3P1JA

Crystal structure of human gtpase imap family member 2 in the nucleotide-free state
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
190
Chain Sequence
SELRIILVGKTGTGKSAAGNSILRKQAFTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKGSLMDYMHDSDNKALSKLVAACGGRICAFNNGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase IMAP family member 2
publication title Crystal structure of human GTPase IMAP family member 2 in the nucleotide-free state
rcsb
source organism Homo sapiens
total genus 72
structure length 190
sequence length 205
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3p1jA00
4TMZA 2ZRJA 1OW3B 5A0FA 3EARA 2CVFA 1NSFA 4Q9KA 3SYNA 2IYTA 3T1QA 2G0TA 3BBPA 1UDWA 2ERXA 4KU4A 3U7FB 4MYHA 3ZH9B 3MGCA 4QNRA 5UKDA 1T0JB 1V5WA 2YVUA 5K8TA 4K46A 1CR2A 3T35A 1RVDA 4C9BA 2UVQA 5LB4A 1Z6AA 1U8ZA 1GUAA 2QAGA 1VIYA 4Z8XA 3K70C 5HE9A 1Z6XA 1TU4A 2AFIE 3N2EA 3M1IA 1RJ9B 2G77B 2YHSA 621PA 4QKQA 2QSYA 4PSKA 4LI0A 4KI0A 4DLRA 1ZJ6A 1E1QA 3KJEA 4BE7B 3ZS9A 2VYFA 1N2CE 1G7SA 4BLQA 4QJ3A 1Z29A 1ZNYA 1SVMA 3WYFA 1FX0B 3EWSA 4BZXA 5JI2E 3EIQA 4ERNA 5TMPA 4GPTA 4OI2A 2GILA 3V4FA 3KQHA 2J59A 4M21A 2WSSA 1KZ7B 1XEXB 4N3NA 2RGCA 3NDBB 4FMCB 2A5FA 2WJVA 4R7ZA 2GJKA 2IXGA 3EWAA 1ZU5A 5CB8A 4ZO4A 3A58B 2JLRA 4QM6A 1XF9A 4M4SA 3ZZUA 5JI3E 3U60B 1OH8A 3B1ZA 1NVVR 2KBEA 1II8A 3SHWA 3HR7A 1AZSC 4DLUA 2XB2A 1FNMA 4V0KA 3MD0A 1KI1A 2NO9A 3PG5A 1IY2A 3TKLA 4OHVA 2IS1A 2ORIA 2C78A 3W3ZB 4BLOA 3FPAA 3N5CA 4TYYA 4Q4LA 3QVVA 4A8JC 4DCTA 4WAUA 3RC8A 4NCJA 2WWYA 2ZYWX 1OF1A 3TSOA 5LPNA 2G83A 4MYCA 2WKQA 5DI9A 4KVGA 2H17A 4PHTA 4M2LA 1HEIA 5FPTA 3K0CA 3K70B 4D6PA 2QTFA 2ZUDA 5JEEA 4KV9A 3FHCB 3Q9LA 2VO1A 4HI0E 3LDAA 4DEYA 1X8LA 3V4RA 4LPKA 3NVAA 1U94A 2IUSA 4Q4JB 4W5WA 5DI3A 5AUNB 2WTUA 3FGNA 2O8EB 1QG4A 1KI9A 3BE4A 5L8VA 4OKSA 1E6CA 4EJSA 4CEHA 2GAAA 2QL6A 2DPXA 1IJEA 4AKHA 2V4ZA 4TSFD 2CLSA 4MRSA 2IUTA 4II7A 3EXAA 3FKQA 1MO3A 5DNYB 2YC4C 1HQCA 4L9SA 4WXRA 1CLUA 2CCGA 2QUZA 1AQYA 2W00A 3CRW1 5P21A 2F1RA 3I1FA 3HDTA 4BASA 4FINA 4MKGA 3WMFA 1DAMA 4DCVA 4RKEA 4UJ5A 3FTQA 1KK2A 4Q7MB 1E2FA 3CUEF 3BH7A 3QI2A 3ZLJA 2WJIA 3W6OA 3T5DA 1F60A 2EFGA 2KE5A 2WJYA 3VR3A 1VMAA 1PZNA 1CJUC 4R98A 5DO9A 2ODEA 2V1UA 1CRPA 1BMFD 1YHNA 4JL5A 3QNUA 2IA5A 5FBQB 1GL9B 3LH5A 2XTMA 2RGXA 4LHYA 2RH5A 4IOLA 4TMWA 2YINC 3SQWA 3DHWC 4R9UC 4C3ZA 3LAWA 3GJXC 2BBWA 4PC7A 3QKRA 2IWRA 4Q4AA 1OFTA 1KAGA 4Q03A 3U3OA 3HU3A 2OBLA 1P62B 1ZAKA 4NYJR 2QROA 3NH9A 1JR3D 3UANA 2CBZA 2F55A 3GJ8A 2FPKA 4US0R 1AM4D 4D0NA 4Q1FA 5ELXA 4WXPA 1MRNA 2CMKA 4PAOA 2DFTA 4B3XA 2G6BA 1NL3A 1KK1A 3TE6A 2HCBA 1XMVA 4BGDA 4OI4A 3IHLA 2XZOA 4TSFA 3FFBA 4EPYA 3VHLB 3VTKA 5H70A 2FX3A 1NN1A 3CPJB 1G17A 4FXPA 1G4UR 5HCNA 1Z5ZA 4RJLA 2W0SA 4PC2A 1YE8A 5CB6A 3ZZ0A 1P5ZB 3VNUA 3AGPA 2V55B 1B23P 4IKEA 4ZV4A 1E9DA 4UXIA 5CLLA 1BOFA 1YRBA 2DWQA 4NCNA 4ITRC 1GKIA 2JJ1D 4B75A 4G3XA 1J8YF 3CWQA 3ZDQA 1E94E 1BS1A 1BMFA 1XRJA 4EAQA 1KI7A 4B3CA 1T0HB 1ZC4A 1Y63A 2QG6A 2WWFA 2CE7A 1QHHB 1KMHB 3BWDD 3OHMA 3B9PA 4MA4A 4ARZB 2O8EA 4IVPA 4BLRA 2W6JD 4WIAA 3NTUA 3RSOA 4FN5A 1WCV1 3KKOA 2KJQA 3EPKA 1KO1A 2AXPA 4P3YA 1JPJA 1JR3A 4GDFA 4OHZA 3GLGB 2ATXA 2FH5B 4URWR 4HAWA 4OI0A 1XDBA 2GESA 1E2NA 4ILEA 1TMKA 4MGYR 2ZRIA 1Z0IA 4IXMA 3NXSA 3W9YA 4C0SA 1N6KA 1NBME 3EG5A 5GJBA 1ZM4A 5CJPA 3TW4A 2G1JA 4DDUA 4AKIA 3U3RA 4PANA 2PLFA 3B6EA 3VKWA 2AX4A 2IEZA 2BHRA 2J7KA 3W5IA 1AZTA 2O8BB 4QXAA 4NKRA 3HWSA 3RRMA 1E2MA 1AN0A 2RAPA 5KNCA 3AVVA 4TZ0A 1ZIPA 3CZPA 3HP1A 4EPXA 3ND8A 5BN5A 1L4UA 2PMDA 3Q8XB 5FBLB 2OXRA 1JI0A 1TAGA 2IT1A 2EYUA 2W58A 2N1BA 4B2IA 1BO6A 1RPZA 4Q1EA 2JJ1A 4U5XA 3VKHA 1XTIA 2IXFA 4MITA 3T15A 2J0SA 1TX4B 1XJCA 2C98A 4BFXA 4JVMA 2JLSA 1JEEA 4DB4A 2H92A 4AIIA 3OIVA 4C0BA 2AK3A 1U8YA 3CWZA 2W6JA 4PSAA 2V7QD 3SQXA 1G3QA 1AQUA 1NN3A 4TN1A 1YR7A 1CF4A 2A30A 2ZYTX 721PA 5LDDC 1UKEA 3LA6A 1D9ZA 4AG5A 2IYSA 2ONJA 2QORA 2P2LA 2YV5A 4IVQA 4JLKA 1OFHA 3QXXA 1JNYA 5IF9A 1FNNA 2NTYC 3AVQA 5EQTA 1UAAA 1GILA 4JYBA 1DO0A 1OXTA 2KI5A 2OZEA 4Q00A 5KPDA 1E0JA 2F9LA 1Z6YA 4DDVA 1H65A 2WMOB 2WSMA 2ZI6A 4YMTA 1IHUA 1LVGA 2GZHA 2ECKA 2HLDD 3GQBA 3AH8A 1GFIA 3ZVRA 3TK1A 3IPXA 5HKKD 2J3EA 2ZI5A 4A9AA 2EWWA 2BCGY 3NWJA 3V00A 3OEHD 5EP1A 4DBLC 2BEJA 4Q9LA 1IY1A 3KB1A 3X1ZA 1KMHA 4C4PA 3ZIAD 1VIAA 5D3MB 1ZM3A 3AKDA 1CXZA 1TUIA 3A1WA 3QPWA 2Q9CA 1Q3TA 3A1VA 3DZDA 2YYZA 1K6MA 4TMKA 1NG9A 2BOVA 2ZREA 4LJ5A 2IEYA 4V0OA 3CRRA 2JASA 2O0JA 2V6IA 2GK6A 2GZAA 2V7QA 1OIXA 3ADBA 2OCPA 1HTWA 4LC0A 2IYZA 1J90A 2KB0A 2P5TB 2WHXA 3GLFA 3MMPA 2EW1A 2HT1A 3RS0A 5EXPA 2Q3MA 3GPLA 2DBYA 2F43A 1IN8A 3B7GA 3OIUA 4FW9A 1E99A 2R6DA 2ODBA 2ZS8A 2WWHA 3MAAC 3U44A 4RFVA 2PL3A 1HV8A 4TWZA 3AVYA 2XAUA 1N0WA 4KODA 3RAPR 1GSIA 2FF7A 2GJSA 3WMEA 2WWGA 2NGRA 1G291 3LO5A 2D62A 3KJHA 1ZD8A 2O0HA 1M6NA 4DSOA 1VG0B 3AF1A 5L3SB 2HLDA 3LX8A 1CTQA 1QHXA 4CEJB 1S3GA 1UKVY 3MSXA 4I1OA 2IBMA 3UMSA 1Z3IX 1E9RA 5HKKA 4YDSA 5JWRA 1TL7C 2WOOA 1OLOA 3OEHA 3L0IB 1IBRA 3QIAA 1PUIA 1E3MA 2YOHA 4LJ4A 1K8RA 1NKTA 2GVDC 3ZIAA 4TQUS 4A4DA 4P0TA 2OHFA 2ASEA 4FD2A 3K0FB 3U4QB 2X2EA 1UBGA 3E2IA 2HYDA 2Q21A 1IY0A 4BQSA 1YRAA 2JLYA 4KO8A 1R2QA 2FWRA 2CXXA 3R7WA 3F5FA 4A82A 4MDFA 3B1WA 5AK0A 3I5YA 2QQEA 4TL8A 5FOTA 4G5SA 5E7JA 3NHBA 3TNFA 2QSZA 4RCYA 4X8OA 3B1YA 1A2KC 2XNSA 1H8HD 2CJWB 2RGNA 2QY9A 1C1YA 1TF7A 1W4BA 2E1RA 3IKJA 4B34A 4F7WA 2VIIA 5JCZA 2GEUA 3EZ6A 4UNSA 2J45A 4ZPXA 5EXSA 4PZZA 1Q57A 4LBWA 3IEVA 2O52A 2V6JA 2NO7A 4E09A 3TGPA 2OESA 2X8AA 3CF2A 2AWOA 2QMEA 5KNDA 2HCJB 2KWIA 1UPTA 4BWYA 2BCJQ 3CM0A 4TMTA 3LXXA 1T3LA 2RGEA 4CDGA 1M7BA 2R6GA 3UG6A 3EZ9A 1YZUA 2VSXA 4GP7A 2Y8EA 1E4VA 4ZKEA 2QGNA 3RLFA 1KDTA 4M1SA 1KI6A 1UEIA 2GDJA 4LCBA 5JS8A 4TL9A 4EQ6A 1JJVA 4OQFA 1G3MA 4YMUA 4IRUB 3GLGE 3THYB 2REBA 3H1TA 2OFWA 3RRYA 4YMVA 2FGJA 4OI1A 1J2JA 2QEQA 3F8TA 4GMXA 4DXAA 3DOEA 4CYMA 5KDLA 1XTSA 5GVSA 3BFXA 2HF8A 4B3GA 3PXGA 1ZP6A 3DDCA 2IYXA 3WHKA 1Q44A 1NP6A 3WY9A 5BYJA 2VHCA 4BLTA 4DWJA 3ADCA 3CRMA 1O3YA 3OF5A 1NN5A 4Q47A 3X1DA 3QXSA 1H8HA 3UPUA 3NG1A 2NO1A 4R2HA 2VP9A 5CDFA 1KK0A 1E2QA 3PUWA 1E98A 3WRYC 3L8YA 4DJTA 4WW0A 3SU8A 1WQ1R 4HUQA 4CEJA 1XD2A 5FUVA 1W48A 5LB2A 1YR9A 1JB1A 4HAXA 4CRWB 4JS0A 4HYYA 2GJ8A 5KSPA 2FSFA 5JCPA 5FOVA 1YJ5A 1Z0KA 1EX6A 4LYAA 1FPMA 4PSVA 1G8PA 3L2OB 5G3YA 4TLDA 5FPSA 1P3JA 2HEIA 2B92A 1N6PA 1YR8A 3AB3A 1SULA 1VG1A 2YOFA 4L9WA 1RRCA 4DCNA 3TUZC 2WICA 2GXUA 2R2AA 4XWOA 3X1WA 4B3DA 3BD9A 5HCIA 4Q01A 3MUFA 1LTQA 4MYTA 3KJIA 3TSWA 4DDTA 1ZM9A 4HB0A 2BEKA 5JEDA 3LRPA 5SZKB 2QAGC 3LQQA 4P4SB 1Q3HA 5IHPA 3PR1A 2WKPA 1R8QA 1W4RA 2GNOA 1A4RA 3R9IA 1QDEA 1TPZA 1R0ZA 2PEZA 1F2TA 3OE7D 3AV0B 2PCLA 3X1YA 1W36C 4GNKA 2HV8A 5JHGB 4H1UA 4LHVA 4PHFA 4D4MA 3SN6A 3ZQJA 1KI8A 5DHAA 3OAAD 1M74A 1S8FA 1P4SA 1DAKA 4M1OA 4EDHA 2ZE6A 3KXKA 3U3MA 3CBQA 4LHXA 1P2VA 2OEPA 3IUYA 4JLDA 4HB2A 1DAFA 1D2MA 2ZRKA 3MWJA 5FL3A 4LJYA 4DEXA 2ZSFA 5FOWA 4NTZA 3G82C 3PV0A 1KO7A 2GHIA 2A78A 2KSQA 3I32A 4G01B 4IDPA 5AJWA 5DYIA 4F91B 3TR0A 4Y0AA 4OJQA 4FIDA 1E9AA 1JJ7A 1SXJB 4IOJA 1LS6A 5JS7A 1NJGA 1Q22A 1ESNA 1N6NA 2B8TA 5SZJA 1XNJA 2Q6TA 3Q5DA 4RZXA 1FFHA 1MKYA 4NCKA 1P60A 1WE2A 2D7CA 3A1TA 1Q21A 3CW2A 1E2GA 1QHNA 2ANCA 1F2UA 1I4TD 4Q7JB 1GP2A 1X86B 2NG1A 3NBYC 3K0CC 1KY3A 3OE7A 4EFMA 3TQCA 2JEOA 2ZVPX 3A37A 4WOPA 2YOGA 5H68A 2MMCA 3U6KA 2IHBA 1OKKD 3RWOA 5HE8A 3RRZA 3OAAA 4OQNA 2W2TA 3FWYA 3FVQA 3VU9B 1G3RA 1N6LA 3O8BA 4YDHB 1SVOA 3SJAA 4EJSC 4MUBA 4B35A 4BFVA 1SKYB 3QG1A 4P31A 5KSOA 3F3YA 3D6TB 2C04A 5J4LA 5KO2A 4ZIRB 1ZVQA 2OFOA 2IHYA 2PCJA 1XFAA 3EZFA 2XXAA 4C7OB 3THXB 1VCOA 1NJFA 2ZITA 4U02A 2VQSA 2QBYA 5EZ5A 3E5HA 1HY3A 3QKSA 2B21A 4MKHA 1ZM7A 4ABYA 2REXB 2PH1A 1G8FA 2ZAOA 1P61B 1R5NA 1EWRA 2GF9A 2MMGA 3IILA 3T1OA 1IXSB 1E2KA 4RFSA 1WRBA 2REOA 1U0LA 1G5PA 2BBSA 2ZVQX 3IBGA 3L0OA 3TJZA 4G5QA 3CNOA 4F93B 2X19A 1G8HA 3FYHA 1NI3A 3LLMA 1W47A 2FEMA 5BWMA 5BXQC 1W1WA 1S9DA 3IGFA 5EUMA 2ZI4A 2V8OA 1US8A 1VKJA 2XZPA 3GJ6A 4N1AA 4OHXA 4M1MA 4M9SA 1P73A 2O0KA 1TADA 4ZI3A 5FUWA 1XCPA 3K9NA 3PJRA 2F3RA 3ECCA 4OYHA 2F3TA 1FUUA 2VHQA 3SBEA 3R8FA 3ETLA 2Z0MA 3EZ7A 4XVQA 4ACAA 1FW6A 4NYMQ 5FUXA 2JLUA 5AUOB 2XOKD 2GCOB 1OKKA 2WM9B 1NKSA 3QE0A 3ASZA 4JVSB 3UK6A 1RW4A 3L43A 3W8NA 4QBIA 5B30A 5JRZA 5J4YA 3RS4A 2EFCB 4JYCA 4DZZA 2IF2A 3KX2A 4IFEA 2BIFA 4BFTA 1U81A 3R9WA 4LPSA 1E9EA 3P27A 3A1SA 5IK2D 4IEEA 2FFAA 4I99A 1G64A 2I3BA 1G9XA 3K0EA 1W44A 2IF0A 1MO6A 4DSUA 2QMUA 3CONA 3K9HA 3K0AA 5AJVB 2WBLC 5AJXA 3W8RA 3C41J 1OB5A 3U3JA 4BECA 4GFDA 1YZTA 1U0JA 1E79D 1N5IA 4D0GA 3KTAB 1G3UA 4DUGD 3JZMA 2AD5A 3S1AA 2FV8A 5J4VA 4GRAA 3EX7C 2AHOA 1TU3A 4MRRA 5JJLA 1DAGA 2ZUBA 4URYR 5EP4A 4JZKA 5BYKA 4M1TA 1K5GA 3CRQA 3B9QA 3KFXA 5AUQA 1II0A 3L8ZA 1J8MF 4TLBA 3FFAA 3ICQB 1NBMD 4ZDJA 1T8UA 2P0EA 5G41A 4N0DA 5KSYA 1ODFA 1LF5A 2AKYA 3SBDA 3PUYA 1G19A 1Q1ZA 2A5YB 3VU9A 1YZLA 4G5OA 2YKGA 4PHHA 1TF5A 4Q4HB 3GEHA 1GRRA 3Q85A 4PPQA 2XOKA 4B32A 3AVTA 1KK3A 3Q7PA 5C4GB 3G0HA 2VP0A 121PA 1ZCAA 2CL7X 4AKGA 1UM8A 5GJWC 1JR6A 2FG5A 2NMVA 3DKVA 2FJUA 4A0GA 2CLCX 2WV9A 5IK2A 5F3WB 5FOXA 1CRQA 1MABA 4HDOB 4C0JA 2F1IA 4QBFA 1JBKA 2VP4A 4IW3B 5FTKA 2ZTSA 2VHTA 4QHYA 1NY5A 4NL4H 5TVKA 2ZE8A 5JJIA 4OK6A 1FQKA 1YVDA 3WNBA 4B3FX 1QHYA 2ZSAA 4KFUA 1E79A 2WWWA 1GWNA 3IIKA 4V0LA 4DLYA 4YQFA 1E2PA 3T34A 3KKQA 4O3MA 4TTRA 5HZKA 3AF3A 4DUGA 1N25A 4HDQB 3KKPA 3AF2A 3IO3A 1RE0A 4HAUA 4LJ9A 4W5HA 3VR6A 4G1UC 4BFZA 3B78A 3B1VA 2ZAMA 2EFDB 5E7IA 5G40A 1VYTA 4RY2A 1GOTA 2H8KA 2RB4A 3TH5A 5HR5A 3U7GA 3W90A 2GBLC 5LBIA 1NBMA 3I72A 1XD9A 4ZDIA 2AFHE 2BV3A 3AVPA 5KSZA 3SYLA 4NZYA 5J47A 4QG7A 3HU1A 1AKYA 3DO6A 3K70D 3T61A 2FSIA 1W4CA 1RJ9A 2QP9X 5B57C 521PA 3LV8A 2FZLA 3P1JA 1L7VC 1TF2A 1NMXA 1UBEA 5BQ5A 4A8JB 3DL0A 3OIYA 2FE4A 3PCRB 4IXNA 2HJGA 4FI3C 3GJ7A 2XX3A 4PO1A 1K5DA 1FX0A 2JCSA 3VR5A 2O8CB 2ZR9A 5J4KA 3L0SA 1P72A 1SVKA 3LWNA 4RD4A 4DLVA 2J46A 2PEYA 2VF7A 1W49A 2OBNA 4ZCLA 1XEXA 2XTZA 5FR1A 2R8RA 2J9RA 5CLQA 1Z8FA 2CCKA 2QRZA 5FTLA 4JVNA 4UNPA 1QBKC 1GNRA 5KOYA 1X3SA 4RZ3A 2MSEB 4FCWA 2OCYC 3W3AA 1Z0DA 3CX8A 3KZ1E 3QBVA 4TYQA 3IDQA 1WB9A 4GOKA 2TMKA 3K8YA 3QXJA 3AEZA 3UXMA 5F9FA 4E5UA 4QGHA 4KXFB 1IONA 1ZUNB 2P65A 4W7SA 2IYRA 4ZDKA 3TBKA 3A4LA 1RRFA 3EPHA 5H8WA 4LBYA 4NE2A 1T4GA 4AI6A 5GADl 3CF6R 4URXR 1MRSA 5G3ZA 1AS3A 3DKPA 3LBIA 4S2EA 3HJNA 3LBHA 3ZD6A 4MQBA 1Q1QA 2NZ8A 2ZJ2A 1EGAA 1Q0UA 1OJLA 1ONBA 3DMNA 4Q9JA 3SOPA 5CYOA 4F38A 3KKMA 1X6VA 3TAUA 4Q4JA 1DAEA 2ZYUX 4MKFA 4TZ6A 1OIVA 3NBFA 1MOZA 1W0KD 2KBFA 4GSYA 4L15A 4MH0R 4NCIA 4XOIA 4CF7A 5JECA 1VYUA 1E9CA 2CNWD 2F1HA 4B44A 3D31A 4JLJA 2VH5R 2HDNB 3Q72A 2ERYA 1C4OA 2B7BA 2HJVA 2HXSA 3B2EA 2O8DB 1BH2A 3U3KA 2O8FB 4L8GA 3CX6A 4ESVA 1OIWA 3GLIB 2JLXA 3K09A 4A0HA 3SDZA 4OK3A 1T3HA 1FL9A 1DTSA 3RHFA 5FL7D 4D0LB 4C2TA 4KFSA 4PR0A 1OXUA 1LNZA 3THOA 3QXHA 1RYFA 2DFKB 3AP2A 1KI2A 2DCUA 1N6HA 1E4YA 5HTKA 2EVWX 3CLVA 1LF0A 2J0VA 1IXRC 1S1CA 4NONA 4MGIR 3E70C 3QJYA 2A2ZA 4HLDA 1ZC3A 2A5DA 1E1RD 3LXRA 4BFUA 3AKCA 5AJYA 5HPYB 1OXSC 3CNNA 1RC8A 4LGMA 1DAHA 1E0KA 3NC0C 4B6FA 3THWB 4O2LA 3SYKA 2IS2A 3LD9A 3SEAA 2ZJ5A 2LKCA 4F92B 1S3SA 5IT5A 1S1MA 4D26A 3EPLA 3LVQE 3EIHA 3UMRA 1U90A 3HPRA 2Q0HA 3MWKA 1I2DA 2H5EA 2ZANA 4B3BA 1W0KA 2AD1A 2N46A 1W2GA 4LHWA 1ZW6A 3GJ5A 5JBQA 1FTNA 2CNWA 1E32A 2FSHA 3UATA 3K0SA 1M1YE 3GFOA 1FTSA 3A4MA 3LLUA 2CL0X 4HAVA 1VHLA 4HLQB 3QSYA 1N6RA 1NN0A 4PFSA 1U2RA 3BS4A 5DSZA 2FEOA 3QPUA 1JECA 1DELA 4PTLA 3SR0A 2ZETA 2XSZD 4TMXA 3N70A 4QGAA 2GAOA 4M9XA 5FL7A 4EPRA 4ZCMA 3PEYA 5KDOA 2QZ4A 1F5NA 3CZQA 3MWLA 4A0RA 1QVRA 2HT6A 2OAQ1 1PUJA 5CIQA 1DADA 4DRZA 1RYHA 1KDRA 4BRWA 1KY2A 1SVIA 1NVXQ 1FQJA 1KI3A 2IYUA 1E1RA 2AL7A 3LFUA 3RABA 4E22A 5FUYA 3QY0A 4ARZA 4WZAE 1QHHA 4Z51A 1XMSA 5DN6D 3SE0A 5EE0A 1EK0A 2QAJA 3FHOA 3D3QA 4RSGA 4AYXA 4HB3A 5FFMA 1N5JA 4URUR 3AKEA 5CM8B 1BYUA 2NQ2C 2VSOA 4CT5A 2UZIR 1DARA 1GM5A 4NYMR 5JMTA 1SZPA 5CJ2A 4DSTA 1LY1A 4CW7A 3GLGA 2V1XA 2WJHA 3N2IA 3QVUA 1TTTA 2MSCB 2VRWA 2ZYVX 5TB5A 2EFHB 5KNBA 1AKEA 4KYIB 4Q7KA 221PA 1G7RA 4KVAA 1NLYA 1XD8A 1COWD 2CK3D 3QBTA 4LBVA 4DIDA 4KFTA 3H84A 5L3QB 4JVLA 4V03A 4C0AC 1XPRA 1E2DA 4OBEA 3P4YA 2R6FA 2BBTA 3KDSE 1NMYA 1DO2A 1I4LD 1HH4A 1SHKA 3G5UA 2O8BA 1CU1A 4DKXA 2QN6A 2XJ4A 1XWIA 1WBDA 1A5TA 2GEDA 4RD2A 5SZHB 1KNQA 1OPXA 1RRGA 2QPAA 2XSZA 2P6UA 4BFSA 2E9SA 2VPPA 4A0FA 4CEIB 3PENA 2C96A 4JLPA 4PPFA 3GJ4A 3C5HA 821PA 5EJEA 1XXHB 3O8DA 3IO5A 3MJRA 1KDPA 2YWGA 2F1JA 4US1R 1LFDB 5B64A 1OXVA 1YZQA 3WYAA 2EYQA 4POAA 5FI1B 4Q1AA 5DN6A 4TYNA 5CK4A 4B47A 4W9MC 4YMSA 1CKEA 2FDCA 3AQ4A 4LK2A 1DS6A 3I5XA 1II9A 1ETUA 5EE1A 1KSHA 2Z5FA 1PLLA 1KNXA 2F7SA 3O8CA 1KO4A 3MWYW 1O87A 2QM8A 1M34E 4GL2A 3AP1A 2A3RA 2GJAA 4MDEA 4FWTA 1COWA 2CK3A 2HF9A 4M0LA 3SS8A 3WXMA 2QT0A 4WA7A 4BLPA 1P2SA 1Q12A 4NYIQ 3GLHB 4B73A 2BDTA 4H9GA 2ZU0C 1DAIA 2C9OA 2XNDD 4LY6A 3OFND 4C0LA 1OT3A 1YZNA 4D25A 1XCMA 1HUQA 2RHDA 3MRSA 3CR8A 3Q5EA 5C1BA 4LSGA 1U98A 2QT1A 2OILA 3BIFA 4PZLA 5FPYA 5KUTA 4I1UA 4V0MA 3QF4B 4EUNA 5EZ6B 4DCUA 4TQAA 4L5BA 1KSJA 1KKMA 4CVNA 5D3MA 3SHFA 1NMZA 4JSTA 5D3QA 1XBTA 1XTJA 2PZFA 1EFTA 1R10A 4I1VA 2ANBA 3VR4A 2VP2A 1KO8A 1XMIA 3NEJA 1KOFA 1UDXA 2ZRDA 3IQXA 4EPVA 4LUCA 5FBVB 4UNQA 1DE0A 1KI4A 3EC2A 4KSCA 2BVNA 1P75A 4LYFA 3KQKA 3WNDA 3BH6A 2C99A 1AJEA 2K5UA 3VHXA 4BZPA 3FMFA 5L3QA 2B7CA 2SHKA 2X77A 3MCAA 1SVLA 5C46F 1R5OA 3AP3A 2H18A 2R65A 3C15C 1BIFA 1E2IA 3NIBA 4BRUA 2YWHA 5JZVA 2QMOA 2H57A 4ACBA 3EASA 2ODWA 2IW3A 2C8VA 1D5CA 4RKFA 1D2NA 4NHOA 3L82B 3CX7A 3U5ZB 2VL7A 1WMSA 4Q19A 1U9IA 5L3SA 2XNDA 3OFNA 2W83A 3LQRA 3RDPA 3TR5A 2ZJ8A 2WVJA 1XXHA 3NBZC 1G4AE 2YWFA 3K9GA 2Q9BA 1GIAA 3I4LA 3TMKA 3BH0A 1CR0A 3NKVA 1Z0JA 2XZLA 4OHYA 3ZQ6A 1WXQA 4AC9A 4RVCA 2GJ9A 2RGBA 5FR2A 1XX6A 3K0FA 4PQYA 2ZI7A 1Z22A 1P7CA 2GCNA 3TQFA 4ESHA 5DIFA 3U4QA 1W7AA 1SGWA 4DLZA 4Q9IA 4LX0A 2WWXA 4B2PA 4BFWA 2ZSEA 2Q9AA 5AWFC 3VAAA 1OSNA 2IWHA 1GZSA 1HURA 3K1JA 4TLEA 4JLNA 1CR1A 3C7KA 3TUJC 2IUUA 1J99A 1X1RA 2F9MA 1FMJA 2GKSA 4JLOA 3U61B 1P2UA 2D3WA 2B8WA 2I1QA 3C4JA 4GT1A 5DYGA 3FOZA 2CJWA 5LD2C 1G21E 2QPOA 5J5CA 2ATVA 1NLFA 4O2RA 3H86A 2J0UB 4LJ7A 1YZGA 4IHQA 3KUDA 3NEYA 1X8KA 4YMWA 5DGXA 2FZ4A 2BBOA 3HR8A 3U7EB 5EP2A 2OSBA 1KSFX 2Z4SA 4FWIB 2W2XA 3DVLA 4AK9A 1XP8A 4U7DA 3FKSD 3ZJYA 4EFLA 2GEVA 3B60A 1VCMA 2P3SA 4V0ME 4ZDWA 5J40A 1E69A 5E3HA 4P4TA 4TL7A 1GL7A 5JHHB 2RKOA 5JSZB 4D4JA 1XPOA 3MJHA 2BM1A 2QE7D 4PC1A 2H7VA 3BB1A 2ZROA 5JWOA 2HYIC 2IK8A 3KL4A 3NBXX 4MKIA 4B2LA 5FI0B 2BC9A 5KU1A 2OBMA 3BJIC 4RD3A 1N6OA 2IXEA 4KBFA 3THYA 2D4HA 3CPEA 1VHTA 2YNMA 3BAFA 3RYTC 1E9SA 4OK5A 3T12A 5K8UA 4PX9A 2VP6A 3KKNA 3AF4A 3GJ3A 4I81A 3GEIA 2BKEA 1J7KA 3DM9B 3O47A 3CF0A 1TQ4A 2A9KA 4A36A 1G6HA 1KJZA 2Z4RA 2WIAA 1ELOA 3GD7A 2P5SA 1I4DD 2ZM5A 4A2PA 2QA5A 3WP0A 1TQ2A 1GL6A 2H16A 3K53A 2AR7A 2XGJA 3SFVA 2QAGB 1NRJB 4QBHA 3GFTA 3I8XA 2WAYA 1TEVA 4NDZA 2ZJOA 1XPUA 1Z6GA 1RZ3A 2OT3B 5TV2A 3QEOA 2DWPA 3UKDA 3MFYA 1W36B 1QG2A 4KBGA 1EFUA 1X8JA 1XXHE 4AG6A 1MO5A 1XTQA 5HZHA 3GMTA 3SJZA 3FKSA 1E9FA 1W5SA 4GZLA 1XZPA 5L3VA 1JAHA 4D80A 1VG8A 1N0UA 3KJGA 5BN3A 1MH1A 1G18A 4Q5IA 4KJZA 3QXCA 1N3BA 3IEUA 4JLBA 4D82A 2QE7A 5TARA 4YC7A 1SXJD 2RCNA 3TUIC 1G5TA 4B33A 4QRHA 4B43A 2DY1A 2QENA 3RVBA 4XVRA 2EQBA 1HE8B 2ZE7A 4P32A 2AN9A 2ZU6A 2OXCA 3C14C 4Z1MD 3ICEA 1G8GA 3NDPA 1L2TA 4HZUB 1W2HA 5KPJA 4HLCA 2PT5A 2QTVB 4JBXA 4P4SA 1II8B 3GEEA 3CR7A 3K9LA 3QF7A 1LB1B 3B13B 4HLUA 3GLHE 4KITB 2ZIAA 3SZRA 1OH7A 1CJTC 3TLXA 4LRWA 1M7HA 1P9WA 1ZD9A 3TRFA 6Q21A 1GITA 2FOLA 3JVVA 2ZJAA 1IN7A 2C03A 4QGGA 1Z6TA 2WJJA 4OHWA 3FMOB 3QG5A 4Q9HA 1HT2E 2GXSA 3DM5A 3T06B 2BMFA 3RSLA 1GKUB 3EA0A 1XB2A 2G88A 5ANRB 4E07A 4QNMA 1WBBA 1T9HA 2JJ8A 1QZXA 3IHWA 1JXOA 3I92A 4QJ4A 3LX5A 1TQDA 4URZR 1P9RA 1BKDR 3W5JA 1ZNZA 3GCGA 2GVZC 2YWEA 1G7TA 2QGZA 4LV5B 3M4YA 2VF8A 2RGGA 1S4QA 4JL8A 2WZQA 4QHSA 3A8TA 4Q02A 4A92A 4EJSB 2G0NA 4CEHB 3KXIA 1CULC 1Q1BA 3X2SA 4IDHA 2NPIA 2FN4A 1YZKA 4FCTA 1E96A 4IOKA 4DLTA 1XEWY 2FSGA 1YQTA 4AWXA 5B2ZA 4JBWA 5FPHA 1SXJA 1R4AA 3EIEA 4UXHA 4UNNA 3U7HB 4DT1B 3LW7A 4BEJA 4G5RA 1AGRA 4DHEA 4Z1MA 5IDVA 3ZVNA 1G16A 2OV2A 5DE3A 2IX3A 4MYUA 1QVAA 4WBSA 4AYTA 4IJMA 3QEJA 4HEJA 3PUVA 3RS3A 1UFQA 4K8OA 1XEWX 4URVR 3WP1B 4E03A 3PUZA 2C9CA 4JL6A 2V54A 3KFVA 2UKDA 2ZRLA 1W4AA 1FP7A 1JQJC 4QGFA 4D2IA 3JZAA 4A6PA 2IL1A 1ZCBA 1RFLA 3ZGXA 1ZRHA 2PJZA 1OHHD 2C5LA 2QTHA 1YR6A 2VEDA 4BZQA 1UBFA 4NBSA 3I62A 1ZYUA 3QKTA 1N5KA 4B76A 4BLSA 4YONB 3DMDA 3TAHA 3P32A 4XD7D 4YLGA 4EKDA 3QKRB 4KHZA 4Q4AB 1P6XA 1B0UA 3CNLA 4FMDF 4EPTA 2GF0A 2P6RA 4ZIRA 4JLMA 1HA3A 3KQUA 4QFMA 4C7OA 3THXA 2MSDB 3K09C 2CEAA 1W46A 2OLJA 4MRNA 2OUKA 4XH9B 2OFXA 4C2UA 1QHIA 2FA9A 3PUXA 1CJKC 1KAOA 3LW8A 4NYIR 1FMLA 2D06A 2R9VA 3QPVA 4JIMA 5JWHA 4HZUA 1A7JA 5FTJA 2J87A 1NNEA 1NF3A 3RS5A 1KIMA 4GOJA 2C2HA 4HATA 2CL6X 1CIPA 4BUJA 2CHVA 1TQ6A 1SQ5A 3AKYA 4NMMA 4IEIA 1X1SA 1ZINA 2ZR7A 1LV7A 5TY0A 3ZS8A 3AVWA 1EX7A 2IYYA 4PO9A 2ONKA 2I4IA 1UF9A 3AUXA 1EWQA 2FU5C 1LS1A 4ASUD 4X8HA 1D8TA 4IDQA 3M0EA 2UZ3A 1SKQA 2PZGA 1RRPA 4XVUA 3TVTA 5JFGA 3AVOA 3PEVA 4OJKA 2GCOA 2NO6A 2FPMA 3V9PA 1SVSA 4EQ6B 1OHHA 4TYPA 2D74A 1S0UA 4XSHA 2PMKA 3LVRE 1YU9A 2F6RA 4NP6A 2AWNA 5FBWB 4A15A 4HAYA 4N0EA 1OFIA 1OFUX 1VCIA 4XD7A 3F0TA 4M8NE 1JPNA 3CO5A 3VQTA 5TXGA 2H1LA 1E2EA 3KUCA 4LBZA 1T6NA 5DLQC 1F3OA 2GCPA 4B74A 3FMIA 4PPGA 3A1UA 1UKYA 4U00A 4TQ9A 1HYQA 3ZZTA 3QUSA 2BJWA 2J7PD 3WMGA 1SXJE 1E2LA 3ASYA 3PFIA 4JKIA 2HUPA 2EU8A 4DT1A 5C18A 2WMNB 2OM2A 4DC9A 3CH4B 4JJKA 1CP2A 2GTPA 3KTAA 3AM1A 4PO8A 4LYHA 4C0KA 1VDZA 4QM7A 1ZD1A 1NSTA 1I2MA 2QPTA 3AGQA 3RS2A 5A5GA 2ZS9A 3I8SA 1PV4A 3ZYCA 5DISB 4IOMA 1WDTA 4PZYA 1N5LA 4JMPA 1OYWA 5KHOC 1Q1EA 2IC5A 5F9HA 1N0VC 2J1LA 1ZMXA 4TTPA 4KLNA 2NPFA 3BFKA 4LJ8A 1ZIOA 2OG2A 3M6AA 1ESMA 4ASUA 2JDID 1U8AA 2FPLA 1UJ2A 1T5IA 2ZRAA 2IYVA 4JKYA 4Y0VA 5EUQB 4B71A 5L3RA 1SKYE 4Q4HA 5FTNA 3PITA 1A2BA 1IQPA 1P9NA 4O0MA 1MO4A 1T5LA 3P20A 4C0QC 4HUTA 2X1VA 3NHAA 2XITA 3GP8A 2WOJA 1KKLA 3BXZA 4G0NA 3KQLA 3BOSA 4HSEA 1SHZA 1L4YA 2Z83A 4PC3A 3QKUA 3NH6A 5FOUA 1JEDA 3HYRA 2QP3A 2J7PA 1TNDA 4DDWA 2CE2X 3P4XA 1CR4A 2NZJA 3W6NA 1IN5A 1GNQA 1P2TA 4KSBA 1RIFA 2BWJA 5EXXA 1EESA 1GVNB 4WVFA 4Z54A 1U0HC 1ZM2A 1D6JA 1DOAA 2LKDA 4TYWA 4IVRA 2JGNA 2PX0A 2VLIA 2ZRHA 2GXAA 3EPJA 2DHRA 2OCBA 4LDJA 5B58C 1VYVA 2ZR0A 4US2R 1CJMA 1KHTA 2BKUA 4DVGA 3I73A 2BM0A 2BMEA 2QP4A 4IDOA 3SJCA 4KFRA 1QHSA 3CKLA 4QBGB 2YZ2A 4M22A 1GRNA 2JDIA 4FMDB 3IIJA 4R2IA 3FDIA 2ZPTX 4B48A 4F4JA 1G6OA 1Q20A 4A6XA 4AKEA 1QRAA 1GTVA 2A7QA 3D8BA 4X8MA 1W0JD 2C95A 2CCJA 4QHTA 1J70A 1KTVA 3WBJA 4A8JA 1CBUA 4X8LA 3NC1C 2PJRA 2XJ9A 3FE2A 2JLZA 5CM9C 2RGNC 1DPFA 4RZUA 5FBRB 4LV6A 3REFA 4B6EA 2CHQA 3GLFB 2ZI3A 1G1MA 1ZUHA 3ZVMA 4EIWA 3VFDA 1IXZA 2QRNA 2F43B 2O8CA 1Z06A 1DVRA 1IAQA 2ZJBA 4PQFA 2W2VA 4OQMA 3U44B 1KGDA 4XWKA 1F6BA 2FMXA 2Q3FA 1NIJA 5FTMA 2V9PA 3RC3A 2OO7A 2GWHA 3CIOA 2AXNA 1QHGA 2IYQA 3OESA 1KMQA 4H1VA 3H2YA 2OCAA 4LWZA 2LWIA 1S2MA 1S96A 1M8PA 4MRPA 5CK5A 2FFQA 3R9XA 1VPLA 2ZJZA 1JXMA 2PZEA 1G7CA 3AF0A 1DEKA 2Z6VA 3GFPA 2D2EA 2WKRA 5GJVC 2WJGA 1NVWQ 2GBLA 3B8HA 5KYKA 1T3SA 5EP3A 4QOSA 1HT1E 1TEXA 1KJYA 4PQRA 2Q3HA 3ADDA 1MV5A 2GZDA 2G1KA 4ON9A 1VG9B 3UG7A 3R7WB 3HU2A 2O5VA 4IFBA 2BJVA 4P4UA 1W0JA 3WNCA 1R6BX 4DB2A 4TMVA 2J41A 421PA 2VP5A 5FH9A 4AYWA 2O8DA 3WBKA 1HE1C 2QNRA 2JAQA 2ORWA 8OHMA 5K8IA 3P26A 4P33A 4QJ5A 3UWOA 3BK7A 1FP6A 1GKYA 1U9IC 1MT0A 2E87A 3EC1A 4YXWD 1CEEA 2CLDX 4RCZA 3DZ8A 2ZJYA 3H4MA 4TTQA 2O8FA 3JVUA 3LY5A 3GLIA 3H0KA 2VSFA 4TL6A 1UBCA 2JLVA 1KSGA 2ZRFA 2QU8A 1E9BA 5AJZA 3ZVLA 4PHGA 3SC3A 1R0XA 4OL0A 4DLSA 3BGWA 3CH5A 4D4LA 5A4JA 1EFHA 2QMHA 2XB4A 1IJFA 4W5JA 1KI6B 2ZS7A 4GOXA 1IM2A 4OQXA 2VA8A 4Q1BA 4PAQA 1Z0FA 1CJVC 4GI7A 4XTCS 1C9KA 1JR3E 1XJQA 2Z43A 1Z2CA 2L0XA 5C4MA 1LW7A 3RANA 1V43A 1H8ED 5SZIA 1WF3A 2ZE5A 3J81k 1ZU4A 3THWA 4NPHA 2FNAA 5GVRA 2ORVA 4QL3A 3CRVA 1A1VA 1JALA 1R5BA 3W6PA 1E2JA 2JLQA 2V3CC 4LJ6A 4BPBA 4R71A 1GDDA 3HPQA 1ZNWA 4V0NA 4NU0A 2J0QA 1ZUIA 1SVWA 3PIRA 1XEFA 2OE2A 1G20E 3RWMB 4NH0A 4JLVA 4YXWA 1L8QA 2DR3A 1PVOA 1NVUQ 1R8SA 4XJXA 3IBYA 4HUQB 1XD2B 2IS6A 3OZXA 5JRJA 1KYIA 2GETA 3LBNA 1UEJA 2JA1A 2I1VB 2R6CA 4FMBB 2X2FA 2WWIA 2XEXA 2FFHA 2JJ2D 3PEUA 4PPNA 4C30A 1FOEB 1G3IA 2VBCA 1IN6A 1NVVQ 5EE5B 1OB2A 4UJ3A 3B85A 3A4NA 4QC2A 4ZCIA 4L4UA 3VR2A 4F4CA 4MRVA 2A5JA 3VX3A 1IN4A 1PJRA 4M1WA 4Q48A 1H8EA 3BB3A 4RD0A 5EE9A 1WA5A 2ZRCA 1Z83A 4M1KA 2LCFA 1NY6A 4Q1CA 1XZQA 4L16A 2BMDA 1A82A 2ZRBA 4CZ2A 2ZRNA 1DBSA 1M7GA 2GXQA 4BFYA 2OLKA 1IOZA 1F2TB 4RD6A 5E4FA 2ZXUA 3BERA 2XTNA 3RRNA 4Q1DA 3ND9A 2HXYA 3E1SA 3TVDA 3C5CA 4JT2A 3CPHA 4PXAA 3GLIE 3MG9A 3QENA 3VX4A 4M53A 1E2HA 5CIWA 2WIBA 2JLWA 4D4KA 1PLJA 1ZBDA 1EFCA 4XIGS 1VECA 5CYPA 4D81A 4EFNA 4ZI2A 4Z8YA 3VNVA 2G9NA 4WZ6A 1D9XA 3FMPB 1JQLB 2IYWA 3WHLA 3DEFA 1WP9A 2R44A 3EAQA 4HB4A 3U2QA 1AA9A 3SNHA 2D2FA 3IIMA 1NG1A 1W5TA 3REGA 2JJ2A 1UKZA 4BEBA 3QOFA 1Z07A 3RS7A 3T5GA 3U6BA 3QQ5A 4TT3D 4LV8B 4CEIA 2RHMA 2EFEB 3ADKA 3EZ2A 2ZRMA 4J0QA 3PEWA 1DG1G 4HLUC 3WRXC 3GLFE 5BN4A 2ZRPA 2J5XA 2DWOA 2VHJA 2YC2C 4UNRA 4M9ZA 2QQ0A 1Z2AA 3B82A 3UMFA 3DPUA 4TLAA 1Z63A 4O25A 2D7DA 1XTRA 3D7MA 4IDNA 4A1FA 4LJAA 1NIPA 2DYKA 1F2UB 2PLRA 3EA5A 4AY2A 1JAIA 4KAXA 2BMJA 1ANKA 2NOAA 2ZSDA 2CHGA 4HZIA 5FOSA 2ZRGA 3ZD7A 1E0AA 3TSZA 1GRQA 4DCSA 4TLCA 3I61A 1XJ0A 3Q7QA 1T91A 4NYJQ 4AURA 4MGZR 5EXTA 1OH6A 1Z0AA 4LZZA 4C0HA 1N6IA 1VCNA 5JLJA 3VR1A 4JSYA 4NCHA 4I4LA 1AK2A 4Q21A 1GAJA 3GLHA 2W0MA 3AUYA 4HAZA 4LHZA 4M9QA 4Q7LA 4XSGA 1PLKA 1G5RA 1MR3F 3VMFA 4A2WA 2RMKA 4I1SA 4DLWA 3PVSA 3ONWA 3T1TA 2XXAB 1SXJC 3VKGA 2CDNA 4K81B 3O8RA 1G8YA 4EPWA 2AK2A 2RGDA 3CB4A 1OXXK 4OQLA 2QBYB 3QKSB 5AUPB 4GBMA 5E95A 2FFBA 1KZGB 2R62A 4HDCA 2C9YA 4RFSB 3QF4A 4RD1A 1QF9A 2ZUCA 1KDOA 4TT3A 4CT4B 3MLEA 4XWAA 1Y3AA 2P67A 2DB3A 4JLAA 3I3SR 1AGPA 4UXJA 4M1YA 4XTRA 1R0YA 5JJKA 4A2QA 4WZBE 4JT4A 2ZEJA 2R6AA 2NO0A 1RKBA 3X1XA 1US8B 4FMCF 1XTKA 2AKAB 3A6PC 1R0WA 2RGAA 5G53C 4KCGA 4CIDA 2IS4A 4PAMA 1G41A 3W34A 2YJTD 2W6ID 1FUKA 3OEED 4CGZA 2GRJA 2CVHA 4Q18A 1OYYA 1XU4A 3R20A 1EFRD 1DG3A 3C8UA 5H1YA 3RNLA 1OE0A 3KXLA 2EWVA 4JBYA 3GJ0A 4DIEA 4ZKDA 2DFNA 1U99A 1T8TA 4LOAA 2WPDD 2C77A 1EG7A 1OH5A 5LD2B 2A5GA 1GG2A 5AR1A 1KO5A 5EE3A 1M2OB 2ZI9A 4LYJA 1XCGB 1TUEA 2QM7A 3KQNA 3L0PA 5K8LA 2OAP1 2JIZD 1VTKA 3K0AB 4V02A 1UADA 4RZ2A 2N42A 1EXMA 1Z28A 4GP6A 1AS0A 4KYUA 2DFLA 4S35A 5C2JB 3LNCA 2ZQ5A 4UKDA 3OIWA 1F48A 2JATA 3Q3JB 3S1AB 3UIEA 5BW8A 1HQYE 3WYGA 4JJZA 4Q66C 3SFZA 4F4IA 3B1XA 5DH9A 3SJBA 5KTYA 2PT7A 5F98A 2GA8A 2WAXA 3BRWD 1NLZA 5CDFE 4GZMA 1AS2A 4MUAA 1Z47A 2VHUA 3AVUA 4LC1A 4FCVA 1XMJA 2IYLD 2NIPA 5GJCA 4UQOA 1S9HA 5E7MA 3TIFA 3FHTA 1ZNXA 3BC1A 3UWKA 3BORA 2W6IA 4KLZA 1BYIA 3OEEA 3PQCA 2QI9C 1OV4A 4AD8A 2B6HA 4MGKR 2J0UA 3FB4A 3HYTA 1KJWA 4PC6A 1EFRA 2VTKA 3A36A 2PBRA 3TW8B 4GMDA 5IRCD 4DSNA 1W36D 3BB4A 1CS4C 5KDDA 3AVXA 3C16C 2FGKA 1E1QD 1AIPA 1FZQA 2WPDA 1Z08A 5TDHA 1YKSA 3EW9A 5DHFA 1E0SA 5F2EA 3BFVA 1MABB 1D2EA 3SI7A 1R7RA 3IQWA 5CITA 5JSZA 4G5GA 3IPYA 2JIZA 3DOFA 1GNPA 5J4HA 2ZSBA 2WSSD 5DI3B 3B5JA 3KB2A 3R8CA 4DLXA 5M04A 2ODNA 2G3YA 2PX3A 3T1VA 5FPKA 2P6NA 2GK7A
chains in the Genus database with same CATH superfamily
2R60A 3F78A 4AO8A 2ZRJA 5KS2A 1RDFA 2G5GX 2XUHA 4BIMA 1YVPA 3UK0A 1M5RA 4ZU6X 4EL0A 3EARA 4RVSA 1ESCA 4Q9KA 3SYNA 3BRWA 3FY4A 4RV5A 4W8OA 2G0TA 4AF6A 3GB9A 3RFVA 2ERXA 4Q3KA 4KU4A 1X1CA 2WM3A 3BTSA 5UKDA 2X42A 3KU4A 4M8IA 3L92A 2DGDA 2C5SA 1T0JB 3GNTA 2JBHA 1V5WA 2VNJA 3WB9A 1JDPA 2DQZA 2FDRA 4TWJA 3T35A 2H9YA 4C9BA 4P5DA 5KZMB 4HVTA 2GN1A 3UUEA 1GUAA 2IVZA 5EA2A 3K70C 3QEMB 4JODA 1Z6XA 3P4UA 4WH0A 3S2FA 1K3UB 4IZOA 1GAXA 4ZQEA 8LDHA 1L3IA 1L5LA 2YHSA 1Y1SA 1QFJA 2R96A 3EHEA 4QKQA 1I36A 3FDJA 4KI0A 4FTWA 1SIOA 2P1RA 3RUDA 1HTTA 1KS2A 3KEFA 5JISA 1W8IA 3OOWA 2B1JA 5HG0A 3Q3GE 1QE3A 3CNQS 2XYPA 5FX2A 3ACBA 2N9UA 2O5RA 3WYFA 4ABTA 4QU5A 4C88A 2C9DA 4CQMA 1E1CA 2XDQB 3C5EA 1PGQA 3VYSB 4PRKA 3DT9A 4X65B 2NV6A 3V4OA 5BV1A 2H54A 2GILA 2ROQA 3DFMA 3FDFA 4CTKA 4CUZA 3KQHA 3KYCB 4DV2B 2RGCA 3QUTA 4R7ZA 2WJVA 2GJKA 4OYRA 4HN9A 4TV9A 4YBZA 1C1HA 2A67A 5IBRA 4CODB 5I48A 4HDMA 4UUMA 4QODA 1ENPA 3EWAA 1ZU5A 2OBYA 4AJNA 5H3LA 3ORHA 3FH0A 1JWLA 1V39A 1C9JA 4M4SA 1OH8A 5JI3E 3B1ZA 1CUJA 3EXHC 4J0DA 3HR7A 3WNQA 1FNMA 3F7TA 4V0KA 2NO9A 2V74B 2C2GA 3TKLA 4DNFA 2C78A 3MAGA 1HORA 1GYQA 4JI3B 2GFQA 3VPDA 1XZDA 2O23A 3W3ZB 2DBVO 2J9YB 3D4LA 4KQHA 4BLOA 3GAAA 4TYYA 3AFOA 3VPBA 4A8JC 3OM8A 4WAUA 4LQCA 2YHUA 4AL4A 3B38A 2ZYWX 4G6ZA 4NMLA 3I6IA 1OF1A 2IOHA 4B6RA 4JI4B 4ENPA 4W5QA 2YBEA 4MP8A 2LDBA 2WDPA 3KSUA 1V6AA 3PZBA 4PHTA 3GGPA 1H9AA 3MS7A 4UM5A 5FPTA 3K0CA 3OM9A 4D6PA 1T6YA 4LQDA 4KV9A 4UUOA 3Q9LA 2VO1A 3GIDA 3PC4A 3W9BA 1E64A 3LDAA 1WXWA 5BSTA 3IL2A 2JFVA 2NVUA 4Y2VA 4DEYA 1VHWA 1WUIS 4BWVA 3V4RA 2NT4A 2WTUA 4FE3A 3OQHA 1T8PA 1C0LA 5CDUA 4OCZA 1XCBA 3STVA 3AETA 1BFKA 2WD7A 3C3AA 1E6CA 2R7AA 1L9KA 3GA5A 3F46A 3H8SA 5BMVB 3NTXA 3FCAA 1JAXA 1E3QA 2RGYA 2V4ZA 3HFSA 4MRSA 3TR6A 3BMCA 2RHCA 4HEA1 5JSHA 2OYRA 4WXRA 1FP4B 3A26A 3RT9A 2CCGA 1K1EA 2W00A 1AQYA 5JO0A 3CRW1 4MJLA 5P21A 3M6IA 4D8TA 3FTFA 1SY7A 4K1LA 1VE9A 4DCGA 5FDFA 2VT6A 5LXTB 2ZT8A 3RF6A 1H2EA 3H5TA 3R7BA 1A8IA 4XB2A 4YAJA 2FMHA 1E2FA 3FWNA 4WY8A 1F0YA 1GL3A 2BGRA 3DMTA 3THSA 2WJIA 3FCCA 1ECGA 4NESA 5FP0A 2OV3A 3WLMA 1SEVA 2WJYA 3KZXA 2G25A 3NUZA 3PYXA 3L8MA 3DC2A 4PZAA 3LZ6A 1C5KA 4R98A 1BN7A 3KXDA 4OLJA 5DO9A 3L7YA 4JL5A 4L51A 2IA5A 3EFEA 1E6WA 3W0LB 4BMYA 4NG4A 5CA0F 5FBQB 4G4GA 1GL9B 3LH5A 2VTBB 2DF8A 3A70A 2RH5A 2RI6A 4LHYA 3TZLA 1AK1A 1O96A 3DHWC 3C1AA 1RWWA 5B2FA 3LAWA 1PJ2A 2P11A 1FTQA 2CNLA 1ZOIA 4QOFA 2XTJA 3UGQA 4ENWA 4ZJPA 1T0UA 2C59A 3ONFA 1K2VN 5COAA 3BMNB 3WTCA 4L73A 1ABBA 1G8AA 5JJ5A 3FHLA 3U3OA 2AN4A 1AF7A 2Q5IA 2OBLA 1P62B 1CQJB 2V3VA 5F21A 4F8JA 3O9ZA 2CBZA 4IDBA 2OGTA 1A7KA 3DQPA 3JTEA 4PLWA 5TPWB 2FPKA 2W6QA 1AM4D 4C7XA 4BN0A 4D0NA 5B4VA 3A32A 3HJRA 1Z4LA 1K68A 4JGBA 4Q1FA 5DM70 5ELXA 3IPLA 1QGED 3MWEB 1ID8A 1MRNA 4FOOA 3PNSA 4B3XA 2E4UA 4CBVA 1CV2A 3HWX1 3WGIA 3IHLA 1VL5A 4QTZA 4HDKB 1Y4DE 5FEMA 3RG2A 1EE1A 4X1IA 2XQVA 3VTKA 5BRJA 3C0KA 3IPCA 1HLFA 4PSDA 3S2ZA 3WRVA 3EGOA 2I6QA 5H70A 3RS8A 1KJ8A 4JXZA 4GOMD 4FJ2A 4PLGA 1VKNA 3CE6A 3OZ7A 5HCNA 2W0SA 4PC2A 1YE8A 3WBBA 5SY4A 1CUBA 5IAOA 2CD9A 2HAEA 3ZZ0A 1JLKA 2Y76A 4L0QA 3VZCA 1QK3A 1UDBA 1ZRNA 4IKEA 1QKIA 1POXA 2XMSA 3W6ZA 4JYMA 3TLZA 3PRYA 3D81A 2FQ1A 2LE0A 3IDOA 3VU8A 5A5DA 2JJ1D 3IAXA 5BOVA 3P0RA 3TTYA 5LOVB 3CWQA 4QDTA 2O50A 4R1NA 2P4UA 2VBIA 2XYQA 4UULA 3JWPA 3ZDQA 3O3CA 1X1QA 2SBTA 3Q6MA 5FT9A 3QWFA 1BMFA 1CNFA 2NO4A 4IRXA 1PGNA 1QO0A 3D54D 1KI7A 3BGSA 4L75A 4YJ3F 3RKUA 2QG6A 2V8BA 4ANFA 3OHMA 4PS1A 1NDHA 1T13A 3CUKA 3K2BA 2OGZA 4AXXA 1C2YA 1WDWB 4OQEA 3H2IA 2Y1XA 1V9LA 4FN5A 4OVKA 5IYZF 1QUEA 2QUKA 3HJTA 1LK0A 1N7IA 1T3GA 1U2GA 3L4JA 1FXWA 4RIIA 4ZQFA 4YPFA 1KO1A 4P3YA 1T4BA 2I4RA 2WUGA 1KFCB 1OAOA 1JR3A 4GDFA 4OHZA 4F9FA 2FH5B 3HGTA 4EG3A 5CLHA 4D6YA 1HR0B 3ICCA 4HAWA 4URWR 4OI0A 4CGYA 4CDRA 3B70A 4MGYR 3L77A 1AMNA 2PD3A 3KCQA 3NAQA 3L6EA 1A9XA 3KSAC 1IVSA 3ITDA 4IXMA 3GK3A 3AESA 3EG5A 3TZEA 4QQKA 4C0SA 3TW4A 5CJPA 3ZHYA 2X58A 3L49A 3EZXA 3U3RA 2Q8QA 4FYPA 2AX4A 1XELA 3QMVA 2IEZA 1UMDB 2J7KA 4PCVA 1AZTA 4Z7NB 4UTNA 3VJMA 3HWSA 5ADWA 1XTPA 4DC1A 4CLRA 4IQGA 5KNCA 3AJRA 3ROKA 5BR7A 1ZXBA 1CR6A 3KDPA 1G20A 2W6CX 2PMDA 3Q8XB 2XADA 2BFAA 4WXEA 1HI9A 2JFXA 3GDWA 2N1BA 3BBLA 3PSAA 3URKA 5HFJA 1PBTA 3FVRA 4Q1EA 1MOPA 4PIMA 2IXFA 2Y2VA 3T15A 3OICA 7MHTA 5BSRA 2C98A 3EXFA 4JVMA 4X1YA 3TIIA 2Z58A 5GY7A 5EJ2A 1DCMA 5HJEA 4DB4A 3ID6C 4HNAA 4Y2PA 4C0BA 1GU0A 3FOFC 4H6WA 5HXAA 4Q4CA 3A06A 4E2XA 1FJHA 2V7QD 3HM9A 4TN1A 3NT2A 3OFVA 2A30A 1UPBA 2JAUA 2ZYTX 721PA 2C5GA 1QO7A 4DGQA 3LA6A 5B4UA 3AR8A 5E38A 3OZIA 4MRMA 2D8MA 1ZJ5A 3H5RA 5TEWA 3RU9A 4A27A 1SU6A 3DD1A 1E60A 4IVQA 5AK6A 1OFHA 5BOSA 1MBZA 2QJFA 3WLKX 3HZHA 1NVBA 4HZGA 4OIMA 1JFFB 4JYBA 5KPDA 4O1IA 3S8MA 4P08A 2VR1A 1I32A 2ZAYA 3H8WA 4U2KA 2AS0A 1Z6YA 3QVSA 2WMOB 1PFKA 1G1AA 1T1IA 1O9BA 3L6BA 5LDHA 2OFPA 3MLAA 5C8XA 3GQBA 3T1HB 3ZVRA 3IQDB 1C4KA 4GUAA 2PRKA 4OMFG 1XZKA 1P4AA 1YUNA 1Z5UA 1C3EA 3RVRA 3WHPA 3FNHA 3UHOA 5CA0B 3NWJA 2R11A 2QD3A 4QDXA 4QDKA 4Y2HA 5JJCA 3VXKA 4I5DA 3ZD9A 3Q5GA 4U2EA 3S2IA 1E61A 2BEJA 4DBLC 3S7ZA 1Z33A 3TCKA 4EKIA 3CGWA 4I4TA 1HX7A 5FAKA 3ZIAD 1LK7A 4WDRA 3A1WA 1QP0A 3GEBA 4PZCA 2VJYA 3U0VA 1W88B 2ZIWB 1EJ0A 2P9EA 1EXNA 4HEQA 1Q3TA 3C4VA 3DTYA 4ETIA 1K6MA 1CF9A 1J9ZA 1RYBA 4E1AA 3K4QA 3RTGA 1MQSA 4RQAA 4ARSA 4V0OA 4JV5B 1STOA 3CRRA 3W8DA 4YALA 4FT2A 3AR9A 5HSGA 2O07A 3DC7A 3FPJA 1SC3A 2I5PO 1ZD4A 2IYZA 2WTMA 1NXXA 1RFGE 2CFTA 2WHXA 2X8LA 2O8NA 2AI3A 3ZQKA 3ZY5A 1T2AA 2AJCA 2N0SA 3ND7A 4MVYA 5B36A 3GPLA 2DBYA 3MOSA 3A3YA 5JSQA 4EYQA 1ZOSA 4FNGA 3MW8A 5LQAA 2Z08A 2FX2A 4IH1A 1QB7A 2WWHA 3R0IA 4HAZA 2PSJA 4PRYA 1R12A 2GA9A 3EVZA 4LGVA 5F64A 4F1JA 1TK2A 5T41A 2OMEA 3R23A 5DM2A 2GT1A 1QR2A 4PYNA 1EVLA 1U5CA 1JSRA 3LKBA 5K0TA 1G38A 1H2AS 4IH4A 4TVKA 2O0HA 4Q9NA 1LZKA 1M6NA 3DLCA 3MLBA 3H11A 3WFIA 2QTBA 5HILA 1IY9A 3PXXA 3GUHA 1T2EA 1LBEA 3MHPA 4RPIA 4WERA 1WW2A 2HLDA 2ZJ6A 3R09A 4BBAA 1CTQA 1QHXA 1TD9A 2DQSA 3DOIA 4BS9A 4BGIA 1Z3IX 1E9RA 1YJAA 2P91A 1DWQA 3FSGA 4YJ3B 1TE2A 4RH1A 4MXDA 4F46A 1OLOA 3L0IB 4HNSA 1PUIA 3CEHA 2OL4A 1E3MA 2IBSA 4O1HA 5IYZB 4BB6A 4MI6A 1TJNA 3UGKA 2GLXA 1RWKA 1P2FA 1TECE 2AQKA 2PU7A 3TTXA 3UT5B 2GJ4A 4JOSA 3ACDA 2IGTA 3U4QB 3I4CA 2Q21A 1IY0A 2V7TA 4OHBA 3M6UA 5ESDA 3RUIA 1DCFA 1O1YA 4KO8A 1OFVA 3BMOA 3ETHA 2NU9B 4B80A 5BWBA 2GN2A 3F5FA 1Z68A 4YGXB 4CHGA 4MDFA 3I5YA 2EDCA 2QQEA 5FOTA 4Q3OA 4CQLA 2IJGX 4OH7A 4IPTA 1ULHA 3FPEA 4M55A 1JKXA 4GR4A 3KLPX 2QZZA 3U7RA 4RCYA 2HMYB 4X8OA 2R79A 8AT1A 2I87A 1H8HD 4EENA 1UINA 1EDDA 4F7WA 1W4BA 3IHTA 5JCJA 2VIIA 5ESWA 4EABA 5JCZA 2GEUA 5EMJA 4LRSB 2GSDA 3SDSA 4XDGA 4DG8A 1L9XA 1G63A 2OCLA 2Q6OA 3PHCA 4R54A 4CF4A 4AMYA 4YAIA 3VZDA 2HH9A 4CKWA 4EHKA 3KT8A 4ED9A 3P5BA 4BOYA 1B6TA 1JZQA 1QVWA 3UMBA 2Y1GA 1N34B 5FULA 1GO2A 1I6MA 4EKNB 4KR9A 3LXXA 3RC1A 4BZWA 4KV7A 1PIWA 3OPYB 1M7BA 3ZWBA 3ZW8A 4CDGA 5C5DA 3ONVA 1YZUA 3OCVA 2AEEA 1L7OA 5IDWA 2O2XA 2P4SA 4RAOA 5I4IA 4HN2A 1Z4MA 1CY7A 1F38A 3U17A 1UEIA 1C8KA 3LBFA 1GZ4A 1WHTB 2KM1A 4PBSA 5HQ3A 1G3MA 2ISSD 4H08A 2I1LA 5FJJA 2GD1O 4G8JA 4MV6A 1BS9A 2CW5A 3IP5A 2XCRB 2CNDA 3RRYA 4JEUA 5LCXA 3BWVA 4MUXA 4IJWA 1EFVB 3M2TA 4U0KA 3CH6A 3QVJA 2ZK7A 1VLMA 4E2FA 5IT0A 1I3CA 3ZG6A 1NFQA 2OD7A 3MRTA 4KAJA 4KK4A 4XCQA 5KWVA 3GRUA 2B35A 3U26A 1Q44A 2Q4DA 1VI6A 2OSVA 3WY9A 3R3JA 2MSNA 1CEXA 1NT2A 1PJCA 3KJNA 2AMVA 1O3YA 2QN1A 3EC7A 2W2KB 3LT2A 2WC1A 3BE8A 4Q47A 2BE7A 1RSZA 3UPUA 5KVQA 1EFKA 3F9RA 2E6UX 2E4VA 3ORYA 4G86A 1EVJA 2NO1A 4R2HA 4XAQA 1E98A 4P38A 2KLHA 2WJPA 2RH9B 1BAPA 1JJAA 2WLTA 3CLTD 2OXTA 5K4HA 1KQOA 1B8UA 4ML3A 3O4RA 2IPNA 4IGAA 5LB2A 4P0PB 3HDVA 4CV1A 1GPDG 1Y1RA 3AR4A 3A9TA 2ZUTA 2I2XB 4HYYA 2GJ8A 1YQ9A 2WF7A 4XRRA 2IP1A 1UXKA 1Z0KA 1HDOA 4BE4A 4CCYA 2VYVD 1G8PA 2CLIB 3L2OB 4TLDA 3A9WA 3Q6IA 2EF1A 3I28A 4Y9RA 4CKBA 5AVOA 5CAEA 1U28A 2B92A 1NZJA 2FG6C 1SULA 3LOQA 1JSCA 1VA4A 2YOFA 3BMQB 2ZP1A 4L9WA 5COQA 5ALFA 2R2AA 3UTDA 1HEUA 4BBJA 4GWLA 5LKAA 1DEAA 5HCIA 3KUKA 4UEWA 3ZY3A 1LTQA 2QMYA 3TSWA 4GX2A 4K9OA 1UXGA 1XQ1A 1ZM9A 4YJGB 3DMYA 2FW9A 3MMSA 3NLLA 1EDBA 3IKVA 2AUNA 4OUKX 3EDMA 5D5HA 5SZKB 2Y6UA 1L5SA 4P4SB 3PR1A 4S04A 1R8QA 3IUBA 2VDWB 3R9IA 5D87A 3M33A 3SIWA 2EKZA 2W8BB 1QDEA 1R0ZA 1O58A 1F2TA 2PEZA 1CZNA 2QQGA 3OE7D 4JEHA 5DBEX 5I5EA 5I51A 4DUYB 1R9GA 4GNKA 3UJ9A 3JSAA 3NKFA 3QUCA 4HGZA 4WFQA 3NONA 1KI8A 4B5LA 3OAAD 2H7YA 4FKZA 2J31A 2Q0QA 2JJMA 1DAKA 1ZGHA 1VBNA 3HMQA 3PC3A 3T94A 3U0BA 5TT0A 2EZ9A 2OYCA 3IUYA 2YY5A 2NU8B 1RZRD 3V1NA 4HB2A 1J5PA 2X3FA 3MWJA 5JTTA 1IUKA 4DEXA 1BE6A 1KZ1A 1DJMA 4GVLA 3TMAA 2NXJA 2VTDA 1ECBA 4ZZ2A 4NTZA 1Y3HA 1UM9A 4RK5A 3SQOA 4G37A 4H18A 3W7VA 4X3CA 1U0OC 2XVYA 3PV0A 4AJ4A 3IJEB 4G01B 2GHIA 4TMFA 4UUBA 1HG1A 1W1IA 5AJWA 4F86A 5IXYA 2WB2A 3H9GA 3QFTA 4QPNA 1BXKA 3I09A 4FGLA 3T38A 3T0IA 2I2FA 4FIDA 2HA0A 1JJ7A 1SXJB 3D6MA 1XV5A 3I0ZA 1Q22A 1DRJA 4FDTA 5LU9A 1N2CA 2EAUA 5SZJA 2Y3IA 4RZXA 4TVBA 1U9JA 4QU8A 4NCKA 4G0XA 3U80A 3ASVA 1IEQA 1DQPA 4X84A 1TZ2A 4QLOA 1F2UA 1FB5A 2BR4A 3F5QA 3F9IA 4BBZA 1RPNA 1W1UA 1C9NA 2RGWA 4DMLA 2V03A 1FU8A 2B37A 1OLUA 3A4IA 1XL0A 1CRWG 2YWXA 3EIWA 3K35A 2OORA 1CZRA 2XNJA 2XMCA 1DXQA 2G5PA 4WOPA 3M1AA 1I1HA 5L95A 2O57A 3P0JA 4IIJF 2QYTA 1QXSA 4TX1A 3RWOA 2GEBA 3UOGA 1X92A 2B5WA 4BX8A 4FCCA 5ESRA 5BVHA 1KVQA 1V6CA 5HE8A 3WLFA 4TMYA 4RBNA 2G1PA 4ZKEA 4KQCA 5I01A 4FGZA 1CY4A 5EJ7A 5AW8A 5ARBA 1XOIA 1I2AA 3L7BA 4Y2JA 4BFVA 1HDEA 4P31A 3H04A 1FFDA 3D6TB 3DPSA 2VJQA 1AU9A 1Y3CE 3C6KA 1IBCA 4HC4A 4Y9TA 1ZVQA 2FMFA 2IHYA 1E7SA 1XFAA 3MGKA 3G5AA 3CF4A 4BO1A 3KNZA 1R0SA 4U02A 2VQSA 4NS1A 5EZ5A 2QBYA 2LGJA 2B21A 3CNHA 1ZM7A 1WCXA 4MKHA 2REXB 3UAWA 4ABYA 1G8FA 1EGQA 1Q0PA 2AX3A 1X14A 5A4AA 2GF9A 2MMGA 1SOMA 3E22A 3NO4A 2QG9A 3KTDA 1E2KA 4HXEB 1A71A 4J90A 3NJ4A 4G0PA 1YB6A 3IBGA 1RPJA 5JS1A 3FZGA 4IF6A 1V25A 3ANNA 3TJZA 4WECA 3DTVA 4TWIA 1G8HA 2PPVA 4FGUA 3STWA 1QLHA 1JG3A 5KTMA 5BWMA 3QWHA 3UEOA 1MB2A 4CMAA 3OZRA 3O1JC 3DV2A 3HKEB 4ZYTA 2XZPA 3G9ZA 4M1MA 1DIGA 5LQNA 3OLVA 3OX2A 4FK8A 3ZGYA 2AZTA 5FUWA 4M0DA 2QR3A 3ECCA 3BCRA 4TGLA 4G2TA 3LKVA 1FUUA 1P7WA 4ENQA 4EAAA 1NE7A 5EYPA 1RRKA 5HS6A 3ETLA 3EZ7A 4XVQA 3SBXA 3TGWA 4ACAA 5MHTA 5FUXA 2LVBA 2YWDA 4FSDA 1DV2A 4DPLA 4JITA 4DCJA 1V45E 2HDOA 2XMZA 1YJ8A 1PBNA 4JP2A 3HZOA 5B30A 4ZMBA 2XZTA 3RUCA 3A3OA 2Q8PA 2C2ZA 4Q7EA 3N3BC 4QEZA 2HWWA 5SICE 3AIKA 1U81A 2GAIA 2WTXA 1DRKA 4NIMA 1IHPA 2IDKA 3IAHA 3P27A 3PNBA 3PHBE 3HB0A 1MXFA 5MN5A 2XYRA 2FFAA 5D85A 1G64A 1HDGO 2IF0A 4DSUA 4AS1A 1HQKA 1SG6A 3FWHA 5FUQA 4X7BA 5AJXA 4JI5B 3W8RA 3N7UA 3DL4A 4BECA 5LMZA 1V0JA 1CWUA 1Y8RA 3PTAA 5CVVA 1Y3BE 4DCPA 4D0GA 4FDLA 1G3UA 2EKDA 1D1SA 3HXMA 4DUGD 4ZQBA 5DNUA 5K7SA 1QGUA 1RCFA 2FV8A 2NVBA 2YY7A 3KVOA 3QYPA 3DYVA 2QYOA 2AHOA 3ZHZA 5IABA 1DAGA 4INOA 3A27A 1U0NA 5EP4A 3KOZA 2TMDA 4F5ZA 5LR6A 2AYXA 1HSZA 1K5GA 2IYOA 3QV2A 4MQUA 4LQ4A 4P81A 4YFVA 4OA5A 2G4CA 3PQ3A 4OQDA 3B9QA 3WGGA 6ADHA 1GUFA 1YFLA 1II0A 2B69A 3WQSB 1S5PA 4D4HA 1J8MF 4TLBA 1HNZB 3GHHA 5CD1A 3IUEA 5AVXA 1P77A 1NBMD 5KOHA 1J1IA 2C2OA 3OBBA 1DC3A 3VUFA 2AKYA 5ILQA 3PUYA 1G19A 1KR2A 2A5YB 1P19A 1Q1ZA 4JQSA 1WKBA 5EMNA 3FLAA 2HXGA 2EDAA 1THTA 2XUKA 3FN4A 3JQ8B 4PHHA 3WJAA 5CDTA 3NHWA 5IWAB 1JFLA 1NJ6A 3GEHA 2PPLA 3OZSA 4A6EA 3EXEB 4EGJA 4KREA 4KGDA 3W1WA 4J29A 3Q7PA 3JAWA 2TRSB 2CL7X 3IP7A 4Y2GA 2F2TA 2DEUA 1YUMA 5DWQA 3ZD8A 1UXJA 2O54A 1AKRA 2IHZA 4EZEA 5JAOA 3CURA 2HRBA 3RK0A 3DPIA 3MS4A 4HWRA 3FDZB 3RADC 4B6GA 2WKSA 2WV9A 2I3DA 4MQFB 1MABA 2F1IA 3W77A 2BR5A 2OCIA 3D7KA 1U7UA 5TVKA 5FWYB 4D8YA 2QTMA 4KQIA 4DJDC 1R6XA 3HVUA 4FLFA 4L8LA 4ND4A 1FQKA 1MNQA 4QULA 5H80A 4X85A 5IUJC 5B3AA 3UCFA 5ICCA 4FE7A 4DDMA 1NURA 3C5WP 1OROA 1M66A 2WWWA 3IIKA 4OJYA 4YQFA 4QXRA 4BKUA 3LHSA 3O4FA 3KKQA 3QVOA 4OUDB 4F06A 1UKAA 1X7YB 3E9RA 1GU7A 3ISVA 3VR6A 2UUAB 4TSRA 5G4KA 5K8CA 4GG1A 4W1RA 2C4UA 2OV8A 3SSOA 1Y9AA 2ODTX 2GN6A 2CWDA 4M0CA 2RB4A 3TH5A 2PIAA 5CM2Z 4LSMA 4Y67A 3UF0A 2A4MA 2VQ3A 3AQIA 3UNXA 1C3XA 3OLCX 1HGXA 2P1DA 2GBLC 4ZI7A 5D51S 4QGBA 3D7LA 3E1GA 5LBIA 3K72B 3LUKA 3KXPA 3I72A 3L79A 1XD9A 3OX1A 4CT0A 4ZDIA 5K6RA 3AVPA 2FB9A 3EGDA 4LOJA 3RR2A 1H22A 2GHQA 1W5AA 3V42A 3HU1A 5REQA 5E6SA 3F47A 3PCXA 3GOHA 3DO6A 3K2QA 5CB4F 3T61A 1W4CA 2BGNA 3RIGA 4HEA6 4BB5A 2P62A 2O7QA 4JHLA 4AB1A 4PW0A 4R9RA 3UYLA 5FV7A 1TF2A 1CUZA 1XK7A 2POCA 5CFZA 3KZOA 4IXNA 1DQRA 4J6FA 3TLMA 3ZDBA 2HJGA 4IV5A 1DZ3A 3DMGA 3NWPA 4ENUA 2B7LA 3OWOA 1WL8A 5C52B 1SRQA 2XUOA 1FX0A 3GDHA 3VR5A 4KQKA 1P72A 3LWNA 1POWA 3CQ9A 2EXXA 2WT4A 1RADA 2IOQA 2OBNA 2VF7A 1NATA 5F77A 3ZWYA 1A88A 4I1PA 3I6YA 3GJYA 4OFZA 3COJA 4JEIA 1IWOA 1Z8FA 4OHPA 3TQTA 5FTLA 1EVYA 4JVNA 3VSAA 1CZUA 3WMRA 3ESCA 2Q4OA 2MSEB 4FCWA 4EW1A 1G8SA 5HM8A 3I9KA 1ZQ1A 1M8GA 2Y0EA 4IUCS 1WY7A 3INNA 3AHEA 4QUBA 4RYLA 2AHRA 4IUBS 3H3FA 3K8YA 4X63A 4MV8A 4OL9A 4E5UA 5JROA 1UJ5A 4KXFB 1HMPA 2M2IA 2P65A 4H31A 4UHKA 4W7SA 2WIJA 4KN6A 3KAKA 3ODPA 1UPCA 4G9EA 2NP6A 3O74A 5AKIA 5C1OA 2NV0A 1T4GA 4HDSA 1GPH1 4XWTA 1U4OA 5GADl 1G66A 3CF6R 4HQ0A 5JDCA 4S2EA 2NYUA 1K3TA 1V5IA 2G1AA 4XGNA 2HX1A 3ZD6A 1GPAA 2YXEA 1EGAA 2ZJ2A 1OJLA 1XTZA 1Q1GA 4RLHA 4CF3A 2E21A 4RPLA 4WCVA 3AR7A 3RBVA 4C7VA 4MW0A 1X6VA 3V8NA 2ZYUX 2O8DB 1KMMA 1OIVA 1QAOA 1UOQA 2KBFA 1L8OA 3R5XA 1HE3A 5JECA 4JFAA 3IH5A 3ZY4A 1E6UA 4B44A 1O94D 4JLJA 2VH5R 4XX0B 3Q72A 1DL5A 1YIOA 1L5HA 1TMYA 2H08A 2CMGA 2B7BA 2HJVA 4BB0A 4LF6B 4KXWA 1T36A 1HMYA 3NIWA 2F8SA 3U3KA 3QWBA 5DI3A 2B82A 3CX6A 3CZCA 3GLIB 2F62A 1WD7A 1RPTA 3K09A 4N4AA 4TZKA 4GI3A 5CDGA 4KO2S 1JQ3A 4DREA 1RAHA 1EFDN 3N0TA 3SDZA 4OK3A 2ID4A 1QCYA 1HYBA 2XGSA 3O1LA 2IOFA 4D0LB 2YMQA 2YVQA 4KFSA 3LDFA 3GVIA 2DCUA 3S28A 1LC0A 5HTKA 4MPRA 3WSTA 4MR8A 4OB7A 3ROEA 2BGWA 4MGIR 3QJYA 4OFWA 3AKZA 1DZIA 3LXRA 4OHYA 4O8CA 5F1OA 1NFRA 1OWMA 3I04A 2YIMA 5IC4A 1IH8A 2ID8A 4LGMA 1DAHA 2X5OA 3CINA 1IB6A 2WILA 5I7UA 1H0HA 5CCXA 1QH1A 1HNNA 1FVFA 2DPHA 3V7NA 4AT1A 3QMWA 4BQNA 3DOHA 2ZJ5A 5JAQA 4OLFA 5KCZA 2IPOA 4PXYA 4WINA 4L5YA 2Y71A 3AW8A 1LV8A 2D7JA 2UYCA 3RTBA 2G1UA 1J23A 3LVQE 3S81A 4YI3A 1U90A 3HPRA 5DVZA 2JI8A 3MWKA 4B3BA 1I9GA 2H5EA 3FJYA 1TEHA 2AD1A 2H9IA 3CCBA 4LHWA 5AXAA 1U5BA 1EI9A 1ZW6A 4LX8A 3PRHA 3GJ5A 3K94A 4MUKA 2CC2A 1FTNA 4ER7A 3LGXA 5ICFA 1ZR4A 2FSHA 5E3JA 3H9QA 3THRA 3JATB 3K0SA 3IUJA 2CL0X 4HAVA 1VHLA 5JAPA 2H6EA 4D98A 2YN0A 1FLVA 1K5HA 3T1YB 4BEWA 1F06A 1ZH0A 4J3FA 4IJUA 5FWNA 2IZ6A 5DSZA 2FEOA 1IK6A 3HO1A 4UVDA 4XB1A 3GUYA 4F8EA 4LCJA 2VRCA 4WLNA 2XSZD 4B1FA 2HI0A 5FL7A 4ZO6A 3PEYA 3CZQA 3MWLA 1QDLB 3AB8A 2FUEA 1QVRA 1QBGA 4OU5A 1PUJA 5CB4B 4JXKA 3DZGA 4B46A 1RYHA 1CPYA 1J56A 5LP6A 1E92A 2GUGA 1FQJA 4Z4HA 1ABEA 1MLDA 2XUAA 1FQOA 3B3FA 3LFUA 1B73A 4I8IA 1PUXA 1QGDA 4KWCA 1E7YA 2ZQZA 1IHOA 1UH5A 4UQPA 3DNFA 5U9CA 5FUYA 1FJGB 3WA6A 3QSGA 4Z51A 2PV7A 1EH5A 3K5HA 2VKTA 5DN6D 1O0BA 1V9SA 2O7RA 3QE3A 2IXAA 2P9TA 4NENA 1KAHA 4B7UA 5KJEA 4LA4A 5TQ2B 2NYVA 1MH9A 1O6FA 3OY2A 5FFMA 2PMBA 2NQ2C 4D9NA 5JMPA 4BX2A 4DA0A 4BNDB 2UZIR 4KX3A 3BX1A 5TGZA 1EEHA 1SZPA 1XVIA 1LY1A 4PGMA 4DSTA 3K6SA 4CW7A 3GLGA 2Q5QA 1GTRA 1WLYA 1QH0A 4MMYB 4WNAA 3ITNA 1QTRA 2QIPA 3ZZMA 4D9BA 1EXDA 1DC5A 1T0BA 2VRWA 2WJZB 4WNCA 5DXFA 2JLAA 4K9LA 2P4QA 5AW5A 5TB5A 5KNBA 1AKEA 2HPVA 1G7RA 2C2KA 4M1QA 1TZCA 1NLYA 3KKLA 5TMBA 2Y92A 3SEQA 3QBTA 1QQAA 1A9QA 4LBVA 1GUDA 3H3XA 2Z8YA 4B0OA 1SVNA 4NAHA 3HZZA 1DT3A 1QF7A 3CTPA 3TZHA 5CDSA 5JXWA 5KYWB 3P4YA 1ZVKA 2WAMA 1DO2A 1XP5A 1UFVA 2A88A 3D6NB 1ZEJA 2P69A 3GR6A 4DKXA 2J85A 2AQ8A 2QRQA 1GLVA 4O5OA 2RC6A 1G2IA 5SZHB 3RVLA 5ALKA 3K1TA 5HA5A 5EZSA 4JUDX 3SAJA 2OO5A 3VAYA 4Y9DA 3G02A 2B3DA 2YWCA 1L1EA 4A0FA 2G07A 4MUNA 4DY6A 3AIIA 2NU7B 2C57A 2Z1NA 1O4WA 4CEIB 2XRYA 3PENA 1KQ3A 1CF2O 2C96A 3A6JA 3G5TA 2CSXA 3AZQA 3IQFA 3JRWA 4FWBA 1EP1B 3NASA 3C5HA 4UCXA 1XXHB 5EKXA 1GN8A 1SU8A 2L42A 3IQIX 5FI3A 3LOUA 5BN4B 3IO5A 1KDPA 3PPXA 2EW2A 2VDJA 3G0IA 4BP8A 5K2OA 2PMEA 1Z12A 1OXVA 4NFLA 1YZQA 3G17A 2EYQA 2UZ0A 4Q1AA 2A57A 4TYNA 5CK4A 5BW4A 4W9MC 1CKEA 4QUAA 3SYTA 3UICA 2FJPA 3T4PA 2WJAA 4X64B 3QOWA 1ZIDA 3NYRA 4FD3A 5F73A 1DS6A 3I5XA 1BGWA 4FX2A 3IVRA 4HL6A 5EE1A 1RR6A 3CLTC 4ZQIA 5LQRA 2VVTA 5ALIA 2HGZA 4LZOA 4L3OA 1M0SA 1PLLA 1KNXA 4QFDA 5JNWA 3DZIA 2CJFA 2F7SA 3N2NA 2JZCA 2H29A 4FYWA 4ZYYA 2FZVA 3O8CA 3WV4A 5K5EA 2JAWA 1DIOB 5KHLB 4KN5A 3AYXB 5CLGA 3P19A 4BNZA 4FWTA 1GFWA 5IM4A 4M0LA 1VSBA 2QT0A 4WA7A 4YN3A 4BLPA 1P2SA 2Q3BA 4NYIQ 3GLHB 4P93A 1Z6ZA 3TX6A 3HJHA 1JBEA 4Z4EA 4IEFB 1EX1A 2XH8A 3E8XA 4K9SA 3KOYA 4MCJA 5TMEA 1QGYA 2ZU0C 3B51X 4G36A 2C9OA 3O1IC 1SXIA 4S1TA 2Q2WA 3REQA 4C0LA 4DIUA 4EX6A 5DTJA 2XDYA 4HDNB 2CMFA 1XCMA 2Q7XA 3CR8A 3PDJA 1S4MA 3Q5EA 1GZVA 4GGMX 4OOFA 4LSGA 4IQ4A 3PXDA 4YYEA 4UEQA 5FPYA 4BVEA 4EUNA 5EZ6B 4R0VA 4L5BA 2CNBA 2PTHA 3D5QA 5D3MA 1XHEA 4BKRA 3S5UA 5A2QA 4TKUA 3EIFA 3GT0A 4GEKA 4KMMA 3WLJA 1EFTA 3TRJA 1Y48E 1VLZA 3VR4A 5CA1F 3ZWCA 2GWRA 1KOFA 4YB8A 1NXQA 3ZK9A 1PT8A 1K66A 1V6SA 1DE0A 3CZMA 4UNQA 4ZA2A 4CETA 3E7PA 4MVJI 4LYFA 4H3HB 5I7VA 3I0MA 3KQKA 3CGGA 1TLTA 4FSHA 4AN0A 2B3TA 4QOJA 4J0GA 3FMFA 1NXPA 1CQZA 3RAFC 3RVMA 5HW0A 3ZQ4A 3MCAA 1SVLA 5IEJA 1F4PA 1MV8A 3AP3A 2R65A 3G9TA 3GUUA 3WK5A 3DUFA 1I24A 1BIFA 2AKEA 2QJRA 4BVHA 1D2CA 5JZVA 1HF3A 2QMOA 2J9GA 4O6VA 1WOYA 2FCRA 1NI4B 2IW3A 2HIHA 4ACBA 5EHGA 2YCBA 2SKDA 4O2AA 4MUMA 3JPYA 4RKFA 3L82B 3PYLA 4XLLA 4Y18A 3M9WA 3JSXA 4UVEA 4DQUA 3G13A 4FFVA 4K7JA 4Q4DA 4Q19A 3VC1A 4P9NA 5L3SA 5TQVA 3SZGA 1LH0A 2W83A 3QLTA 3VZSA 2WVJA 4GI1A 1Q0SA 2GM9A 1SD5A 1KOGA 1DUSA 3Q0TA 3QI7A 2PO7A 4Q05A 1JS1X 1V8OA 4KOEC 3TMKA 2G80A 5HEKA 1WWKA 4AQYB 1WXQA 5EJAA 2GJ9A 4PYQA 4OV6B 1N8KA 3EXIA 4II2A 3RYCA 1LI7A 5DK4A 1H4VB 1GZHB 3O9MA 3W8FA 4OLBA 5AVJA 1IPFA 1E4EB 4O02B 3BQNB 5BV0A 5A6SB 2IWHA 3R9KA 3UA4A 4TLEA 1E59A 1ONPA 2VHZA 3C7KA 3JZFA 3NHFA 4KQ2A 2P9YA 4BTEA 5A3QA 2WJ4A 4IP0A 4R0MA 3KQMA 3OQNA 2CLLB 1AVTA 1XLVA 4YPVA 4YUWA 3M2PA 2PX2A 1P2UA 1YA8A 5J5AA 5DYGA 3MM4A 2SKCA 4IHKA 1PX2A 3D4OA 4R1LA 1I7DA 2O3JA 2ATVA 4AO7A 1NLFA 1ORIA 2JGEA 2YW9A 3GZ4A 1RQRA 3H86A 3JD2A