1OJ7A

Structural genomics, unknown function crystal structure of e. coli k-12 yqhd
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
390
structure length
390
Chain Sequence
b'KAGLNNFNLHTPTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLDALKGMDVLEFGGIEPNPAYETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAANYPENIDPWHILQTGGKEIKSAIPMGCVLTLPATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTKPVDAKIHDRFAEGILLTLIEDGPKALKEPENYDVRANVMWAATQALNGLIGAGVPQDWATHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDDERIDAAIAATRNFFEQLGVPTHLSDYGLDGSSIPALLKKLEEHGMTQLGENHDITLDVSRRIYEAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL OXIDOREDUCTASE YQHD
publication title Crystal Structure of E.Coli Alcohol Dehydrogenase Yqhd: Evidence of a Covalently Modified Nadp Coenzyme
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 153
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00465 Fe-ADH Iron-containing alcohol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1oj7A02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oj7A01
5FB3A 1NVDA 4P53A 2BI4A 1NR5A 1XAHA 3BFJA 1JQ5A 1XAIA 3OWOA 4RGQA 3ZDRA 5BR4A 1XAJA 1XALA 3OX4A 3RF7A 3CLHA 1DQSA 3UHJA 1SG6A 4RGVA 4FR2A 3HL0A 1XAGA 4QGSA 5HVNA 1OJ7A 3QBEA 1NVBA 1NVAA 2BL4A 1UJNA 1NVFA 1RRMA 3CE9A 3W5SA 1JPUA 3JZDA 1TA9A 3OKFA 3ZOKA 1JQAA 1VHDA 4MCAA 1O2DA 1NUAA 4RFLA 5EKSA 1VLJA 5K8CA 2D2XA 1NRXA 3IV7A 1KQ3A 2GRUA 1NVEA 3QBDA
chains in the Genus database with same CATH superfamily
5LVAA 3Q98A 1A04A 2YW9A 1M2FA 2B9VA 4B71A 2YTZA 3QXJA 2EFCB 4U9HS 2OQVA 5AKZA 1GPLA 2BFEA 4HWKA 4AROA 2JBWA 3BBPA 2YJ4A 3UCXA 2KMLA 4A73A 4MH0R 3BRCA 4Q47A 2XQIA 4OMCA 3ZHQA 3COZA 5LD2B 3QBEA 1DX4A 2ZWMA 1JFTA 1WE2A 3I28A 2F43A 1WXEA 3U17A 1UDWA 1HLGA 4B6EA 3P0RA 1G4HA 1RR6A 4LGCA 2B7LA 2E85A 1KAGA 1NX9A 1SMKA 1UEXC 2WMOB 4GQAA 1XTRA 4N9WA 2HW8A 4QYSA 3CS3A 4PHTA 2XLBA 1L7VC 1QFJA 4EEZA 1FYEA 1YTUA 1SUAA 3UB2A 5TSDA 1UPFA 4GBED 4KDRA 3JQAA 4KN8A 4GI1A 1BXGB 3K0CA 3FXAA 3KQTA 3B6KA 3M5PA 4FFLA 1Z29A 1EVQA 5EERA 5ESDA 4AQDA 1RKBA 2XXBA 4PS1A 5EKDA 3RIEA 2A0YA 5AM2A 1TGYA 2ROQA 4QEZA 1W94A 4MX8A 3DCNA 2ZJAA 5EIHA 2SCUA 2WG0A 4LJRA 3GLKA 4RVUA 4RV9A 1NJ8A 1VJ5A 1VG1A 2C7PA 4GP9A 1HV8A 5I8PA 3FY4A 1XDBA 2DETA 3FTPA 3D4IA 4QHSA 4M1SA 1MGPA 3KETA 2YZMA 4TXNA 1CJTC 1U1CA 3AF4A 2DPYA 2I6SA 4BFXA 2BFEB 2V98A 2VR1A 3A6DA 2AW3A 4M37A 4Q9HA 3ZU5A 1OROA 1UFKA 2VUUA 2H2DA 1L4EA 1WXFA 1G3MA 2RGWA 4JLSA 4BO0A 3MS4A 3VNRA 1BMQA 3UO8B 1GCIA 3F8WA 3IVGA 3FMPB 2R79A 4PAWA 3SYKA 1TA4A 4FJ1A 2RGNC 3IAM6 3V97A 3O90A 1KYVA 1OFVA 3DWGA 1ADFA 1BEEA 2F43B 2R25B 3OZGA 2AVDA 3RF7A 1O03A 2H9YA 2FWJA 5BSHA 3ZY3A 1T5LA 5E1OA 1MD9A 1Z5ZA 3LJKA 5FOUA 3GAFA 1WL8A 1RABA 1WHSB 2JAWA 3VR2D 3KM0A 4QD3A 4DGQA 5CBPA 3GNQA 1HFJA 2BGTA 4OQZA 1GZ3A 2ZREA 3JQAB 2DLCX 2WTEA 1KVUA 4X63A 1I30A 1T5IA 3VVBA 4PYMA 2JHAA 3TFOA 3SR3A 5GZ3A 4YJGA 5CURA 1R10A 2O48X 3NIBA 4CPDA 3JZFA 1SCUB 1UBNA 1YBAA 4A82A 2QMEA 3WLFA 2DC1A 4LXHA 4UXIA 3ZU6A 5BPHA 1P9WA 1EXNA 5DLPA 1J06A 2ZBRA 4DNFA 1IB0A 3EIOA 4B3TB 4K9KA 5SY6A 2IU3A 3KJFA 4OIMA 4WW0A 1E3IA 4HQOA 2QN7A 3LXRA 3RYIA 1IY9A 1N7GA 1UM9B 2CLHB 4WFJA 8GPBA 1F5SA 5EZ5A 1Y37A 3RVPA 1LWNA 1CIVA 2YVLA 1EIZA 3DE5X 2X5XA 5C7OO 1I5RA 1P4HA 1U1FA 4ZT6A 1JJBA 2GPTA 4MWGA 4PLWA 3SZRA 3SX2A 3HNOA 3FVTA 4M1KA 2B4QA 1G66A 1SBHA 5I45A 3DW3X 4G0WA 1X14A 3DLTA 4CMAA 2QJTA 3NDIA 2IPXA 3GGJA 1EFDN 3GK3A 2BT4A 5DCYA 2FRDC 5CBPB 1P17A 5AP9A 1GFIA 3GLQA 3A6HA 3GLVA 4G0QA 4KBFA 4Q0MA 4TS9A 3QVUA 5I4BA 5KOIA 1U9YA 2RC6A 3S1SA 3KOYA 1EGQA 1ZONA 3GRPA 4ZT4A 5FOVA 2JK1A 4LISA 1R9GA 4YJGB 3CLHA 3IUQA 4JLOA 5AKHA 4YONB 4ENRA 4P86A 1MTOA 1T9GS 3RTDA 4HNSA 2ZATA 2IEGA 2V6IA 3FNFA 5FXMA 4O2RA 5E1DA 2VF2A 2ZYDA 4TTRA 1S2NA 4TXMA 1KDPA 2OP0A 4AF6A 3C6YA 3O94A 5K3CA 2H18A 3CQ9A 3V7NA 4FDLA 4TGLA 4CKCA 3L9WA 4IIFA 5A6VA 3PEEA 5JYCA 1O5IA 2D2IA 2ZRJA 1MO2A 4RVOA 3A2KA 2VDJA 3ZV4A 1R27A 2Q1XA 4RTNA 1DEHA 5B5SA 1OFTA 4MIOA 1A9PA 1E7WA 1WKCA 3Q9UA 4MQEA 4L6CA 4OJTA 1EDEA 2H51A 3WIOA 1P7PA 2EARA 4MGZR 3TD9A 5JNRA 4Q34A 5FORA 4K86A 4AZTA 1KK1A 4M1OA 4NICA 3RQSA 3L02A 4TKLA 3ZIAA 3OOSA 1EXMA 2OQ2A 3KPUA 1ESMA 3TQSA 3ZQ6A 4ND2A 2VH1A 4PLVA 1V5GA 5KX5A 3GNLA 4GECA 5CNMA 2BMEA 1QWSA 4UM8B 1T9ZA 1QPZA 3B12A 5CK5A 3RWOA 4ETNA 1KQFA 2RHCA 3WV4A 4YWHA 2PCLA 4CMIA 4F0JA 5KDOA 5B3JA 1FVFA 4KQFA 4PG5A 2WILA 3EHEA 1M72A 2W6IA 5K0LA 3CURA 4KU4A 1NXPA 5DM2A 5F76A 3VNQA 1CDDA 3CNLA 4NX2A 3AKZA 5DDIP 3BERA 4NNJA 4QUGA 4PZ9A 3N75A 3CRRA 4CKCB 2XRZA 1W8DA 1Z8DA 3FWZA 3HLTA 4LMAA 3SYTA 2YHBA 4A7PA 5JDCA 5FIUA 2V7GA 1EGMB 5K5EA 4CLOA 4NU6A 1A9ZA 4ZQBA 3ZCTA 1WB6A 3PPIA 1K86A 2O2ZA 4UHFA 1T24A 3GLTA 4E03A 4MQEB 4RV4A 4MW6A 5J3JA 2ECPA 2H65A 1I6LA 2I4LA 2Z3VA 3BF8A 3OETA 2OG2A 3AINA 2ZBDA 3KQPA 3ZQJA 3TG2A 1ZK3A 2OLJA 3W6UA 4FT2A 4AKEA 1Y33E 3JALA 4AF8A 3AHIA 4ZRMA 4YV7A 2WMNB 4N5DA 1HE8B 3OJWA 3AZQA 3V4PB 2O2DA 4K9PA 2DAPA 3R0QA 3RHTA 5T6BA 4ZHQB 2GTIA 2XIQA 5KX5B 2OXFA 4C5BA 1QE5A 3A37A 5BUSA 1N77A 3DTNA 4LS3A 1JR4A 5AVSA 5D2CA 3U7JA 3IEIA 4M8SA 5C31A 3M5WA 4CMIB 3NWEA 4XVCA 2P2CA 2Q0SA 5ILQA 4FEAA 3A6ZA 2HPVA 3GAAA 3AR4A 4UEKA 3ZVMA 3CZ5A 4B43A 2A9OA 3AXSA 3DZBA 3QG5A 5CYGA 3Q3CA 2C9CA 4ZVOA 5J23A 1FU4A 5J4LA 4Y2JA 4IJ6A 3DO6A 3EPRA 3QVMA 1Z6AA 4KXNA 2A9FA 2X2EA 1HPLA 3JD0A 4ZZ0A 2WUGA 4CLOB 2QRPA 5FFMA 1JRLA 4NBKA 1KPHA 3RTBA 2ADOA 4KSBA 1AJEA 4DA7A 2FUNB 4CTNA 3FNRA 2UVPA 3UMYA 4W5HA 1Q0TA 1KGSA 1EWRA 1EE9A 5CTAA 3C7DB 5CVDA 4D6XA 2NUAA 1QRAA 5JFGA 4R3NA 1U8UA 1U7XA 1Z36A 3DM9B 3QKIA 1MIOA 2CWWA 3UFBA 2X6QA 4G1CA 1EP3B 5CVUA 5ALEA 4JI1B 2GD2A 3WLJA 2XHZA 2HADA 4MYHA 1F2UA 1JQLB 4M46A 2WU8A 2R48A 3EQ6A 3PUZA 4LVCA 5KHLB 4ID9A 4L15A 2KYRA 3UMMA 3I1IA 1I7DA 1IQPA 3QVWA 3UCFA 1FFBA 2IDZA 1TUBA 2I2DA 4P53A 1LJ8A 1JA9A 1RZVA 1ZNQO 2CXSA 1KEKA 3L7KA 1GZ7A 4IGFA 4ZCRA 5ALUA 2PIDA 1J7KA 1SCKA 1SKQA 1FQKA 4GL4A 4ZU3A 4X92A 4C87A 2EL7A 3A4TA 1U65A 3E1GA 5DWQA 1M1ZA 2A1UA 3EC2A 3D3QA 3IAEA 2VXBA 4X62B 4Z4EA 4PWYA 5LOVA 1V1MA 1W19A 4S1TA 2HBZA 3SSAA 2BZ0A 3D2LA 1QS0A 5EHXA 3NHFA 1Z0AA 1D0SA 1FYWA 1JG3A 4TS1A 1ZK2A 4C5AA 5CEJA 1UZNA 4S0ZA 4TUYB 4QPZA 4WDRA 1G4UR 1QTQA 4QGBA 4EG0A 1SXJE 1Q17A 4L8FA 4AWBA 4UTVA 5CAEA 2PS3A 1A97A 2C4MA 3EWIA 3E3NA 1B8UA 3KKKA 4QLOA 2NUAB 4DZZA 2I3GA 1VJTA 3ABZA 1MIOB 2XAUA 4EO4A 4J1TA 1J1ZA 1BS2A 2WV7A 3ACDA 3AIOA 1F2UB 5FL7A 1SUSA 4NBSA 3TTUA 5F9HA 1EAYA 2VHYA 3C1TA 4PXSA 1I6KA 4F2PA 2XZPA 4MYDA 2GETA 2E5LB 1WM1A 2VS1A 5SYMA 2XTAA 3FDXA 1BKYA 4JBNA 4QYMA 5F77A 3UAVA 4MS1A 2FZKA 5THXA 4D74A 1E3WB 2BJHA 2OBLA 2PZFA 3HUFA 3K2EA 3S2ZA 3TAUA 5JJLA 4MW7A 4L7VA 3ZQ4A 2PZLA 3CN7A 5F4ZA 3IS3A 2G8NA 2A1UB 3OIGA 1ZAYA 3QEJA 2XE7A 1NVUQ 5SY4A 4KN5A 2Q3EA 5D3ZA 1AO0A 3UANA 4HQKA 5LOVB 1V1MB 4XYBA 4MIYA 4LV8B 3WK8A 2CJXA 1I4LD 2H11A 3ZVLA 1YHNA 3LO5A 1SZJG 4GPIB 1VSUA 4R5MA 3T7AA 4QQ8A 1NURA 4MYCA 5B6IA 5CAEB 2HUNA 4CFZA 4RXUA 4KACA 3STWA 4LJAA 3ONEA 5LDGA 6YASA 4J1NA 1C3XA 4I5FA 3CRMA 3GLIB 1JALA 2X4IA 3ASVA 2FQYA 3CCBA 3QVSA 4U2CA 1N2BA 3KJHA 1ZM7A 2DY0A 1WIWA 1VE9A 2JKVA 4ZEXA 3DE4X 2NV0A 2J59A 5CVVA 1QIGA 3EF1A 1L6IA 3LA8A 1PZFA 3PL5A 4ICIA 2J6IA 3X2FA 1YIDA 5HUJA 3C2QA 1NVVQ 3RJ9A 4E5KA 5LBTA 5I01A 4MS1B 3D1VA 2B1IA 4J0HA 3A70A 1A95A 4ZO4A 3IIMA 3E8MA 2FPKA 2P67A 2ZANA 1V8OA 3EQ8A 5ALHA 1M2VA 1IVSA 1DBPA 1NTRA 4PYLA 4B3SB 2WU1A 2ZYUX 1E6KA 2PEYA 1T4CA 3Q6MA 1CY8A 2GPWA 5DB4A 4MYRA 1N8SA 3H11B 2R5FA 1E2DA 1JEDA 4NECA 4PLTA 2HYIC 4WUVA 1Z6YA 1FDUA 2F4NA 3URMA 4DG8A 5K20A 1SXIA 1E2MA 3DFKA 2R68A 2EHDA 1R6VA 1A2OA 4CLRA 4CIXA 2CHVA 4L51A 2A2ZA 3X2EA 2M32A 3GJ4A 5KREA 4GSYA 1R64A 3NP7A 1N25A 1WP4A 4N39A 4DBLE 3ENNA 3A6JA 4GQBA 1MA3A 2HJRA 5FLXA 2JEOA 1SIUA 4HK4A 3ZZNA 4FC6A 3BIJA 2GJ9A 3AL0C 3K1YA 4XH9B 2X41A 3OE1A 4C7KA 2PZEA 1GGJA 4LRXA 1E2JA 3PYLA 3PC4A 1FPQA 2FMFA 2X1MA 3CIFA 4NNPA 1SM4A 3NTRA 1CZHA 4ZT7A 4YUZA 1P0PA 1VGVA 2EFYA 3IH5A 2XKKA 1N0UA 1XTVA 3TGLA 1KO5A 1JT9A 3QYFA 4CHGA 5GONF 2RHJA 3ZGOA 3SR0A 1EFAA 1UINA 3J7AC 1UC8A 1YFZA 1XP5A 4UUAA 3VVMA 4NTZA 1SD2A 4JENA 3I0ZA 4B33A 4D3XA 5DLDA 1B2LA 4Q1CA 1Y1RA 2DWPA 2YBDA 3F1KA 2HHJA 4JEHA 5IJWA 1M2VB 3PVCA 2XCLA 4NK5A 1EP2B 4N0MA 3OLXA 1K0FA 1DJMA 2BRUA 1RM5A 1QH8B 1RKQA 1GVNB 3MTBA 1BVYF 3H1PA 4LRTB 1BE8A 1M2HA 3PQ8A 3WOHA 1NM5A 1OTHA 4CLRB 1KYYA 2JC3A 1YZTA 4RKWA 5HCNA 4YWJA 4IYJA 2YRFA 1QAQA 2HMUA 2WLSA 5FUMA 4DHEA 4MYTA 3K8QA 4AMVA 1W44A 4P08A 3ZGNA 2XB6A 3OWHA 3PRHA 2BGNA 1JR3E 2CLLB 4P34A 4W1QA 3V1MA 1K6XA 9ATCA 5FUYA 3V2GA 5ICCA 2WMYA 4KX3A 3HB7A 3ZPXA 1USVA 4GOJA 1FLVA 4FEEA 4BWYA 1WDKA 4FR0A 4LNAA 1XKLA 1CUEA 4I1VA 1NASA 3GJSA 1TE2A 2VDVE 2IY9A 2DVMA 3QEAZ 2NM0A 2YHAA 3AWDA 2AS0A 3BX1A 2CXRA 2DPGA 5BMOA 3MOIA 4FB5A 2B21A 3NKFA 2HFJA 1PS0A 2BN4A 2KSQA 4MQUA 4Z7QB 1P5RA 4MV3A 3FTEA 821PA 4C4PA 2VTKA 4C7VA 2AR0A 1CEQA 1ZN2A 2NV2B 4RVNA 2X5NA 3IODA 1IHOA 1CRQA 3ODPA 5IASA 3QVTA 2HNAA 3EW9A 5JAQA 1P4GA 4HB3A 3MELA 3O8QA 4JIGA 4YDHB 5K3BA 3SJZA 2QTGA 3VR4D 1P4RA 2EKPA 3D6TB 4DR4B 3HFSA 1W5TA 5DM0A 1KRWA 1UOPA 5KBYA 2XJ9A 1ECBA 3NBZC 3OQHA 1SBYA 3D5EA 5HIIA 1GTL1 3A1CA 5A6SA 2C7OA 3CRQA 3MJ4A 3WSWA 3JV7A 4F4JA 3FOFC 1SCAA 4QNMA 4PBSA 1IPHA 2YNMC 1L4YA 4PR3A 5AOBA 4REMA 4B32A 3TTSA 1Z37A 3RG8A 2JGJA 4C0XA 1GG2A 4XOUA 3RVRA 3W9YA 1UT6A 2CLMB 1ZRHA 2QT1A 2ZTUA 5FWNA 2PBRA 3I6QA 1AKMA 2J9GA 5F1PA 4OL0A 3AESB 2A0FA 3QWIA 1P3JA 4HLUC 4FXOA 1PKXA 3V6MA 3USZA 3VISA 4E08A 1R3DA 3KO8A 2A8YA 1S89A 4IZHA 1BOFA 5C8YF 1XVVA 2NVBA 2DKFA 3HCNA 4UUQA 1AQJA 4HYEA 4BPBA 1KXZA 2OAGA 2W6NA 1Z17A 3E18A 4Q9LA 2H00A 2AUTA 1N8TA 4QFBA 4IWYA 1I24A 2OZPA 1DADA 1P4JA 2EFHB 3DZ8A 5F52A 1Y98A 4US0R 2RAFA 3OTIA 4GNKA 4NQZA 1UXIA 3PXUA 3ZHRA 1G3RA 3E9NA 5KIAA 5A5EA 4JR2A 1YS2X 2YINC 3P0HA 4KAAA 1NP3A 4J6FA 4PC3A 4FNGA 5HJEA 2ODAA 2WVGA 4RHTA 3DL7A 5JMOA 3R7SA 3O8QB 2VRBA 2X15A 2OUIA 3IRUA 5E6SB 2OLEA 1TYDE 1GV1A 2OXCA 2VRCA 3KSDO 3TW6A 4DTIA 4LNUA 2GBCA 5KJEA 5KNCD 4R8KA 3R7AA 2P2NA 2IXGA 4KR0A 1WXDA 2OENG 1I2AA 3GMTA 3OM9A 4L5YA 2RBGA 4Q1FA 1SBNE 3D9QX 4JS0A 2X23A 3A10A 3PFIA 2R00C 4C88A 4QJ3A 4UM9B 4COOA 1EINA 4RK4A 1NYQA 3EDCA 3KR9A 4LXUA 1NW5A 3ZWPA 4IRUB 3ICEA 3ODGA 1H5UA 4BJ3A 1OZFA 4NCNA 5IAKA 1XWWA 3RC7A 2WKPA 4BZWA 1ZITA 4OHUA 4Y2SA 2GXAA 3ET4A 1RM0A 3OC0A 1EGHA 5DM4A 3GG2A 1YFLA 1E9SA 4FFVA 2EP8A 3DOJA 5L6MB 1KMMA 3GDWA 4NEGA 1DQRA 4X0EA 2VHXA 1QIKA 2AIRA 3BWEA 4JHLA 5EKTA 5DGTA 3TQCA 1TO2E 2QRMA 3CLUC 1CT9A 5B64A 1FTWA 4E2YA 3TR0A 1L7RA 4AY6A 1A88A 1NUAA 1FFWA 1L4UA 3MUFA 2E2WA 3QNWA 5GJWC 4LYAA 3MCZA 4P6VF 2RGNA 1HE3A 3U3JA 1IH8A 3WLIA 1OB2A 2HSEA 3O8DA 1PW5A 1N2GA 4ZDIA 2QT9A 1TTTA 1VDZA 4LZWA 1F8UA 4KE8A 2OFOA 4LNUB 3RTGA 1U2SA 5CHEA 5EJ2A 2Z8ZA 4PO1A 4NH0A 3UVEA 3PQEA 1JA0A 3RQIA 1BOOA 1VHQA 3D6AA 2B2NA 3FNIA 1E1YA 3KYJB 3H4TA 5BSKA 3WAJA 3UPUA 4DCNA 1Y9ZA 2H16A 1GV0A 3AEUB 2R8RA 1U2DC 1O8BA 1KIMA 3ESQA 3GLGA 4OQMA 4UEOA 1ITZA 2VDKB 3QPVA 5T57A 4QTTB 2P0AA 2IEYA 2DKOA 3KZCA 4PCUA 2PKWA 3I53A 3M6FA 4IDDA 4QBFA 6PFKA 1NRXA 3FKQA 4TQ9A 3WE7A 1S2IA 4C05A 5CT9A 4ZHSA 1T4GA 3LLUA 4U2FA 1ICIA 3C7TA 4NDZA 4BQPA 5KNBA 3AM3A 1FFDA 1O58A 1PJSA 3RLFA 2J5QA 2AFRA 4Q93A 2HLDD 1FXWA 4W1PA 3JRNA 4M1MA 2XQVA 3T5DA 3DBRB 3ROFA 3IOMA 3ZGYA 3NFRA 2BE9A 1KRXA 3SKYA 4E13A 3BB4A 3ZOZA 2VJQA 1QMPA 3UHOA 1U0FA 4C7OB 3EXEA 4BP3A 3NBXX 3RHSA 3RYCB 1JHQA 1KBZA 3O73A 4XCXA 3EEOA 4TLCA 4N54A 4J4BA 1K06A 4ZQHA 4RNDB 1KO7A 3FHCB 3SJUA 2WFAA 4KPYA 3KKLA 5DP2A 1X1RA 2G1KA 4DAEA 3F90A 4D80A 4DUPA 1PUXA 1KI7A 4GKBA 4INPA 2O8BB 4Y1GA 5HMLA 2IV2X 3P8ZA 4IIUA 3WO1A 2FRDA 1RYHA 4XWKA 2KI5A 2VQSA 1X70A 3DHVA 3N53A 5G0WA 1EFRD 1EFKA 1J5XA 5EZYF 3B53X 3T41A 3VR3D 3TIXB 1O89A 3OTGA 2EKBA 3U31A 3LIPA 4J90A 3A9TA 2IWHA 4K0KB 1AD2A 1GQ2A 1OAAA 2G7ZA 3DKRA 3TEFA 3Q7SA 3QWBA 1CDZA 4D7AA 1A1VA 3IBFA 4HFNA 2IP2A 2IYEA 1H6AA 4YCLA 2ZE5A 4QGFA 1TNDA 4I2VA 2RHTA 1GLVA 3W3AH 1K63A 1ZCJA 1NI4A 1H9BA 1TT7A 1WF6A 4IXWA 1YZKA 4QDTA 3FPEA 3ZZUA 4CUZA 3D2AA 3N07A 5ALTA 3G79A 4KYTA 3NS7A 4D9JA 4IIXA 5C7LO 2YJ3A 4QDUA 3SXPA 3AKCA 1E2IA 3DDUA 4GW3A 2ZQYA 4O5OA 3WTCA 4F85A 1W1WA 3K0EA 4EYOA 1DBVO 1W5SA 1G3IA 1YACA 2I2CA 2G9ZA 5KOYA 1OGIA 3IRVA 1ZXBA 2TMYA 4BV3A 2DOKA 4DNPA 1VPWA 4IL5A 2OV3A 3TUIC 3LF1A 4IXMA 5TQVA 3FMIA 2QZSA 3IA2A 3MXOA 4YJ2A 1ZGCA 1OXMA 3N2LA 2OHFA 4YV1A 5BR8B 1Q95A 4MP8A 1VL6A 3SS8A 2PRYA 2QV7A 4KQGA 4LTDA 2QZ4A 5BN5A 5B3AA 1VMKA 3Q5DA 1V35A 3W9BA 4IPTA 1TL7C 1LEHA 1PW7A 4N49A 3CH4B 4I36A 3K31A 1I4WA 1I2MA 3FZEA 2VJCA 1FNDA 2VHWA 2LW7A 1C0LA 3MMPA 3VR5A 4U7GA 1GJRA 1CXZA 4UW9A 1NHWA 2WJAA 1OLXB 5H68A 2VPQA 3MTGA 3U0BA 2C9DA 1E2NA 1HTBA 3MQ4A 4UHHA 3WYAA 3NTUA 1CFZA 5EEHA 3EXG1 4HYTA 3I05A 3I4LA 3RAGA 3UOGA 4K81B 3B70A 3DAFA 4KXUA 4UPDA 3VV2A 3QMWA 1CX9B 1VM6A 4BTEA 5J2TA 2X9NA 3M33A 4PZLA 4LZNA 4BV8A 2G1JA 1IZZA 1OAKA 1OI4A 3A3NA 1OQAA 2G1UA 4BJ1A 2A7QA 3OTOB 3I8XA 4JZYA 3SHVA 3QX7A 1U5BA 2D3TA 3QXHA 1ECGA 5BV1A 3AFGA 2ZS7A 1Z0IA 2CL0X 4GM4A 5F5NA 3UMRA 3KU1A 2ET6A 3Q3GE 4POOA 3NOOA 1FY2A 2X0EA 4Q7QA 3DNMA 2PGXA 1OH8A 2GAFA 4YJ2B 1JGTA 3EN0A 3KSAC 1X80A 3DAOA 3Q40A 3SP1A 3K1TA 3TTTA 3DG9A 2WD8A 1ENOA 2GZDA 1YDMA 5HS4A 3U19A 2E6UX 1VCMA 2XDAA 3MGKA 3PNYA 5BN5B 2J07A 2RGBA 2OV2A 3I23A 3LLMA 4NCIA 3L7MA 5JCJA 1FJGB 3A0RB 4GI5A 1WMAA 4KV7A 4YRNA 3PSHA 5EJMA 3L0PA 2ZUFA 2R6HA 4ZO9A 3QIAA 1PI3A 5DU2A 4Y6PA 1EFTA 2XQFA 3IR7A 1N7JA 4Y6LA 3CEAA 4II7A 4L22A 5EP3A 3JVVA 4X85A 2CF6A 1W52X 2XVYA 1EHYA 4HLNA 4KGZA 1NBIA 2EBUA 4O2AA 2IZ7A 5E4FA 4ZCTA 3GWGA 5B6PA 1R0ZA 8ATCA 2AHOA 4V38A 1U7PA 2EFGA 2QNRA 1GDDA 2ORIA 3GUCA 3ZUPA 4ESHA 5J2TB 2CVFA 4BO2A 4ESOA 3I9KA 1UC5B 3OMWA 3RT7A 3L3BA 3MCWA 3NDPA 1XAJA 3WNQA 3P9QA 3JQBC 1USWA 1FMCA 3I1FA 4F2WA 3L92A 1P7ZA 1U5BB 4TKUA 4YRJA 3ZVKA 2QMQA 1YZHA 1UFVA 1C8BA 2WWHA 3C3BA 4L3OA 3M2PA 2C2GA 2WUFA 2ZYTX 2XAAA 3H5IA 3O4HA 1RU3A 2KM1A 3P2EA 4Q01A 1ISHA 1DUSA 2AN4A 2OOKA 2V7EA 4CV1A 4M38A 1ABFA 2JG3A 2E21A 4TYMA 1GQQA 3IULA 1XXHE 2BSAA 1W0KD 2PX3A 2I91A 1N2CE 2OCKA 5I7OA 1T36A 1QOQB 2AMYA 3JVEA 4CQJA 2NNWB 4QC2A 1HDXA 3H1EA 4B0OA 5A2GA 1XU9A 4H4EA 4DL9A 1XA3A 1MB0A 1BO6A 1C3OA 4I55A 5FQNA 2PH5A 1QH1A 2Z2JA 3UV3A 1KI4A 1LW6E 1OYYA 2C4KA 5HIKA 1JLHA 4RH3A 2GBGA 3KQQA 2CDCA 1AN0A 1IAQA 3R5HA 3WNZA 2NO7A 4O2AB 1SQ6A 3O2SB 5DI9A 3UK2A 1ZFNA 1VL8A 3OX2A 3PEFA 1OZHA 3WL3A 1XZDA 2QE7A 2Y77A 3D6VA 4LY9A 4OJNA 4WN3A 2O6LA 1GR0A 4DQVA 1SHZA 2I22A 2IYYA 4FCTA 4COKA 4Z54A 3IDZA 2IH5A 1P1CA 5DGDA 4Z0NA 1IL0A 1HDYA 2AHRA 2PH1A 3PKJA 4GOKA 4TKUB 1VYUA 4Y67A 1K6MA 1TC2A 3L1JA 1FJXA 4LF5B 1N1MA 1PUIA 1UPCA 5D51S 5FAXA 2BGMA 3B51X 1TCVA 1TJ3A 3REGA 3DNPA 4BJHB 3TXAA 5KCZA 4HAVA 4J94A 1NV9A 3ND7A 3NCHA 2PTGA 3NBYC 1PJ4A 1KYXA 1GKLA 1I36A 5LC1A 5K3SA 3S40A 4LYDA 2FLKA 4LMBA 1WTAA 1JHDA 1T36B 4Q4JB 3IA7A 2VOJA 1NMYA 3FDZA 3ROMA 4IINA 1TEZA 1YS6A 4FSXA 1NOIA 4UM9D 2OORA 3ZWXA 4D6PA 1ETUA 1C3OB 3H1TA 1A7AA 3PQ5A 2P6OA 4H77A 4I55B 4IRMA 1UKEA 3IKMB 4H27A 1QH1B 5JCZA 3OLCX 3IAM1 3CR7A 4O4LF 3C3DA 1YZQA 4AMYA 3N59A 4BATA 4YXWD 3SVLA 2YZ2A 1W6UA 2AI2A 3EGEA 4LBVA 1N6LA 2AKAB 4OHRA 1DZIA 4ZYXA 4EHJA 3JD2A 5C5EA 3HA2A 5C5CA 2IVZA 2Q3FA 5GOTA 5J1TB 3VR6H 1Y1PA 1SG9A 2HWUA 3E15A 1XV5A 4LZJA 3TINA 4DBLC 1C9DB 4NS4A 1DFIA 1ZD9A 1NSFA 2GHQA 1NBME 4OJKA 3NHMA 4W99A 1ZZGA 4YT5A 4QPJC 4HAOA 4X3PA 1VJGA 2REBA 1THGA 2UVDA 3GCZA 4XQEA 3W34A 1CY2A 4C01A 1QHEA 5AI6A 1VCIA 2JIDA 1HL7A 2Y1DA 1D7OA 2GVDC 2YUIA 4J4HA 4GIBA 4BYGA 4E12A 3I01A 1DEAA 1VHDA 1KI8A 3PI7A 3GPCA 1DKRA 3TPCA 1PT7A 1GL7A 3LDAA 2ZIWB 4B44A 2VKTA 5AQ1A 1RT9A 2QPAA 3WLAA 4HVCA 1JI0A 4YAEA 2FMUA 3FDZB 4RL6A 3ADPA 2D7JA 4P3OA 1V41E 4CQLA 2J7PD 1ZOSA 2P4EA 1AURA 1NNI1 2C29D 5BQPA 1KH1A 3TQTA 3S81A 1T4MA 1KO4A 3LZCA 5IAOA 1S4QA 1JE0A 4AECA 1ANKA 3AJDA 3LQRA 1RM3A 1H0HA 2M2IA 3FR8A 4NH4A 4YQZA 5ESXA 3QELA 1U3FA 3FAZA 2E4AA 4H3SA 1HR0B 3AR3A 1HH4A 3KZKA 2B5OA 1CS0B 1Z2OX 5EXSA 5TPZD 1E6UA 2OZVA 4EVSA 2IK8A 5EVJA 2PHZA 2Q4RA 3VHXA 5HFJA 2FQ1A 5T8KC 4BGVA 2OP1A 1DQYA 2P3LA 4RQBA 2D1TA 1U3CA 4BWVA 4JROA 2BCEA 3PF8A 2ZVPX 3ZU4A 5GMOA 4FB4A 3IP8A 4KVZA 4LMRA 5B7QA 1AB5A 2GRJA 2WHRA 5CCDA 3TZBA 2NU9A 5CH8A 4DQDA 4GE0A 1ZU4A 3ZBTA 2J3IA 2WTMA 1N34B 1L9XA 2P0YA 3ZK8A 1NG9A 3AILA 4AO6A 1ICEA 1CHNA 1T0UA 2DT8A 4CQLB 4EMBA 2WT8A 2ZJFA 1OWNA 2H52A 2O8NA 1JFLA 4HUJA 4PGAA 5JT1A 2OXTA 1ZYUA 2OVFA 4ZALA 1CJVC 3H8SA 1GYRA 1DP4A 1ARZA 2B7CA 2YN4A 2F8MA 1HYGA 3HSYA 3WGUA 4KC0A 4A6PA 4DJEC 1QF7A 3CH7A 5A5VA 2EATA 2ZT6A 3U62A 4EFLA 4FGLA 4FU0A 2ZCUA 3K70B 3DHNA 4BV2A 5CVTA 3QELB 5FL3A 2PZAA 3FOCA 2J6CA 2WPDD 3DM5A 3C74A 2FLWA 4UBJA 5C3MA 3GXBA 4WY2A 4FK8A 4MV8A 4NQRA 1XUOA 2YVAA 1PBTA 2PBFA 4NFHA 1XLUA 2J5RA 4S1WA 3CVYA 5E38A 3LFTA 4EPXA 3U3MA 2IPAB 1XU4A 3LF2A 1DKQA 4JEUA 4TMVA 3WYBA 2JLVA 3PHIA 4FC7A 2H31A 2QS9A 2VI5A 4YBRA 4DB2A 5AXAA 4F5WA 2BEVA 4RELA 5M29A 1HEIA 2YUTA 1I2BA 1MOSA 3P0IA 4D4KA 1GRRA 3LP6A 2ZWOA 5D5HA 5FTMA 3W5IA 2NU9B 2HF8A 2JFPA 4AL4A 3BL6A 4Z4GA 4XASA 4RABA 4MA5A 4LF6B 1VBFA 4LF9B 1GQOA 1XZ8A 2HK9A 3QVXA 5KKAA 2GWRA 4TYYA 1XTJA 3AVOA 2Z8XA 4MA4A 4TLAA 4CCAA 3SCZA 4K9MA 4IV0A 3PX3A 1MJFA 4MKHA 4BZXA 1B8NA 1PBNA 1M0TA 1PL0A 3PXDA 5DHFA 4BEVA 1CWUA 3B2EA 1RPZA 3WLHA 3ROKA 2LGJA 2WKWA 5C5DA 5CITA 3T94A 2JIZA 3OOJA 1I5OA 3ANMA 1PWHA 3Q87B 1Z6TA 4N3CA 3DOFA 1PTKA 1UJ5A 1Z7GA 2QAGA 4YY3B 4IZ6A 1RWWA 1UH5A 3TJZA 4CV2A 4N8DA 5A4DA 2YNMA 2Z43A 1L5FA 1WZUA 4PRKA 1VSBA 2PIAA 4EHIA 4JLNA 2AYYA 3OOHA 1QO0A 1O8CA 1NN0A 2JI4A 1R8QA 4WEOA 1TYBE 3E3MA 4LY6A 5JS2A 4EJ0A 1K6JA 2ZJ8A 3PLNA 2QB5A 3PB3A 3R0XA 4HLUA 1FUEA 3E9QA 4JP1A 3JYNA 4YIKA 3PENA 3NJRA 2Z57A 4F5EA 1M2EA 2W7TA 1VHTA 2QTLA 4QULA 4HXYA 4YR7A 5HEKA 4WRRA 3H9QA 3BICA 5AW2A 1W5EA 3RD5A 2C1ZA 2JIPA 4RS3A 3VAZA 4YT8A 2OWEA 1E4YA 3IEPA 1ZHFA 3N58A 3O4JA 2QQGA 1VTKA 3GJ3A 4KRGA 1IUNA 4RPCA 3PQ3A 2WU4A 4RUKA 4UHJA 5E7IA 2P6MA 2YFHA 2X7XA 2J09A 4Y6QA 4AY2A 1E6MA 5ALJA 2V3VA 2QLMA 1EX1A 1K8XB 2J4DA 3KE9A 4G0ZA 1IN6A 3L05A 5I7AA 3DDSA 3RVBA 1O97D 1O5TA 1GYQA 1S2GA 2QAGB 3DB2A 1PK8A 4G67A 3VUFA 2F9LA 3UT0A 5FLEX 4IZOA 1S1MA 1GGEA 1JXMA 1NVWQ 1V9CA 4HZGA 5FRDA 2WM2A 7REQA 4P4TA 4B2PA 4D3SA 2DWUA 3JZMA 4JX8A 2R00A 1PV1A 3S3TA 5M34A 4NYIR 2AXQA 1OXSC 1J0EA 3M6LA 2QMZA 1XHLA 1A5ZA 3IT2A 2QN6A 1JJVA 2L82A 1GU7A 5EA2A 3UGKA 2Z5FA 3DCJA 2Y05A 2IYPA 1M2WA 1NN5A 2IJGX 3KHTA 1YVEI 3QFSA 3GI1A 4G24A 4QUHA 4OGLA 3VZPA 5IZCC 2HV8A 1GZ5A 3F6CA 3IAAA 3NBAA 4GXQA 3CLKA 4O1IA 4TMZA 4A03A 1PP4A 2PKXA 1V6CA 2G9UA 1HDCA 2IXFA 1KDRA 2R6FA 2XVAA 3L04A 4MR8B 4MV7A 4S3MA 5AI8A 3QF7A 3MCTA 3U3DA 2SNIE 4HNTA 5JXGA 2OESA 1YMQA 1I32A 1LTKA 2A1TR 1O9HA 4AJLA 4R81A 4P58A 3MWYW 1Z13A 2FN3A 2X4LA 4RFSA 4RD1A 4Q3BA 1LNQA 2G9QA 2BTQA 4KQEA 1J09A 2C2ZA 5L7YA 4XSHA 1YIOA 3D81A 1UBFA 5BXYA 2E5FA 5H3CA 5I47A 2WG1A 2GCGA 1A9YA 2Z9CA 1SU4A 4ER5A 1FP7A 1NXQA 2HIAA 3NT2A 4F2GA 3ZD6A 4LY0A 4B4DA 2I1LA 1RJ9B 3I52A 1E9DA 1HWYA 3MGBA 4MW5A 1FB5A 4WSOA 2ZYWX 4ZOCA 4Z0TA 4PN3A 4QT4A 5ADUS 3CSSA 2F9FA 4O08A 3WP1B 5EGSA 10MHA 2CN1A 1SB9A 7REQB 4F56A 1NAHA 2R97A 1K7SN 3OPYA 3QOFA 3QUSA 3TZKA 2DFPA 1TCCA 3GAMA 1W85A 4R41A 3OPYI 4O4HA 3D3EA 1U2DA 4IR7A 5DEOA 1XCLA 4B79A 4C4OA 3F5SA 3HXKA 1AKVA 1VI6A 3RODA 5ELXA 1XG5A 1OZGA 5HKKA 4F3NA 3OSZA 2XA1A 2H2IA 4HB4A 5BNZA 4UBOA 1T2CA 1X7DA 3FB1A 4D02A 3MUOA 4OF4A 3IP9A 3U44B 1B41A 2FF5A 2Q5LA 3WSTA 1YF3A 1L7EA 4RYDA 1K27A 4XPIA 4IQ4A 2V6GA 4ZXFA 4D6YA 5BV0A 4I9UA 2VHZA 3EMKA 4DC0A 1JHYA 4IEEA 1KOJA 4RFSB 3SHWA 1NUTA 1LI7A 3MN1A 3OQ6A 4HO1X 5EG5A 2UUCB 2BTQB 5K8TA 2CLOB 2JFNA 3BTOA 1FSZA 3N86A 2RB5A 4LDJA 1WULS 5HDQA 3FPHA 4M55A 4JGIA 3ZE0B 2GMWA 5C8DA 1OKKA 2BF4A 2JZOA 2WJVA 3G17A 4QPDA 4YDRA 1P5HA 2AXNA 4C6HA 1SKYE 1Q2UA 3UAWA 3QGMA 2D5BA 4ZYUA 1X92A 1F4VA 3L4SO 3OA0A 4GX2A 4R51A 4HBGA 5GQSA 3GDGA 2VPZA 1JDSA 1Y48E 1UL1X 1C8KA 1ONBA 3OPYB 5IEJA 4PBTA 2FP3A 1SR8A 2LBPA 1S3SA 3G2NA 1W85B 2W2KA 3QA3E 2NYVA 3DTVA 1WY7A 2BM0A 2WF7A 1R18A 4YASA 3RUAA 3F4BA 3N28A 3H16A 3QUBA 2GUWA 5T4FA 2G7MC 2LUOA 2FMKA 4CN9A 3GP3A 1G8SA 5JD4A 4OHVA 1FPMA 1NZFA 1RHKA 4YV2A 4W82A 1J2JA 2R5NA 3HB5X 5K2MA 1Z2AA 4EKIA 2PD3A 3DE3X 4F71A 5AVYA 4XPIB 1TAGA 3SS9X 1QB7A 3L0BA 2JLCA 1OIWA 1C14A 3DGEC 4LBYA 1YCFA 2G67A 5TMBA 1YZUA 3HXOA 4LF4B 5DT9A 5JHHB 3FDFA 1M34A 4TRNA 2QM0A 1XCOA 5ALXA 2QUBA 4NU0A 2XF2A 4BMVA 3V1KA 5IAGA 1XTIA 4QOJA 2BY4A 3ND6A 2OM2A 3OPNA 4TT8A 1VBMA 2ZVDA 4TKVA 5IN4A 4R1SA 1J25A 2VDUE 1DEOA 4J7CA 3HVHA 4EUSA 3PFKA 2B4TO 4D26A 3IJ5A 5CDTA 2ORVA 2HMYB 4OBEA 1T4BA 3EEBA 3VHQA 4NZYA 1COWA 3B9QA 3I5YA 4HQRA 1D2AA 2PMEA 1AU9A 4FUTA 4NOJA 4ZK6A 1KRHA 2JJ2D 4M6WA 4ZT2A 1Z25A 3NWJA 5CJJA 4BZZA 2ZETA 1E64A 1L7AA 3JAKA 2IWRA 2JRCA 1A76A 5KO2A 3TLYA 3NMUF 1Y6RA 4DBZA 2HRDA 1KMCA 3K05A 2DCUA 4JWKA 1WCYA 3GNTA 4P82A 2IUEA 5JZBA 4OXIA 2Y93A 2AB0A 2IHKA 1UJ4A 3TM4A 2VSYA 4IXNA 4CM5A 5CUQA 3EPHA 2CJFA 3GYGA 2YV4A 4MRMA 4R2MA 4X6LA 3MQ2A 5LA6A 2V9ZA 3RUIA 3VU0A 1I94B 4PSKA 4OLAA 1VJ0A 2ZZMA 2TMGA 1LV8A 2QY6A 2VK8A 1O94D 4I1OA 2A88A 4FI3C 3JPWA 1NW7A 1TD9A 2IV7A 4C4AA 1N57A 1M34B 4Q1DA 4KHPB 1PU2A 1XZCA 2FW7A 3TECE 3EDYA 4PZAA 1Y3HA 4B40A 1B1CA 4BO5A 4I1YA 3M5DA 3P71T 1C1HA 1TRHA 2IYXA 5G1PA 4QX6A 2C2HA 4WDQA 3H87A 1E7QA 2IPMA 2BMJA 2K2QB 4Q7JB 4F12A 5IANA 2X3YA 5EIEA 2HMAA 4UVDA 1LTHR 1ZIYA 5I5GA 4EY6A 3K70D 1A2QA 3NORA 1ECFA 2GK7A 1H2EA 1MABA 3HI4A 4KI7A 3NB0A 3FDJA 3EIXA 4B3FX 3PTZA 1XTBA 4IGAA 1ZDMA 4M6WB 3QKTA 5E9AA 3ZE6A 4CYMA 4M0DA 1HYEA 1SOVA 1WXGA 2IRWA 3JAKB 2C2WA 3KL4A 4OJYA 4UVGA 1SELA 3VTFA 1LS6A 3FSEA 1NIJA 3PD7A 5EXDA 4FT4A 5E9WA 1N0IA 3PQDA 4A0HA 2Q4TA 1TAQA 3MJTA 1BEUB 1MC4A 1JS1X 5DSTA 4MRMB 5LA6B 4YRFA 1K68A 2COUA 4EL0A 2LPMA 3R6GA 4EA9A 3E0QA 3NBMA 8LDHA 4DCCA 4TV9A 5EIBC 4V03A 1ZCAA 2CJYA 4G8CA 1SEVA 2Z4TA 5C1IA 2UU9B 4Z7OB 1HBJA 3NHYA 1R6BX 4DR7B 1AHNA 3OQIB 3QMMA 5EWLB 5DO9A 1VLMA 1TZMA 1XMJA 2HDOA 2LD4A 3RHZA 4ZEVA 1QONA 1T5BA 5BW6B 3UIEA 4ZI7A 3JQBA 4GLFA 1T3HA 3U4GA 3G0GA 3EOZA 4DC9A 1RI2A 4NS1A 1DDGA 3F3YA 1ILEA 3VYRB 1ZGHA 1MABB 4J0FA 3HC7A 4Z4HA 4DGSA 4E2FA 2INGX 1FDOA 3SQMA 4B6OA 3WFIA 1V3UA 2ESRA 3BFPA 3WB9A 4JH0A 4DSTA 5I7FA 2GXQA 2DXIA 1DELA 3P2MA 2R6AA 2WYHA 4U2GA 1PYGA 1J56A 1W75A 3DEAA 5BMVA 1SCBA 2FR8C 3SC4A 1XROA 2PXHA 5CXXA 2RCYA 2VP0A 1E9AA 2EWMA 4RH1A 3U7QA 4MI6A 3HJTA 2CE7A 3L7AA 2C97A 3ICPA 4DR2B 5EKSA 1OE0A 1XNGA 2F8LA 4GPBA 2YC4C 5DNVA 1PNRA 4ZAZA 3U26A 2XY4A 4F3YA 2BOVA 2AW5A 2QOEA 4HTAA 3V6LA 5KJCA 5C9ZA 5LB4A 3EXG2 4XM2A 1IPEA 1KSGA 1BWQA 4Z9BA 2YV2A 2Q4DA 4TV9B 3R7DA 3VU3A 1RCTE 2HA0A 3TL6A 1M5UA 1E2GA 1UWKA 1A72A 2R8PA 4HGZA 2D0IA 4MLDA 4BU1A 4F45A 4D98A 2HSDA 2ZRAA 3KDPA 4B6FA 5U4QA 4R9RA 4ZI7B 3JTEA 1LQTA 5B3LA 5EJEA 1SXJB 2E82A 2J48A 1GKIA 3N6RA 3DOUA 3MCUA 4ZXPA 4HCJA 5JVDA 5K8UA 1V11A 5ADVA 3LQ2A 5JS1A 3KKEA 5IM5A 4BGDA 1E4VA 1WZNA 2A7XA 4G8DA 4RX1A 3TLJA 1NY6A 3WMEA 1RBYA 1ULBA 3QTTA 1B6GA 3RSGA 4B82A 4QM6A 5JH7A 2VDWB 3U7QB 2E5WA 3IDSA 5HJ7A 2YN2A 2C5AA 1OY1A 1KH2A 2AV6A 1PL7A 2G1AA 2V65A 4I9GA 4RCZA 4RJIA 1OTXA 1VE6A 2CXUA 3FFWA 1QP4A 1ECCA 3C41J 3LDFA 4ISBA 5HCUA 2PFGA 5HFNA 1LCIA 2XADA 4MWSA 4O25A 4B3CA 1Y6QA 4MAFA 1AKQA 5C52B 4OXYA 2RH4A 3PJGA 4GZ3A 1Y82A 2VIIA 4JI6B 3TMAA 2YRWA 4U2DA 1O6FA 1UXOA 3K9LA 3VYWA 3ZKWA 4LOJA 4OSEA 4ZHQF 4L5CA 3DB1A 2FZCA 3BREA 4N65A 3E3AA 2YDYA 3GEHA 4QOGA 4E0BA 1SVUA 3UWDA 3VTAA 3KAPA 3L46A 4RTSA 3KJIA 3WYDA 3MBIA 3ZWKA 1IXKA 5HZMA 4WESA 1XFAA 1WQ1R 1MAVA 2RAVA 5JVDB 1E59A 2C2BA 2ZIUB 3NU1A 2O54A 2PLRA 1V11B 3T3GA 2X0FA 3UWMA 4B3DA 4CQMA 2WIGA 3Q85A 2NP6A 4QGSA 3U0VA 2HGZA 1GG8A 1G5FA 4X90A 3ZJ4A 2WKSA 4HUTA 1AQIA 2O5EA 1F3LA 4GUAA 2Q5FA 4HGPA 4Y2PA 3BDAA 5JH7B 3HKCB 4EA8A 1G5QA 1Z28A 1NQTA 4LOHA 4NCAA 4OHZA 4N0QA 1N9GA 2G6BA 2FEOA 2C3YA 1NUPA 4XVHA 2ZSAA 1GT91 4WLVA 1KQOA 1FNMA 3G13A 4TV8F 2I2XB 2IZOA 1WAMA 1MTZA 1L6RA 3A4MA 4PF1A 4ZOEA 2XH8A 3RC3A 1B73A 2ZRBA 2GXUA 1AQYA 1VMAA 2Y92A 3D0RA 4NU8X 4CV3A 1LLQA 5DHUA 1TM7E 4RVHA 3ZKWB 2NZWA 2D1FA 2WRZA 3E58A 5LQDA 2CFIA 2MJLA 2N1BA 2G40A 2YMLA 5K0NA 2HQRA 4E30A 3CEHA 1QU3A 1R5BA 3AIIA 3WLEA 3H3JA 5T8KA 1TTHA 4D8YA 2YFYA 1D0VA 2YWRA 4MWEA 2I8AA 3ANLA 3QNMA 4QBGB 2GHTA 4H0CA 4CQMB 1P80A 1LFAA 1E79D 1YOVA 1IPFA 2CL5A 4BB6A 1RS0A 2WJHA 4EUEA 4TT3D 4Y18A 4D0SA 2IKSA 1DV1A 3CW9A 4JITA 4LOIA 5JSUA 1QKJA 4NENA 2NUTB 1PR2A 3QMPA 4KDFA 1MEOA 4ZRNA 4BRWA 3QU7A 4BQIA 1AMNA 1W4ZA 2O4UX 3E9RA 1CEYA 3TOXA 1N9GB 3HJNA 2G09A 3KKOA 4NHEA 3VDNB 4EHAA 4LDPA 4DSAA 2H8KA 1X2BA 3OZFA 1H6DA 3UICA 4MW1A 4TUYF 9LDBA 2A6PA 5IP5A 2XKAA 3DPIA 2W0SA 2B36A 2XCQA 5JV5A 2N47A 1KK2A 4WH0A 1QR2A 2YVQA 2PUWA 2N3ZA 2OY0A 3E4CA 4O29A 1Z4NA 3RNLA 3EVBA 4OK6A 1FBTA 4OP1A 5CCXA 2HMWA 2BHRA 3EVTA 4PC2A 4QRDA 3GAZA 2XWPA 2BP7A 2GJ8A 2ID9A 1VPEA 1JL3A 1XMPA 1SJ9A 2PK3A 2Q5IA 4BVGA 4JELA 3SFTA 3DXYA 2A0KA 1OGYA 4E07A 4ARIA 1FRFS 4TRJA 3G7NA 4GF5A 1Q1EA 1V7CA 4MVJD 4JT8A 5EJ4A 3THSA 3ZWBA 4HAWA 2B5WA 3T5PA 5C7IO 3GFVA 3OHSX 3TLAA 3H17A 2Y1EA 2VPIA 5K09A 1YOVB 3FSGA 4HGRA 1I33A 1N8NA 2AE1A 4RZXA 2P90A 5BWLA 3AETA 4F6RA 4NENB 1C4OA 2I29A 2RC5A 5D01A 5KVCA 3CLTC 4CMGA 5LOVF 2IOHA 2OMEA 4JL6A 3UYKA 3L0ZA 5LJLA 1HETA 4DV5B 3AHFA 4RA6A 3LXUX 1MV5A 2H06A 4WBSA 5FTWA 2NO6A 3D8UA 3BCSA 3PT5A 1E9EA 2GHIA 4CT5A 3CYFA 1E1MA 4KYVA 3WGOA 1ZEJA 1IU9A 1CQIA 1QX4A 4GRIA 3MTIA 4ALMA 2B83A 1A82A 2RBKA 1R8JA 2QG6A 4HDRB 4TTAA 5D5QA 3RVKA 1X7XA 3PTLA 4JVNA 5K4HA 3M6VA 3C5WP 3T1OA 5BR1A 3GHYA 2QMYA 1RD4A 2BP7B 1GZUA 3EIWA 1XHEA 3JASA 4FHDA 4MUMA 3EZYA 3K6RA 5HBRA 3VVLA 3Q8MA 1XYYA 3P4XA 3DC2A 4I66A 2BFBA 3HDVA 1RLMA 3IV6A 5BVHA 4C07A 2EZUA 2V8BA 4BGIA 4G5RA 4DMRA 4YJHA 4HS9A 3DBHA 5ECYA 2P78A 2B3TA 3V8NA 4R9SA 3SM3A 4MWCA 4PPGA 1KJWA 3TLEA 3VTZA 3RSZA 4A8PA 5EQTA 3EWSA 1D6NA 1NYRA 3K71B 2XBMA 3ZE2B 4DPLA 3AETB 4F6RB 1I4EB 2C1XA 4M89A 5AQEA 2GLUA 4RLSA 2E1PA 3QNUA 1EVYA 1Z83A 3VDXA 3E9CA 2XPCA 1NMSA 4BN5A 4RA6B 3TZLA 4WLOA 3S8YA 1MT3A 1NBEA 4IGEA 1ZXXA 4MYUA 4P2BA 3HU1A 3WBFA 5B2EA 4M0PA 5ALLA 2HCFA 4CCWA 3RASA 4OA5A 1RMQA 2QN2A 2YIJA 1P5FA 4M76B 3UV6A 1XZHA 3W7VA 4B2IA 1NW4A 1YB7A 3BQNB 1TZJA 1FP4B 1M0SA 2GPAA 4OMUA 5BRAA 1IXYA 3HCOA 2DHDA 3AL3A 3B6MA 1KERA 1GN9A 5M3BA 3HY3A 4WOBA 2ZR9A 2CB9A 4CTMA 3TM5A 5FBVB 2C8JA 3BTSA 2BHSA 1PEKE 2O1SA 4II3A 4UUOA 5AJHA 2D1RA 4PYQA 4I2NA 4YJHB 4EKEA 3DBHB 4OLJA 1NUHA 3GARA 3HEAA 1ZJJA 2JJMA 5MN5A 2QTVA 3DZHA 5JBNA 3EOBI 4Q9IA 1U8AA 4MR9A 3H4MA 4W5NA 4BLOA 4G4GA 5HE8A 4NOKA 2FMXA 2W5UA 4C7BA 4ERNA 5DM70 2FW1A 3ZOKA 1QZZA 1ZI9A 2QSUA 4EHBA 4ZKDA 1KY5A 3REOA 4F3CA 5CM9C 2IS6A 4D5EA 2YYYA 2E0IA 1RHMA 1VXRA 5IZCA 2A1IA 1XDSA 2Q1TA 3ZWDA 4RK5A 4Y9UA 1G9TA 1GTJ1 1ID1A 1P60A 2QUJA 3WLOA 3I58A 2PPLA 4M0FA 2Q5JA 3RAJA 2ZBFA 1E6EA 2XA9A 2HPAA 3TVDA 3HDJA 1QDEA 2PSSA 1NF9A 1D9XA 3ZR4B 1A69A 3HP4A 1UFOA 1BNCA 2A9KA 1U1EA 2B35A 2BW0A 2Q6LA 3LT0A 3MUEA 2AQ8A 4XGIA 4DOMA 3LVRE 3DMNA 3DWIA 2Y27A 4E1AA 1H1LA 3FNQA 1R8XA 1Q7GA 1IZ8A 1GCGA 2C54A 2A9VA 2H5LA 2ZUTA 2REQA 3GJXC 5GOZA 3RADC 1EGAA 3AFNA 1YA8A 5G0VA 1PV4A 4UM5A 2GK3A 2C1EA 5E1MA 4E11A 1LB1B 1JDBC 1ADJA 2V03A 4HX9A 2JGLA 4BUCA 1ML3A 2NXNA 4MR9B 2FMTA 4FGWA 3V2HA 1V1RA 3UY4A 3NHAA 3VNAA 4E4RA 3ILSA 4OOEA 5C3UA 3RVQA 4LJ5A 4NIMA 1PEAA 1P8JA 1SXJD 2FYTA 3AUTA 2KE5A 1ZIPA 1YQWA 1C9NA 1SG0A 1WXWA 1XZJA 2HA2A 3C6BA 1USUA 2GZ3A 2PXCA 2FHSA 1UQRA 3F67A 3ONNA 4ON9A 4YRDA 5DK6A 2VA8A 4YR9A 1M6NA 1WUKS 3D0KA 3F96A 1BEZA 3M89A 4LQ4A 4JYAB 1JJ7A 1HNNA 1EFLA 1S3FA 1UMCA 1DXYA 1LBTA 1L5VA 2JIMA 2VCYA 1GU0A 3AEYA 3FLEA 4WZZA 2FOLA 3ZD8A 3ZQKA 3KLNA 2VK2A 5IZ4A 4Y2UA 1HURA 4Q3KA 3D4LA 1N3IA 2IYVA 2V7PA 2VWQA 3DQQA 4LY3A 4MQ5A 2OBBA 3HPQA 4F7DA 2QN3A 3QH4A 2VK4A 2WIFA 1UDRA 3H1AA 5DZSA 3VH4A 5K8LA 3W4IA 1XTTA 3H5OA 4OBBA 2BGIA 2I03A 1CJCA 1IQRA 1DQZA 1SU8A 2E48A 2OGWA 3IPXA 3JQ7A 3DO5A 4PFJA 1H3EA 3PQ4A 5E3HA 2VP2A 1E1QD 1NIPA 1QFSA 2ZJ7A 1R12A 4RVFA 4UCFA 4OL9A 5IULC 1SVMA 1PQWA 3OQVA 3H75A 4Q37A 3B3FA 4E6PA 3KAJA 4XRGA 1JBEA 3ZJTA 3L43A 1JNXX 5JBIA 3IL2A 1EUYA 2REQB 1IHYA 1YHYA 1PJCA 4OH1A 3PKIA 5CLIA 4AK9A 1Z7WA 1L8LA 1NKVA 1SCJA 3GA5A 1V1RB 2GR9A 4KQIA 4NR0A 4TYPA 4BQOA 1Z0DA 2EZ4A 1B0UA 4X65B 2LRHA 4XW2A 1BCRB 4M1EA 2GEJA 3R8XA 4YT2A 1LI5A 1SIBE 3HBLA 4ROTA 3ZZTA 2JGRA 3KD2A 3ULKA 2HWYA 5M04A 3I6BA 2E4WA 3P9RA 3D6MA 4JJFA 5H0IA 1NQXA 4TS4A 5BWMA 3A2MA 1NMQA 4OQDA 1NMXA 4XDHA 2Z1DA 1UMCB 2ERCA 2V9CA 1MFPA 4C2AA 1JBKA 4FYVA 2XCOA 1SK9A 3MC1A 2YJGA 1ZMBA 3INRA 2ZRPA 3QFRA 4L4UA 1J2TA 4G97A 3ENZA 2PZGA 3EYWA 2FR1A 3UG6A 4MUEA 2WI8A 3KL2A 1Y1KE 1ULTA 1GLGA 3IP1A 4PZZA 4IEFB 3D1JA 3JQ7B 4PIVA 1KZHA 5EMJA 4NE2A 1DUVG 3IXQA 4RFLA 1C9KA 1GPUA 2DG2A 2W2VA 1G8AA 3AV0B 3HWSA 4I4NA 1HZZA 1Z5OA 4P5DA 4RWEA 3RTCA 4BKOA 4PAQA 5JRDS 3SQWA 3UUWA 1IONA 2DEUA 2Y9MB 2C4TA 3LKVA 1V3QE 5EYPB 5AW3A 2ZPAA 3QSYA 4V1CA 3H9CA 1RWMA 4RGQA 4IUDS 4XD7A 4V1CI 3HDYA 2H1OA 3VPBA 4OOFA 1OD6A 1AMUA 1NSTA 1PJAA 1XRQA 1SCQA 2KB0A 3LO8A 4KE7A 1ZHOA 2OFWA 1HORA 1T1RA 2FK7A 3DHEA 4BVBA 3CU5A 2X0KA 3NYQA 1I7NA 4XJVA 1MW8X 4IG9A 5IH3A 4JBWA 3PR1A 3BXGA 1NMZA 5MFPA 2F3TA 3BORA 5BYAA 5JNSA 2CUTA 4UCWA 4YP6A 2P1RA 3AVYA 4OFXA 3NEPX 4N3AA 3D31A 2VDPB 3ZDFA 1D6JA 3EXHC 4LJYA 2CXPA 3MRTA 3M6WA 4MNTA 3INYA 4NRDA 1XQVA 1B26A 4ARUA 4X20B 4K7JA 2LXNA 1LLDA 4PYOA 2J85A 3FN4A 4RD2A 4TKMA 4X97A 1Y6GA 4B3RB 2AG1A 1C4WA 4Q5IA 4GHWA 1LKZA 3O8LA 3IPCA 4UQPA 3R7BA 3P2JA 3RC1A 3WJAA 5EJ5A 1U3DA 2PUHA 4R7TA 2D1SA 2JHCA 1FZQA 4IIJF 2SKDA 1WUHS 1I3CA 1RRMA 4V1CB 5K7SA 1KKLA 2VP9A 5KZMB 5TEWA 1YR7A 3LCCA 3BRQA 2Y0BA 3WZLA 3ANXA 5LNK6 2K7FA 3GJTA 1ZBDA 1LV7A 2Z58A 1GU1A 4RD3A 5BW4A 1PWXA 5TY0A 1N2CA 3L7YA 2EX0A 1NVVR 2RSLA 4F91B 1JR3D 4RJLA 4S0XA 3S7ZA 4YUYA 1PNVA 3V4OA 3QA9A 3PNSA 3OF5A 5HZGA 1VRWA 3THWA 2BFWA 5CNIA 1EFPA 1Z4QA 3N2NA 4E33A 2PSDA 2VZ0A 4U8GA 1NW3A 1XYGA 2VDOB 3O91A 5C7YA 4E7OA 2HBQA 1J8DA 5DLEA 1K6IA 1SA0B 3U80A 1JQKA 1ZC3A 4ARBA 3EPJA 1A96A 3O0DA 1Z73A 1KC1A 1PJ8A 4JX9A 4ZYTA 5EZQA 2G76A 4QREA 4QTZA 4RTRA 1FU8A 1L5SA 3RCBA 1NAIA 3MMSA 4L02A 3ZNNA 3D4NA 4JUDX 2ODNA 1VDMA 2B98A 1U0OC 1XDGA 2NU7A 3PCTA 4GI3A 4WWHA 3BGOS 2YFKA 3OPVA 2VCHA 1PZMA 3NI2A 4PHGA 2ZR8A 2OBNA 4ER0A 2Q1SA 1D2CA 2V6MA 3JQQA 1N7HA 1JEYA 1E8MA 4Q1VA 3V4ZA 2O9JA 4W9MC 1SXPA 2FR8A 3QFCA 1FXWF 1XXHB 1X7YA 5AJVB 4YCMA 1N2CB 1L4MA 1Z62A 4P80A 1ZMXA 5IXYA 4FFMA 1J99A 2NZUG 2QMUA 2VG8A 3OH8A 3EIFA 2BGWA 2RG7A 1B42A 4RIFA 3ITDA 4EW2A 3K1AA 4I6EA 1MX3A 2QTAA 1GTVA 2QVCA 5LXTA 1EFPB 1LLUA 1TK2A 4NBVA 3U9TA 3U60B 2ZSEA 3M82A 2GYUA 4N5HX 3S7TA 1E5XA 2H1FA 1ZVQA 2HJHA 2OECA 2HAEA 4OG2A 1UC9A 521PA 1S1CA 5CX1B 4ZVLA 1MU0A 4RESA 2ZYAA 1PGQA 4URZR 1CFJA 4P3XA 3AY0A 4N03A 3DP7A 3TK1A 4M53A 3N0VA 4BFLA 2DQ4A 4E5DA 1JIKA 1XVTA 3PWTA 4L7QA 1NBMA 1CR0A 2B4RO 2NU7B 3HDQA 2JBAA 3NIWA 4GUDA 3ZV5A 3UT5A 4NBTA 2X5JO 1JG4A 1Y4DE 1DOHA 5TMPA 4YPOA 3LPNA 3C3AA 1JEYB 4H2DA 4XZ3A 5JR3A 2GB4A 5F64A 3NDBB 3DLCA 1HDOA 1QANA 1QIFA 4MI9A 4LSWA 5FJJA 2WHPA 3GRYA 1K3TA 3ROXA 5H8WA 1LRJA 1A9OA 1P77A 1PX0A 4J4TA 3RB8A 4AT1A 3P9ZA 4C6TA 2J9FA 3TRKA 3ISTA 3I2JA 2FWBA 4EA7A 4EY7A 4J1QA 4IUCS 2H59A 4IAOA 1HE1C 2HN9A 4OGWA 3G5UA 4RD4A 3SG0A 1E77A 5LXTB 5JU6A 1DRUA 2A5YB 4QAJA 1PT8A 4NMMA 1GRNA 5CIWA 1B8VA 2ISQA 3L1HA 1LXCA 2JVKA 3IJRA 3MSXA 3VC1A 4UNNA 2J67A 1ZHHA 4ZVPA 4D9HA 2HJVA 3RFXA 5B7GA 6AT1A 5M5BA 1YMUA 3FOEC 1YT5A 1ECLA 4LQLA 1XE3A 1E66A 1NLYA 2Q21A 2XUAA 3X1KA 1U99A 2HRRA 3BB1A 1O0CA 1CV2A 4LVUA 4I81A 2VJBA 1KYZA 1KNXA 1YDFA 1OC4A 1TMKA 3G2KA 3QG1A 5B37A 4DA8A 4KAXA 2NO0A 4UDOA 3SI7A 4YAIA 4IXDA 2YXLA 4ILEA 2F6RA 2VBFA 2C59A 3KIPA 4XUDA 2FFBA 1NNSA 2JBAB 4LZOA 4PLCA 3UT5B 3L6UA 5BRJA 4JBIA 3FHOA 5CLFA 2Q3CA 2RHRA 4FINA 4KXQA 4DRYA 3OEHA 4J0QA 3WHKA 3KR2A 4MEAA 1OXKB 2Y1GA 2ZQ5A 4ZOLA 1FQWA 4DMCA 1DC6A 3FR7A 1RAAA 3ST7A 2VQ3A 4G5XA 5DTEA 1QYWA 2YWFA 2R8YA 1QJ4A 1C9YA 4JYCA 4KDEA 2WB2A 4LJSA 5CDFA 2QRNA 4AZ3A 2KBFA 1DFGA 3CPHA 5K51A 4EEXA 1II8A 1O96A 1EE2A 4LN1A 3OM8A 4LHSA 4QG3A 4BB5A 4B1FA 2C78A 3JWPA 3ZLJA 3L7OA 4RHEA 2ZUBA 3E48A 5FI1B 3OX4A 1HG1A 4DCJA 5FTKA 4ER3A 3B1FA 4XYMA 3H4VA 1ODIA 3CIOA 3ZJVA 1Q1BA 1UIRA 3NT5A 1SUBA 8AT1A 5DTMA 1FU7A 1V7PC 3NIGB 3NEYA 4MW4A 3F73A 2H7VA 4RU1A 2NW6A 1FMJA 3R3HA 3EB9A 1JMYA 2NYAA 2R4UA 4OGFA 2YJTD 3W2FA 4MQ6A 3ZHBA 4FMPA 5DOVA 3MYYA 5AI5A 2Y0PA 2I71A 2NAFA 3OLVA 1AT1A 1PT9A 3L0CA 4NATA 4NJEA 5LDHA 5GTDA 2ACKA 3U61B 3BVPA 3RSLA 2J30A 2J6BA 3W8RA 4EEKA 1Y81A 1QCYA 1SB8A 5AVRA 3PUKA 2XZOA 1NF2A 5FTJA 5JXJA 2JD2A 4O2AF 1TCUA 2CVPA 3O21A 4HDMA 3LX4A 4UUPA 2AUMA 2C84A 1CDOA 1HG0A 3AUAA 5FNVF 2AT1A 1YZGA 1DQPA 4AZ3B 5BSFA 3E6AA 1IZYA 1II8B 1O96B 3TKLA 3A6EA 3WAKA 1H4QA 5CFMA 4E3ZA 1QV7A 2ILVA 1EWTA 2XMDA 4RPHA 1IMJA 5A3JA 1DAIA 1L4NA 1LPAB 4FE4A 3I8SA 3IP5A 1XR3A 3LBFA 2DZDA 4XOIA 3RVMA 2AD5A 4EHLA 1NQVA 1FUKA 2YASA 4MO2A 1NE2A 1PYDA 2YHIA 5EXEA 3RE1A 4YIHA 1HDRA 3D4BA 5C53B 2CMGA 4RTOA 4F4HA 4HEHA 2C9YA 5KQSA 1NZDA 3DZDA 2LDBA 3L7JA 2HWWA 3MWJA 1NXWA 2GD6A 4BUZA 2VAXA 3CLRC 5L40A 2R1VB 2ONCA 4KQMA 1T2DA 3ORRA 1MJNA 1Z7YA 1U0JA 2OGSA 2QXTA 5DGIA 4B4OA 5AVWA 1A5BB 1HA3A 3EEFA 4G36A 4XIYA 1NJ5A 4TL9A 2TMDA 3T95A 3UJ3X 1G8GA 4WACA 1RLIA 3RS5A 1N6HA 2WEKA 3HWRA 3U5ZB 3VI4B 5I9IA 2OYSA 1YZFA 4I50A 4UUMA 1HXHA 2RKBA 2R9VA 1THTA 3MF4A 2XNCA 1VYTA 4M87A 1P33A 3BGIA 3LP5A 3LNCA 4KWIA 4MIEA 4HDMB 1Z5UA 4TWIA 1GA6A 4YMWA 3EFBA 5T4BA 2IFTA 4FYIA 1IWPB 2J9XB 2JJQA 5FPQA 1WDLA 5IHPA 1AMOA 2Z9DA 1V4NA 1DKOA 1MP0A 1TAHA 2GFIA 4EDFA 5IVHA 2X1HA 4ITVA 4KAFA 1L5LA 1ZMTA 4PQEA 4CKWB 4BLPA 1Q0ZA 3USCS 2XRFA 2AG8A 2OCLA 3PNBA 4HXGA 1Q44A 3FW1A 4KDCA 3FPBA 2GNPA 4YB8A 1IM2A 2YHIB 1SC4A 5HGXA 1OH7A 4FD3A 4L1KA 5IBPA 4F1KA 3WSVA 5ALPA 1RYFA 2V7XA 3LC7O 4RJJA 4X00A 5D5PA 1PQUA 2PRSA 1BWPA 1E2QA 5FCDA 3UJ8A 2FCAA 4EGJA 3B60A 1E5QA 2SKCA 2P40A 2WE8A 2XNHA 4E5YA 1FTQA 1LNSA 2A58A 1D2EA 4JJ8A 5K8CA 3KXIA 3PYXA 4WD3A 4Q3LA 1NVMB 4EK9A 4Q3AA 2VL7A 3FCOA 4FQ8A 2ZRDA 3H19A 3PS9A 2ODTX 1XJ5A 4V0SA 3PFBA 4FGJA 3QI2A 3RJTA 1WSBA 4IDOA 4BLUA 3CVXA 1P7CA 1WZ2A 3QBTA 5HIJA 1BKDR 4I50B 4R2WA 3UZUA 4YRBA 3IEMA 4RENA 4N3NA 2ETVA 3HDTA 3WIBA 4AJJA 2R1UA 1DPGA 4QELA 4R9NA 2PD6A 5F3RA 5AW5A 4ML3A 3JAWB 2IYRA 1M8FA 2HLHA 3K0HA 3WDLA 3LT2A 2VHQA 3AHCA 3LXXA 4D2IA 4DSUA 1DS6A 1XZGA 3BEOA 4AJOA 4X8LA 1F0YA 1PE0A 1HTWA 3LGSA 5EKXA 2DUJA 1DX6A 4D3YA 2PZ8A 4GZ5A 1HSZA 4ZP1A 1S0UA 5JISA 2O52A 2IH2A 2GEKA 1MX9A 1MO4A 1JSRA 3ZCXA 4OP2A 4EVIA 1XL1A 3ER8A 1B93A 3V4FA 1DINA 1XCBA 3KWMA 1Y1TA 4JEIA 4KSYA 1NXOA 3D5QA 1WMEA 5AWFC 1B43A 1JECA 4V24A 3GEDA 3TOVA 2ZTSA 1W2HA 5TVKA 3SY8A 4YDSA 4AD8A 5DTIA 1CUFA 3AF1A 4RMHA 5ALYA 5IAAA 3W7BA 4MW2A 4V0KA 2WP0A 5KQLA 5F2KA 2XECA 3ANSA 3FYUB 1SHTX 2Y9PB 3QLJA 3H65A 2HM7A 1WDMA 3WBKA 3K15A 2GDZA 4G81A 1QX3A 2P9HA 2X8AA 1U9ZA 2GT1A 2VDRB 3EF3A 2PJZA 1U80A 3LY9A 3HCBA 2NPFA 4YH1A 1U0BB 2O3TA 1YJXA 2W6JD 2HCTA 1K4YA 2K87A 1L5ZA 3NAGA 4M8IA 4XQ0A 4O3FA 4M1YA 5DW3A 4C0LA 1MOPA 1UJ6A 4UAVA 5KTSA 3EUFA 4KEAA 2E1RA 1A9TA 1NJSA 1NLZA 1TZKA 1E58A 1SOMA 2F00A 5HDBB 3PXCX 3W0LB 1IHDA 4IFEA 4TLBA 3VKWA 4KR7A 4W4TA 5LN1A 2E49A 3GD7A 2HJGA 2RFLA 5CB4F 2Q28A 2ONKA 5CHYA 5I7WA 2O8FA 3OM0A 5C4MA 5AK5A 1P75A 3P4YA 3PGXA 3ZE8A 1SPXA 1ZGAA 3F46A 2VHJA 1G41A 5JG7A 2WZDA 4P9NA 4CDRA 5GJBA 4AJ4A 3RYFA 4M98A 2A57A 3R6DA 3RT1A 4DLTA 1UODA 1U7WA 3L6EA 4RJ2A 4RY8A 1Y4AE 4LHZA 3RUCA 1T35A 1DBRA 1K7XB 1F12A 1SVLA 3JU3A 3MVEA 4GZ6A 3IUYA 4L8LA 4XTRA 3WQBA 4ENQA 5KNDH 4N4AA 2H1IA 3GZJA 3DJFA 1E5VA 3EJWA 4B3IA 3AOEA 2J3JA 4CM9A 1X19A 1H9AA 2AFVA 2VEDA 3EFOA 4P4NA 3S6JA 4RYLA 2LCFA 5F2OA 5FLKA 1XMQB 3T3MB 2ZSKA 5MN4A 1WUTA 2HQSA 2IXBA 2KHZA 4JBGA 3H1GA 5DBHX 1CUUA 3PDHA 1W49A 1JVSA 1RCUA 2DX7A 2QRJA 3GMDA 4L9SA 4ZQGA 4EARA 3L1VA 1XZBA 4M54A 3ORSA 3HY4A 3UKJA 1CEXA 1OF1A 2M9MA 4JB8A 3ZG6A 1J21A 1AK1A 3DOCA 4NBRA 5K6RA 1YR3A 4TZKA 5CX4A 1CJBA 2ZPUA 4K88A 4TRMA 2ZXEA 3COPA 1QVAA 2EERA 2O8FB 1SKYB 2GS9A 1WPGA 5ER6A 4E22A 2O4CA 2PR2A 3MGCA 3U16A 2WWXA 5DYYA 1RJGA 4HWTA 2WWGA 5ALOA 3RYFB 5ALRA 5AUNB 4A16A 1C81A 2V4UA 1JDBB 4GBMA 4YAFA 3JQ8A 4LYJA 3ENKA 3T8YA 1PHPA 1S9DA 2QRVA 2HT1A 2ZZKA 4WASA 3TCNA 5FDFA 1Z4JA 5AVKA 3ROZA 3UF0A 2GXSA 4YUWA 5K99A 2HU8A 4R8VA 3ENVA 1YKFA 3P2OA 2PAFA 1EHCA 2PXXA 2UXBB 2SHKA 3IPYA 3OCZA 3WHIA 3EIEA 4PHFA 4V0ME 3JW8A 4EPVA 4DJTA 5K4GA 3KQHA 3RFVA 1E98A 2P2ZA 2Q9UA 2V59A 2VZEA 3D3JA 4F9EA 4X71A 3O8CA 3E84A 1CYEA 3EPLA 1NGSA 3W90A 5CA0F 1SAYA 4RHUA 5AKEA 1T1EA 4BFVA 3BFKA 5TXGA 2I3AA 2WSYB 2VSQA 4TTTS 3SLKA 3H83A 1QDUA 4LWOA 4EJSC 5F12A 1AO3A 4NZMA 4G4SO 1KDVA 1E69A 5TF4A 2G4CA 3A7EA 4ONEA 3NHPA 4IH1A 3NETA 4JYZA 1MXFA 4KYIB 1QHFA 4ARVA 4EX7A 3Q8LA 4ZTUB 2QV0A 4JC4A 3OM1A 4DV1B 2YBEA 5FH9A 3IB6A 2K6GA 2OO3A 2FDCA 1J33A 2DBQA 1Y7HA 2I8CA 2NUBA 2V7QD 3AIKA 1QJCA 1V47A 3B20A 3CF4G 1XA4A 3EEQA 2CK3D 4GC5A 2ZPTX 2QRVB 4J0EA 3EDMA 4P3NA 4FCWA 2JFHA 4TWAA 4TXJA 3T7IA 2F1IA 3RU3A 3AVQA 3VMFA 3FUCA 1QIHA 4JOQA 3ILVA 4OHFA 4PGFA 3AR2A 4R40A 5DTRA 2QGNA 4TLMB 4UBLA 4C0SA 2ZS8A 5GV8A 4L76A 1ZOOA 1M2OA 5L9AA 1NRWA 5B7NA 3W2GA 5I7EA 3EOAI 3KJEA 5GADl 1DWUA 1FW8A 2ONYA 2Z5VA 2VF7A 3KQLA 4EG4A 3SBOA 4HD8A 2ON6A 4GX1A 1G8MA 3WMGA 4X24A 5DWDA 3N9IA 4RM2A 2Y3IA 5KQPA 3K6JA 4URFA 4H6VA 5ECDA 1KVQA 3RROA 4G5FA 1VCNA 3T1TA 3ZWQA 3E70C 6Q21A 1KO8A 3JSAA 3COVA 1QRUA 2BMFA 2GYVA 1BH6A 2OC9A 4NFYA 1Q6YA 3MAGA 4MLCA 2XBLA 3A2NA 4BAZA 3FAKA 4J91A 3W4KA 1CNMA 4CM7A 3V1NA 1F17A 5EC8A 221PA 3OIVA 3UJCA 2W2LA 1TF5A 4JVLA 4CT4B 4K9LA 3BWMA 1DI0A 1WUYA 3PWSA 5KUTA 1N2HA 1O9GA 4HJRA 2IODA 2XD9A 2F3SA 3U1TA 3MIZA 4V02A 1D2NA 2VNIA 4KQWA 4IUYA 3LIIA 1H5NA 4Q3CA 5TQJA 2EG5A 3PUIA 5JPIA 1M2OB 2B0CA 3I2KA 1G7TA 2BBTA 1BTOA 2YQ4A 4Q4AA 2GWHA 4NEHB 3OQJA 3ETJA 2IYUA 4TTSA 2CDRA 4YJ3F 2GJSA 5HMMA 2HU2A 5B1YA 3JQ9A 5CPBA 5BQ5A 2FJ0A 4OTZA 4IDNA 4WXMA 3W6OA 2ZB3A 2MCFA 2GEDA 2TECE 3LKDA 4WHMA 1X7ZA 1JIJA 5H83A 2CEKA 3L1IA 2ODBA 2VA9A 5A3SA 3BSYA 1LVGA 4IDHA 2OD2A 1QTNA 4KMRA 3STTA 3P96A 4M36A 5IT9A 1CUIA 3HRKA 4DLVA 1DC4A 3K9NA 1WOYA 3DZIA 3OQ1A 4K6GA 4OQLA 3E3LA 4H4DA 4Q66C 2B69A 2WLTA 4W5OA 1JWLA 2QDXA 4DEXA 3K92A 4DMKA 4PG8A 2DT5A 4LV5B 2GEFA 4HNGA 4Y6OA 4NPAA 2QTWB 1ABEA 1UBEA 4J0KA 4AIRA 4LDQA 3ESZA 3P97A 3S2GA 3KYCB 3N2YA 4UJ5A 4B6QA 2VNKA 2XZLA 2QRKA 3OHPA 2WYOA 2Y1FA 2HFKA 1L5HA 2WJ3A 2VH5R 4TXLA 2C2OA 2QTMA 3K0BA 3P1JA 1JEJA 2PMCA 1RWVA 3EISA 4B84A 1KOFA 3FKSA 4Y2QA 4Q4AB 2KS6A 3QP9A 4JJ7A 2GCOB 3C1UA 2J5BA 4XFJA 1RRKA 1RIIA 5I4KA 1IDOA 2WQ6A 3H9UA 4E5UA 1XVAA 1QK3A 5C34B 2XUGA 2EAUA 2QUIA 5EINA 3RKSA 1X7ZB 2ODWA 2GBFA 4JVMA 4DLYA 1JHOA 1R3UA 1NATA 3P19A 5BSRA 3KUUA 4FWIB 4BNZA 1XVIA 2R7KA 2FSHA 5KINB 3D8NA 2O5VA 3MFYA 1QG6A 1HQKA 4P7JA 2KW5A 1RXYA 2VWPA 2HXSA 1AQLA 3KALA 5IRCD 5LQJA 3WGTA 4IKOA 4B0PA 2EV9A 1IY2A 2CLKB 1K7FB 2G4LA 3ICOA 1G7CA 1V8DA 4G2TA 3DE1X 2DTDA 1QGOA 3LWNA 2TMKA 3H2YA 3N8DA 2R1ZA 3NH6A 4QEDA 1MC5A 4GLBA 5BT8A 1IRIA 2ODEA 3SPXA 4HRYA 3WA6A 1BWRA 1L5HB 1UMKA 1J2RA 2R1TA 2RJ3A 4JJ4A 2XB8A 1AUPA 3ZI4A 4IJQA 3I39X 2WNSA 1APBA 1U8FO 5C51B 1K9SA 4KXYA 5G0SA 4AJKA 4CM3A 5BWNA 1Y7PA 1CUZA 4O3MA 3ZHUA 1RBQA 3EXAA 4FDTA 4DCUA 1JLSA 2GO7A 2QBYA 3SX4A 3VDQA 2EW1A 4UNIA 4C0HA 5ICEA 3MJEA 1FLAA 1VJCA 4G26A 4LV6A 4AC9A 4PG6A 1V26A 2XB9A 1I3NA 2Z8YA 2QL9A 3WFJA 1D07A 3CY6A 3RS8A 1XCPA 5TEVA 3N0RA 1RP7A 4EUKA 3G7UA 1CNEA 3M4NA 4YAWA 4JGGA 3PEWA 2PMFA 5F2NA 4W63A 2A5DA 1YBVA 3U39A 3PJFA 4CVNA 2A4MA 3AHDA 1AS0A 3TS1A 1ZRNA 2P9EA 1NR1A 1PX2A 3ZEIA 4U2KA 3KXDA 3WZMA 1Q0SA 4A1FA 1BMFD 3B82A 4HAXA 2H1WA 1E1CA 3FA2A 3QENA 2YW2A 3FYCA 4DWWA 1RP1A 2ZAMA 5REQA 1SXGA 5B30A 1LNZA 2QD4A 3DE7X 3SLRA 5AKIA 4AO7A 2H5JA 3Q9NA 4U00A 5I6DA 2IQIA 4WZBE 2ZLBA 4PIMA 4W1RA 1GPNA 2BZ1A 2CMHA 2R1TB 3CX8A 4LOKA 4MTLA 3HUUA 4QPNA 4RKFA 3CNNA 4HHEA 4J0GA 3OU7A 1S96A 2P6PA 3PCXA 4OB7A 3KWJA 3V9PA 2GJ4A 2C20A 4Y2VA 1Z38A 2W2OA 1E1RA 3EGVA 2BJWA 2PLNA 4B2YA 1A77A 2F55A 1H3NA 1CW2B 1ISMA 4RD0A 1BVHA 3ESXA 4QGGA 1N3LA 1EFVA 3FHLA 2ZRHA 4QBHA 3A26A 1N2EA 4LC1A 3BB3A 4ZJUA 2XNKA 4GDMA 1B4DA 3WJ7A 1YRLA 4Y7DA 4FMBB 4WZAE 2ANBA 4ZEWA 3SM9A 4ALKA 3ITNA 1NPDA 2V8OA 2EQAA 5IYZF 4DEYA 2V5UA 3L01A 4ZEMA 1B6RA 3LUGA 3GV0A 4NCJA 3WLRA 4MQLA 5BWCA 2H2WA 1EXVA 1QNFA 1EWQA 1JFFA 1NT2A 2Q2NA 2XTJA 3AR8A 4OHBA 4PCLA 4UM7A 1KETA 4PVCA 4ACAA 2XR1A 3OJCA 1DO8A 1FBNA 3L06A 1SUPA 5EE5B 3W8NA 3ZDEA 4KTTE 1XK7A 3SDZA 3FYDA 3BD8A 3QE9Y 4AS3A 3MJDA 3UBTA 3DVLA 4BCDA 4N18A 1NC1A 2RAPA 3GRRA 4GZLA 3GN1A 1AK2A 1TEXA 1M2JA 1Y5IA 3ETCA 3GJZA 3QE3A 2ILTA 4ND8A 5GONA 5H9WA 3C6XA 3CB4A 4JT4A 1DHRA 1GA4A 3HA5A 3VAAA 3H13A 3OJFA 4EFKA 4DVJA 1CE8A 3I8OA 5CDGA 2JNWA 1I8TA 1UEJA 3N2EA 2VYQA 1EFVB 4YREA 2QROA 2Y1KA 3OZEA 3ISJA 1ILWA 4PRLA 1J6UA 1CK4A 4RQAA 4JLJA 2HSGA 3QSGA 4LA4A 4G2NA 4QG7A 4TVBA 4RSRA 5FI3A 5IVDA 5BSMA 2EWWA 3WKEA 1DKMA 1U8TA 2FFHA 1GL3A 4PX2A 3NHUA 3VC2A 4LECA 4EB3A 2BLNA 1OIVA 1L4GA 3L6OO 3CZ9A 4RGBA 1Z8HA 1YOBA 2QW0X 2Z2ZA 4WY5A 4D0GA 4DW8A 7AT1A 3W5UA 1N5LA 1QM5A 3P9XA 2Q2QA 1MCZA 4KK3A 1ENZA 1L8XA 621PA 3I30X 3TW8A 4QZVA 2EJBA 2FEPA 2RCNA 3EMDA 4HH1A 1FMTA 5F51A 1ZR2A 4MO9A 5AH0A 2WF8A 4IQ8A 4LZZA 5BN4A 4EW1A 3F9CA 5HBGA 2CGEA 5IVIA 3UUGA 3FUWA 4BNUA 2VDLB 2RMKA 4GX5A 2VHUA 2JGAA 4GWGA 5GONB 5IDVA 1R5OA 2G83A 1DT3A 2CXQA 3VZSA 3L0SA 2IXTA 2Q46A 3DCIA 5JVDF 4P8RA 3RYHA 5AUOB 2LE0A 1NR5A 1R15A 2XIJA 3AV3A 4G4IA 1UBCA 3D8RA 5JYBA 3U3OA 4EG6A 3ISVA 4N1AA 3GN2A 5H59A 1DAMA 1UZLA 3HTXA 3BYZA 5LNK1 1PF7E 1H8HD 4Y6GB 1Y9EA 3UMVA 1U0LA 4PPNA 2CNWD 1MQ9A 3A28A 3NQ41 5F35A 3RM3A 4F96A 3ZW7A 5E9JA 3M6XA 1HC7A 1A4XA 2HEIA 4QGAA 3VDMA 1X7WA 1U0EA 2G5GX 3Q2OA 3TAHA 3QYAA 3L8FA 2CV2A 2GBLC 3R41A 4N6GA 2D8MA 4FZJA 4Q3OA 1ZMOA 2QWXA 3A1FA 3CZCA 5JNWA 1RAGA 2TRSB 3CUWA 3KPYA 4Z9AA 5FFFA 4CUKA 3FTNA 1IBMB 3TW8B 5E3JA 3N6XA 1X94A 3STUA 2ZXUA 1H2ZA 1CRZA 1MG0A 3WGLA 4MUBA 1QE3A 3OJ0A 3RIHA 4NEQA 5IM4F 1M7GA 1MLDA 1RE1A 3B9RA 4CL0A 3U37A 3FSRA