VA 2I55A 3BL6A 1E1YA 2PX5A 3G17A 1TO2E 1RC8A 1OKKA 1HE3A 1RRCA 3DUFA 3OMWA 1AMOA 2V98A 4Y7CA 2YRWA 1Z18A 4ESEA 4DWVA 1H2WA 4G0WA 1ZA1A 4NJMB 2YZKA 1WCIB 3L8ZA 4RANA 1KARA 2FZKA 2IJGX 4G5HA 4RLQA 5AXBA 4B6SA 3RAEC 2P90A 4HDCA 3PX7A 1Y9EA 5EJEA 5JJKA 2FSPA 5KVVA 2FMUA 4DBLE 4E22A 2VAVA 2AQKA 2X22A 4QBKA 2ZUEA 2GERA 5CUQA 4NP6A 4ZVLA 3S1LA 2QBYA 1N2IA 2JJ1D 2GO1A 3AH8A 3JD1A 4RF4A 1AQJA 3NRCA 2CLIB 1GQSA 1XSEA 3MTEA 2IODA 2R5FA 2XT9A 3WL5A 2OZLB 4L4YA 2FH5B 1KH2A 1TYZA 1Y80A 3ZU2A 3DVRX 1W0JD 1SXJE 3VKGA 2ODAA 5BRNA 1B43A 2Q0QA 1ODKA 4F3TA 3LCCA 3HC7A 3VZDA 4B1FA 2ZJBA 1G8AA 1SD2A 4RH3A 1CZHA 4CIAA 1VE6A 2WINI 3UC5A 4HDQB 3VM6A 3RHTA 4M1KA 1SXHA 2IZ6A 3A36A 3BXXA 1V7CA 5CFMA 3NOVA 3TQSA 3H9CA 3FZQA 3CYFA 1RTKA 1WW8A 3O94A 2WBLC 2BRUA 1DCFA 2DTEA 1FVHA 3KV1A 5K0BA 2XNDA 2D3TA 1OWMA 5DF1A 5DI9A 1H66A 4TQ9A 1MTOA 1NBIA 3BERA 2I7TA 4KSBA 3WQRA 4CUKA 1UXIA 2J9XB 2LDBA 1HE2A 5JROA 1K6IA 2HNKA 4X3CA 4YJHB 1N1GA 2YINC 1QGDA 2JJYA 4WNAB 5EJGA 4UOQA 4GR4A 2FP4B 4Z1MA 3PGXA 1M8JA 2X0NA 2W2QA 3HP7A 4UQOA 4YJ3B 4RJKA 1XZCA 1WETA 1UBOS 2XB6A 5ICEA 3VAZA 4BLOA 4M76B 3HZZA 1I7SB 3N6RA 1OWPA 1XCMA 2QTBA 3U17A 5F9MA 3V42A 4E3ZA 4KE9A 4FR0A 1RJGA 2HSWA 4U2GA 4IICA 3VAAA 3T9CA 2FPRA 4OSEA 4ZO4A 3A3KA 1O9HA 4AG3A 4X1KA 4B31A 3FKJA 1I8TA 3A58B 5EIOA 1RPJA 3E9RA 3U16A 2IYYA 5K09A 4PX9A 2BFPA 4QGSA 4C01A 1TK3A 3OQVA 1N0HA 1R37A 1X42A 3GXBA 1ILWA 1MXHA 5IPFA 1KFKB 1EUQA 4B2IA 3MQ4A 2Q45A 3WBBA 1FDWA 1JE0A 3ENQA 4HXFB 3I4FA 3QU7A 3WDLA 1JH9A 3GWGA 4UQPA 3EGDB 2A2ZA 1BWPA 1HKUA 1G5HA 5EZSA 5B5SA 3O8CA 1M2JA 3HB4X 4WCVA 2XTJA 1OF1A 3CNBA 3RB8A 1V41E 1JJ7A 2QR2A 3R75A 3BMNA 3C3DA 3RFTA 2IHJA 4X41A 5A9SB 2F90A 1ODLA 3BYZA 1IOLA 5FIUA 5M7EA 2FW8A 2HK7A 3M2PA 1J5EB 2JH3A 1REQA 2Y0EA 4M53A 3WGUA 3MJCA 3A6KA 3ASZA 4Q7EA 2PJDA 2ZI5A 2DR3A 2G6TA 3BMOB 3HFJA 4MW6A 4NZ9A 4CM5A 1WCV1 1QIGA 5BORA 1X1AA 2FPGB 2QZJA 2XYPA 1OLSB 3ND9A 5A7FA 3C87A 4PSUA 5KQMA 2GILA 3V7UA 4P32A 2HDWA 3UJPA 1GRQA 4ZV7A 2PDAA 4CHGA 2PX8A 2QE6A 4E31A 3LUBA 1U3VA 5C4GB 2DFVA 2QX8A 3DE0X 1GQOA 2GGSA 3QEJA 4GVLA 1Q7BA 2PNJA 4UCXA 4W4TA 1SVWA 2PJRA 1COWD 4EY7A 1XDUA 2VHUA 4FHDA 4J7XA 2M6RA 1SD1A 3AESA 5GJCA 5BV1A 1LTKA 4X8HA 3BSWA 3AHIA 2J9ZB 4DKXA 1T6ZA 4K6GA 3UXHA 3GFSA 5KSZA 1L4NA 5EAIA 2BZ0A 4MH0R 3SC2A 3WGNA 5B3LA 4TQAA 2BFDA 1GSHA 1VMAA 1BX1A 1OC4A 2HO4A 3D4OA 1EFVB 2ZRNA 5EZYA 4N47A 4ZYWA 3N58A 5KVQA 3R77A 1NOIA 3LRPA 4WKGA 2B0JA 3FYUB 1P6UA 5ARCA 5FXMA 2XMPA 1BQEA 4DV7B 3I2JA 1QBKC 3LY9A 4Z0HO 3EVAA 1TM3E 1NF2A 2PWPA 3P71T 4CKYA 1NZFA 3E03A 3GJ8A 1KI6A 4L7QA 3RS2A 5KTMA 4QUBA 1KXJA 5LC1A 3MOSA 4MAFA 2GAOA 2UVPA 1P4JA 2IYLD 3X44A 2YFKA 3Q8MA 4ZICA 4UW9A 4M83A 3AF6A 1VCHA 3UNXA 2C00A 2NU6B 1HDXA 3F4KA 3IP8A 1QOQB 5DX8A 3RYFA 4EW6A 2R87A 3LTEA 1YAJA 2AUMA 3OM8A 4KFRA 5IVHA 4RCYA 4WCFC 1K1EA 1QP0A 2F8MA 5JAOA 1UBSB 2YDYA 5EXDA 1AZTA 1V6AA 1JIXA 4G23A 3K6SA 4LQDA 2IXDA 2ZIVB 5ILGA 1A8IA 1VLQA 1J97A 2W0MA 1E3JA 3O4RA 1M8PA 2A0YA 3PTLA 1WTCA 1WJGA 3DVQX 3H11A 3EDYA 5FL7A 3MOGA 4BO7A 4RTPA 2WB2A 1E2LA 1FS4A 4NR0A 5FUYA 4FT2A 1MZVA 1E20A 1T26A 5FR2A 1EFTA 3VDQA 3LHSA 4AMUA 5CVEA 3MT7A 2AK2A 2REXB 4AYWA 5TVKA 1GA1A 1QNFA 2PSSA 3R09A 4X62B 4TLCA 2AJCA 4AY3A 2Z6UA 1F60A 5CB4A 4YCAA 4DL9A 2DUUA 3SVLA 3RYIA 2FPIA 2J85A 3LVQE 1SOMA 5DPMA 5GVSA 1T5TA 1H4TA 2C77A 4NU0A 5FI3A 2HEGA 5MDHA 3AVXA 2CB0A 2AOTB 1E9FA 3A1SA 3GFPA 8ADHA 5BSGA 1DZIA 1OLSA 4QDJA 3RHZA 3R9WA 5F78A 4EJ2A 4LKRA 3RC9A 1SHLA 1VCOA 3R1IA 3DAPA 2WLSA 1IDN1 1KY3A 2V7BA 4OGWA 3K9GA 4D4HA 2JFVA 4ZQGA 4EUFA 4EG7A 1OBVA 3DBIA 1TOAA 2V6IA 5IVPA 1YKFA 3L05A 4QJ3A 3FNHA 4IJVA 1TK2A 2CHUA 1DG1G 3IV7A 1Y63A 4GBED 4PNHA 5JCOA 2FWIA 2G8LA 3VR4A 4RVGA 4N9WA 1GT6A 2KLHA 3REFA 1H0SA 1TT7A 2FTKE 4X92A 3UFXA 1EVLA 4TLEA 3RS5A 3K2IA 4PYNA 2ZBVA 1KPHA 3COWA 4MZDA 1P61B 3MWLA 5T4FA 5TQJA 4BP9A 1F8FA 2I29A 2VYNA 4X1YA 3QOXA 3S99A 1SELA 5KAMA 3IIEA 3MRTA 1G21E 1K6EA 4XLZA 3PR1A 4REMA 2OHHA 3G2KA 4BGUA 1AGRA 1MRSA 3SJAA 3SEZA 2VRCD 1R5OA 4OGKA 3B1FA 3EXG2 1NI5A 1C0LA 4KRYA 1VKHA 5HIMA 3I83A 5JEEA 1ZC4A 3IBSA 5FI5A 4U7PB 1JU4A 4RCVA 5FOQA 5LOVF 4EUKA 3CW9A 3F8SA 3HB5X 4JSRA 5KYVA 3OPNA 1K0FA 3H5IA 1MX5A 3IKLA 1JR2A 1DC4A 1PD0A 2QVGA 2RHHA 3I1IA 4LXHA 2MSLA 3RRFA 5GOZA 1JU9A 1P3DA 1RIIA 2IHTA 5FA8A 1G6OA 5FQNA 2XCOA 1CS0B 3IUEA 1P0CA 2JLQA 3MELA 4KK4A 2IBMA 4NARA 5CVJA 3TRDA 4DLNA 4KIGA 4PX2A 1X7XA 4I0WB 5DCWA 1US8A 2QPTA 3HB9A 1W5EA 3I76A 4HB2A 4YB8A 3PDWA 5HYVA 2V3VA 4N3AA 1PZGA 4M7OA 3ILSA 4HZUB 2PZBA 1U0JA 3VPXA 1MW8X 1Y1TA 5G1PA 1MFZA 5TC4A 4ZHQF 2F9LA 3KPYA 3L1JA 5AK6A 3W90A 1FSFA 5IH3A 1W44A 4O29A 1OT3A 2IUFA 1HTTA 4DDMA 3BZBA 5JWOA 2HWYA 4AAYA 3CF0A 5JY1A 5KU7A 1V6CA 2IYEA 3S5UA 4FHFA 5F7XA 1WG8A 4KQJA 3SBDA 1CPYA 2NTNA 4KODA 3L7JA 2IEBA 5KOYA 3WLNA 2JIMA 4UCQA 4PC7A 1SZJG 2B4RO 2Q5IA 3RC2A 1QS0B 1E60A 1XCPA 2ODQA 4X7MA 4YAGA 2FU5C 3RRBA 3ETJA 3ANYB 1H4VB 4PGHA 3AKYA 1OX4B 2QLTA 1KMHA 5EP2A 3FMOB 2XYHA 2CDNA 2DRIA 3ESAA 4CDRA 1KGDA 3UQZA 1ZJ4A 4N39A 3QXCA 4HZGA 5ENZA 4YUYA 4F7DA 4JLVA 3ZGNA 3WZLA 3WBFA 2D5LA 1VJRA 3TW6A 4LYAA 4ARCA 1P2UA 4OI2A 1QQ6A 3D0QA 4LV5B 2WNHA 4RY8A 3H1GA 3Q9NA 5JZ9A 1CRPA 1ZCJA 1G2OA 2GN2A 1QYXA 4FU0A 3UA4A 1XZLA 4CM8B 4QODA 3ZD7A 2CLHB 3RODA 1ODJA 1CY6A 5BOSB 3OE4A 1KAQA 3D0KA 5FPQA 3N39C 3NGXA 5JT1A 4Q3LA 1OGJA 1JJAA 3JAWB 2QXYA 4WEQA 2GM9A 3O3MB 4YQYA 3DBRB 4E5DA 4G1BA 4XD2A 5EP3A 4HHEA 4IIGA 2NN3C 3VPHA 2JIZD 1OAAA 3BH6A 3FHJA 5D51S 2RJNA 3V4FA 3COSA 2AR0A 1SXJC 4IP0A 3PYLA 1QGUB 2X76A 3AK4A 1CZRA 3FYUC 1M33A 1PGPA 4X90A 1Q95A 1Z5VA 4JFRA 1ZISA 2X0EA 4YUAA 5DLQC 2WHRA 1PVDA 1IJEA 2DWOA 3AINA 3O9MA 3ONWA 1XBTA 1DJLA 1WA5A 3GGGA 4MKIA 5AMXA 1O4VA 2NYUA 4AKSA 3DYVA 2QJWA 3WLFA 1BN6A 2H7XA 5G3ZA 5LN1A 5EJ5A 1M6WA 1UBLS 2R68A 3DOCA 4CLRB 3LQ4A 4BMYA 4EMBA 1E3SA 4CCYB 3E9CA 1UQUA 1WBJB 1X86B 3KZMA 2V6BA 1MO4A 4FDLA 1ENZA 2IX9A 5GJWC 3B38A 3UMCA 3HN2A 2NX2A 1FMJA 4YNBA 4J1QA 4NZOA 5HM6A 2W4MA 2OORC 3PQ7A 3E7XA 2EFHB 4V2IA 1BGXT 1EDEA 1F14A 2X3UA 4G0MA 1T5BA 4ZDKA 3ELBA 2BFCB 3SEFA 4A15A 1NJFA 3BCRA 4IGEA 3C8HA 1E5QA 2HJHA 1IUPA 3IR5A 3F7TA 2GRUA 2Q2OA 5KAPA 4S1WA 3HJBA 2BOVA 3N0WA 5DM1A 5JVDA 1D7OA 2ATXA 3W5DA 5L6LB 4IIHA 3IUJA 1ZJ5A 1E7SA 2BI7A 4X94A 3ZG6A 2FZWA 3ST7A 1LSOA 2J7PA 2ZROA 3A4VA 4MV3A 4PRLA 3TQTA 1TAGA 3LUAA 2NV2B 4JEIA 4ZQCB 3ROMA 3G8DA 5T8KC 3GDWA 3FBWA 1A98A 5EZ6B 1LJ8A 5ICMA 1H0RA 2E4UA 2O2DA 5IW8A 1ZOSA 4S35A 2AOVA 2VJCA 3C7AA 4NCIA 3ZY4A 2QD5A 1DG3A 3GN2A 3JXEA 4X85A 1CF2O 1A27A 1ZINA 1XAGA 3P9IA 3WK5A 2P2ZA 1HKHA 1I3OA 4YQZA 2GWHA 3O4IA 2J6CA 2O14A 2ZJ4A 1IWPB 1I1OA 1R4NA 3OZEA 4RM2A 2J0UB 1Q91A 5GAJA 1IB6A 3CF4A 3BEOA 2O23A 5IUJC 1T4MA 4C0BA 1RLTA 4J7UA 1S01A 3BGSA 4JC8A 1U98A 3LT4A 3Q3GE 2G3YA 3V4LA 3FTNA 4JU8A 3IUSA 4KYVA 4R41A 4C21A 4MV9A 2W2KB 3C4QA 4PQEA 2GCOB 5CNJA 3UH0A 4B8WA 2QX9A 1TM5E 1PKXA 1IAQA 2ZIXB 2G4LA 3H65A 3WGKA 3R7WA 3G3EA 1SBHA 4OA5A 3CKMA 1C7IA 3H8VA 3KC2A 2O3QA 2PO7A 1HI9A 2EWMA 3JQRA 2Q1WA 4POOA 1HNNA 1M6HA 2G76A 3CUKA 4FDUA 4RVFA 1KY4A 3DOFA 1XA0A 3F6YA 4MKXA 5I4CA 1Y7HA 4KXNA 3I1FA 3WK7A 1RIFA 4ZYXA 3UWSA 1Y5IA 3WGMA 4QJ4A 3JRNA 4K81B 1QO0D 4CKXA 4YMVA 4MRAA 1LJUA 2VF7A 3OURA 1BS9A 1CZOA 4P38A 3GUCA 4MO2A 3Q2KA 4Y18A 1KP2A 2YV3A 3V5NA 1JTVA 2H3HA 3MK31 2ONZA 1QHEA 2PRKA 3BQNB 3IKVA 3KSBC 4MS1B 4CEHB 1AQUA 1JLLA 3A10A 5TMDA 4XVUA 4EJMA 3VTFA 1RJEA 1HM5A 3QF7A 4P80A 3VU9B 1UP4A 1BKSB 4BE9A 5ICCA 2UZAA 2Q3LA 3RTBA 1YFKA 3HACA 1NC1A 1QYRA 3ISVA 3MGBA 2WIAA 3P9KA 4JVSB 2O2XA 2OAEA 2VZ8A 1ZR2A 3ZNNA 2OK8A 2HMSA 4X91A 4BKMA 1GNVA 3VYTB 1IHPA 1JDSA 2DJ5A 2P2CA 1KSJA 1T36A 5AD1A 1I30A 4BNLA 2PRJA 1EGQA 2C2XA 4YPVA 1DTWA 4WCDA 5BWMA 1YB7A 3OPYI 2EX4A 4MQ5A 4Q15A 5AHOA 1S2NA 3EZ7A 3S40A 4KKXB 5BQOA 5FV7A 2ZE8A 3JZIA 5CA0A 1XGKA 1E77A 1KYWA 4BEBA 1U0NA 2HA2A 4IXMA 1VIVA 2HLDD 3SC6A 4QYWA 2XD9A 3DQZA 5EYPA 2W6OA 5DEOA 2H1HA 3OETA 1JHOA 3WGLA 4UTPA 4ETNA 1N32B 2HX1A 4ZYVA 4XSVA 5LQMA 1FLDA 1JDNA 4PRKA 2XMRA 5REQA 1EFHA 1CY0A 5EJMA 2R0QC 1LVUA 4LCEA 2GMWA 2QI9C 1H2XA 1HDCA 3ETLA 4PPFA 5B3KA 4DLWA 3HZRA 4ZQHA 4B82A 2J9RA 3JTEA 3FTPA 4U0JA 4UU8A 1TF7A 1AMUA 3WYNA 1Z15A 1SMKA 2RGCA 3I01A 4M0MA 4L78A 2IU0A 1X9GA 2X9VA 2BFCA 4QFCA 4UVDA 1GM5A 1O9GA 5C8XA 2A0FA 2O8EA 5EFOA 1ZD8A 3V1LA 4IW3B 2CHVA 4RSHA 4IOKA 5AKJA 3ROGA 3VUFA 3ZCSA 4LVOA 1L5GB 1JEYB 2XA2A 5HJEA 1XE3A 1PW5A 2GTPA 4L9WA 2J46A 3VVCA 1ZWKA 2IZZA 3FFAA 1PJTA 2WWGA 4B6OA 2VN8A 3QWIA 2VZEA 2BF7A 3E35A 2G77B 1PLJA 5BSVA 5BT8A 3K0AB 4JFAA 1V8PA 5MF6A 2GNPA 4A5OA 4BJ3A 4B4DA 2GAJA 3LKVA 2P68A 3IVCA 2H2WA 3B5EA 4JP8A 4A6DA 2GPYA 3LE8A 3N5KA 4DCPA 2NPIA 4DY6A 4JI4B 3MMZA 1LLFA 3U3KA 4EM6A 2HZ7A 3BMXA 2W71A 1VBKA 3HM9A 1D4FA 3NOXA 1PJZA 3ZE8A 3LUDA 1M72A 2R6R1 3CZ9A 3G0IA 1S4MA 4JB8A 4LF4B 3LT0A 4MRSA 4MW2A 3TIIA 3I39X 4AY2A 3OM1A 3D6HA 4G0NA 4FKZA 2VF2A 3PIRA 3L46A 3T7SA 3ZHCA 3ZY5A 4QICA 4CR7A 4DN6A 1ATZA 1N5RA 4HTFA 4L5BA 3EQ9A 4WJLA 3P9RA 1MJGA 5JZVA 1YULA 1V8BA 2PV0A 2PUTA 2X2PA 3I28A 4HFMA 5G0SA 4WLEA 2UYCA 3OT1B 4ID3A 4AJEA 2IFTA 3KEMA 3IALA 4YT5A 5E9QA 4Y2HA 2D5BA 1C1XA 3VO1A 4WK4B 2VCEA 3GVIA 1BDMA 3IQEA 3ZGOA 4II7A 2R6DA 1N9KA 1PP4A 3FDZB 4L3OA 4GX2A 5FPTA 1E63A 4BJHB 1AG9A 1Z39A 2BGLA 2D1F