1OJ7A

Structural genomics, unknown function crystal structure of e. coli k-12 yqhd
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
390
structure length
390
Chain Sequence
KAGLNNFNLHTPTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLDALKGMDVLEFGGIEPNPAYETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAANYPENIDPWHILQTGGKEIKSAIPMGCVLTLPATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTKPVDAKIHDRFAEGILLTLIEDGPKALKEPENYDVRANVMWAATQALNGLIGAGVPQDWATHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDDERIDAAIAATRNFFEQLGVPTHLSDYGLDGSSIPALLKKLEEHGMTQLGENHDITLDVSRRIYEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of E.Coli Alcohol Dehydrogenase Yqhd: Evidence of a Covalently Modified Nadp Coenzyme
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords HYPOTHETICAL OXIDOREDUCTASE YQHD
total genus 153
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00465 Fe-ADH Iron-containing alcohol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1oj7A02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oj7A01
1JQ5A 1NVAA 4RFLA 1JPUA 1SG6A 5FB3A 1KQ3A 4QGSA 1VLJA 1RRMA 2GRUA 5BR4A 1NUAA 4RGQA 1XAIA 5HVNA 1O2DA 1XALA 3IV7A 1TA9A 1XAJA 1DQSA 1NVEA 1NVFA 2D2XA 1XAHA 3RF7A 4MCAA 4FR2A 3UHJA 2BI4A 3W5SA 3HL0A 3CLHA 3ZDRA 1OJ7A 1UJNA 2BL4A 1JQAA 3QBDA 3OKFA 4P53A 4RGVA 1NVBA 3ZOKA 1VHDA 5K8CA 3JZDA 1NVDA 1NR5A 3OWOA 1XAGA 5EKSA 3OX4A 3CE9A 3QBEA 1NRXA 3BFJA
chains in the Genus database with same CATH superfamily
2ZS9A 3UGTA 2VPQA 2CNOA 5B55A 4UNRA 4XDGA 1EPUA 5C4MA 1VSUA 2WZCA 4CF7A 2ZUFA 1I0LA 3WMFA 2XAUA 3DV0A 1E9BA 4JBIA 3X2FA 3GELA 3QPBA 5NLLA 1XQVA 4LKRA 3O8CA 4PLZA 1ZA2A 1U04A 3BDAA 4WK6A 4YO8A 3UMSA 3V6LA 4PCVA 1DNPA 1ZVQA 3T35A 3CNEA 3FOFC 1EK5A 3NTOA 2YTZA 5I7OA 4JBYA 4J3JA 1XZJA 3RC9A 1R8JA 3R6DA 3OAAA 1OBVA 2J87A 3RSLA 2EEPA 2ZM5A 3BHNA 3RTAA 4AF6A 1SMKA 2HO4A 5T7BA 1D04A 2FB9A 3LZCA 3J7TA 1U3GA 5JCJD 1CK4A 4RMIA 1GFWA 1UEIA 4XCQA 5DTJA 3QTBA 1V8ZA 4E12A 1DX6A 4WX2B 4FOLA 3N5CA 1PNVA 5CAEA 1CRLA 5JPCA 1JHDA 2OB1A 3DOIA 4EG4A 4D9FA 3VZDA 3RHTA 4MCAA 3JYLA 4H1HA 5KPJA 1UK7A 2FJ0A 3DEJA 3KB6A 4FR0A 4KGDA 4BNKA 1VKOA 3D5QA 1GDTA 3DD1A 4EWLA 2I4OA 5DLQC 1HURA 4HDOB 1W0KA 3RAEC 5EE9A 1Z36A 2J1LA 5F51A 4WK2B 4ZOAA 5DCYA 2QB5A 5IVKA 4J6EA 5DB4A 1D1TA 1RXVA 4HWKA 2G1JA 1B15A 2O20A 3NXKA 2JGEA 4KQ1A 3FPHA 4NEHB 4TLBA 5IT0A 3E9RA 4LHXA 2ZATA 3GLGB 2NUAB 4WTOA 1BROA 3CF4A 5KNCA 5TE9A 5A4DA 2R6HA 2ZRMA 3CV3A 3R3VA 5B53A 3ESDA 4C4TA 2CXQA 3FSRA 2PIDA 1Q0RA 4BHTA 4AAYA 5KSZA 4H60A 4ZPJA 4P0QB 3B1FA 5E9QA 2VNSA 5BOSB 2O2XA 2VQDA 4W5HA 3MRVA 1MBZA 2OHGA 1M2NA 2UAGA 2JLSA 3B1JA 1DXQA 1N6LA 4HB3A 3A6FA 1L4BA 4LDQA 1L7MA 1NSYA 3LYAA 1Q7GA 2F1OA 3REQA 2CUTA 2M6LA 3WZLA 1NU8A 3B13B 1QVRA 1WXEA 4DL9A 5BSVA 4D25A 2CVQA 4XRGA 5IANA 3MA0A 1H2XA 3G85A 1TMKA 3ZU6A 2F64A 4MR7B 3LT2A 5JWRA 4ALLA 1YR7A 3KE8A 5GJVC 1QIIA 2P11A 3ZR4B 1MG5A 5LFAA 1MHTA 4FHDA 5K3SA 1YO6A 5CA1A 1SB9A 4BU1A 1E2PA 4Q7MB 1VJ5A 3EUAA 4H27A 1HWYA 3IS3A 4EQ6B 1SXPA 4LKOA 4IG4A 4W1QA 3D0OA 4PLCA 4RZSA 3RYFB 1YULA 1ZESA 5H02A 3PQDA 4A2WA 2OD7A 5ITZA 1NJ6A 5ITVA 2A94A 5KB3A 3NH6A 5JTTA 4RJ2A 2RIRA 2J9YB 3NP9A 4GOND 4MV5A 1WQ1R 1L5MA 3DJFA 2FJPA 3F46A 4MUXA 1GA4A 1TNDA 4O63O 2WD7B 5THKA 1IMJA 3U80A 2JLWA 4QBKA 1T8TA 1B0UA 3AR7A 3HJGA 4AJ4A 4EKEA 5DM0A 4K1LA 3EZLA 3ZDEA 4JJ6A 5FO0A 3O4GA 4CLDA 1KJJA 3TW6A 4MZDA 2W8BB 4PONA 1BQ4A 2HCRA 2PH5A 3KJNA 4GGOA 2C1ZA 4ABYA 3PUWA 3R6TA 1PFKA 3BRCA 4OYLA 2EV9A 3OCXA 4EHFA 3HU5A 3IPCA 4EM6A 3W8EA 4DSOA 3L7IA 1VKNA 4F2PA 5FNZA 4OB7A 4DFDA 1ZVJA 3HMKA 4O59O 2ZVQX 4NY1A 4KSCA 2QENA 3MMSA 3Q8XB 2WHEA 4WL0A 4Z1MA 1NM5C 4UPEA 2C7QA 3C4QA 5C2JB 1XU9A 1WXGA 1WWKA 2V4ZA 1U3CA 3LPMA 4EF5A 1LSUA 2JATA 3O4FA 2ZIXA 1LZKA 3U1BA 4BMDA 3ZXSA 4MJXA 3WWCA 4LBZA 4Q7EA 1SVMA 2C42A 2N47A 1LPPA 3QZUA 3PPYA 4UAVA 4DLPA 1JFFA 4EYOA 2WJ3A 5I51A 2JLUA 3A31A 2PX5A 2PVSA 1KIAA 3PTAA 3FAZA 4JITA 1JPVA 2RB5A 3KLBA 4DLVA 4YUZA 1ISIA 2ACVA 3FCSB 4NOLA 3TMKA 5IT4A 2PT6A 3PX3A 1Q20A 4BBAA 2QL5A 3G3EA 1ODFA 3HTXA 3UOWA 4GAEA 5TGTA 1QOZA 1KXJA 3DZKA 8MHTA 1RNLA 4CUZA 1QDEA 4OQMA 5FP0A 2GETA 3EHDA 1VC2A 4MPRA 1AKTA 1DBWA 4P32A 5KNBH 3RJMA 1K68A 2YC4C 3BWYA 2FPIA 1BGXT 1JWAB 3I76A 5H81A 3HXLA 4EBFA 2IOFA 5B58T 2HL6A 2ZAGA 3IAM1 1E5LA 3QFHA 5KNCD 5KBYA 3R0JA 1P6QA 3LMKA 4HAUA 4WOJA 3CUVA 5DNUA 3JRWA 3OZVA 1PL0A 4UD2A 4K9DA 2PR2A 1UPUA 2PX8A 4LPKA 4EA6A 4Y2YA 1A5SB 1G7TA 3ZW8A 1X7XB 5PNTA 1EI9A 2RAFA 3RH0A 1OWNA 2P9EA 4BB9A 1S3GA 4ZCTA 4DLBA 4BJ6A 2P2SA 2ZYDA 3AFMA 5DGXA 4CKCA 1G7RA 1I13A 2QMUA 5DHPA 1OYOA 2O7QA 5H3LA 3BJMA 3NOVA 2Z09A 1G5PA 3O9MA 2Q3FA 2E4YA 3K35A 4B3MB 1EDEA 3CWQA 1LJ8A 5HKOA 2HT6A 2R4UA 2JLQA 4PZ9A 1MF7A 4G5YA 1QV9A 3EXFA 4UM7A 1LPAB 3W1VA 1CF4A 3LL4A 4LGVA 1IXKA 1XCLA 2ODBA 4JHXA 1LBIA 1WCWA 4N7JA 4TTIA 4YP9A 3TW8B 5CVUA 1R9GA 3NDIA 1N3YA 3AOEC 1N7GA 1F0KA 4G0YA 4Y6PA 4IKEA 3P71T 5IDQA 3WL3A 1RYMA 1KZHA 3N58A 5JAOA 3QFFA 3EN0A 4BBZA 1HNXB 2C77A 3NALA 1GEGA 2FFQA 2GN0A 3B3FA 2G80A 4F5YA 4C1BA 4OFXA 1I4OA 3PUYA 1XK7A 4YJ2F 1E4YA 1PK8A 4IIJB 1WZIA 3TLMA 4NU0A 1XQWA 3FRJA 2FSHA 3QJ5A 4V02A 1EKXA 3MEQA 2BEJA 3X1XA 3VKGA 4GX2A 2C0QA 4OB8A 4IS2A 2ORWA 2WIJA 4M7PA 4GYYA 3FCEA 3H2JA 2J6IA 4QBIA 3FTCA 3ISVA 4ZIRA 1K63A 3JU3A 3ORRA 3T0IA 2IHUA 4KOAA 3MG9A 1Y9JA 4HQOA 4PN3A 2F3UA 3GFVA 3KHSA 3V8BA 4PG7A 5EE3A 1A88A 2Q1YA 3D3KA 3G7NA 2W6OA 4PYLA 3FNQA 3VDQA 1KJYA 2HU7A 3PNPA 5J4KA 4UNPA 1FMFA 3ZK7A 2XYVA 1NVFA 4ZU1X 4QO7A 1C9NA 2FPRA 1I7PA 2WKQA 4BMPB 2MR6A 2WTMA 2X23A 4DV2B 1XSEA 4KGXA 1MGPA 1ZNQO 3HO1A 4QBGB 3SS7X 1HG1A 1WY5A 1YR3A 4IDQA 5HFNA 3WBJA 3IAEA 1F1JA 3FLBA 1ZINA 4L74A 5AJVB 4X66B 2P90A 1UBTS 2MIIA 3K9LA 4OHOA 5EOVA 2H1WA 1S2IA 5DM70 3WYFA 1Q7EA 1KI7A 5I9IA 5FI0B 5H82A 3TIGA 2J0UB 5LIRA 3Q9NA 3KZKA 4LECA 3VNUA 3NATA 1R6AA 3V1LA 4KDRA 5AHXA 1W35A 2PWZA 2TECE 3KKOA 1Z0AA 2IEYA 3K09C 4LJ9A 5AK4A 2BTQA 4ZAZA 1R88A 1X3LA 3S44A 3ZLUA 4DQDA 1CDEA 4RADA 1GPAA 4F8YA 4UMVA 4G1UC 4EK9A 4J7UA 1V8FA 4Z7OB 3UT5B 4EP1A 2OPBA 3NYWA 1UDXA 5DKFA 1AQJA 1QP7A 2GM9A 1Z08A 3MJVA 3WYEA 5ULLA 1E5VA 3IHTA 2I67A 4O33A 4YTEA 5KOJA 1LSJA 3TTWA 5L45A 1HORA 3N2IA 4OXNA 4RDHA 2O8DB 2WJAA 4NC9A 3AH8A 1NVUQ 4G9GA 5C5DA 3Q6NA 2WSBA 5EIWA 3UOGA 1FTQA 2R0QC 2IH2A 2FRXA 4YVFA 3F6RA 2VP3A 1FTSA 2J09A 3WK4A 3WQBA 5F9HA 3D3NA 4G37A 1HZJA 1ISMA 3CGWA 3II6X 2CEAA 3TL2A 3PNQA 3G5MA 4XSGA 5K99A 2HUPA 3WJ7A 5KYUB 3VNBA 1CY4A 1R4ZA 4TUYF 3UCXA 3C3XA 3OESA 4NICA 1QMPA 4NULA 1FDWA 2BKXA 2FE4A 3CR3C 4G26A 2PE5A 2P27A 5DGHA 3NXSA 2C8VA 2CLLB 1C1DB 1O03A 1U63A 4BV3A 1YQ9A 3ENNA 3H5RA 4B3SB 4MCHA 4P4TA 3ILYA 1MZPA 1C8BA 2PBLA 3VR2D 3PJEA 4V0MA 2EOAA 4TLEA 3EDQA 1KJ9A 4GWGA 1Y3FE 4F5DA 1GM5A 4V2UA 1Y3AA 5JDCC 2GNPA 1NQWA 3CLTD 4KQ6A 2NYVA 2WILA 3MS7A 5C1IA 4EHIA 2AHOA 3LL7A 3WQRA 5A0VA 1UQRA 2Z4SA 2DFPA 4QYIB 1SBQA 1HQCA 4KXVA 2BCJQ 1T1IA 2GKGA 2JA1A 2W2KB 1DMRA 1XEWX 3PB3A 4BX3A 1UZLA 2I4NA 3IR7A 2GNAA 1EDBA 8ATCA 2IE0A 1ES9A 1OT3A 2IY7A 4QU5A 5HCUA 4YCNA 3ZE6A 3M3PA 2HB6A 1E7QA 3KCNA 3GX1A 1F17A 4TXLA 3V48A 4YJGB 1EU1A 3L4KA 2Q7XA 4HSEA 3GAFA 3Q8KA 1OZFA 1C3XA 3T94A 3O82A 1Q1EA 1UKZA 3L0DA 4KIWA 1NNI1 4JYMA 1BE8A 3NKVA 1E20A 5A71A 2X0FA 1G21B 5CLQA 1F8UA 3BCHA 1TUBB 3KJIA 4XLTA 1RPAA 1MUUA 3O38A 3VGPA 2B7BA 2WUEA 3FPSA 1P5HA 3MC1A 2MTBA 4R0NA 1NJ1A 1A5TA 2PUBA 3ACDA 4LXIA 3RTEA 1PJZA 1FMJA 2GCGA 1XLWA 2YFYA 3CF2A 2YS7A 3RUDA 4DG9A 3A05A 2E1RA 4ND3A 3NOOA 2HHAA 4PIPA 1AGYA 2EZ8A 3SBEA 1NW6A 1PS9A 1NTRA 2OMKA 4FDMA 2WIDA 4UBJA 1FJHA 1XEXB 2XZPA 5HQ3B 1ZFNA 3I34X 2ECQA 1U8EA 1SAYA 4JBGA 2E2WA 1BFKA 3FOEC 2JZNA 5IK2A 5CDSA 1NG9A 3N75A 4FW9A 4WXHA 1MV8A 3A11A 2GCNA 1NN0A 2MWMA 1N5LA 3KOZA 2W42A 3QVXA 1SUEA 3WLMA 1M2OA 4YYEA 3QEAZ 1AD2A 1E2DA 2PT9A 1QQBA 4CQLB 4I1IA 5AVWA 5EWLB 2MSDB 2EBUA 1TZCA 4O3FA 4IIJA 3AESA 2BGWA 1TJ5A 1UBEA 1Z5UA 3W9UA 3M70A 4WFKA 3WI7A 1RTTA 2P2LA 1O6GA 4FUTA 4XDZA 3TMAA 2QN6A 2WKSA 2C7VA 3DFFA 3IEPA 1P4HA 1YMUA 4RULA 1THGA 3CLRC 3GLFE 1D09A 4HOYA 3G0IA 4LWZA 4OI2A 1O97D 1T24A 3FB1A 1VZ2A 1EMDA 3PEYA 1OF1A 2F3TA 3ZV6A 2QXTA 1AA9A 1JG1A 1UT8A 1NP7A 3AINA 1SHTX 3FOCA 4QTZA 1FA9A 2YOGA 3FWYA 4RA6A 2ZJ2A 2ONZA 2Z2KA 1R9NA 5HK8A 4OHMA 3K8QA 4AIRA 1ICEA 3D6NB 1XALA 2EX4A 5ALHA 4IEEA 3CLRD 5BSWA 3RYHA 4XCXA 4C01A 4PINA 1KWKA 1DAEA 3KP1A 1UDRA 2QMHA 5K09A 4IO0A 3AR4A 1G3UA 3R9WA 5AVRA 5GADl 4UOQA 2VTBA 1FQKA 4RVHA 3CC8A 2EGGA 3A7DA 1JA0A 3FMVA 5CJ2A 1UMCA 3U09A 4FOOA 5I48A 3UKOA 3KETA 3K2BA 4Y7CA 1IZ0A 1O96B 5DT2A 3K0CC 3TLXA 2IPLA 2R751 3LYUA 4Q3AA 4QOEA 3ZW7A 3FZEA 1FS4A 5AW2A 5K0ZA 4NK5A 2H7VA 3ZHXA 1M8FA 4C0LA 1EIWA 3WA7A 3F97A 3PGA1 3U44B 3KPJA 4HGYA 5F98A 5A3JA 3S2GA 3VBEA 1ESZA 4ZDKA 3AF0A 1FXUA 4ZHSA 4BYMA 2D1SA 4FN5A 4O8ZA 4OMDA 1ZCAA 1G9TA 1SQGA 3VU1A 1DAIA 3PUJA 1FVFA 3OZDA 1JFRA 2NWQA 3QLEA 1RHQA 3TRHA 4M9SA 5MN5A 3AHGA 3QBDA 4A36A 2ZCVA 4RX1A 4F9TA 4EUFA 3GBSA 3EY9A 3HABA 4UEJA 3WX0A 2IH5A 4X20B 3JQAB 2OHOA 2YN2A 4R16A 5IWAB 2NQ2C 2IF0A 1FF9A 1L7RA 4Q4CA 2XXAA 2OFOA 4N3AA 2REXB 1G60A 4HQLA 1EA5A 2XUIA 3MLBA 5EWLA 1EFHA 1AS3A 3TIXB 1RXIA 3DE0X 3RIMA 1XJCA 2RMKA 3DVSX 3RVLA 4L4ZA 1I9GA 3A9UA 5DNCA 3SE7A 1AKRA 2VP2A 3THWB 4DWJA 1PFVA 3PHGA 3QFSA 3ZWVA 4RTQA 4LQLA 1JDVA 2V6FA 4UXHA 1H4QA 1XDZA 1U9YA 4M1EA 5EMHA 3HCAA 5IAEA 2JJ2D 3HO8A 4K9MA 3ZWDA 1LY1A 3ACCA 5IM5A 2N1BA 3AL3A 3GMIA 2IFTA 3WSVA 2FPOA 2B4RO 1KEEA 2NMVA 3OCUA 2FPPA 2HRBA 3K6SA 3AI3A 2Y0CA 4IHJB 4NBRA 3KT6A 1ZI8A 2CL0X 4KXUA 1E1QA 2VRBA 1GG2A 1WB4A 3MWDA 5CA0A 3TL6A 3VJMA 5K8JB 2AYZA 1URPA 4H15A 4TTSA 4B17A 1RMQA 4LJYA 2PA0A 1FFEA 1KZ1A 4WKOA 3TYXA 4WBNF 2IYFA 1YQWA 1CZKA 3UO8B 3PCXA 2CYCA 3LPCA 4JUAA 4WZBA 4R9SA 1TM7E 1K75A 1P0MA 4GP6A 2VJOA 2IXFA 5I4BA 3LZDA 5AJZA 2C84A 5GM1A 1YJAA 4D74A 3HHEA 4P5PA 4E0BA 1QQ7A 4BX8A 2D7DA 1G6Q1 1SBHA 2RKBA 2IBTA 1N3LA 1GU0A 2XMRA 2DQYA 3OSUA 5AK0A 1RRGA 4MLDA 4KC0A 1OFTA 1ZK3A 1N9ZA 2V6BA 1VHLA 2P5TB 1QRAA 1C3LA 1ZOLA 3A3OA 2OKCA 3AXSA 3EVEA 3KQWA 4S0XA 3TGWA 4ZZIA 5GV8A 2AFIB 2JGRA 4N12A 2IEZA 3LGXA 1MEOA 1VYUA 1Z68A 2DM6A 1X1CA 4IW3B 1QONA 2QV7A 3AVQA 3AERB 1NY6A 4GMHA 3ZC3A 5HM6A 3QUBA 4W82A 1MTZA 2YX1A 3B9QA 2B7LA 4BL5A 1YS7A 2VKTA 1P75A 4IXMA 4BLUA 2AW5A 3UN1A 1I3NA 3DBHA 2Q5QA 4FJ1A 3TWOA 1MCZA 1PG5A 3UCEA 3VUEA 1YS4A 4W8OA 3ZIAA 2BLNA 4QKQA 2BFFB 3A2LA 2ZQZA 1YQUA 3FIJA 5HIJA 5L9AA 1VIYA 2V7BA 2PXCA 3CFYA 1AUOA 1JNXX 1X7WB 3FCOA 4PYKA 4X1YA 4YUVA 2PXAA 2X2FA 2YV5A 4IP0A 4YCMA 2BGUA 4OY3A 5EQTA 5KWJA 2X8JB 4TKUA 2XKJE 4QYMA 1QORA 4DNFA 3GEHA 3QSGA 3DOEA 3ZXXA 5IU6A 2WJPA 4RTSA 4J0HA 1RPZA 1MHPA 1GHTA 4RV9A 3DH0A 4Q4AB 4XXHA 5DDIP 1YVDA 1MEEA 1QUFA 3IMKA 5CD1A 1SKUA 2QV0A 1V4NA 3AZPA 3A6EA 2IDJA 2W83A 2XNSA 2ACEA 1I32A 1U1DA 2HPZA 3H1BA 4QXAA 2BSAA 4A10A 1DX9A 4D96A 4NARA 1QVZA 2Q4EA 3R4VA 2PLWA 4TL8A 3U60B 2XUHA 3UANA 5HJ7A 4N39A 3ZEAA 4JLJA 1W5EA 5ELLA 1MJFA 1T35A 2VHYA 5CX1A 3A6GA 5AUQA 1Q2XA 3WKAA 4CT4B 4HLQB 4DIBA 1ACJA 2YXPX 5J1TB 3EPRA 4YDHB 1YBFA 4Q12A 1QRRA 4HNQA 3ESZA 1VGQA 1RXSA 1IQPA 1FNCA 1S9DA 4JU8A 2M6RA 4ALJA 2I03A 4FB4A 2QXYA 2QDKA 2GDJA 3SHQA 4CF6A 2WK1A 1MJGM 5T6BA 1BS2A 1E7MA 2BUCA 3GR6A 4D79A 1WSAA 1U1IA 5D87A 4E5KA 2K2QB 1GKIA 2EDAA 4QQNA 4C1NA 1ZRMA 4G5FA 1MVNA 3TVYA 2VDNB 2BMWA 1NBMA 1L4MA 2HTEA 3CBQA 1QNLA 3R6LA 4WEQA 4MYUA 3RI3A 3RLIA 5SYMA 4KSBA 1DKLA 2X0KA 3LUBA 4AN1A 4X3CA 3KX2A 1YJXA 3MFQA 4MKGA 4YMWA 1UBMS 1I7NA 1I80A 1X80A 4KP7A 2RHOA 4X3PA 4PO1A 3C6ZA 1RQPA 5HF6A 1XCPA 2GTPA 4C6RA 4JUBA 1N2CA 2Z56A 1ESMA 1VHQA 1VECA 1NRXA 3F5FA 1BH6A 1Q1BA 4IVPA 2H2WA 4KPUA 1G2OA 4Q4HB 3I45A 3RWMB 1DC4A 3DEKA 5FI1B 1NDQA 4RIGA 3REGA 2ORYA 1NNUA 1II8B 3RTGA 3TZBA 1EWTA 1Y3HA 2GJKA 3EPPA 1T0BA 5IKOA 3MT7A 1H2AS 1ND5A 4B5KA 4U9UA 3U5TA 2FV8A 1Q1ZA 2ECFA 1R4MB 1EUDA 4QICA 1GPUA 5JJBA 3OQHA 3ZBPA 5A04A 3X1ZA 4X7MA 3M2PA 3X2EA 4PC1A 4RY2A 2PMEA 4JJKA 4EG8A 4TKVA 1FLVA 2N9UA 2II6A 4FMDF 2ZI9A 5KVAA 4J2OA 4YRAA 1GRVA 2QM8A 2VEDA 3GP5A 5K01A 4FT4A 2CHGA 1G9XA 1NFRA 3GJ4A 4FYIA 5DULA 2ZRCA 4WKPA 1WKCA 4D1YA 5BT8A 2F7SA 1TO6A 2G9UA 2XX3A 5AI0A 3PR3A 5FV4A 3H75A 3LUFA 2WSLA 5AQEA 3R3XA 4TSFD 1V11B 5AVKA 1P60A 1IDN1 4HN4B 4Y9TA 2ZRQA 5FBQB 3Q7TA 4CFYA 4UE3S 1L7QA 3N87A 4AKIA 1W0KD 1A8SA 1NUUA 4NZZA 1SA0A 4R40A 1CUYA 1KFBB 2QRVA 2ZVJA 1AS0A 3C24A 5AKYA 5CAEB 4DYDA 2R8OA 2R7KA 4Z9FA 4AWBA 4YBRA 1DDGA 2CWDA 4GOOD 4ALIA 4DQ0A 2PX2A 1L5VA 4G3XA 2CVPA 2YZMA 3OE7A 3IP1A 2CT8A 5AH0A 3ZVMA 5AO9A 3IEMA 2RHLA 2FFBA 1MX9A 2HJRA 3MD0A 4LE0A 4X63A 1N8TA 1QZUA 3KEOA 1QQAA 2WM8A 4PGMA 4F8JA 2VHCA 1PN3A 2C2GA 4QT0A 3ZLJA 1G5FA 3KT3A 5LXTF 2J3DA 3L4BC 3LX8A 2I8CA 2EC5A 2R6GA 3P9KA 4S1TA 1TU4A 3KQNA 4EG0A 3N28A 1G4UR 2V6MA 3GROA 5ENZA 5TV2A 3FHOA 2O2HA 3JWPA 3RVBA 2A9PA 2NPIA 3EBOA 3C4VA 3FX2A 3KDAA 3LT0A 3GZTB 3HY4A 2WE8A 1C14A 3LXUX 2Q21A 1WSDA 1H3NA 1XL0A 4F6LA 3FWNA 5JO0A 1RKVA 4K46A 3STVA 1ULSA 4R8MA 1MRZA 3EDOA 4EJ0A 1REQB 1TEHA 3HDQA 4PTLA 1CNMA 4QT4A 1TZKA 1CVIA 1GGVA 1FW8A 2JHFA 1I30A 4TYNA 3VR4H 5C32A 3Q8MA 1SU7A 4GX0A 4KO2S 5AW9A 1QYDA 4ZODA 1E79A 4D56A 3I9LA 3IUJA 1F2TA 1YFZA 2ATIA 3FH0A 3MGKA 4J1TC 4RLQA 4UTXA 5I7VA 3L8GA 2JHPA 1N6HA 2I2XB 1CVRA 3B89A 1BA3A 3TSZA 3UZUA 1ECJA 1PR0A 2ZIVB 4AS1A 1RHMA 2FQQA 1GUBA 2JARA 5T4BA 4K86A 3ZKWA 2E37A 1M8PA 1XQ6A 2R97A 3MWLA 3OZGA 3GYGA 1MA0A 4KE6A 5CURA 1N7IA 1TJ4A 3FMIA 1YAJA 4UHBA 3OEWA 1W96A 3PEVA 4YP5A 3H2SA 3LZ6A 4MW9A 1YA8A 3ZV3A 1NLUA 1UXHA 4DAEA 1I2CA 3V2IA 1H2RS 1MKYA 3FSJX 5DH9A 4G9EA 4ZVMA 1X94A 5FOUA 5JQGF 1OWLA 1H2ZA 4MS1A 4TKZA 3I1FA 4HK4A 1BMFD 1F8XA 1LI7A 2I4TA 2AF3C 5AI8A 5DWDA 3WDSA 3FM9A 1P1FA 1X9GA 4BB6A 5HRAA 4P58A 1M5UA 1VRWA 1EX7A 2GD2A 3KQTA 3GARA 2IWHA 4RTMA 4M9CA 2QVGA 2J5KA 4MPDA 5HMLA 1P74A 1WE2A 4ILEA 1P8JA 4DIMA 3GF4A 4HS9A 5K3CA 1KY2A 1ODKA 2HU8A 1ZJJA 4ZEXA 4EYQA 3WP1B 1QH1A 2VNIA 4I5EA 4HLNA 3RT7A 3PG5A 4J1NA 4PE5B 4C7BA 4JAVC 1J25A 1JPJA 1ZVMA 1NMXA 3UAVA 3UAYA 3VAAA 1RQXA 2KQUA 1NI5A 2XB6A 5IKMA 3I3SR 2HFKA 2O4CA 2R8PA 3M1LA 3R0QA 1YXMA 4F56A 3HXMA 3S2SA 4Y0AA 1HL3A 1UM8A 2C92A 4HY3A 3PRYA 4Q0MA 4N5DA 3K0BA 4UBIA 3H4MA 4B79A 3CVYA 3V1YA 2NP7A 1QLHA 2CXRA 3A4MA 1QH8A 4KMRA 3KB2A 4UTRA 5KTOA 4PG5A 4YMGA 4P81A 3FBTA 3A32A 4A4DA 3UHJA 1Y9ZA 1L6RA 4IGFA 4QECA 4EYGA 4B6QA 1WCIA 2JAHA 1T3LA 4OP2A 1C4WA 2O52A 3VZQA 1U2DA 2A3NA 2ZUDA 4AP5A 2EW8A 1V4BA 4J75A 3A3YA 1SGWA 3GN2A 3K1YA 4W7SA 3ROZA 3CLSC 4BNZA 2WFMA 1JIQA 4KMOA 2VZLA 5JD4A 1XA3A 3GFRA 4PLGA 4TQGA 3VDNB 4EUHA 2NO7A 4B0PA 2NUTA 4QPJC 5TPWB 3U7GA 1ZG3A 2NACA 3PXAA 4BKPA 2IDZA 4F2WA 2I54A 2WT8A 1MB3A 5FFNA 3U3ZA 2GN9A 3S8YA 1EFKA 3ZV7A 2QD3A 1Z5OA 3Q98A 4LYAA 5C1DA 1EAYA 5CGQB 3SQXA 4CL8A 4YJFA 3G9TA 1M2FA 3ABQB 2WSSD 5DTIA 2JAPA 1XGKA 4QELA 4ZEWA 2E3JA 3KHTA 3UWPA 4JA0A 3KVRA 1AXEA 2AI2A 4P9NA 4F06A 4N8SA 4AO7A 3UPTA 1TU0A 1NPDA 5JBIA 1MD9A 4TKLA 1MNQA 5KCMA 3ISTA 4K6OA 3NTXA 3D31A 1CVLA 4RZ3A 5C8XA 3TOCA 2HXSA 2WHYA 3WTCA 2HWUA 5D86A 3HVKA 4RTNA 3NO4A 2QLFA 4K03A 3QG5A 2BC9A 2BKLA 1ZQ1A 3IAS1 1ELOA 3L8FA 2CYAA 3W5BA 2VK1A 4YCDA 1KOGA 3WL7A 4J90A 2KE5A 3PFWO 3EPHA 1J49A 3I8SA 4L9SA 4ENUA 1NP3A 1RRPA 3HXPA 1SPBS 2IPAB 2EJCA 1KOJA 3AB8A 3NJ4A 3S2FA 1B3BA 2WTEA 3ORHA 4X5OA 3ZLVA 1LLFA 3OJLA 1CU1A 2ZDGA 4Y1GA 3ZHBA 4NZOA 1YOBA 2C59A 4Y98A 4F86A 1U0GA 2VEOA 4IJVA 3ZWPA 4A91A 3LC1O 2BSQA 1T6BY 4BY9E 3KFLA 1ZAYA 1A8UA 2DX7A 4ZKEA 3SYTA 4HXEB 1E2EA 3I52A 4IRUB 4RK4A 2E87A 2GB4A 3UWSA 4C7OB 4NHEA 4HNGA 1Y4UA 2FOIA 2FMHA 1J24A 2NXNA 2JFGA 3FCAA 2D1RA 1JYEA 4DBLC 3OA0A 4NV3A 1OTYA 5EZYA 2FSUA 4UHEA 2YNMA 2JAUA 5K51A 3DOOA 4ARAA 1TPZA 1NUTA 2OV4A 1UBKS 3WWDA 1KZ4A 2C5GA 2VN8A 3CNHA 3ZZ0A 3I2HA 4PPYA 1SC3A 1WQ4A 2ZRPA 4LXHA 2V7EA 1AKMA 3OY2A 4RIFA 3RK1A 2H52A 4FFWA 4O4HF 3ESYA 1HDOA 1ZCFA 3PHLA 3JALA 1GG8A 3PUZA 3CX6A 3DCJA 3IAHA 4HXFB 3VPSA 2V0NA 4LXGA 5KQMA 1UT6A 5DX1A 2Q3MA 1NW9B 1S3FA 1UMBA 2QJRA 3EUFA 2XUZA 4R8KA 2VDPB 4Z4GA 4Z4CA 3G1WA 3ZWCA 3H7AA 4D8YA 3SOZA 1SUFA 3JVIA 4FJ0A 2CD9A 3ZK9A 1PR6A 5I4CA 5AKZA 5JSFA 1BVUA 2H9AA 3B1YA 2WDPA 1E69A 3RS5A 1Z5PA 4ZO4A 4IINA 2FQXA 3WLSA 2IPXA 2AXQA 2C2YA 5AKLA 4PYJA 3FUCA 1PS8A 4KQJA 4Y18A 4YJKA 1MB2A 2ODPA 5I01A 1C7IA 2ZPAA 3NHUA 3UUFA 2OL4A 2R2GA 3M6WA 1R16A 4HR7A 3GRZA 4OQNA 3QVSA 3LRTA 3SXPA 3AM5A 1D2CA 5DSTA 2R6ZA 5G3ZA 5KYXA 3L18A 4ZT2A 2FUKA 2F48A 2OQRA 2AC4A 2PH3A 3HDGA 4MIOA 1UJ5A 3QXJA 2NGRA 1OYVA 1MX3A 4NZ9A 1IOZA 1V3QE 5DWQA 1QIMA 2ZJZA 3DWIA 1Z6XA 1EJ6A 1T6YA 2F8MA 3VR4A 3WAKA 1WNTA 2B0CA 3T3DA 3JQ6A 1MEJA 4P4LA 4YONB 1G20A 1VL6A 2M98A 2O3RA 2PZKA 3OM8A 3OPYA 4Q19A 4Q47A 2A0XA 1M66A 5M3BA 2DBVO 5K0TA 3SXUA 2FZVA 2I76A 5BQ3A 1OXVA 1QE3A 2H2IA 1J39A 1OI4A 2PSEA 2XMCA 1I0IA 2FEAA 4LQDA 4RY9A 5DE3A 2JG3A 4YQYA 3L6RA 5E9WA 3LFHA 4BLTA 1T3TA 2WAAA 2FQWA 2RGRA 5T8KC 3JQ9A 1T6ZA 1DKUA 3I32A 4QPNA 1VMDA 3M3HA 4CIBA 1ISFA 2WF8A 1DWPA 3F3MA 3T4XA 2OFFA 1NX6A 3PXEA 1MVLA 4RF4A 3ZVRA 2J8ZA 2GLTA 3VGJA 3KXKA 1Z74A 2ENUA 2P68A 4HGNA 2QDXA 3IP7A 1EFUA 2KM1A 2IZ1A 1XP5A 2DJ5A 3BHIA 4L22A 2Q45A 5IARA 3R7WA 4LJRA 1TMGE 3N7UA 1M83A 1CJBA 2HXGA 4WNIA 1R9JA 3A1UA 1CEQA 3M1YA 1D9ZA 1E1RA 2P9HA 2QW1A 2JFVA 2ZYTX 3E3LA 3L0SA 2G5TA 3AUYA 1Y81A 1OU4A 3B6MA 2OECA 3KXIA 4NPAA 5D7NA 2HSWA 5EEHA 3DVLA 1PZNA 2OZVA 3BRWD 5FUXA 5CFQA 4A2QA 4ALKA 4XX0A 4U7PB 1YKFA 1JAHA 4ZGGA 1HYQA 1VIAA 5CEFA 4UTOA 5JRDS 2D13A 3PNLA 1MO5A 1Z33A 3ZI0A 3I2YX 1P7WA 3Q5GA 3EVFA 5JE8A 1KAMA 4FOPA 1JQDA 3P1JA 1GO2A 4WUTA 2BH9A 2X58A 2CDAA 4LJ5A 1NA5A 2FCRA 2V59A 3PITA 1N1GA 1I0ZA 4KBYA 5AHWA 1K3TA 1UANA 1XTKA 5E7IA 4AP6A 4CU2A 3NHRA 1LDNA 2IS1A 4NOMA 2HV8A 2OHIA 4Z2AA 1W36C 2H4JA 4O3MA 2FWMX 1LTHR 3GDGA 1XA4A 3OFVA 4F4DA 1QB8A 4HYTA 5LD2C 5AHRA 1W73A 3B7PA 3X2SA 1N2EA 3COVA 2H00A 1I8TA 2VH1A 5CIWA 4M0LA 1M75A 3MS4A 3O31A 1J90A 2VHUA 5CLGA 3L9XA 1L9XA 1WDKA 3GC6A 4MRNA 3LQYA 3OLQA 4MI6A 1UINA 3EVZA 4GLOA 4QBHA 1RMTA 3V1UA 4Z3KA 4BE4A 3JWHA 3FYTA 1R9MA 2HA6A 4S12A 1R0ZA 2IRWA 2WIGA 5IAAA 1V11A 4GOLD 4YREA 1JEQA 6ABPA 3K0HA 1YONA 2ZE6A 2O5CA 3EXAA 4K9SA 3K96A 4CDGA 3R5KA 3E70C 2YJGA 4F3CA 3G9XA 4WCFB 1OAKA 1KYQA 1UEXC 4BQQA 1PWZA 4LRQA 3UV3A 1J23A 5JATA 5KYWB 4MIYA 2I6QA 1BNCA 2QMQA 3WGOA 4BRZA 2CVFA 1T29A 1DKOA 2FA9A 2BKAA 2NOAA 2Q3JA 2P1ZA 3F3YA 3N8KA 3UJPA 3S2UA 5IJZA 3IKJA 3C70A 1LRLA 2J4DA 5DI3B 3OBIA 3LKBA 2C5AA 2FWJA 4EGFA 2XIQA 3EIWA 4P2GA 3QU5A 2QUHA 4S24A 3CUYA 2X4LA 1KEUA 3AWDA 4XVHA 4C03A 4YALA 1BS9A 2V9CA 1FYXA 3OF2A 5REQB 5JAZA 1ULUA 1RP1A 2IC5A 5ALXA 3LUPA 1R74A 2Y93A 4HS4A 4TV8A 4EO7A 1VGRA 3HJAA 4JSRA 4WOPA 2CDBA 3C8HA 3IKTA 3C1UA 3ND8A 3BD8A 2UZ1A 3LFUA 4PYQA 2OCDA 1XF1A 1DZ3A 5E2BA 4F6RB 1V1RB 3TTSA 3HKEA 1C3OB 4JUFA 1K6JA 4RAOA 1LB1B 1EZ1A 3LF1A 5DLYA 1IEQA 3NHZA 2E85A 2KBFA 2AFHA 2QUZA 4QDTA 2OK7A 1LRKA 3HEAA 4G65A 4DZRA 2AJDA 4F21A 4URXR 3GRYA 3IDFA 3ETLA 1NVDA 1JE0A 1MO2A 2QQFA 3GIDA 1Q1GA 2OCAA 4LTMA 2RGDA 3D6AA 5JJ5A 3O1HB 3Q0EA 5FULA 2QGZA 2YW2A 4FFOA 4LQCA 4B3FX 2ONCA 4LF5B 2CNLA 1THZA 1H0KA 3ND5A 4W4TA 4OHKA 4NX2A 4D4HA 2GARA 3PHJA 4JI6B 5GIOE 5HUQA 4BO7A 3PSAA 2LCQA 2X0DA 2Q7DA 2I2AA 4GKVA 2NVUB 3WO1A 1NDHA 4RH0A 4LF7B 4K0KB 4Q4HA 1XDSA 3GJYA 4H1TA 3L0OA 1Z0ZA 2PAFA 2G8NA 2ZPUA 1JIJA 4AU1A 3ST7A 4Z9AA 2HQSA 1ZSVA 2FZ4A 2WAMA 3GJQA 1L9KA 3KR1A 3L84A 4HZUA 2F3QA 3T9DA 1MDFA 4UREA 1AHNA 4RETA 4BNJA 1C1YA 2ZIGA 4HB0A 1SU4A 3AV0B 1OZ0A 5ALOA 4AECA 1NF2A 2ONYA 1PDOA 2IYUA 1ZCJA 3IT0A 3QVWA 1P7ZA 2BMVA 2FW0A 4RM2A 2C5BA 3TOXA 5KYNA 2CVOA 1RZVA 3QWAA 4FT2A 2FSGA 2C3OA 3G2LA 5D7BA 4IR7A 3RBXA 3C3WA 1U90A 2AG8A 2IA5A 3MWYW 1W29A 2HREA 3QM1A 4WGFA 4AKEA 4QTXA 1JHRA 1NTOA 3B3AA 3HZZA 4PX5A 4Y6LA 5BQOA 4BP3A 1U0FA 3PC4A 4CQMA 4E30A 1USVA 5DOZA 2ZANA 4LVCA 4ZZ3A 2CBGA 1T36B 1EGAA 5IN5A 3GOQA 4KR7A 2D2FA 1W30A 2HJHA 4D4MA 5LZ8A 3CN7A 1DFHA 1RQ2A 3D6HA 1VM6A 3G2JA 3LYHA 1EE1A 3CWCA 4I5DA 5FYDA 1Z17A 1C4KA 2QNBA 4LMAA 2PKRA 1K08A 3R24A 3WFJA 3R8XA 1JE1A 2O8DA 2BISA 1R4NB 1QCYA 2Z08A 4NEGA 1WUIS 2CV0A 2ZCUA 2IZ6A 4UMFA 3LQRA 4L3OA 4BVBA 1RYNA 2ZIAA 3D8BA 1PTJA 1AU9A 3KT0A 2A2ZA 4HQ6A 4TSKA 1FP2A 2LWIA 4RO0A 3VNQA 4B85A 2WWYA 4CEJA 3BWEA 1ONPA 3GP3A 2O2GA 1K2VN 3CH7A 3G5LA 4HPXB 4R8VA 3C39A 3OJOA 3RE1A 3VKUA 1U2EA 2X77A 3DC7A 5IAOA 4QJ5A 5K3BA 2PZBA 4EY8A 2JAOA 1LVGA 3HVJA 4MA0A 2N75A 1RI5A 5K8IA 4CKZA 3WFIA 2PUCA 1U0OC 1GPBA 3C3KA 5CJJA 1N75A 3AM1A 2BTQB 2OENG 1U2ZA 3PQ5A 5D8DA 3O75A 2BF4A 5C46F 1JRLA 1E3JA 4G86A 4MWBA 3M4JA 4O4IF 3KB8A 1REQA 4N47A 3WO0A 1RS0A 4HVLA 1GKLA 1VIVA 3AJ8A 4FS8A 3KQOA 4XWGA 3QE0A 4RVFA 2BJVA 3QBVA 4KQ9A 1MXHA 3PTLA 5KNBD 3S70A 5D51S 4IHKA 1CZRA 2ZKLA 3E5HA 4PC3A 3A1WA 1HDRA 5K0GA 3FB4A 1IUOA 1MC8A 3N0TA 4UJ3A 5CGZA 2X5KO 3O6VA 4KREA 1Z0DA 4WHMA 2VOJA 4Y9UA 3BD7A 1NYLA 1NVVR 4N7BA 4Q9JA 3W77A 3U3DA 5DHAA 1K9VF 2BFBB 5TMBA 4YRDA 5JJCA 5E3IA 2IT1A 1T13A 2GF9A 2AHRA 1HT2E 4CLRA 5INTA 2H1RA 4NBTA 3D6TB 3RWOA 5JZMA 3D6JA 4JSTA 2OQ2A 4WXPA 4X93A 3ENWA 4ENPA 1QK3A 3IDOA 1M73E 4DMFA 3P2MA 4BVJA 4TZ6A 2PWYA 4MAFA 1P0PA 3STTA 1DO0A 2ZDQA 3QWBA 4LCJA 1XLTA 3PFGA 1NASA 4B6FA 1E5DA 3A6HA 1FTNA 1RJFA 2Z2ZA 3RKUA 3T95A 4PG4A 4I81A 1T4BA 3HKBB 4PYIA 2FG5A 2O48X 3IO3A 4DEYA 2XUJA 3IQIX 5HCIA 1N2ZA 1PP4A 5LQNA 2ECKA 4LDZA 3GVIA 2VXYA 3PD0A 3R3WA 1KAHA 2ADMA 2JK0A 3RU3A 1DFIA 2OSVA 3GNTA 2BCEA 2X9QA 4BOYA 2FR8C 3Q9UA 1V6SA 4HDCA 1V95A 1SO8A 1JJ7A 4JB2A 1U9IA 5EZYB 3MT8A 2RH9B 1A69A 3L6BA 1E6EA 1UBJS 3D5TA 3HXTA 4RPHA 2ZUTA 2PBRA 4EVRA 1OFIA 4RK7A 5IJWA 5SY4A 2WKRA 4DR7B 1PGJA 4E4YA 1XXHB 4O2RA 1DMSA 1KNQA 4KPEC 2V65A 1NKTA 4MKIA 2HY7A 3C87A 3MWJA 4QWWA 2FUG6 4UFNA 3GLQA 3KEMA 1BXKA 5CBPB 1YUMA 2YN0A 3MRSA 4JROA 3ORFA 2HOQA 3WBKA 4CXMA 1YFJA 1PQYA 2FRDA 1H8EA 1XZNA 3HFRA 2IHKA 4GPD1 2NZYA 3AVTA 1E3TA 1YT5A 1V8BA 4XB1A 3HVRA 3H19A 4W8HA 5CIYA 4XH9B 3HDTA 1I4EB 1JDBB 1EP1B 1V0JA 2SHKA 3DM9B 2Z5VA 4KX5A 1S8NA 1D4AA 4B6SA 2PUFA 4H1VA 4RQUA 1VTKA 3N7AA 2QY9A 4NG5A 1F8GA 1UXJA 3E9QA 3E23A 2CEKA 5FWYB 4X90A 4PZDA 2GGSA 3SX0A 1G5RA 4D0GA 3T5AA 1CG6A 2EERA 1NVTA 2HAEA 3EFEA 4FEYA 3SEAA 2ZSEA 4AKSA 2QRLA 3KLMX 4Z7NB 4DGQA 2XF2A 5JEDA 1CZNA 1T8PA 2JBWA 4JQYA 1KI4A 3H13A 3WQSB 1V7CA 3DG9A 1C9JA 5TQ2B 2FPSA 4WN9B 3PENA 3CU5A 1N0HA 3R4CA 2H48A 1G8SA 1KYZA 1J2JA 4PZUA 3D1LA 3QW4B 4TKVB 4X61A 1SHJA 3NGXA 3DVAB 3F6PA 3AR2A 2HO5A 1RRMA 3S1SA 4QARA 3H2HA 4HAOA 1D6NA 3NIFB 4UZFA 4D26A 1LLCA 3C3JA 4FIDA 1BFUA 3KCQA 4NZNA 5FRDA 2W6IA 2XR1A 2X3FA 3GCZA 2JCVA 1E0SA 1M6EX 2ZU0C 2XOXA 4WBNB 1M5RA 4OBXA 1VJGA 1QB7A 1X7DA 2Z3ZA 4NBNA 5DK4A 1EXDA 2QI9F 5CXUA 5MFZA 1LH0A 3GRRA 3O1LA 4OLJA 5KTKA 4IY1A 1SFRA 3IPAA 4QAQA 1MG0A 3WIEA 3V1KA 2F8SA 3GQBA 5FKJA 3T99A 2B4KA 3QMVA 4ZO9A 1ZN9A 5AXDA 1JR3E 4U7GA 5A5VA 4DLWA 2WM9B 5BWCA 1ESCA 3MM4A 1BOFA 1XKXA 2Z8XA 5BSFA 4U9IS 2HRZA 2XA1A 4BQEA 1CIJA 2QZ9A 2R1TB 4MVXA 5B2FA 1QH9A 3WR5A 5G3YA 3W1WA 3DXZA 4UDYX 5KU1A 2WWVD 3QMWA 3HYNA 1BVYF 2I1LA 4K9LA 1FP6A 2J0SA 4DTCA 2BGRA 1L5KA 1ZHOA 3I72A 2YKGA 4CR6A 5ADHA 2DLNA 2J6CA 3H9CA 3HMQA 3SLKA 1AQ6A 2CHVA 3MCZA 1OH5A 4B3TB 2DQ4A 1C30B 2D8MA 2I6UA 3NUQA 4UDOA 4DA8A 4NYJR 4ZVLA 2A57A 4LVUA 2XD9A 3JXEA 1NU6A 4ZI5A 2Z9BA 1B42A 1UXIA 3VNRA 3PRKE 1OBHA 1FLAA 4KLRA 4C4ZA 4I6JA 5JWOA 4OQ4A 3D3EA 2XLBA 2C9OA 1SXGA 3DE6X 4RKEA 4PXYA 1IXSB 3D4NA 3RG8A 3NTUA 1AXGA 1A9QA 3BHJA 3AHJA 3UMRA 4M2LA 5A4JA 5BYAA 2PS9A 1CJKC 5TIIA 2FSSA 1T0IA 2WYHA 3A6JA 5BOSA 3QKIA 4BEWA 2BFAA 5FTJA 1W52X 3OT5A 1PJRA 5AW3A 4LCBA 3RIEA 4KFUA 4LC1A 1JDNA 2OXFA 1RXEA 2QUKA 3WYAA 4BLSA 4RE6A 4CV3A 4Z4QA 3OT1B 2H9YA 3EMVA 4TSFA 3RRMA 3REQB 2EYUA 5JSZB 3T5GA 4IWXA 2JPDA 1WQ3A 1T1RA 4DT1B 2ZSBA 1BEUB 3BKWA 3D3QA 4MYTA 4US1R 3TEFA 1E9EA 1GZ6A 2I3GA 2Y76A 1C0KA 1NURA 2RG1A 2F1HA 3D8SA 1G8PA 3OEYA 1Y9EA 4FFMA 4KO8A 4DIFA 2BD0A 3AVVA 2QMEA 1O5OA 3TZLA 2MINB 1YJCA 1OZGA 1EK0A 2ZK7A 3H42B 3N5KA 4JOCA 4QQRA 3T9AA 4DRXA 5LLDA 5K0EA 3L8ZA 1BRTA 1KMHA 4U8HA 3WGVA 1Q3KA 5IFKA 2BI8A 3Q3HA 4TT3A 1RWVA 4JGBA 5IAGA 1ULTA 2QG6A 2XI4A 4UM5A 4ZJYA 3C3BA 3LWDA 2O8EB 2A58A 2E4VA 1JG7A 3JD2A 2BUBA 1TF7A 4X3OA 4YCSA 4L85A 4UFOA 2V4UA 2DBZA 3EFOB 3S8EA 1UJ2A 4N6OA 2A9VA 4CF5A 1NUSA 5FL7A 1DIRA 2EHDA 1W5AA 1VLQA 3CEJA 3EXIA 3QF4B 4MWGA 2DHQA 2XH8A 1DXOA 4IFBA 5CM9C 5BXYA 2AN5A 3GPDG 2VBCA 1WXXA 3TAHA 1VGVA 1I4WA 3DWGA 3EG9A 4GIBA 1GNPA 1M2JA 2ZW9A 3VKHA 3FDXA 2L82A 3U1VA 5BV1A 1LJUA 4Y2UA 3MWEB 2EFGA 3BD9A 2EQBA 3W3AD 1X70A 1N1EA 2QPTA 3D6UA 4IIBA 1Y6RA 1ARZA 1TCCA 1TOAA 3OOJA 3NEYA 4R9NA 4UNSA 4EZBA 3UB4A 4KDCA 4XW2A 4KLNA 1GDHA 3PBKA 1QG4A 2NU7A 2PO5A 1EFRD 4O02B 3WDLA 2IU3A 3JQPA 3CJQA 3KDSE 4P7BA 1C1HA 5BO5A 3GA5A 3TW4A 3BMXA 1TYEB 4OI0A 3LDAA 3C16C 4XB2A 4CQJA 1XKTA 2PMWB 4W7HA 2YWDA 3HHPA 4K87A 4C20A 2XY4A 2ZWIA 3EHEA 3HB7A 4Q1BA 3L01A 3R7AA 2IVFA 3BCSA 2X15A 2NAPA 2QUJA 4PX3A 5ESWA 2AZMA 5M2QA 2P5UA 1BHJA 1F0NA 1OFGA 2VP5A 2YUTA 3P26A 3QENA 4D8WA 4RFLA 2XW6A 1SURA 4I3FA 3WK6A 4BFVA 3GT7A 1PJAA 2AGVA 4L15A 1DWOA 1AX9A 1GL9B 3WWZA 2NN3C 3GN1A 2G8LA 4AMBA 1TC1A 1KZYC 1X92A 1TF2A 1YRAA 2D0DA 3IUYA 2V74B 3MQFA 5EJIA 5DTRA 1L3CA 3HCDA 2Z6UA 4E6EA 1K7XB 4H0CA 4YRPA 1Y1TA 1UPCA 2DT5A 3V8RA 2VYNA 3E9ZA 5JVDF 1RYZA 5EKDA 1XTUA 5AVOA 4F4CA 4LYEA 3JAWA 1DL5A 1T0JB 4IV5A 4CKYA 2Y92A 4P31A 3P9YA 3M6AA 4IYRA 4PX9A 4OHBA 1XPOA 4DCJA 4FNMA 4TWJA 2J3IA 5EKXA 1ZOOA 1MW8X 1X80B 4H31A 5ALFA 1QBGA 4H4CA 1IWOA 3SE0A 4BNDA 1X13A 4RVUA 5L6LB 1ZD5A 1YJBA 4W99A 5CDHA 2NTNA 2R47A 3IVAA 1ZD2P 4D02A 1EWRA 4F3RA 2O8BB 2YCBA 1JLLA 5A06A 1P4GA 1RJ9B 4KR6A 3O4JA 1VYHA 4MWEA 5AUNB 2VC2B 5JDIC 2OBMA 4LQ4A 1A1SA 3A4VA 3HCFA 2GQ0A 2HJSA 4X1KA 1GQYA 2QW8A 1T5SA 4AMGA 2Z83A 3IR6A 5ISMA 4B9EA 4BQFA 4MKXA 2XCQA 3BSFA 3LIPA 3TZQA 4C6SA 3FHTA 1RFLA 3NBUA 2VPXA 1YQXA 1GAQA 3Q0TA 4MW6A 5I5GA 2ZAOA 1PLJA 1ZUWA 3F98A 1LF5A 1V6AA 4AJ2A 2HR1A 2O23A 3A04A 3DZGA 3E9DA 3G79A 3K16A 4MXDA 1FYEA 1Y7IA 2YC2C 3AR6A 2HHLA 4FZJA 4UCFA 4RK5A 1U80A 5KAPA 5FHQA 1IATA 4CGYA 4NBUA 1QIFA 3L1IA 4J0DA 4M9XA 4AICA 2PGIA 1UJCA 3BXEA 4LNUA 2TMGA 4FMPA 4WA8A 1EP2B 4NG4A 2NQTA 1DBRA 4NPCA 3SI7A 3VTKA 4B7AA 3E9NA 3GJSA 3Q40A 1LBQA 4JC5A 3DUFB 1XPRA 2WVJA 2Y99A 5DT9A 1KOLA 2V8BA 1F0PA 3SYNA 4EPWA 4AKHA 4QUBA 1B14A 4LS3A 4AJ9A 4D4LA 1Z63A 4EJ2A 1WD7A 3P4XA 4CDNA 3VH2A 3RO7A 3T1YB 3HXQA 1TTTA 1EBBA 4URHA 5BNTA 1RWWA 1ADGA 2QX6A 3CNQS 4PV7A 5CDTA 3QGMA 5ICEA 1E3WA 3PWKA 1A4XA 2WF7A 2TMYA 2H7YA 1YQTA 4FGSA 4C4PA 2OO3A 2RK6A 5BMOA 5CCEA 2XMGA 5AK3A 1R6BX 3PQ7A 4G4IA 5DI9A 4ONEA 2AR7A 2WMNB 2XT6A 4M99A 3ZJTA 4M0DA 1A8HA 3D2AA 3EZFA 3W5IA 3E2PA 2QAJA 3RUPA 4ER3A 5CG2A 5BOVA 4BN4A 4CF4A 1M1YA 3HYRA 3OPQA 1IBRA 4JZKA 3BGIA 1ADFA 2A59A 2OGUA 4HMQA 4OHZA 5CEEA 1W5FA 1SCJA 2IPMA 4QPZA 3ROMA 1P1IA 2KYRA 3ZU2A 1XTVA 4C0JA 4HFNA 7ADHA 2J9GA 3QE9Y 4LISA 2VOEA 1D8TA 3BWVA 3KZXA 1JMYA 2EKDA 2H3EA 3B85A 3LA6A 5JLAA 3HSSA 4Z9BA 2OM6A 1MMFB 2JFXA 3EQ7A 4FFRA 4E4TA 2YYAA 2O8EA 1ZRNA 3Q7EA 1D8AA 1OLXA 3RVJA 4C2BA 1YR1A 2VSQA 1UPAA 2OCIA 2XGMA 1KO5A 1MENA 1SBYA 5CXSA 1E4EB 2C61A 2VWGA 2G0NA 2EFDB 1Z82A 1N2XA 4FKBA 4I8IA 2GKSA 3N9IA 4RTRA 4IILA 2WD8A 4DUYB 3RYCB 1A76A 3SF8B 1XVTA 3PFBA 3RVKA 4MCJA 4L8LA 4RMGA 4NBVA 3VM6A 4UU7A 4EY6A 4MRMB 4IUYA 1OIXA 2QSUA 1VI2A 2IYEA 4D9JA 1WUTA 3AP2A 4GOXA 3L8EA 4BJ1A 1FNNA 1GUYA 4B43A 4CM6A 3PLAE 3D6MA 1RW4A 4NCXA 4DV4B 5DGDA 3FNHA 4HQNA 4OUKX 5AJUA 3B6KA 3W3AH 4KQHA 2JL1A 2D4AA 3K15A 2HWWA 2JI7A 3CSUA 1HDIA 3QPVA 1AUQA 2ZTVA 1Z4PX 3CEHA 3VH1A 4M1MA 3TQCA 5BSKA 2A9RA 3KQUA 2G06A 3FNGA 3GH1A 1EJ0A 1D2EA 4YP6A 2VCYA 3O47A 3MGCA 4R69A 3V4VB 4RGBA 3D7RA 2G71A 2GN6A 1GZVA 2V45A 2BJWA 2C7PA 1WD5A 1XDGA 2HJWA 2ZYRA 4CPDA 2BEUB 2C5SA 2H1VA 1RZRD 1NXTA 2C4KA 5E4JA 3WB9A 1OH7A 1JJBA 4QFDA 4D9MA 2A4MA 1F9AA 5BQPA 3WISA 3DMDA 5ALGA 3H2YA 1VMAA 2GNOA 3RADC 4CMCA 3RC2A 3GCXA 1SCNE 4XM1A 2HHHB 3H5NA 1NLZA 4M0FA 1TCUA 1WO8A 1KMCA 2J7PD 3A3KA 4DG8A 2I65A 4F85A 3TNDA 1WU7A 2Q9CA 3KQVA 4J07A 5FTWA 4ZCQA 1XTPA 4UKDA 1K7YA 4A3SA 4C4XA 3ULKA 5EWMA 1BJRE 1DUIA 5DASA 1TA9A 3P9ZA 1F6BA 2QZJA 1DDIA 2O3UA 4I14A 4G1FA 4YJ3B 5DSXA 3VDMA 4YRIA 2DPXA 4JI8B 1VLMA 1X86B 3CMMA 3GRAA 3SBDA 2QGFA 2IYLD 1ZH8A 5LYJB 5BWNA 2UYHA 1W47A 3PT5A 2H0AA 4RPKA 3RODA 4I2NA 4BGEA 4TZ0A 1GQ2A 4XUDA 3FE2A 3URKA 4XWWA 2MINA 4NFLA 1CNEA 4BNLA 2GEUA 1U0NA 1JKXA 1ULHA 1Q12A 1Z22A 4J7XA 4KWTA 1RKBA 4NCNA 3SKVA 5IJXA 5AW4A 5L7YA 4MWZA 4XWYA 2FG6C 3CONA 3I04M 3M34A 2NU9B 4ENRA 4U7DA 2VAWA 1J21A 1Q7TA 5EMKA 3M5PA 1IWPB 3E82A 4DIDA 3DE4X 2VUUA 3FDFA 1RJEA 2H59A 4H2DA 4B7ZA 1JLLB 1MQ9A 4DEXA 3QXGA 3UJNA 3KQPA 2ZS8A 4TS1A 2PXHA 3MGGA 2GYUA 2GJ9A 2W0MA 3VYRB 3LT5A 1H2WA 3IEVA 4ZVNA 3O2JA 4MVJF 4BWVA 3OQJA 1XWIA 1DKRA 2XWJI 2AKYA 4NYMQ 1U0SY 3B1WA 4BMZA 3MIIA 2IS6A 2V3WA 4E5YA 4FNGA 4YJFB 4C5AA 3STHA 4CG1A 3Q8WA 4BLRA 1B41A 1Z56C 2F8LA 1IE3A 1T4GA 3G88A 3QTTA 1W8DA 1ZZGA 2CXOA 3RYIB 1WP4A 2NU7B 5DCWA 4MGHA 4B3CA 3GXOA 4WCFC 2QHXA 1Z18A 1QVAA 4DC9A 2J67A 3LG2A 4B6PA 4E7PA 1ECFA 1E60A 3E81A 4KN9S 1P39A 3ZGXA 4Y2QA 1QHNA 1U2PA 4WKGA 1PR3A 3F6YA 3UJ3X 3MIZA 1T5LA 2CWWA 2CJWA 2WAOA 1DZIA 4IYJA 1HXHA 3UB3A 3ZUGA 1EINA 1Z5WA 4EJSC 5F4BA 4LMPA 5EJ4A 2NXCA 4HQFA 4B34A 1FP7A 2JJQA 3WVNA 2JCGA 2UYQA 1R0WA 3CUUA 1P91A 3OX4A 4FNAA 2AMFA 1SN7A 1X7YA 2J3KA 5KINB 2GHRA 5KWIA 2FF5A 2QIOA 4MUGA 4ZO7A 5EG5A 1JBEA 5JPDA 2DUWA 2QYHA 2PLFA 4DDHA 2DVMA 1U7XA 3JTMA 4YCJA 5CCBA 3H18A 2QX7A 2ZJFA 2GF0A 2RGYA 1G6OA 1OFUA 2XEXA 1RPTA 4Q1DA 1FVXA 3ZQJA 2NW6A 1GRCA 1L1EA 1Z7WA 2FEPA 1MABA 3OOYA 1KFCB 4O2BF 4V03A 1K4YA 3RSQA 4C0XA 5B7PA 4QDUA 2VBGA 1JQEA 1Q0SA 1WCYA 3JQ9C 3SQLA 3IPYA 1ID8A 2JGIA 3TLEA 3BRSA 3NU1A 1FX0A 1NOKA 4XPIA 3AU8A 4NFYA 2FXVA 3PWTA 4QYXA 1E63A 4JVNA 3DE3X 3ROFA 1QHFA 4WZBE 3PXDA 1P9LA 3VR0A 2ZYUX 2LE0A 3H7IA 4LOIA 5LMZA 2CJFA 2J30A 3NVMB 4O4LB 1OX5A 2HA4A 1U7WA 2EQ5A 2JJ1A 1QHIA 4YMVA 1MC1A 2ZE5A 4ZK6A 1W4LA 1Q21A 3JV7A 5LZ4A 2AKAB 3OJEA 1N1DA 5AI5A 2JI9A 1XCGB 1XZQA 2C8JA 3E1KA 5AOAA 2IEDA 2GM3A 1H0RA 5E8RA 5JFOA 3TPFA 4BCBA 1T1EA 4EB6B 4ZU3A 2AXEA 3H5OA 4MR8B 1GJRA 3W2EA 2AD1A 4CF3A 1UR5A 1FZQA 3GW8A 2QT9A 2UZ3A 1D2AA 4F84A 2C5LA 5MHTA 1ST2A 1D5CA 2ISCA 3DPSA 3H86A 3HFGA 2ZB4A 2EEZA 4JLKA 3CCFA 3MAGA 3AIIA 3WJ1A 5JC8A 4KR3A 3LY7A 2BHLA 4PS1A 4XFJA 1WMBA 4GH5A 4FBMA 3DDOA 1V9CA 4QXQA 1KQ3A 1HDYA 3CRZA 1Z0IA 4BGDA 1GZSA 3VSEA 4EL0A 2UV8A 3OJXA 2FUG1 2ZG6A 3A3PA 1E2HA 2X0IA 1AA6A 4Z0HO 1M8GA 4EX7A 3BSSA 3DXXA 1Z6PA 5DFAA 3WRXC 3KPVA 4XPZA 4AWXA 3VJRA 3K09A 1O5TA 3PNSA 1X1RA 3VVBA 3CRQA 3OWXA 5KJCA 4DQVA 4I4LA 1Q74A 2A0WA 3B3GA 3PKZA 2P30A 3DYBA 4AZTA 4EYSA 2PX3A 3MCTA 2Z2JA 1LV8A 5J2UA 1PQUA 3PXXA 4YPFA 3VR3D 5F3WB 4Q3BA 3T5PA 3FNEA 4BZPA 3UIEA 4B4WA 1ZLXA 2DOKA 3QJGA 4IDFA 4OH1A 5L7TA 2W5UA 3M5DA 1YMQA 4FYPA 1K7FB 4ZI3A 4XUEA 3WGIA 4G0PA 1IEWA 2R62A 1OHHA 2RSLA 3N2LA 4JH0A 3HO6A 2UXDB 4Y6QA 4UCWA 2QJTA 5HWSA 1T5DX 3QXHA 1UC5B 1N9KA 3VNVA 3RF7A 4EATA 2Y1WA 2CL7X 3AUSA 2XE8A 1YE5A 3PNVA 3HCRA 4NL4H 3GD7A 1G18A 5DNWA 1PL6A 1IZZA 1QJCA 3HCOA 1SVWA 2IEBA 4IJ5A 4NYIR 1T5HX 2IQ5A 4TKMA 3ZYCA 1G59A 2BFCA 1G8JA 1N4AA 1GFIA 1NW5A 221PA 2RH5A 3GGOA 2DAPA 3AEQB 3B1ZA 1VCOA 2CXTA 2R5WA 1GSAA 4IS3A 4BVAA 4G25A 4YAUA 1P61B 1ZNZA 3PGVA 4Q7QA 3SJUA 5LQMA 3IMFA 1ZUNB 1IIBA 1NBMD 1O58A 4OX9Y 3ILXA 2OORA 4Q66C 4MVJG 3VAZA 5CYPA 3W7AA 5IM4A 1M0EA 5TPWA 3RASA 3T1TA 1HOXA 1L5WA 2D0OB 4OU5A 4RAQA 3HJRA 4CMGA 1WRBA 1GVNB 1VPLA 5CPBA 2B6NA 1ABEA 2HMAA 1YZVA 2Z9CA 3MHPA 4RF2A 1L6IA 3G7UA 1VE5A 3FBGA 5DVZA 3ZK8A 4MUYA 1ODIA 1K4KA 4EAAA 1MW9X 4ZA2A 3R23A 2I78A 3GEEA 1C80A 2GD0A 2Q3BA 4NMLA 2YWBA 3KQSA 1SXJA 2VQEB 1X1SA 4EJFA 1Z26A 3GFBA 2O2YA 3JYNA 4EW2A 3UHPA 1XZHA 3G2PA 3H9GA 4XYLA 3ME5A 2W8ZA 3OIUA 1V39A 2Q41A 2REQA 2PD3A 3A4IA 5T3YA 4C08A 1P1RA 4N3BA 4XARA 1YRLA 3OMXA 4FQ8A 2NO5A 4IM7A 4I4CA 4KL8S 4UASA 1N0WA 1U8AA 1OWOA 2YRXA 1WP9A 1L8XA 2W2OA 2BFDA 5DSZA 4K8OA 5ERYA 1WCV1 1XRLA 3CXRA 4ZAFA 4C06A 4DSTA 4IIUA 2NU8A 2RHGB 3JD3A 4ZVUA 1TZMA 1JHUA 2I8LA 1BU5A 3ZKAA 1D3AA 2BMJA 1W4BA 3E7PA 1KYWA 4JYAB 3T54A 2GAIA 2IUTA 4LPSA 3EY4A 1T4CA 2ZYWX 3GI1A 1M6HA 5G0WA 4XWOA 1HNZB 1R1DA 1LV7A 2PKEA 2CL5A 2NUTB 1NBHA 3LH5A 4UVIA 3TZEA 3ZVNA 3HDJA 4XD7A 1TO2E 1ZJWA 2QORA 1ZGZA 3UK0A 3EDRA 3SOPA 3G23A 4JQSA 4HAXA 1WX1A 4RA9A 4R9VA 4PNZA 3OC6A 4TLDA 1E6CA 4PYRA 3NFRA 3H1GA 1GGKA 1JXQA 4JR2A 5LYJA 3OJ0A 3GUYA 2QVLA 3IIMA 3ROEA 3DV2A 1I6MA 1OYWA 1EFVA 3TTVA 4DBZA 1PE0A 3WIVA 5HILA 4MGZR 1MT3A 4M1TA 1J06A 1GYQA 2JZCA 2GK3A 2V4MA 4OAPA 2APJA 2LIPA 5LLSA 3KXLA 1ECCA 4C5CA 4WXMA 4OV6B 4XIIA 5LQCA 1TGYA 2DBRA 3GFSA 2Q4RA 4HWRA 2V98A 1CDDA 5BN4B 4EHNA 1YR6A 4GBGA 1GLVA 4N0DA 1EEXB 3G2MA 4JOQA 2IS4A 3OU2A 2CN1A 1DDOA 2P2DA 3TOZA 5JZSA 2RBEA 2PKYX 3C6KA 4OATA 5C8VA 4AJOA 1Z4JA 5THXA 1L5FA 2FPWA 4P4SB 2GEDA 3CJRA 3FFXA 2WB2A 2X2PA 4RZHA 5EP4A 5C7IO 5AM3A 1Z6ZA 2YQ5A 4Z3OA 2BKVA 2A1IA 2H2DA 2J9ZB 2X1MA 2RK4A 3NM5A 4ZREA 4BUZA 4L2IB 5BXQC 2PL5A 3UK1A 2QSJA 4MWOA 1JDPA 3GB9A 3KQMA 3GOHA 1BWSA 4Y9RA 2XGSA 3SPXA 3LCVB 3M3DA 4YAKA 4H1WA 1WVGA 1EXWA 4FHFA 4PFQA 4MRVA 4ZCPA 4QZVA 4JQZA 3M82A 2JLBA 4KQEA 2HPHA 4D9GA 4PHCA 1EVEA 1AB5A 1H8ED 3ELWA 3P0JA 4U3JA 4AROA 1VOTA 3ESXA 4O4IA 4BCCA 4BQIA 3ZE0B 1DO8A 1J6UA 1ZXLA 3PHCA 4IKOA 4IQ8A 4V1CA 3UMYA 4FSXA 2VSXA 3VC1A 1YKSA 2OHXA 4RSMA 2AVDA 2AWNA 1HUQA 2Q2OA 3OCWA 2IUSA 4E11A 4G07A 2G4LA 4YCCA 2I80A 2GHQA 2QR5A 1H2BA 1UDAA 3ZE9A 4ML3A 3VU0A 3AVOA 4NJMA 1ABFA 2WUDA 4M98A 4ENVA 3PZBA 1HC7A 1S0UA 5DNAA 4JJAA 2J45A 3GGGA 4BQOA 3WSWA 5ICFA 1VE3A 3D2CA 1A7KA 4AKGA 1KKLA 1PD1A 2RC6A 5H3CA 1RYFA 1WMEA 3AHDA 4XAQA 4LRUA 5E6UB 1QFYA 1PR4A 3UAOA 5HS6A 2JCXA 2VPIA 3F5SA 4WZBB 2CHQA 1HDXA 3D3WB 4AQDA 2GFIA 1CFZA 1JWLA 4W5RA 1EDOA 3VR5D 1PS0A 4UU8A 1G7CA 4QO8A 3O3CA 4YWHA 4PZAA 1K6IA 1P29A 3I2KA 3JZFA 2P6MA 2HADA 4XFDA 4Z9YA 4M49A 4BX2A 4K7JA 2H4HA 3E0QA 1V43A 4JP1A 1M10A 2WUWE 2X5XA 5EGSA 3FVRA 1M1ZA 1JX6A 4K9OA 3IO5A 4G85A 4OMFG 3KG2A 2PRYA 4H7KA 3A4YA 3RSZA 1A3CA 5IYZF 4EG1A 2ZB3A 2YINC 1U8CB 3DZBA 4UEWA 1AKEA 1GPYA 1EB9A 4JI3B 3U49A 1Z7EA 1BJTA 1AG9A 1Q19A 1A4RA 3G1UA 3QNMA 4RNCA 4HQRA 2AC7A 4DWVA 2IL1A 3F96A 2VNHA 4YMTA 1HKUA 3VOAA 4ARCA 3WBFA 4Q9KA 3ZVKA 4IIFA 2PMKA 1N0UA 2EWMA 4XQ0A 2ATVA 1YQDA 4PS0A 5HFAA 3BERA 4HPJB 3FBWA 3TTUA 2XRFA 4JBHA 3RGGA 3WGZA 1CZLA 1V45E 2P77A 4EG6A 5HUHA 1T2FA 3PEWA 4YJGA 1PTJC 1KHTA 3JW8A 4MVJI 2DECA 3KUDA 3GHHA 2IHTA 1BOOA 2G25A 1SUAA 2PXXA 2VF2A 1U0EA 3A9RA 3ITNA 3SKXA 5T4FA 1GKYA 1OB5A 1FFYA 4B6JA 1SUCA 1NLFA 2UVPB 1S6YA 2ASEA 3NANA 3A1DA 3R6WA 4RKFA 3A7EA 4RW0A 4BNTA 3KJZA 4Z1MD 2LNDA 3IPLA 5JHHB 3BWBA 4B76A 4JMPA 3V7NA 4WKNA 1PG0A 3OJWA 4QLAA 4MVCA 3N8DA 4M9QA 3KOWA 4R6XA 4CKBA 5AD1A 3QF4A 4I9FA 3M49A 2DBQA 2WU1A 3BJEA 5B1EA 1SCIA 2VXOA 3NAMA 2ZUSA 4DUGA 2AJLI 1DRJA 1DHRA 1DQNA 2DTDA 4WY5A 2K6GA 4HZIA 2EU8A 1VFPA 2ZYSA 1PFWA 1VG8A 2VSFA 3MBKA 3O0TA 4WA7A 5ADUS 1AHPA 3LWBA 4C9BA 3CX7A 3NB0A 4CR7A 1JR4A 3ETCA 1SD2A 4MWTA 4TQAA 3RDPA 1LQUA 4HRXA 1G98A 1LF0A 3ACBA 5HW0A 4X1IA 1EUQA 4N3CA 3KYCB 1E7YA 3K1ZA 4A6PA 3RTCA 1U0TA 1M1UA 5JAIA 1E9AA 1JT9A 1CYDA 3F4LA 2R6R1 1JQ5A 3KIPA 4ER0A 2Y1OA 1SQ5A 4REQB 3WRWA 5L3QB 1NPTO 2H8KA 2R85A 4EEXA 5JY1A 5GOZA 4W5QA 1DOHA 3OZBA 4YBZA 4AMYA 2YFKA 4NZPA 4TV8B 2RC5A 3WRXA 5FJIA 1FK8A 4MQ5A 1VL2A 1Y4ZA 1SZDA 4D44A 1U1FA 4PNHA 1JTVA 2PD4A 1P62B 2Q5CA 3OU7A 3R77A 4HTAA 2AW3A 1Y6JA 4TXMA 1ZD9A 4V38A 1ETUA 1SOVA 1YCGA 4MMXB 3KNZA 2P9QA 1K27A 2IUEA 1ODTC 3CLUD 1IOWA 1BHSA 4C78A 2LUOA 3B51X 1X19A 4QXRA 1L1FA 3UF0A 1IG0A 1NNEA 1P18A 2RHWA 2EYQA 2QTVA 3F7OA 1FNMA 1P72A 2CE7A 2F43B 2GPBA 3B12A 3BH7A 3H0KA 2VLBA 3NBXX 4R4JA 2YXDA 3DDZX 3CUKA 4PLWA 4WCFA 3WLOA 2BLLA 5I9BA 5KUTA 1W8IA 2ZVDA 2HLDA 4YWJA 3AERA 5T5QA 2O7SA 1ILWA 2W22A 3TSOA 1HEUA 4D8UA 1XZ8A 4WOKA 5DIZA 1J2YA 1PJBA 4Y2TA 5DI3A 5IH3A 3ON5A 3WADA 3WLJA 5ALNA 3TAXA 1GQQA 3HL0A 4E07A 3AW9A 2K4MA 1EUYA 3F49S 2C3YA 1UBUS 2WMDA 3IRUA 5DP1A 3NPMA 5GONF 3RQSA 5FPHA 5CTJA 3SGLA 3W3AA 4EI8A 2VJPA 3T7IA 2RBKA 1F14A 1ULBA 4QOHA 1QZ3A 3GU3A 2JJMA 4G4GA 1N2JA 1QU2A 4QVIA 4H59A 4UOZA 2OILA 2JFPA 4L4RA 1ZH6A 1VRCA 1I7QB 3JQEA 1Y6QA 3QHQA 3FD8A 5JOQA 4B44A 3A2KA 1BD3A 1YZQA 5F7OA 3IDSA 4HD8A 1YDFA 5J9FA 1IN6A 2GEFA 1I1OA 1T4CB 1ZDMA 2P4SA 3VSDA 4YX9A 1H6CA 1ZM4A 2ICAA 1PCXA 1W1IA 2XMSA 1F7VA 1HFKA 1QUEA 4R98A 1RBQA 1XL1A 3VI4B 3W2TA 4S2UA 3CGGA 3AETB 1G5TA 4J1SA 2WJJA 4Y2VA 4EQZA 3JQGB 4HLUC 5AKIA 5BSRA 2PSJA 3DAHA 5BNFA 4DQXA 2WTXA 4YAWA 1DAMA 5F1PA 2LCFA 2V54A 1SKQA 2N0SA 5EIXA 2O0MA 4QASA 4G97A 5CA0B 1RZRA 2EFCB 1AB6A 1E7RA 2PZ8A 3HQ4O 4H6PA 5IJ9A 4JP5A 1KYVA 3A36A 4LTDA 1T26A 1YZHA 2E7ZA 2KB0A 3PGLA 4LA4A 1P33A 3GLHB 1AQUA 1IVSA 1C41A 1AE1A 2ORED 1U3TA 3LHIA 4IHQA 3VOSA 1SWWA 1TM3E 1BN7A 3ZDFA 2WG0A 4K9NA 4M1SA 4Q82A 3UMJA 1ODJA 3UY4A 1HYBA 4W9NA 2ZE7A 2G4VA 1LKZA 1E8NA 4KXFB 3B1KA 5IT5A 4JI1B 2G3YA 4HGOA 1EVQA 2BZGA 3LT4A 3C7KA 3RFTA 1AN9A 3CF6R 1JHYA 4FXOA 5MN6A 3WGLA 1I36A 2VIIA 4DTIA 3ZHCA 3OECA 1ENOA 3KYDA 5JI3E 1YVUA 5LNK6 3OKPA 4C0BA 1KI9A 3I6BA 4D3DA 2YBEA 1HF3A 4LG1A 4BJ3A 3BYZA 4BRSA 1ZH0A 3NONA 3MINB 3OUZA 2V6IA 5KNCH 1WSBA 1XCOA 1LQ2A 2H2HA 2RHMA 2V5UA 3IQDB 1N4DA 2R4TA 5E1BA 4MV6A 2OQVA 4XQEA 3WLNA 3QPDA 2FGKA 2ZSHA 3N3AC 4A0RA 4NWIA 3IQWA 2AX4A 1ZGGA 3HJNA 1YU6A 3G6KA 2VTVA 3V32A 4YR9A 3U56A 3THOA 1V9LA 2UYYA 2PSDA 3OFJA 4XVQA 5D6OA 4Z0TA 5U9CA 1E64A 4HP8A 1GN8A 6PFKA 5IN4A 4NNPA 1FYWA 1IUKA 1RACA 1OAOA 1E77A 3I4LA 4MPTA 5P21A 4D0SA 3TFOA 2ZYGA 5LOVF 4BIMA 2L18A 4NABA 2AX3A 3BXGA 3FYSA 3IDQA 3RBAA 4X20A 3ZZTA 5JISA 3ZW9A 3OIYA 4BMCA 2RH4A 4FILA 4N49A 4NJMB 1OLUB 1RM4A 5TGZA 1Y8RA 4XB6B 1ECGA 4G09A 1NR7A 1RLTA 5J59A 1YFLA 2PY6A 3LT1A 3GUUA 4W1SA 3ZV4A 4MV1A 3W9SA 1Y48E 1YGPA 3FLMA 4M36A 1RC0A 1RTKA 3ELBA 4QULA 2GS9A 4J29A 4UHDA 4V39A 2CFCA 2DQZA 3IUNA 1NBEA 4KDFA 1X14A 1SB8A 4QOJA 2XPCA 2AL7A 2YIJA 2EJBA 2XQJA 3F5QA 3ZE2B 2GT1A 1WEHA 2OXCA 3NPAA 1TUIA 5E1OA 1R0XA 1P31A 1KEEB 4B2IA 2FLKA 2QUAA 5KNDH 3K2QA 1P0QA 2GPJA 2FN4A 2XUAA 5CB4B 3BC1A 5AK6A 5F5NA 3LRXA 4O1MA 3ZZUA 1CV2A 2BONA 2JVKA 3ECCA 2QJOA 1YIAA 2J7KA 1P0IA 1UPXA 4CMKA 1X39A 4FLMA 5D1HA 2O54A 2XZDA 3DHVA 1CJCA 4YJHA 2VLIA 1E61A 4BO1A 3AL0C 4JV5B 1J2TA 2JH9A 2H1LA 1TKAA 2ZUBA 1JTFA 5FPTA 1J1IA 5ARCA 4ZQFA 5CT9A 1ZD8A 3GBPA 1DEXA 1JEYB 4JI7B 1Y6GA 4NCHA 2Q2NA 4ZU6X 4IJMA 4C3VA 3DBLA 1HE8B 3VYWA 4F8EA 3T5DA 3I53A 1I3OA 3ZHSA 4G0UA 1ZJ4A 2A5YB 2IQIA 3DAOA 4X71A 5IXJA 3HG7A 4Z6KA 4TMXA 4QUEA 2H1IA 4GF5A 5FEUA 2C4WA 3P9NA 2QTRA 2MYUA 4R51A 1B8PA 4LHZA 3V8QA 4ZQHA 3JAKB 3O84A 4MIKA 2IBSA 2PKWA 1GAWA 4UTZA 1G17A 1DBIA 4HEQA 1OH8A 5JAUA 3Q3GE 4A6XA 2HA0A 1QFSA 3I2GA 4MVJP 5KNDD 5IT9A 4IJKA 2W71A 3ZWOA 3QVJA 3BMOA 1GTL1 4XI9A 2H9IA 5CPFA 2WW8A 3ES9A 3NT5A 2VBFA 3E2MA 1TKBA 5I45A 1VB3A 3EULA 4MYSA 3UC5A 2AQHA 2BVNA 3MMPA 1RD4A 3ZZNA 3RVNA 3JWEA 1SOWA 2V5AA 1R0CA 5IDYA 3IIJA 4OQXA 1W36D 4ACBA 2BIFA 3OF5A 1AZLA 1W5TA 4XVCA 3OLCX 2JHAA 5KPDA 1C5KA 2DZDA 2HGSA 3I62A 4BVEA 1X7ZB 3MZ0A 4RJLA 3SQWA 4IDNA 1SUDA 1K8QA 4AL4A 3B7GA 3EBPA 3UAZA 2J7PA 5L3RA 1YE3A 2CCKA 1SU8A 1C7JA 1TZ2A 4A8JC 2Q4TA 2WUVA 4IUDS 3UBTA 1EHYA 3RAGA 3F6SA 1Y63A 4R1SA 4ZD6A 2W11A 3TQTA 1UOEA 3U4HA 3G9UA 4P80A 4U0KA 1CUAA 5CVVA 1ZN2A 3PQ2A 3WGJA 1Z9BA 4B3JA 3I73A 1BDJA 3PNKA 5EKSA 1AS2A 3OY7A 1PBTA 1PYOA 1JGTA 2WKPA 4P82A 2FFJA 2NTYC 1DB3A 3LBFA 5JSKA 1BEEA 2JHCA 1M7HA 4I8XA 4EGSA 3VXKA 4EHLA 1CETA 3RF6A 1UXKA 1YBVA 3S27A 3LY8A 4OCZA 5C31A 1P44A 2NU6A 1Z7BA 3W1EA 4D6YA 1YGYA 1TX4B 3EVAA 2CJPA 2PX6A 2Z57A 1QLJA 2BM1A 3DFIA 3UWMA 3W06A 2ZDHA 4BKUA 4FGLA 1VIMA 2E21A 2WSYB 1VL5A 1CRQA 4AG6A 1FDTA 1KRXA 1SCQA 1JG4A 4TYYA 2I9KA 1LBTA 1QG0A 2BTOA 2HSDA 1XKQA 1E6WA 1C29B 2Q62A 4J1TA 4X85A 5EUMA 3TLGB 3WZMA 1WCIB 3I9OA 5ES4B 1Q17A 1NQ5A 2P2GA 4XA8A 3UC9A 2O3SA 3PQFA 4HMOA 1LWNA 1JU9A 1PW7A 1AQYA 4LYHA 3IILA 2FN3A 4D0RA 4HCJA 2ZBEA 2WSMA 5A1JA 3HU1A 4X91A 5IC5A 1HK7A 2NV2B 1ESNA 3K2IA 3VU9A 3P97A 4R83A 3CURA 3I2JA 3M4ZA 3RSOA 2BMEA 4Z0NA 5DTQA 5SY9A 3U3XA 2EW2A 4E5UA 3DO6A 4FHGA 1KIFA 5FOQA 3H9QA 1Q15A 2X9VA 3MTGA 5HKKD 1GPJA 4MW5A 4NMMA 1GDDA 1KTIA 5BYKA 4NMWA 4RS4A 1MDBA 2QWXA 1S1MA 1Y8QA 2IOFK 2O06A 2IP2A 1O6BA 2WF6A 4NYJQ 5FPYA 4P92A 4GXRA 1X7ZA 4ZN6A 3F90A 3P27A 1RC1A 4UHHA 1CHDA 1R12A 4HVCA 4IOJA 3N0RA 1E96A 1XZPA 1CJMA 3TEJA 4MW7A 4QLBA 3EH1A 4M0PA 4FW8A 2G09A 1BWRA 4LYFA 1JJFA 3ID6C 2HRQA 1XRMA 3I01M 1ECBA 3AG6A 3FTFA 4ZYVA 1G4AE 5DMHA 4JVLA 3S4YA 5E1MA 5CVTA 3QVUA 1XJ0A 1SG9A 2RHHA 4MVYA 4QBFA 1TU3A 4UJ5A 3S81A 2FKNA 2QTLA 4FDVA 3VSAA 2XUKA 3NH9A 1C9KA 4JT4A 1HLDA 4JL5A 2DSNA 1XRSB 3P9XA 3JR3A 3U4DA 4DUPA 4YRMA 3OA2A 4Y3UA 2ZZMA 3EVTA 3URMA 4CMEC 4FFBA 5BSGA 3RKRA 3O8NA 4Q1VA 1LFAA 1KARA 2AS0A 1LTQA 4FYWA 5J58A 4KVAA 5I9TA 4DADA 1LWOA 2LPMA 1HE1C 1HTWA 2XQKA 3ICCA 5AM5A 5JAQA 4JR1A 1KI6B 2IZOA 2ZQ5A 1P2TA 3F3KA 3MYYA 3PGXA 4GPBA 2C5FA 3ZWAA 2HW8A 5FPKA 3N0XA 5SV2A 3PGKA 2FK7A 1QQ6A 2GBCA 7MHTA 3QELB 1CQPA 3IEXA 5F7XA 1ZM3A 4DLXA 2PZEA 2OLJA 3R3HA 2E9SA 1T0HB 2OUIA 3PFFA 5DBHX 3QBJA 4FB5A 5HSGA 1TVKA 4EX6A 4W5OA 4LC9A 4C87A 3FJYA 2R1ZA 3W5SA 1GA6A 1M34B 3QKTA 2H5JA 4NBWA 1C8VB 2J0QA 4FEEA 4IMJB 2BL4A 1EZ4A 4MI3A 3WYBA 3P8ZA 2DGDA 3GWGA 5IJ0B 1X3SA 1UP4A 1O57A 4MSUA 3V4OA 1IEVA 3MTIA 5CDFE 4DUZB 5IVHA 2G1KA 4ZTZB 3HWX1 1ESDA 4QVKA 3JAKA 1F51E 3TMYA 3Q5DA 1ZJ5A 5ILGA 2JKYA 5C37A 2JH8A 3C7TA 3LTEA 4G84A 2MCFA 1ORIA 2FRVA 1VLHA 2LKCA 4JLPA 4QGHA 3L7AA 3VZCA 3GEDA 4C2AA 2QRMA 3ZX5A 4DKJA 3ZGZA 4H3SA 4BC0A 3FPCA 2OESA 3BXXA 3PA6A 4NQRA 4RK0A 4YH1A 2NPFA 4IDCA 1QTQA 1RHRA 2VHJA 2PYDA 3KB1A 1XXHE 4P4NA 1GOTA 4EB0A 2DY0A 3VNAA 1N5KA 4RMJA 2LV8A 3G2QA 4BWYA 3VVLA 2B5OA 2R5NA 1A71A 2WYIA 1YBAA 4O1HA 4C0AC 4Y2SA 1JYSA 1L0BA 2YY7A 5F7JA 3ZQ4A 1VCNA 3FVWA 3PGMA 2JANA 2D1FA 2OTCA 4LDJA 1NLYA 4GOMD 2Z5FA 2YJZA 2IXBA 1UQUA 3H2IA 4GQIA 4U2FA 2AG0A 4HATA 5FUQA 5C8YA 3DMGA 2FR8A 3LUKA 4KXXA 3ZU3A 1Z07A 4G0QA 5B57C 5LUAA 2SECE 2F9FA