3P1JA

Crystal structure of human gtpase imap family member 2 in the nucleotide-free state
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
190
Chain Sequence
SELRIILVGKTGTGKSAAGNSILRKQAFTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKGSLMDYMHDSDNKALSKLVAACGGRICAFNNGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase IMAP family member 2
publication title Crystal structure of human GTPase IMAP family member 2 in the nucleotide-free state
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 190
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3p1jA00
4BLTA 2C98A 1M74A 3SEAA 1J2JA 1N2CE 3JZAA 1CP2A 3GMTA 1YRAA 4C3ZA 4V03A 4LHZA 4OHWA 5CIWA 2A5GA 3QPVA 2BC9A 2FV8A 4PO9A 1XZQA 2VYFA 4ZCMA 2FFQA 2G77B 3W8RA 4PC6A 5DLQC 2FSIA 4PC2A 3P27A 3WBJA 1E9EA 3C5HA 2OAP1 1F2TA 3ZIAD 4KITB 3L8YA 3D7MA 3MD0A 4HAZA 1L2TA 2QG6A 5L3SA 1GKYA 1R5OA 2H17A 3VQTA 1FPMA 2GTPA 4PC7A 2XXAB 1W2GA 4KJZA 1LS6A 1NIPA 3CR7A 3C15C 3HWSA 4IDOA 1Z2AA 1FUUA 2A2ZA 4I1UA 2GA8A 2VP0A 1QG4A 1JEEA 2FA9A 3GJ5A 4PPGA 5TY0A 4E09A 4LBYA 4D25A 1DG1G 1E99A 2FFBA 4POAA 2WWIA 3FYHA 3AP1A 4II7A 4PPNA 1KJZA 4DDTA 3OFNA 2NIPA 5GVRA 1BOFA 3PUXA 2AXPA 5H8WA 1E0AA 4OQFA 5CDFA 2JJ2D 2WIBA 4PO8A 2IYXA 4JZKA 2KWIA 3KXKA 5EP3A 2IWRA 2JJ2A 1YR6A 2UZ3A 3ASYA 2RGGA 4US0R 4CVNA 2V55B 3TVDA 1X1SA 2YOFA 2YJTD 4B3CA 2GESA 3OZXA 4JLNA 4D4LA 1OB2A 2FFHA 1P62B 1J99A 1E94E 2NTYC 4IVRA 1NG9A 3SYLA 3IO5A 3CH5A 1JXOA 5KNBA 4XWOA 4DSUA 2A5JA 1NP6A 3U4QA 1S1CA 2VRWA 1T0HB 4A4DA 4QL3A 2QBYB 3F3YA 1XRJA 3FHCB 2IUTA 3MWJA 2H1LA 2OSBA 5CJPA 3RRMA 4TLDA 1AS3A 4DSOA 5HTKA 1RIFA 3RHFA 1U99A 5BN3A 5KSPA 4N0DA 2EWVA 5LPNA 4KXFB 4OI2A 3I8SA 1GP2A 4FINA 3I8XA 5BN5A 1TAGA 4RFSA 1RRPA 3PEWA 2F6RA 1Z22A 1B23P 4PC3A 2X1VA 3OE7A 1R7RA 3VR6A 3ZDQA 5AUPB 3RSLA 3KB2A 1W48A 1UKVY 2ZYUX 2C9YA 5LD2C 2YOGA 3IDQA 1IY0A 2OFOA 1AJEA 2Q9BA 2VP4A 5FFMA 1AS2A 4IEEA 4BEJA 4HAYA 5FR2A 2H8KA 3RS7A 4ZDJA 2BWJA 2GJ9A 3AKYA 5JMTA 1UDWA 3TH5A 2LKCA 1JEDA 1T6NA 3LAWA 2Q0HA 3Q72A 5JI2E 1A2BA 2J7PD 2D06A 1YZQA 2IYTA 1RKBA 3U3JA 3K8YA 2WSSD 1GRNA 1T4GA 3B5JA 2ZVQX 1JR3D 4GOKA 1IBRA 2BCGY 3GJ7A 2GXUA 1T91A 4R98A 4XH9B 2FPKA 4F4JA 2DFKB 3AVTA 1SHZA 2GWHA 1WBBA 2CXXA 2WSSA 3KTAA 4KVGA 4Q9JA 1F48A 1RE0A 1G5PA 4U02A 2IS2A 4IVQA 5JWOA 4S2EA 3BC1A 4Q18A 1E2KA 4DSTA 2CE7A 4MA4A 4ZKDA 1CR1A 1Z6XA 4BLPA 1TL7C 4FCTA 3MJRA 3ZS9A 3TSWA 1YE8A 3MCAA 3LW7A 1XPOA 1ZNXA 1GAJA 2XITA 2Z4RA 4AKHA 2EFCB 1TUEA 3CIOA 2BEKA 1RZ3A 3BB3A 3D3QA 3KXIA 5A0FA 3P20A 1P2SA 4Q7JB 1VG1A 3L0IB 1QHHB 3BB1A 3P1JA 4V0ME 5J40A 4ZI3A 1OH8A 4CZ2A 2PZGA 2RHMA 1WMSA 2PX0A 4QHTA 1I4TD 1W36D 2IYYA 2GEDA 1HEIA 2XTMA 1SVWA 4L8GA 1WQ1R 3KXLA 5EQTA 2D2EA 4IDQA 3A4NA 4FCVA 4MYHA 2GJ8A 1R6BX 4NYJR 1XTKA 3SZRA 1X86B 2OCBA 3N5CA 1NN5A 1ONBA 1U2RA 2G3YA 4UNSA 1NVXQ 2V7QD 2A7QA 3PFIA 1IN8A 4TYWA 3CWQA 2F1HA 2YINC 4LYFA 5TDHA 3U3OA 2JLZA 3K53A 2NPFA 2HT1A 2OAQ1 2V7QA 2DBYA 1BS1A 4X8LA 5E3HA 1W4BA 4DCSA 4V0NA 2JLSA 3RS0A 5AJZA 2JAQA 3RLFA 5TVKA 2AK2A 4G5RA 4MKIA 1ZP6A 4JLDA 1H8ED 1KI1A 2NQ2C 4B6FA 1GRQA 2BMEA 3SFZA 4B2LA 3M0EA 3PVSA 5JJLA 4M1OA 1QHSA 1H8EA 3JZMA 5FUYA 5C4MA 3G0HA 3FKSD 1KI4A 1L4YA 3TNFA 4IDPA 1KKMA 1XPUA 2C96A 3K1JA 3AF0A 2RB4A 5KHOC 3KQKA 4BFWA 1WBDA 3FKSA 3CNOA 3X1ZA 4ZDIA 4JSYA 4JVMA 1KSJA 2QEQA 1KY3A 4O2RA 3BAFA 2XTNA 4KV9A 4ARZA 3Q3JB 4KAXA 4MRPA 3NDPA 2QPAA 5H68A 2O8EB 3QJYA 1UADA 3HU2A 3PUZA 4O0MA 2EFGA 3TAHA 3WMGA 3BH0A 2XJ4A 2PEYA 1G3UA 1VCIA 2ATXA 1KNQA 3Q5DA 3MAAC 1NBMA 3CONA 1F6BA 1E79D 1ZMXA 2GRJA 2HEIA 1CR2A 1PLLA 2ZJ2A 1XMSA 5CB6A 3A4MA 4C0QC 3TGPA 3SR0A 3H1TA 5KNCA 4HZIA 1E79A 1QHIA 3KKQA 4AKEA 3IGFA 3M4YA 5FBRB 1N5KA 3K09A 3PUVA 3IEVA 1KI8A 2DHRA 2KSQA 4G01B 1P5ZB 4IRUB 3PG5A 1CULC 2ZSEA 5GJWC 3RNLA 3AF4A 3M6AA 4QBHA 1NNEA 1U8YA 3Q7PA 4LJ8A 2X2FA 1D5CA 1H8HD 4QHSA 2J46A 4XVQA 3EXAA 2ANCA 2ZUDA 4PSVA 2HXYA 4AC9A 3B85A 3NEJA 1H8HA 1YU9A 3KJGA 4HB4A 3C41J 4B2IA 4UNRA 4IKEA 2QMHA 2ZI9A 4EPYA 4Q4AB 2HLDA 4JSTA 2ORIA 3WP1B 3B1VA 1RJ9A 2QA5A 1JQJC 2QU8A 3IIJA 3RAPR 1RYHA 4EPVA 4M1KA 4DB4A 1VG9B 4B33A 4DDWA 1D8TA 1ZVQA 5P21A 1UM8A 3TIFA 4TMKA 3MMPA 1OIVA 3RWOA 3N70A 2OCPA 4U00A 2LCFA 1XMJA 4Q9KA 3VFDA 3RS2A 1E2GA 1JJ7A 3K0CC 3RVBA 5C1BA 1MR3F 2EYUA 2NPIA 4K8OA 1XEXB 5FOTA 4QHYA 4QJ5A 3K9GA 3NBYC 1GDDA 4BLRA 1SHKA 4JJKA 4BLOA 1NMXA 1PUJA 3A1WA 1N6KA 4B3FX 1YZUA 1G6HA 3ADKA 2GBLC 3U2QA 2OBMA 1M6NA 5AWFC 1NVWQ 3U6BA 2ZI4A 1OFUX 1NKTA 3BOSA 3FFBA 1AA9A 1Z0IA 3A1VA 2I4IA 2FNAA 2ZAMA 3BD9A 4L15A 4TL7A 4CF7A 1TEXA 3U44B 1LB1B 3GJ3A 3B13B 1XTSA 4AG5A 4XWKA 4OI4A 5FTNA 5KSZA 3U3RA 3RRNA 1YR8A 2ZS9A 4JVLA 2WWYA 2QMEA 5HE9A 3PENA 2QTHA 1VPLA 4FXPA 421PA 4D82A 1KK2A 2D3WA 1KDPA 4YLGA 2GK6A 4TT3D 5FTJA 1GL9B 3PITA 4Q4LA 4TYPA 5HCIA 3QNUA 2BV3A 5JEEA 3W3ZB 4GL2A 1EFRD 4TT3A 4HATA 1AS0A 1TF5A 4HAVA 2XOKA 4FN5A 2ZITA 5GVSA 2CNWA 3GJ6A 4LJ9A 2JLXA 1EFRA 3K0SA 2P65A 1J7KA 621PA 1F3OA 3EARA 2CL0X 1PUIA 4ZKEA 2W0MA 4M1SA 5D3MA 1JECA 5FI1B 4D80A 2JDIA 5CLQA 2J45A 4K81B 4Q47A 4P31A 5DYGA 3LNCA 5FOUA 3LW8A 3SFVA 2ZI3A 4L4UA 2R6DA 1G17A 4K46A 2VHQA 2C8VA 1KI6B 1TPZA 1U0HC 2BBSA 2FH5B 1Z8FA 2B92A 3T1QA 6Q21A 5F3WB 4DSNA 2QPOA 4RJLA 3SYNA 1JI0A 5KO2A 1UBGA 2ZANA 4NZYA 3TW8B 1DO0A 3CKLA 1U0JA 1W7AA 2C95A 5FTMA 4F38A 3SJZA 2ZRPA 2PJRA 3RC8A 5BW8A 3RDPA 3QXXA 3LWNA 2QAJA 1GIAA 2RMKA 3X1XA 3SN6A 2XZPA 3CR8A 3THYA 1RRCA 1NIJA 4TQAA 2O8BB 5GJBA 4LY6A 1N6LA 1GUAA 5DI3A 1AGRA 1WE2A 4UNNA 3HR7A 3KJIA 2QAGA 4ASUD 4P33A 4C2TA 1F2TB 5AUOB 4CRWB 4XVRA 1NY5A 1KIMA 3A37A 5EE0A 4ASUA 2AD1A 2OM2A 5L3SB 1W46A 3THWA 3R9WA 3T06B 2IF0A 4BRUA 4EFNA 2FPLA 3AVPA 2ZJYA 1KSGA 3UG7A 5KPJA 2QPTA 5J4VA 3QF4A 5JSZA 4HLCA 4NCNA 4LHYA 1KI9A 2VHCA 1AKEA 1XXHE 1MO3A 1KYIA 3K0FB 5FL3A 3PCRB 1HE8B 2CEAA 1V43A 2J41A 2WVJA 4NL4H 2XZLA 1DS6A 1S2MA 1WDTA 1G1MA 1HT1E 3BB4A 2CHQA 4OL0A 5JLJA 1G64A 3CPEA 4LV5B 1P60A 4DLVA 1IXSB 1RVDA 2Z6VA 1KDTA 2NZJA 1QF9A 3N2EA 4IFEA 4B3GA 4PR0A 1OFHA 3UKDA 2D62A 2YC4C 3DKPA 3NWJA 2VQSA 2R6AA 2RKOA 2I3BA 1YVDA 4Q48A 4V0OA 3PQCA 3SHFA 3HP1A 2JJ8A 1J8YF 4R2HA 3T5DA 4ZDKA 2ZUBA 1QBKC 1YZNA 2WWWA 4GDFA 5J4KA 4OQLA 5AJWA 4D26A 1E9SA 3B1ZA 1S8FA 3IBGA 2ZR7A 4UKDA 2XSZA 4AURA 4QXAA 3LD9A 2W2VA 1XX6A 2VIIA 4Q1DA 2HUPA 2GDJA 3IIMA 2EFHB 2H57A 3U3MA 4A36A 2RGDA 5FOWA 4B71A 4LHVA 3QPWA 4EDHA 3FHTA 1U98A 3EIHA 2JIZD 3U4QB 3G82C 3BH6A 1DTSA 1W4AA 1ETUA 1XJCA 3Q7QA 4W5JA 5EE3A 3BXZA 3SC3A 3VU9A 1QHNA 3AP3A 4HDOB 1G7SA 4JMPA 4AG6A 2QSYA 2O8CA 3HDTA 5FPTA 1XCGB 2A5FA 2CCGA 2PL3A 3BFVA 1G9XA 2C2HA 4M9ZA 2J0SA 1WXQA 3W34A 4XTCS 4NBSA 4FMCF 2GXSA 1CRQA 4W7SA 1OLOA 1UJ2A 3QEJA 4G1UC 5FBLB 2UVQA 4C0KA 3EZFA 3KQNA 5DSZA 1R4AA 1CJMA 4RFSB 4Q66C 5BXQC 5B2ZA 2YHSA 1D2MA 1I4DD 4DLRA 3CWZA 4M1MA 3H86A 4EPTA 3GEEA 2WMOB 2V8OA 3P4YA 4HLDA 4LJ5A 2RGBA 3IKJA 5KDOA 3BBPA 4ESVA 1XF9A 4PQYA 4GT1A 3ZD7A 3TLXA 2ZU0C 2GVZC 4ZIRA 1J70A 2VSXA 1D6JA 2MSDB 2ZTSA 1ZM3A 4PAMA 2BDTA 1JALA 1EFHA 4RD4A 3LVRE 1P9WA 4ACAA 1FMLA 1XJ0A 1C1YA 4PHFA 4ILEA 2D4HA 3PIRA 4Y0AA 2ZRGA 1ELOA 1T8UA 2AL7A 1DADA 2C04A 4A6PA 3AVVA 4Q01A 3R8CA 1UBEA 4LPKA 3TSOA 2JLQA 4A92A 2QSZA 4A82A 2HCBA 1DELA 1QHYA 5L3QA 4CT4B 4MKFA 4PPQA 4OK5A 3QG5A 4B2PA 5FUWA 4PHTA 5F2EA 3O8DA 1EGAA 2G1JA 4D6PA 1G7CA 1M8PA 3NBZC 2B21A 3SJCA 5EE5B 3DZ8A 1OYYA 5FPHA 5KDDA 4JLMA 2XX3A 4Q4HB 5CDFE 1AK2A 4X8HA 3KTAB 2W6JA 2X19A 1JPJA 2IYWA 1HTWA 1X3SA 1U90A 5FPKA 3OAAD 1E9RA 2N42A 1ESMA 3CX6A 4EPRA 1ZM9A 2RGNA 5E7JA 5JCPA 2WWFA 4BFXA 3CBQA 2P6NA 3IILA 3TMKA 1FZQA 4LYAA 4AD8A 3DKVA 2SHKA 3FPAA 4JLJA 5J5CA 2NO1A 5DI9A 2ZSDA 1YJ5A 1WB9A 1G8GA 2OE2A 4H1VA 1N3BA 5FR1A 5M04A 1KY2A 1EK0A 2ZSAA 2WWHA 5UKDA 1CIPA 2ZEJA 1G291 3KX2A 4B3BA 2QN6A 1XTJA 1QG2A 1Z6GA 3SBEA 1O3YA 1KAGA 2FEMA 4Q02A 4TMWA 2OBLA 2XNSA 3QXJA 3N2IA 5G3YA 4MUAA 2ZRKA 3NEYA 3WHKA 4FWIB 2G6BA 3LVQE 3QKUA 1MABB 1KO8A 2WJHA 4JT2A 4TMZA 3HU3A 1UKEA 4GP6A 2GJKA 2P6RA 1E0SA 1K5DA 3RSOA 5EZ5A 4AYTA 3P32A 1RRFA 3ZIAA 4FD2A 3UIEA 1GITA 5EXXA 2OXCA 3AVXA 3QE0A 3SBDA 2BHRA 1VIYA 2IA5A 1KSFX 4GFDA 4HDQB 2J9RA 2BMFA 2FSHA 3LX8A 4XSGA 3B60A 4RD6A 3TSZA 2RGCA 3LH5A 5IT5A 3UMSA 3FKQA 1IJEA 1ZYUA 1S0UA 3IPXA 2P67A 4B47A 3MGCA 1MKYA 3I5XA 2J3EA 2R6GA 3AB3A 1E69A 2VF7A 3C8UA 3KKNA 3QVUA 4M4SA 5EE1A 1FNMA 1T5LA 1YKSA 3GLFA 4IJMA 1U8ZA 2G0TA 1CR0A 1T3HA 4P4TA 5JRZA 1CR4A 3RS5A 3ICEA 2D7CA 1Z08A 1IN6A 2ZRAA 3F5FA 1FOEB 3OIWA 2DWOA 1IONA 4PZZA 3VR5A 3L8ZA 4JVNA 4ARZB 1E32A 2BMDA 5EP4A 3DDCA 2RHDA 2VSFA 3W5IA 3WMEA 4EJSA 3EZ7A 3FHOA 4TLCA 3O8CA 1A4RA 4CEHB 1A1VA 4QM6A 3U6KA 2ZETA 4QGAA 4ZPXA 4XOIA 1E0KA 1LV7A 2CL6X 4HZUA 1L7VC 4J0QA 1Z63A 1WRBA 4M9QA 3QXCA 4FMDF 2VH5R 3IEUA 3QF7A 4WW0A 1FP7A 3VHLB 3TAUA 4URVR 4DLTA 3ICQB 1N6NA 4I1VA 3SJAA 3EPJA 5JHHB 1R5BA 4Q1EA 4PC1A 1X8JA 2ZUCA 1KO5A 3M1IA 4H1UA 4C30A 4AYWA 2GEVA 2IYVA 2FEOA 2AXNA 1A7JA 2OG2A 3U61B 3VX4A 2QROA 2GILA 2QM8A 2VHJA 5E7MA 5TXGA 3RRZA 2ZI6A 3ZVNA 5JCZA 1CJVC 821PA 2LKDA 4A9AA 1EXMA 2REXB 3DMDA 1VCOA 1SKYB 1C4OA 3AP2A 2PLRA 4LJ7A 4B75A 4JBXA 2GF0A 3OIUA 1SVIA 5G40A 3UK6A 4IXMA 3T1OA 1LS1A 1XD2A 3I73A 3TQFA 1E2QA 4N0EA 5ANRB 1Y63A 5HKKD 2IS1A 2WMNB 1ZM4A 3O8RA 4C0AC 1UBCA 3X1YA 4PSAA 3GFTA 4DT1A 2YNMA 4UNQA 1VMAA 4U7DA 5HKKA 1XCPA 4NCHA 3B7GA 4GSYA 3W8NA 5FTLA 1CJKC 4M9XA 3X2SA 3ZZUA 1WCV1 4HYYA 3BWDD 1KZGB 1N6RA 1Q1ZA 3GCGA 4QJ3A 3MUFA 3U7FB 4B44A 4D4KA 4A6XA 4L5BA 1Q1BA 2NG1A 3C7KA 3VMFA 3W6OA 3A1UA 2F7SA 1EG7A 5JS7A 2OO7A 2PZFA 1GNRA 2KBFA 2PCJA 5GJVC 1Q1EA 3K0AA 2IBMA 3A58B 1N25A 1MRSA 5DHAA 2BBTA 2AWNA 2PX3A 1JAHA 2BEJA 3FFAA 1L4UA 1S4QA 1J8MF 4B73A 4S35A 1KNXA 2EYQA 4BFUA 2J7PA 3LLUA 2EFEB 3P26A 3QKRA 3W6PA 1EWRA 3GPLA 1JR3A 4HUTA 1U9IC 3FMPB 3LBHA 4BWYA 5CK4A 1LTQA 2Y8EA 4V0LA 2G83A 4QJ4A 3IQXA 1G21E 4N3NA 1KKLA 4DXAA 2MSEB 3CB4A 1W44A 4DUGD 4UJ3A 3T61A 1FQKA 4L9SA 1GKIA 4TN1A 3ZQ6A 4YDHB 4AKGA 1GWNA 1VHLA 3LA6A 3W3AA 1JBKA 4RD1A 2W58A 3K9HA 1NBME 1P9NA 3KUCA 4FCWA 4R9UC 2PCLA 4TTPA 4DUGA 4Z54A 3VKHA 1E2NA 2DWQA 3NHAA 2P5TB 1LF5A 1IXZA 3DHWC 3NTUA 3IHWA 1Q20A 1UEIA 2O0JA 4E07A 5IHPA 4NPHA 2N1BA 3UG6A 1Z0KA 1TEVA 2NO6A 4OQXA 1TQ4A 2MMCA 1XFAA 2FF7A 4PXAA 5HR5A 2GXAA 3PUYA 1LW7A 2E1RA 3CZPA 1ODFA 2QZ4A 2ZE7A 4Z51A 2RAPA 4E22A 4P4SA 1SKYE 5D3MB 1CEEA 1HE1C 2R44A 1QZXA 2IHBA 4IVPA 5B57C 4RVCA 4MGKR 5AJVB 3WYFA 5FI0B 1MOZA 2J87A 4NMMA 4EPWA 4MYTA 3VKWA 4DLSA 2VBCA 5GJCA 2ZSFA 3CRMA 4QOSA 4V02A 2ZI5A 2ZYVX 2R9VA 4RY2A 2WPDD 4Q7LA 4DZZA 3AEZA 1QRAA 1OKKD 2JLVA 2PBRA 1RRGA 3ECCA 1LFDB 2JASA 3EA5A 4M0LA 4PZLA 4MQBA 1EFUA 4D0NA 1GSIA 3GP8A 1B0UA 1G16A 3AQ4A 2FX3A 1XMIA 4DIEA 1U8AA 4B43A 1Z06A 2WJIA 2O5VA 4KHZA 4AIIA 3CF0A 1T9HA 1VDZA 1VECA 1G8FA 3AGQA 1I2MA 2FOLA 1G18A 2HF9A 2OV2A 3OEED 3I72A 4LYJA 4NONA 4Q9IA 3NBXX 4C0HA 4L9WA 5TMPA 4IXNA 4JL6A 1NY6A 1ZD8A 3A1TA 2WM9B 3FMIA 2PEZA 3W6NA 1FX0B 3RYTC 2R62A 3OEEA 4DKXA 1FP6A 3QENA 2QAGB 2EVWX 4MITA 4DRZA 1Z0DA 2QE7D 3LXXA 4PTLA 1ZNYA 3GD7A 1XD9A 2XXAA 4PX9A 1WP9A 4W5HA 4MKGA 2V1XA 1DE0A 3KZ1E 4TLAA 2QE7A 1E2FA 4NYMQ 4OBEA 4KODA 1E9CA 4LZZA 4FMCB 2ODNA 1E2LA 2FZLA 2WZQA 5K8IA 1G3RA 4DCUA 3QF4B 4GZLA 2BIFA 2XNDD 5JSZB 3VHXA 2RGXA 4Q4JB 3WYGA 3PR1A 2F3RA 2O8FB 2KI5A 1US8B 1RW4A 3TK1A 3GJ8A 4HB0A 1OXTA 2KBEA 2XNDA 1IXRC 4LWZA 3RABA 4DCTA 3TQCA 1OIWA 1N5JA 4R2IA 3E70C 2YOHA 4LYHA 4OK6A 721PA 1K8RA 3SE0A 3CW2A 4D0GA 5KTYA 3LO5A 1S3GA 4JLKA 1SVOA 3F0TA 1MO5A 2QGNA 3OIVA 4I1SA 4LBWA 2OHFA 3I1FA 1R10A 5HPYB 2ZS7A 1G7TA 1KMHA 1II8B 2ZRDA 3AF3A 5CM8B 4A2QA 5BYKA 1CXZA 3MJHA 1ZUHA 3NXSA 1HV8A 1KI3A 3C14C 1BO6A 2OEPA 2AWOA 5JEDA 2VL7A 1SXJB 3K70B 2XGJA 3WNBA 1M7BA 4TWZA 2JA1A 4MRRA 2QBYA 5DGXA 1A82A 2V3CC 1G8PA 4JL8A 3L0OA 5FBVB 4OQMA 2Q3MA 5H70A 2BCJQ 1G8YA 5TB5A 4C2UA 4PHGA 3V00A 4BASA 5EUMA 1S9HA 3NHBA 2CBZA 1R8SA 4A8JB 4JYBA 3SQXA 3UMFA 2FU5C 1HYQA 4YMUA 1BIFA 1M7HA 2DR3A 4DLWA 2P2LA 4TQUS 4TZ6A 1BYIA 1HT2E 4HLUC 3T1VA 1JPNA 2J0VA 2IUUA 1UPTA 2Z83A 4OI0A 2O8CB 2QP3A 3AKEA 3QVVA 5D3QA 1GRRA 3U7HB 1ZNZA 3L43A 3NKVA 3QI2A 1P7CA 3DO6A 3ADDA 4LV8B 2V4ZA 4RZ2A 1CBUA 1AGPA 4AWXA 2UZIR 3KJEA 5EP1A 4BRWA 1YQTA 1E4YA 4ZCIA 1BMFD 3DVLA 4ESHA 2ONJA 1ZRHA 3BRWD 1PLKA 2QY9A 4KO8A 5JWHA 1CF4A 2EQBA 5KPDA 1JQLB 5JRJA 5KSOA 2H5EA 2HF8A 3CRQA 2ZRFA 3V4RA 5TV2A 1ZW6A 3TUIC 1VG8A 2JCSA 3FE2A 2B6HA 4IOJA 2BKUA 4R7ZA 5C2JB 4M1YA 3KKOA 1UFQA 2FJUA 4OHVA 1FTNA 4EFMA 1W5SA 4M1TA 1I4LD 4ACBA 3AKDA 1UKYA 1OPXA 1XXHB 1KK3A 3IO3A 1P72A 1O87A 2AN9A 4FWTA 1XPRA 4NYIQ 3NDBB 1E6CA 1ZM7A 1N0WA 1T5IA 1ZIPA 5C4GB 3RC3A 1ZUNB 5L3QB 5G41A 2ANBA 3AV0B 121PA 3C16C 4PANA 2C9OA 3BGWA 2ZRIA 3QXSA 4QGHA 2YWFA 5DISB 5SZJA 4EKDA 3U60B 1R0YA 3QSYA 1XP8A 4MRSA 1W0KD 3RS4A 1SXJC 2VLIA 3SOPA 1GM5A 3K70C 1S3SA 1NVUQ 4CYMA 4DIDA 5J47A 1VCNA 1Q22A 3EAQA 4JLPA 1II9A 4WBSA 4DCVA 3VAAA 1OW3B 3QG1A 1SXJE 2A9KA 1SGWA 1E2EA 1NN1A 4F93B 3O47A 1QHHA 4O2LA 3CRRA 3VTKA 3SQWA 1XEWX 3D31A 5SZKB 4A8JC 4LJYA 4EFLA 5CB8A 4OJQA 1YZGA 3EIEA 3EZ2A 3LV8A 4WAUA 2QT0A 3WNDA 1OSNA 2VPPA 2D74A 4G3XA 1KAOA 1Z29A 3AVWA 2QMUA 2XTZA 2DFNA 4YMWA 3K9NA 2P5SA 2Z5FA 3EC1A 3SJBA 2GCNA 4KI0A 4DVGA 1P4SA 4ZDWA 4WIAA 3LQQA 3A8TA 1ZUIA 2QNRA 2OZEA 4KFTA 3EPHA 1RC8A 4FMDB 1OXXK 1X8KA 4IDNA 4AYXA 5IF9A 2O8DA 3ZZTA 1Z0JA 4B74A 2F3TA 1DARA 3U3KA 2K5UA 1E1RD 1XTIA 2QP9X 3Q5EA 3REFA 4RZUA 2IWHA 4TLEA 2GCPA 2ZE5A 5FL7D 1HURA 3A4LA 3AGPA 4HAUA 3ZVRA 1E1RA 1D9XA 3EW9A 3ZS8A 4B35A 1KJYA 1G5TA 1MO4A 2I1VB 5FL7A 5B64A 4BZQA 2IYLD 3TBKA 2FSFA 4BQSA 1YR7A 1OXUA 1CS4C 3DPUA 4DCNA 5FOXA 2WOJA 1ZCAA 1FFHA 1AQYA 2ZR0A 3V9PA 4BLQA 1OHHD 4OHXA 3TKLA 3WBKA 2Q6TA 1N0VC 3HR8A 2ODEA 4LBZA 4N1AA 1Q21A 1X8LA 5DHFA 3LBNA 3EX7C 1OHHA 2RGAA 3LXRA 4PSKA 5A5GA 3OIYA 2DYKA 2AK3A 2BM1A 4Z8YA 4ON9A 3R9IA 5KUTA 2PMKA 3FWYA 2IYRA 2GBLA 3KDSE 1CJTC 4I99A 3GLFB 2O8EA 2OFXA 4X8OA 3T34A 1KOFA 3VX3A 3KB1A 1M1YE 1VYVA 2VP2A 5HZHA 1G7RA 1IM2A 3MWLA 4NTZA 2CE2X 2ZRLA 4TL9A 2ZYTX 2DB3A 4F4CA 4C0JA 4URUR 2QMOA 4FI3C 4HAWA 2OCAA 4EJSB 2BJVA 5TARA 1Z5ZA 3B2EA 4LRWA 1Q44A 4A2WA 3BFXA 4HZUB 2X2EA 4LPSA 2GZDA 4Q5IA 2OLJA 4V0KA 3HJNA 2WSMA 4AKIA 4GMXA 2QM7A 3GJ0A 4JBWA 1GNPA 4LHWA 5IDVA 2O0KA 1KGDA 1QHXA 1KDOA 1D2EA 1SVSA 5KYKA 3ZVMA 2RH5A 8OHMA 4KVAA 1OIXA 1TQ2A 4YQFA 2CJWA 2REOA 4KU4A 4DLYA 1AIPA 3KKMA 2XB4A 1NVVQ 1WA5A 2X8AA 3CO5A 3DZDA 1E3MA 5LB4A 4DLZA 4UJ5A 2JIZA 4JS0A 2J0UA 1OB5A 1D9ZA 4PPFA 1ZNWA 5EUQB 4RFVA 2HT6A 3RS3A 4NCKA 4Q4AA 1DG3A 3THOA 1FL9A 3H0KA 1KHTA 1RPZA 1Z0AA 2A78A 4RSGA 4B48A 3S1AA 3R8FA 4TMXA 2Q21A 4CT5A 1GG2A 3B9PA 5CJ2A 2WWGA 2JLWA 2ERXA 4GOXA 4MGIR 4GNKA 4QGGA 1MV5A 2GCOA 1ZC4A 1NN3A 2W2XA 4NHOA 4DT1B 2AFHE 5JI3E 2FDCA 2ZYWX 1MRNA 4LX0A 1TNDA 4LHXA 4U5XA 5ELXA 1XEXA 1G19A 5KSYA 1GL7A 4C7OA 2ZPTX 1R0WA 5JJKA 221PA 4Q1AA 4OQNA 3HYRA 4KCGA 3WRXC 1W49A 2GKSA 3EZ9A 3LFUA 4LJ6A 3OESA 4C0SA 2A3RA 3QY0A 1E0JA 2DFLA 1DOAA 4OKSA 2FZ4A 1HQCA 4X8MA 1P61B 2IF2A 2ZRNA 1F5NA 3B1XA 3H2YA 3U44A 4M1WA 1N6HA 1U0LA 3GLFE 2ZJ5A 4P3YA 1LF0A 4MKHA 5EXPA 3VR4A 5FH9A 3MLEA 2PH1A 5AK0A 4ABYA 2A30A 2GAAA 4EJSC 2AD5A 2QUZA 3AF2A 2QRNA 3QKSA 2QL6A 3QQ5A 4G5GA 4HAXA 5J4HA 3QKRB 3RWMB 3O8BA 3C4JA 1K5GA 1PZNA 5H1YA 4C9BA 4EIWA 3R20A 4DC9A 2Z0MA 1JAIA 2CLDX 1YR9A 4BFSA 2CHGA 5L3RA 1OH5A 2V1UA 2P0EA 1P75A 3QXHA 2J0QA 2PJZA 3T5GA 2R6FA 4LJ4A 2ASEA 3OAAA 2EW1A 1CU1A 1TMKA 1P6XA 2Q9AA 3U5ZB 1IY1A 3OF5A 1JB1A 2D2FA 3TE6A 2FMXA 3SYKA 4IOKA 4F92B 2WJVA 3ZGXA 4QBIA 3QEOA 5F9FA 3PUWA 1OF1A 3H4MA 4CEJA 2WAYA 2G88A 4WZ6A 2G0NA 4NE2A 4ZI2A 3VR3A 3I3SR 1YZLA 1DVRA 4FW9A 2GEUA 3GLIA 2NMVA 3BJIC 1NRJB 1P2VA 1W36B 3I62A 5FOSA 2ZJZA 1IN4A 2IXGA 2TMKA 2VP5A 1KI6A 4HI0E 2QQ0A 5AJYA 4M53A 1GKUB 4A0HA 3NVAA 1J90A 4D4JA 1Q57A 3Q8XB 4NCJA 5F9HA 2CLSA 3SU8A 3B1WA 4KYIB 3IHLA 3GLGA 1JR6A 2BOVA 2BM0A 1S1MA 3AVOA 2HXSA 2YZ2A 1I2DA 2CK3D 2IYUA 3TW4A 4LJAA 4KFRA 2YC2C 1IQPA 1QVAA 5J4YA 2C9CA 2WHXA 4JBYA 1E9DA 1Y3AA 3IQWA 4KLNA 5G3ZA 3R7WB 2CK3A 4QFMA 3UWOA 2O8BA 3HU1A 3I32A 4AK9A 4HEJA 1SQ5A 3MG9A 3LQRA 3D8BA 4TYYA 2IS4A 3E2IA 1N5IA 2ZJ8A 3K0EA 4QNMA 5EP2A 1NMYA 3DM9B 4C4PA 3THXA 2ZXUA 4IHQA 4PQFA 4RCYA 4KYUA 3W90A 2JATA 2PLFA 1CLUA 1P3JA 3CNNA 2LWIA 4NU0A 4DLUA 2WBLC 3QOFA 2HV8A 4MRVA 3X1DA 3CPJB 3CRVA 3F8TA 4JLOA 3NC1C 5LD2B 4BZXA 4H9GA 4NYMR 4PZYA 4HB2A 5EZ6B 2EWWA 1NLFA 4LK2A 3K0FA 2RCNA 4WXPA 1FTSA 1Q1QA 2P3SA 4DWJA 5JBQA 1JR3E 4C0LA 3TVTA 4IOMA 5K8LA 5DO9A 1UEJA 3ADCA 4LSGA 1TTTA 2UKDA 5BN4A 3OFND 1GVNB 1SVLA 1D2NA 2AHOA 1IAQA 2OBNA 4YDSA 3I4LA 4M9SA 4TLBA 1HA3A 5DIFA 4MDFA 2PZEA 1G3IA 3MWYW 4LCBA 4R71A 4Y0VA 3V4FA 2AKYA 4US2R 1Q12A 4FMBB 1ZIOA 1TX4B 1KMQA 1R0XA 4Q1BA 5K8UA 2GNOA 5EJEA 4Q21A 3ZH9B 3QUSA 1IJFA 4NDZA 2OUKA 3E5HA 3I92A 3GLHA 3TRFA 1W36C 1E9AA 2IW3A 3B78A 4M21A 1OFTA 3B82A 3NH6A 1KMHB 2GXQA 5LB2A 2CCJA 1FQJA 3T12A 1TUIA 2PT5A 5FTKA 4URZR 3LLMA 3L82B 1G4AE 3SHWA 4F91B 2A5DA 3DMNA 3ZLJA 3VNUA 3FGNA 2F43A 2GF9A 2CVFA 4URYR 1KDRA 1ZM2A 1DAEA 2J7KA 3FDIA 5EXTA 4AY2A 1ZD9A 1GL6A 5G53C 4ZV4A 4CW7A 1RJ9B 1OXSC 2VSOA 3BFKA 3EPKA 1S9DA 3CZQA 4MUBA 3OHMA 2JJ1D 2Z4SA 5AJXA 4YXWD 1KK0A 4L16A 4WZAE 3QBTA 2W83A 3A6PC 1QHGA 4P32A 4B3XA 1IY2A 3OE7D 2JJ1A 2A5YB 4YXWA 2IHYA 1W4CA 3TUJC 4A1FA 1P9RA 1RYFA 4PAOA 1QDEA 4BLSA 3T35A 1EESA 4IDHA 3SDZA 1II0A 2Q3FA 3TJZA 4LC0A 3CPHA 3CX8A 1ANKA 2QI9C 2IYQA 3LY5A 1UF9A 1UAAA 1GOTA 2F1JA 4IW3B 3HPQA 4HLQB 4KSBA 3KKPA 4JL5A 4ERNA 3PEYA 1G41A 1W0JD 2DWPA 1E9FA 3CF2A 3CLVA 4RD3A 1OH6A 4HUQA 4A0FA 2ODWA 3IPYA 1MH1A 3SNHA 5FUXA 1VYTA 1W0JA 5SZIA 4D81A 4CEIA 1UBFA 3ZYCA 1DAIA 3NC0C 2FPMA 1E2HA 4YMVA 2V6IA 1F2UA 1RFLA 1NJFA 3UPUA 1L8QA 4NYIR 1NKSA 4EPXA 1PJRA 4HB3A 4QM7A 2B8WA 1KI2A 1KJWA 5IRCD 3EPLA 3K09C 2AR7A 3B6EA 4Q4HA 3CX7A 1A5TA 1NLZA 4MYUA 2ZRBA 5JFGA 1H65A 1LNZA 1T8TA 4JLBA 1G8HA 2WV9A 3NBFA 4EQ6A 4XVUA 3GJXC 1E96A 3AUYA 5IK2D 1N6PA 3BERA 3ONWA 1M7GA 3NH9A 4JKYA 2G9NA 2VP9A 5J4LA 1KO4A 1XDBA 2J1LA 5KOYA 2ORWA 3U7GA 1OJLA 1Z3IX 5IK2A 2JLUA 4W5WA 1W4RA 4TTQA 1Q0UA 3GQBA 3MWKA 2CLCX 4BFYA 4BUJA 2EU8A 1S96A 4BPBA 4IFBA 1Z83A 2ZSBA 3ADBA 5FOVA 3NIBA 3FTQA 1JJVA 4PQRA 1GNQA 1ZD1A 1AN0A 1K6MA 3ZD6A 4BFZA 1N5LA 4RZ3A 2DFTA 5L3VA 2WPDA 1TF2A 3BIFA 2VTKA 1VCMA 3QIAA 2F1IA 1OKKA 1MABA 4CDGA 1FW6A 3VKGA 2REBA 2WJGA 4M2LA 1HQYE 2ZRJA 3GFPA 1E2PA 2JLRA 3WY9A 5JECA 5C46F 1E2DA 3BK7A 2O8DB 3WNCA 4XD7D 3KQLA 3VR1A 1JXMA 4BFTA 2FSGA 3THYB 1BH2A 4TYQA 3UANA 4JKIA 2YV5A 4XIGS 1DAKA 5GADl 1CRPA 4WZBE 4XD7A 5DI3B 1DAFA 3Q9LA 4DB2A 4UXJA 4G0NA 5SZHB 4BZPA 1TQ6A 1TQDA 1C9KA 3H84A 4WVFA 3LRPA 4DLXA 3A36A 1GZSA 3THWB 1XCMA 3WRYC 4B76A 2WWXA 1M2OB 4TMTA 3PEVA 3FVQA 1OV4A 3K9LA 2XAUA 4Q7MB 1VHTA 3D6TB 3AF1A 4RKEA 4XJXA 2D7DA 4OI1A 5LDDC 1DAMA 3AM1A 1FUKA 2QORA 2W00A 5E95A 1ZBDA 2O52A 3KQUA 2IS6A 1ESNA 1P2TA 3QPUA 1JNYA 4IOLA 1Z28A 3UXMA 4NCIA 4ZCLA 1SZPA 1XD8A 2ZROA 3BS4A 3DM5A 5CYOA 2I1QA 4F7WA 2FFAA 1CJUC 1HUQA 2C5LA 1VTKA 1Z6AA 5B58C 4CEHA 2GJAA 4CIDA 2BBOA 2J59A 1NBMD 4PFSA 3RRYA 3WXMA 4DEYA 3ZJYA 4DEXA 2QT1A 1U9IA 3KL4A 4QBGB 2DPXA 4M8NE 1CTQA 2H7VA 4NKRA 2QP4A 1W5TA 4G5OA 2BKEA 5A4JA 2FN4A 4V0MA 4JIMA 4GRAA 3I61A 2BMJA 4YMSA 2E87A 1DAHA 2IT1A 3I5YA 3KJHA 3AVUA 2B7CA 1WF3A 2HJVA 2F9MA 1G20E 1R0ZA 2HCJB 1KTVA 3EC2A 3TUZC 1AQUA 4OK3A 4P4UA 3PEUA 1NVVR 4ZO4A 4Q19A 2ZJBA 4RZXA 3EWAA 2CJWB 4Q9HA 2QTFA 2WTUA 2YWEA 2B8TA 3EWSA 3EASA 3VU9B 1XB2A 2ZS8A 4Z8XA 3CH4B 2J0UB 2HLDD 3T15A 2IXEA 3RANA 1U94A 5AUQA 2HYIC 1T0JB 1KSHA 3L2OB 5BYJA 3WP0A 3ND8A 5HCNA 1PLJA 4LC1A 4DJTA 3EZ6A 2ATVA 1G3MA 2NOAA 2QAGC 1OH7A 3FOZA 3S1AB 2JEOA 1DO2A 1N6IA 1FMJA 2ORVA 4HDCA 2Q3HA 1XWIA 5DE3A 4MYCA 2OXRA 2CCKA 2GCOB 2NO7A 2OCYC 4RKFA 4OJKA 3KUDA 4QGFA 4NP6A 3ASZA 1BMFA 5CITA 3CRW1 1OYWA 1UKZA 1DPFA 1IHUA 3L0PA 4URWR 4ZIRB 1QVRA 3R9XA 4GMDA 2ECKA 4RD2A 3WYAA 2GJSA 4C7OB 1V5WA 4ITRC 2HYDA 3CM0A 1MT0A 3U7EB 3W9YA 4A2PA 3LDAA 5CK5A 4B34A 2GZHA 3DL0A 1EFTA 1Q3HA 1G6OA 1HY3A 3MRSA 2KJQA 1YZTA 4Q00A 4I81A 2XZOA 2WJJA 5E4FA 2OILA 3GFOA 3HPRA 2V54A 4TL6A 3AUXA 5HE8A 1W1WA 3NG1A 3PV0A 3QKSB 3EA0A 4BECA 5JWRA 4C0BA 3GEIA 3ND9A 1A2KC 1NL3A 4JVSB 2XJ9A 2W0SA 4QBFA 4WOPA 1EWQA 1NLYA 2GZAA 1HH4A 1W0KA 1Z47A 2VO1A 1X6VA 1BKDR 1EFCA 3CNLA 2OESA 2XOKD 3WHLA 2Q9CA 1KK1A 4Z1MD 5F98A 2CNWD 2IEZA 2DY1A 1NMZA 4GBMA 2Z43A 1E2JA 1Z0FA 2L0XA 2OT3B 3ZVLA 1ZC3A 4Z1MA 1TU4A 2ZIAA 5FPSA 2BJWA 1NN0A 3B8HA 2MSCB 2JDID 3T1TA 1TU3A 3B9QA 4LBVA 2CMKA 1TADA 2XEXA 3L0SA 4LV6A 4NYJQ 1VKJA 1NJGA 3LBIA 3R7WA 4CEJB 2OFWA 4TL8A 2N46A 1E2IA 2P6UA 5FPYA 4DBLC 3B1YA 2IEYA 1OXVA 5CIQA 4D4MA 4E03A 4DDVA 1UDXA 5CM9C 5EXSA 1W47A 3GLIB 5FBWB 1AZTA 2ZJOA 4TQ9A 2VP6A 4US1R 2XB2A 2FGKA 3MFYA 1XTRA 2ZM5A 4B3DA 1E2MA 1VYUA 4LGMA 4YMTA 4KSCA 2FGJA 2VEDA 1XNJA 1BYUA 4YC7A 3SI7A 1W2HA 1YHNA 2FWRA 2ZR9A 4OHYA 4B32A 1FNNA 2MMGA 4QNRA 1DBSA 2IL1A 3GLGB 5LBIA 1OFIA 1G3QA 2ZAOA 4TTRA 2H92A 1M34E 1U81A 1EX7A 2VF8A 4QKQA 4HLUA 1YRBA 2ZJAA 4HSEA 3K0CA 2AX4A 3BH7A 2WICA 3AH8A 1R8QA 3EG5A 4I1OA 4KFSA 1FX0A 4PHHA 5JHGB 1KI7A 4TYNA 2YWHA 4KBFA 5C18A 4E5UA 2WOOA 4Q7KA 1EX6A 1GILA 2VA8A 2JLYA 1F60A 5DNYB 4LOAA 3THXB 4IEIA 2GAOA 2ZU6A 4MGZR 1LVGA 2ZRCA 3EIQA 1Z07A 2ERYA 4QC2A 2X77A 2BVNA 2ZI7A 4LDJA 2C03A 2NO0A 5L8VA 1NG1A 1LY1A 2C77A 2WKQA 2CDNA 1ZAKA 2G1KA 1Z6TA 1XU4A 2R65A 4DDUA 2IK8A 2QTVB 3CUEF 4Q4JA 2CVHA 1AM4D 2QQEA 2W6ID 3J81k 2H18A 2O8FA 2RGNC 1US8A 1OE0A 3BORA 3REGA 1COWD 2GETA 2J5XA 4PAQA 1GFIA 4TMVA 1N6OA 4WXRA 3PXGA 2IYSA 5BWMA 2W6IA 4GOJA 1SVKA 2OLKA 5K8TA 2WJYA 1NF3A 1COWA 4WA7A 1PVOA 2EFDB 5CLLA 3C5CA 3JVVA 3ZZ0A 2PT7A 3DOFA 3E1SA 4QRHA 2YKGA 3FB4A 1II8A 1SXJD 1ZJ6A 3Q85A 5JJIA 2ODBA 3OEHD 3K70D 3SS8A 2YYZA 2E9SA 3AVYA 4XTRA 4GI7A 1SXJA 2GK7A 2NZ8A 4G5QA 1IN5A 2ZRHA 3OEHA 2KB0A 2XSZD 3GLHB 1VG0B 1P2UA 2WKPA 2VHUA 1XTQA 3GJ4A 5JZVA 2HJGA 4LUCA 4A15A 2JGNA 3QBVA 4UXIA 3DOEA 2V6JA 3GLIE 3KQHA 4UXHA 2W2TA 1XMVA 4DHEA 3AKCA 4A8JA 3HYTA 4B6EA 4KBGA 3UATA 3VNVA 2F43B 3DEFA 2FE4A 4UQOA 1XD2B 3IUYA 4LI0A 3W5JA 2IUSA 4URXR 1Q3TA 4PO1A 5JS8A 1ZCBA 3ZQJA 3IBYA 1E98A 5KDLA 2KE5A 5FUVA 4GZMA 3GLGE 2GHIA 5BQ5A 3WMFA 4RCZA 5KNDA 3G5UA 2CL7X 3FMOB 2O0HA 4CGZA 521PA 4KLZA 3A1SA 2GVDC 3ETLA 4TZ0A 3UMRA 1E9BA 1R2QA 4P0TA 4A0RA 2QGZA 2ONKA 2ZQ5A 4MH0R 2ZE8A 4BGDA 3PJRA 4MGYR 1PV4A 1G4UR 1XJQA 4Q03A 3K0AB 4A0GA 1KZ7B 4MDEA 1N0UA 1XEFA 4O25A 5HZKA 2ZREA 3KFXA 2NO9A 2NGRA 3FMFA 4XSHA 4Q1CA 4YONB 2AFIE 4JT4A 1E4VA 3QKTA 2C78A 2V9PA 2F1RA 4NH0A 2YVUA 4I4LA 4BE7B 3P4XA 5CYPA 2IYZA 1R5NA 1XXHA 1NSFA 4W9MC 2WIAA 4HUQB 3BE4A 4XWAA 2FG5A 5DN6D 5E7IA 4EAQA 1SKQA 2ZVPX 4G5SA 4Q9LA 1MO6A 1ZU5A 1OT3A 2YWGA 1GTVA 4OYHA 3TR5A 4BEBA 4BFVA 4CEIB 5DN6A 4GPTA 1IOZA 1G5RA 2HDNB 2R2AA 1KO7A 4FIDA 3VR2A 2IXFA 1F2UB 4UNPA 2F9LA 4M22A 4Q1FA 3UWKA 1XEWY 3KFVA 5KU1A 1DEKA 2RGEA 3LX5A 4TSFD 2W6JD 1NI3A 1ZU4A 2B7BA 4GP7A 1SULA 1T3SA 1AKYA 1T3LA 1Z2CA 4KFUA 4MRNA 3X1WA 4D0LB 3TR0A 2QENA 4D2IA 4TSFA 1SVMA 1E1QD 1YZKA 1AZSC 4EQ6B 4JLAA 2WAXA 4EUNA 3MSXA 1P73A 5B30A 2ZRMA 3IIKA 1NSTA 2PMDA 5AUNB 2R6CA 4RD0A 4JYCA 1E1QA 3GLHE 2BBWA 5AR1A 4F4IA 2F55A 4AI6A 4QG7A 2IC5A 2IX3A 3AVQA 1DAGA 3GEHA 2VHTA 2WKRA 5DYIA 4JLVA 5FBQB 4O3MA 2ZE6A 4OHZA 1Z6YA 1IN7A 1X1RA 5DH9A 4P4SB 2DCUA 1CKEA 1XZPA 1TF7A 2C99A 2CHVA 2H16A 3CF6R 2AKAB 1ZINA 5EE9A 2QRZA 2R8RA 1XBTA 1KO1A 4JJZA 3JVUA 1VIAA
chains in the Genus database with same CATH superfamily
4Z5XA 2C98A 3T3PB 6ABPA 3JZAA 1PYDA 3GEDA 4J1TA 4HBZA 4LHZA 1DX4A 2I9KA 4Y0NA 3ZV5A 2OD7A 3EWNA 3C8ZA 4PO9A 2B1QA 2FV8A 4KNVA 4CQMA 3IVRA 1XZQA 5DHPA 4L8YA 4QIHA 2G07A 2PZBA 1WHTA 1B6RA 1CY2A 1MIHA 2FFQA 2G77B 4B84A 1A76A 3ROTA 5KTNA 3MB8A 4PC2A 4UARA 3WBJA 3F4LA 1RVV1 3HB9A 4KAJA 3LSYA 2IIPA 5EPUA 4QTYA 1F2TA 1XZFA 3PUJA 2OUIA 1W1IA 1JHDA 2DX7A 2HH9A 2COKA 2VK8A 3M3PA 4HDNB 4CR6A 5K5EA 1MA3A 3HTXA 4EA9A 3UMVA 3IVMA 4HAZA 2ZT5A 4EGSA 1L2TA 2WD7B 3WGIA 1PGJA 1TUBA 2H9AA 1GKYA 1R5OA 2VAPA 1TC2A 2ZDGA 4GNRA 1MXHA 4H4CA 2HMSA 4QBTA 2G67A 1P39A 4JHXA 4FGZA 1E8MA 3CR7A 4FHCA 4ND7A 4IDOA 1EK2A 2QAIA 1Z2AA 1ESCA 2WT4A 5DW3A 2PAFA 5JANA 4JUAA 1CUCA 2Q5HA 3FNQA 4C2BA 1D6MA 5E2IA 2GA8A 1XL1A 2YRXA 2VP0A 4I1RA 1YWGO 4LYJA 4K6HA 5TY0A 3TX2A 5KYGA 4LBYA 2HMVA 2IPAB 4D25A 3AXSA 1E89A 3GC6A 1GEGA 3GI1A 2H8GA 4FK8A 4JJGA 5E3JA 3AX6A 3S3TA 1K6EA 3AP1A 4R7GA 5A9TA 1KJZA 3HJBA 4CUKA 3RG2A 3FOCA 4K7JA 4MV8A 4MS1A 4IH1A 2NIPA 1BOFA 3PUXA 2AXPA 1UWKA 2JJ2D 3I6MA 4IBOA 3DNFA 4JN6B 4PO8A 2ZT8A 5JAPA 4FP9A 1CQIA 1EFAA 2KWIA 1IAVA 1TVCA 1KDZA 1Y3CE 1U2SA 4EI2A 4DUZB 2JJ2A 3K0KA 1ZH4A 1YV9A 5JO9A 1GZHB 4FFPA 2R47A 5KZMB 1I51A 2Q45A 1MJHA 5G1OA 3TLBA 2O5CA 5KNBD 3WA7A 1CY7A 2IYPA 2V55B 4RHUA 1QORA 2P9ZA 3L6RA 1VQ1A 2AI3A 3NGXA 4R2KA 4JLNA 1IM8A 1VLVA 2IUYA 3B7WA 1I2BA 2O3TA 1E94E 1N2ZA 2ODTX 2YFQA 3BN3A 3C3YA 1NG9A 1ONPA 3IO5A 1JXOA 5KNBA 3DAFA 2Z9BA 4OHFA 4DSUA 1MD9A 3H16A 5EI5A 2W98A 3U4QA 3KD2A 2G1AA 3QLUC 4QECA 3AL2A 2QBYB 3G9QA 1XRJA 4RESA 2OO5C 3PDIA 5BORA 3SQLA 4X45A 3JYNA 2MIIA 4KDFA 3MWJA 5IT0A 4DOMA 1E58A 1VE1A 1M0TA 5CJPA 2Q1TA 4R9SA 3ILSA 2AZXA 1QYVA 2D0DA 3FETA 2B4RO 2F64A 3FYUB 1RIFA 1U99A 2G63A 5FYQA 1ZGZA 4U6SA 5FI3A 4BVLA 4N0DA 1BXZA 4AJLA 5LPNA 1KZ1A 2HN9A 1O4WA 4ZQBA 1XG5A 4QXPA 2VTBB 5EXDA 3SZMA 4FINA 2ZR8A 1WWKA 3G8AA 3KR0A 2HDWA 1A77A 1JBEA 1CZKA 1FFDA 3PEWA 2F6RA 1B23P 3TNYA 3M6UA 3TFOA 2IEGA 4OIMA 1EVYA 2NU6A 4YJ2A 2R1VB 3AJ9A 3OE7A 1NVAA 1R7RA 1YIAA 3DTYA 5H80A 3QMMA 3S2UA 4GOND 1WBJB 3KB2A 4B8ZA 2D2XA 2EV9A 3A1NA 5H59A 5DM60 3RTBA 2EHDA 1I6KA 5CFMA 5E4TA 4E3ZA 2C9YA 5LD2C 4B3RB 3PQ4A 2YOGA 4I6JA 3W8FA 2OFOA 4A1OA 1PK9A 4RF3A 3AHFA 2Q9BA 2VP4A 3IXLA 4UU0A 8AT1A 3P97A 1P7WA 3R0XA 1FRQA 4HAYA 2FR8C 1MLDA 2QV0A 3KZKA 1U2DA 3NT5A 1A4UA 4FR5A 3TQSA 4QARA 5CGQB 3RS7A 2W42A 2GJ9A 2A9OA 2DTEA 3AOGA 4FNMA 4AW9A 3R9XB 4WECA 1NA5A 2XDQB 2VWQA 3R3YA 1UDWA 4IWXA 3DL2A 4NXNB 4P53A 2UVPA 5HJ5A 3Q72A 2Q0HA 4S1PA 5JI2E 3M5PA 4HF7A 2D06A 1YZQA 2CLIB 3U3JA 4HPWA 1O58A 2WSSD 4HMQA 4DNFA 4EYSA 1XZEA 2B4AA 2BCGY 1T91A 1NI5A 2GXUA 3IUSA 3VH2A 3BYZA 2YMMA 5GTDA 2WSSA 3KTAA 1ADJA 1N2EA 1NFQA 1Q91A 2C2XA 1F48A 4J7UA 1RE0A 4MJ3A 3KT3A 5ALHA 2I2XB 4MUFA 3V4SA 3MNFA 5JCXA 4Y9SA 4DSTA 3BHJA 1E3EA 2IVZA 4MA4A 4NS1A 5AYVA 1W9MA 4BTVA 2HJRA 4ZKDA 4JUCA 5I7OA 3ZS9A 4C29A 5KYNA 3TSWA 4P4GA 3MCAA 4ZQGA 1Z12A 1N9ZA 3LW7A 4U2GA 3EVAA 1GAJA 1C1HA 2EFCB 3G0GA 3KBBA 2PV0A 2BEKA 1J56A 3R5XA 3UENA 2C2WA 2NV2B 3P20A 2CLKB 3VA7A 1BVRA 4EY4A 5CDTA 3BB1A 3TOSA 4PAGA 4C3UA 1OH8A 3OSZA 2Y6UA 4YJ2F 3CN7A 2I5PO 4RLHA 4CZ2A 4IIDA 1WMSA 3BXFA 1I4TD 3HB0A 2IYYA 1H2ZA 2Z8YA 2QR5A 1SVWA 2EZ4A 2OV8A 1GQRA 3A26A 3O6VA 3C1TA 3T9FA 5EQTA 3TQHA 4EMUA 4MYHA 3WQHA 2GJ8A 3IQIX 4QOGA 3W2IA 3RD5A 2QVLA 1X42A 1KP3A 3N7UA 3SC4A 3T7EA 1EUQA 1NDQA 1GZ3A 3CUKA 3T7SA 3VU1A 4OATA 1AOXA 2H1IA 2YINC 2JRLA 2ZG6A 4LYFA 5TDHA 2ZUFA 1EM8A 3JQAB 2PWBA 3OC0A 4HDAA 3UAGA 2OAQ1 1UXKA 4L8FA 5AW2A 2AA3A 3UJBA 1VE6A 3OX2A 4REQB 5CCEA 1KEWA 2PKXA 1BS1A 4HNAB 4OXQA 5JDIC 1GUDA 1P1KA 1U6IA 1UT6A 3D7LA 4X8LA 1X7ZA 5E3HA 4Z7QB 1KU0A 1W34A 4YAFA 3RS0A 1C3EA 2JAQA 1SKAA 2AK2A 1CUVA 4JLDA 3MTGA 5LQAA 4EGFA 3T3HA 1S7CA 2H1WA 3BTUA 2WTXA 4DC0A 4F3KA 1IH8A 3LCUA 1G9TA 1JU3A 3A3OA 3JZMA 4I8DA 4UATA 1RFGE 5I9MA 4FLEA 3ZY2A 4BC1A 3G0HA 3E9MA 3FKSD 2XMGA 5CLGA 4OMUA 5ALWA 1L4YA 3MQFA 4O2BB 1KKMA 2YHIB 3RSQA 4EVRA 1XPUA 5KTSA 2C96A 1T10A 5HRUA 2RB4A 5KHOC 3SBOA 3U1VA 1X2BA 1K6IA 2D6FA 4BFWA 4N8SA 3FKSA 3H2BA 1POXA 3CNOA 1THTA 1QZTA 4R8LA 4QYSA 2AC4A 2PTHA 4RIGA 3ED1A 3OFKA 3RSCA 4ARZA 2PGIA 1W73A 4BNJA 4PE5B 2POCA 2O1WA 3CHYA 1UC9A 2O8EB 4XB2A 4W1QA 4PSCA 3A06A 3U80A 5JPDA 1UADA 1QZ3A 5DP2A 2C9BA 3WLQA 5LKAA 1I3OA 4Q3CA 3ROGA 1PNRA 4G5XA 2A92A 3ORQA 3Q3EA 1CW2B 1UMDB 2VPWA 4CM8A 1OTHA 1Q2UA 3HCFA 4BNLA 4M0KA 5KVAA 2AX3A 2E7ZA 1K97A 3Q5DA 3TQIA 2M6RA 3BPSA 1Z4OA 3QTLA 4EAAA 1E79D 4I4TB 1WZUA 4LI3X 4EKYA 1XMSA 3F6PA 3SR0A 1VRCA 1QQ5A 1PS9A 2EX4A 2JBAB 1KIFA 1E79A 4HZIA 1P4HA 4WNAB 5FBRB 1GXSB 1KOJA 1N5KA 1HEUA 1P0QA 3OTHA 2FUEA 2VT7A 4MQMA 4UPVA 4X95A 3IEVA 1EVZA 1OU4A 4CF5A 4IRUB 2BW0A 4U3JB 1Z8DA 4Y1GA 3M6AA 5DCWA 3E2MA 2O2CA 3ESDA 4D9FA 5LM3A 2VR1A 2X2FA 2E21A 1D5CA 2R86A 1RI1A 3OPYI 1TEHA 3C6ZA 4FMPA 4IL5A 3L6DA 3JATB 2PYZA 2D0PB 4MQLA 2BGMA 2QTGA 4PSVA 2W2PA 1GGNA 3TM5A 4O4LB 4LXUA 4L4XA 4DDMA 2IEIA 4IKEA 5HGJA 4FGKA 3VI4B 4LXXA 4YRJA 3B6IA 2WYIA 2ORIA 2QA5A 1JQJC 5F4BA 5J2UB 1RYHA 2BF4A 5ER9A 4YMGA 1FXUA 5AKKA 2IU6A 1Z4QA 2OCDA 2YXPX 4JFAA 3TCKA 5P21A 3D1VA 1UM8A 3TIFA 1H1LB 1N2JA 3WO1A 4ITUA 4FGWA 4WWHA 1SG0A 3N70A 4U00A 3CRZA 1R4NB 2AI1A 2WAOA 1M34B 1W6UA 2B20A 3DQZA 2B2NA 3RVBA 5BSGA 2EYUA 4LDQA 5H3HA 3DD5A 4EB6A 1GGEA 1VP3A 2Q4DA 4GQIA 1EUCA 3KOMA 5LQCA 4JWTA 4QJ5A 4U8HA 4MS3B 2OSVA 5ILGA 2P1DA 3K9GA 4BV9A 3NBYC 4CFYA 1QU3A 4UTVA 1SHKA 1PO7A 3IAM1 3A1WA 4INZA 2WF7A 3DHEA 1GSHA 1XKLA 2LDXA 3QVLA 1M6NA 1NVWQ 1SQSA 3U6BA 4N7MA 1OFUX 1I7DA 2HIAA 1JWLA 1C29B 4LZJA 1XVLA 1UDCA 2I4IA 3OE5A 3HVIA 4L15A 4DM3A 1RQPA 4OI4A 3V4LA 5KSZA 4XWYA 2IUEA 2X41A 3IP3A 5IEBA 3V7YA 2CLFB 3C4VA 1QU2A 3EZYA 1KR2A 3BGIA 2I22A 3LLSA 4JQYA 3D54D 3UT5B 3HA3A 2FG6C 3SZ3A 1WMAA 1WSBA 2D3WA 3UWDA 4AVYA 3HUDA 3DDSA 3OQNA 4WQMA 1B41A 1X8XA 4YLGA 3C8DA 3WSVA 1X7YA 1XJWA 2BLNA 1JTFA 3M49A 3BUSA 2PKCA 4YQEA 3ZVKA 2DGDA 4RVUA 5JEEA 2DUWA 1TFUA 1L5SA 3AERA 3VH1A 1PSDA 4AJ2A 1EFRD 2FMUA 3K9CA 4GL2A 1RRMA 5KTMA 1XMQB 3LYHA 4I9NA 5CNJA 3KLPX 4EF5A 2ZITA 4D9BA 3K0BA 3SZLA 2QN3A 3U4IA 1EFRA 4MUJA 2I7TA 2HDOA 3JAWB 9ATCA 3GEGA 2X3YA 2XNCA 3H4IA 3K0SA 4RJJA 3CNBA 1HNWB 2YIJA 4QPNA 4JP8A 5D3MA 3N8GA 4AN4A 1JECA 1U9ZA 1AUVA 3NGLA 1BG6A 4IXDA 4LYYA 5CLQA 4D80A 4K81B 1T9GR 4QTXA 1ZS9A 4P31A 1V6AA 3NDJA 4KOAA 2ODQA 2R6DA 1QUFA 1G17A 2PZ8A 3NRJA 2VHQA 2C8VA 4ZAYA 3RHSA 5AVJA 2FH5B 3UQYS 4B6OA 5EJ4A 4DV4B 5F3WB 1Z7EA 1I10A 4Z3KA 4B09A 5G0TA 1E6LA 3HB5X 3P2YA 4P2GA 4RORA 3AIIA 4ID3A 4RH1A 4RJLA 3SYNA 3ICWA 2VBIA 1XPJA 4EHFA 2A1IA 1ZRSA 3KEGA 1Y7HA 1DO0A 3CKLA 3O2NA 1C0LA 4X7RA 2VQ3A 2CLLB 2HJHA 2JH3A 5FTMA 3SJZA 2FLKA 2WUGA 5CXSA 2DT8A 2QNIA 5FHRA 1Q16A 3M83A 3RC8A 1QAQA 3COJA 3LWNA 2QAJA 3E8MA 3X1XA 1W29A 3THYA 4IMJB 1PWXA 3M9WA 4TQAA 5GJBA 1IEWA 3A1EA 1U3FA 2VDJA 3DGFC 1PFYA 1N8TA 2FRDA 1X1EA 3EVZA 2F00A 2BH9A 1AGRA 4UNNA 3WV4A 1GADO 4QO8A 4X6YA 1NYTA 3GVXA 5AUOB 4WH0A 1EJ2A 1SA0A 2BCEA 2RI0A 1KIMA 4OREX 4WBNA 1H66A 3R9WA 1W46A 5LWQA 2AFIB 1XF1A 4QELA 3T06B 4AJ9A 1BX3A 2IDMA 5FJIA 2ZYRA 1HYGA 3IR5A 1NXSA 2I65A 2VQDA 2PSJA 3Q87B 1Q84A 4K28A 5H3CA 3RSHA 5FKJA 3UG7A 3UV7A 4JT9A 4X7PA 2DHQA 1ND5A 5JSZA 3BDAA 3JAMA 2XVXA 1Y48E 1NHWA 4LHYA 1MENA 2DPLA 4NBLA 1AKEA 1TTQB 1SUPA 2J9FA 1ZN7A 1XXHE 3OQBA 4Y6LA 5EWMB 1C7JA 1KYIA 2NYVA 4BVJA 2PSSA 1RTKA 3CEMA 1HE8B 3HV0A 4XGKA 5K05A 2XA9A 1V43A 1RWPA 2R8EA 3CLSD 3R24A 2CVOA 4YCDA 3I0ZA 4ZHQB 2HWXA 3MELA 1GNTA 3COYA 4OVKA 1RVDA 1J22A 2Z6VA 3KPUA 3PHJA 4IFEA 1TZCA 4BP8A 1T8RA 1GEEA 4E32A 3RRJA 4UTNA 1EDOA 3ABZA 4CR8A 2IE8A 2X86A 4ZXPA 4TWIA 4OM7A 1NTRA 2B2XA 2Q07A 2VQSA 3FCUB 4L4RA 3VM6A 3OTWA 3N39C 5C1PA 2I3BA 2PK3A 1OBCA 1MC8A 2VKQA 1K5PA 1Z4LA 3H6KA 1T5TA 2JJ8A 1J8YF 3HP1A 4V0OA 1NGSA 3KQSA 4LF5B 2QDXA 1NFFA 3O92A 4P98A 4ZDKA 4TGLA 4DNOA 1H05A 2NSHA 3CEPB 1QYIA 2XE4A 2Z2XA 1IBSA 4M60A 4OQLA 4RA6B 3R74A 5IF3A 1BMDA 1JVNA 3OLQA 5PNTA 4IJ5A 5CTAA 4QXAA 3ZHOA 1PGQA 4Q1DA 2YQ5A 4YAIA 1O0SA 5MHTA 2GDJA 2EFHB 2H57A 4XASA 1EQAA 2L82A 5IVDA 5FOWA 3FHTA 4ZI7B 1UOQA 3RKRA 2NVWA 4PY2A 3GMIA 3EIHA 1YB4A 4YASA 2EQAA 1Z26A 2J32A 3G82C 1W4AA 3L7LA 2Z98A 3GMDA 3KTOA 3NIDB 4K2AA 5CXQA 3BXZA 3HJGA 2VDVE 5SZJA 5CBPA 4JMPA 3I5MA 3P9XA 1A5SB 2GBGA 3HDTA 3OZSA 3QNMA 1XCGB 5EYPA 1DJQA 2CCGA 3FHLA 1QM5A 3RSFA 3GPDG 4ZK6A 4ZYWA 2JAOA 5AW6A 1MCZA 3GVPA 4OJYA 5JZMA 1RKUA 2WQ7A 3W34A 1WNFA 2J0SA 3CUUA 4R69A 4XTCS 2REQB 4X54A 2GXSA 4DNQA 1CRQA 4UTPA 4M1QA 1UMCB 3QEJA 4KO4S 5EZYB 4I9HA 4IIHA 2OA0A 1C30B 2Q3DA 5DSZA 1ZH8A 1QIGA 4ZEXA 1CJMA 4RFSB 4DAEA 2CFSA 2XCLA 5AHOA 1L1QA 5TT1A 4LCJA 4DLRA 1M8KA 4D74A 3QWIA 3H86A 1E1KA 3GEEA 2WMOB 4LJ5A 1MBZA 5DIZA 1LBSA 4WKCA 5KDOA 4B7ZA 1JIQA 1LI7A 3ELBA 2PA0A 3MCWA 4L76A 3ZU6A 1NULA 4GT1A 1X15A 1QFZA 2QMQA 4FJ1A 3TOCA 1WPQA 1QCCA 1ZM3A 2ZTSA 3W06A 1EFHA 3NHMA 4C4XA 1FMLA 1PKXA 4X90A 5KYYA 1C1YA 2HU2A 1KIAA 1H5UA 2IELA 3D6FA 2ZRGA 1GPJA 4Y2HA 1T8UA 1Z15A 1DADA 4I1YA 5EJAA 3AVVA 4DA0A 1Q0RA 3IP9A 1UBEA 1DGQA 3EG9A 1TCAA 4L0DA 2QSZA 2BAGA 3V1NA 2IHUA 2Q2OA 3CCBA 2HCBA 1PJ2A 3GDOA 1CUEA 4UCFA 2YYSA 5C7IO 4MKFA 1RAEA 4L50A 2VNHA 4I5IA 1M1YA 4WK6A 4Y2XA 5J59A 2RKBA 4BX3A 3V1TC 1I6MA 1SCUA 3NNSA 2GX6A 1U7OA 1ZLYA 1HSOA 2GRAA 1JG2A 2JFGA 5EIFA 3PB3A 3SJCA 1BD3A 3IL2A 2XGOA 5FPHA 3UUEA 1G8MA 1GTG1 4X8HA 5ES3A 1RJEA 3DWGA 3GARA 3TMYA 3VH3A 4E51A 4PWYA 3E0XA 1Y81A 2XHEA 3LL4A 4ANFA 5AXBA 2IYWA 4GLBA 3RJZA 3UAXA 2W6CX 4EO4A 5BV0A 3T1HB 2MSWA 2NXNA 3RSOA 2N42A 2G08A 2JHGA 1ESMA 4IHKA 1E1YA 3SK0A 4ERXA 4YRGA 5CG2A 2RGNA 4EECA 3QJ5A 5E7JA 1X87A 4G89A 1SC9A 4WNIA 1EQ2A 2C2GA 4TKVA 1BQEA 1INLA 3JXEA 3RSZA 5JCPA 5JVDB 4HVCA 5DLEA 4WHMA 3DAHA 2O50A 2KYRA 1WKCA 5T64A 4D8XA 1SO8A 3DKVA 4MS4A 3FPAA 3U39A 4DV7B 4K6OA 5J5CA 2NO1A 1KQGA 2XGMA 2UU9B 4G0UA 2WNHA 3A6JA 2P62A 4AAYA 5U4XA 2Z1DA 5FR1A 1XAJA 4REOA 1K8QA 4KJXA 1KY2A 3RFTA 4JI3B 2ZSAA 1LTKA 1E1CA 2E2WA 2WWHA 3FOFC 4CI9A 1RYDA 1XN4A 1M8JA 4PX5A 3AUFA 1ZAYA 4FYHA 4IILA 4YVFA 1QG6A 1O3YA 1KAGA 1SVNA 4KEAA 3FFTA 1JDTA 2OBLA 2Q1WA 2XNSA 5CA1B 5IULC 3BGDA 3EIUA 3OJCA 3PICA 4MVJM 2AR0A 4E5SA 3U1BA 3DOOA 1U3WA 1MABB 1KO8A 3GT0A 4MCAA 3N0XA 4QUHA 4ZOLB 5AM1A 3RC9A 4C43A 3OBBA 5LXTB 1ZGAA 3MTEA 4PZDA 1BKYA 2AFHA 1NQAO 2OV6A 2WFMA 3QQPA 4EKGA 4XJVA 3V8BA 1A9ZA 1Q0LA 2TMGA 3P32A 1KETA 1RRFA 1T1EA 1URPA 3NV7A 4HC4A 4LGYA 1GCIA 4FM9A 3OCYA 2OXCA 2V58A 2ZDHA 3HBMA 3QE0A 4QYIB 2BHRA 1ZI8A 3AWDA 1Q95A 1VIYA 3E5NA 3PRYA 4TUYA 5JD5A 1KSFX 1U3DA 4GFDA 4Y7CA 4NBKA 1MUUA 2H06A 1YL6A 5IMSA 4DMKA 4R3WA 1GPBA 3QX9A 4IGAA 3PQ6A 4GKBA 3FIJA 4RD6A 5JC1A 1GLGA 1E6EA 3LH5A 3OPVA 4I2NA 4ROSA 1HYEA 3OU7A 4AY4A 1JHZA 3G8BA 3QV1A 4B47A 2DKNA 3MGCA 3CMCO 3AB3A 3JVIA 2VF7A 2Y1DA 3QVUA 4QRDA 1H42A 4J9VA 1GA6A 1GG5A 5EGNA 5LU9A 4BXOB 2FX2A 4P4TA 3AJAA 1CR4A 2QLMA 2IOFA 1ID8A 2XYHA 2D7CA 1Z08A 5GAJA 2DPYA 3TKAA 2ZRAA 3F5FA 3VO8A 1FOEB 1PR5A 2DWOA 2XMZA 4CIVA 4PZZA 4OXYA 4UU1A 1N33B 2BMDA 2RHDA 2LVBA 1KS2A 3GP5A 2YVQA 5ITZB 5DNEA 3QEAZ 1JFFA 3H9GA 2AQKA 3FHOA 5DHSA 1A4RA 2FPXA 3A0RB 4DN6A 4ZCPA 1G21B 4S0XA 4OPMA 4KTTE 5G02A 4DRXA 3DZFA 1E0KA 3K2IA 4E08A 4CHGA 2D59A 5HUHA 1WRBA 2GEKA 3G5TA 5IAKA 3HJRA 2ISSD 3DEZA 1YDGA 2VH5R 3GUCA 3IEUA 3L0DA 4K9OA 5EGSA 3SLGA 3TAUA 4TQGA 4W82A 4URVR 2ZCVA 3E4CA 2X5KO 2VTEA 3ICQB 2G9UA 2QTMA 3ROKA 3RK1A 4QUDA 2I0FA 4I9GA 1JLHA 1R5BA 4XI9A 3RJ5A 2J3LA 1MTZA 2IYVA 3DEKA 3VGJA 4C06A 1I3CA 3JWIA 1A7JA 2OG2A 1PEAA 1T26A 1Z74A 2QM8A 3B3FA 2RHGB 4H59A 4G6ZA 3Q0EA 1JFRA 2J4FA 5AVWA 2LKDA 1MORA 1ZHFA 4B46A 4R51A 5HMLA 1YR1A 2NNLD 3PYLA 4HUJA 4AO8A 5BW5A 2JCXA 3IBSA 1C4OA 3AP2A 4TUYF 2PLRA 3RFCA 4PGFA 5B7QA 3TRKA 4DLLA 3UK6A 2TYSB 3PPVA 4IXMA 3VJKA 3TQFA 1V8DA 2IV3A 4Z4CA 3K8OE 4E6EA 1UK8A 1Y63A 4DQKA 4RQBA 3O8RA 4EI7A 4F2GA 3A6DA 2HEGA 1JLLA 4HH4A 2XF2A 5KQLA 2YV3A 4DT1A 3AR3A 3OF3A 3L40A 4UNQA 3VAZA 4U7DA 1ZVJA 3DCYA 1UBKS 3EOAI 1XCPA 1GGHA 2LZ0A 3I04M 3ZZUA 4YJGA 4ES6A 2J31A 4UEWA 5FQOA 2WWRA 3KQVA 1L4BA 1GZ6A 1N6RA 4NFSA 2JK0A 3V97A 2BLLA 1JHMA 3V2GA 4LNAA 3D3WB 2J67A 2Z8ZA 4B44A 3NUGA 5DT9A 3RVQA 5HOQA 3BMXA 3E53A 3VMFA 3W6OA 4YRCA 3HB7A 1EG7A 5DASA 4E4RA 2OO7A 1NPTO 2PZFA 2KBFA 3NHSA 4Q3BA 5DBIA 5GJVC 3O9ZA 4XSVA 3F6SA 1LPAB 3OZUA 4MNTA 4AWAA 4HSGA 2LE0A 1FQOA 3OWXA 2B4TO 1A96A 3OQIA 2PX3A 4YCJA 2FZVA 1FS5A 2PYDA 5IS2A 3QLJA 5F73A 1TKCA 2MTBA 4KH1A 4J2TA 1Y7LA 1ZI6A 2BELA 4B2YA 1J8MF 3PI7A 2P2ZA 4W99A 1NM5A 2AHRA 1N9KA 5T8KC 1F0PA 5L7YA 1IWBB 1MGOA 3P26A 3QKRA 2JFXA 1PWEA 2O05A 4WEOA 1O6ZA 3W6PA 1ETHA 1V6SA 5F7JA 3HJUA 2AOWA 2PS3A 1Y4DE 4OLHA 1JIXA 1CY1A 5TQ0B 3G49A 13PKA 1ZRMA 2OP1A 1H0KA 1OZ0A 1LTQA 1OLUA 4RDIA 3PHBE 5H83A 5FWYB 4QJ4A 3QX8A 5DXAA 5LLSA 3WGZA 1NX6A 3W3AD 4NE9A 3NMUF 1O0BA 5KJ1A 1XO1A 2W2NA 1WETA 3P52A 1W96A 4IGEA 1E8NA 2H00A 4RPLA 1FQKA 3ITKA 4L9SA 4IUCS 4YDHB 3JD2A 3W3AA 3LA6A 4H2DA 1JBKA 1JHXA 4NBWA 1UKAA 2P9BA 3K9HA 1K7YA 3O4RA 4LQLA 2QJRA 2PCLA 5EJ8A 2AN5A 1NWHA 4K8RB 4OHMA 4UMVA 5F3RA 2AI2A 3SAJA 2H1SA 4DDKA 4O4JA 3WIBA 4F9EA 1LF5A 1IXZA 4W5RA 3CH6A 1DCTA 2CLOB 1YC2A 2IIQA 4UREA 1ENOA 1ICIA 3LT2A 4FDAA 1H4SA 4NPHA 2N1BA 4LRUA 4WCFA 4EY5A 1XZMA 3L1KA 3MGBA 3NI2A 4OQXA 1Z5PA 5HIJA 1GTL1 2DECA 3K5PA 2IZ1A 1Z5WA 2HOQA 4MOWA 4NX2A 4R1OA 4YUVA 5LQDA 2E1RA 2XQJA 1WS6A 2E4WA 1GAQA 2VJMA 3O83A 4IWYA 4GWGA 5C8YA 2ZE7A 4MK4A 4Z51A 5FWXB 4P4SA 3KVVA 5KHAA 1K3UB 1SKYE 4NQZA 1QP4A 3LDUA 1WOYA 1QPGA 4IDEA 4KWIA 1K98A 3K6SA 1RP7A 5JCOA 5AJVB 5ESWA 4RETA 3OPQA 2YCBA 5FI0B 5CDUA 2J87A 3R0QA 4N7BA 3MT9A 4ABTA 4QJBA 4A27A 1AV6A 4G85A 3I2GA 3L8DA 5D2CA 2G9ZA 5EAIA 4ZV9A 5A2GA 2XNHA 3I0NA 4UHEA 3CRMA 2ZI5A 2ZJFA 2R9VA 1I01A 4WADA 4AUMA 2XCRB 1P81A 4WZAA 1JJFA 1LWNA 3R7WA 1RRGA 1DIGA 5DMXA 4PZLA 3RG8A 2WA2A 3P2IA 1TI7A 2G5TA 2J3QA 2O7NA 3AESB 3GYBA 3DOCA 1TYZA 3ENNA 3R7NA 3UHFA 3GP8A 1PQYA 4UAGA 4IPTA 1VSTA 4DIEA 4B3SB 1IK4A 4KPYA 2OZLB 3BEDA 2I4LA 2X4LA 3G2HA 1X92A 4P3PA 5BWLA 3K1YA 3I9KA 3LYUA 3CF0A 1QGDA 1T9HA 2NZ2A 1VECA 1G8FA 2XRMA 3OM0A 3R6LA 3JPYA 4H6PA 5FUWA 5TMPA 1ILEA 4UM9B 1A3CA 4LTMA 4E7PA 4QDOA 4IXNA 4JL6A 4Q37A 1NY6A 1KBQA 1ZD8A 3OETA 1J42A 3C1UA 4QO7A 1FX0B 3RYTC 3W6NA 2Z6QA 2I4OA 2R62A 4PHCA 1N7JA 4TV8F 3HHPA 1C50A 3I01A 4ARVA 1XD9A 1XQYA 3QVMA 3RAJA 4MKGA 3UCEA 1F7UA 2FAXA 2PXAA 2PKYX 4ZP1A 1DE0A 2B7LA 3GUUA 4Y6GB 3BF8A 4OBEA 5AKEA 2YMQA 1E9CA 4G4SP 4LZZA 1OAAA 4I4CA 4FMCB 3DE5X 2CB0A 4PZ9A 4HXEB 2WZQA 1RWWA 4HVAA 3CUVA 3KIPA 4AJOA 3HHEA 2BZ0A 4HNHA 1I3KA 2RGXA 5SY9A 4CUJA 4R2XA 1CPYA 5C8YF 4W1PA 4HG2A 1IZ0A 4BNMA 3F6EX 3REQA 4RY8A 3RABA 2KBEA 2WJWA 2P79A 3L9WA 3JYQA 1I1HA 1NJ2A 3E70C 5IVIA 3DUWA 3SE0A 2JKZA 1DKMA 2PKQP 1S3GA 5BOVA 2BFFB 3JWGA 3PPYA 3KKEA 4KAAA 4KO2S 3OIVA 4QODA 4YK7A 5HEKA 4CIYA 2OHFA 4GM0A 4S2UA 3NU1A 5HPYB 2Y67A 1G7TA 5TIIA 1KMHA 3AF3A 1YL5A 2VNKA 5CM8B 4Z4GA 1DIOB 2I9PA 1ISFA 4FBLA 4P81A 4CTNA 1DQYA 3DAPA 3DPIA 2XZLA 1BO6A 5JEDA 5AXAA 4NEQA 2C2MA 5KMGB 1SXJB 3MWEB 4LWOA 1BDIA 2F8TA 1OA0A 2WZCA 4KYVA 1TZJA 3K70B 3QFTA 4TWZA 2EARA 3MJDA 4HXFB 1KERA 2QBYA 4J7CA 5JJIA 1A5AB 1ADFA 1R27A 4IV5A 4DG5A 3VAYA 2XF8A 5FBVB 4H1TA 4OQMA 4W8OA 2NVUA 5DYNA 2ZWPA 4P3OA 4WASA 1O6BA 1Y8CA 3PJEA 4MW0A 2W4IA 1RM4A 1S9HA 4W8GA 1RBQA 3W7VA 4BB9A 3SQXA 1WU8A 3GUZA 3STTA 4B7XA 3FYUA 1R15A 4EHNA 4G5HA 4KQFA 1SAYA 4DLWA 1VIDA 3C5EA 5CXUA 2Q8QA 3ST7A 1FYWA 1WUHS 4A8TA 4YJFA 3L4SO 4BLVA 1X0XA 2VTBA 1CV2A 5T6MA 2IUUA 3MJEA 4JNKA 1MRZA 3QVVA 1S2IA 3AKEA 4D3DA 4BVKA 2A88A 2P1ZA 3PDWA 4BO6A 2D5CA 2R1VA 4DEVA 2I78A 2GAIA 3NKVA 4ZZIA 5DLPA 4PU0A 3F7OA 3JTEA 4JI5B 3DO6A 1G0OA 3GRKA 3AUUA 4WY8A 4LV8B 4AICA 1CBUA 3Q98A 4R3NA 3UAOA 1Y1RA 1UFRA 3W7AA 3QX3A 4JLUA 4AWXA 1YTLA 2R8YA 3EMKA 4ZCIA 1P1CA 5EQJB 4NPAA 1BMFD 1Y3BE 4WCVA 1CUWA 1PD1A 3BRWD 4KO8A 2WJZB 5CTJA 2EBHX 1THMA 2DU8A 5DMHA 5KPDA 2CSXA 2YVLA 5KSOA 1C0PA 2FSPA 3PXEA 3L7BA 2HF8A 1YACA 3BRWA 3QEMB 1HE3A 5TV2A 3V4RA 3KHTA 1VG8A 2B6HA 4R7ZA 5EJGA 1VL0A 4NR0A 4UTXA 2ZBUA 3K73O 5GONA 1T6XA 5C2JB 4Q3KA 3PHCA 4ZGGA 4HFJA 4HPJB 3C6KA 2UAGA 4ENQA 1KWKA 2C31A 1G2QA 1JQEA 4QOFA 2H4XA 4OX9B 1ND6A 3AKDA 3ZWDA 3BXEA 4IJUA 1XXHB 1USIA 1U9JA 5AO9A 4D41A 2BFPA 5FWNA 4J1SA 2AN9A 5A0TA 1XPRA 1YL7A 2ETVA 1ZM7A 1YJAA 1T5IA 1QIFA 1ZIPA 5C4GB 1AKWA 3S0JA 4QU0A 2NQTA 2QRLA 5G41A 4PANA 2HRBA 3BGWA 4JASB 3H9QA 3N53A 3QXSA 4ZOCA 2XI4A 2YWFA 5DISB 3TI7A 4EKDA 1ZL0A 2QTTA 4D9CA 4G0VA 3QSYA 2V7TA 1TZ2A 2CXSA 1FVFA 4WINA 1QRSA 4L75A 4Z6KA 1S3SA 4XOUA 1NVUQ 1K1EA 2FZKA 2C5FA 1ZJWA 2RG7A 5K0SA 5BRAA 4Z7JA 4JROA 1II9A 4DCVA 5K03A 1OW3B 1A97A 3L7KA 3U0BA 1J97A 2A9KA 3ETHA 3GHHA 4ZAGA 1C3LA 1F0KA 1T5OA 1V6CA 2G8LA 4YV2A 1LX6A 2P4SA 3CRRA 1UBTS 2BHLA 4I9FA 4CL0A 2HNBA 4RQAA 4HEHA 5CB8A 4EFLA 4E1VA 1K3FA 3MCVA 1O57A 3D6AA 4OJQA 4QPZA 4ILKA 3WNDA 2QT0A 1OSNA 5HF9A 4OFXA 3NR2A 3V2IA 2WNIA 3DE2X 1ZK2A 1KAOA 1U8TA 1Z29A 2VZ9A 3VISA 4M7WA 2EDAA 4YRMA 4EO7A 5GINE 3GLQA 1RMQA 3JQAD 4WKBA 4W9NA 1QUEA 4YMWA 3EC1A 1Q0TA 3U9SA 4ALJA 1HM5A 5I01A 3SCZA 1P4SA 5LKRA 5IUKC 4ZARA 5AVKA 2JI6A 1ZUIA 4CXMA 1IRIA 4AMGA 1E20A 2OTCA 4FMDB 1RC8A 1KRHA 4G97A 3WWOA 5GONF 1R8JA 2VNIA 3ZXIA 3QWFA 2I2DA 3HQ4O 4FNAA 3QGMA 2VOJA 3ZU3A 3FBTA 4BO2A 4IGIA 3A9SA 3PGLA 3Q5EA 2Y2VA 2NXEA 3PNSA 4KE9A 4QUAA 5WRFA 1ZJJA 2IWHA 2ZVJA 2GCPA 4B7CA 1QX4A 5AMXA 2PX8A 4MVJP 2VG8A 3M1YA 3ZVRA 4D57A 5THXA 4EJMA 3ZS8A 4B35A 2IHNA 1G5TA 1U7DA 1VCHA 2I1VB 3LKBA 4P4LA 3ZDFA 2R0QC 1Y4ZA 5IYZB 3DV0B 1SUBA 3OU2A 2YIDA 2IPOA 3PPXA 4WKPA 1XZCA 2FSFA 5F35A 4O2BA 3R3SA 1OXUA 2YHIA 1B8UA 4R01A 2EBWA 3UJ9A 1VLLA 1XLTA 2HU7A 2GAFA 3Q6MA 4FJ2A 3LBYA 4PFJA 4R5MA 3STUA 3VTAA 3WBKA 2Q6TA 1N0VC 4F4UA 1JILA 1R6UA 2ODEA 2UVDA 3V3TA 1PN3A 4R4JA 3V8VA 3AEXA 4E5PA 1FDVA 4ESEA 3SXUB 3W5HA 4F4FA 4GOOD 3GRFA 5IEJA 2RGAA 1VKHA 4R68A 3SBXA 5A5GA 5I3CA 2AK3A 3P9NA 2BM1A 1NRXA 4Z8YA 1FTGA 2CHUA 2OVFA 5EWLB 2EP5A 3KQOA 2IYRA 2GBLA 5GOZA 2BSAA 4K1LA 2O8EA 4X8OA 3N2YA 1TM7E 2WSBA 3CTPA 3E81A 3B5IA 4K05A 3O2SB 3L79A 5CFPA 3NT2A 2JEZA 4TL9A 1UMDA 4G8DA 4E5VA 1FTYA 4TYMA 4L51A 3WC4A 4YPOA 4F4CA 3C3MA 2RGWA 4DIBA 1UOPA 1UXJA 4FI3C 3ZZ1A 3ZY6A 2BJVA 4BNYA 2A6PA 2KLBA 3HUEA 5TARA 1CHNA 1Z5ZA 4I4TA 3B2EA 3W5CA