1OJ7A

Structural genomics, unknown function crystal structure of e. coli k-12 yqhd
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
390
structure length
390
Chain Sequence
KAGLNNFNLHTPTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLDALKGMDVLEFGGIEPNPAYETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAANYPENIDPWHILQTGGKEIKSAIPMGCVLTLPATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTKPVDAKIHDRFAEGILLTLIEDGPKALKEPENYDVRANVMWAATQALNGLIGAGVPQDWATHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDDERIDAAIAATRNFFEQLGVPTHLSDYGLDGSSIPALLKKLEEHGMTQLGENHDITLDVSRRIYEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYPOTHETICAL OXIDOREDUCTASE YQHD
publication title Crystal Structure of E.Coli Alcohol Dehydrogenase Yqhd: Evidence of a Covalently Modified Nadp Coenzyme
pubmed doi rcsb
source organism Escherichia coli
total genus 153
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00465 Fe-ADH Iron-containing alcohol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1oj7A02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oj7A01
4P53A 1NVDA 3RF7A 3IV7A 5FB3A 1NR5A 3HL0A 1SG6A 3OX4A 3QBDA 3CLHA 1NUAA 1OJ7A 2BI4A 3OWOA 1JPUA 3QBEA 4MCAA 1RRMA 5K8CA 1NVEA 2GRUA 1KQ3A 1VLJA 3CE9A 1VHDA 1XAIA 1XAJA 2BL4A 3ZOKA 5HVNA 1O2DA 1NVFA 4FR2A 1NVAA 3ZDRA 2D2XA 3JZDA 5EKSA 1NVBA 1UJNA 3OKFA 4RGQA 4QGSA 1NRXA 1TA9A 1DQSA 1JQ5A 3UHJA 5BR4A 1XAHA 1XAGA 4RFLA 4RGVA 1JQAA 3BFJA 1XALA 3W5SA
chains in the Genus database with same CATH superfamily
5CDSA 4I14A 2Y0EA 2CD7A 1NVGA 3N39C 3OQJA 5MF6A 2JIMA 2BGKA 4MIOA 2DBQA 4A6DA 4DNQA 5H3CA 2RB5A 2XWJI 4K1XA 3MTBA 4IQ8A 3RLFA 2CHFA 3OHMA 1NBIA 1BFUA 1ND5A 2Z8ZA 1BXRB 3DL0A 3DE5X 4L75A 3ZGYA 1CVLA 1NOKA 3K6SB 3RGGA 2EQ5A 5EY5B 4C7XA 3QP9A 2YHIA 3WS7A 1RYEA 3QE9Y 2D8MA 5DN6D 2PUEA 1WOMA 1VSVA 2D06A 2JNWA 2QIPA 4KR0A 3DHEA 1EM8A 4GE3A 4KO3S 3WB1A 4DJEC 4G8JA 4I4LA 1ECGA 5DH9A 3V7WA 4P22A 5D1HA 2N3ZA 4TV8A 3CS3A 4Y9SA 4Y6OA 3ZQUA 5DP2A 2BFMA 4DYHA 5JBIA 4CMKA 4JQZA 4H31A 2OXIA 5LMCA 4PTYA 5HMMA 1FDVA 4BB6A 5CA1B 3B5JA 4DDUA 1LSUA 1SQ0A 4GP9A 4GDFA 4C01A 4RJIA 3DEIA 2ZRGA 4ITRC 4X00A 1FP7A 3GCZA 1KYQA 1YS6A 5AUQA 1Y6GA 4KQ1A 2JG3A 1X74A 1OV4A 5ALMA 2RGBA 5K7SA 5TSDA 1GPWB 4ZT3A 1PFGA 2GZRA 1PF7E 2W6OA 5AWFC 1A95A 4A15A 3W1WA 1JU4A 1RFLA 1O95C 4LTNA 4TROA 4C89A 1ZNZA 3EIOA 5DISB 1G5RA 4JYAB 4UCWA 4C4YA 3KZOA 2XI4A 3WGJA 1PN3A 1VG8A 1C3OA 5FF9A 2HYDA 5BN3A 3NXSA 3VKVA 1FEZA 1MBZA 3U7IA 5K99A 3ONWA 3HZRA 4GDMA 4HUJA 4JHXA 1V1RB 1N0UA 3VMMA 5CVTA 2VZEA 2G76A 2V96A 4K88A 4H7HA 2QZJA 4R7TA 3IAAA 2I71A 3K70D 3JPWA 2XADA 3DO5A 1LDGA 3HCEA 2JHFA 2GM3A 5J43A 5EQFA 4CDRA 4F06A 3FSGA 2FQWA 3CNOA 1AA9A 4IH1A 4A1FA 1SXJB 2VDUE 4LE0A 3KHTA 4PO3X 1FJ2A 1TQ8A 2MINB 3GQVA 4G5OA 2JLZA 1DS6A 3LKVA 3ORQA 5GJCA 4P2BA 3O4IA 1GQFA 4IGIA 4QODA 3C24A 3I23A 4PCUA 4C6TA 3CUKA 4XFJA 3MSCA 4BGUA 1JHQA 3KSUA 1U7OA 2B8WA 2ZI7A 4JEHA 4MUGA 1DJOA 2JJ2A 2VHTA 4PFQA 2DUNA 4UJ5A 5HGXA 1SD1A 4MJ3A 3WJ2A 1MAAA 3R9KA 2WUGA 3P19A 1RXUA 4TM7A 3VC3A 5KKCA 4LFAB 1DGQA 5I4IA 1SC9A 2WJHA 3EGXB 4D4MA 1R6TA 4A03A 4BVFA 2I0FA 1G0OA 4L73A 1ZM9A 2FSSA 4OHUA 4UE3S 5DSTA 1JFVA 3BEOA 2Y9MB 3UB3A 1GYPA 3U9TA 4G0VA 3EFBA 1UDRA 5FUWA 1OWNA 4MUIA 1SBHA 1KR2A 3WLQA 4CFYA 1DKUA 1C30B 5AKYA 2C42A 3EIEA 4ENQA 4RCYA 5GP1A 1OH7A 5AH0A 3MCUA 5GMOA 1FTNA 3OT1A 2Q2QA 3UW1A 1MC5A 2JH3A 4I3FA 4ZCTA 4Q1EA 4M1TA 5JJ5A 1YS9A 5FBLB 4DC9A 1YZGA 5AVQA 1K6JA 5CB4F 5AM5A 1U7HA 1JA9A 2LDXA 5BV0A 4WZBE 1ST2A 5AKGA 4BRZA 1BGVA 4HPWA 1RP7A 4GL4A 4YRLA 1HDGO 3NKVA 4HGPA 3FVQA 4H9GA 1M7HA 2I03A 5KC8A 3EF0A 2I2WA 1KSFX 1M0EA 4AWXA 4N03A 5J2UF 3UFXB 1XRLA 3G1TA 5ALEA 3NIWA 1VP3A 4KODA 3C3CA 2HA4A 3LXUX 3U1BA 3LDUA 1G8KA 1LH0A 4LWOA 3A9RA 4OH7A 5CTJA 2XEXA 4C76A 4DMCA 1LBTA 4JS0A 4Z0TA 4R1LA 3I2JA 3M89A 2ZIEA 1UBMS 3U31A 3CBQA 2QRHA 4FHGA 3PGJA 2FPXA 4P7BA 4BVKA 2GD1O 4D4LA 1Q95A 4B8WA 1NSYA 1L9KA 4KWEA 4ZI7F 3DBOB 1OXSC 5DCLA 5IMBA 3I04A 4CMAA 1E2HA 1NRJB 4J4BA 5JD3A 4E14A 4YBZA 3AY7A 3V7NA 5IT0A 1XVIA 5HJ5A 4R9SA 2IXDA 4GO1A 2GPBA 2NSHA 2Q1SA 1CZRA 3AF6A 2B4TO 5B7NA 3T5CA 3BWEA 3DDUA 3GRCA 3ORSA 4PQFA 4JUIA 4CEIA 3QXSA 1M0WA 5KYWB 1GAXA 1KYTA 1U6JA 3BFVA 2IYTA 1P1CA 2V0CA 1T8YA 2QRLA 4HLNA 1NTOA 4PTZA 2JFXA 2IS4A 2P3LA 1SVLA 5EP2A 3ZJVA 4ILKA 1ADCA 4X54A 3IULA 3NOVA 2A3RA 1PLLA 5HCUA 3UXMA 5BMVA 2UYHA 2ZJ3A 4OXYA 2FN7A 2COEA 4RK5A 5C1IA 5BURA 5JISA 5JQGB 2Q1TA 4QVIA 1KE2A 4YFVA 3A06A 4DAEA 1SRQA 1BE6A 1SKYB 2E89A 3W5DA 5K2MA 5JWOA 2VP6A 5IJ9A 2PUGA 4JBHA 4J6EA 3ILYA 2BMAA 4BWYA 1BC5A 1KIAA 2BBSA 3QEMB 1JR6A 1QFYA 2JBHA 3UJNA 5KTYA 1JHXA 1XPRA 3PUXA 3IE0A 4WKGA 4FGSA 2VCHA 4L2IA 1ECBA 5L3QA 1WBDA 3U3MA 3MWEB 4FSXA 1E0AA 3UFBA 2X6RA 1YC5A 2G1AA 4ZOEA 4FYVA 2XWSA 4CKWA 2FFRA 2I2AA 3H83A 3ZBTA 3CT6A 1NX6A 1T2NA 2PMKA 3MYYA 2C5BA 1YQXA 1T5IA 4JXXA 3HCRA 2Y9PB 3BE5A 1QLWA 3KT0A 3H2KA 2Q5CA 3O6VA 5FOUA 1E0SA 4HJRA 2AEFA 4ZMBA 2AOVA 3I6BA 3MUEA 2KM1A 2BGGA 4TVOA 4KQMA 4NV1A 2RI6A 2ZT5A 3WYNA 1JHPA 4HWRA 2I7CA 5E6UA 1DKLA 4WZAE 4ND5A 4JVNA 2BW0A 3KJZA 1RIFA 3MXOA 4IMIB 1JEEA 1T6ZA 4ZRDA 3RUPA 1Y8AA 2H18A 1T5DX 1PEAA 2FQXA 1QHNA 5EE3A 5REQB 1IQ0A 2XMQA 4IIJA 2YIVX 4L72A 1KVTA 1KU6A 5KYXB 3U2QA 4ZIRB 5ECGC 2QMQA 3JVVA 3UHOA 3KB8A 3AERB 1BX3A 3MGBA 2IPAB 3O4GA 1NMQA 1YR9A 3HI4A 1W1IA 4AJJA 3I9JA 1MXFA 3NHKA 4XTCS 4MUEA 1L3CA 4JC0A 5FTWA 1RRFA 4QXRA 4US1R 3RUDA 4QXOA 4Q34A 2HQSA 3HP7A 4F4CA 2V6MA 4FMCF 3E1SA 3I1FA 3GGCA 3NJ4A 3PDHA 4H4DA 3B1FA 5FJJA 3NBQA 2PLFA 4NEGA 3KJEA 1V95A 2EZ9A 1Z0ZA 2W6CX 4BBZA 4W8HA 1B14A 2DWUA 3PWZA 2Z2XA 2BDTA 1ICIA 2IT1A 2BGRA 2I4IA 4KTTE 4RV4A 2WM2A 5JROA 4TT3A 1XP8A 4JLJA 1BQ4A 2YKGA 4MQEA 3T15A 3LP8A 2H1WA 4JJFA 2O8NA 2EWMA 3TM5A 3TW6A 5IVDA 4B3DA 1ZIOA 3NM6B 3BF8A 3OJXA 2GAOA 3VKGA 1JLLA 4QJIA 4ZOLF 1GYQA 1Q3KA 2GN9A 4U3JA 3RYHA 3WYAA 1Q0TA 4LF4B 4BFZA 1ZEMA 1Z88A 1CQIA 2HXGA 2VP0A 2QRUA 4UXIA 4AS1A 2A0XA 4ZAYA 4J3JA 3R5HA 4WN9B 2Y2VA 3VTAA 3HBFA 2ZYHA 1U80A 2TMKA 2FZKA 3NEPX 4QVKA 5CLIA 2HA7A 1BG6A 5IMSA 3M34A 5CB4A 1E0DA 4JLAA 3E8XA 4AECA 4BECA 1HUQA 1MRZA 1MC8A 1Y4UA 3OJWA 4BGVA 1T4CB 3K8QA 3QTLA 2BR5A 3GX1A 3OT5A 1BVYF 4TQUS 1W36D 1OUMA 1VLQA 1WUJS 2HCFA 2ECOA 2I1QA 1CJMA 3BSFA 3KQQA 2XTJA 4OGWA 2O9JA 3AHGA 1W8IA 5HMLA 1K2WA 1NJ2A 1SOVA 4HGQA 1AQ6A 1QGAA 1QUFA 4IKEA 1H8HA 1TGVA 2I8CA 5AK5A 4W5QA 2OKCA 1TTPB 1U3GA 4MVJI 4U4AA 1YAHA 4UVIA 1CRQA 2ZUUA 1C7EA 4UEQA 1I1QB 3JSXA 1JR3E 3A1DA 4XTRA 4YUZA 4HNTA 1OTXA 3OLYA 4C6SA 5TX7A 4MYRA 1Z0UA 5BRJA 1ZOOA 4ZI7A 3M3DA 4F9FA 1JGTA 3K8YA 5K8VA 4P1ZA 1Q0QA 3NYQA 2VZ8A 1SHJA 4XOUA 4KO8A 1GHTA 4PPFA 5IASA 2O1SA 3ZJUA 1QORA 4Q7KA 3B6IA 5HKKD 3VJLA 3GJYA 5AXAA 3QFHA 4M8NE 4S2UA 1EQ2A 1RQ2A 4EW6A 1PK9A 3EN0A 1PDVA 3HCWA 1B1AA 1JIVA 5ESWA 4GKKB 1T0BA 2AVDA 5G1NA 4B3JA 3LX4A 4INPA 2FA9A 5AJUA 1V9SA 2B1JA 3ZYZA 4ITVA 4BRWA 4MRMA 2PMCA 4LY0A 4EK9A 3X1DA 1RZRA 1MIOA 4KK3A 4GR5A 4G1BA 3V6MA 3ZU2A 4UBIA 4AUEA 3RIXA 3VAYA 5AM2A 1TYCA 3ZHVA 1MO3A 5D7BA 2DUMA 1O9BA 1TE2A 4NU0A 4HFNA 1PYDA 3EW7A 5FR2A 1JL3A 5J40A 4DIBA 1PNRA 3L5KA 2REQB 3OZCA 4BFYA 1R27A 1ISHA 2PGOA 2E4WA 4GP6A 2ZTUA 3UK0A 5KINB 1DIAA 1B0AA 1CR0A 1P4HA 4OSPA 4YQFA 2HLNA 1CR2A 3MWKA 2R11A 4M0KA 5FOVA 1P0FA 3QUBA 1TRKA 3H2GA 4ARBA 4HEHA 2W8BA 1W9HA 4BKPA 4Z7JA 4UULA 3HDHA 4HQNA 4WV3A 1IK4A 2CBGA 2IK8A 1D8TA 4LRSB 2DU8A 3F9IA 3L01A 1NVFA 2I1LA 4WZBA 5MDHA 2V7QD 1EJBA 1QX4A 1BVHA 1WCIB 1O6CA 1I3OA 2J3LA 3KDAA 1PYOA 1V1MB 3M33A 3M5WA 4N5LA 4EX6A 1TVCA 2B9VA 3O4VA 3VJKA 4E33A 3QK7A 2G8LA 2REBA 4NCAA 3ZHSA 3IALA 3IHWA 2ZSKA 3SSOA 3FOZA 1YNOA 2CBXA 5CLFA 3IE2A 1X80A 2QZ4A 3BMOB 4EG5A 1JSCA 2I2CA 2AQIA 3ZE0B 4GPEA 4WKOA 5DX8A 1NYTA 3PRHA 2OXFA 4AJOA 2VF8A 2UZ0A 3DCYA 4OK3A 3ZV5A 4QJ5A 5KPDA 3KR9A 3OZVA 1E94E 4BCBA 5AVSA 4AT1A 1E7WA 4IV8A 2Y4OA 3JX9A 3NNNA 1JVSA 2DAPA 2J6CA 4MQ5A 3EFOA 4X8MA 1Z3IX 2P2ZA 1Y8QB 2PQ0A 1DPFA 3CUSA 3KPWA 2PR7A 3PCXA 1M8KA 5E2IA 4LHYA 2D62A 2OHVA 4JVLA 4D9IA 3PFGA 4KBYA 1CZOA 3IVMA 3G85A 2A1TR 4QUEA 1GCAA 1WD5A 4Y3UA 1BTOA 4UDXX 1LPNA 2OZPA 4JB3A 1MW8X 1EK6A 2QLNA 4R9NA 5KX5A 1P2UA 2QRVB 4FI3C 4W5TA 2HHHB 2AL7A 1OXTA 4WW0A 2EGGA 4DY6A 1QJCA 1JFSA 5IT9A 3R7LA 2PEYA 2LV8A 1R37A 2RJ3A 5DTMA 4AMVA 2HMWA 3RABA 4ZOLA 1DL5A 3ELDA 3FMPB 4GR9A 4TTJA 3O8OB 4NU5A 2BI8A 5FBRB 1DQNA 5SYNA 1XPJA 3L8YA 1K27A 3FVTA 3L1KA 4B33A 1HEYA 4ZGWA 1KRWA 4X0EA 4MLDA 3M8KA 4ZWNA 3CMCO 1OGIA 4QSMA 3ICEA 1C7IA 3NTRA 4ER5A 2FW0A 3P8ZA 1ZD1A 2ERXA 2VNKA 4TMYA 1BN6A 1ATIA 4U5QA 1E64A 4O4JF 1YIDA 3H1TA 4GBJA 1XR3A 1UM9B 4LRQA 2H6EA 2GD6A 2NV2B 5BYJA 3X2SA 4ON9A 2Z1NA 2JRCA 4LSGA 1GA4A 1L7XA 4NCKA 1VDMA 2O59A 3ZY3A 2G63A 4URYR 4CM7A 1OC4A 2GNOA 1E7RA 2NGRA 2JPDA 1ZUD1 3P94A 5HF8A 3OOEA 4XJSA 3H8WA 1QDLB 1X39A 4ZYUA 3JYNA 2ZS8A 4CCWA 1KJ8A 4CLXA 4WZAA 4EJ0A 2G82A 5C80A 3T3MB 2DLCX 1RC8A 2B20A 3LS2A 3R8FA 4TWZA 2C0PA 3HBNA 1Q50A 3E5RA 3EOBI 4ARSA 2XF8A 3DJYA 5EIXA 1UBKS 2JLYA 1U9IC 1FRVA 1F8GA 1Z0JA 2IGBA 3HKBB 3NIDB 5BW5A 5FWAA 3EZ9A 2ZG6A 1SG0A 3HA2A 3VU9B 1BO6A 1SY7A 1XT6A 2Q1UA 3BL8A 3JWPA 2IZOA 3NNSA 4GVPA 5CBPB 5GGYA 5EN4A 1FXWF 1SVUA 4CIDA 4YMHA 1MZPA 2F43B 2ZGVA 1WUHS 3S1AA 1C29B 2JJ2D 2AOTA 2QKYA 4QGBA 4XWTA 2G9RA 1NI4A 5KYTA 5ED4A 2GT1A 1FSSA 3IIIA 2X3UA 1C0LA 1T9BA 3A3NA 3SBOA 5MN6A 1S7CA 1ZKDA 2P9QA 4KJZA 4JX9A 1J22A 2Q3LA 4CM3A 2QTRA 1JEJA 1R5OA 1EK2A 1DWPA 4ALJA 4AZTA 4S3MA 3OIDA 5LQJA 1T2VA 3BH7A 4ANFA 1ZH2A 2CW5A 2YN2A 4Y0VA 4TTQA 2J3DA 3C14C 4HNGA 2KE5A 2NZWA 3DTYA 3SI7A 3VDQA 4MVJP 3G2LA 4WGFA 4V1CB 2EJVA 2WNIA 2O8DA 2D2VA 2XV1A 2I9PA 2PS1A 5BT8A 2Y2UA 4I9HA 1I2BA 1NBMD 1R4NA 4WIAA 4EB0A 1XMPA 3HWWA 5IN4A 4LY9A 2XGJA 2FOXA 3OE7D 3ZW8A 3SX4A 2OGSA 2PKQO 3BGWA 4Z1OA 5JH7B 3I6YA 1QIKA 2VC2B 4GD3Q 3L0BA 1P18A 4GKVA 1PGJA 4L9AA 4PEVA 1YBFA 2TECE 3AW8A 3B1ZA 3O7WA 1E9VA 1CUJA 3L4SO 3FPAA 2AJCA 3OPYB 1V41E 4LXTA 2W2QA 4AURA 4E70A 3KLOA 2AJLI 3DW3X 4LGYA 4UTRA 2GM4A 4B3IA 1RTKA 2YTZA 3DB2A 3E9EA 3KAKA 3C3WA 4UC0A 2Y0PA 1SU8A 1IU9A 5FUYA 4GPIB 2PA3A 2GGSA 2HSZA 4G0XA 4RSMA 5J59A 4CKBB 4E1AA 2H1OA 3FUUA 1BE1A 2XF2A 3OEHA 4H1HA 4LI0A 4QUHA 5E7QA 3TB6A 5BP7A 3K71B 5KC9A 2PEZA 2XTAA 4W1PA 3ZXSA 3A4TA 4FHDA 1MRSA 1PHRA 4XW2A 3E9NA 1NRIA 2O2SA 2XQIA 4IHJB 2N46A 4ARIA 1ZQ1A 3K0AA 2C7BA 1JMYA 1GPKA 2AF4C 2FMXA 1FP4A 2UDPA 3IVAA 4M6WA 2W0MA 3RAGA 2JIDA 3CLKA 2LCQA 3TLKA 4B73A 1N0IA 5TE9A 2FN4A 3FMVA 2MCFA 1OTHA 4BIIA 4M38A 1JR3A 2ZRCA 5COAA 5JCXA 2L0XA 1W93A 2W22A 1MO5A 2LTAA 4IDGA 2VCYA 1OBHA 1RC0A 3CZMA 4HTFB 4BASA 4BVEA 1Q1ZA 1TIBA 3EX7C 4TYYA 2WWRA 3THWB 2VT2A 2FZLA 4JBWA 5AW8A 3ZVNA 3CNHA 2BEJA 3BJRA 2L2QA 3FB4A 4LZOA 4M0MA 3LT5A 3BM5A 3VVBA 1RE0A 3A4MA 1FK8A 5HQTA 3DT9A 4Q7JB 3ZOZA 4UHJA 2VK2A 3FB1A 4JJIA 1RRGA 1ZK1A 3SC2B 5EJ8A 4RKQA 3BXZA 3S40A 1G16A 1D1QA 3FAZA 2IZ6A 4MOWA 3T0GA 5IH3A 4RULA 1RYDA 1TEZA 3K30A 1E2BA 1RQXA 2ES4A 1NUQA 2RC5A 4UTZA 1ZM3A 1L9XA 1US8A 3GBPA 4KMSA 1L7RA 2CFIA 3B1XA 5E2BA 1E3JA 1SUWA 3OCZA 1JU3A 2GK3A 2HXYA 1P9NA 5IAEA 1G2OA 5SY9A 4ZYLA 5HQ3A 4JI8B 1NI3A 4NY1A 5EWLB 4P92A 2QRZA 3B5EA 1CY0A 3N28A 4G0MA 4RBNA 2C58A 2NP7A 4OMDA 3HJTA 4D6PA 1FFCA 5LJIA 3KETA 2P65A 2P5YA 3JZAA 1Y4AE 2D7CA 4C9BA 3TVDA 5FUVA 1XDUA 1OXKB 2WNHA 3DXFA 3QJ5A 1CVIA 3BDVA 4I5IA 2I3DA 4NE2A 3DL4A 4ZU6X 3E3NA 4JSYA 3W78A 4MWZA 4Q4CA 4C0KA 1W85B 5CYOA 5LQUA 1RXEA 4J3NA 1CB0A 2Q6VA 2FFJA 3P0HA 1FRQA 3V7UA 3ZJYA 5LOVB 5BVHA 1M5RA 5CH8A 4UOZA 2FPWA 3CVWA 3EXHC 1BJKA 4IRUB 5HG0A 5K3DA 4C7OA 5AKXA 2HIGA 2PL5A 1DV1A 3FDJA 2FWRA 4OI1A 1D2EA 2EKQA 4C1BA 4HRVA 2G0AA 4XARA 2Y3IA 1JSLA 3BMQB 4BNLA 1TD1A 5CPFA 2FETA 1A77A 3C7KA 4LDAA 3UGQA 1W6UA 2B7BA 4I2NA 3HLTA 1PTJA 2QE7D 5D7NA 1E4VA 3HXLA 4Q4HA 3IAM1 4V24A 4F1JA 2W71A 4R81A 4CIVA 3IMKA 4CM6A 1N6PA 1UXKA 4G0OA 5A03A 4G5XA 1X42A 3OFSA 4JUBA 3U9LA 2DVMA 3CZ4A 3DNMA 4ZHQF 4F3CA 4TKZA 4AO8A 4RKRA 2QRNA 4X84A 5AM0A 5TEWA 4TTTS 4A82A 1B74A 2OV4A 4V0NA 5KU1A 1N92A 1T3SA 4WNYA 4UHFA 2ZSJA 1HLFA 121PA 1U8TA 2H2IA 2ZBPA 1B6TA 3E7FA 3KQYA 4YJGB 3SQDA 2CFTA 1BX0A 1E1MA 2RK6A 2ZRHA 4EA8A 2HWKA 2ZYDA 2A9QA 3E23A 1KPIA 1M2VB 3KWLA 4I8DA 2DQYA 4OPMA 5EERA 4RXMA 2XXJA 5KOJB 2AKYA 2HRZA 4C6HA 1VLMA 4DLZA 2IEBA 2WOOA 4LZNA 2QMEA 4LNAA 4MWGA 3GP5A 3X1WA 3D5TA 1KH2A 1ACJA 3AKCA 1D2NA 5DGCA 5HM8A 5JI3E 4NCJA 6ABPA 4K9MA 2ZTVA 1CS4C 1E5TA 1YCHA 1OU0A 2OQRA 4PSKA 2A1IA 1N5LA 1R6XA 4RY9A 2QQ0A 5EWMB 3WGVA 4G23A 3RCBA 3U4MA 2VYNA 1YCDA 3CJTA 2QGNA 4M1SA 3R7WB 3QOFA 2CL6X 2HU8A 4YJ3F 1EWVA 1WXGA 1XLUA 2Z2IA 3DSRA 3IYLW 4C0BA 2FJ0A 1H1DA 1TADA 1Y1LA 1S8OA 2QA5A 4IFEA 3TBFA 1A9QA 1EE2A 2C4WA 2G9ZA 2QN2A 1G8MA 2WJ6A 2W4IA 5CTAA 4ZOBA 3UKDA 4L50A 1MV5A 4BL5A 4G1FA 2FK7A 3HCOA 4REQA 3IV6A 5JTUA 3V8EA 1H5QA 1L7MA 1IRXA 5HOEA 4TRRA 1E0KA 5EVCA 4ARVA 2PUCA 3BQ9A 3HGQA 3BHNA 1YL7A 3LLMA 1ULTA 1TC2A 3QVSA 1QPGA 2X9GA 1N2CA 5PGMA 1ZR4A 3HYNA 1IYZA 3RV3A 4ABYA 3TOCA 4ZVRA 3ZW9A 3LUPA 1SM4A 3LPCA 4DREA 4M3NA 1YZHA 2XDQA 1X7XB 1CRWG 2YBDA 3EQ6A 3G2HA 3QEOA 4PZPA 4YIHA 2FP4A 4QGSA 3L6DA 3JQ7B 4MCHA 2I91A 4QBTA 5CG1A 1YR1A 1IWBB 1M2OB 4EB6B 3GW8A 1YZUA 2OUIA 4B34A 1F9AA 2A1TS 2WD7B 2YWJA 4Y2GA 4C1NA 3RS4A 1ZM4A 2J4DA 2JC3A 2JA2A 3E9CA 5BNWA 1U7TA 2VCEA 4UMFA 3AVOA 1YHZA 2BFDA 2VF2A 1I32A 1W5FA 3FTQA 4Q15A 3GLRA 1VHDA 4FFVA 3ZZTA 4AF7A 4RA9B 3G5TA 3QNWA 1DIGA 2CMFA 1F5SA 2Q0QA 3JAKB 4IUCS 5KAPA 1L5GB 5A2QA 2XMZA 4K9OA 3PQ2A 2ZVJA 4R68A 1LTHR 4Y2SA 1C3XA 2X7XA 3BCHA 5CG2A 1ZC3A 2BE9A 3G89A 4TT8A 3MIZA 4WLFA 1XXLA 2PCJA 3ESAA 4JQOA 1D5CA 2Z1MA 6GPBA 3DZJA 3GCGA 1D6MA 3N53A 1A8UA 3SU8A 3V1KA 1W4CA 3MS4A 3V8PA 3WQBA 2PJRA 3U81A 2YN4A 2C1EA 1FQOA 1U2TA 2YINC 3AXSA 4HDNB 2JCXA 3TD2A 1QR2A 2IEYA 3O9VA 5JASA 1GFZA 3DF7A 3LXXA 1I4LD 1N7GA 2I7XA 5I7AA 1KI8A 3O21A 2X23A 2XUGA 4E08A 5TIIA 1QE5A 2X1MA 1K7EB 2C5HA 2H07A 4N8EA 3R5KA 4Y6RA 3UIEA 4Y1RA 2Y93A 1BMTA 1GQ2A 4J3FA 3DZCA 5HK8A 4C4OA 4GLOA 5CA0B 1IOWA 1Z62A 3KOYA 3KZKA 4WBXC 3E8SA 1LZKA 4IGEA 5CK5A 4TXMA 3W5SA 1H1LB 1PT9A 3KOZA 1AUQA 1EX1A 2PV7A 5JCJA 2PPLA 5JFGA 2NUAB 2FG7C 1HY3A 1C14A 1O94C 2PT9A 1DIOB 3EOAI 3V55A 4BC1A 3ZU5A 3EZLA 1NQVA 4CMIA 3KQMA 1ZD8A 1X8LA 2D7JA 5HF5A 2PNFA 4X3OA 3JRNA 2FDCA 3CE9A 4GG1A 4JBNA 3SHQA 4PINA 4F6LA 4CLRA 1BYIA 3T7DA 1H2BA 3Q3VA 3ICPA 5G40A 3VMFA 3D6HA 5JPIA 3IAXA 3LUFA 2GO7A 3QXHA 1USIA 1QV9A 4Q9DA 4LYGA 4N5HX 2WKWA 3PZRA 5EQJB 1JEYB 2DPGA 1J0EA 3QXJA 5HTOA 2FZ4A 3AUSA 4J1SA 7ADHA 4MI6A 3HHPA 3U44B 3QFSA 5JYBA 4HEQA 4XR9A 1B7GO 3QPVA 3JATB 4H15A 4IYRA 4YRDA 3I9NA 2PJUA 5B1DA 4B35A 1GTRA 3S4YA 3PEUA 5JS2A 1ZH0A 4PZ0A 3GAMA 3SLKA 5A62A 4WEQA 1NPTO 5KNDA 2IOYA 2DWOA 3QZUA 3COWA 1DB3A 4IEIA 3W3AH 4D1YA 4WOPA 1U5BA 2CB9A 2Q5FA 4CU2A 3QVTA 4IIYA 1T15A 4BRUA 3VO2A 2Q2VA 3JZMA 4HZGA 4GX5A 4NBLA 5ALFA 5EJGA 1T6NA 4KUHA 5IBPA 2YVKA 3ULKA 1A98A 1N8KA 1YBVA 1XHFA 2I99A 2JFBA 2NXNA 2NU8A 5JZ9A 1Z07A 3TKLA 5LZ5A 1KE1A 2G08A 5EMKA 3SZ3A 4PSDA 4K3VA 1RI2A 4WKCA 4YJ3A 5BO5A 2O52A 1TYDE 3HCFA 4QJ3A 2D1FA 2BZ1A 1OOEA 2DFKB 1LLFA 2IA5A 3MUOA 5I5EA 2QUAA 1POWA 4MV6A 4S05A 4R0NA 2E4ZA 3QVJA 1G9SA 3JRWA 2DT5A 2JFQA 2SICE 2FDRA 3E9RA 3PYXA 4P35A 3ZDAA 3NBUA 4YHBA 1SKUA 4GR4A 2ZM5A 1EDZA 3L07A 3OIFA 5BVGA 5K8LA 3CX8A 4K6CA 3OCWA 2W6NA 2PUHA 1X0VA 4DBZA 1FLNA 2C57A 3Q0IA 2HSWA 2HY7A 3B85A 3QHQA 3U6KA 2OBBA 1YO6A 4MR7A 2ID9A 4RGQA 3LF1A 1Z7GA 3WJAA 3WWPA 4MJXA 5FLXA 3L8MA 1Z83A 3TG2A 3WP1B 1PQ4A 3OTOB 1XV5A 3FWYA 4M1KA 4O29A 3O8BA 4U8HA 1GGVA 4I50F 4ZZ2A 1A7AA 4L3VA 1YMVA 2XDAA 4TLBA 2WVJA 1TA0A 1Y9AA 3G8DA 5AVOA 1SVMA 2DFLA 4AZWA 4DM3A 1X7YA 2OB2A 2YC2C 2CHUA 2WILA 4U2CA 4XD7D 5LKRA 2EZ4A 3RVOA 4JVMA 4IG4A 1SAYA 4NPCA 4RVHA 2V97A 2B61A 3O82A 3DTVB 2C04A 4B4VA 4F5YA 2MYUA 4CEHA 3TL6A 1NM5A 2O0LA 1IWPB 3KR0A 4HUQA 4L3OA 4PM4A 1P3DA 4OJTA 1SBZA 3WWOA 5C8XA 1Y89A 2WUFA 5J5AA 5KTPA 3C7AA 2J8ZA 4RZHA 3RROA 4G0NA 4F72A 5LDHA 5LNK1 2MYTA 1D6NA 3VDRA 1ITZA 1N33B 3OQ6A 2EFHB 3N2IA 4X1KB 2P9JA 3ML1A 2CK3A 2I65A 3JPYA 4HBZA 4BLWA 1Y8RB 4LXXA 4OMUA 3L7IA 4E3ZA 4HH3C 4MV5A 4YECA 1IHXA 2PFKA 4D8TA 5LZ2A 2CJWB 3WK6A 1F2UB 1FXSA 2BELA 2HCBA 2HMTA 3DHWC 4D3YA 5IYZB 3VA7A 5JADA 2DR0A 4B6GA 1QE3A 2FZVA 2OV2A 3PEVA 3WISA 1G7CA 3EWAA 5AHXA 1ZMOA 1G3MA 3V97A 4O8ZA 1KJYA 1RNLA 3VU1A 4C78A 1C81A 1JQEA 1K6XA 1P6UA 4RY0A 4WNCA 3LBNA 3L7JA 1D6SA 1KMMA 4WMLA 5DN9A 3KKOA 4TLLB 2VIIA 2D1YA 2EWWA 2ZYUX 3RK1A 3WFZA 1J4AA 2XBMA 3VU0A 4MRNA 3AH8A 2O8BB 1Z0IA 5KEIA 2F4NA 5JANA 1I6LA 1MAUA 2BTQB 3P2EA 1Q6ZA 3EFEA 1EQAA 1PE0A 4E46A 2R00A 4I0WB 4I1PA 5E8RA 2JCYA 2R7LA 3DYBA 3W3AD 5CB0A 3MTDA 4GYJA 1F20A 1Y98A 1NL3A 1T3TA 5C35A 1JR3D 1JLSA 1PT5A 2JHPA 1U8EA 4LUCA 1MJ5A 2GUGA 3BWMA 3MPOA 4D6XA 2R5FA 1Q0RA 4DSOA 3CUUA 2C07A 5B64A 3ZK8A 3ANLA 3E82A 4KLCA 4R8SA 4JBGA 3RADC 5DHTA 3CG0A 3L1UA 3K3PA 1KARA 4JT2A 5TV2A 1SXPA 2QM8A 1U6IA 2H4WA 5BQFA 4HT3B 1XHEA 3AJRA 2GJKA 3EYAA 4Q00A 2J67A 4UZSA 2GCNA 3K09A 3EVCA 3KHUA 1OJ7A 2I6QA 3CRNA 4NK4A 2GSDA 1EUQA 5K4GA 3JZFA 4KWTA 3IAEA 1Z06A 3QIVA 1Y7IA 4MPJA 3D7RA 1XU9A 2HQ1A 2N42A 2R5WA 3KFXA 3PUVA 1KO5A 5I47A 1KP3A 1WG8A 2R6JA 3RLIA 3CR8A 5H3LA 3K2EA 3EDCA 2C5GA 1ZCJA 2X5NA 3D2LA 1TJYA 1C9JA 1RI3A 5F3DA 3FJ1A 3TW4A 4ARAA 2ERYA 3HLYA 1K88A 2VXBA 2BFNA 4N6OA 4O1MA 4C0AC 2C0CA 2BKEA 2A57A 3KEFA 2SNIE 3OT4A 3D8TA 3L6RA 3D4IA 1GU0A 2A58A 3KE8A 4F3NA 5F23A 2UUOA 1H5NA 2R8BA 2V5UA 4PXAA 4UXJA 5HDQA 2PSDA 3PKZA 3FH0A 1OV6A 1I4DD 1TM4E 3ZY2A 4YJHB 1ULSA 1YR8A 3DFZA 3FPGA 4LCJA 4PF1A 1I94B 3QBEA 3LCMA 1XX6A 1NPYA 2H1CA 4TKVA 4H18A 4AJLA 1E0JA 4Y7DA 1ZXBA 2H7XA 2JLCA 2R7NA 3A2LA 2AC2A 1N9GB 2Z3WA 1P45A 2DE0X 4ESOA 2FEOA 1I10A 3MJEA 4DHWA 3GLVA 4R54A 2P5SA 4XSVA 2NO4A 3O2JA 5LL6P 1TLLA 2YJ6A 2JA1A 1IUPA 3UQYS 3N7AA 4X91A 3K6SA 3IHLA 4W1RA 3CLVA 1XTRA 4G5YA 1LFDB 2GX6A 4ER7A 2BMJA 3HL0A 2E7ZA 4INZA 4YXFA 2J85A 3ZE1B 3F49S 1O6GA 4RIGA 4C2AA 2PKXA 2OFWA 4I50A 2HFJA 4C08A 5BV1A 1QYDA 1YNSA 2WBLC 1NJGA 2CMHA 3FFXA 5F7JA 1LWOA 1I6MA 3EZXA 2IXTA 4KHZA 1MP0A 3EUAA 4Z0HO 1IN4A 3V4SA 2B1IA 4G81A 4I99A 1W34A 2C2YA 2XECA 4B71A 1NKSA 2PL3A 5A5FA 5AKJA 2YHBA 2QLBA 2XMPA 4D74A 1O9GA 4G5HA 1FMFA 2CLSA 3HUTA 2IELA 1DIHA 1YRAA 3C16C 5FJIA 1B8PA 3L6BA 1XA4A 1XRMA 3JD4A 3QPDA 4NMLA 1Z56C 1PGPA 2SBTA 3QE3A 2WP8J 3QMMA 1GL3A 2TYSB 3AR8A 2Q4TA 2CDRA 3A6DA 3DKKA 1WW3A 4LZPA 3WBBA 1CF9A 2ZRFA 3HDTA 2C2GA 4J90A 2Y1GA 3VNQA 4OMFG 1IRIA 3ZDYB 3A27A 3L9WA 3ZIUA 5KVCA 5ETJA 3WLMA 3CX3A 5IF9A 1DQYA 1V1RA 1ZZEA 5C31A 1QNLA 1RU3A 4Y2HA 4IHQA 2ZM6B 2ZB4A 5LDDC 2VHWA 1HM5A 1VIVA 2H4JA 4WFJA 3R1IA 3NUGA 1NP7A 1SULA 4DMRA 4CL3A 5HCNA 1ADGA 4MYHA 1XI2A 4H27A 1KVSA 5A2GA 4DF3A 1P5FA 3RV4A 4RGVA 1P5ZB 4ZGGA 3NVKI 4CQJA 3N3AC 1NNUA 3DAGA 4P4NA 2P1ZA 4RD0A 3TQTA 1L5WA 4D46A 2V1UA 5H4HA 4O08A 5EE0A 1HOXA 1NQOA 1F2VA 2JIQA 4NPHA 3AQ4A 4D26A 3MHPA 5DNUA 2GBLA 4EM6A 1YDHA 3A4IA 4RTQA 2YC4C 3LW8A 4BLSA 3EGXA 3TE6A 3EA4A 1IL0A 1EZ1A 3L7KA 4LMRA 1XQWA 2FW1A 4PRKA 5AM1A 2Z95A 5FDFA 3NV7A 2A1UB 1SJ9A 4PLCA 2G5GX 3JQCA 3WIVA 4E4RA 3TIIA 1C30A 1RYBA 1YQUA 4R1QA 4WD3A 5E6SB 5EKUA 4EVQA 4WLNA 4OKIA 1DV2A 1W4ZA 1K63A 5KTMA 2XTNA 4HNSA 4NEQA 1E58A 5A5GA 3KKKA 4P0PB 1DKQA 2BIFA 4LRUA 4MV1A 5C3UA 2Q7OE 4B44A 4HX5A 2OCAA 3T7TA 2AF3C 4ODIA 1DG3A 4KAXA 2P3OA 4MS1A 3IUBA 4ID3A 2ANBA 2P9YA 4HWTA 3CUEF 3NDIA 3BGDA 3DM5A 5EUQB 2EEPA 3PE4A 3VPDA 4NCBA 1CUDA 2OD2A 1IM8A 4EHDA 4IGAA 3L18A 4XAQA 1OHHA 1TF5A 1Y63A 4MGIR 1N3BA 1BXGB 3B6ZA 3G2NA 4PYNA 1XZPA 4QUDA 4I8IA 4BMZA 4K7JA 5B58T 2AI2A 3UFXA 3TW8B 5HKAA 1AUOA 3LC7O 4DT1A 5JXIA 2VZLA 3FYUB 3IAHA 4Z4IA 1FB5A 3L8EA 3L6UA 4HAYA 3HRKA 3FOBA 3QVKA 4F2DA 5I9IA 2JD0A 5BR7A 2X0RA 2QL9A 3BKXA 3HYRA 2FPUA 1AQNA 3C6XA 2V6BA 4FFLA 5T8KC 1RWXA 5DWQA 5AVZA 1YFJA 4XJXA 1AMNA 1QLHA 2R85A 1SHLA 1GQSA 1H65A 5G3YA 3V4OA 3VGPA 4DV5B 1E1QA 5K0GA 1WBJB 2MIIA 3A4YA 3T3NA 2YWFA 5AM3A 4HSGA 5GGXA 3PZBA 1WDKA 3ETEA 2H63A 3UHPA 1S0UA 1F17A 3T95A 5TQ2B 1T3GA 3NT5A 5JVDF 2CHEA 1TCAA 3HNRA 2WJWA 3MLEA 3NB0A 2B2XA 2RKBA 3C3DA 4QOGA 4BPBA 4U0KA 1DBPA 1Y3HA 2GUWA 2YXNA 5JCJD 5GOTA 5M7EA 1RWNA 3ZVRA 1AZSC 1ODSA 4QBGB 1YUBA 4MHOA 1FSZA 5TQ0B 5A71A 3RKRA 5DGTA 4QZVA 4RD4A 3AMVA 2QN3A 5DT2A 2GEBA 1DCMA 3K0HA 4UE6A 1NY6A 2VP4A 2AC7A 1ZI9A 1TM7E 3AONB 1YGPA 3CINA 1KXZA 2ZYRA 3QEMA 4DR7B 1E8MA 1CY7A 2OCLA 2Q5LA 1C2YA 3O1IC 3QFRA 2BFAA 1TQ4A 3FUWA 3RYCB 4GNKA 1SZDA 1T2EA 3MRXA 5TGTA 1U0BB 3AQIA 5DM2A 1XZGA 1BMDA 2C5SA 3MWEA 3CT4A 3P20A 2RHBA 2VSOA 3P9CA 4ZCRA 3JZDA 2WG1A 3L8CA 5GTDA 3IT2A 1CNEA 4TN1A 3Q8MA 1II8B 3PC3A 4U6SA 4O0MA 3FUCA 4Y9UA 3U17A 3X44A 1KQNA 3JAWB 3V2HA 1U2EA 1IM2A 3JWIA 4E5UA 2AI1A 3KP1A 2YJTD 4S1TA 1E59A 1Y7TA 1YK0A 2P9TA 2VJNA 4Q21A 5GQSA 2HADA 4D8WA 1W7AA 3W5IA 2C8KA 3UAXA 2GN2A 4GAEA 4C5CA 2XKAA 4AJ2A 2IPOA 3M7IA 5C3MA 1FSPA 4OU4A 1JDTA 4MUYA 4YACA 4L0DA 5DTRA 4CR6A 1V3QE 4D42A 1O95D 1UZLA 4MUMA 1SUIA 2R60A 4LC9A 2WHQA 4MWOA 1U3VA 4QDXA 5KYVA 4HDRB 5REQA 3R76A 2G07A 1WBBA 4C5AA 4UTOA 3T12A 5B6JA 3K1YA 2PL1A 4WCFB 2C7GA 4ZAGA 4ZIRA 3H11B 4U63A 3TIGA 1XEWY 1MT3A 5TMEA 1KTIA 3A6ZA 2ZB2A 4YPVA 3D0KA 2ST1A 3WRVA 4CMJA 2UXDB 5F1KA 1Q0HA 2BEUB 4FFBB 1RWPA 4DNXA 1CSEE 4GLFA 1UDAA 4PO8A 4EL5A 3DTTA 1BXZA 4C4PA 3QXGA 2QZPA 2P41A 2PGAA 1OWLA 2ECFA 2WU1A 5IDYA 2BZSA 4L02A 5JAUA 4HDSB 1VGRA 3FVWA 5KSWB 1PFQA 2I4RA 4QDJA 2BMVA 4WUTA 2VQSA 3EIFA 1V7QA 3OCVA 1QX3A 1OAOC 3CGWA 3GDHA 3LA8A 4LVUA 3REOA 4Q93A 4Z0NA 4JASB 3IDOA 1ZCFA 2B34A 1EZZA 5FL7A 3TRJA 3X0DA 1NONA 4ES6A 5PNTA 1XEFA 1Q1BA 2Y92A 1J70A 3JCZA 4K6KA 2VOEA 3CIFA 1P2BA 1E9BA 2ORIA 3LOUA 3ZI7A 3LXMA 2B4KA 1JFFB 2C2BA 4LJAA 3TXAA 4WNIA 2FEPA 3IUSA 2NX2A 1NXPA 1XLVA 2W48A 1T2AA 1ZUIA 1UKAA 2YCLA 3QBDA 1CS0A 1NJ1A 4NG5A 2X7JA 3RODA 1XKXA 1ZD4A 2A14A 2XZTA 3ANYB 4F0JA 1C41A 2Z4RA 2AJTA 3TUZC 5MHTA 2FOIA 3BX1A 2QV0A 3O2SB 4KAJA 4XGRA 4BLOA 3GJ5A 1N5RA 1JI3A 3SC3A 2YIJA 3VR2A 1ZMXA 1EGAA 4D9NA 4MJLA 2V7EA 1MABA 1MQSA 4BMOB 4ILEA 3FW1A 3JWEA 4XIIA 2DBRA 3NHUA 1JAHA 1KJZA 4B6SA 5C7IO 4F3TA 2J9XB 3L1JA 1NYRA 3F8SA 2RHCA 4MV7A 5DOZA 3LNTA 2RHJA 3HDVA 4QGFA 5HS6A 5FWYA 5IJZA 5AKKA 3KEOA 2DTXA 3V8BA 3HP4A 3UTDA 2FR8A 3ANNA 4OO3A 3ILXA 2VPYA 5TMDA 5B55A 5J2TB 3U4QB 4XVCA 4UUBA 4J49A 5HP4A 1BHSA 4OHPA 5LD2C 1HYHA 2DXIA 3DAFA 3FR7A 1E62A 3QLUA 2WMNB 3GMSA 3PUKA 1ULBA 2GBCA 2IWRA 4FYKA 4J6FA 1BCRA 2RGUA 5AI4A 5K51A 3I05A 4XLLA 4DCNA 2C77A 4JOBA 5IZCA 1VSUA 2Q3DA 4B6RA 3WG9A 1RJWA 3GP8A 2GEVA 3N0TA 2ZSBA 3IP1A 1WKCA 4ZEOA 1T9ZA 3HB0A 4OHFA 1O89A 4Y2QA 2YZMA 3NHAA 5JVDA 1REQB 1VBNA 1J25A 2QDKA 1NJFA 4JBLA 4MI3A 4PPGA 4UXHA 3VU8A 4AAYA 1O4WA 1TYZA 2X2OA 2WFZA 4RZXA 2JATA 4ECEA 5CCEA 5EJ5A 1JJ7A 4GM4A 3L7NA 4DY4A 4GPZA 5HJ2A 1GKKA 4KN9S 2D2FA 1JKFA 3IJPA 2HJWA 5HM6A 4EHAA 1DBIA 4OCZA 3VPHA 1E6WA 1ZQ9A 2ZSHA 1HX7A 1ZN2A 3C3PA 1NYLA 3HJUA 3LRTA 4G09A 1SCDA 2IL1A 4M37A 3R44A 5B3JA 3ZLTA 4LVNA 4AG3A 3ZI4A 3F1LA 3C74A 4ZHSA 1HEUA 2B0CA 2HPHA 2QAGC 3KR2A 2REQA 2V9ZA 1Z15A 1ORVA 1RJ9B 2BJHA 1VYTA 2QZSA 2R4TA 3I0MA 3L7YA 3MCAA 2C03A 5DBEX 4O4HB 3AM1A 2VTEA 1N2EA 4K6MA 2ORWA 1DE0A 2EBWA 2PO7A 3FKSA 2PRSA 5BV2P 3KWMA 1IPHA 3IC5A 4B9EA 1C7ZA 4PX2A 4DLXA 4FE3A 5LB4A 1AQLA 2NUBA 3PCTA 2VKTA 2NSDA 3CZ9A 4HAUA 3THYB 4X1YB 4OOEA 4JEUA 1RXSA 1KJWA 5HPYB 1XF1A 1WVMA 1YE8A 3DE7X 1AN0A 3WYBA 3ONDA 2CLLB 1V1MA 4EKGA 4FYHA 3HY6A 2NPOA 1U2DA 3JQEA 3TIXB 1RCUA 4M9UA 4BQEA 5BQ3A 4RTPA 3L4EA 1G8JA 1T8RA 3TG8A 2ZUBA 4KX5A 4TKLA 5BR1A 1SRRA 4AULA 4FOSA 2Q4DA 3K9LA 1UIRA 4FWIB 2WMYA 1XK7A 4MTCA 4RNDB 1XALA 3I9MA 3IDFA 2GKSA 4EI2A 4WY2A 5ALLA 2C4HA 4OGGA 4RVUA 3N07A 2G70A 3WKBA 1VJCA 2I29A 1M1XB 2IKQA 2QUJA 2RJOA 2OO5C 3OEED 4N0EA 3I30X 3A3OA 4PX9A 4L28A 3A6PC 1IHYA 4W8GA 3NZEA 3AY6A 4P4GA 1O8CA 2HEIA 1YI0A 4PLWA 2W2LA 2CLHB 3EGEA 1LKZA 4JR1A 5TEVA 4EENA 1TDJA 5BWCA 1SBIA 1NV9A 4PLGA 2XUFA 3RF6A 5BQXA 1G5TA 4QYXA 1D5WA 4EUSA 3SVLA 2O48X 1UPTA 2HUPA 5H81A 1M54A 1PJBA 5E3HA 1IIRA 2NPFA 1K92A 1PWZA 2FPOA 1JFRA 1CHNA 3W6UA 3E81A 2B4YA 3GEGA 1FW8A 2J7PA 3CO0S 3M1AA 1MR3F 4KH0A 4OAPA 1YMUA 3BRQA 1XL1A 5EPEA 1BFDA 1WU8A 2QTGA 2VPIA 1WNTA 3A1NA 5HYVA 3R5XA 5EIHA 4AUMA 4C06A 4CG1A 4QU9A 2QBYB 4J91A 2IIQA 1ZXLA 1FBNA 3O8OA 1AQJA 4KVFA 3JQBC 2FZ5A 4UREA 3SQWA 2AKEA 2ZIVB 4V3BA 4B6EA 2G5TA 5JRJA 3QJGA 4KQHA 3C43A 3QA3E 4AJEA 3CPJB 1U8UA 2IP2A 4FQ5A 3JVUA 3X1JA 1TU4A 5K8UA 4Q03A 4Z54A 2W93A 4GRDA 1MIHA 3TAHA 1L5SA 5D1NA 3QITA 3TQRA 3ICCA 3NI2A 3ZV4A 4BKRA 1UM9A 1OLXB 2PTGA 2DJIA 3DLCA 3DMPA 3IAM6 3A6KA 4XM0A 3CMMA 3G68A 1LS6A 4REOA 1JA0A 2XBUA 3IQZA 4F6RB 4MB6A 2XITA 1X86B 4FZ5A 4LBZA 4J0FA 2EG9A 2GZAA 4MKIA 2WWVD 3OAAA 1P39A 4YX9A 3DC7A 4AY2A 3VAAA 3CEAA 1II0A 1KNQA 4CUKA 1SBNE 2HDHA 5LZ8A 3LBFA 5LYYA 1HQYE 2CXUA 3VPAA 4LVCA 2QMUA 1AS0A 2RIRA 4BMSA 4H1VA 2PX0A 1WB9A 3HKBA 1YRBA 4X6UA 3K9NA 3WOHA 1HNXB 2UXCB 2HDWA 2INGX 4TUYB 3CBGA 3VU9A 5LN1A 2PJDA 5CBPA 4E0BA 2RKWA 3N2KA 1J9EA 1W1WA 3IERA 3S70A 4E22A 1Q0UA 2ZBQA 2F43A 1W5SA 4MYCA 4P31A 4X3CA 5BXQC 1S9DA 5AVYA 2O2IA 1DOZA 1DC6A 5HE8A 3V7YA 1CUBA 3Q9SA 4L0CA 3S68A 1ZJWA 4B3TB 5GONB 3E4DA 1L7PA 2DMRA 2RGNC 2C2XA 4CKYA 4Y9DA 5KJ6A 5DLDA 3TLMA 2A0WA 3IBFA 2HD4A 2XAAA 4G84A 3QMWA 3DOUA 4Z9YA 3ENNA 5K0CA 2C96A 3P0RA 1NW6A 3PTLA 1Z26A 2XYPA 1PUXA 3QY9A 3ZDQA 5IUNC 1WUIS 3LLVA 1JBQA 1ST3A 4FX5A 3GOHA 4LHEA 3TJMA 3CISA 3KJIA 5IDWA 3OJEA 1B3RA 2TS1A 2F6RA 4V1CA 4UVDA 1YSCA 3PRKE 4MZDA 4LDJA 3EEFA 3KUKA 1RRKA 1L7QA 3WHKA 3IUQA 1CR1A 1WXQA 4CGZA 2JH8A 2HV8A 3KKLA 1HR0B 1AXRA 4KMRA 4DQVA 1OHHD 2X77A 4OQXA 3OPYA 3RQSA 3KSDO 3LWBA 1AK2A 3LBAA 3NX4A 2OZEA 2O2JA 1R1DA 3PJFA 1PV4A 1NURA 2J3MA 3EUFA 3ZWAA 5DCYA 4FNGA 2E21A 1FUEA 3ADCA 2BGJA 1DKOA 4HMQA 4KIUA 4QUJA 4GZ3A 1XCBA 3HJAA 4FB4A 1V16B 1GG9A 1P17A 4BAZA 1DO2A 2B8JA 4TZKA 5JMTA 1NVAA 4FGKA 5CIQA 3ZGZA 5C8YB 1UMKA 7AT1A 2A8YA 4EPTA 4CI0B 5FI5A 4BKOA 2C92A 2PUJA 3NHYA 4HXYA 2W43A 3DE2X 3IGFA 3MTIA 1EJ0A 1JLRA 4YK7A 1V5EA 1VE7A 1OW3B 2QRPA 2WT9A 1RI4A 3BA6A 1OFUX 3L0CA 1YMQA 2Q3BA 3MF4A 3GZNB 3NBXX 1C7JA 3RJTA 2NT3A 3E22A 1R0BA 1YS4A 2X1HA 3G23A 4PNPA 4W99A 4XDGA 1N5KA 3LQ4A 4KKXB 3U40A 3WNDA 4G3XA 3ZCPA 5JD4A 1KZ6A 5DNCA 1R16A 1XWFA 4RDHA 3SYLA 1KK2A 1DZ3A 3AL2A 2FRXA 3FN4A 3G5MA 5TY0A 3J81A 1HFJA 2QD2A 3HS3A 5KJEA 4WERA 1VDZA 1VPLA 3H75A 2YYYA 2PU5A 3ZNPA 3H97A 1U0GA 1TF2A 3A04A 4NABA 3FPHA 4I4IA 1J2RA 2XB8A 1TJ3A 2H00A 2HIAA 4GE0A 1D6JA 1GADO 4TVSA 3HVJA 2VHVA 2V4ZA 3NHFA 4CMHA 5JYCA 3GLTA 4BNTA 1M0SA 3SC2A 4DRXA 3CRQA 2AMJA 1KJQA 4NOMA 3HA3A 3KK0A 3ZJ5A 1FVXA 4RADA 1PK8A 6REQA 3QWFA 1WETA 2VDPB 4UCQA 2D1SA 3DFFA 1TZBA 1PX0A 5T41A 4OAQA 5A3JA 1MD9A 1T1GA 3AILA 4IILA 3FNBA 1Q1QA 3R7SA 3R7NA 1XNHA 3CNNA 4KPEC 1A4XA 9ABPA 1L7NA 1QH0A 4QNRA 4GGMX 2RDMA 4K87A 4MRRA 1MAWA 4NK5A 5E6RB 4BO9A 4BU1A 4DWJA 5JC8A 1SXJC 1QGZA 3CV3A 4CI9A 4R01A 3ETCA 4KEAA 4F9EA 1R3DA 3LVQE 3F71A 1JWAB 3N8HA 4R51A 2GQ0A 4A0FA 1TFUA 1EXVA 2DWPA 4FKZA 1FW6A 2AI3A 1W85A 4TOIA 3ETGA 3DNPA 2D5AA 3FOAA 5LOVA 1M8PA 1XVAA 2KQUA 1F12A 2QNBA 4H0FA 3SQMA 4QM7A 3BPSA 1R10A 4NZOA 3GR6A 4K9DA 4GXRA 3ZEIA 3BK2A 2AGVA 2RH5A 1R7RA 1N36B 4L7VA 1PJSA 2WHPB 2DP4E 1X1DA 4UHCA 5A4MS 3RFTA 3BMQA 4BYMA 5BWNA 3L40A 3P1JA 1N1DA 4DUZB 4XYGA 2O0KA 2HHLA 4UMDA 2O05A 4KMMA 4Y2YA 3H5TA 3DHYA 3T7SA 1IBLB 2DLNA 1E61A 1QHHA 3I2IA 5IC4A 1O57A 4IDOA 1ADBA 3RANA 1YDMA 4IOMA 2FRVA 3ZD7A 3JALB 4V0SA 4WK4B 1AHPA 4TXHA 1IOLA 2PMFA 1TCVA 2Q28A 1G2PA 3COZA 5IJWA 1ORRA 4ROTA 1H2FA 3FUVA 4RO0A 3ROGA 3PGKA 3VO1A 3TJZA 1UODA 3FYCA 1FFBA 5BUSA 3PDWA 2GAAA 4YJGA 5AKLA 1HZZA 2AZTA 5AJYA 3IIMA 4JT4A 5FL7D 1UXIA 2EIXA 3R41A 2CVFA 3CJRA 1TIKA 1FFXB 2IIVA 3R5SA 4LTDA 1HO3A 3VZBA 3TO5A 1GGHA 3OA2A 3I61A 3HGTA 2ZS9A 2FN3A 3ENKA 1J1IA 3KWJA 4MGZR 1CYEA 3R9XA 2RCYA 1UKZA 3KXDA 3WYGA 3L43A 4ME6A 3T0FA 2VT6A 4KLNA 3SX2A 3N6RA 4MK4A 1BKSB 3HXKA 3VH1A 3KQHA 4AMGA 2IC5A 3H4VA 4B3RB 4P7FA 4MI9A 2NZVG 3A70A 4N5DA 1DT5A 4XWYA 4IDFA 4KLRA 3BAZA 5EWMA 4ZXPA 4BNFA 5HIJA 5A3RA 1P44A 4FONA 4BNNA 4OXIA 5BW4A 2OC4A 5EHXA 4JT8A 4W7HA 3F3YA 2H1LA 5T6BA 1S5PA 4NAVA 4COKA 3R9IA 1KI3A 3IKLA 2CJFA 2VEOA 4RFSB 3KL4A 3P9SA 4KKVA 1A5SB 2OHHA 3OBBA 3SZOA 3UOGA 1UFVA 4NTZA 2PUVA 1SU4A 5F1YA 1UMDA 3DBVO 5ILOA 1KJIA 4YPFA 3SN6A 2VDRB 2DYKA 2JL1A 3UJ7A 1JDBB 2WG2A 5F9HA 4K81B 1PNOA 4CBVA 3JQAD 4B4UA 3NWJA 2HT1A 1GTG1 1TM5E 1ZM2A 1S4MA 2ODPA 1CVRA 4OUDB 5LFAA 4J1TA 3DVSX 3N75A 1XZEA 2EKPA 3GJSA 4BO6A 1A8IA 3HBJA 2VJDA 2OGUA 3QPUA 4ZGBA 1USGA 4IAOA 3VJMA 1DQPA 4XVHA 4MI1A 3WK7A 5J2UA 3JQ9A 4NJEA 4NX2A 3AVPA 5LNK6 3UUFA 3OOYA 1HDYA 3B3QA 1SCKA 2ASEA 1M2OA 3C6MA 3GFTA 1VJGA 4EB6A 5IHXA 4EPWA 1OJLA 3M0EA 4PC1A 4ZVQA 5BSKA 2WD7A 2IBTA 2A9JA 1BAPA 3OI7A 1WO8A 1L5OA 1W49A 1OIVA 3RWMB 1L4UA 3BEDA 1D4ZA 4FIZA 4B6JA 5K4HA 2DQSA 1UK9A 4G26A 2XNJA 4RELA 3DMDA 1Y1KE 2SCUB 1QIIA 3ANSA 4WK6A 3WTCA 5JSZB 4NJOA 1FVOA 2BRUC 5KQSA 5KS2A 1S01A 3BE4A 1ABEA 2OILA 2WWGA 1GZ6A 1O77A 1OI7A 1NXXA 3T38A 4UEOA 5AVJA 1NSTA 2YZ7A 5L4SA 2Z83A 5LQRA 3G9QA 3JAKA 1T9GS 2BI4A 3V80A 1P3Y1 1E9FA 4NZZA 5AK4A 5IC5A 2HF2A 1QE0A 2W5UA 3F47A 3ZWYA 4BAGA 5A9SB 4Z7QB 3BMXA 5LWQA 1EUYA 4E88A 3GFQA 4DLKA 5K6TA 2GNPA 1RRVA 3CZPA 1II9A 3IHTA 2FNAA 3LPDA 4IX1A 3NC4A 4OHKA 1U3CA 2Z6QA 1SVSA 2ZCJA 2VJLA 4DXHA 3D7KA 3H5RA 1JG7A 3C7DB 2WAAA 4R69A 5EP4A 4E5PA 1ESZA 2NPIA 3DF9A 3UXEA 3GLGE 4HWKA 4JYCA 4D82A 4CRWB 2ZWIA 3IESA 3A6FA 3KDSE 1V7ZA 2FPIB 3TZCA 2FMUA 1CBUA 521PA 2Q9UA 1QZZA 2FZEA 1SU7A 1JIIA 1PJRA 2BHSA 5BN5A 3EA5A 3RJ5A 3QKRA 4KFSA 4GPD1 1OROA 4BBAA 1U4OA 2LP4Y 5CA0A 2IS6A 1A7KA 2JGMA 4J03A 1IZYA 4RY8A 4LF5B 3G7NA 1C3LA 1RKUA 2FGJA 2IZ5A 1D9XA 4QOIA 3UJ6A 2VRBA 4NOLA 4W5OA 2PH5A 3E1GA 1ZSNA 3H3JA 3DOIA 3JY6A 3KRTA 3TDKA 4BP9A 4CF7A 1ZL2A 3F7OA 2VA8A 3MINA 3OX3A 4E15A 1U8XX 2FV8A 2NUAA 3CKYA 2J48A 4FC6A 2PK3A 1KORA 5FOSA 4XQEA 3R74A 5IXSA 1XNGA 1KQGA 2I54A 1HA3A 3JASB 2J5RA 3MLBA 1DHRA 3CEPB 4M0PA 1YS7A 1SOWA 2VUTA 5AHKA 4K3UA 1E3SA 1Q11A 3C1AA 4P9NA 2W2LD 4BFXA 1LJUA 4FYYA 4KJXA 5LJLA 2VK8A 3OPMA 1IATA 2BBWA 4K6FA 4L6IA 1KOGA 1FL9A 2GLXA 3HSSA 1JEYA 3AHFA 2ZIAA 4KXWA 2D0PB 3D7MA 2PGDA 1Z5UA 2V45A 3ZQJA 4DJJA 2G88A 2XTMA 2BF7A 2J7PD 3CYFA 1IG3A 2WOJA 1A8SA 2YMMA 4EPXA 2OV1A 3JATA 4BPRA 1MA3A 3WV5A 1BJTA 2FR8C 2BGMA 2NAPA 3OHSX 2QRMA 3Q6MA 5FWDA 3TM4A 1A7JA 1L5HB 1YIOA 2H5LA 3IKMB 3NCHA 5DYGA 4YAJA 1CJCA 5IAAA 3PLAE 3DBLB 3H04A 2P75A 4M4SA 3RARA 1R9MA 3IL2A 1N34B 2R47A 4Z49A 2OP0A 4JLNA 2IEDA 4FLFA 4H6VA 1E2LA 5KUTA 1DC7A 3I8XA 1STOA 3LQFA 1J06A 4DLVA 3SICE 4WBNF 2YJ3A 1V0JA 2JGDB 1AG9A 3HJCA 3PNVA 5DULA 4KQGA 3GDOA 1VKJA 1XTVA 1UPAA 2OSVA 4DG5A 3NC0C 4LYJA 2OHIA 1LTQA 2Q6KA 2YOGA 4RZSA 1A9OA 2ETXA 2IITA 1QSGA 4D4GA 4ISCA 2BEKA 4LZLA 1NW8A 4EEZA 4DIOA 1GQRA 1A4UA 1I7DA 3I39X 3E3OA 3FOCA 3PQFA 4KAAA 1JTVA 2CHGA 2B2NA 3LZ6A 4MVJE 1RWVA 3G9TA 1NFRA 5CFNA 3E6AA 3KTOA 3L8GA 5CFOA 2D7DA 1I7LA 2GJSA 4D3XA 3MMZA 4XRRA 1K5DA 1Q2XA 2FMKA 3PXBA 4PW0A 2JASA 2DFDA 4EY4A 4YMIA 3Q7TA 2P78A 5CFQA 3IR6A 4DDHA 4S1VA 1NV8A 2WMDA 4N1AA 4DJ5X 1O97C 3BJEA 1IN8A 2RFLA 3KVNA 1DDGA 1P7WA 1KERA 3BMCB 5B7QA 1AT1A 2WB4A 5HJEA 3ZCUA 5CIYA 3H05A 4KQJA 1VB5A 1KZGB 3DTVA 2GPNA 1CZKA 1ZICA 4OYHA 3ADBA 2IRWA 2OAGA 2YJ5A 1JE1A 3COPA 2W2MA 1U2DC 4ZJZA 3UA4A 3N0WA 4F04A 3UMYA 5CURA 2FEMA 5DLPA 2C3YA 1YDEA 2JJYA 3VNBA 3IPLA 1MOZA 4F60A 1KTVA 1BQ3A 1PO7A 1YB1A 4OIFA 5FYDA 4BMCA 2CBZA 4X1KA 3RVSA 3ZOKA 1FTQA 2UZAA 2X5KO 3SGLA 1RACA 2QL5A 3E1KA 2QJWA 4ZDWA 5I6DA 5HBRA 3C2QA 3DE1X 4JI0B 4ETNA 2AD5A 2IFTA 1M1UA 2WUEA 3CEJA 1F2UA 2ZJ0A 5JDCA 3CLSC 1LB1B 5IYZA 2JVKA 3PVZA 2HR1A 2QTTA 2V5VA 3WI7A 2CN1A 4V0LA 2AX4A 2O0MA 3OD1A 5HIAA 5D85A 1UC5B 1RAGA 3K0CA 3M2PA 2NYAA 4FE7A 4HXFB 4O4IB 3HVKA 2I76A 2AN1A 4FOTA 4IQFA 3GIWA 4YA6A 1SN7A 1A8PA 5F9FA 3R9XB 3ENQA 3NHBA 4UU7A 3VOAA 5FTNA 5IU6A 3O1HB 4OY3A 4JI5B 2O8BA 4JKYA 4DEYA 3ROTA 1EB9A 3UWMA 2VAVA 4YVFA 1O2DA 1GV1A 2IODA 3KOWA 3UENA 4BFLA 1VOTA 1Z2NX 3GZTB 5G4KB 1X8JA 4IWXA 2NQ8A 4IIDA 1IXKA 3I9OA 1X7WB 1QFMA 2FWAA 2D4HA 3WGQA 2VWHA 2NVUA 3JQ6A 4IDEA 2DWQA 4MVJF 1WRBA 4GX2A 1T36B 2HNAA 4BLVA 3B3JA 3QU7A 1EFRA 1B1CA 2Z2JA 2ZB7A 4QIHA 4DV6B 2P2NA 1QGUB 1O94D 2J6BA 2V98A 3C8DA 3Q40A 2HU7A 1JG1A 3TFWA 3V8VA 1EK0A 1MEOA 1KSHA 4ALMA 4MHTA 3GGJA 2Q3MA 4OLJA 5DI3B 2QPOA 5ALWA 2O8EA 1Z6QA 2F4VB 3DO6A 2ZRMA 3IBYA 5DJ5A 4BMYA 3IPYA 4KIGA 1JQ3A 1YBAA 1VSTA 2PRIA 4EO7A 4RVNA 1XYGA 3NU1A 4YCDA 3W4JA 1U2GA 2ZXUA 1LVHA 1I9GA 2CCKA 3EWSA 2BKUA 3KWFA 2HEGA 3IP5A 3O8QA 4N5NA 5FTJA 2VPWA 4GYWA 4ZVPA 1J0XO 2CDAA 1MTZA 1FU4A 1ELOA 3ZZ0A 1UBSB 1ZOPA 1NBWB 1FQWA 3LZCA 3SZUA 3ZIDA 4X94A 2H1VA 4RK4A 2GYUA 1TAQA 3QHAA 4URZR 5KDOA 2JIRA 1OX4B 1CG6A 3SEQA 4HL6A 1S7GA 2ZVQX 3AB7A 4O6VA 4R7GA 5K3AA 4BNIA 5AYVA 2IE8A 4WNAB 3OZIA 3K9GA 3F4KA 3H2IA 3RSGA 1ZK2A 3H9GA 3OEWA 4MDEA 4J7CA 1UJNA 4WBNA 1QLJA 2P6MA 1KYVA 4JLMA 4R71A 1DC3A 1KY5A 2DF8A 2JFYA 1VPTA 3M2TA 3MRTA 3D1LA 3EEIA 4FD2A 1QFSA 4YJHA 5HEKA 5FUMA 1R15A 3GLGA 3SFZA 2XZPA 5C46F 2ZSEA 1DC5A 1JYEA 3VR6H 2QTHA 4GOXA 1PL8A 1R8YA 1J20A 1N9GA 2HT6A 2QIOA 1HC7A 1X1EA 2V74B 3VR4H 1JYFA 1JDZA 2J3KA 3DWEX 3ESXA 3S7TA 4OQZA 2PZ8A 1UQRA 3EIUA 3STTA 1UM8A 4W9MC 1GKIA 1H2YA 3ZHZA 3SFTA 3ZWQA 1PG0A 1D1SA 2HSDA 4UTVA 1NW4A 1YH3A 3ITKA 4U9UA 2JIOA 3LAWA 2O2CA 3NQ41 2HLPA 5G4LA 1Y6ZA 1N2GA 3E61A 4QA9A 1UKEA 2XCUA 1X77A 1FDWA 3U4GA 3AT1A 3BB3A 1E1CB 4R2LA 4ERNA 1NLZA 5KQGA 4P3PA 3AM4A 3BK7A 3EC1A 4I3HA 5EZYF 1A50B 1K7CA 1M66A 4PHHA 1F4VA 2XXAB 1OH8A 3R6GA 5JNLA 1EBUA 3LK7A 3S2IA 1K98A 2GEJA 1H6DA 1K9VF 2O7SA 3GDGA 4JYBA 4MQMA 5DWDA 1QIFA 3TL2A 3AZOA 4DZZA 4EJSA 3TSAA 5I8ZA 5DM1A 1E6LA 3DAHA 3AVTA 1P91A 4AM8A 1QGYA 1OLSB 3OOSA 3PVCA 1ZPDA 2X0IA 1VYVA 4JYPA 5IAKA 1JSRA 3MAJA 1V5IA 2E2WA 4H2DA 4KQCA 4EYGA 4MP6A 5H16A 5ALQA 5I9MA 4CTJA 3D3WB 4KYUA 4YQZA 1EP1B 2J0VA 1LA2A 2IYSA 2V4MA 3CUYA 3Q7SA 2PRKA 1ML4A 1U3WA 2NYVA 3T7KA 1V9LA 2DC1A 4KYIB 3SKXA 6PFKA 3H5VA 4B74A 1Z8HA 1LJ8A 2RGRA 4ZJYA 4B48A 3ZBQA 1LDEA 2ONYA 4CU5A 2Y1DA 4QO7A 2XVAA 2ATIA 4GYKA 4IIHA 4JODA 4O2AB 1GUYA 4YALA 3S55A 4J94A 4UBMA 4DN6A 2H5EA 2ZYWX 4EKEA 1DAGA 1H9BA 3VVLA 5I9LA 4XIJA 2VNSA 1K7XB 3O75A 3FI9A 3KVYA 1R0RE 1MRNA 1SWVA 2PH7A 1Z18A 2JFPA 4IJ6A 4CIAA 2ZI4A 4ONEA 4DUPA 4J16A 4Q4AB 2RGAA 4Q7EA 3WQSB 3ZWOA 1P73A 2ZIFA 3SIWA 3N7TA 1LQ2A 4RZ2A 3P0FA 1W48A 1JPJA 2R8XA 4EFLA 1N3IA 2G28A 2ZSAA 4XQ9A 5KWEA 5JZMA 3KJQA 5F64A 1KZHA 4Y98A 3BYZA 3CRW1 3ZHOA 2OQIA 1XZAA 2RHTA 4N7MA 1RWKA 2JZNA 2ODQA 4R3UC 5LQKA 2NM0A 2R1TA 4LS3A 4RLHA 4K40A 4CEJB 3ELYA 3WXMA 1KBOA 3B3AA 4I6EA 4RK1A 4RXTA 3M6WA 3WDSA 1UMCB 6CHYA 2X0JA 4I8XA 1NNSA 3W9SA 1Q7RA 3J7TA 4NE9A 2VXOA 2A1UA 4OI2A 2C83A 3VOTA 2J59A 2QYSA 3BCRA 1W88A 4F8YA 2AYYA 3RS9A 5KSYA 4M0CA 1LS1A 1Q17A 2FWNA 2VDMB 5E6SA 4A23A 5K0ZA 1I80A 3KQVA 1J97A 2WM3A 3OLVA 1MOQA 4J0IA 5LYJB 1CY2A 1M74A 1XEXA 5A4IS 2HPZA 1T6YA 2WM9B 3NHSA 1IJFA 3TSZA 1DUIA 4D41A 1CF4A 1NXTA 1U3TA 4ZT2A 4GEKA 4BTVA 5BSFA 1DLJA 3X1KA 4C2BA 2FQYA 4FB5A 4FNAA 3EDMA 1QKIA 1GQYA 4ZKEA 3C4JA 4D4HA 1Y6FA 2XCRB 1M72A 4RYDA 4DQXA 1NXSA 2EBFX 3AO0B 3VR4D 4ZODA 2DX7A 4LI3X 4RCVA 4BKQA 1SVIA 3DYIA 3TI9A 2O23A 1BXGA 2SKDA 3KT3A 3WL5A 2Q8NA 1G42A 2H7VA 2PZEA 4FCVA 3TW8A 2ZULA 3N9IA 4F46A 3O31A 1R4AA 1DCFA 1I3MA 1QTNA 4F5WA 3RK0A 2NWQA 4NATA 3AEQA 2C31A 1ZHHA 2HLDD 3QE0A 4YAUA 3L4JA 5A1TA 3WZMA 5FTLA 4NZNA 4D43A 4DRYA 2N47A 1R64A 5EHGA 1BEEA 1BMFD 1WZUA 1ZRHA 2P27A 2YMPA 3MOSA 3WMRA 1ZS9A 4PLVA 4I5FA 2VTBB 1GEEA 4L8LA 3KYIB 3RC8A 2JAHA 4JXZA 3HWX1 1TKRA 4AY4A 4DLTA 5KNCH 3DQQA 1IZ0A 2IHBA 2FDXA 1D3AA 1MVLA 2ZPUA 4E13A 3IVCA 3ESRA 5TQ2A 4EY5A 3WRXA 1EINA 2AK2A 2DFVA 4RAOA 1HZZC 2I87A 1E9SA 1P4GA 3ABIA 2VQDA 5BNTA 5B1SA 1KP9A 2FJUA 3OTQA 1HZJA 2XR1A 5FUBA 3W8RA 1FU7A 1T34A 4BNJA 2ONJA 5K3BA 5TQ0A 5DTJA 2DQKA 5A06A 3N5CA 4ESVA 1BWPA 3GN2A 3M6UA 4OLFA 4R1OA 4QASA 2IY7A 2WKQA 4PONA 4F6CA 4LIPD 3O2NA 2OCXA 1OZFA 1YXMA 5BPFA 3OO1A 2I1WA 2D1QA 1W36B 4E51A 1NXWA 3TUIC 1DAOA 1SOMA 3V32A 1TO6A 4B81A 4MEBA 1XTSA 3I9LA 2WYOA 3OLZA 5SY6A 3RYCA 2XNDA 1GZ7A 1SUPA 4G0QA 5A0FA 1TZCA 1HDEA 4A92A 4R8VA 4C7VA 3QUSA 3HXQA 1I7NA 4GZMA 3J81k 2TRSB 2Q3EA 2H4XA 4IH9A 3IQXA 5F7OA 1NBAA 3AJEA 5EZYA 1M2JA 3A7DA 3ON5A 2YV1A 5I7VA 4HVTA 4J0EA 3HM9A 1JMKC 1NDHA 5D84A 1Z13A 4BU0A 2BFCB 1ZOLA 4D99A 4Q16A 4QSHA 2IYAA 2YXBA 4OB6A 3UCFA 3UG7A 2Z4SA 1K4YA 4KE6A 2W37A 5DX0A 2VWQA 1NVBA 4FGZA 1YIAA 3FA2A 1W8DA 4GBED 3HUFA 2QROA 4X92A 4EI9A 4QVGA 1ODJA 2D00A 5I7HA 1LBIA 3EGIA 4F85A 4LF7B 2ZJOA 4X1IB 1Y9EA 3UWDA 1UZUA 1Q16A 4TS1A 4YCCA 5KMGB 1ODLA 2BGNA 2WSSD 3OQ1A 1VFNA 1H4TA 4QQFA 1SVKA 1N0WA 1UBFA 1B23P 2I67A 5IKPA 3PG5A 3INRA 1MEEA 4L9RA 3MWYW 4KH1A 1ZH8A 2G83A 4TKMA 3B9RA 1K8QA 4WCFA 4ECAA 3H11A 2CNNA 3ER6A 2PXHA 3ABQB 3OIVA 3GF4A 3ISTA 1HYGA 2BL4A 3GGOA 1KU0A 3QEKA 4G0YA 4V2IA 4WXPA 5J9FA 4DW8A 5LLDA 5B12A 4NF2A 1XXHB 2YJ4A 2O8VA 4FFBA 3ACCA 1XPUA 5CITA 3HJRA 2HSGA 3RO7A 2QSYA 3WE7A 3NCTA 2JI6A 1N6LA 4XCXA 2QAIA 3I4FA 4Q3DA 1HT2E 5CLHA 4NNPA 3FG9A 1M10A 3OQIA 3DE3X 4MPTA 4W1SA 2WTAA 1FYFA 3RE1A 5DF1A 2OCPA 4GQAA 1U2PA 1SVNA 1XL0A 1QRTA 1UT6A 1V4BA 2Z5GA 1AKEA 3FKQA 5JXGA 3ECCA 5AR1A 2C3MA 3UMJA 2WAMA 3N2GB 1TQ2A 1F38A 1Z35A 2I2FA 3PNSA 2A0YA 4DILA 4OQQA 4HQLA 4JR0A 1JFFA 2VVTA 1CUZA 3CKLA 3WSVA 2FVYA 4MKZA 2X9QA 3MA0A 5KNCD 3MJFA 1RHUA 4OB8A 4HYEA 2PWBA 2QXUA 1EFDN 2QYOA 3MWDB 4H7KA 5KSPA 1SC4A 3C5WP 3WLSA 2EG5A 4S1OA 1UEIA 2KS6A 1LPSA 3IPCA 1RT9A 4L74A 3IOBA 4E5SA 2XCSB 2C2ZA 5L6MB 1QYRA 1MJNA 4ND4A 5T4FA 4EG7A 2FMFA 4ND8B 1B3BA 1QRSA 1OH5A 4BBPA 2XCOA 4QRIA 4PS0A 5KQRA 3WA6A 1A5BB 1RHMA 3Q5GA 5KJFA 1OFTA 3ZDZB 4Y6SA 1KKUA 3UH1A 1H0HA 3C3AA 2BKXA 4LNUB 3M4YA 4TL9A 5J2TA 5KHAA 1QBGA 2NV6A 4UBJA 3OLCX 4YONB 3UJPA 4HZUB 4E21A 3U4QA 1RKBA 3BH6A 4EB8A 5IKEA 3CH5A 1GCOA 1UF9A 3JXEA 3I58A 2BR4A 4RFLA 2Y6VA 5EI5A 1TU0A 1EM8B 5JAMA 4TMZA 2QUZA 1CUGA 3TN7A 1JB1A 3U6BA 2DJ5A 4TV8B 1Y37A 2ZYAA 3GO4A 4QBFA 1QQ6A 4Q1VA 5KJCA 1QAMA 2D13A 2RC6A 3NHWA 2PGIA 4JYZA 3HXTA 3AWIA 3H42B 3L6CA 5IWAB 5GJBA 5JD6A 3AR7A 3KTFA 2GJ4A 2H17A 4IJUA 3FTEA 4C21A 3I1YA 1CZNA 2NV0A 4AJHA 1FFWA 1REQA 1J9ZA 1MDBA 4RKWA 3LQYA 1M2EA 3D31A 3RHSA 5ICGA 1L4BA 5EEGA 1PS9A 1YR7A 621PA 2QRQA 2AN3A 2ZSFA 3MM4A 3ZIAA 3VUEA 4DSTA 4V03A 1BW9B 2JCBA 2BZGA 3FPFA 3ADPA 4R83A 1ADYA 1EFRD 3DOEA 3OIYA 4DGQA 2F3TA 3U3RA 3WB2A 3ZHYA 2NUPA 1HDXA 3OPXA 4YRGA 1C3OB 3WAJA 1PP4A 3BKWA 3SHOA 4EYEA 3SJCA 1SPBS 4R4JA 4BMVA 1EG2A 5BN3B 4NOKA 2I1VB 2BKVA 3ZWMA 4XM1A 1RJ9A 3WRYC 2AWNA 4QGGA 3S2SA 1WCYA 4G4JA 4KFRA 3DDCA 2ZRJA 4HGZA 4OX9Y 5IG2A 1G3QA 4AJ9A 3BD9A 3H9BA 5J47A 1PD0A 2XMBA 2AB0A 3Q7QA 1MX3A 4NARA 4U5XA 3DD1A 5IM5A 5C4GB 1CK4A 3RSQA 3OTGA 3UZUA 4BVJA 1F7UA 1HI9A 2PJZA 1A4RA 3LCUA 2CY0A 4ZO8A 3OZWA 4BVHA 3P96A 1DU4A 1DEKA 1NG1A 2QHXA 5CU7A 2DRIA 1NX9A 1YB6A 4P2GA 4X1YA 5CDUA 1YL6A 2J0SA 1XFDA 3E9QA 4LMBA 3BTUA 3IUEA 4M1EA 1O5IA 2D3WA 2H4YA 2GZHA 4LHZA 1G2IA 1OZGA 2NZ8A 3FYSA 4I6GA 1NF3A 1I13A 3N2ZB 1CT9A 4P5EA 5AUPB 2IF2A 3U16A 4LBWA 3TGWA 3P5BA 1QP0A 3WB0A 3IHKA 1N32B 4WKPA 1TAHA 2QRKA 3P5SA 3G0BA 2RH9B 4GI2A 4IQ0A 1XZBA 2YUTA 1HL7A 1UJ6A 4TL8A 2OY0A 2CUZA 1W35A 3Q5DA 5FPHA 4F7WA 5ERYA 1TO2E 1J8FA 5LZ7A 1T8SA 2UVDA 1XMIA 3OM1A 1HT0A 1QRRA 3BZBA 2VK4A 4F92B 2PXAA 1VXRA 3PNOA 5AJVB 4Z9FA 1LY1A 3WLRA 3ES9A 4IRMA 1J7KA 2G77B 1PG2A 3U4HA 1G6KA 3EVNA 2IZ1A 1JFTA 5JLAA 4MVJG 4GLBA 2BD0A 1KPGA 5ANRB 2NTEA 4KUEA 1KEEA 2ZTHA 2GEFA 3ACBA 4KW7A 4WTOA 1B8UA 1F14A 1JECA 1QUEA 1UOQA 3AFNA 3AK4A 3D59A 4RSRA 4U1RA 2EW1A 3ROEA 3TNJA 2Q0SA 4YXWD 1OILA 1XCPA 3HN6A 1D09A 3LX5A 1GUDA 1G8FA 5EMLA 4COOA 3VDNB 2REOA 2XTZA 2YS6A 4F1KA 5C7OO 1E69A 2GCPA 1H2WA 3RC9A 4ZO7A 2EKZA 4E4TA 4WA8A 3CRVA 3UJHA 1U9ZA 1DIBA 2F00A 4IUYA 5CYGA 5EJMA 4UE2A 5L3VA 3PQDA 2AMFA 2GYYA 2V4UA 1HGXA 3VJRA 4E7PA 3K4HA 5LBTA 1ZVKA 2VHZA 3G5AA 4Z9XA 5DEIA 1SHZA 1UBNA 2PLAA 3O4RA 2PYDA 2OK7A 1C8KA 3DLPX 2HBRA 4YLEA 5FA5A 3Q7PA 3AF1A 2QM7A 5JWHA 4DQDA 2VYVD 1L6IA 2ZZKA 3GVHA 2P2DA 1SUAA 5LXTF 4CMGA 4PHFA 1PGQA 3DKPA 3ASVA 4WXHA 4YR9A 1T5SA 1K7FB 3RVLA 2YVAA 2BONA 1W46A 3M6IA 1I0IA 1WMEA 1ZSYA 2ZRPA 1RM3A 1ZO8A 1XAIA 2PKQP 3DMRA 5EJFA 2L17A 3NGMA 4F6RA 2HU2A 1JKMA 5C37A 1E7MA 1O87A 1YI1A 2RARA 2HN9A 1TPYA 3F2IA 3HQ4O 3O9ZA 3VYWA 3W77A 4BEJA 1S2NA 2PFGA 1FJGB 1KI7A 5JZBA 1H8EA 2E6UX 4ZYXA 5K6AA 5I4CA 4TQAA 1BEUB 3A9CA 3G2MA 2W6MA 1Z6ZA 3CRMA 4URHA 1X9HA 5TNXA 3ZHUA 5IJ9B 1DSSG 5KOHB 1FTSA 4W9NC 1YA6A 3W2IA 1XJQA 4JJZA 4EQ6B 1JKXA 2O1WA 5IXJA 1VTKA 1Q92A 4EKIA 1LQTA 2X8WA 4L2IB 2WAOA 4PZYA 4TUYA 3F6EX 1VE1A 3N2LA 4NOJA 3K92A 2JDIA 3MRVA 4P80A 4F8EA 2PX6A 4QPZA 1ZAYA 3KAQA 4N3AA 1ZNWA 4MIEA 4RMGA 2HX1A 3SR4A 4Q37A 2LW7A 1LVUA 1QP4A 2OFFA 2QD4A 3LQQA 1M6WA 3FHTA 1HBJA 3AKZA 2Z30A 4S1NA 5GONA 2I34A 3ETJA 4XKJA 2QTFA 1L7BA 2PD6A 3RRJA 4CKEB 3MD9A 3U48A 1J5XA 4MVJD 1QCDA 4YRFA 1D7AA 3EUWA 1PDOA 1KDTA 1EIZA 2W58A 3ZZUA 5I7RA 1EFTA 4HTAA 3QFTA 2YZ2A 3WHLA 1JT2A 4JD5A 2Q1YA 4DM7A 4YT2A 2QUKA 1V8PA 3RWOA 2GRUA 3WLIA 4EABA 2XXBA 1CWUA 3TJRA 1R0LA 3DCIA 2E3JA 4C0JA 2AZXA 1UKCA 5ECWA 4PR3A 2XGGA 3BT7A 3WQRA 2ZROA 5HFAA 4BFUA 2YFKA 4NH4A 3NYWA 4WCVA 3T1OA 3PIDA 4MCIA 5BSUA 5JJBA 3L4BA 1PR2A 5U1PA 1QF9A 4Q1FA 3INGA 3ZUPA 1XAGA 1T5HX 5G02A 1O54A 4O5AA 1LDBA 4NEHB 5INTA 5L4NA 4NONA 5GM2A 2EHJA 1N3YA 2QENA 2NU6A 4OHRA 4YMTA 1E2PA 1FLAA 3OIGA 4H7DA 4RTNA 2P69A 4CF4A 1RIIA 1V16A 1HQKA 2FW9A 2R97A 1K5GA 1AURA 2OVFA 3L1VA 4IG9A 5LC1A 3R20A 2CNOA 3MBKA 3VYVA 5LPNA 3M6AA 2C9YA 1GNTA 2NZJA 4DANA 4GOKA 1CIJA 5JFOA 4MULA 1O6FA 1D2CA 3E70C 3V1NA 3PJRA 3ZNOA 4MQEB 5H1YA 2C82A 2R6ZA 3GD7A 1TI7A 3SDZA 1Q3TA 3HLKA 5A4KA 2JLSA 3PC7A 5ALIA 5FX2A 4RGBA 4YUYA 1GG2A 3OZRA 1OTYA 1Y0BA 3WA7A 2CL7X 4PTLA 2BEVA 3RYHB 4U3JB 4W7SA 2IYRA 3H1BA 3WYDA 2WHRA 3KTAA 3LP5A 4RD6A 3W9YA 3KHKA 4RY2A 1CQIB 2PWPA 1X87A 5E1MA 1GTVA 2F90A 4YMUA 2NTYC 3OQMA 5F1PA 4W5NA 1JJVA 4TQGA 1EP2B 4XIFA 1X1BA 3GEEA 3VOBA 2JBWA 2NXJA 3OE1A 4HATA 5CEJA 3LQKA 4OXQA