1OJ7A

Structural genomics, unknown function crystal structure of e. coli k-12 yqhd
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
390
structure length
390
Chain Sequence
KAGLNNFNLHTPTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLDALKGMDVLEFGGIEPNPAYETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAANYPENIDPWHILQTGGKEIKSAIPMGCVLTLPATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTKPVDAKIHDRFAEGILLTLIEDGPKALKEPENYDVRANVMWAATQALNGLIGAGVPQDWATHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDDERIDAAIAATRNFFEQLGVPTHLSDYGLDGSSIPALLKKLEEHGMTQLGENHDITLDVSRRIYEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL OXIDOREDUCTASE YQHD
publication title Crystal Structure of E.Coli Alcohol Dehydrogenase Yqhd: Evidence of a Covalently Modified Nadp Coenzyme
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 153
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00465 Fe-ADH Iron-containing alcohol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1oj7A02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oj7A01
1KQ3A 1TA9A 1RRMA 1NVFA 3CE9A 1NUAA 3JZDA 1JQ5A 1OJ7A 1NVBA 1O2DA 1SG6A 1NVDA 1DQSA 1XAGA 1XAHA 1JQAA 2D2XA 3IV7A 1XAJA 3OKFA 3OX4A 1VLJA 1XAIA 4MCAA 3W5SA 4RFLA 1NR5A 1NVEA 1NRXA 2BL4A 3ZOKA 5K8CA 4RGQA 3CLHA 3ZDRA 3OWOA 3QBEA 3BFJA 1NVAA 1VHDA 3RF7A 4FR2A 4QGSA 5BR4A 5HVNA 1UJNA 5FB3A 4P53A 1JPUA 3HL0A 2GRUA 3QBDA 1XALA 3UHJA 4RGVA 2BI4A 5EKSA
chains in the Genus database with same CATH superfamily
2E4UA 1IEWA 4F3CA 4NK5A 2HUPA 4L5BA 3L4BC 3IE1A 2I62A 4YR7A 1E9EA 3JD0A 3BJMA 3EISA 1ILWA 4A4DA 3FTQA 2PX4A 3CNEA 3V46A 4Y1RB 4B32A 1FX1A 2JG3A 4N8DA 3RBAA 3NBXX 2R5FA 1SKUA 2GJAA 4EG5A 4P35A 1JHDA 1JDVA 2ERYA 2HXGA 3CNOA 3M3PA 4MQEA 5AKZA 1JKMA 3OCUA 5FPPA 3RLFA 5C4IA 2EV9A 3A37A 4V24A 5CT4A 5MFZA 4NU5A 5CK4A 4WLNA 3LT5A 4CV3A 4GPAA 4ZZIA 2J0QA 1DQRA 1I51A 1RWQA 2AI2A 4GICA 2X4GA 1KSGA 4BO5A 4CIXA 4MPJA 1XRRA 4RHCA 4YRZA 5GM2A 3STTA 1QG4A 2IVZA 3W3ZB 4BQIA 4E08A 4MYSA 1NY5A 1MIHA 2HK7A 4L2IA 4FMBB 4CJXA 4OP1A 1XDSA 1LLQA 1R00A 1WXGA 2WDPA 1RI4A 3Q85A 3SYNA 4HGRA 4C05A 4P2GA 3FOFC 1YIAA 4Z51A 3LRTA 4R0NA 4R7TA 5C0OE 2WHPB 3IPXA 4RHTA 1SHJA 4LDAA 1FRVA 2QX4A 2BEWB 4GVPA 1PZNA 3OJXA 5CPFA 1THZA 2Y67A 1ZKMA 2W2TA 4FYMA 4GFDA 5LKAA 1D4AA 4J0DA 4BMNA 5EWJA 3CKLA 3W0LB 1D1PA 1UC8A 3T7IA 4C6RA 3IT3A 1Q83A 1D0SA 1JMKC 2XR1A 4DUPA 2AR7A 3O94A 5I7AA 4Z4FA 4H0CA 2VJMB 4JA2A 1WMAA 4F5WA 2C95A 4NR0A 4I3FA 4HR7A 5KYGA 3QKRA 3MRTA 5FAXA 4RHFA 1EE1A 5ALFA 3D4LA 3N5CA 1Z62A 1AS2A 1QQBA 3DOOA 1ZZGA 2LV8A 1P1JA 1KZ7B 4HAOA 4BX3A 3CX7A 4CT4B 1BCSB 2Y77A 1MW9X 1W96A 4DJJA 5ITWA 3TRHA 3WICA 1QP0A 2P9BA 1OYWA 4ZD6A 1HE1C 1XG5A 2ZSIA 3MQ2A 2OCPA 3PB3A 4LHEA 5AI6A 3B51X 1HNZB 5TJHA 4HGOA 1M8PA 3PIIA 4II7A 4KN6A 5NULA 2N46A 3TGLA 4Q93A 4Q4AA 4ZV4A 1DPFA 1L4HA 1V37A 5KOHB 4JL5A 5I9SA 3UKOA 3K6SA 3M82A 3KKOA 2Y1EA 5IBPA 2AG5A 1W25A 3ZE8A 2GLUA 3I6ZA 1Z5WA 2IEGA 1LBHA 2HRQA 2XCUA 2PEZA 4OX9B 1AZLA 4MVWA 2IHYA 3AERB 1MQAA 3DE0X 2BYTA 1PUXA 3CRNA 3ID6C 4EG8A 1F6WA 3JAKB 4WKBA 1G1MA 4G89A 2GJ9A 2HPVA 2OB2A 4Z1MD 3O2QB 1SR8A 2ODTX 3W2HA 3WIBA 5BNTA 1MA0A 1VIVA 3H7AA 2X8WA 2G3YA 4UCWA 4IRXA 3GRVA 1GQYA 1R9MA 3OWHA 1PCXA 2B99A 3M5WA 2YL2A 1DC7A 3GUHA 4A0HA 4DIFA 2OD7A 2XJ4A 5CXUA 5KQSA 3T1OA 4Z9BA 3K1TA 2CHUA 2QBYB 4HPXB 2C59A 4QLBA 4NZPA 3FE2A 2QYSA 1GGNA 5BSGA 1UAGA 2ZJAA 2NUTA 3C7AA 3OZUA 2JDIA 4FYXA 1NX6A 3WFJA 3D6HA 3MGAA 1VHJA 1WUKS 4MWTA 5IBRA 3KU4A 1A5TA 3M2PA 4RZ2A 5AXAA 1G2PA 2BELA 3NWPA 2JANA 2OVFA 2JHFA 3A1TA 3NVKI 1JFFA 1STOA 1P74A 3TZLA 1GNTA 3E70C 3A58B 2PKEA 4R6XA 3WGKA 1KAEA 4IBOA 2HXYA 3DUWA 3VBCA 3ZUGA 2HY7A 2FSSA 4WJLA 2JI6A 1LLUA 5BOSB 3AOGA 4LC0A 2C1EA 1SQ0A 1T1SA 2QTTA 2YW9A 1NLYA 5EKXA 2GRAA 2WWIA 1RDFA 2FSVC 4DCGA 2QA5A 2QD4A 1NXSA 2QLFA 2JFFA 2QTHA 3BE8A 3MCAA 5GGXA 4QPDA 3W3AD 5J2TB 3O4HA 3C87A 4JYBA 1DOZA 1XBTA 3JYLA 1U8CB 3TM5A 2ZFUA 4J4HA 5F73A 1W29A 3AU9A 4EKYA 1JB9A 1L4UA 1WD5A 2NIPA 2VYNA 3K9BA 1VL8A 3MCVA 4H0NA 4IHJA 3A6DA 4K03A 4P7JA 3U4QB 1FFHA 5CYOA 1Z13A 1RVDA 1Y7IA 2PKCA 3RKSA 5LLSA 2PH3A 3TDMA 2I0FA 5HX7A 4I1RA 4IVNA 2A0FA 1S4QA 2Q6TA 4HAXA 5D3KA 1TNDA 4M38A 3G9UA 1GLNA 4JIMA 2J0SA 3OE1A 1YS4A 3AGQA 4QXPA 4RVNA 4MUIA 3C1UA 4M83A 4ASUA 1YRAA 3VJKA 3CLKA 1GNQA 4ZAWA 2ZCUA 5F1OA 4I1YA 1XKQA 3NALA 4LY0A 2XYHA 2Z5LA 3LKDA 1BFKA 4QYWA 1PHPA 4E14A 4RU1A 4XM1A 2YOGA 3T3DA 3R3JA 4TTPA 3ASZA 4R1MA 1AM4D 5DCUA 4C89A 2P75A 3W1VA 2H54A 2FKNA 2C07A 4DLRA 3V2UA 1KS9A 2VK8A 3V7NA 4BP8A 3WO0A 2X9GA 4UEWA 3GR6A 2ES4A 3I5AA 3V1YA 4V03A 2MSKA 2NZUG 3KJNA 1KVQA 1XA3A 3KP1A 2YUTA 2VDKB 5TSDA 3AKYA 1B6TA 4R98A 1K75A 1OFHA 1NRXA 1GCIA 2XNSA 3CUEF 5HIAA 3OZGA 2VJYA 2ZAYA 4TV9F 1P81A 1Y5RA 4LEIA 5E1BA 3A8TA 4BVKA 4G5OA 4QBKA 2HHAA 1MVLA 1JDPA 1SIBE 4INPA 4KWTA 3WWOA 4KW7A 4XD7D 4G1CA 2X9NA 4ZJYA 2HHCA 2D8MA 1E9RA 1CE8B 1K3FA 1SPXA 3A27A 3BFPA 3GIDA 1YJQA 2IYZA 3GDHA 2CMKA 2YV2A 3F3MA 2BM9A 4IV0A 2XTNA 5GOZA 1JDBB 1XKTA 1UJ6A 1Z9BA 4LHVA 5LBUA 3RARA 4COOA 5DXFA 9ATCA 3NO4A 4NK4A 1G21E 2IU3A 3MS7A 4CDMA 4BNXA 1ULHA 4EO7A 3RUPA 5IRCD 4QWMA 3LQQA 2O4CA 1XVTA 4HEQA 4J7XA 4M9QA 2I2WA 4O4JB 4QQNA 3SNHA 3TYXA 3IT1A 1H4SA 2HNBA 2F43A 3KB1A 4IIXA 3RJTA 1CQJB 2EZ4A 3HKDB 4PNEA 3JYNA 4B6JA 2I99A 4KO3S 5AJVB 3VU0A 5FIUA 4BZZA 5LYJB 2CV2A 1OU4A 1CNMA 2V0CA 3P5SA 1FRFS 1Z6ZA 3AKEA 3IEUA 2CKDA 3MT9A 3TZEA 4RHUA 1GNLA 2F9LA 1ZCBA 2PUVA 2Q1SA 3HM9A 2VQEB 2W2OA 1R5JA 1BNCA 3HUUA 4DZZA 4ACBA 1FVXA 3A14A 2X4LA 2FW0A 2NZJA 4C2BA 1RMTA 4UUNA 2FE4A 4AMGA 2PNJA 1EE9A 3RC1A 1PJ8A 1R64A 2QN1A 1URPA 3PZBA 4Z9FA 2JNWA 2XT9A 1DMSA 2WT8A 2EJUA 4QVKA 2H1RA 3T7DA 3FKSD 4M76B 2R66A 2RB4A 2XCQA 4P36A 5TT1A 4KACA 3F73A 4EI7A 4FNMA 1ANKA 4QYXA 2WMYA 3UPDA 4EJSB 3FTCA 4A36A 4JKOA 1ESDA 1T1GA 4PC2A 1Q1EA 1W30A 3VSDA 1SOMA 4NE7A 1GO2A 4OHPA 1NSYA 2AD5A 5LZ4A 3M89A 4DMMA 4DRXA 1XXHE 1WSAA 5CLFA 2QL9A 5GIPE 5KTYA 2Y27A 5KYNA 4D3DA 4BTVA 1B0PA 1NNSA 1V71A 2BEUB 5FWXA 4QSHA 3T5GA 5GMOA 1YZFA 1KK0A 2PYIA 3NWBA 3SFVA 2EW8A 5A4JA 3WYGA 2G17A 8MHTA 4MAMA 5IT4A 1NVTA 4KP7A 3MWKA 4I6GA 2ZS9A 2GKSA 3V7UA 3ZV3A 4Y30A 4TKVB 2Y4OA 5K3EA 3AU8A 1BDJA 1JDNA 1OFGA 2WZCA 3SHTA 5JS8A 2B61A 3RVDA 1D8AA 4HWTA 5EZSA 4EDFA 1E2QA 2DPLA 3UPUA 4P7KA 5TMPA 2JGEA 3E9QA 4NRDA 4Z3DA 4B8YA 2BUAA 3F9RA 3BEDA 2X0FA 3IQXA 2QQGA 3N05A 3OZAA 4UDOA 5I4IA 5ALLA 3AIIA 4DZTA 1EB8A 3IAUA 1FFYA 1DCKA 1CUXA 3TE6A 1U0TA 3N7AA 2BCEA 1P62B 2B5WA 3OQIA 5J4YA 3LZ6A 4MI1A 3G8DA 5JSUA 3TDKA 1JQAA 1UDXA 4KQWA 4KV9A 3EARA 1FNNA 1JDZA 5CA0A 2X0EA 4B7AA 5L6LB 4M0FA 5KNLA 3C4QA 4HNAB 2R25B 3UK2A 3E6AA 3TTVA 2VOJA 2UVDA 4ADSG 4ZAXA 4CBVA 4CL0A 1H3EA 3EEIA 1OQAA 4BN5A 1ZM2A 1BQ3A 2RC6A 1JEEA 1M6VA 5HPYB 1XCPA 4F1JA 3Q3HA 5K0SA 1QFZA 3U81A 2FMUA 2H9IA 2V74B 3QU5A 1Z6YA 5A05A 3Q1KA 1NQVA 4R16A 5AJTA 3NRBA 3WMFA 2LE0A 4BCBA 4DCVA 3G2HA 3LPNA 5TRTA 1XCLA 3U7EB 4TN5A 2JLUA 5KNBD 1YFLA 2BZGA 1T3SA 2GEJA 2OBLA 2X41A 1TMKA 2IZZA 5LR6A 5D1NA 3BYZA 3GEGA 2CXRA 4ZT5A 1X7ZA 3H3JA 2AN4A 1A8HA 3EPJA 2FPIA 3HVUA 2FMXA 1R8QA 1TPYA 2M2IA 1PNRA 2QSYA 4C4YA 3PUJA 3HUEA 3SM9A 1SQ5A 1AKVA 3R2JA 3SHOA 1KVTA 1CK4A 3BEOA 5ECDA 2GEDA 2QS9A 4F2GA 5BMVB 1FIUA 2EHJA 2IT1A 3GGJA 5H0IA 1HOXA 3DMNA 2GM5A 5K51A 2WNSA 3UJ7A 4ZYTA 2LPMA 1I7PA 3NT4A 4PC3A 5G0TA 5J4KA 5JLJA 3GEBA 3HVKA 4HZUB 1XPJA 1JH8A 4XD7A 1Y5MA 2Q6OA 1RNLA 1VCIA 2V97A 2CL6X 1VMIA 4HLCA 2E6KA 4KFSA 2XZDA 1JLSA 2HTEA 4K6OA 3FRJA 1WD7A 4CM4B 4R8VA 4S0XA 4RXUA 4H27A 3H05A 5SZIA 1QC5A 2BUBA 4A5SA 1BWQA 4RTMA 4BB6A 2P0YA 5HQJA 1LS6A 1GRVA 4H1UA 2VJDA 4OHMA 2VDLB 3OP4A 4PU0A 5F5XA 3KHTA 5C37A 1GDHA 1EAMA 2GEBA 3KQOA 3OJEA 1ACMA 3HWSA 4K2AA 4QOSA 3F6CA 1PQYA 3OPYA 5ADUS 4LF4B 5CH3A 2OAP1 3TJMA 1SUFA 2UVQA 5F3WB 1DV1A 1T4CA 4FHGA 2JCBA 2WPDA 4HGYA 1JHYA 4UNQA 1VA4A 3KXLA 1C0EA 3ZWVA 3TH5A 1WV0A 2UUAB 1X80B 3PGJA 4TGLA 3PUKA 3HWRA 4I5IA 1NIPA 3B1XA 5FUYA 4CG2A 3NKLA 1MF7A 3HXPA 3O2NA 5HDQA 3KD3A 4F1KA 1WR8A 5LB2A 3RU7A 3PC7A 5I51A 4KSBA 4PRKA 3H5VA 1G2QA 1J6UA 1ECBA 4HTAA 1KH3A 3FKSA 3WLQA 3BH6A 3NH9A 3RK0A 2J59A 1VHDA 4ZAYA 2DKFA 4BFCA 4UNRA 1YBHA 1Q20A 4FGJA 1FP2A 4MV4A 4B3MB 2D4HA 3DL7A 2FSUA 4LISA 4RESA 5JH7B 1MKYA 2Z2IA 3VVLA 4PYIA 1GPUA 1Y7HA 4CIYA 2CZCA 3GXBA 5BUZA 3IX7A 1E3LA 4YBRA 4BMCA 1DT5A 2KE5A 2AEEA 4WZAE 3VR0A 4L76A 5FOQA 2OHGA 4G5QA 4F3KA 3K9HA 3LKBA 1KA9H 3ORHA 4BNDA 4LZJA 2W2LD 1ODSA 3CLRD 4RE6A 3KG2A 1P33A 1G3IA 2O8NA 1KNQA 2XE6A 4OBWA 4R3UC 4DCPA 2O8DA 2V8OA 1GU1A 2O2SA 2D5CA 4FFBB 4G5HA 1E2UA 2YWBA 3DTVA 3M34A 2NT3A 4G0ZA 1ICEA 2X8JA 3SF8B 3GFBA 4BYMA 2FRVA 4MGKR 3NUQA 1ZXBA 1E9FA 3JWHA 3ZKWB 1ETUA 1FTSA 3HDJA 3HCOA 1YV9A 4UD2A 3RYCB 5AKHA 1N36B 2A5FA 4D46A 3AW8A 2OXCA 3CZMA 2R4QA 2O7NA 2J3KA 3FSEA 5GV8A 3M4ZA 4R1UA 4O2LA 4GR9A 3N2ZB 4C22A 1WMDA 3DE3X 1A2KC 2JH8A 3E9RA 3B89A 3IAFA 2ZKLA 5AOVA 2BFEB 2WJPA 1ISRA 1DEKA 2FN3A 2CLCX 4IWNA 4WI1A 4B73A 4C88A 9LDBA 5DNDA 4FYYA 2GPYA 1NW3A 1YE8A 4GAEA 4JJ4A 4DBVO 5JO0A 1T25A 1CUDA 5JADA 1GFWA 2P35A 2YVUA 1J0DA 3MBIA 3VVMA 4L3WA 2PMFA 3LWDA 3T54A 3EW7A 3TLKA 4YT2A 4YMGA 1WNFA 5ALXA 3RS0A 1RXIA 4TZKA 5D3QA 4NBRA 4OVKA 3NJ8A 1RIIA 1H66A 2W42A 3PNKA 5HMLA 4ZHQB 4LQ4A 2Q7DA 2JKZA 2O2XA 5EL0A 4YV7A 2CVQA 3LLVA 4O0LA 5A62A 5LVAA 1C1DB 2VYQA 3KD2A 1Q57A 1O9GA 4G4SP 1L4LA 4RA9A 4V0MA 2Z08A 5JDIA 5KNBA 4HJXA 3B70A 4JB8A 5IT9A 1C1HA 2IOFA 4IX9A 4B2LA 2C7VA 3IP9A 4NYIR 1H0SA 4WOBA 2BONA 1NM5A 2GK4A 1KJQA 1PWHA 1PEKE 2X6TA 3O83A 1Y7PA 5AW9A 4FMDF 3ZWDA 3L43A 4F8YA 1E89A 1KKMA 1PV1A 1T9HA 2JFVA 3C7DB 1E8NA 4HNGA 4N7BA 5IARA 3W8RA 1YFZA 4RM3A 3OBIA 3GRZA 1R8YA 3H0CA 4HXYA 2XNJA 2DF8A 2R6CA 1DUSA 1I33A 2GBIA 4QYMA 2CFSA 4GQAA 4EM6A 2EZTA 3TAXA 1LI5A 2IW1A 1ZIDA 1D4ZA 3OOEA 5BRJA 4KAXA 4JU8A 1EDDA 2PR2A 2QN9A 4FYHA 4CTMA 4P31A 3L8HA 3MFYA 4JC0A 4KSYA 2GCPA 3PUVA 3ZNQA 1NONA 5U4XA 2BI8A 3P20A 1M2KA 1RYBA 3NBKA 4MUXA 4DF3A 4C04A 3PNQA 1OLXA 2P2SA 4GZLA 3TQHA 1KHHA 3PDHA 5FUVA 4JBNA 2C5EA 2GX6A 4YI5A 1KP3A 2XF2A 5I9LA 3KZXA 1WCV1 3R3XA 4RORA 3QLVA 1BMQA 4GL4A 1PVVA 2BFBA 5A2GA 1UBJS 4N9WA 1WZCA 2YS6A 4UPVA 4WNIA 3JZMA 3EDOA 1ORHA 1S5PA 1F0KA 1CWUA 1HEUA 2QOEA 2UZ1A 2X5XA 3CLTC 3GN2A 1IHXA 3HR7A 3IOYA 3U26A 3U49A 3GRYA 3A6EA 7REQA 1YIOA 5H1YA 1ULAA 2J67A 3E9EA 4OO3A 2R1TA 1N1EA 3PPVA 5DNAA 5CG1A 1SCNE 4WFIA 3VPSA 3OCXA 2QNIA 4FR0A 2LWIA 4ZALA 3BWVA 3KUDA 3DLIA 4MGZR 2YWDA 3IEPA 4IMRA 2WSIA 4EQ6B 3DAPA 4B6SA 3DMHA 3ILXA 3QFCA 3SHVA 2JAOA 2GPWA 3OFJA 4JDPA 2EU8A 1Y7LA 2VBIA 4JJKA 1P19A 5DWQA 4II3A 1C4OA 1TVKB 1YC5A 2IU6A 2RJNA 2MWMA 2WAOA 2Y99A 1JLLA 1Y9AA 1EXNA 1QORA 4Y0NA 5K3FB 5LMZA 3BWMA 5CW2A 4IYJA 3E58A 1KBOA 3JQEA 2BFFA 4TPKA 3NTUA 1JHOA 3PA6A 4PR3A 4AG5A 1T0UA 3RSHA 3VNVA 2XJ9A 2GYWA 3ZWBA 3BXPA 3QTLA 4XGKA 1XDBA 2AI3A 4O5AA 4FDUA 4DV3B 1XPRA 5F7JA 1J39A 2FUCA 2KM1A 1FBNA 3M4NA 3MQ4A 4C76A 2R6R1 2JZCA 4QEDA 4URFA 2W2LA 4GU5A 2B25A 4QFCA 2E82A 4F2DA 3U7HB 3AG6A 5J63A 1KZ6A 3CJRA 3VKWA 2M1XA 4ZVVA 3BICA 1T10A 1Q17A 2IEAA 1KRHA 4BQPA 4WUTA 3FVVA 4PYMA 4FLMA 1GTZA 1GFSA 3IODA 4BLRA 3GLGE 3A6FA 1NC3A 3X1KA 2AZTA 1AHPA 2GSDA 3TQQA 2W71A 1VDZA 3F6RA 5C7LO 2ZPTX 2C04A 4EG3A 3DQPA 2DQYA 1XAHA 4IEIA 4BB9A 2XXAB 3ABSB 3DD1A 2Q62A 2QJFA 1ISMA 4H6WA 3OP1A 1YDHA 2A9VA 2XWQA 4UM8B 4Q4DA 4TUYF 4YUXA 3C3EA 4EPYA 5IT5A 3LD9A 621PA 2O7SA 2ZYDA 3HEAA 1YQQA 3MT0A 3LW8A 5AVUA 4ZT7A 1WMSA 1XWIA 2IOFK 3BORA 4MVYA 4RC9A 2VF5X 3VBEA 1QR6A 2G80A 1JHMA 4A10A 4JC5A 1POXA 4KXWA 3O26A 1DTEA 1GJRA 1JXOA 4RK1A 5IXJA 5DI9A 5JDIC 4P3YA 2PZEA 4DIEA 2DEUA 1NRIA 3LWZA 3JQGB 5ADHA 3NEPX 5FPKA 2EKPA 4ZOEA 3CR8A 4NMLA 2Z2XA 3LOQA 4P3PA 4ER5A 1Z88A 3O3NB 1NM5C 1RMQA 3UMFA 3WWPA 4D98A 3R4CA 3SICE 3KOXA 1DFGA 1L9KA 3PBKA 1VXOA 3FHLA 2Q8PA 2FQYA 2Q3CA 2R7AA 4DA6A 5HKAA 1PF7E 3V8PA 3PTAA 1QZTA 2Z3VA 2Q21A 1VJ5A 5CVTA 1SBNE 3Q1LA 2WUEA 5AHXA 2HWYA 3I2IA 5LQDA 1JPUA 2X58A 2ZWMA 4H1TA 1PL8A 4YMIA 3ZZ0A 1ADGA 7ADHA 4RL6A 1BVYF 4TLBA 3ADBA 1WZ2A 2TMDA 1SAYA 1S02A 3DEHA 5ECGC 1JW9B 1U5BB 2E7ZA 4M1TA 3KELA 4RENA 4GIBA 3X2SA 5KS2A 1SCIA 2GEUA 4M99A 1U4SA 3IQIX 2GZRA 1WB5A 3IT2A 3JVDA 2W00A 5IAJA 3FJOA 4JLNA 5LXTA 1MPXA 3TL6A 3DC7A 3DMTA 3IAS6 3HCBA 5CX1B 2O2YA 3TIVA 4RY8A 5TEVA 1FFWA 1L5HB 1GKIA 1YS6A 3PQ6A 5JBNA 4UM7A 4QBIA 3L0ZA 2B37A 5BQPA 1PT9A 1P2DA 1NP7A 2AUTA 2DYKA 3G2LA 4N4AA 4R8RA 4BFUA 4B3FX 4MKRA 3ZWQA 5AQ1A 1JI3A 2BGMA 2BHTA 1CEEA 5B53A 4HGQA 4CF3A 1D03A 2J5KA 2Y2UA 3BD6A 2HL6A 4MEJA 4WQMA 4Z3KA 5ER9A 3WSVA 2CBGA 4F4IA 1YFJA 4MQMA 8ABPA 4G0OA 5JXJA 2QGNA 1V8BA 2JGAA 1K0FA 1LPOA 2Q3MA 2LKDA 5CDSA 5DZSA 3AVUA 3QQPA 1MC8A 3Q8MA 3FZEA 2WWTA 1V26A 4CFSA 4F4HA 2R0QC 3LHFA 3SZOA 1WUYA 1MGPA 5DM1A 5B6PA 2F64A 1W4RA 4XJXA 3EF3A 3GEEA 4FYJA 3RFUA 4IHKA 3DNFA 3HXTA 4JZKA 5FO1A 3TN7A 1PJTA 2A1TR 1K97A 1A88A 1E7MA 3SJAA 3RRJA 3VNUA 1W6RA 3ZDFA 1KF0A 3AY6A 2GESA 3FG9A 5B64A 1I9CA 1XE3A 2Q50A 1IBRA 1R50A 2R11A 3D02A 2VPXA 3NIGB 4G2NA 4HRAA 4YMSA 2BMAA 1QRSA 2PO7A 2MCFA 3G2NA 3KSBC 3U2QA 3FWNA 2YZMA 2KBFA 4GF5A 3C1AA 4K9MA 1VBMA 1WZUA 3GAFA 1U0OC 3TIXB 4X8LA 5A04A 4JI2B 3B9QA 5KYXA 4C0LA 4JI4B 2PEYA 2V7PA 2LTAA 1N0IA 3FCSB 3G5TA 1L5WA 3NVMB 4RJLA 4HV4A 5FWYB 4E1VA 1EFAA 4LRQA 3P2JA 4RBNA 4PG6A 1VCNA 2AOUB 2HK8A 4YHHB 5BN3B 5DISB 4EKEA 1QU2A 4FHFA 1FDIA 5JLAA 3GEHA 4MCIA 3F5DA 4W1QA 5DNUA 1M0TA 3QVVA 2VJOA 3KJXA 4CMGA 4D96A 1F2TA 1DLIA 2DJ5A 2VP6A 1W1IA 1Q14A 3A0RB 3EFHA 1DWOA 3WTBA 3QBDA 4H1VA 4AMBA 4AY3A 5I7RA 3CUYA 2ECOA 4X1IB 4PBSA 5G4KA 3U19A 4ME6A 4ZVNA 1MDFA 2R60A 3FH0A 2XMDA 4MVXA 4YPFA 4DLKA 4TXLA 1U1CA 3ZDXB 3EXIB 2CF6A 4C43A 1ISIA 3QM1A 3PJEA 3HY6A 3LT0A 1ZOSA 4N9QA 1IUNA 3WL3A 4EVRA 5J2UB 3HBFA 3T7SA 1UT6A 4PIPA 3IE0A 2VNHA 4FC6A 4X6YA 1CKEA 4D0LB 1KEWA 4YV1A 3IPLA 2PL9A 3X2EA 1SVWA 1ESNA 3ABQB 2ZUCA 4LYGA 1V2HE 5FEMA 2Z3WA 3L0BA 4IZHA 4MGYR 1EDBA 3TTXA 2VAVA 3E03A 3PUXA 1KMIY 3Q41A 4ZCPA 4D3YA 1M6EX 2DFNA 3AVWA 3KOOA 5F5LA 4MWCA 1FS6A 1R6VA 3QJ5A 2OM6A 1KJJA 1Q6YA 1XZJA 3ICVA 3LSYA 3KB6A 3N2KA 4WAUA 2QNBA 3V42A 2IHBA 4U7HA 1DX6A 2AA3A 2AX4A 1T1JA 2PGDA 4UE2A 4AF6A 2WF7A 3QMMA 4GZ6A 4TVOA 4IUBS 3MMZA 4Q9IA 2AK2A 1E1QD 1V4NA 3C3XA 5KNCD 1BE6A 2Z1NA 1V5FA 3U4IA 1FTYA 1C3VA 4J94A 2ZXUA 5DM2A 2YJ3A 3N3BC 4OQMA 4EIWA 2QM8A 2ZU6A 5HJ2A 3I76A 4OQEA 1IZ7A 4KK4A 1E79D 5JS7A 1L2TA 1CP3A 1KDRA 2OCKA 4HN9A 4N3GA 1GEEA 5HM6A 4FMDB 3RIYA 5KYTA 2QI9F 4Y67A 5FLXA 3QEOA 3EIHA 3QPDA 2ZE8A 4A9AA 1B73A 2F8MA 3SXUB 5DBOA 2DX7A 3T5AA 4KFRA 2X5NA 3EGXA 3GLQA 2WYVA 3DMTC 3FZNA 4JYZA 5LP6B 3T3PB 1ZQ9A 4OOFA 3ZCXA 1T9KA 2AQIA 4RFSB 2BKVA 3FNFA 3SQMA 1ECFA 1GL6A 1KIMA 3OO0A 4L8LA 2A1IA 4XH9B 4Y2YA 3ONEA 1DBPA 5F78A 1UC9A 1VYTA 1P1IA 2B3DA 3P71T 1JU9A 3R0QA 5DX8A 4CQNA 1IN6A 3FUTA 3ZHTA 4E5VA 4C06A 5DLDA 3H17A 1A5BB 1ZIOA 4LNUB 3HPRA 3VVCA 4XGNA 3UT0A 1GZ6A 1O9HA 1AQJA 4CHTA 2JJ8A 3U3JA 2FZCA 3CNHA 2JLZA 3UJ3X 4P0PB 1OYYA 4UBMA 1A0OA 2Z9CA 3B2QA 2OY0A 4ECAA 2XA9A 3BCUA 3D5QA 4MQFB 1RP7A 4AECA 4EI8A 2ZJ2A 3ESXA 3F90A 5K0CA 1HDYA 1K3TA 2RH8A 4RNDB 5CRIA 3MG9A 2XMBA 4UM9D 3N76A 5IVDA 1C14A 1NQUA 4J2HA 1NMSA 2GNPA 1YJAA 2DT8A 2R8XA 3OHSX 3REQA 5K2MA 4E4TA 2P4SA 3QPVA 2P62A 3IHKA 1H8HA 1O94D 2NNWB 5KWVA 1UIRA 3L2OB 4EG6A 3WK6A 2GN6A 3A1VA 5KC9A 4ITRC 1G8HA 2QX8A 4PQRA 1KO5A 5FOSA 1W36D 2J7PD 4XGRA 3MTEA 3L4KA 3AFIA 3WL7A 1WBDA 2YFQA 4RQUA 3CPEA 3LY8A 1TZBA 3WGYA 1TEXA 2E5LB 2VFAA 1FX0A 2R3SA 3O0TA 1J8QA 4H7JA 1JQLB 1G55A 2FWNA 2X2PA 5AW6A 4DMHA 4K3UA 4LZWA 4U2GA 1SXIA 1E5TA 3SKVA 5C4GB 1KAQA 4GEKA 4C87A 3BQNB 2EFEB 2IL1A 2SCUB 3R3WA 4H3KB 4RWEA 3W9SA 1ORTA 3DM9B 5E9AA 4DQLA 1GADO 2Q7XA 3AFOA 3HL4A 4LYJA 4YLEA 4KO8A 3B1FA 3FY4A 4D6YA 4HQFA 3A25A 2MHCA 2RGEA 5DXAA 4C3ZA 5CBPB 1D6SA 3GMTA 4LX8A 5L7TA 4FZJA 3RAGA 2CV0A 4N6NA 2QROA 4F4DA 2BGUA 3I52A 4B47A 1C41A 2JBWA 1CUYA 2BEVA 3LBHA 3VPXA 4P0QB 2GM3A 3IKJA 1GCUA 1XD8A 4O4HA 3VNSA 4RVOA 5TF0A 1LPBB 4XVCA 4O5OA 2KPOA 2YZKA 2Z5VA 3HYCA 1Q2XA 1XT6A 3D0KA 4CU2A 3IV6A 2HLHA 4MB2A 3TW6A 4DOMA 3QHAA 4OI1A 3GCXA 1EFPB 5F4BA 1QP4A 2IELA 1E3TA 2GBLA 1LSSA 2AVDA 2W6IA 3IUJA 3PPWA 4GI2A 4QOFA 3PDJA 2HGSA 1TA0A 2XE8A 4V0NA 3VISA 1JR3E 1R9GA 1ECJA 2GARA 2LIPA 2G6TA 3A9TA 3N87A 3RYTC 1DUVG 3E53A 4I1IA 1K7YA 3CVWA 1OX5A 1P5JA 2ZT7A 4TUYB 3O4GA 3MUEA 3EGEA 4CN9A 1BJKA 1FS5A 1C8LA 3EHEA 1YI1A 2WFLB 4Z9AA 2DKNA 4Q3BA 5GJWC 3UT5A 3JAMA 4KNWA 4JHXA 3SIPA 2D1FA 1W4LA 5JJLA 4YASA 1KE1A 4WADA 4Z8YA 3NT5A 3LBAA 1MRZA 4LSGA 4TKUA 4BUJA 3L8CA 4FEEA 1ZHOA 2F1JA 4BL5A 3IQEA 3RIMA 2HQSA 4W5JA 3I9V1 1N5DA 1LVGA 2CFCA 2JIOA 2Q5JA 3H1AA 3UB2A 2OGSA 1NQ5A 2QPOA 3FZQA 3TFWA 3TSCA 2V7TA 3EVEA 1BHQ1 4BO2A 3HSYA 1JEAA 2A30A 2ON6A 2BY4A 1TJNA 3FVTA 2O2JA 4Y1FA 4AUMA 3AR8A 4A0FA 1JWAB 1AC5A 1OZHA 2FWJA 2IUFA 1NJSA 2GWRA 4RTKA 2NSDA 5HWSA 2VPTA 4IIGA 4AG3A 5GIOE 4FVTA 1K6IA 1UEIA 5KCZA 3QFSA 1IPEA 5FA8A 3AQ4A 5IJZA 5C7YA 3VH3A 3JRWA 4E5YA 2QRVB 3Q5DA 4CM6A 1FC0A 4AZ0B 5BWOA 1ENOA 4DC1A 1NI3A 1U7PA 1GTSA 1FNBA 4KNVA 2ZIUB 1DZIA 4R2XA 4JOCA 3JQAB 3AHEA 5DX0A 1T2AA 4CM3A 3GBVA 3RIEA 4PVDA 3DA8A 1WCWA 1FPQA 1QE3A 2FRXA 4RYLA 3ZY5A 2GZHA 1H3NA 2A0UA 4L28A 5K4AA 4PLCA 3ER6A 2WSLA 1NAHA 4FWTA 1GAJA 2SKDA 5CB4A 1NW7A 1E0AA 2BC9A 1R18A 1T3GA 3U3RA 5KO2A 3ICQB 4XQ0A 4WKNA 3GFVA 2RONA 4WIAA 5EJGA 4DYVA 3MMPA 2IOHA 3NYQA 4Q48A 1TJ5A 5AXDA 4E5KA 1J5XA 4Y1GA 1M1NA 2W4MA 3EGIA 4GGOA 5IPFA 2QG6A 1ZK4A 4LNHA 3ZHYA 1ZMTA 1T3ZA 4DG9A 5CYGA 1IB0A 1O4VA 5IAAA 3T4PA 4OQLA 1X94A 1QCDA 3ANSA 4HDOB 2GD0A 3PL5A 3V80A 3MCTA 3MMSA 5D3ZA 3VPBA 3FAZA 1O87A 3TR5A 4BUZA 4QYIB 2C8VA 1MQ9A 1EVJA 2AMYA 3FCEA 3O74A 3UOAB 1X1DA 1YA8A 1O94A 3IOMA 3RG2A 4GKVA 1SELA 4RFVA 1B2RA 4CKXA 3OF2A 3P97A 3Q5EA 4BTEA 2UZ3A 4TKZA 4ZO7A 1NOJA 1ORIA 2LP4Y 1MJGA 2J7PA 2PWBA 3LLUA 4HNQA 4BGEA 4BNUA 4EB6B 3OE7A 2H6EA 5CYFA 4ZARA 3ZV5A 1U7OA 3SIXA 1EJ0A 1TT5B 3MWEB 4B7CA 1F14A 4M4SA 4J0EA 3LIIA 1WUTA 3BMXA 3TTWA 4CLEA 5CFLA 1E92A 1NUTA 2WYUA 3VZRA 2VH2A 2Q45A 4AN0A 1FFSA 3VR2D 4P84A 1XPOA 4QUGA 4NJOA 5C31A 2HJGA 1RYDA 4L8WB 3TSAA 5IFKA 1YZYA 3AKCA 3QVTA 3ZHRA 3NETA 1GAQA 5B58C 4B3IA 4INAA 1QIIA 2YV1A 2R6HA 2RH5A 1KAMA 1CV2A 5FXMA 3AGPA 2JKVA 5HVNA 3R9KA 5FDFA 2VF7A 3BMQA 4V2UA 1I7LA 1OAOA 2PU7A 1QVWA 4X1KA 4BBAA 3QZUA 2YJ5A 1GQ2A 2GBLC 5D87A 3I2FA 2BR5A 2GJSA 3T5MA 4F06A 3EX7C 1SHZA 2GO7A 2W6NA 1MORA 4O02B 3PU6A 1JAIA 2IITA 1B8OA 3AHIA 4MI6A 1ECCA 1P9LA 4CI9A 4MMYB 3THXB 3AUUA 4G5XA 3WXMA 5AKKA 1KPIA 1WETA 2JIDA 2R6ZA 1V8FA 2ADFA 3P9RA 1J21A 3QVUA 2WVJA 4UASA 2J3HA 5CDGA 5FWNA 3W5HA 3E22B 1D7OA 2FPGA 3G0IA 3N74A 5AW1A 1T9BA 4WN9A 3KLOA 3UG6A 4FJ0A 2OM2A 3C97A 3WBFA 4RTLA 1PR5A 4TWRA 5GPBA 1ZOLA 1WQ1R 2ZQYA 3HEBA 3MOIA 1OKKD 1MC4A 2G9RA 4JC8A 4ALLA 1T9GR 1VJ0A 3DFZA 5F2OA 2CL7X 3Q87B 1TCBA 2D74A 3P2IA 1ONPA 2H65A 2VUHB 5H59A 3RVKA 4K6MA 5EJ5A 3T99A 3A4MA 1BOOA 2VZ8A 4JODA 2OWDA 3DUFB 2W98A 4YCJA 2JCSA 5ICEA 4WT7A 1XKLA 2B1JA 2FW9A 4UHEA 1NJ6A 4IH9A 4X64B 1N4AA 1QH9A 2CMDA 4U7PB 4UPEA 4FFSA 1G21A 1N2BA 3SQLA 5B2FA 2ONYA 2VP9A 3N07A 3RRYA 3V8BA 1FDUA 3EMDA 3O8OA 2NAPA 1KDTA 1OGIA 4AU1A 5JT1A 2H85A 1GN8A 2B4YA 3PHIA 3TLMA 3CPSA 1W46A 3ZIDA 1QHYA 1WVMA 5SY4A 3TCXB 3G2QA 3GGOA 1VHLA 4FOLA 5EPOA 4OHOA 4D79A 4PG8A 3OQPA 4DNFA 3PP8A 2VHVA 3PCTA 3G7NA 4DCMA 3HH8A 4N8EA 1UH5A 4RZ3A 5HFNA 4YRPA 2FN4A 5H4GA 1G4AE 3OHPA 3OY2A 2Q2QA 2VP4A 2BFPA 1TQ6A 3DHEA 2QG4A 3P9PA 4JUAA 4JUFA 4DIDA 4F56A 4HG2A 1S8NA 5KTKA 3AF4A 3ESRA 1D6MA 5CNJA 5CVJA 5HMMA 2RGUA 5J5CA 4AKTA 1E69A 4ER0A 5LZ9A 3NDJA 5JD5A 2DQKA 1CIPA 3X1DA 1J2TA 4R8LA 1NW4A 3F4BA 2FP4A 3COSA 4Z3OA 2BD0A 2R62A 5CA0F 4P8RA 5EPEA 4UZEA 1E3IA 3TLGB 3Q9NA 1HI9A 2VDRB 1F51E 1VHQA 1VCOA 3EEFA 5JFGA 4O63O 4W7SA 4DJDC 3GUZA 1K2VN 1T26A 1YHYA 4FZ3A 4KLAA 4JR0A 4LYHA 4CQMD 5I4CA 4HFJA 1XYGA 1XXHA 1I3OA 1Y37A 3AINA 3FWYA 1Z47A 4Q3EA 1MEOA 2JFBA 1TQHA 2PLFA 2CB9A 1R8XA 1TECE 3BCSA 1B15A 4MVJD 4YQYA 4JYMA 2FE1A 5HFAA 4CL3A 4RGVA 3L01A 2QRMA 3M6UA 4F1WA 3CF4G 1SUPA 2J5RA 3ENQA 2W6PA 1QBKC 5SYAA 2JCGA 3T35A 3SI7A 2PR7A 1LSOA 3TCNA 2JLVA 1I6KA 2FEWB 2GNOA 3D7MA 4L6CA 3SNKA 1SKAA 1O94C 1V8PA 2EQBA 4OSOA 1D09A 3UJPA 1Y5LA 2MDTA 5ARCA 3Q4GA 5DBGA 4O4IA 2NO1A 1DTWA 2RH9B 3NEAA 2PZLA 3F9CA 1UPBA 4M21A 4XSHA 2OV3A 5E2AA 3D8SA 2Y1CA 5K8IA 4R01A 3KAKA 2CK3D 3OIWA 4N7RA 1ABBA 3IH5A 3DL2A 3RDPA 5C1PA 1XMSA 4L9WA 1XMPA 2VNKA 1FOEB 2D5BA 3WQQA 1BH2A 4FFRA 3LT2A 2Z83A 5F1KA 4C08A 2VQDA 3GGPA 3KQNA 2OOSA 4DA8A 2PZBA 4IW3B 4D8VA 1JIXA 1AB6A 4EB0A 5A03A 5E9WA 2I4RA 3B9RA 2P6NA 4RD6A 1GGHA 3D8NA 3L0PA 1YZUA 2Q1UA 3LP6A 2VDMB 1SUDA 4BFZA 1ZNXA 5LM3A 2V0NA 1M9NA 5I6DA 1YHZA 2YIDA 3B1ZA 4NOMA 3USZA 3VR2A 2P4QA 2RG7A 4NENA 1OAOC 1R1DA 3DPSA 1PDWA 3CRMA 4MPDA 3UK7A 4BLOA 3V4ZA 1I5EA 4BVJA 2LD4A 5C4MA 3W5AA 3HYLA 2PD6A 2I6UA 1FUIA 1GPNA 1N2EA 4NBVA 1DOAA 4I08A 2ZW9A 4FT4A 2RDMA 1ECLA 1P4HA 2NTVA 3FLEA 2ZRLA 4CCYA 2FWIA 2H7CA 4RMIA 721PA 2YH2A 4HX5A 5KOJB 1FXWA 2IW3A 1LTHR 3IJRA 4ZAFA 4BEWA 1LC3A 4ZTZB 1T4GA 3ZC3A 3IIIA 3V6MA 3REGA 3C5CA 4FD3A 2FKAA 4LQCA 2GN1A 3H8WA 4FMCB 4ZOLF 4NYJR 4E7OA 5AVKA 5KC8A 4Q1EA 4JQSA 3WP0A 2HO4A 3CGWA 2AOWA 1U8ZA 2J9FB 4YAEA 3U7FB 2NUPB 3E8XA 1S1CA 3IR6A 1GYQA 2BFWA 1N6LA 3U9SA 1G8JA 2NVBA 2KWIA 4NHOA 4BBPA 4KR9A 4DS3A 3SDZA 5FBKA 1V6CA 1RXCA 4CEHA 1NMYA 1TDJA 1U1GA 3R76A 1LPSA 2DHQA 2A33A 2GBGA 4FHZA 4A0GA 3GPCA 4F6LA 4FM9A 4I55A 1R0RE 4DVGA 4IZ6A 4QQFA 1M7BA 4YIHA 1OJ7A 1E6WA 2HF9A 1RJ9A 5BQOA 2YASA 3GNSA 3FKQA 2D5IA 1XQWA 4UREA 3GNLA 3STWA 3MAJA 5JDCC 2OTCA 3ADDA 1A27A 3D2CA 3L5OA 1MB4A 1I6MA 2IS2A 2HGZA 1GA6A 4Z54A 3JZFA 3FFTA 2Z43A 1P91A 4CKWA 2YR0A 3IKLA 2V7QD 1GSIA 1OXKB 4B79A 2V8BA 4UFNA 4BXOB 1ZUNB 1IXZA 3E0QA 2LGJA 4BO6A 3W90A 2OGTA 3LQKA 3ZW8A 3GT4A 4PFQA 2LNDA 3ZHZA 2CJWB 3PNBA 2ZPAA 3KEOA 2I54A 4R1TA 2UXCB 1GLVA 3QVKA 1NYTA 3O2JA 3OA0A 5EMNA 1RACA 2GT1A 1YVUA 3JQFA 3P9XA 2FEAA 3JQBA 4OJMX 4L78A 4ZVOA 1RYEA 4BASA 4EG7A 2Z58A 1PGQA 5CLLA 5GONA 2G0AA 3ACCA 3SDBA 3IOEA 4ND4A 5L53A 2FCRA 3IV7A 1SD1A 3X1ZA 1QOZA 2B8JA 1GKYA 3ULKA 1Z5GA 2WINI 2Q9UA 3I1FA 3P52A 4BE7B 1P0FA 3BK1A 3GV0A 4UUMA 3C43A 1RRKA 1UXOA 2Q2WA 4AY4A 1KO8A 4LIPD 5TE9A 4FFVA 3GCWA 2I9PA 2ID4A 1LBEA 3HP7A 4IQ8A 1ETHA 2IV7A 3HCDA 3A2NA 1LTKA 5H8WA 3O8LA 3CH6A 3G2IA 3I9MA 4CMIB 4A92A 3LCJA 4IXNA 4EG0A 4XYBA 1CB7A 1P5RA 2IHTA 3FOCA 4M0EA 4DTIA 4Q05A 4ETNA 2CDBA 2XVMA 2XOEA 3EZ2A 1ST2A 3KUUA 3RS5A 3RT9A 4DA9A 2D1YA 1CCWA 3B6JA 3FIJA 2ZIXA 4Q9NA 3GOQA 3KSAC 5AHRA 2XADA 5EY5B 3FUVA 5G0UA 2L82A 1M2OA 1P9NA 1WZIA 3HC7A 3HKCB 1BKYA 1N8TA 1Z4MA 2PH5A 2QMOA 4HDRB 5F3RA 3W4JA 4M1QA 2W90A 4HY3A 4MQLA 4W82A 3P4YA 1KSHA 4KYUA 4AYWA 2PWZA 2SICE 2W37A 3ENNA 4R9NA 2PGIA 5HW0A 4OMUA 3TRFA 2JC3A 2O3RA 1OC2A 4WOPA 2GTHA 2CK3A 1JFRA 5ICFA 3JPWA 4ETMA 4DV5B 4N48A 5FBHA 4JSRA 4PVCA 3CVUA 1OASA 3MPUA 2CHEA 4HB0A 5EXSA 2WWVD 1VPDA 3A9CA 4ZVPA 2QJTA 2UXBB 1C9DB 1SQSA 3SX2A 4KL8S 4AK9A 4NDAA 3RNLA 3NTLA 3REOA 5KQGA 4R6WA 2Q99A 3G2KA 5AUOB 4HX2A 3RSCA 3OTGA 4X63A 1LRJA 2CUTA 4NSNA 5IKXA 3E9NA 3NNDA 4Q4HB 2R68A 3C6MA 4BQEA 3MJHA 4XEHA 1N9ZA 1J0XO 4L50A 4I1SA 2XUDA 1UDCA 3BN3A 2BLNA 4GVXA 5FQOA 4RTPA 3F74A 4X45A 3U1VA 1Z2NX 1OR8A 3OAAD 4Q37A 2ENWA 3S4YA 4B76A 1L5YA 4BNKA 3AXTA 3NDBB 3DO6A 2BDUA 4XUCA 4BFLA 2JIZD 1E2KA 4R1LA 4IRUB 2NUAB 5COAA 4C7VA 2HYIC 5CIWA 4GD3Q 3ZIAA 4H7FA 3GP8A 5D7BA 2ZT6A 2I4LA 2W6JD 4TL9A 4WOCA 2XMPA 1NY6A 2NACA 2Q5HA 2PSEA 3BQ9A 3SZMA 3UMRA 5EVJA 4NDNE 2NU9A 4EZIA 2OO5A 2LIVA 1AN0A 2PGLA 2JIPA 3PYLA 4TMWA 3QE3A 5IAGA 2GQ0A 1PL6A 4MQ6A 5IJWA 3SCZA 4DR2B 4I50A 1Z4JA 4MPPA 4YAIA 4Z4EA 5CDTA 4MWDA 5TPZD 2W2MA 5IDYA 3H11A 4HLUA 1SH7A 1V11A 5K8LA 3C6QA 4IY1A 1KFKB 4EUHA 2QWXA 2WM2A 1SQGA 4JLAA 2BGKA 2IIQA 5LQAA 1X1AA 1P3JA 5JJBA 2INGX 1FP1D 1MZPA 2YDXA 5JAUA 3HRIA 3IBSA 3AL0C 3L7OA 1JWLA 1QUFA 2W4QA 3X44A 2CLLB 1XZCA 1E58A 3OHMA 3R6DA 1JBQA 4HB3A 2HRCA 4RA6B 4TT8A 3T34A 1RQRA 3G2PA 1DBSA 1A9OA 1TZKA 3A6LA 1I3LA 2ODNA 2IU0A 3HJAA 2Q8NA 1XRNA 1XROA 1JHRA 2QTMA 3ZV6A 4FCTA 2I7VA 2H1LA 3JQFC 4EGJA 2F1IA 3JQBC 4D9GA 3WNZA 2V3CC 3WTCA 3LVQE 2AKEA 1MENA 3Q7QA 5EJFA 2UXDB 1SB8A 4C20A 4Z6KA 3N5KA 3FHCB 3FNHA 2O8BA 3IA2A 5HRAA 4ZGBA 3ZWPA 2PD3A 1NWCA 1N3YA 4X8OA 1JS1X 1QG0A 1N2OA 1VMAA 3FDZA 1CUVA 2C8JA 4ANFA 4ZYXA 2PY6A 3KBOA 3BM5A 821PA 1D7AA 1K9VF 1YZQA 4HEA6 4TMFA 3A3KA 3UNXA 2AMFA 2XCTB 3PD7A 3M6VA 3RBZA 3AETA 1CULC 1KDPA 2P68A 1Z0JA 4QHSA 1P0IA 4M46A 4ND1A 3SHFA 3TZ6A 1T5OA 2MYUA 4IDAA 2YN0A 5KINB 2Z4RA 2ZUWA 3JRNA 3L05A 1N33B 2ASEA 1H5QA 2D7JA 4HMOA 1EUCB 3WGHA 4R9VA 1VFNA 2X76A 1LVHA 3DW3X 3N70A 3QYAA 4G09A 3JD2A 3PFHA 1QJCA 4GI1A 3HBNA 1VG9B 2J46A 1QF7A 5CVEA 3I01M 5H9WA 3JTMA 2JFHA 2Q2VA 2MR5A 1EINA 1MPTA 4N12A 4BFWA 4AUNA 2PLNA 3FGOA 2Y68A 1Z73A 4RTSA 3VTFA 1W44A 2HIHA 2O6HA 1SHTX 3B9BA 5BR1A 1P2BA 1E2NA 2W4IA 3M1AA 3WLRA 1V1MA 1Z36A 1N2CB 5C5EA 2VO1A 1P9RA 4OHBA 1XL0A 4IHAA 4YECA 3BMNA 1ZRHA 4XTRA 4KWCA 4TT3A 4OOEA 1FTWA 1UKBA 3L0IB 1HOTA 4ND8B 1COWD 5EOVA 1YDGA 3EASA 3COVA 3GLGA 1U2EA 2VT6A 2V4ZA 1WZNA 3CMCO 2Y9PB 3EPRA 1L6IA 1XTZA 2HNAA 3UMSA 4BQFA 2QAJA 4HMPA 4YCLA 2NZ2A 4QGGA 5DJ5A 1N8SA 5GJCA 4A8TA 5IWAB 1B8UA 3DC2A 3LC7O 3JQDA 1E6LA 1TF2A 2RJ3A 3LO8A 1J8FA 1T9CA 3EA4A 1A95A 4RV4A 3UN1A 4BO0A 1WDWB 4G4IA 2WTBA 3O91A 2V9PA 3HGQA 4PR0A 2PUJA 3AJAA 3CONA 1VBKA 3CS3A 3JSXA 4X3PA 3F46A 2ATCA 3OD5A 3DP7A 2VXYA 2B9EA 3R5XA 4UEJA 5LBIA 2C4UA 5LXTF 5EJ2A 4MGIR 3ZZNA 1YZHA 2C1XA 1DZ3A 2ZR0A 3ET5A 1QVVA 5BV0A 4ZGGA 3FGZA 3BJRA 5T4EA 1G9XA 5B7NA 2IYWA 4QPZA 5K7SA 1JDSA 2OCGA 1KQOA 5EE1A 2IYSA 1PZGA 1QIGA 3IESA 5KDLA 1MN6A 3ZE7A 3OAAA 4PAOA 1XJWA 1JVNA 4XYLA 4LE1A 1Y9JA 1BS2A 3KUXA 3AEUA 2OO5C 3UW3A 1N2SA 1Q7EA 3R3SA 4X90A 3JAWA 2JIZA 3WGVA 3WA7A 4UOZA 3HB0A 4PNPA 3LDFA 3MSCA 4M0LA 4QTUB 1EGHA 5DHTA 5HKOA 2D62A 3PQEA 1TQDA 2XIJA 3NNNA 2W6JA 4MH0R 4NCJA 4BZXA 1N0VC 3TEFA 3RTDA 1Z4NA 2JFWA 3V2IA 5F12A 2BGRA 2PHZA 1JV2B 5D6NA 1S96A 2EEPA 2FEXA 4ZOLB 1I4OA 3CX6A 1YWGO 3RKUA 1P4RA 1YB7A 1FUEA 3CYFA 2FMFA 2J0UA 3OM1A 3PK0A 1DAOA 1PGOA 1DEXA 4O8ZA 4ZXPA 3P9QA 3K1AB 5E8RA 1TF5A 2ZRPA 1JQ3A 1O97D 2DUUA 1KERA 3AX6A 4CG0A 1UP6A 2FFQA 2GPBA 1SMKA 5LL6P 2EW2A 4MI3A 1GZDA 3GELA 2CCGA 2OAGA 1ZVVA 1ZGGA 1FMJA 4WPGA 3D1LA 4LDZA 1T0BA 3MILA 5AK3A 4IV5A 2ZI4A 3UBMA 4J75A 1JILA 1J8MF 2BISA 3BL5A 1U6IA 2C4TA 5HCNA 4K86A 1UT8A 5FI5A 1OZAA 1DC5A 4BMOB 2PGOA 4KBYA 1IQPA 5BYAA 2DBVO 4C2AA 3OWXA 1HDGO 1SU7A 1Y1QA 5J4VA 2HT1A 1NE2A 2DGDA 5H4HA 2EEZA 1L5LA 1ZMRA 1DIAA 1TW2A 3ZBUA 3GWGA 5CA1A 3QXSA 4JSTA 1NVVR 2BF7A 3QYFA 5AVYA 4G26A 5AM5A 1RYHA 1Y6JA 5ALNA 3F5SA 2QM7A 4JLOA 4NZ9A 3U39A 1JU3A 4V0KA 3NHZA 3B6ZA 5HCIA 1QS0B 1G5TA 5AOCA 1RKVA 3KLNA 4OHZA 2IZ0A 1IG3A 3EWIA 3AO0B 3PHBE 3OFVA 4G0YA 1M7HA 4DR1B 1NVFA 4OFBA 5DEIA 5T3UA 4TYWA 3KAPA 2ZZKA 4CKEA 4EVIA 4QPPA 4NS1A 1X9IA 3IFSA 3KKPA 3KOZA 3O8CA 3PSHA 5BNWA 5AI0A 5FBLB 1IRXA 3L8ZA 2H7YA 1LUAA 1NJ8A 1VRCA 5EJ7A 5LA6A 2Y1DA 3B1KA 3ERCA 5F23A 1I4LD 3M6XA 1EP1B 5DMHA 4C78A 5JEDA 3PHHA 4JU9A 4P93A 3S6JA 1LV8A 4XA8A 4CR8A 1MB2A 1O96B 5FWDA 3FWKA 4FE7A 3Q12A 2CDCA 4M8IA 2H4HA 4PCUA 4OHRA 5KWJA 4RIFA 3UHFA 3TQTA 5DGIA 4F4CA 3MINB 3OX1A 1IOWA 1RD4A 3EPLA 4HB2A 5IS2A 3H16A 4M49A 2Q28A 4RHEA 4IDQA 2HCFA 1L5QA 3NHJA 1H3FA 1KMCA 2OYSA 3V8MA 3O47A 4EW3A 4OFXA 3VHXB 2F3RA 3GFSA 4NV1A 3FFAA 4BMVA 2VAPA 3O8QB 1VB3A 4Q39A 3WGZA 2WYHA 4B3RB 1B6SA 3P8ZA 1PEYA 1TPZA 2CXNA 4K46A 5DOZA 3W7BA 3OZIA 1ZA2A 5H68A 4NPCA 4OHKA 1J20A 3VGPA 2H07A 4PNZA 1SOWA 1Y8RA 4ML3A 5FPYA 4P4GA 3VJLA 4RDCA 3KT8A 1AUPA 2AHRA 3KKMA 3L7AA 3PRYA 4OKSA 4BQRA 5AM3A 1XRJA 4DT1A 1CB0A 5JYEA 2G1KA 5C8YA 1CDZA 2XMRA 3D1VA 1NVDA 2APJA 3SEQA 2Q29A 3F98A 2ZCJA 1GZ7A 1L4YA 1PQWA 4WBNB 1XAJA 2IXTA 2UDPA 4D45A 2HMTA 3KKZA 5T4BA 3SQXA 2JLBA 4NX2A 4DCOA 3D6JA 4L9AA 1T6XA 2JJ1D 3HZHA 3N86A 3V1MA 2GS9A 3I6MA 1PWXA 5B1YA 1Y8QB 2WB4A 2ZXFA 1MAWA 3TKAA 3RTCA 4LJ4A 4G9EA 3C3PA 1VYVA 3KEFA 5EG5A 5FFFA 3W9UA 1TM4E 2DPHA 2XUHA 4M0MA 2HEIA 3NYIA 4MIYA 2A7QA 4X85A 3KK0A 5EP2A 5FJJA 3G88A 4M87A 5JNVA 4KQJA 1BDIA 3QENA 3DBIA 3L8EA 3OZXA 5D5HA 3KR9A 4LWQA 3U3MA 2GO1A 1TCCA 2N75A 3IUMA 3EVTA 3WGMA 4WV3A 4OAOA 1WDMA 2YCLA 3ZHVA 4HJRA 3AI3A 3CKKA 3SFTA 2A9PA 3QX8A 1E0SA 4WA8A 4U9UA 5EMMA 4H17A 1ODCA 4IUYA 4QOHA 5JXWA 1ISPA 3R74A 4QA9A 1ICIA 3L1KA 1WHSA 1YC2A 1ZDMA 3TQRA 3CRRA 1OA0A 3E18A 2PKRA 4NAUA 4E5DA 1PWEA 2CJPA 4PZAA 2D06A 3PE6A 3H19A 4DV2B 5BN4A 2XOKD 3TZCA 3HFJA 4QUKA 5EQJB 1RLOA 2QN6A 5I5EA 1P17A 4C9BA 3QKTA 4QHTA 3TZQA 3F8TA 1XQ1A 2VXCA 3KHSA 5T4HA 5TVGA 1II8B 4HVTA 4AY6A 3KKEA 1FTQA 4ZC8A 1Y1SA 4GX0A 3DEJA 1M1YB 3L0SA 4G0PA 2JGRA 3Q9SA 4YRLA 4B3SB 3MSXA 4L4RA 3NONA 5FORA 3NKVA 3HXKA 5LYYA 1JHZA 1CS0A 2PT9A 3EDYA 4JJEA 4MO2A 3VPGA 3OCZA 3MT8A 1ID8A 4NEGA 5AKYA 3ROKA 1VKJA 3W6NA 3FWHA 3L82B 4MUMA 4MYUA 2JEOA 5KIAA 3LUDA 3NTOA 3CLVA 4M98A 2OQVA 4QJ3A 2QW1A 1CZOA 4YP6A 2BSAA 3OOHA 1ZYUA 3QYPA 4MWZA 1HO3A 1Z6PA 4G01B 4TMZA 1QFSA 4CG3A 3ND8A 4K7JA 1V48A 1H2BA 4D57A 1DDGA 1KFJB 4E11A 2FUG6 4BKPA 3JATA 5AFSA 2PMDA 5C3MA 2ZYSA 2SKEA 4GVLA 1J25A 5BN5B 2VKQA 1YU6A 3RC9A 4W5HA 2C9BA 3RWOA 2ONCA 3AUAA 8OHMA 1GZUA 3EDQA 4RVUA 3I9KA 1YOVB 4J16A 4LXUA 4QRHA 3LLCA 5D51S 4RUKA 4RJKA 5C80A 3D3KA 3PJDA 1RRPA 2V5VA 3TUZC 3JWGA 2IBSA 5ULLA 1VJ1A 1BRMA 1RAEA 1ZH2A 4B82A 1XZPA 4EHNA 3TSZA 3JS5A 4UDXX 3N58A 2HA0A 4Q6WA 4GOXA 2VQ3A 4KXQA 3ESZA 3R7LA 1D2GA 1RI3A 1W47A 1Z22A 2OVBA 1XEFA 2VLBA 2YZ7A 2FMIA 3GHHA 4NOLA 3CRVA 5T5QA 3KQMA 4R1NA 4F7DA 2X1HA 2FU5C 3V8VA 2ZZMA 2GLTA 3LUFA 1CJUC 1Y34E 1KXJA 3ZW7A 4ZCRA 3O75A 1T9DA 2QMEA 3G6WA 5DTRA 3VR4D 3WWCA 3EIWA 4TXHA 3DGEC 3EVCA 1XHLA 2BMFA 4LNAA 3UGTA 5EXTA 4R8MA 1AVTA 3RUAA 1MH1A 3QNWA 1VSUA 1XXLA 1V7ZA 1K5DA 2OP0A 4U7DA 4IIJA 3RTGA 7MDHA 2QRLA 2H63A 3FYUA 4WOKA 3ENWA 5E6UB 2CSXA 2CSUA 2R47A 2QRHA 4Z0HO 1K92A 2DOKA 4E2ZA 3KXIA 4WJKB 5CB8A 2WIFA 5KX5B 4G97A 1WULS 1E1MA 1L3IA 2B1RA 3B3FA 3KJHA 2CXXA 4K3VA 5I7SA 3H9JA 2C96A 5F7OA 5JD6A 1DG3A 1Z74A 4MP3A 1IWPB 4PFJA 2C3PA 4TYQA 4A15A 4K6GA 4G9BA 1F3LA 1UBCA 3EGVA 5KJ1A 4I4NA 1QFYA 3OIDA 4L7VA 1E3MA 1XVAA 1MX3A 2D7DA 3QF7A 1GA1A 2NXNA 1FFDA 1NW8A 1XAIA 3DDUA 1TTHA 2F4NA 3GJQA 4R41A 5MN5A 1EBBA 1DCMA 1KZGB 1WXEA 1JVSA 4M60A 2JJ1A 4OM7A 1U5CA 3AWIA 3C3DA 4D4GA 4NKRA 2IHNA 1PHRA 3BDAA 3T7RA 3KSDO 4NMHA 2B0CA 1QIEA 4GRDA 5TB5A 4FLFA 5EKTA 5CB4F 5JVDA 1SKBA 3E0XA 1E1CA 4BNHA 1Z0IA 2A5DA 4DSOA 3KLPX 4V0LA 1IAQA 4EA6A 3EMBA 4L51A 4PBTA 3QOYA 2E4WA 3ZUPA 3UUEA 3ML1A 2VDNB 3M9LA 1BW9A 5JG7A 2R97A 3WLOA 4KOAA 2YYZA 3ZJ5A 3A9SA 1RSZA 4K1XA 5GQSA 5HKBA 3BJIC 1MXFA 5EYPB 1SGWA 1C8VB 3DHYA 3HCRA 4BFVA 3PKIA 4GLJA 4HRVA 1KR5A 4RSRA 3UW1A 1KBZA 3CWCA 2A4MA 3JYHA 4G25A 1LX6A 4ENVA 5K0GA 1RXWA 2DUJA 1FYDA 5IUJC 3G49A 1OBCA 4CF7A 3FHJA 4FGSA 4LJAA 4C6TB 2YWCA 1ADFA 1UFVA 2AC2A 3HLTA 4LRSB 3WLJA 1YKFA 3A6HA 4FI3C 4XB1A 3ZDYB 2XOKA 1PFVA 5FUXA 4B6QA 2EATA 4OK3A 2M6RA 1RU3A 4EJMA 5AI9A 1JZTA 1NA5A 5JC1A 1P7PA 1BHJA 1ZD2P 1ML4A 1G7RA 1EWTA 2XUQA 4M9RA 1DXYA 4OGLA 3I62A 4EFNA 4S1NA 2W2QA 3DE1X 4YAWA 3RHZA 1E6UA 3CURA 4ZT4A 3RODA 3U4DA 3WDMA 3PDWA 3UFXA 1QKJA 1YCFA 2F1RA 4D3SA 3KOWA 5EA2A 5FHQA 3WB1A 3OPMA 3DCJA 1MVNA 2ZM5A 3GUCA 4RGQA 1P1HA 4TYPA 4N41A 3OSUA 5IN5A 1GCAA 3G9TA 3GD5A 3I5MA 4E51A 2C2MA 1M67A 1Y89A 3PCXA 4A8JB 4QZVA 4JOBA 4MZDA 1ZN7A 3GFRA 3ZE6A 3LYAA 4DJAA 1WY7A 3ZD6A 1R15A 1XR3A 1I0IA 5ED4A 4P98A 3WKEA 3B8HA 3ETDA 4RDIA 2Y1WA 4K9QA 4J16C 4K9DA 3WV5A 1A8SA 3DEZA 4JNKA 4QUEA 3ZDZB 3QEMB 3A28A 3RFFA 5A2QA 1T5SA 4KAFA 3CV3A 1Z35A 2X5OA 3OECA 5F33A 1L7RA 4DQ0A 1VKNA 1F2UB 4Y9RA 1GVHA 1QDUA 2PS3A 4QXAA 4EYOA 4NJEB 1E98A 1NV8A 4BJ5A 1KYQA 4MR7A 1AQYA 1FFXB 3CO0S 3MWJA 4FHCA 1RLTA 3TE7A 2PQ2A 2RCYA 4D44A 1O5OA 1Z37A 1EM8B 4TTIA 2RAUA 3U9TA 2DY1A 2Y1KA 3MJDA 1FP6A 1H94A 4NBKA 5FL3A 3WLLA 4LYDA 2CHVA 4GOOD 1TIBA 1X8KA 2VRWA 4WCDA 4RANA 5HZKA 3FNEA 4JD5A 1S1MA 2CC2A 1V7QA 1OFIA 2PBRA 1JAYA 2JZOA 3SXJA 3NHPA 5F52A 3DCYA 2B1GA 5FOUA 3R5KA 4FLEA 1N8NA 2RHRA 2WTEA 1L1EA 3OLCX 1NZDA 3AR9A 1DPGA 3HXMA 3OTIA 2XAUA 2IUYA 4Y0AA 2J4DA 5DV9A 1DAMA 4GMKA 2PX5A 3BPSA 2EWWA 1YZ3A 3FYUC 3QWFA 3GLUA 4REMA 5IAEA 1FQJA 3DAGA 1MV5A 1HQKA 1T91A 1Z0DA 4G8DA 1FP4B 4TSRA 5LWHA 4PLZA 4QTYA 1XZMA 1NSFA 2F1OA 3F67A 3PI7A 4P3XA 4IDEA 3SDSA 3CZAA 1XVVA 2QRNA 1FPMA 3WKBA 1H5UA 1YKGA 1GNRA 1MMFB 3H9GA 1XJ5A 4MRPA 4KLZA 3V4LA 3NTVA 4QO8A 1EHYA 1OLUA 2DFDA 2IYPA 3PFGA 4M1WA 4YH1A 3ZCVA 3W2TA 1I3MA 2TECE 4LRYA 4FK8A 4TVKA 1C0KA 2OZLA 3L7YA 3LHIA 1AD2A 1FCJA 3UJHA 3CEPB 1U99A 3VYRB 1YU9A 3ETLA 1JXMA 1C3LA 2VTVA 5TGZA 3EQ6A 3H1GA 2UYQA 2R9VA 1CUWA 3SC4A 5FF9A 5JI2E 2G09A 2NO6A 3VYTB 1PN3A 2OGUA 1OLSA 4KMSA 4OQFA 1Y4SA 5C53B 4NV3A 4ZAVA 5ALYA 1DXOA 1M34B 2JFZA 2Y0DA 3KKKA 1JYFA 3HDGA 4N5NA 5DTJA 2QXYA 1LF0A 1Z0FA 2F62A 2C9MA 3LP8A 4DSTA 1NNEA 4YMWA 3BGDA 4TLCA 5IJ0B 3H9UA 4YYZA 5HKLA 4CMJA 5IM4F 1YZGA 1I4EB 1LBQA 4ZT3A 5EJ6A 1VE7A 1YB2A 1B8VA 2XPCA 1UWVA 1OI3A 3A9UA 3MWDB 2O06A 4DCTA 2GAAA 1UXHA 2J3DA 5KDOA 1CSEE 3CWZA 4LC9A 2R87A 4YAKA 3IULA 5H3HA 4HAYA 3VH2A 3ZYCA 3UMCA 3BVPA 2J4CA 1TYDE 5SYNA 5E1OA 2ZB3A 5CHYA 1I1HA 1QF9A 3BWDD 3PQ5A 2JIBA 3ONVA 4Z99A 1KEEA 4QECA 3RTBA 4MDYA 1UMKA 1M2FA 4P7GA 5LFAA 4XWWA 2P2CA 4DWWA 2TMGA 3UC5A 2EQAA 4AJHA 2IUEA 4XIIA 5KPDA 1CJBA 2VZEA 4Y2TA 3KZ1E 1H1LB 5D3MB 4O4IF 2OLKA 3NQ41 2NPIA 5AKIA 8ATCA 2JA1A 5ICSA 3VKHA 2VJKA 3QSYA 1J33A 3FPKA 3HBLA 2P7HA 3P1JA 4NU0A 3ZG6A 3IURA 2PYZA 4JJIA 1CUZA 1BCRA 3I9FA 3SC2A 1J8DA 5AH0A 1CPYA 1LDBA 4D81A 1KH2A 3KJEA 3NANA 3OOYA 1AUQA 3G5UA 1T2VA 5EN4A 5LQSA 1DRVA 3I0ZA 1SCBA 1R4MA 1NBIA 2B4RO 3N8KA 3JVIA 3WLIA 2H4XA 3ZBQA 2FDRA 3AT1A 3K15A 5AKJA 1NFQA 3U44A 1X7DA 2QV7A 3I2GA 1BMDA 2QRQA 1QV7A 2DWCA 2HQBA 4IJ5A 1LA2A 3QTTA 2G5PA 4MYHA 3DKRA 2ONJA 7GPBA 1DRJA 1SBIA 1V1JA 5IYZA 3H2HA 1BX3A 3O8RA 1XHFA 4LE0A 2ZIZA 1E66A 2FETA 1AN9A 2JAWA 4E31A 1V3TA 3NIFB 4ARZB 3K8YA 1NQTA 2ROQA 4PGGA 1REQA 4OX9Y 3S1AB 4C4OA 1Z12A 1AKMA 5JXGA 4M88A 5G0SA 1ZVQA 1GKKA 2H1IA 2O05A 4KO1S 5L3SA 2QU7A 2DKOA 3WNVA 3N7UA 4X00A 2AL7A 3HFGA 5CCBA 2W70A 4TTAA 4IIUA 2R85A 4PC6A 2IH5A 1FS4A 2SBTA 5DSZA 4EPVA 1FXWF 4NYJQ 2YZGA 3UMGA 1OZGA 2ODBA 3NCHA 4FFPA 4EA8A 4ER3A 2WWXA 4EY4A 1GKLA 4PZPA 1KQPA 1IIRA 4LOKA 1EFCA 1Z3CA 1SHUX 2CY0A 2UUOA 3K31A 5CLGA 2WYOA 4FS3A 4BAUA 1HFKA 1RWBA 2XGOA 5CNIA 3TPZA 3B7PA 2HHHB 4L4ZA 4AVYA 3WGJA 1U2GA 3DZGA 5PGMA 3X1WA 2R7NA 2BGJA 1VE9A 1FUUA 2QX6A 3L93A 4KQFA 4MB0A 1J2UA 2ENUA 3RSFA 4DGSA 1HKUA 1QGUA 1A76A 3LGXA 4K9PA 5L7YA 4KE8A 3W8FA 2GN9A 5F21A 4E1BA 5D5PA 4AYTA 3DONA 2QRPA 3TRJA 3AK4A 2B8TA 4K6FA 4P38A 1NF3A 2NXJA 3JQ8A 3GLSA 2E0IA 1DEHA 2NO7A 1W9MA 2FPPB 3EXEA 3FTPA 4I55F 4JJZA 4LTMA 2XBMA 1GPAA 3D3NA 4UHDA 2HWXA 4NOKA 4RVSA 2C92A 2QYOA 4X9XA 3S8MA 3MN1A 1AB5A 4X1OA 1LFDB 2PVCA 3DDCA 1G8KA 1N9GA 1PZEA 1TM2A 1BMFA 2BMJA 2PBLA 4BPBA 2XITA 4IFTA 2BTQA 5JCJD 4BJ3A 1C1XB 1G18A 1RM3A 3DBRA 5T8KA 2ZI5A 3RC7A 1T36A 1ZJ4A 4UQPA 4NLLA 1NNI1 1Z63A 3PE4A 2XXJA 4BC1A 1UZNA 1ZEJA 3LVRE 2WC1A 1TKRA 3PC6A 3AV3A 5EP1A 4R2MA 1DELA 2P77A 2ZRHA 3QXJA 3VC3A 4B3CA 1GG8A 3RYFB 4X1YA 5KYWA 1NJGA 2YHBA 4GBMA 3FUXA 1IU9A 2GEFA 1SUWA 1Z6GA 1JX6A 2X3FA 1RHJA 3R1IA 1OH5A 2LVBA 3IV9A 4XVQA 5GONF 2RI0A 1A9PA 5JQGF 3QNMA 3EAQA 4YEDA 5HTOA 2DR0A 1WM1A 1AG9A 1CLEA 1E6KA 2AJLI 3L0OA 5F1YA 1JNXX 4FE3A 4NU6A 1ULTA 2GH1A 3W06A 4KVZA 1ZI6A 5BY2A 2BFMA 2P65A 5JJCA 4DR7B 2ADOA 1RRCA 3CNBA 1OLOA 3C6ZA 4Y1RA 3HJNA 5CTJA 2Q0XA 1W0JA 5E6RB 4AJEA 3G0BA 4KFTA 4TMYA 1IJKA 2Z30A 3WMWA 3HFSA 5LD2B 1TEHA 3BE6A 1UK8A 3OMXA 5B1IA 1W48A 4QU9A 2OD2A 2P4HX 3RK4A 3QE4A 4ZT2A 3ZY4A 5ITVA 4CCSA 4LI3X 1QIMA 1H4VB 2OQIA 4FFLA 1MRSA 2R8RA 3F47A 4N49A 3TW8B 1ADBA 1AKTA 1KNXA 1X7HA 3ZE9A 1N1GA 1YS1X 1ZWKA 1Z75A 3P9NA 4F7WA 2HFKA 2QXTA 4W4TA 1QZUA 2RK6A 3DQZA 3MLAA 3ZS9A 2P9JA 4AW9A 5BORA 3IP8A 2JRCA 2P1DA 1AO0A 2NZVG 4MQUA 1P2GA 1J22A 1I6LA 4MROA 4UPDA 3I5XA 1SVMA 3IIJA 5B3JA 1X87A 3I0NA 4PHTA 1VZ2A 3GZ4A 4Q47A 1GPH1 1R6UA 2WHPA 4L8VA 3WIOA 3O1JC 1JSCA 1ITZA 2C7QA 1UZAA 2BGTA 2YZNA 2BEWA 3S2IA 3O8BA 3WA6A 1G2OA 1P7VA 3I8OA 3OOJA 3PQDA 4EUNA 4W5TA 5AVXA 3A4LA 1HSOA 4JYPA 4G5SA 2Z0MA 4GNRA 2WJVA 1Q3TA 1PR3A 2C83A 3ZIUA 3EPKA 3EMKA 3OTOB 4EHAA 2AFIB 3ABOB 2VJMA 5BXYA 1CUFA 3JY6A 5CGZA 4AJLA 1EFUA 1E8DA 4WESB 1TEVA 3TBFA 4UD6A 4G1UC 2CVHA 2OKCA 1FB5A 3F3YA 4DUGD 2AX3A 1G59A 3GUYA 4BV2A 1BCSA 4KRGA 2IPXA 1NHWA 3GJTA 5AUQA 2BFDB 4D97A 1M0EA 2V7WA 1P6UA 4PG4A 4QXOA 3KOUA 2GAJA 3VAZA 2G1PA 3AEXA 1E1KA 2Q49A 4EHIA 4LJ8A 1X1CA 2JB9A 3IXMA 3FOEC 3P5BA 3H1TA 5KOHA 1UT5A 4OM8A 1QIJA 4POOA 4TM8A 2AUMA 4Y3UA 4D4HA 4BRZA 2I6GA 1I2MA 2Q4TA 1Y3FE 3HBAA 5CVCA 3WADA 3PXAA 1BC5A 2DHEA 5BVHB 3AERA 4DG5A 2ZI6A 3D4OA 1SY7A 1L5ZA 1U2GC 4JB0A 3JAKA 2DQ4A 1PS8A 4WRRA 5FO0A 4ZKEA 1FZQA 1CUIA 4PBRA 2VF2A 5IAKA 2NZXA 2QIOA 4G5YA 3DE4X 5ILQA 5BRNA 2ZUTA 3AONB 4I50F 3VPFA 1Z7YA 1XZQA 5A9RA 3H5NA 5HUQA 3HK2A 3K0FB 4KRXA 2DPXA 5AJWA 2A84A 4MWEA 4MUEA 4B85A 1CU1A 5HK9A 4V1CB 2XZLA 3CLUD 4DQKA 3AV0B 3BGVA 3GB9A 3NX4A 4PX2A 2BGGA 4WK0B 1O0CA 1DAIA 1NLMA 4N47A 16PKA 3HI6A 3SBDA 5IZ4A 2RAPA 4JY7A 4OU4A 3UOWA 1QQ6A 3KWMA 4JK3A 3A2KA 3T5TA 1DC6A 3GA0A 4PCLA 1WZEA 3DKVA 1BA2A 1L7PA 1X7GA 3TNFA 2A59A 3TXXA 1W8IA 4K9KA 2OHVA 2O9JA 5A0FA 5G41A 3M3DA 1I7DA 4HSGA 4ZHSA 3COJA 2R6AA 3A9RA 4GO1A 4JUCA 1HY3A 3S7TA 1VSVA 5JCJA 1E63A 2B4AA 5BOSA 4ZAGA 2O50A 4K28A 4Y6LA 4YJ3F 2NPOA 4HBZA 4B6PA 1P2UA 3RF6A 2HQ1A 3HYNA 4N7JA 3W4IA 5T41A 1FYWA 4GPEA 5F5NA 3INNA 1N1DA 4UNIA 1NVXQ 2A9OA 3BBLA 5FYQA 1Z18A 3EPPA 4MRNA 4FOPA 4LXYA 4UAVA 4UHCA 2H5JA 3MTAA 2J0VA 3TDNA 5TT0A 1Y4UA 3KQSA 5IH3A 5J2TA 2P1ZA 3KYCB 5EHNA 1J90A 4BVAA 1Q91A 3BH0A 1NJ2A 5MHTA 3VSAA 10MHA 3KJFA 2CLDX 1HNWB 1XEWY 4I4LA 4JT8A 3OETA 2WFAA 4FT2A 3U4QA 1M73E 2OXEA 1QK5A 3V7YA 2ZWVA 1LQ2A 3OUZA 1P5HA 1XVUA 1ZKDA 4K5QA 5EIWA 3U1TA 4TWZA 2ETXA 1FSZA 3KKLA 2GRUA 4X6LA 1HE5A 5JPIA 2HDNB 2QEQA 3U3KA 2GLXA 2F9FA 3FOZA 1UBOS 2XCIA 1OXUA 2CBZA 2ZJ7A 4QUBA 1PLJA 4Y2SA 5CH5A 2XUPA 1GSOA 4M53A 4AJ4A 5FPHA 1JSZA 4URWR 2A9RA 1K08A 2QN3A 2CD9A 3WLSA 2C20A 4LCEA 5B3JC 3TS1A 1N8KA 2ZDHA 3MM4A 5BQ5A 1DBIA 1G60A 1XNHA 4TYNA 2Q0SA 5HDBB 3ESBA 3NI2A 5LU8A 2Z1MA 4HH3C 3L7JA 1ZXLA 4RMJA 1VGQA 2QTVB 1Q0HA 4QT4A 4D0NA 1JZQA 4DUYB 4XWTA 3M4XA 2WA1A 4MUGA 4UMDA 4GBED 4C2UA 3NM6B 1VDMA 2QAGB 1MEEA 3BWBA 4LZAA 1U7DA 4RABA 3G59A 1JLHA 5G1PA 3HJBA 1LEHA 1SKMA 1PR6A 4AY2A 2OD9A 2PBFA 2BZ1A 4PLWA 1CZKA 2XTAA 2DVMA 4MKFA 1ZQ1A 1V39A 2WZBA 3K6JA 3LDAA 1F8XA 3I9LA 4GXRA 4KUEA 3ZU4A 5M7EA 2X6QA 2I4MA 2X6RA 5DF1A 2E4XA 1FDRA 1EZ4A 4NESA 2C5LA 3IXLA 2YTZA 2XRFA 2X86A 1HMPA 3R8CA 4O2BB 1K8RA 2XUIA 2FEOA 4ISCA 3ZHCA 1CE8A 5K1ZA 3TF5A 5EGSA 3CZCA 1WPGA 4YCDA 1R6TA 1YOBA 1ZGBA 4LK3A 2NVUB 2E85A 2HKIA 2PUTA 4PS0A 3GFQA 4C30A 5LZ8A 2YINC 4JI7B 1G7TA 2C84A 5FR2A 1USKA 4E94A 2G06A 3F8SA 1DXQA 3AJ9A 3CTPA 1DSSG 1R3DA 2W8BA 2AG0A 2O07A 4O4JA 3PJFA 4YDRA 4AO6A 2DLCX 3AR6A 5H80A 2PS0A 1Q0UA 2DR3A 3I9NA 1WKVA 1JJFA 2V1XA 4JBXA 1CQJA 1QFJA 3HKDA 4A91A 3KEMA 2C7OA 4KMMA 1ZD1A 5LYJA 5KWIA 5IVKA 4J4TA 1KDYA 3VYSB 1UPFA 3MGKA 2QD3A 3OQ6A 4RPCA 3O95A 3O38A 3ZX5A 4D9HA 4IMIB 3DE5X 4MVCA 2O5EA 5AXCA 2ZKIA 4M3NA 2O2CA 3WISA 1KXZA 1Y3HA 4DIKA 4DMFA 1CUHA 1NJFA 3E27A 1IY9A 2C5FA 3P2OA 4QL3A 3GUUA 3IAEA 4HFRA 3DZKA 2JHAA 4KXVA 2C5SA 1FNSA 2WFMA 1IEXA 1MUUA 1WDLA 2WA2A 2XQJA 4TWJA 4TXJA 4KR2A 4RKRA 1JE0A 3ILSA 4OGGA 5CT6A 1BFDA 4YWHA 4ALKA 4EJSA 3CY6A 5GJVC 1OIWA 3TQIA 3PF9A 3U61B 1Y8AA 3ZVKA 2QTRA 3F6SA 1L5SA 3IVCA 1ENPA 2J9GA 1KFEB 1KTIA 5FJIA 2CUNA 1DIOB 1P4JA 1TK2A 4KB5A 1FU4A 4Y2PA 2QM3A 5AI5A 1MX5A 2BEUA 4F4FA 8LDHA 5A71A 1CQWA 5MFPA 3S7ZA 3ZXUB 2PH1A 2G1AA 4JITA 4BJ1A 3AG5A 4M37A 5EP3A 4X7PA 3WC4A 2H06A 3LGAA 1Q0TA 2YJ4A 1PFQA 4CMHA 4R8KA 2Q4BA 1QYRA 4AFNA 4F8JA 1G16A 3H42B 1Y5NA 4AZWA 2FF5A 3M33A 2XBLA 4JXKA 3NZEA 4EARA 4TKVA 3UCXA 2DPGA 3ZJ4A 4C4SA 2OG1A 4ENWA 1U4NA 1J7JA 2Q1WA 4IDGA 4QAQA 1R16A 1A9XB 1DKLA 3K0AB 5FTNA 2C2OA 5DYTA 5ETJA 4BVBA 3K09A 4JR1A 5AM4A 3WLHA 1WUHS 1P1CA 5HUJA 1Y6GA 5AO9A 4Z4IA 2HJWA 1NR5A 3PGXA 2OYCA 1E18A 1ESMA 1GV1A 1LY1A 4CW7A 4ENRA 1P77A 1WKCA 1HPLA 3HB9A 4DLVA 6NULA 4NEQA 4HNVA 3AF0A 4ZK6A 1V7PC 1U2ZA 1RVV1 4I66A 2AYYA 3ZCSA 5AK4A 3I30X 3FBWA 4RD2A 1L5RA 2IY8A 1JHPA 2OGZA 3JASA 3L0CA 3UUWA 4PE5B 4CM5A 1MA3A 4CLRB 4F5YA 1P1KA 2O52A 3KZKA 4MULA 2IDZA 4HNAA 1WEHA 2AOVA 4UNPA 2P6MA 4RK7A 4L5AA 2QTGA 4FZRA 2ZIWB 4IS2A 4M1EA 4C0WA 1YULA 2XRYA 3AVQA 1L4MA 3C1OA 2DFVA 2FWPA 3P9SA 4IOLA 3VPHA 5CD9A 4REQB 5F9HA 4PPYA 3T9AA 5BURA 4WZAB 5AT1A 3A1CA 1GQQA 1V16B 5G0VA 1N32B 4RPIA 4KLNA 4V2IA 1CZHA 4PGHA 2VPPA 3DDZX 3M70A 2HF7A 3I23A 5B57C 4GZ5A 2H1OA 1Q21A 2HCRA 2AOXA 2PJUA 1YVDA 3VV2A 1AKUA 1NI4B 1E0DA 1XDUA 1ZISA 3LK6A 3CW9A 3OT4A 3TGPA 4MW6A 3OICA 2YVQA 2ZSKA 4EO4A 3W5JA 1MW8X 4YC7A 3ELYA 3N2IA 4B4WA 5TV2A 1I4TD 1L6RA 4W7HA 1EDEA 4DPLA 4HMQA 2HW8A 4H7HA 2Z8YA 4Q4JB 2NG1A 2JAXA 1I3CA 2LBPA 3D7RA 2D2EA 3FPAA 1HM5A 3Q0TA 4NMWA 3SLGA 3VOBA 1R66A 3PQ7A 2HDWA 1L8OA 2HXSA 1IY2A 3WFZA 3HM2A 5BMVA 3OJ0A 2JGJA 1DARA 4H7DA 4BWVA 1JDBC 1N5JA 4KDCA 3ZXIA 1BKSB 3EUFA 2Q5LA 4M9UA 1CZNA 3SE0A 3WQBA 4HZUA 2OORC 4PPFA 3IXQA 1IRIA 5K09A 5HQ3B 4PQYA 4BBZA 1C3XA 3IEMA 3FPHA 1DHRA 2EZUA 5KYUB 2FJUA 2WVGA 2VK2A 2PUCA 1H0HA 4CM4A 3N8GA 5DH9A 1K0UA 1E77A 3OCWA 4G4GA 4QREA 3NIWA 3VU1A 2JFXA 3HCAA 3UGQA 2QD2A 1YBMA 2VDJA 5KDDA 2VAMA 2IHVA 2HMAA 3A6KA 2QLLA 4JB3A 3N8NA 4ZZ3A 3RUDA 2VNIA 2IYFA 2WD7B 1BXKA 3IBGA 3KT6A 1HDOA 1NXWA 2JASA 1ZH4A 4YQZA 3BF7A 3U7JA 3WNBA 4EMUA 1PJZA 2BI7A 5K8CA 2CNOA 1G3MA 3TX2A 4DXAA 5JHGB 3G2OA 1KI6B 1UL1X 3LAWA 4NCKA 4OLJA 1W9HA 1X80A 2C29D 3O73A 2HADA 2B7LA 3S81A 2O8CB 5CFPA 2GCEA 1AS0A 1P73A 4LMAA 3U3ZA 2HBYA 4EJSC 4QU5A 1U3UA 2VHJA 2DHRA 4KH0A 1CIVA 1R12A 4QTZA 3HZZA 2DHDA 4S0ZA 1JJ7A 1CDEA 3GDFA 3M5CA 2RH4A 1F2DA 5CDYA 4LHXA 3W5DA 5CYPA 4CVNA 3OC6A 2IXFA 3FA2A 4FI3F 2NO9A