3P1JA

Crystal structure of human gtpase imap family member 2 in the nucleotide-free state
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
190
Chain Sequence
b'SELRIILVGKTGTGKSAAGNSILRKQAFTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKGSLMDYMHDSDNKALSKLVAACGGRICAFNNGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase IMAP family member 2
publication title Crystal structure of human GTPase IMAP family member 2 in the nucleotide-free state
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 190
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3p1jA00
3V4RA 3I8SA 1XMSA 4WBSA 2F1JA 1PUJA 1QHSA 1VG8A 3BAFA 1N6OA 2J7PD 1KI8A 4A8JC 3AKEA 1JR3E 3EASA 1QHHA 3VFDA 2WTUA 4ZPXA 1IBRA 1TNDA 3SNHA 1N6PA 2HJVA 2ZREA 1U0HC 1VG1A 2CMKA 3X1ZA 2BJWA 1AM4D 4JLJA 1Z28A 1FMJA 4ZDWA 1NN3A 5SZIA 3SQWA 4NE2A 4M22A 2REBA 4RZ2A 1RRPA 4UNPA 1WBDA 5IK2D 1GSIA 3KL4A 4Q48A 3SFZA 4JKYA 3NWJA 1Q21A 1E2PA 5KDLA 5CJ2A 3UIEA 4BE7B 3T35A 1IXRC 5KHOC 5IF9A 1UEIA 3OAAD 2FFAA 3NHAA 5KSZA 3AUXA 2Z4SA 1NVVQ 2XSZD 3U61B 1TF2A 1X3SA 5CDFE 4BRWA 2IUTA 2PLRA 4ILEA 2J0UA 4HAWA 1A2BA 3CUEF 2ZETA 1N5IA 1AGRA 1Z2CA 3NIBA 1R7RA 2E9SA 2O8CB 4JIMA 2QQEA 2OAP1 3KB2A 2QI9C 4YMVA 1E9RA 2C77A 2RGAA 4OQXA 2BBTA 1QVRA 3U3KA 3U3JA 121PA 4CEJB 1L4UA 2JJ8A 3X1YA 1QHXA 1YJ5A 2OSBA 1E1QD 2GA8A 2ZJ2A 5JCPA 1NJFA 3ND9A 1FP6A 2VYFA 2JDIA 4DRZA 4DSTA 3K0FA 5L3SA 5GJBA 2CL0X 1NIPA 2ZU0C 3I62A 1NN0A 5JLJA 3QEJA 1Q0UA 1W0JD 2GZHA 1GTVA 1Z0AA 1XPUA 4IJMA 4BEBA 4C0SA 4ASUD 2IX3A 5CB6A 1SVLA 2ZS7A 4JVLA 2K5UA 5FPSA 2QBYA 5F3WB 3AUYA 1RRCA 5FH9A 4TLEA 2VP2A 2IYVA 2ZRHA 3AB3A 3AVUA 4M1OA 1BKDR 2PT5A 4Q4JB 4PQFA 1P3JA 1BOFA 1W7AA 5E95A 1MOZA 3LDAA 4DEXA 3AVOA 2ATXA 3GLGA 3ZQJA 4C0LA 2H16A 4P32A 4Q03A 2NZ8A 2ZPTX 1P5ZB 3NBYC 4KLZA 2JLVA 1T5IA 1L7VC 3T06B 2ZYVX 2QPTA 3AGQA 3EA5A 4HAYA 1NN1A 3NBZC 1GOTA 1W47A 1VCNA 1N5LA 2AKAB 2D62A 4AIIA 1U8ZA 2ZRPA 2ZRLA 2RMKA 3EC2A 1UFQA 4XVQA 2BJVA 2CCGA 1MKYA 3AF1A 3FPAA 1ZUIA 4WXRA 3I3SR 3FMPB 2FEOA 1XJQA 4OK5A 4LCBA 3MWYW 2DWPA 1Q12A 2A5FA 1A82A 1HTWA 5J40A 1SGWA 1OPXA 4PC2A 1WA5A 4TSFA 4L5BA 1RC8A 3K0SA 1P73A 1QF9A 1HQYE 3D31A 4TYYA 2RCNA 5LD2B 4HAVA 5DN6A 2QAGA 3LW8A 2EFEB 3ZDQA 1W4AA 1QHYA 1DAIA 2GVDC 3CB4A 1TEVA 4LBVA 4XTRA 4DDUA 1KMQA 1G5RA 2AFIE 2RGCA 3AKYA 3GJXC 1CS4C 3GLIB 2YINC 1DAFA 3H4MA 2IXFA 3CPEA 5TVKA 4CF7A 4IRUB 2GTPA 1Q20A 2FPKA 1K8RA 3HJNA 3CF6R 2KJQA 4G5GA 5JRJA 1K5GA 1ESMA 4PZYA 4Q4AB 1GM5A 3ZD7A 1OKKD 2HUPA 1FOEB 1MR3F 2VP0A 5B64A 3T1OA 4B3BA 4IDHA 1Q3HA 1LF0A 3FE2A 3TH5A 4EDHA 2V3CC 4C7OB 2N46A 3SC3A 2QAJA 1AJEA 2VHTA 1S8FA 1XD2B 3BH0A 1G8FA 1KO5A 2IYYA 3FKSA 2A30A 2BMFA 4ZO4A 2D3WA 3A8TA 3VR3A 2BMDA 2OXCA 4JBXA 4ABYA 1DE0A 4G5RA 4AYWA 3LVRE 5EZ5A 1ZNXA 2CL6X 3IHWA 3FTQA 4R71A 4HUTA 3R9IA 4ESHA 3P27A 2QN6A 3NVAA 5J5CA 5JHGB 2EQBA 2PX3A 1D9XA 3VMFA 1RE0A 221PA 4DLRA 2YWHA 2XZOA 4NYIR 2UZ3A 4DDVA 4TTRA 2IC5A 5DI9A 4DBLC 1ZAKA 4NHOA 4M9ZA 1HE8B 2WSSD 3GLHE 4M8NE 4YQFA 2IYRA 5FUYA 2FN4A 4D80A 1FZQA 4HEJA 3DMNA 3IILA 4MUAA 3HU2A 3LO5A 4B76A 3QKSA 1M7GA 4DLUA 4IOJA 1G3IA 1W48A 2FDCA 4DLXA 3B1VA 1LB1B 5CK4A 5E3HA 4LDJA 4BLRA 5M04A 1RRFA 2PH1A 1WE2A 3NBFA 3I8XA 5FFMA 3VQTA 3SJZA 2GEUA 3OZXA 2YWFA 4V0LA 2V1UA 1VG9B 3BFVA 2BM1A 3QEOA 2ZRBA 2AWOA 2QAGC 3HYTA 2J45A 4LSGA 1JEEA 2X77A 2WWIA 5KO2A 2G83A 4GMDA 4V0KA 3KXIA 5CIWA 1F2UB 2ZJ8A 4RZUA 4A8JB 2R44A 3BH6A 4RJLA 3THXA 2QPOA 1G7SA 4IVPA 4U02A 4ZI3A 1NVUQ 3NDBB 2QSZA 2BEJA 2JLWA 3B6EA 4LJYA 5BQ5A 1E99A 2ZROA 3OFNA 5DH9A 3DOEA 4WA7A 3CRQA 3QG1A 1CLUA 3CX8A 2FFHA 3U7FB 1TQ6A 3B85A 1E4YA 2JAQA 1ZCAA 4AC9A 1KY2A 2EWWA 1XJCA 3VX3A 1YHNA 3SJAA 1TADA 2VIIA 2JLYA 5JJKA 4QGHA 2PCJA 1GDDA 3OIVA 1F48A 4EQ6B 3CM0A 4F4CA 2J0QA 1UKZA 2IUSA 1KHTA 4G5SA 1W0KD 5F9HA 1N0UA 3I72A 4FI3C 2GHIA 1G1MA 1KI2A 1SXJA 1GILA 4Q66C 3KKQA 2W2TA 4DCVA 2BM0A 2MMCA 4FCWA 4GOJA 1NG1A 2X19A 1ANKA 1CR2A 1W1WA 4DUGD 2RKOA 1E94E 4C0BA 3NC1C 4G01B 2ZI6A 4KHZA 3VHXA 4AWXA 2W6JA 1E79A 4DHEA 2F55A 1LS6A 3ADCA 1SVIA 5JEDA 1U9IA 2ZE6A 2ONJA 2XZPA 3CO5A 1Z3IX 2KB0A 4LBYA 2NG1A 2DFLA 1TL7C 1YVDA 3QOFA 1S3SA 1E2JA 4LJ4A 2FOLA 3CPJB 2JJ1A 5HZHA 4B47A 4PSVA 2G88A 4TYQA 2X2FA 4BLQA 4Q5IA 2PCLA 4A6PA 2IS6A 2QPAA 4B2IA 2F43B 4F91B 1JQJC 4IEEA 4ZDJA 3SS8A 2GXSA 1OJLA 3AF3A 1DS6A 2P5SA 3ADBA 3QKTA 2GDJA 2ODWA 2QG6A 4LV5B 2GJSA 2ZRGA 3BRWD 2FU5C 1OB5A 1DARA 2B8WA 2W83A 4B2PA 4UXIA 5J4VA 3IHLA 4QKQA 4Q1FA 1W4RA 2BVNA 3EA0A 1CBUA 5KDDA 4JYBA 4LPKA 2O8CA 5E7JA 1H65A 1PLKA 2AHOA 5FTNA 1CJKC 4M9QA 1PJRA 4CEJA 2QL6A 4A0FA 4MGYR 1P7CA 3OIYA 2CHQA 3R8CA 5BYJA 1XF9A 4OK3A 4CT5A 4IHQA 3PEYA 3CX7A 4PPFA 3RWOA 3F5FA 1KSGA 4LYJA 2FPLA 4FMBB 1MRSA 2OUKA 2YV5A 3LBIA 3AF4A 3TVDA 5JJLA 4PFSA 2YVUA 3A6PC 5E7MA 2OT3B 1LFDB 1UAAA 1NKTA 4OK6A 1SXJC 5LBIA 5EE1A 4EUNA 4L9WA 4TL7A 5FBWB 4MYUA 1F6BA 4A2QA 2EVWX 2E87A 4DDTA 3GPLA 2QQ0A 3TR5A 2Q21A 4U7DA 2J0UB 1TX4B 3KTAB 5TB5A 1IN7A 2KWIA 4PC7A 4Q4JA 4AKEA 1ZW6A 4AURA 721PA 5JZVA 1U81A 1E6CA 3DVLA 3W3ZB 2JIZD 2VSOA 4UNNA 5TDHA 3RS7A 1GKYA 4O3MA 1COWA 3THWA 2P6NA 2B7BA 2RB4A 2Q9AA 1GAJA 3LAWA 2VHCA 1U9IC 1XTJA 4M53A 3RS5A 1FL9A 3HU1A 2CLDX 2F9MA 3P1JA 4NBSA 4KYIB 3PVSA 4EPXA 3CNOA 1EGAA 1KOFA 5L3SB 1OHHA 1G5PA 4NYJR 1T9HA 1QG4A 4US2R 3QVVA 1T91A 1S1MA 4R7ZA 4BUJA 5H8WA 2LKCA 2QUZA 1XCGB 3ADKA 4TYWA 3KFVA 2NPFA 5AJXA 3VTKA 2ZI5A 1XTSA 1VCMA 2GJAA 3C15C 3KQKA 5FL3A 1W2GA 1E2LA 3AVWA 5J4HA 1FTSA 2YC4C 4F93B 1YZUA 4D0LB 4DJTA 2GCOB 4LGMA 3P4YA 3Q72A 4RD6A 5EP1A 1ZJ6A 1E9CA 3SHWA 2IUUA 1VIYA 3R9XA 1MH1A 2W00A 5AUPB 4JT2A 4Z1MD 4GPTA 2QGNA 1ETUA 3AKDA 4Q9IA 4ACBA 3AQ4A 4ACAA 1LNZA 2VEDA 5B30A 1GRNA 3GLIA 1M7HA 2OEPA 2ZE7A 2DWQA 4HZIA 4DSOA 1QG2A 1IONA 4TTQA 2MSDB 1TUEA 2ZITA 5CIQA 2O8DB 2RGDA 2FE4A 3L0SA 1G9XA 2I4IA 1W44A 1CULC 1Q57A 1Z0DA 2WJJA 3G82C 2QT1A 3NKVA 4Q4AA 3E2IA 1KO4A 4CEIB 1W2HA 3E70C 1YZNA 2AR7A 2FWRA 3CNNA 4Q18A 2CNWA 4QC2A 5KTYA 4F4JA 1ZNZA 2HV8A 3GLFB 3WYGA 3MLEA 4IFEA 4RD4A 1G3MA 1XD2A 4TMKA 1Q44A 1A7JA 2WWGA 2GCNA 1RRGA 2LKDA 4IDOA 4LHYA 5H70A 6Q21A 3QJYA 5EE5B 3A1WA 4L4UA 4C4PA 2ZRNA 1H8HA 4DIEA 2VHQA 3OEHD 2D2EA 1CJMA 1DPFA 1G3QA 1XCPA 4PC3A 5DIFA 1AZTA 2D7CA 3AEZA 3U6KA 4N0EA 4BASA 1I4TD 3C16C 1IXZA 5C4GB 4P0TA 1J7KA 3EX7C 3SN6A 4A9AA 5F98A 2ZIAA 2X8AA 2I1VB 4XJXA 3L2OB 4JS0A 3K0AA 1Z29A 3Q7QA 1EFUA 3QNUA 5JHHB 5GADl 2IYUA 2PMKA 3WMEA 1II9A 3OEED 3KKOA 1M34E 1ONBA 3DOFA 3FFBA 2CEAA 1WDTA 1MT0A 3FVQA 4NYMR 3NDPA 3X2SA 2Y8EA 4KVAA 1FX0B 1WB9A 4QBHA 3EZ2A 3RC8A 3WRYC 2DFTA 3MJHA 4XWOA 4FWTA 4JT4A 3PV0A 4NTZA 4MKFA 2KI5A 1D6JA 4Q4HB 3WYAA 4QFMA 5FBRB 3RSOA 1KK1A 2RHMA 4PHGA 4LPSA 3TUJC 1DAEA 5P21A 4I1OA 3V9PA 1D2NA 1X1SA 1GP2A 3A1VA 2HXYA 3KUDA 3CX6A 1P4SA 2H7VA 3QXCA 3HU3A 5FI0B 3ZVNA 1W36D 1KSFX 2FFQA 3QXJA 2HXSA 5LD2C 2IWHA 5FOVA 5EUMA 4NCKA 4OL0A 3RS2A 1H8EA 1F2UA 2H8KA 4R2IA 4A8JA 2WPDD 5E7IA 3GEHA 4URYR 1DG1G 4KVGA 5KPDA 4LJ8A 2CJWB 1NBMA 3P4XA 4Y0AA 3W6PA 2IYZA 2Z6VA 1KTVA 5J4LA 1E32A 4PQRA 4YDHB 5G3ZA 1CRQA 4RZXA 1TAGA 1JPJA 4HLUA 1JR3A 1OH7A 3BXZA 5FOSA 3WRXC 1OH8A 5JS8A 2GEDA 3GFOA 1T3LA 4YMTA 2BBWA 4GSYA 2DFKB 1C1YA 3QPUA 4Q01A 4EQ6A 1P62B 3SI7A 5AUNB 5J47A 2ZVPX 1JJ7A 3THOA 3AVYA 3K8YA 4HB0A 4WIAA 2O8BA 1RFLA 1YQTA 2J7PA 2ZRCA 1KJYA 2R6CA 1J8YF 4LV6A 1GZSA 3PXGA 1XEXB 4A0GA 1FNMA 4M9XA 4OQNA 3L0OA 5LB2A 2XNSA 1XZQA 4NP6A 3I73A 4Q1BA 4JLPA 3MWJA 2BDTA 1UEJA 2HCJB 4BECA 1UDXA 1UF9A 4KFUA 2HF8A 4BQSA 5JWOA 1T5LA 3OESA 4GZMA 4TYNA 1XWIA 1T8UA 1KI4A 4NCIA 2REOA 4IDQA 3IEUA 4FMCF 4H9GA 1Z06A 1N6KA 3EIHA 4LOAA 3CONA 5KNCA 2JASA 1L4YA 2VL7A 4B74A 1GITA 3BB4A 2GEVA 5FL7D 4KI0A 2DR3A 1FPMA 2FH5B 1CKEA 3U4QB 2CLCX 1C4OA 1GFIA 1XXHE 4H1UA 4IVRA 4W5WA 2F43A 4IOKA 2IA5A 3HWSA 5DI3B 2PT7A 1QDEA 1HE1C 1OFHA 5IDVA 3U7GA 2Z0MA 1GKUB 5JSZB 3IQWA 4JLVA 4JVNA 1LS1A 2IF0A 3QKUA 3KQHA 3CBQA 4EFNA 1MV5A 3TUIC 1S1CA 2NQ2C 3LWNA 4MUBA 2GXQA 3ZS8A 1G8YA 2C96A 4HLCA 4OJQA 2RGBA 3EZFA 4QBGB 3AVQA 3CRVA 2CCKA 5EE9A 3K9NA 1NMZA 4HUQA 4D4MA 3TLXA 4RFVA 4W7SA 1CF4A 2HCBA 2BBOA 4I1VA 3MRSA 2OLJA 4JSTA 4D81A 1RYFA 1M8PA 1FUUA 1YKSA 3S1AB 3WBJA 2OAQ1 3PENA 2VHJA 2WWYA 1DEKA 3IIJA 1R4AA 4QNMA 2XITA 3MUFA 2MSCB 1W4BA 2XX3A 4RVCA 4JBYA 3CH5A 2YJTD 1Y3AA 3WMFA 4ZCMA 4HLUC 2AK3A 1G7TA 5EXTA 2V7QD 3GFTA 4TT3A 2O52A 2BKEA 3X1WA 2NPIA 3UATA 2ZM5A 1P9NA 4TL9A 4P4SB 2X2EA 1UBCA 2CK3D 3A4MA 3DL0A 5J4YA 3BFXA 2Q3MA 2C5LA 3HR7A 1E2FA 3OIWA 4EAQA 1NP6A 1JECA 1ZBDA 3TK1A 3IDQA 3ZQ6A 3SU8A 2FZ4A 4NH0A 3PFIA 4KSBA 1E9BA 1NVVR 2C78A 1E9FA 3OE7D 4XSGA 2GK6A 5L3RA 4BZXA 4B3FX 1AN0A 2WSMA 1K5DA 2FNAA 1DVRA 3KTAA 4EKDA 3B2EA 1Q22A 4R2HA 1ZNWA 1XZPA 4LJ9A 3LXXA 1G21E 3B9QA 1KI9A 2OCPA 3IPXA 4QG7A 3V4FA 3QF7A 4K8OA 4QXAA 4GOXA 4WZAE 2A5YB 2P6RA 1GRQA 3BJIC 4LUCA 3LQQA 5AJVB 4C0QC 2JATA 2WJYA 2B6HA 2QY9A 2XJ4A 2ZR0A 4YMUA 4G3XA 1G3RA 4LRWA 4LI0A 5HR5A 2P2LA 4M4SA 5DO9A 3DMDA 3E1SA 2AD1A 1EFRD 3O47A 3U3OA 3KJGA 1YRBA 2O5VA 2XOKA 2QMOA 4B3XA 1XNJA 4JLBA 2YNMA 4PO1A 3PG5A 4DLSA 4BGDA 1XB2A 3KJHA 3PUZA 5TY0A 4S2EA 1W46A 1OYYA 1R0XA 1M74A 4JBWA 3B7GA 2R2AA 5GVSA 2BHRA 2PMDA 4TMZA 1XD9A 2NO9A 2GCOA 4K81B 3AP2A 1AQUA 3Q5DA 2Q3HA 2XGJA 4HAXA 4BFXA 1IY2A 1S2MA 3ASZA 4TL6A 4A36A 1OIVA 1ZC3A 1OKKA 2GJKA 1G291 1HEIA 2GJ9A 1GWNA 4RFSB 3EZ7A 2G9NA 2QA5A 1R5BA 2JLZA 4HB3A 1J2JA 2WWWA 3UWKA 1ZM7A 2O8DA 3THWB 4MRNA 4BFTA 4JVSB 1G3UA 2WKRA 4NU0A 3WHLA 4CEIA 2ZI3A 1T3HA 5FOWA 3HPRA 3IO5A 5JJIA 3D3QA 1VYUA 4QHSA 3GLFA 5AWFC 1SULA 3CZPA 3MFYA 2ZSBA 4FMCB 1GKIA 2AK2A 3ETLA 2D7DA 1N6HA 5FTJA 2W2VA 4PPNA 1EWRA 5KNDA 3B82A 1P2VA 3ZVRA 3PEUA 1N6NA 1E2KA 2WJIA 2J5XA 3VX4A 3D6TB 3BGWA 3TR0A 3EIQA 1P2UA 4UJ5A 1OFUX 2P67A 3SBDA 1QVAA 5HE9A 1E9EA 2FSGA 2P5TB 1KZ7B 2FF7A 2ZTSA 2H17A 4GNKA 4MDEA 3FDIA 4HATA 5CLLA 4K46A 1NMXA 1Z0KA 2XTMA 1NL3A 5CJPA 4B34A 4BWYA 1D2EA 2OFWA 3O8DA 2C03A 4NONA 1WBBA 1G4UR 4ON9A 5FPYA 4DCUA 2JDID 2OG2A 3JVVA 2ZYWX 4V0MA 4M1MA 5EE3A 4TN1A 1FX0A 2KBFA 5H68A 2XXAB 1NN5A 4MRRA 4A1FA 5KDOA 2RGXA 3MAAC 3QI2A 1ZIPA 3C5CA 4Q4HA 4MDFA 1Z2AA 2TMKA 4HYYA 1E2MA 2WOJA 1XDBA 4F4IA 5C4MA 2EU8A 3Q85A 1OSNA 3LA6A 2D4HA 2H57A 3RLFA 2ZSFA 3TVTA 2NTYC 3UMRA 2GVZC 5FPTA 2IS4A 3CKLA 2BWJA 1SVKA 2W0SA 3GJ7A 2YZ2A 4OI0A 2O8FB 5DHAA 4Z8YA 2XTZA 821PA 2H18A 1ZP6A 3P20A 1KSHA 1RIFA 1GNPA 5K8IA 3VR4A 2DYKA 2CJWA 2PZGA 1XTKA 1FFHA 3L82B 1RJ9B 2O8EB 3K0AB 2PEZA 3LW7A 4NCNA 4DSUA 3MG9A 2F3TA 5KOYA 1QBKC 1HT1E 4I99A 3W3AA 4Q21A 2ERYA 3FOZA 2MSEB 3RABA 4JL5A 3LBNA 3U3RA 4CDGA 421PA 2YOFA 1D8TA 2PL3A 2BIFA 2ZR9A 3Q9LA 2CVFA 2G1KA 4KFSA 4MGZR 3TW4A 5C2JB 4TSFD 3GLGE 2HLDA 4HDOB 3M6AA 2N42A 1E9SA 2AL7A 4Q00A 3VR1A 3Q5EA 2BOVA 2B8TA 4DUGA 3U5ZB 1YR7A 4QRHA 1XEXA 4MQBA 5DN6D 3RS4A 3PITA 3FHOA 3HPQA 4ITRC 3I92A 2ZSEA 1JALA 1G19A 2VHUA 4RSGA 1CU1A 1R8SA 3R7WB 3A37A 3BBPA 3FHTA 4LC0A 3SE0A 2EFDB 4HSEA 1II0A 3C8UA 4WZBE 4GBMA 2QE7A 3EZ6A 2W0MA 5K8TA 5SZJA 2DPXA 5DE3A 5H1YA 1E0SA 3U7EB 2HYIC 1AKEA 2V8OA 1P60A 1SHZA 2FGJA 2JJ2A 2QMEA 3RRNA 3PCRB 5JBQA 1RYHA 3RSLA 1ZIOA 2P65A 1R0YA 2PBRA 1T3SA 3QUSA 4BLOA 3FB4A 1SKYE 3U4QA 2C98A 4JSYA 3CRRA 2HF9A 3TSWA 1IJEA 3QG5A 1TTTA 4B33A 3GEIA 4KITB 5DI3A 4CVNA 4PC1A 2IYXA 4OQFA 3FMIA 1R8QA 3AKCA 1VPLA 3FKSD 3V00A 5JSZA 1Q1BA 1LY1A 4PTLA 4Q1DA 4JVMA 1G5TA 1GNRA 1VECA 4NCHA 4PC6A 4D2IA 4AK9A 1Z6YA 1XP8A 3O8RA 5J4KA 1UBFA 2O0JA 3PEWA 4YONB 2O8BB 4EPYA 1I4LD 2CHVA 2JLUA 1A1VA 4JKIA 3WP0A 3ZVMA 3BD9A 4JLOA 2DB3A 1HUQA 4PO8A 1XJ0A 5JI3E 1OXVA 2PX0A 2WWXA 4OHZA 2G6BA 4MRVA 3ZZUA 2QENA 1N6LA 2CVHA 2BCJQ 4MKIA 1KI1A 3S1AA 4LYHA 2AKYA 4I81A 4LZZA 3TSOA 3RVBA 1GRRA 3DZDA 2WVJA 3FYHA 5HPYB 3EC1A 4TQ9A 4Q7LA 2O0KA 2OFXA 3HP1A 3LV8A 4XWAA 4A2WA 3B13B 1Z0JA 4XVUA 3K53A 4BLPA 1EWQA 1XD8A 5HTKA 4IXNA 2OCYC 3UK6A 1OT3A 4AD8A 2ANBA 3FWYA 3U60B 4BRUA 3N2IA 4MYHA 3UPUA 4P4SA 4UNSA 4LC1A 4KLNA 1SVMA 1HA3A 2VF8A 4OHVA 3VR5A 1KJZA 1EXMA 3C41J 4ZCLA 2JIZA 3GCGA 2IK8A 4IDNA 4H1VA 4JJZA 3QKRB 1HV8A 4L16A 1VG0B 3ZH9B 3AH8A 4ZKEA 2J0VA 2KBEA 3SBEA 1TUIA 3IPYA 1E1RD 4ARZB 2G0TA 4QM6A 1HURA 3B1ZA 2XNDD 2R6AA 3EWSA 4R98A 2WAXA 3AP3A 1OB2A 2YKGA 4MGKR 4GT1A 4HUQB 4D4KA 4ZDIA 5BN3A 2W6IA 2V4ZA 4M0LA 4PHHA 2P6UA 4PSAA 3U44B 4IXMA 4PAQA 4QGAA 5JRZA 3OFND 4V03A 1U98A 1N2CE 1N25A 1OFTA 1E2NA 5GJWC 3T1TA 2ZU6A 4XSHA 5JS7A 2PJZA 5G41A 1PZNA 2HDNB 1CR1A 2CE2X 1AKYA 2ZUDA 4ZI2A 1BMFA 5FBVB 3VU9B 2ZRKA 1ESNA 3E5HA 3SR0A 1N0VC 2JLXA 2KE5A 3EXAA 4C9BA 1E2DA 1GNQA 4HB2A 3W5IA 1X1RA 5CLQA 5B58C 4WZ6A 4CZ2A 3BK7A 4HDQB 4QBIA 4OI1A 3N70A 2ZAOA 5KSPA 3O8CA 1V43A 1SXJD 3F3YA 1US8B 2WZQA 3QVUA 1T8TA 4Z1MA 3NTUA 4DWJA 3KQNA 2W2XA 4RY2A 4Q47A 2CLSA 3RC3A 4B3DA 5L3VA 1K6MA 1KZGB 4PPGA 2KSQA 3U6BA 4GOKA 2FJUA 4ERNA 1J70A 4PZZA 5HCNA 1RW4A 4AG6A 3NXSA 1Q1ZA 1Z6XA 3FFAA 3LBHA 4A0RA 4AYTA 2V6IA 1E79D 2MMGA 2W6JD 4MYCA 3RRMA 1XBTA 3DKPA 4KXFB 4RFSA 3GFPA 3AVTA 3W8RA 1SXJE 3P26A 1Y63A 1EK0A 3SYKA 1YZTA 2F3RA 4QJ3A 3B8HA 3AM1A 4EFMA 1YRAA 2JJ1D 3QF4B 1TQ2A 3FKQA 1ZU4A 2J59A 4TLBA 5EUQB 1XEWX 2JLRA 2FX3A 2WJVA 2ZSDA 4LJ5A 1AZSC 1Q1EA 5D3QA 1AQYA 4OYHA 5TMPA 4A82A 3K70C 2Z43A 4UNQA 5EXXA 3RRZA 3GJ0A 1XMIA 4QGFA 5EZ6B 1EX7A 3WBKA 1OH6A 4NPHA 1OXSC 2GZDA 2DHRA 1IQPA 1TEXA 4FW9A 4TZ0A 2ZANA 4HAUA 5EXPA 1JR6A 8OHMA 3RS0A 2R62A 2WICA 1W4CA 5JWRA 3WYFA 1G16A 4HI0E 4RCYA 5KUTA 3FMFA 1HQCA 1JEDA 2CHGA 4Z54A 3IKJA 3SDZA 1FTNA 2EFCB 4RD3A 5G40A 2FA9A 4Z51A 4JMPA 2C8VA 5KYKA 4WAUA 2NMVA 2GXUA 2JLSA 2OBLA 1EESA 1IHUA 3KZ1E 2QRNA 1KK3A 2J9RA 1QHIA 2FGKA 2VP5A 3B78A 2XXAA 5FBLB 4RD0A 1HH4A 4O2RA 4MA4A 1F60A 4F38A 4B6EA 2QGZA 1P9RA 3MD0A 3GLHB 4DB2A 3DKVA 3VNUA 4XD7A 3WY9A 2ONKA 5FUWA 4CYMA 1CJUC 1UKYA 4QJ5A 3J81k 2OFOA 3R8FA 4HLDA 1KDRA 1CTQA 2WMNB 4G0NA 1KI7A 4HB4A 4I4LA 2QTVB 3ZIAD 3ZS9A 5TV2A 4B75A 3WNDA 2O8FA 4Q1CA 4NZYA 1NI3A 2GRJA 2GBLA 1R5OA 2ZE5A 1SZPA 3T34A 5HKKD 2ZJYA 3Q3JB 521PA 1CIPA 1E0JA 4YC7A 4F92B 3K9LA 1AS3A 4BLTA 1U0LA 1CRPA 1KI3A 1COWD 5HZKA 2WMOB 3SYNA 4RKFA 2P3SA 3QE0A 5DYGA 2VA8A 2ZRMA 4PXAA 3A1SA 4Q9LA 1RJ9A 4POAA 2O8EA 2PZEA 1WF3A 1FMLA 1QRAA 3TQFA 1IN8A 1J8MF 3CWZA 1OHHD 5JWHA 5FOUA 2Q0HA 2IWRA 1F3OA 1KK2A 4D25A 5JCZA 4II7A 1VTKA 2DCUA 4US0R 5SZHB 2OBMA 1X6VA 2F1IA 4GFDA 1BYUA 2XB4A 3KB1A 2GWHA 2Q9CA 3PEVA 5A4JA 3TQCA 3DHWC 1PV4A 2YC2C 4DVGA 3SJBA 4TLDA 5CM9C 3W6NA 3BORA 1NNEA 4RD2A 2J0SA 5D3MB 1X8JA 3R7WA 2R8RA 1XEWY 3B60A 2IHYA 2OHFA 3AGPA 1IN6A 2FG5A 4NYMQ 1YR6A 1TF5A 2VP6A 1I4DD 4YXWA 5JFGA 5FL7A 4EIWA 1ZM4A 2ZJOA 2IF2A 1J90A 4JJKA 4TQAA 3CR7A 1LV7A 3GJ6A 3DM5A 3M4YA 3ONWA 2F7SA 4IW3B 5TXGA 1G17A 2NO1A 1Q3TA 2CNWD 1WMSA 2A3RA 2V1XA 3C5HA 4M1SA 1D5CA 4BFVA 5JEEA 3KDSE 1CJVC 5DNYB 3ZJYA 4UKDA 2R6GA 3GLIE 5G53C 5AK0A 3KJEA 1W36C 2D06A 2IW3A 5B2ZA 2ATVA 4DIDA 4ZKDA 3CF0A 4DB4A 2QTHA 2WV9A 1U90A 3VKGA 1H8HD 2C2HA 5LPNA 5EP4A 2IYLD 4WOPA 1DOAA 1AS2A 5AJZA 5GVRA 1P72A 4FMDF 4RKEA 2GF0A 2GJ8A 4GL2A 1E0AA 1EX6A 1T0JB 3T61A 1G6OA 3K0CA 3M0EA 4DKXA 3L8YA 1KDOA 5C1BA 2GBLC 3CIOA 1KMHB 1OYWA 5CDFA 1T6NA 4I1SA 1J99A 5CYPA 5K8LA 2B7CA 2ORIA 1P61B 2YYZA 1O87A 2OM2A 2RGNA 4PHFA 2DFNA 5DLQC 5BN4A 2Q3FA 5IK2A 3K0EA 4GMXA 4GZLA 4QBFA 3A1TA 3CRW1 3L8ZA 2A9KA 1OIXA 3KKMA 4PAOA 1N6IA 2J3EA 2VLIA 3DZ8A 1OE0A 3IBGA 3LY5A 5KNBA 3WHKA 1XFAA 3OAAA 3SQXA 1BS1A 4YMSA 2GAAA 2UZIR 1R0ZA 2XSZA 4LHZA 1XRJA 4X8OA 2CE7A 3UG7A 2XB2A 2VPPA 5FOXA 3IIMA 1FQJA 4AKIA 3CLVA 1XTIA 2ZSAA 4PO9A 4M1YA 4AYXA 4E07A 621PA 2ZJZA 2HJGA 4HLQB 4TTPA 3A36A 2OLKA 3WNBA 4DCSA 3QQ5A 2AXNA 3AF2A 2A5GA 1Z6AA 3QKRA 1LVGA 3H1TA 1WXQA 3BC1A 1P9WA 2BEKA 2NZJA 4KBGA 1IY1A 3REGA 4ARZA 2IYSA 1KDTA 4AKGA 3DO6A 1H8ED 1PLJA 1ZMXA 2F1HA 3QIAA 1X8KA 3H0KA 4NDZA 4PZLA 1Z6GA 1E1QA 2GAOA 5E4FA 1UBGA 1NBMD 2REXB 1RZ3A 3U44A 4Q7KA 2ZI4A 1IY0A 2ZRIA 3DEFA 5BWMA 4G5OA 4FCVA 3NBXX 5IT5A 4LJ7A 4A15A 1IAQA 3MMPA 1ZM3A 1VMAA 3TIFA 4XH9B 4MKGA 1W5TA 1W0JA 2O0HA 3CF2A 2VF7A 4M9SA 2A78A 3VU9A 3PUYA 2ZRFA 3QXSA 5BYKA 4TMTA 2IYWA 3L43A 5CM8B 4ASUA 4HZUB 3K70B 4C2UA 4B73A 4PSKA 4Q02A 1NBME 5LDDC 3GD7A 1GVNB 5F9FA 4WXPA 1US8A 1II8B 4ZDKA 1NG9A 1EFTA 3TRFA 1CXZA 4JL6A 1KNXA 4XVRA 3LLMA 2WM9B 4KCGA 2OO7A 1UM8A 4PAMA 5FPKA 5B57C 1A5TA 4KYUA 3VR2A 3C4JA 1JAIA 4GP6A 3K0CC 1G8HA 4Q9KA 4EPVA 2GZAA 1M1YE 2IYQA 1G64A 1G8GA 2VP4A 2F6RA 1A2KC 1GL7A 2OZEA 5FPHA 3D8BA 1TQDA 3AF0A 4AKHA 2GK7A 1IXSB 2VSXA 3QXXA 3BE4A 5DGXA 3ASYA 3I1FA 3A4LA 3LX5A 1XPOA 2HT1A 2RGNC 2RH5A 2WJHA 2J7KA 4URUR 1HT2E 3QF4A 4GP7A 3WNCA 3RHFA 1PVOA 1G41A 1E2HA 4DCNA 1NIJA 2XEXA 3K1JA 1E2GA 2IXGA 3B5JA 4MYTA 3TBKA 2ZRJA 3EG5A 3C7KA 1YZKA 1YR8A 1U99A 1MO3A 3K09A 4TYPA 3GQBA 4EJSB 1E3MA 3LLUA 2J46A 4LWZA 1ZUHA 2HEIA 4J0QA 2BKUA 1PUIA 3QENA 5C46F 2SHKA 3IIKA 3MSXA 5G3YA 3BB3A 2OBNA 1S3GA 1NLFA 2QT0A 3B1WA 4HDCA 3VNVA 2ZEJA 1OF1A 3BH7A 1BIFA 3LD9A 2QP3A 2N1BA 3TMKA 1JAHA 5JECA 4D26A 5BXQC 2WAYA 5KU1A 3I5XA 4A6XA 3T1VA 2YOHA 1R6BX 2ZVQX 4FMDB 5DHFA 5F2EA 4KBFA 1D9ZA 1SKQA 1XEFA 2ZYTX 3ND8A 1JB1A 4CIDA 2GCPA 4OBEA 1S9DA 4JLKA 5EQTA 4TT3D 1OXUA 4OI2A 3N2EA 4UQOA 4F7WA 1UKEA 3B9PA 1N5KA 1W5SA 3GLHA 4LV8B 3CH4B 4BFUA 4W5JA 2ORVA 3KX2A 2BMEA 3KJIA 3SHFA 4GDFA 1N6RA 3KKNA 1P2SA 1HYQA 1XMVA 2C95A 3TKLA 2QMUA 3W9YA 4U5XA 3FHCB 1DO2A 4DLYA 1G7CA 2ZS9A 4LJAA 2GESA 4A0HA 2H1LA 4KJZA 1FP7A 2ORWA 3H84A 1ZVQA 2ASEA 4FN5A 2C9CA 4N1AA 4CGZA 2WSSA 3NC0C 1AIPA 3B1XA 3MWLA 3RWMB 3T1QA 5CITA 1VHTA 1KI6B 5EP2A 1DAKA 3U3MA 3TGPA 1JNYA 3EPJA 3JZAA 3LH5A 2R6FA 4UXJA 2F9LA 1FQKA 4Q4LA 2VRWA 1ZINA 2NGRA 5C18A 1X86B 2YHSA 4A92A 2F1RA 4IVQA 3HDTA 2ZJBA 2XOKD 4OQLA 1E0KA 3X1XA 1C9KA 1RPZA 3F0TA 2ZE8A 4C2TA 2Z4RA 3BERA 1E69A 2WKQA 1W36B 2V6JA 2JGNA 2L0XA 3K09C 1IM2A 3A58B 1CEEA 1Z8FA 4JL8A 1MO6A 2GKSA 2DY1A 4D6PA 4BFWA 2A5JA 3EARA 5D3MA 2P0EA 3TAHA 1L2TA 2IEYA 2ZR7A 4R9UC 4B3GA 3SJCA 4LHWA 2C9OA 2R6DA 1ODFA 1KYIA 4JLDA 3R20A 1WCV1 4FINA 4URZR 3UMFA 2ZUCA 1LTQA 2BV3A 2FMXA 2ZQ5A 2Q6TA 1R5NA 4E09A 4EPWA 3SFVA 3PUXA 4D0GA 2IT1A 1GG2A 4V02A 3GEEA 2VSFA 3BB1A 5FTMA 2FEMA 4DC9A 4OI4A 5FI1B 4TMXA 5KPJA 1KY3A 1XTRA 1M2OB 1R10A 4LHXA 1NY6A 4URWR 3WXMA 3UANA 5AR1A 4GI7A 4C0AC 2GNOA 1DADA 4X8LA 3PUWA 2QM7A 5K8UA 1ZUNB 3K9GA 3R9WA 1W0KA 1NY5A 4CEHB 4BEJA 3AP1A 5TARA 4C3ZA 2CBZA 2EYUA 2D2FA 1IN5A 1VHLA 1XU4A 2A5DA 2X1VA 4B2LA 4B35A 5L8VA 1IOZA 3CZQA 2EWVA 2FFBA 3HR8A 2Z5FA 4S35A 1MABB 4TL8A 1B0UA 4NYIQ 3NHBA 3SOPA 2H92A 1XXHB 4PX9A 1JI0A 4B6FA 3ZZ0A 1OXXK 2FV8A 4OHWA 3DDCA 3PUVA 4M1WA 2BC9A 5EE0A 1Z07A 4NMMA 4QOSA 3IQXA 3QBVA 4W9MC 4Q1AA 4NCJA 3GLFE 3RDPA 3EPKA 1KMHA 3P32A 4QHYA 1JPNA 4LYAA 4XTCS 2EW1A 1S4QA 1G18A 1GUAA 4PHTA 5IHPA 1MO4A 1T0HB 4Q9HA 1U94A 2I3BA 1KKLA 4P31A 1KO1A 2QM8A 4D0NA 5JI2E 3CPHA 1XPRA 4PANA 4Q1EA 1KAOA 1NMYA 2NO0A 4PQYA 1UJ2A 1KKMA 1NVXQ 4XIGS 5ELXA 3FGNA 1E2QA 1KSJA 2ZAMA 3W8NA 1VCOA 1UDWA 1AK2A 1DAMA 2J41A 4B3CA 2JCSA 1OH5A 1NRJB 2GXAA 1EFCA 4P4TA 2BBSA 3CNLA 1E1RA 4O25A 5SZKB 1MO5A 4DDWA 2C99A 2QTFA 2XNDA 1CJTC 1N0WA 1KAGA 5EP3A 4UJ3A 1TMKA 4BFZA 2NO6A 2H5EA 4BZPA 1VIAA 1P75A 2QMHA 4V0ME 4QL3A 4EFLA 3THYB 1TF7A 1NKSA 2HT6A 1NLYA 3W6OA 1KGDA 4QNRA 3ZVLA 4AY2A 4L8GA 2D74A 5FOTA 3AVXA 2OE2A 4LJ6A 4YLGA 4DCTA 1VDZA 2UVQA 2UKDA 2LWIA 2ZI7A 4JLNA 5A0FA 4IEIA 2YOGA 4KFRA 3ZZTA 5A5GA 1BO6A 3CR8A 3IO3A 1M7BA 1SVSA 3KKPA 4TLCA 4U00A 4BFSA 5JMTA 2XZLA 1OLOA 4V0NA 4OHXA 4PPQA 2QRZA 3NH9A 5EXSA 1QZXA 4L15A 4B44A 4OQMA 1KDPA 3NH6A 3H2YA 2PJRA 2QORA 1A4RA 4BPBA 1IJFA 2CCJA 2E1RA 3MCAA 1YE8A 2AD5A 2RHDA 2WIBA 4HZUA 2WIAA 4I1UA 4XOIA 3X1DA 3I61A 1ZC4A 4RZ3A 3UWOA 3KXKA 1N3BA 4W5HA 2HLDD 4DEYA 1LW7A 1CR0A 4CW7A 4ESVA 5EJEA 1II8A 2PZFA 2VP9A 3QXHA 4N0DA 4DLZA 3W34A 1NJGA 1E96A 1NSTA 2XJ9A 3LFUA 4URVR 1WRBA 1MRNA 4TMVA 2IS2A 1XMJA 4RD1A 1F2TB 1M6NA 2DWOA 2PLFA 3T12A 3GMTA 4ZV4A 3AVPA 2XAUA 4NL4H 2VTKA 3SYLA 3T5GA 3LNCA 4UXHA 1E2IA 2JA1A 1DELA 1XTQA 2QE7D 2EFGA 3EIEA 1KO8A 4LX0A 4LK2A 1VYVA 4YDSA 5L3QB 3K9HA 5LB4A 2JJ2D 2FPMA 1UBEA 1KIMA 3A4NA 3A1UA 4IOLA 4BZQA 4Q9JA 4ZIRB 4B43A 1XCMA 1S96A 2AXPA 4QGGA 5FTLA 2QNRA 2AN9A 4DT1B 1KK0A 2WHXA 2WBLC 1G7RA 5CK5A 3UKDA 4OJKA 2FSHA 2QZ4A 4N3NA 3NEYA 3RYTC 4C0JA 4JZKA 3BFKA 2IHBA 4EJSA 3KQUA 1W49A 4LHVA 4FCTA 4Q19A 3BWDD 4E03A 3CWQA 1NLZA 5FTKA 5DISB 1Z63A 3PQCA 2C04A 4B71A 1DTSA 3EZ9A 3L0PA 2VBCA 1QHHB 1R2QA 4PR0A 4MGIR 2ODNA 4FWIB 2QEQA 4TZ6A 4IDPA 3NEJA 1UPTA 3EPHA 4Q7JB 1Z0FA 2XTNA 2IXEA 3GJ5A 3QY0A 1PLLA 1I2MA 2VQSA 2NIPA 4DLTA 1ZYUA 1Z83A 4FIDA 2IL1A 2JLQA 3I4LA 3PJRA 3QBTA 2ODEA 3T5DA 1QHNA 1TPZA 1B23P 4DLVA 2FZLA 2G1JA 2Q9BA 4KO8A 2V55B 3VHLB 4A4DA 3K70D 3ZLJA 4JYCA 4G1UC 1G6HA 3L0IB 1ZD8A 3LRPA 3ZIAA 2R65A 1FUKA 4X8HA 4B32A 2OESA 2LCFA 3IBYA 2I1QA 1HY3A 1AS0A 3OEHA 4D4JA 3I32A 2YWEA 5HKKA 3F8TA 4WW0A 1ELOA 5AUQA 2V9PA 2WKPA 2FSIA 5KSOA 1JXOA 4AG5A 2CL7X 1XX6A 1OV4A 2J1LA 1G4AE 5GJCA 3VKHA 1Z5ZA 1TU3A 1Z0IA 4YMWA 1S9HA 3PIRA 5AJYA 2OV2A 1T4GA 3EAQA 1IN4A 4FD2A 3GJ8A 1JJVA 4KFTA 3TAUA 2W6ID 1JQLB 1GIAA 3OEEA 4Q7MB 5GJVC 4FXPA 1I2DA 3QSYA 3K0FB 5FR2A 3TNFA 4NYJQ 2W58A 4JLAA 2ZUBA 4DXAA 3W90A 5DSZA 5ANRB 1LF5A 4M21A 1ZRHA 2FSFA 3ZGXA 4C0KA 1BYIA 1OIWA 4XWKA 1KI6A 1EFHA 1ZD9A 3KQLA 1WQ1R 3FMOB 2ZI9A 3BIFA 1U0JA 1BMFD 2OCAA 4DLWA 1ZCBA 3C14C 1CR4A 3ICQB 3TW8B 4TQUS 3LVQE 4P33A 5CB8A 1E9AA 4QJ4A 4IOMA 2QBYB 1DG3A 4LYFA 3T15A 3GJ3A 3O8BA 2ZJ5A 3AVVA 4EJSC 4Y0VA 4O2LA 4QHTA 4AI6A 2WPDA 2OILA 2B92A 4HAZA 1BH2A 2ZYUX 4DZZA 3GLGB 4ZCIA 2OXRA 2B21A 2IEZA 1R0WA 4MRPA 1NF3A 3ECCA 3BOSA 3TUZC 3MJRA 4E5UA 5BN5A 1ZM9A 4L9SA 4C7OA 3VKWA 2RGEA 1SQ5A 2QSYA 4CT4B 5IRCD 2IS1A 1DBSA 3PR1A 3REFA 4E22A 4LBZA 3Q7PA 4QM7A 5HCIA 4B48A 2CXXA 1P2TA 4KODA 4KSCA 2J87A 1X8LA 1YZQA 1YZLA 2AWNA 4CEHA 3IEVA 5FUXA 1UKVY 2Z83A 3DPUA 1DAGA 3JZMA 2BMJA 3ZD6A 1YZGA 2QAGB 4M1KA 3AV0B 1NSFA 3OIUA 4DSNA 3EPLA 3ICEA 4C0HA 1MABA 1SKYB 2ZRDA 1XXHA 3CW2A 3UG6A 5KSYA 4D4LA 1ZNYA 1FNNA 1ZD1A 4OHYA 1VKJA 1Z47A 1SVOA 2ZJAA 1E4VA 2ZXUA 2VO1A 2AX4A 3GJ4A 2ECKA 5AJWA 4BLSA 1OW3B 2QP4A 1OXTA 4CRWB 4Z8XA 1Z08A 3RAPR 1KNQA 3UXMA 4KU4A 3WMGA 2R9VA 2WJGA 5AUOB 4IKEA 3ZYCA 2ERXA 4URXR 1N5JA 2V54A 3Q8XB 2JEOA 3GP8A 2IBMA 3HYRA 1TU4A 2A2ZA 5BW8A 4G5QA 2WOOA 5FUVA 1AGPA 3QPWA 1SVWA 1F5NA 4EPRA 4TLAA 4XD7D 4IFBA 4M2LA 1L8QA 1U2RA 4A2PA 3RNLA 2DBYA 2VH5R 1JBKA 4BFYA 1DAHA 2OCBA 5DYIA 3THYA 2QP9X 4OKSA 2GF9A 3G0HA 1VCIA 1CP2A 1P6XA 1FW6A 1RKBA 1AA9A 3LX8A 3LQRA 3ADDA 3VR6A 2ODBA 3W5JA 2C9YA 2RGGA 2YWGA 1V5WA 1ZM2A 3TSZA 3I5YA 2GETA 4TMWA 1Q1QA 4KAXA 2V7QA 2QU8A 3RRYA 2QROA 1U8YA 4GRAA 1G20E 1KO7A 3M1IA 3NG1A 3JVUA 4TWZA 2IYTA 1KJWA 3QKSB 3SZRA 3G5UA 2CK3A 4MITA 2EYQA 2HYDA 1GL6A 2RAPA 1RVDA 3KUCA 3EWAA 3U7HB 4V0OA 1O3YA 3RANA 4MKHA 1GL9B 3OF5A 5FBQB 4D82A 3TE6A 3LXRA 1E9DA 3OHMA 2NOAA 3OE7A 2ZRAA 4KV9A 4P4UA 2EFHB 3BS4A 1YU9A 4MRSA 3H86A 1TQ4A 2G0NA 4WVFA 2PEYA 1JXMA 1Z6TA 3KFXA 4X8MA 3U2QA 3WP1B 1QHGA 3IGFA 4MH0R 5HE8A 3B1YA 3N5CA 1S0UA 3THXB 2ANCA 1F2TA 4LY6A 1WP9A 5CYOA 1D2MA 4O0MA 4YXWD 1NVWQ 2ZS8A 4M1TA 1Z22A 2GILA 2NO7A 5UKDA 4NKRA 1G8PA 2A7QA 5FR1A 4RCZA 1SHKA 3CRMA 1EG7A 3UMSA 4UNRA 3MGCA 5L3QA 3EW9A 4JLMA 3SEAA 1DO0A 1VYTA 1JR3D 1EFRA 1ZU5A 3D7MA 4ZIRA 3VAAA 3RS3A 1OFIA 3TJZA 4P3YA 1E2EA 1E98A 1UADA 4EPTA 3DM9B 2WWHA 2CDNA 4LBWA 2WWFA 2AFHE 3IUYA 1SXJB 4DT1A 2G77B 4C30A 3KXLA 2G3YA 3MWKA 4US1R 1U8AA 2BCGY 1YR9A 3QPVA
chains in the Genus database with same CATH superfamily
4RKRA 3R5FA 1AXEA 4L57A 2JW5A 4U7TB 2WG1A 1SRQA 4X6XA 2F1JA 2J6CA 4HEA1 3NHYA 2O7SA 5F1YA 5FNVF 4YJ2B 1N6OA 2W22A 2YS7A 1KI8A 1FSPA 3FLMA 2Q46A 3EASA 2WTUA 1PFKA 4N0PA 3N8IA 2C7VA 2PKCA 4JX8A 2C9BA 1X9HA 1U0HC 3F97A 1GADO 4FX2A 2CMKA 1D4FA 2H2FA 3TZEA 2IYFA 4DHWA 4OJTA 5HKAA 3AINA 5E38A 5CX1B 1OMOA 1FMJA 3WIOA 4I14A 2GCEA 3IMEA 5B1HA 2REBA 1U04A 3WK9A 4ADSG 1T2EA 5AICA 3WYDA 4PVDA 4HDMB 5H16A 3NFRA 1DJLA 1J8DA 1V7CA 5HJ2A 2XLCA 4EMSA 4O2AF 3E48A 5KDLA 4WK6A 5T4HA 4B31A 1MJHA 3SFTA 3T35A 4BE7B 4MNTA 1UMBB 3VDRA 3WA6A 1GTJ1 3W8DA 1QG6A 2WUDA 2XSZD 5KAPA 4CFYA 1G8AA 1TF2A 3KLMX 1X3SA 4RL4A 4DA4A 1E89A 2PLRA 3H5NA 3QVGB 4GYKA 3IRUA 4U5QA 3L4BA 2XQVA 2VJNA 4G1CA 2ATIA 2ZIGA 3MPOA 1DZIA 1R0LA 4L7VA 4EA6A 1WZUA 3LM8A 5KQSA 2OD2A 2BGNA 4XUGB 1WCWA 1R7RA 2E9SA 2R3SA 1YD7A 3LKBA 3OU2A 4JIMA 5LZ7A 2I7VA 4P36A 1VLLA 2Y0EA 4R2MA 1ZQ1A 2P1ZA 1Y8CA 3L7YA 5IUNC 1CRWG 3PS9A 3U3KA 3S7TA 4O6VA 1O97C 3CUKA 4YREA 121PA 1Z2PX 3KQVA 4II2A 1QHXA 5EQFA 2OSBA 1E1QD 2ZJ2A 1A98A 1LWOA 2R0QC 5B12A 1CVIA 1VRWA 2DUWA 2RIRA 2VYFA 3P2OA 4Z9YA 3UHPA 1NNSA 3K0FA 3TKAA 2GTIA 4DMMA 3I62A 3JW8A 1NN0A 5H9VA 2D0OB 2E49A 3AHDA 3BTSA 3H1PA 2HDHA 5HF9A 5JLJA 4YH1A 3ANSA 2AYXA 4EHAA 3UT5A 3BMQB 5IZCC 1CJSA 4HDSA 4G2NA 2PJDA 2IKSA 2OXFA 4CKWA 1OUMA 2D1SA 3L6RA 4HP8A 5CX4A 3G1TA 3O3OB 3ZGNA 5HS4A 2CT8A 2IGBA 1Z0AA 2IY7A 4HHEA 4UTPA 1RBYA 4BXOA 2CXQA 2ZDGA 5DNVA 1KXZA 3IVMA 1YAJA 3TW8A 2O0LA 1F3LA 2OKCA 3HA3A 2ZS7A 2PS1A 2FW0A 2W6MA 2AC7A 2EKLA 4JN6B 3H5LA 3AJAA 3VAZA 1Z9BA 4B6PA 2IZ0A 5GTDA 4F06A 4Q12A 1DEXA 2BFEA 3H9QA 4JLSA 2BHLA 2IYVA 2O5RA 2FXVA 2ZRHA 3AB3A 1QBGA 1JG6A 3TOXA 2XCTB 4Q4JB 1H4VB 2PL9A 4JP2A 4N40A 3NBAA 1P3JA 2Y1DA 3ZLTA 1W7AA 4UQPA 4QSHA 4DEXA 4LXHA 2M9MA 2ZUVA 4S3MA 4Q03A 5CPFA 2Q07A 3NBYC 3FYDA 1B8NA 4NJEA 1JYEA 1T5IA 3ZXIA 5HSGA 5I4BA 4ALNA 1FDVA 2QPTA 3AG6A 1Y1LA 4P38A 1TRHA 3EA5A 4HAYA 4N6OA 4WJKB 1GOTA 3VR6H 1W47A 5DPMA 1N5LA 2IEGA 3FN4A 2D62A 4P8RA 4AIIA 1HNNA 3EQ6A 3OT4A 4RVOA 4XVQA 5JY1A 1UFQA 2FN9A 2BJVA 2CCGA 3H13A 4WXRA 2Z04A 4HMPA 4PG8A 3FMPB 2FW9A 2H31A 1BZYA 1UDAA 5J43A 5LIRA 4NK5A 4LXIA 2DWPA 3ITEA 3C85A 3VH1A 3W7VA 4ZT5A 5ITSA 1DV2A 3P5BA 1YTUA 4IKOA 5KS2A 1WA5A 3O8LA 4GM0A 2FLVA 3OICA 4TSFA 1R9MA 2NT4A 1GR0A 2PMFA 3EXIB 2B9VA 3F9CA 3L1UA 1HQYE 2RCNA 2Q4OA 4I5EA 5EMMA 3JAKA 4HAVA 5ERXA 3X1JA 4GM1A 3PLAE 3L4BC 1PDWA 1P1JA 2PE5A 2E82A 1N7HA 1JWAB 3UGTA 1YQXA 4DDUA 1U0EA 4R69A 3WKCA 3JRWA 1NKVA 3C6ZA 4R31A 1B2RA 3NJ8A 4HNUA 5G0SA 4IH9A 1P4AA 1V1JA 2YINC 1DAFA 3WKDA 5FXMA 1WHTB 2FB9A 3E5RA 3GVHA 3WI7A 3BHIA 4NZPA 1JL3A 1K8RA 2O1SA 4MCJA 3RKUA 3R09A 4H6PA 5KNCH 3SX0A 1EUQA 4NV0A 4PZYA 4Q4AB 4LXTA 1GM5A 3GL9A 3ZD7A 2B37A 5JR3A 5FORA 4PYOA 4PIMA 3SSAA 1AZLA 1R0BA 3KQWA 4EDHA 3FE2A 3HCEA 2B8NA 4KQIA 3KT8A 4MB6A 5JSQA 3VSCA 3TQQA 1D0IA 3I01M 3ON5A 3IFSA 1AJEA 2FQQA 1S8FA 3C0KA 4EITA 3EVDA 3MBKA 2XTAA 3KZKA 1ZNQO 4F45A 3GCWA 2CWDA 2CFSA 3I1YA 1LSUA 4BP1A 2D3WA 4MVYA 4FT4A 1O5OA 1WB6A 3A3PA 3A8TA 3VR3A 5JS1A 3JYQA 3T7IA 2JH3A 4AYWA 1XIVA 3LVRE 3A2KA 2QYHA 2B9EA 4I6EA 3T7SA 4GUDA 3F1LA 3FTQA 1P80A 3GP3A 4B4UA 3R9IA 4HUTA 1MFZA 3P27A 2QN6A 5BWCA 1UT8A 1QK5A 1W1UA 5J5CA 1KFEB 4P92A 1JHYA 4DNQA 2PX3A 3D5TA 3EOBI 4ALKA 221PA 1LPOA 4ZA2A 4NYIR 4IGEA 3PHLA 1Z5NA 5ESWA 5IW8A 1KFCB 1PD0A 1O5TA 2ZSHA 3P9SA 4TTRA 1FJGB 1IQ0A 4DBLC 4J1QA 4J94A 3PFWO 1NWHA 4M9ZA 4FFWA 2WSSD 3FPFA 1ISSA 4OGFA 4ZO6A 1SC6A 2GN6A 4HGRA 2IYRA 3VH4A 4PRYA 2FN4A 2XB9A 3HCNA 3MS2A 3RI3A 4N0MA 4V2UA 4R9RA 1JQ3A 3DMNA 4I1YA 5COQA 3RC7A 3IILA 4JJ4A 4LXQA 4B76A 4K6FA 1M7GA 1W48A 3EEIA 1LB1B 3NKFA 2OQRA 2XMZA 4ZJZA 3OPYA 1WE2A 5FFMA 3VQTA 3K0BA 2YWFA 2GKGA 5T41A 3I52A 2MR6A 1X92A 1ACJA 1BA2A 2QRUA 3C4VA 2BM1A 3FYSA 4JXJA 4YRKA 4TV9F 8MHTA 5L9AA 4CU2A 1TB4A 2J45A 4W63A 3PPIA 5AQEA 5KO2A 1Z8NA 1VI5A 3Q2OA 4M99A 3PPXA 4WY2A 5CIWA 3KXIA 4MIEA 3TTUA 5A4MS 2ZJ8A 3OU6A 2QG9A 2R44A 4K9DA 3BH6A 3THXA 3EMKA 1P1FA 1DAOA 1G7SA 2QPOA 3HDQA 2X8JA 2V97A 2D5BA 2HMYB 4GPEA 4IVPA 4NFYA 5E1DA 3S40A 4ALJA 1D6NA 2JLWA 1OVGA 10MHA 4IL5A 5DH9A 3AUUA 1E1LA 2NUBA 3ORRA 4O1HA 3SGLA 1JXAA 3CX8A 2FFHA 3B85A 1ZCAA 4AL4A 1KY2A 1Z7EA 2IEBA 1SXIA 2QW0X 3NXKA 1KE1A 2X0RA 3VX3A 4TKUB 4XB1A 4ER5A 3GLRA 3TW0A 1P18A 1ITZA 4FYMA 3D4NA 3RASA 1SHTX 3CM0A 3P9RA 3ZQUA 4Q4CA 2J0QA 3WHLA 4G5SA 2XF2A 3I72A 3DTVA 2GHIA 1KI2A 3PC7A 4FI3C 4ZO9A 4HPJB 1GILA 1CNFA 1J25A 4Q66C 2G5PA 2O2XA 3DEZA 2AN5A 1ZIXA 1D1SA 5EHGA 4M86A 1YOBA 1KWGA 5I8ZA 1EG2A 4GOJA 3LUGA 2DERA 3UW3A 1NF2A 1GTMA 3F46A 4RHUA 5LQAA 4F84A 3ROPA 1ANKA 1MEOA 5M29A 2IXAA 2R1TA 1UXIA 1K06A 2VXBA 4KX5A 1XZNA 3FCYA 4MJ3A 2Q5CA 1MTZA 4ZQCB 3EDCA 4C0BA 2IP4A 4KHZA 4MWEA 1GNSA 2WHPA 3TVYA 4DHEA 4FLMA 1T36B 5BN1A 2WYUA 3OM1A 3RKRA 1SVIA 5JEDA 2Q29A 5A5FA 3TMYA 4IILA 3PJFA 4TS3A 2X58A 3ML1A 1H5UA 2WLSA 1MENA 1S3SA 2PGOA 4XE5A 1IB0A 2JBAB 2FOLA 1DSSG 2XB8A 3D7KA 4I66A 4TN5A 2GZ2A 5LA6A 4CWAA 4F3NA 3GAFA 4HWOA 4DIFA 3T38A 2IIQA 1ISJA 2OZLA 4A6PA 5BSVA 2X9QA 2IS6A 1LDNA 1FMTA 1Q77A 2PFKA 4L8YA 2QD5A 3H9GA 3LMKA 4QUEA 1KMCA 2VWHA 5EMHA 1ULUA 1QF7A 1JVNA 4WESA 5J3JA 1YONA 1C3VA 2A7XA 2P5SA 3NRBA 2GDJA 2W4IA 2AI2A 4RGBA 3DD1A 2GJSA 2X9LA 2ZRGA 3BRWD 5CLIA 1P1CA 2B8WA 3I42A 4X7MA 3RNOA 3TDNA 2IQ5A 1IDOA 3NYQA 2HMTA 2REQB 3FDJA 3L7JA 5EKTA 2V3WA 1AD2A 2BVNA 4FFVA 4H7JA 4BNZA 4MUXA 1OR8A 5BW5A 1CBUA 4R9NA 4XQ9A 1BEUB 3ZHBA 4DIMA 4LPKA 1PF7E 4DQKA 3MS7A 3QMVA 3WGGA 2O8CA 2YJGA 3DE1X 4MK4A 2GMWA 2FP3A 5FTNA 3UV7A 1IIRA 2OOSA 1FTYA 1TE2A 1TK3A 1XZAA 1PJRA 3QBJA 4R0NA 4RMHA 3VKUA 4AJHA 1T5BA 1XVTA 3G2QA 4F9GA 3B89A 3HA7A 1P7CA 3OIYA 4RMGA 5CH5A 4BJ6A 3FSEA 1CQIB 1SD1A 5DSXA 3SJUA 3CVVA 1T4DA 1KORA 3CE9A 1FLAA 3GARA 4CT5A 4IHQA 4XARA 3CX7A 4Z6KA 4C14A 2IU0A 3BWBA 2Y1KA 4DMGA 1GG8A 3EY9A 4O4JB 4QUAA 3NT4A 3LBIA 4XYBA 1LZKA 2TMGA 4M8SA 2P6OA 2VRCD 4G5YA 2H29A 3HUTA 1LPBB 1RKVA 3TVDA 3WO0A 1FMFA 3TZQA 1Y7PA 4K88A 1NZFA 5TGZA 5JJLA 2B6NA 2O7RA 3FWPA 2GBPA 5AIBA 2OT3B 1XL1A 4TLMB 1NKTA 5LBIA 1QFZA 1Y6ZA 5IBCA 5DM70 4EUNA 1H9AA 2BDUA 2BGJA 1Q2UA 4UOZA 2E87A 4PU0A 5K5EA 3DE5X 4QVIA 5T6BA 4U7DA 4W8OA 4DMCA 3KTAB 1IN7A 2NTNA 4YAIA 3VR5D 3MINB 2CF6A 2GD0A 3ETJA 4HFJA 1IRIA 1U81A 1T1GA 1XZ8A 2F17A 1ZK4A 2I4RA 3QMWA 2PUBA 4U6QA 2IYEA 2DTDA 3QA9A 4Y1EA 1L5QA 2P6NA 3FR8A 5JTTA 1E1KA 2Q9AA 3LVBA 2HU5A 3CUYA 1EQAA 1GA1A 2XKBA 2YXLA 4J0KA 3QWAA 4MICA 1DJQA 4YJ3F 4HXFB 2FMKA 3OLYA 2VLBA 4HJRA 2ZTHA 4KAAA 5EIBC 5JSYA 2I62A 2Q0XA 3MTDA 2FKNA 3WRYA 5L3SB 5JC8A 5LKAA 1NJ5A 3VC3A 4NYJR 1QG4A 2X76A 1LLQA 1PT8A 3QVVA 4NECA 1BCRA 4N03A 4ZQHA 3NUZA 5H8WA 2WLTA 3K6SB 3M2PA 4MQFA 1T9ZA 4A91A 4TYWA 1BAPA 3KFVA 2BN4A 2XQIA 1Q74A 3DDOA 2OBXA 3INGA 4I3FA 3VYWA 1PE0A 3KQKA 3AUTA 1XRNA 4NBLA 1SH7A 4LXXA 1E2LA 3AVWA 4BN4A 3MT7A 1FTSA 5J4HA 3K1AB 4QDXA 4UCXA 1YR2A 5HILA 2VNHA 2Y77A 4DM4A 4AY6A 4G25A 1I6MA 2CD9A 3ILSA 2IUUA 1VIYA 1SQ0A 1Y9ZA 2W00A 5JAIA 4RWEA 3ERCA 4UUQA 2Z56A 4Q9IA 3WSTA 2H9AA 3T0GA 2JJMA 3FNHA 2ECQA 3BTVA 4LRYA 4ACAA 1LNZA 1Q3KA 1IHOA 1IBMB 3IULA 2OEPA 3AHEA 3S44A 3PPYA 3I09A 3E7WA 1QG2A 1IONA 3HA2A 2H4JA 4TTQA 3S70A 4NK4A 2ZITA 3AWIA 4CLRA 3KO8A 1H93A 1UFOA 3TQOA 2RGDA 4QUBA 3NFYA 3QKWA 1Q57A 3G82C 3KWJA 3NKVA 4N6NA 2YDYA 1BS2A 1Y3CE 5AVTA 5KMGA 3HXMA 1YZNA 1PFUA 2FWRA 2IZ6A 3LCVB 1U9JA 1CQJA 4QC2A 4EZEA 1H2EA 2HV8A 3BE5A 3WYGA 2G06A 1LLUA 4QYIA 1G3MA 1DQZA 4EG1A 1HXHA 1ZH8A 3FIJA 2J09A 1Q44A 5LXTB 1CUVA 3CMMA 5CA0A 2WD7A 3LBYA 4FJ0A 6Q21A 5KB3A 3QJYA 5EE5B 1YGPA 4M55A 5I7SA 4WKBA 3KKLA 4C4PA 2AXEA 1YJQA 1RQGA 1H8HA 1ZGAA 1X38A 1FDSA 2W93A 4P5DA 4F04A 4JB0A 2VHQA 4YMLA 2VJQA 2VTEA 1Q50A 1XCPA 2I29A 4GGOA 3MIIA 4PEVA 3GPDG 4Q3BA 3FRJA 3WK5A 3C3XA 1I4TD 3DEAA 3ETDA 1IXZA 1RPAA 3U3ZA 1QPZA 3TQTA 2DPGA 3V33A 2MCFA 3WLRA 1SBZA 3L7KA 5AW7A 4A9AA 5DBGA 2Y1FA 1DG9A 3MHPA 1FUIA 4LQLA 2OYRA 3Q7QA 4NEQA 4JJGA 2QN2A 3DT8A 4OOEA 4CKCB 4O63O 5JHHB 3TF5A 2PMKA 1XAIA 3T6KA 1UJ6A 3WMEA 3SHOA 3OEED 1UBJS 2ZVDA 1M34E 4WXYB 1GAEO 2UZ1B 3VYUB 3L6OO 2ZBPA 3DKKA 3ABRB 3WE7A 3TX6A 1QDLB 3O9ZA 1QIIA 3V8MA 3X2SA 2XZTA 5AK4A 1WB9A 2WJWA 3RC8A 3WRYC 1IDN1 1K0UA 3ZK8A 4FWTA 4JT4A 3L18A 4YRIA 3A4YA 3QFFA 4YEDA 2KI5A 4FC7A 4FXOA 3PD7A 4QFMA 1A9TA 1LH0A 5FBRB 3ZXXA 3T9DA 4PHGA 1GUYA 4KUEA 1OCEA 4E3ZA 1HE5A 1X1SA 1BHJA 1GP2A 4N8SA 4XQCA 4O2BA 4RTMA 2TS1A 2D0DA 4R1QA 3GLUA 4RK7A 3CX6A 3NALA 1P4SA 4GKBA 4LY0A 4QVKA 4X44A 1VA5A 3OFSA 1UH5A 4GX0A 5LD2C 2HXSA 5FOVA 5EUMA 1MJFA 4BDTA 3OMXA 1QGDA 2H8KA 4R2IA 3WQRA 1QGYA 1U6IA 2BEVB 3DF9A 3QX9A 1C3OB 5HFAA 3OQIB 4P5PA 5I9LA 5AVOA 1HTBA 1JI3A 1UJNA 3I30X 1KTVA 2DP4E 1VIDA 3BDVA 4PGHA 5G3ZA 5J4LA 2BTOA 5GIOE 1Z38A 2C2OA 3I83A 1TAGA 4BAZA 1JPJA 4W1RA 1OH8A 1N1MA 1FFXA 5JS8A 4I2VA 4PYQA 1KEEB 1M2NA 4HBZA 1IYZA 3AUAA 5B1YA 1OFVA 2GZSA 3O92A 2BBWA 1YFLA 1C1YA 1IEVA 4YQZA 2PD6A 1ZA1A 4XPIA 3K16A 3W6ZA 2H00A 3CT4A 4ALLA 5HHTA 3OZWA 1I32A 4IH4A 4DR6B 2QTNA 3IEKA 1S6YA 2ZRCA 2EWMA 4LV6A 4X1IB 5HKLA 3DLHA 4A0GA 4OD0A 1FNMA 5DLPA 2HMAA 1YS7A 4OQNA 1FP4A 3L0OA 3KUUA 5ALTA 3D9QX 5LB2A 4DR2B 1XZQA 3GVXA 3LOQA 2PMEA 3LLVA 2HQ1A 2FFRA 1WX1A 3MWJA 4EO9A 4CE6A 2QUAA 1YB1A 1W87A 4OSPA 1LQTA 4FQ5A 4K9OA 1UF9A 1FUYB 3GMIA 3HI6A 4LY3A 4B3SB 4NAHA 2HGZA 2P1RA 4XB2A 4GZMA 4U2KA 4U7GA 4ZVLA 2V7WA 2I2WA 3K9QO 1KQGA 2BM8A 4IDQA 4EENA 2QX6A 3FPHA 4FOSA 1Z06A 4H9GA 1N6KA 2B35A 4G24A 3CONA 4MKRA 1HLDA 5KC9A 2JASA 5EJ8A 2JKYA 2JIPA 4GWKA 4FR2A 1X80B 4JWTA 4KK3A 1O1YA 2WQZA 1YA4A 2Z4TA 4HWTA 1ZOIA 2V4UA 3DWGA 4RNDB 3VVMA 4BZWA 3EMBA 3R3SA 4R6XA 2DR3A 4LRTB 1FPMA 3E53A 5DGCA 2G25A 3VOSA 2VDWA 1GQSA 1C4OA 4HNRA 3PGKA 4NG5A 2FHPA 2AEFA 2PWZA 4HDRA 4KH1A 1EVYA 1P0MA 2IA5A 3HWSA 3KLOA 3INRA 3QUBA 4WADA 3RIEA 4C7KA 2PSHA 4FPXA 1JKXA 1QDEA 1QO0A 2FQ1A 2X3UA 3USES 3S8YA 3U7GA 2Z0MA 1GKUB 4HGNA 2JANA 5E2IA 1LS1A 2IF0A 2JLBA 1XROA 5AK5A 3CBQA 3JWPA 3HBAA 3TUIC 5JSUA 4Z5XA 3WYCA 3I37X 1UPUA 1EP2B 3GNTA 4MUBA 4WASA 2GXQA 1Y6FA 2EBWA 4NJMA 4FHGA 4D8WA 3P7MA 4TMYA 4HLCA 2AG8A 4NU8X 4OJQA 1YF3A 3HJAA 2HU2A 1KQOA 2JCYA 3EZFA 5GONB 5ITVA 4QBGB 2QL5A 3Q3VA 3DVRX 3E5MA 2J9YB 3NHKA 3SVLA 3K9NA 3RSQA 3AU8A 4M0DA 4X24A 5IMBA 3HM2A 3W7AA 5FDFA 1KZ6A 5A5EA 4BTEA 2Z58A 3KK0A 3EIFA 3N0VA 5EHXA 2EX4A 3HDJA 3ONDA 1ATZA 1ESDA 1PQUA 1QONA 1RYFA 4KNVA 4MIOA 2CMGA 2FEAA 4PHCA 3WBJA 1CF9A 3DBHB 4CHGA 3ER6A 2H2HA 3HCCA 4S2UA 4AY4A 1R4AA 2H11A 1UL1X 2D5AA 2MSCB 1W4BA 2NSYA 2Q6KA 2XYQA 4LFAB 3O4JA 1BN7A 1CV2A 4JBYA 4U2EA 3WMFA 3C70A 4M36A 3LUCA 3GFTA 3ZE2B 3BJMA 4HDNB 2O52A 3KT6A 2NPIA 3UATA 4ZZ1A 4CQLB 4MVJI 5EJ9A 1QFYA 1MC1A 2XY4A 1WG8A 2ASVA 4LN1A 4EGSA 1WWKA 1E1CB 1YBMA 3BFXA 3IR7A 4IEFB 4XGKA 3MJFA 1E2FA 1ECPA 3RJ9A 2PRZA 1EMDA 2O48X 2QYTA 1G63A 4YASA 4XVCA 3BMXA 3QUCA 4EHNA 2DJIA 3ZHOA 1EE2A 2BY4A 3SU8A 4QT4A 2LD4A 2Y9MB 2XMBA 1E9BA 1NVVR 4XSGA 3VPBA 4BO2A 1G9SA 1NUPA 2GK6A 3EG9B 2QUKA 4N3BA 5L45A 4XX0B 3LLCA 1G8SA 3R75A 1HLFA 1ZK3A 1DVRA 3C74A 1RXWA 1Q22A 1RD4A 1D8AA 1EWYA 1G21E 3MCVA 3MXOA 1UDBA 2AG6A 2Y0CA 4IIEA 3KJNA 4YFYA 1KI9A 2E4AA 2OCPA 3IPXA 5AJTA 3V4FA 4R1TA 1BXGA 2XVZA 3LL7A 3HLTA 4EX6A 1M0EA 1MGPA 4MPJA 1JDVA 2EW8A 4B83A 5LN1A 5B6PA 1TO6A 3BJIC 2Q41A 4KLAA 4LUCA 5K8CA 2JATA 1XGKA 4IMRA 4RZIA 2AFIA 4D8UA 2PLNA 4RO0A 1ABBA 2B6HA 4E14A 3E81A 3IMCA 3PC8A 3KZMA 5TR9A 3JD0A 2HXGA 2DBVO 4OXRA 1JSRA 4BNLA 1ZJ4A 1U8FO 5E9JA 4TOIA 1FYXA 2OV4A 3KV3O 2W2KB 3DMDA 4ZMRA 3AI7A 1PX0A 3RADC 3U17A 3CUTA 1NXXA 3A11A 3F7MA 3IAXA 4L6CA 2O5VA 5DW3A 4ZT6A 5LC1A 4AN4A 4F2GA 4JLBA 4DLSA 1I24A 3AM3A 3SZGA 4WBNA 4KR7A 4K1XA 3PUZA 5TY0A 1ZRMA 1FRFS 1A88A 1W46A 3JYNA 1UT5A 1QH1B 4MULA 2DPMA 4D43A 2AB0A 4JBWA 5K0EA 5REQA 4CM9D 2BFDB 3IAAA 3QOXA 1JW9B 2BHRA 5JXWA 1QIEA 3HSYA 3AP2A 2GA9A 4JA2A 1R37A 2ZIZA 5KYTA 4CF5A 3PFNA 5LSAA 5LQRA 4E2WA 1V2HE 1IY2A 1FU8A 1L1RA 4PLHA 1UC4B 1OIVA 3H2KA 5DX8A 3WLPA 2W2LA 1LJ8A 2PDAA 2X8WA 3CNEA 3I04A 3AZPA 4DMLA 3VPFA 2ZWAA 3LGAA 4QODA 3VC7A 3NDIA 4DREA 6REQB 5GZ3A 2G9NA 3G7UA 4HB3A 3U4AA 4ITUA 3VR2D 3ZDAA 1T8YA 5I51A 3THWB 2JRLA 2NU6B 3G9ZA 1XN1A 3P9YA 1PDOA 3AYZB 3RJTA 2WKRA 2O3QA 1O96A 2HC9A 5IJWA 1FFYA 1SCKA 3BQNB 3UWSA 5I3ZA 1T2VA 1IAVA 2B94A 5FOWA 3ZU5A 3IO5A 1IHPA 1X7HA 1XDZA 2PYDA 5JJIA 4BBZA 1VYUA 4LMPA 3GLFA 3OZVA 4PX5A 2G40A 3W5UA 4QYSA 3CZPA 1YZFA 2C3OA 4FMCB 1AUOA 4R7TA 2O6HA 5BT9A 3M89A 3WTBA 3ZGLA 2D7DA 4N12A 5EKUA 2CFRA 5KNDA 3B82A 3V7WA 2ADMA 3ZVRA 3C6YA 3OX3A 5B36A 1Z62A 3G2KA 5AW0A 4CG0A 1VFNA 2QTVA 3KEQA 1P4GA 1TZCA 3C3DA 5EFZA 5DM0A 3D6TB 3I01A 4ZT7A 3EXHA 3N5KA 1XYYA 3QFCA 2WFZA 5CH8A 4BMSA 1M1UA 4EF6A 3EIQA 1T8SA 4C6SA 3FDZA 4DV2B 5BQXA 1PVVA 4K6GA 4UJ5A 1TA9A 5HE9A 3FGZA 1E9EA 2CBGA 3R9XB 2E7ZA 2H17A 4TWAA 3NYIA 2H1HA 4DDHA 4MDEA 1RADA 1STOA 1U3UA 3ROTA 4D8XA 4D9GA 4W7IA 4A6EA 5D3ZA 3G8DA 5JSFA 1Z0KA 2XTMA 4B4VA 3U81A 1ULTA 1NP7A 3IA2A 1ORVA 2ZJ6A 4BWYA 4YCCA 4PSUA 2OFWA 2APJA 2WTEA 3WLNA 5LZ4A 4E12A 2C03A 5IFKA 5FPYA 4ON9A 1HNXB 3H19A 2VHYA 3HY3A 4FILA 2OG2A 4FUQA 4JFAA 4V0QA 1PKXA 2UVPB 3NO4A 3JVVA 1Y1KE 2ZYWX 3EUWA 3C8ZA 5JLAA 3R7BA 2ICAA 2JZOA 1C2YA 3FHLA 2XRYA 2GN0A 3E9EA 3PC8C 4O4IA 4UE3S 4AXXA 4CTOA 4LZOA 1V8BA 5F78A 4AVYA 1NN5A 4GD3Q 1VE6A 3FUXA 2RKWA 4HNAA 4I1PA 3QI2A 1RS0A 2EJBA 2JAPA 4A0SA 1Z2AA 1PI3A 1PP4A 2CUZA 4QPJC 2CGEA 3QBDA 1E2MA 1N75A 2I65A 1EE1A 1BGXT 1I7NA 4ND8A 2OZPA 4AP6A 5C32A 2YTZA 1WHSA 5BR8B 5K0TA 3RLFA 3CZMA 3ZWOA 4RPIA 2NTYC 5FPTA 4BMNA 3PGLA 1SVKA 1VHWA 1Y8AA 2D5LA 1WMFA 4BNDB 3VXKA 5DHAA 1MVLA 4DLNA 1E64A 1YRYE 2H18A 1SEVA 4P7FA 1GA4A 3AHFA 2NQTA 4MA0A 3WZMA 1AK1A 3HO1A 2WTNA 4EHLA 3DCYA 5EPOA 2HF7A 1JIQA 1QC5A 2WNSA 3ITKA 5JYEA 3G7NA 1O7JA 1WM1A 4AWAA 1I0ZA 2ZRQA 2GTHA 3D3JA 4EUEA 4MDYA 2LIVA 2B3DA 3EUAA 4NHEA 2R8YA 1WPQA 3RF7A 3D4PA 4HS4A 1E7YA 3OCUA 4E11A 5B1SA 4KN9S 1D6SA 3T9AA 5JADA 3W3AA 4LRQA 4MUJA 4XQ0A 5JH7B 4QQKA 3ZBUA 3AL0C 5JPDA 4PQGA 1IPFA 4BYGA 3U3RA 3M4NA 1YJXA 3K8QA 4CDGA 3FVTA 3PHGA 1D8TA 1GCUA 2V6BA 4DV5B 2BIFA 2FUNB 1PW7A 1EGVB 2IXTA 2HPVA 4KFSA 1WW2A 5AVXA 3E82A 1LLFA 3IPRA 4KPFC 2HIAA 3GLGE 5AXAA 3M6AA 3HWRA 3OTGA 2GJ4A 4KN8A 3KZCA 1YR7A 1H0HA 1JH8A 4MMYB 4L4SA 4B4WA 2NWQA 3DJFA 1SUAA 4BE4A 5DN6D 5ILOA 5BORA 3IVXA 1KAQA 4ITRC 4RSGA 4G65A 3EXHC 1WBJB 2VHUA 3R7WB 5JCXA 5E6SB 3QEKA 3R2JA 4UAUA 1GFWA 2AFHB 2XQJA 1BE8A 3O73A 3A4VA 3PI7A 2XKAA 3D0RA 3I9NA 2LIPA 4HNVA 4ZP1A 3C8UA 5BV0A 3V6LA 3ZBTA 3V8BA 3ROZA 4Y2JA 7REQA 2DPXA 4IDEA 1KBOA 3HVIA 4W99A 5KINB 1T8WA 1E0SA 3DYBA 2G9UA 2NO4A 2V8OA 3RRNA 2JJ2A 3F5SA 4KDCA 3VJRA 4DV0B 3PCRB 2P65A 3EXFA 5DCWA 1GG5A 5B3AA 1R0YA 2PBRA 1ODSA 3FB4A 1SKYE 1NDHA 2C98A 2V03A 4EECA 3CRRA 3TSWA 1DEAA 2VDQB 1IJEA 1M0SA 3F6RA 5LM3A 5LWQA 3M6MD 1A9QA 3L49A 4CVNA 3GVPA 1E8MA 3OT1A 4G09A 2IYXA 1D2AA 3FMIA 1ZRNA 5TJ9A 5CXQA 1QHEA 1A7KA 2EP5A 1VPLA 2QRMA 3V00A 1Q1BA 1LY1A 1UMCB 1P1RA 4MZXA 1GZVA 4JVMA 3UEOA 1U8EA 1NP3A 3AEQB 4D2IA 4QTYA 3RG2A 3ABOB 2CVOA 3O8RA 2O0JA 3CKKA 4QDUA 4YONB 4KGVA 4LSMA 3C4QA 3DUWA 4ZOLF 2CHVA 2F48A 2PVPA 3U40A 5AM3A 1TQHA 3ZVMA 1T0UA 1S2NA 2VJDA 4C03A 1HUQA 2DB3A 5A9TA 3S0JA 5JI3E 3KDPA 4L27A 3QHAA 2PX0A 4ZYZA 2G6BA 4RETA 4NARA 3ZZUA 4Q3AA 1LRLA 1E8NA 2BE9A 1BWQA 1KI1A 2XQKA 4F1KA 4F3CA 2AKYA 1PR1A 4OX9B 3RYHB 1XZHA 4D9IA 3V8EA 1L5YA 1GRRA 3DZDA 3R0VA 3V4PB 5HPYB 5I3CA 3L8FA 2FMFA 4QDOA 3EC1A 4UMEA 4TQ9A 1KWKA 1CJCA 1K7CA 3D02A 3LV8A 5DM4A 5FV7A 3UCEA 2EGUA 2OWEA 3JQ8A 3K53A 3FMVA 3OCYA 3MAGA 3NAZA 4U2BA 3S81A 2ANBA 2JC3A 3IAEA 4FEYA 4EB6B 3SLRA 4P4SA 1PAUA 4QOEA 1I3OA 3S5UA 3WGZA 1MORA 2Z2JA 2V7EA 1SVMA 1N1GA 1HA3A 1MW9X 1S01A 3VR5A 1KJZA 5KOHA 3ZI4A 1J6UA 2YXBA 1AG9A 1M3SA 5EERA 3R3JA 5C0OE 2JLZA 4GPZA 4JXXA 2ZUWA 4ZKEA 5EIXA 1KEZA 4ARZB 2QUJA 3H8VA 3B7WA 3T4XA 4R98A 1AXGA 5DTJA 4CV3A 1AMOA 4D8VA 1M66A 1Z4OA 3LY9A 4MGKR 4GT1A 2L18A 4N5DA 4Y0NA 3R7SA 2WT9A 4ZDIA 4KWHA 3QWIA 4PHHA 2P6UA 1JHVA 1EJBA 1JYFA 2CJYA 2EXXA 2QY6A 2YWBA 3U4IA 4I50F 4IXMA 3J81A 1A9PA 5JRZA 1UJBA 1HG1A 2CUTA 3LHDA 3UVEA 1WDMA 3EQZA 1N2CE 2X6TA 3DBOB 5GJWC 4YQEA 4RLQA 1BC5A 3T1TA 5JS7A 3MTQA 4FFBA 4XSHA 1JHAA 1GAXA 3Q7IA 5BPFA 4WL0A 1MEEA 1NC3A 3H2JA 3KZVA 4G9GA 1SC4A 2OPHA 4Y6GB 3VU9B 3E5HA 3WDKA 1MAVA 2I3DA 4OOFA 4TTVA 3PTAA 1VLMA 1E2DA 4XWTA 3SM3A 1X1RA 1H6AA 3DEKA 3OJEA 3W2EA 4FNGA 4WZ6A 1KJ9A 4QBIA 1IUOA 1S4MA 2QZ9A 2ZAOA 5I8PA 1V43A 3CZRA 3O84A 3DT9A 3F3YA 4WERA 4L5AA 3QVUA 4DWJA 1T8TA 3DTTA 3NTUA 5E6RA 3S2FA 5BMVB 4N3CA 4HQFA 1L5OA 4RY2A 3ZHRA 1T0IA 1ZD5A 1X7GA 2R7AA 3M1YA 3OI7A 4KO1S 2VDRB 4N0QA 5BR4A 1XYVA 3GI1A 1UWVA 3PQ4A 3M6VA 3KU4A 1ULZA 4UMFA 3KB8A 4F91B 1UFRA 2FJUA 4GOKA 4H0CA 4OYYA 4Q24A 3RAGA 3WRWA 3EXEB 2CSUA 5CFNA 1J70A 3IJPA 4J7AA 4PZZA 5HCNA 3NOXA 3CIFA 1E79D 5BWOA 2XMPA 4RFSA 1XZIA 3BL8A 1A9YA 1NQVA 5TGTA 1ZESA 3NWBA 1Z26A 4R4JA 4QBTA 5H3CA 2YFQA 3SIPA 2CNNA 1Q0SA 3ELBA 1EK2A 2P90A 3AM1A 3QF4B 4IHJA 1TQ2A 4TROA 5DSTA 3WGMA 2V9CA 3M5PA 3OOWA 4QQRA 4UDYX 4RL6A 3GJTA 3AJ9A 4PLYA 4L3OA 4KLRA 4HFNA 3C7DB 4V3BA 2FX3A 2G09A 5FULA 1OI7A 4LJ5A 1AZSC 3ENZA 3ND7A 1AQYA 5ALPA 5FLYA 5TMPA 2Z43A 3TPZA 3LZ6A 4PSCA 1XRPA 4Z7QB 4RTKA 1WZIA 2DUJA 2YYSA 3QA3E 1ZI9A 3QWHA 4U6SA 5G0WA 4BN0A 1HOTA 2HFKA 2CJFA 3Q40A 3JYOA 2ZKLA 4WV3A 4NPHA 3PL1A 3WJ7A 3EA4A 3GVIA 3B9BA 1LDBA 3ZJ5A 1HZZA 1E7WA 2DHRA 4GSKA 1NV9A 1V95A 1DHTA 4TZ0A 1PL8A 3H17A 2GK3A 2ZULA 1QIFA 8OHMA 1JR6A 2WE7A 3KXPA 1LC3A 3T54A 3L1VA 4JGIA 1W4CA 2Y4OA 3HSKA 3V9AA 3I0MA 2VJMB 4HI0E 2NNWB 4A8HA 5KUTA 1PV2A 2QLLA 2BPOA 3FMFA 1LZLA 1JE0A 1JFFA 4B6RA 4BN5A 4ENUA 1QE5A 1QNLA 4MP3A 3JQAA 3SDZA 3ENQA 2P79A 4H4CA 4RD3A 2FA9A 2C0PA 2DECA 2ILTA 1CC1S 1Z4PX 4MVJD 5E6UB 3GY0A 5H83A 2OBLA 3ZD9A 1UUFA 5C51B 1IHUA 4HQ0A 3WGLA 2D00A 3R40A 1YZVA 1F0NA 3H1AA 1U5BB 4L4RA 4A6DA 3B78A 1UXOA 5JROA 5CHEA 1HH4A 4MA4A 1FZTA 3PUJA 1FXUA 5TEVA 2QGZA 2VYVA 5J1TB 1RYBA 4DB2A 1U1EA 3G0CA 3WY9A 4KIGA 3N2YA 4CYMA 1UKYA 2XHZA 4C76A 1J9EA 1S8NA 1CTQA 3C7CB 3LNTA 5K0CA 4B75A 1A9XA 4D92A 3TYXA 1GNVA 3JYPA 3WBBA 4HDKA 1SCNE 1L4FA 2GRJA 3F73A 1E3DA 1FSZA 1RZUA 3ABSB 1SZPA 2AYYA 3W5VA 1SWWA 2RHRA 3ZV6A 2EG5A 3BSYA 3IBTA 1A76A 2DFVA 1W76A 4O2AA 2QD3A 1XYGA 1YRLA 3WGYA 4BLT