1OJ7A

Structural genomics, unknown function crystal structure of e. coli k-12 yqhd
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
390
structure length
390
Chain Sequence
KAGLNNFNLHTPTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLDALKGMDVLEFGGIEPNPAYETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAANYPENIDPWHILQTGGKEIKSAIPMGCVLTLPATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTKPVDAKIHDRFAEGILLTLIEDGPKALKEPENYDVRANVMWAATQALNGLIGAGVPQDWATHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDDERIDAAIAATRNFFEQLGVPTHLSDYGLDGSSIPALLKKLEEHGMTQLGENHDITLDVSRRIYEAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL OXIDOREDUCTASE YQHD
publication title Crystal Structure of E.Coli Alcohol Dehydrogenase Yqhd: Evidence of a Covalently Modified Nadp Coenzyme
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 153
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00465 Fe-ADH Iron-containing alcohol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1oj7A02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1oj7A01
4FR2A 3CE9A 1JQ5A 1NVBA 1RRMA 3OWOA 1XAGA 2GRUA 1TA9A 4P53A 1JPUA 4RFLA 3OX4A 1NR5A 1VLJA 3OKFA 1O2DA 3BFJA 3HL0A 3UHJA 1XALA 1JQAA 5EKSA 5BR4A 1XAIA 2BL4A 3ZOKA 1NRXA 1DQSA 1NVFA 1VHDA 4RGQA 1OJ7A 5HVNA 4RGVA 3RF7A 4QGSA 4MCAA 3W5SA 2BI4A 2D2XA 1NVDA 3CLHA 3QBEA 3QBDA 1UJNA 5K8CA 1NUAA 1XAHA 3ZDRA 1XAJA 1KQ3A 3JZDA 3IV7A 1NVAA 1NVEA 5FB3A 1SG6A
chains in the Genus database with same CATH superfamily
3H18A 1UDAA 2Z57A 5HE9A 1LUAA 3E48A 2J9RA 3IUBA 5IAJA 4Q6BA 5E4TA 4KQ6A 4ALMA 4CCYA 5KC9A 4TWZA 2OV6A 3ELWA 2ZI5A 3KJEA 1U1DA 3IVMA 4R01A 1EVQA 1W5SA 3BCSA 3GAMA 3M9XA 1OWPA 1HYEA 2WPNA 3UG7A 2IXEA 3VPXA 3RT1A 2GWHA 4ZOLA 3QUAA 1V4VA 4Q18A 3RYFA 4PGHA 5A2GA 5I3CA 5JNVA 3MIZA 5C8YA 1E32A 1QVAA 4N3BA 3BN3A 2CNNA 4FIDA 4OSOA 3ZXYA 2C4KA 1ZITA 1RAIA 1DWUA 3F4BA 1VI2A 3K32A 2QRHA 3QVGA 1NN0A 5F9FA 4L8GA 4M98A 3FXAA 3TNDA 2VA8A 2ORYA 4K88A 5L3QB 3GRVA 3L1HA 5CIQA 3STTA 5JC1A 1JNXX 2M1ZA 5A4FS 1XN1A 2AG0A 3CF6R 5K0BA 1Y6JA 1VE9A 1LPMA 3DMPA 2VOJA 4IQGA 3WWDA 3A05A 3P9RA 3EPKA 1ZP6A 2X77A 1DAHA 1I10A 2XA2A 4GLOA 2AMJA 1NMYA 1SOMA 3D7NA 4UHBA 3W78A 3HK2A 3AEQA 1XA4A 2ATEA 1FFXB 1OXXK 3FPGA 2BCEA 4PFSA 5J4LA 4RH3A 4FE3A 4B5LA 4CL0A 1DKRA 1EZZA 1ZIPA 1D1QA 4M2LA 1XVAA 3E18A 3MUOA 4JBNA 3HJAA 1PT9A 2Q3FA 4R71A 4FFLA 5A4KA 2DQ4A 4HCJA 1T9GS 1OFUX 2H00A 3R40A 4IVNA 3EGXA 1EFCA 5FKJA 2VUTA 5ALLA 4GOND 1II8A 4HWGA 4WWHA 5B55A 1CR2A 3K3PA 4Q3BA 5TT0A 2XCLA 2A9RA 4J0KA 3KQOA 3I45A 1EESA 4AZ3A 2J5XA 2ZRQA 4E6EA 3LHDA 1UJMA 1Z5ZA 4CCSA 4WY2A 1X1SA 2IU4A 4NBKA 3L6CA 4JSTA 1A1SA 5EJGA 2TMGA 3ENNA 3I6MA 1VHTA 2G8NA 3CA8A 4ZO7A 3SSNA 1IBCA 1RM0A 3OX1A 3WAGA 1KQGA 2JFXA 1VIVA 1WA5A 1XZAA 1U0EA 3IR7A 3Q0TA 3T1NA 1ZHFA 2WDPA 5DK4A 5BR7A 1IY9A 2PLNA 1Y1QA 3DMRA 2ONKA 3W6UA 2FQQA 5SZKB 1NF9A 3NS7A 3WQSB 3VNAA 1X2EA 4BS9A 3KAQA 1M6EX 2C78A 2IHJA 1ZMXA 1IOWA 1QAQA 1T9HA 1ZWKA 3M9LA 4JQZA 5EP2A 1W5TA 1ONNA 2FQ1A 1I7PA 1FDIA 2IIBA 2JAUA 2Q41A 4QO8A 4RQBA 3HUTA 5A0TA 1OLUA 1JN0A 2R5FA 1QIJA 4OCZA 1EVEA 4PG7A 1PG0A 4XFDA 3MRTA 2OXTA 1I94B 2OGTA 4QOGA 4S0ZA 4MRPA 3FKQA 4KU4A 3NU1A 4R5HA 4EJ6A 1E6EA 4NY1A 4JC0A 1TRKA 3GA5A 1KOJA 2YZKA 3IP3A 1AQYA 2PPVA 5B1DA 4MW0A 4TV9F 3NWBA 5JMOA 5DFAA 7ABPA 1DZ3A 3LX8A 4LF9B 4KDFA 1RHMA 5AKLA 2NU9B 1XUOA 1EH5A 4B2LA 2CL7X 4Z0HO 9ATCA 2Q46A 2GM3A 1WF6A 1H2AS 3QXJA 3NYQA 4BFXA 4NYMR 1ICIA 1QH0A 1XQ1A 4KE8A 3REQB 1T3SA 4MUMA 1NBAA 1R8YA 3M5DA 1VKZA 1GFZA 2OEPA 4PIVA 3Q85A 4DLBA 1NBHA 1XX6A 5B57C 1QYDA 3G2HA 3G5TA 3KOZA 2NN3C 4YAIA 5BRJA 3OJWA 3KTAA 1TUBB 4IDFA 5KQSA 3WR5A 2WABA 1IZ0A 4FDTA 3STWA 4PC2A 4ITVA 3WFIA 4ZYZA 1QOZA 1E4EA 1KHHA 5C7OO 2EAUA 3UV3A 5ITSA 2DCUA 4FGSA 4HADA 1USWA 1UIRA 2ATXA 2WINI 1C8LA 1E3SA 1UKCA 2C1ZA 2PU5A 1DLIA 5CX1A 3P2OA 3V4FA 3A7DA 4LC0A 4NEHB 5K01A 3HWRA 3VYSB 1TAUA 3QXCA 1N36B 4URWR 2PMDA 3OE7D 4R1SA 1RAEA 1G1AA 3ER9A 1ADBA 1O6ZA 4AZTA 4IMRA 2FEXA 3BERA 3K09A 1PSWA 1ATZA 5HF9A 1K4KA 1KAEA 3R3XA 4JBHA 3E61A 3IMEA 4WTOA 4LPKA 2DBRA 3H99A 1QX4A 5DNCA 5JR3A 4RA6B 4MGIR 5DBIA 5GM2A 1ORHA 1AHHA 1GLGA 1WQ3A 2OKCA 3AZQA 3NEAA 1FTSA 1ZSNA 1ZJZA 4BFUA 2NXWA 5DGHA 1CNEA 2E4ZA 1OV4A 5CYGA 1ENOA 1XZCA 2KPOA 2ZI3A 4PWYA 3N58A 4PZDA 1M2GA 5HM8A 1GL9B 4IIJF 4JYAB 2ZSEA 5HWSA 2D00A 3MINA 4RNCA 5E2BA 2ZIEA 2A0UA 1E2FA 1YE8A 4I55A 4LOIA 1E7MA 2HQSA 3ZBPA 1T8RA 1RKQA 3DDOA 3DP7A 1P4JA 1IFXA 2BFBB 3INYA 3TRIA 1VC2A 2ZWPA 4BIIA 5I4KA 2GBLA 1QAMA 1GFIA 1LBEA 4LZNA 5LKAA 1OH8A 4JBIA 3NOVA 2PUCA 5IBRA 3WYDA 4DJ5X 3D6HA 3KUXA 4HTAA 4ZHSA 5HDQA 4R8SA 2YVKA 3UAOA 2P91A 1Y4SA 4YREA 4ZAVA 1TCAA 4FW9A 3OEEA 4DC0A 1WPRA 3TSZA 1YVEI 4BNWA 1R50A 1P9NA 2ZRLA 3K70B 2YWEA 1GPBA 1NUTA 1RJWA 2LUOA 1KH1A 3RADC 4Q1DA 2WAOA 3FCYA 2W6CX 1L5SA 3EF0A 2PGAA 3E23A 2YZMA 1SUCA 1DHTA 1GOTA 4DW8A 3NBAA 1E58A 1WQ1R 1XQWA 1I7NA 1Z8DA 2P67A 3AV3A 2FSHA 5EKUA 4MYUA 1YGPA 4J6FA 1W87A 2ZRIA 4EG1A 1LS6A 1GGVA 5A4JA 1JFRA 1GZDA 1RRPA 5D7BA 8AT1A 1PR6A 1WSAA 4I9NA 1JSRA 3ZCXA 4HR7A 2A78A 4HUQB 4J0DA 3LSTA 4NS4A 5B2FA 1X8XA 5BN4A 3ZGOA 4AG6A 5KX5F 2F9FA 5FTJA 2VXCA 3QEMB 4ER7A 1B73A 3BD7A 4PY2A 2PNJA 3OCJA 4C01A 4ES6A 1T1RA 4MRRA 1A9YA 3G5UA 2YJNA 1MW9X 4FHCA 1HK7A 4UZSA 2QJRA 5DTQA 3SEFA 1AV7A 5EKTA 1IXYA 3NEJA 1SCDA 1CQJB 3VC1A 5HIIA 2MSDB 2YUIA 2ZB2A 5G4LA 5JNTA 1MO4A 2H8KA 1GNSA 5ADVA 1VFPA 3OESA 3C8DA 3QKTA 1YZNA 1ZGAA 1SQ5A 3VISA 4TN1A 4D6XA 2OXRA 4W8HA 2IHYA 4I50B 2I4NA 1USVA 4XZ3A 1ISGA 2B2XA 2DQSA 2GAJA 5B58C 3V55A 2JJ1A 3HCAA 3UH0A 3WYFA 1TPYA 3A1SA 1VYTA 1WXDA 1YJQA 3ZXXA 1Y1LA 1RVDA 3G2MA 5LQUA 1XZ8A 3KHSA 4OHKA 3ZCVA 4UQLA 1LV7A 1W9HA 2QBYB 1P81A 2PD6A 3MEQA 2JGKA 2CXPA 4QDOA 5EJMA 3SQDA 1VJCA 3MNFA 1X8LA 1CW2B 5CXSA 1GKLA 4F8YA 1N3BA 1T5HX 3CRMA 5CBPA 2X2FA 1NULA 2ZRMA 3QBTA 4B81A 4UU7A 1BXZA 2QZ9A 5FFFA 2HF2A 1OFTA 2O3QA 2WPDA 3PJDA 4LYGA 3VOSA 2PUEA 4QUAA 4M36A 2O7RA 4RLSA 4AZ3B 2BGWA 4G0NA 1GSOA 3HRKA 2BGMA 4DQLA 3T5AA 3CZRA 1ZJYA 5FV7A 1S01A 4C03A 1Z83A 4C07A 3W6NA 4MLZA 1XVTA 4LZAA 1MH1A 2XBMA 3P32A 2ZB4A 1QOQB 2FEOA 1MFZA 4QG3A 3FRIA 2H5EA 4QA9A 1IK4A 1CLUA 1KZHA 2HSZA 4KG7A 1WG8A 4LGVA 4N7MA 2VJAA 3GEMA 1OKKA 3LUKA 4KO3S 2ROQA 4PX5A 3EQZA 2VQ6A 4JMLA 4V0OA 5AVXA 1RBQA 4ZVUA 2IV3A 1KAGA 2A7XA 4KIJA 3SKXA 1U7UA 2HWYA 4WRRA 4DARA 2GPYA 3QXHA 2X0NA 2QLTA 1TLLA 4F8EA 1XYVA 3LLUA 2BL4A 5KNLA 1UC9A 2XQIA 3WGOA 3N6VA 2QKYA 1ZC3A 3FE2A 1L2TA 4UMEA 2OCIA 4KQKA 1SBYA 3WSWA 5ITZA 3AL2A 5EMKA 5CMLA 1EZ1A 5TVGA 1IBRA 3EEQA 4EYGA 5BUSA 3WWOA 4WUVA 1B42A 1X1CA 2YZNA 1WR8A 1VJ1A 2ZIZA 3KPUA 5AKEA 5I47A 1AHIA 5EI5A 3SLKA 3GUUA 3HU2A 3CE9A 1X7GA 4YJ3A 3KELA 1I2BA 2IHZA 5H59A 3BWVA 2ZP1A 3U0BA 2FUKA 4A8HA 4L73A 1UINA 2E0IA 4N47A 1QP7A 2AA3A 2G63A 1ECBA 2Z5VA 3BK2A 3EDMA 3KHKA 1SG0A 4DPKA 1JTEA 2A33A 4DV0B 4EGAA 3C3JA 2WNSA 1OIWA 1DQSA 2FX5A 2IEBA 3D3QA 1DRKA 3H9QA 2FMXA 4YVFA 2YRXA 2FUEA 2GVDC 4KAFA 4PGGA 1UPFA 4QNMA 1Z5WA 1RDFA 4R2XA 5EXPA 2IEAA 3D5TA 2WA1A 3JD4A 2PKWA 3R5TA 4P4GA 4QBIA 3WDMA 2F4NA 3GJYA 4CHGA 1FU4A 2OQIA 1M6WA 2YCBA 4IIHA 3V7WA 4JJKA 2A67A 5A06A 6CHYA 1T6XA 3HRIA 2NV6A 1DPFA 5E7JA 2JFZA 1I6WA 1POWA 3CY6A 5THXA 1IBKB 3LECA 4I7EA 1KOGA 2IYTA 5AW5A 1D2MA 3FVVA 5BSKA 1NV9A 1GZVA 2XNDA 4IAOA 2OZLB 1LI5A 5CX1B 2CMGA 5ALVA 3V8VA 4MQLA 2PLFA 2ISQA 5IVDA 4N18A 4U5QA 3H2ZA 4FD3A 3H5WA 3NP9A 2EVWX 3PXBA 4INAA 4RK1A 5EE1A 3WYGA 3NLLA 3QVWA 3X43A 5IK2A 4H7JA 3TO5A 4B31A 4CF5A 4QOFA 2JCVA 1O8BA 3A32A 1M2WA 1SUDA 4KTTE 3T99A 3RUCA 4CG3A 3DLPX 1LJLA 1U2DC 3MJCA 1QQ7A 5FBWB 5AUOB 1Q1AA 3U9LA 4QJBA 2EEPA 1BXRB 2EIXA 3H0KA 1HEIA 2CLIB 3OP1A 1NXXA 3HR4A 1Q2XA 4FSXA 5JCOA 4GOOD 4Q1AA 2Z6UA 2R8XA 3ZS9A 1PTKA 2IY8A 2C4NA 3E22A 1QQBA 1NF8A 3MQ2A 1R9NA 4LDQA 5C18A 4KMSA 5AKKA 5IYZA 1V39A 1G63A 2DE0X 1KI4A 3AFMA 3DD5A 3MINB 3O6VA 4ZVRA 3OPNA 3PQDA 3FPJA 4X20A 4AO8A 1REQB 4YRJA 3Q3JB 4J0QA 1E18A 1JJAA 5M29A 4RULA 5LMCA 2Q28A 3F2IA 1W36D 2WAXA 3V42A 4ERNA 2CLHB 1L7XA 3EXHA 4XQ9A 3OZVA 3U7FB 2P9BA 5E4FA 2BGIA 2PSHA 4DT1B 4B3CA 4Q24A 1L5KA 4NPAA 4W1RA 4W7IA 4DZZA 1UBUS 4MIEA 4CUJA 3IMFA 1F2UA 3B1KA 2EG9A 2H1LA 3DOOA 1BFUA 4RYDA 2ESRA 4NXNB 1WZCA 3JZAA 1KPIA 3L7KA 2CJXA 1WZIA 1AOXA 3MMNA 1DIOB 4I46A 4DHWA 2IK8A 3SHOA 1IJEA 3CBQA 4JC5A 4WFKA 5JFOA 3H3FA 1Y5LA 3O8OB 3P2EA 4MPTA 5GZ3A 4PX9A 4H17A 4O4HA 4RCVA 4L6AA 3VNRA 1PJ3A 3R77A 3T3DA 4KR6A 5HE8A 1LK0A 3MS7A 3SX0A 2QTNA 4PYKA 5KEIA 1TT5A 2ZE8A 3GLHA 3HJRA 2QX9A 3OWXA 1VA5A 1K7SN 3AWIA 2SECE 1RJEA 3I5AA 2XKAA 2R1UA 4EA9A 2AG1A 1XAJA 1N2SA 1U04A 3COVA 3ELDA 1QZUA 4O2BB 2ZE7A 3BXFA 3WRYA 4AICA 3PR3A 4BQNA 4DRXA 2DERA 4RQAA 4C1BA 1J90A 1ZPDA 3SQXA 3NGLA 5IFKA 5AM2A 3JWJA 5EWJB 4V2IA 4AMUA 1WV0A 2A92A 2CHFA 2A0KA 5DNWA 3SJZA 2C5AA 2HUNA 4Y2GA 4DJJA 2XCTB 1MX3A 5JS7A 4OBWA 3ILXA 4HG2A 3I61A 2BEKA 2W2VA 1ZIYA 2H0QA 3DTTA 2QUBA 2SKCA 2C3OA 3AUFA 3NTUA 5JPCA 5KWVA 1SXQA 1OI7A 2XNSA 3F78A 2I4MA 4B48A 5LL6P 3RV3A 4N6GA 2HWKA 2J5RA 2QRVB 2R8ZA 3WG9A 1G6OA 4CPDA 5KVAA 1MIOB 3IR5A 3C6XA 1LC3A 4TTIA 1F7VA 4KQ9A 3E3NA 3CGGA 4EA7A 2DHRA 3AVUA 2JK1A 3EZXA 3GDOA 4YECA 2GRAA 3SIRA 1U0RA 3R0VA 3CONA 5ALSA 5A05A 3R5HA 1OXBB 5KZMB 3I1JA 1AS2A 2GSDA 2WV9A 5HQJA 2P2DA 4LJ5A 4QLAA 4YI3A 4MYDA 1WMDA 2JC3A 3RLFA 5C3MA 721PA 3JAKB 4B8ZA 4GMXA 4EHLA 4ZO4A 2FFRA 5DM4A 3TLGA 1H0SA 4JQYA 3A6LA 2H18A 3R1IA 1BJRE 1G5QA 1VL5A 5DCWA 1L5MA 4Y1RB 4JFRA 1E79D 1CS0A 1VSTA 3B9RA 5EXDA 3SQNA 1R0BA 1XA0A 5C46F 3G9XA 3CVUA 2ZAGA 1JG4A 2PA3A 3K0HA 4Q7KA 3UIEA 5CBPB 3AHCA 3LW7A 2JHAA 1DJPA 1WPGA 1ZK4A 3G8YA 3TI7A 5CFQA 2C4VA 3JQQA 5IHXA 3S68A 4CIBA 2IV7A 1KSGA 2X0IA 5DOZA 3FOAA 1V6AA 3PUHA 1Z35A 1M0EA 2CMFA 2D8MA 3TECE 1CDEA 2DLNA 2VT7A 4R6WA 2WYUA 1OYVA 3WGKA 3A4VA 2BFDB 3LUCA 3QU9A 4GLJA 4OVKA 3L6UA 3LA8A 3KL2A 1M2EA 2JD1A 3RVBA 4C0XA 3AEYA 3AESB 1GADO 1KFCB 3NIGB 4X3PA 5AVUA 2JFVA 3G2OA 2LNDA 4QFDA 4CEIA 2R751 4TSFA 2C9MA 2CT8A 2YYZA 3QXSA 2C07A 2IYXA 2D62A 4X8MA 4Q4AA 3UWSA 2ZRGA 1XROA 2HA3A 3AOGA 4FJ0A 2HHCA 1C7JA 1SCNE 4PCAA 1RPAA 4J94A 1W93A 3BFVA 1GQOA 1DAOA 2W4QA 3RB8A 4AF7A 3DLBA 3K09C 3EULA 1NVAA 1FFBA 2GYUA 2IKSA 3ROPA 3GGPA 3FAZA 3ZWDA 3TTTA 3DAGA 3MGKA 4QRHA 1E3WA 3OQIB 2VF8A 1BX1A 1DG1G 4L5JA 1AXGA 1YJXA 3LPCA 4ND3A 2GBIA 2PLWA 3CPJB 2MTBA 1D1SA 3G2JA 2VSXA 5FL3A 5ES4B 5IFLA 3WGHA 4YRMA 3EWIA 2I9KA 4H2DA 2IYEA 1FDTA 5EWMA 3W3ZB 3RKSA 1NVFA 4IIFA 4EG5A 4L7VA 4OQPA 3KXPA 4LHWA 1HYBA 5DW3A 1QCZA 1HE1C 1T5IA 1N5KA 3H1FA 3L7DA 1EEXB 3LT0A 4RCZA 2VT6A 3UWOA 4LYYA 3HVIA 4YPFA 3NHMA 4RMNA 4XIYA 1OFVA 2I2CA 2O9JA 3RFUA 3JRNA 2GBLC 2GEBA 2GFQA 2PV0A 2XB2A 3ANYB 4G0YA 4FCCA 4FB4A 2J3JA 3ENZA 3H75A 2V4MA 3OZRA 5EXSA 5IJZA 1PIWA 5EJAA 4PV7A 4BQPA 1K9SA 5KBYA 1V1RB 4IYRA 5D85A 1XRPA 1C3LA 1FDOA 4JLAA 1DUVG 1IIBA 2GM5A 3H2HA 2J59A 3KXIA 5IJWA 4DDMA 4RAQA 4OGWA 1IEVA 2B6NA 2FH5B 1K3FA 1W4CA 3CURA 3GUZA 4WDRA 4CRWB 2R7LA 2V4ZA 3DZJA 4AYXA 2VDWA 4MGEA 1CJBA 1E3QA 4QUDA 5LP6A 1W4RA 1NVUQ 1FXWA 1JVNA 2ZI9A 1MC1A 1Y7HA 2B1IA 2BM9A 5HFNA 4DA8A 5A9SA 1KMHA 4D3YA 1QRSA 3NKVA 2HF7A 3ZXUB 3L6EA 3M70A 1N6KA 1QHFA 2WSBA 1EA5A 4OB6A 1ODLA 2G40A 3IC5A 4JJ6A 4EGQA 2GCIA 2MIIA 4YYZA 3DEFA 3LVQE 1GTVA 1V11B 3WA7A 1XZJA 2XAUA 4YAWA 1CY4A 3ZVLA 5J4VA 2Q2VA 2O8BA 1L8AA 3I04A 3DT6A 3EF3A 4WX2B 4GUAA 2W6MA 1EB8A 2N9UA 4F84A 2WUWE 4D6PA 1O0CA 1A4RA 3OD1A 5SZJA 6ADHA 1PWXA 2Y1XA 3O2SB 1XAIA 2GETA 2YWDA 1LCIA 2DH5A 4WVFA 1JIXA 4BFVA 4MWDA 1N7GA 1LSSA 3FZYA 5ESDA 2VNIA 5IYZB 1GU1A 4TLCA 2AMYA 2AZTA 3NX4A 3QUTA 2Q4RA 3LX6A 5CJPA 2ORVA 1FS6A 4ZVQA 4QSHA 1K97A 2NTVA 3E1KA 5ER6A 1U7OA 1VG1A 3HDJA 3L02A 3KFLA 1QO0D 3OU2A 4X20B 2WMDA 1HT3A 4ZJYA 4UZEA 3F5FA 4CLHA 2Q7XA 3H04A 5AW7A 4ZOLF 3UN1A 4FM9A 2O8DA 2L17A 4U9IS 1NSFA 2QR3A 2VR1A 4FZVA 4BYMA 1GGEA 5HTKA 4RTKA 5C8YF 1VBNA 2FN7A 1RCFA 4AB1A 4REQB 2HMAA 4OFWA 1NL3A 2NVOA 3VKUA 4B8YA 1NX9A 5IASA 3H5OA 3GIWA 2A30A 3QV2A 3J81k 2IHUA 2IP1A 5AUPB 1VFNA 2D0OB 2VSNA 3D4BA 3DOIA 1IMOA 3GAZA 1FF9A 1OY1A 2G4CA 3L7JA 4WKOA 5C81A 3D7MA 1EFRA 4M9SA 2QRNA 5LIPA 4OOFA 4RPGA 1QBKC 2EZ4A 2RI6A 2O2IA 3EZNA 3KTFA 5IUKC 3M1AA 2EWMA 2AOTB 1G8FA 3GT7A 1BU5A 3VYWA 3OMLA 3VR1A 4A10A 1ZNQO 5F3DA 2YY7A 3P9SA 2H1IA 4RY0A 4URXR 3PEWA 4UEJA 1B23P 2PKXA 1TT5B 4PRLA 5AYVA 1HT2E 3TW0A 3CIFA 5CYPA 2C4TA 3V4PB 2EKDA 4B33A 5KOJB 2JAPA 3J80A 2KX7A 4DRXB 2H29A 5FD8A 4R51A 1EVZA 1CR4A 2C5HA 5BYBA 1O5OA 3DT8A 1XRSB 5KYKA 3AERA 1F0PA 3WXBA 4YUAA 5ICCA 1SXJD 1DWOA 1M7BA 3RDPA 2PS9A 1RQRA 1R66A 1KJWA 2IXFA 1U1IA 2XCIA 5CT9A 2Q5HA 2AN5A 4Z86A 5BW5A 1E7RA 1F9EA 3NYIA 5CM8B 1HA3A 3IVXA 2VJPA 1CYDA 1SQ0A 2NACA 3QVMA 1L7AA 4I6GA 4R3NA 3A25A 3QXXA 4ZQBA 3T5GA 4RXMA 4BJ6A 1BDBA 4NP6A 5LA6A 3ZGVA 4RK0A 2F3TA 1JTFA 3UJBA 2JIDA 1G1MA 4JX8A 3LUJA 3PHHA 4NZOA 3AX6A 4WMLA 4B7CA 3B3GA 3DFMA 3QFHA 3CWCA 5FYQA 3E9YA 1N8TA 5THKA 2IZ5A 2X3YA 1PHPA 2GQ0A 5T4EA 5LZ2A 3THWA 3CU5A 3AY3A 4J3JA 2AOXA 3KJQA 4N8EA 2ZPTX 3AJDA 1MO2A 4GWLA 4O4HF 3S81A 3THXB 1ZD1A 2ZATA 2UVQA 2WSIA 1WMAA 1XD8A 3HUDA 4KXUA 4XWAA 3K0AB 2DETA 3C1UA 2B4YA 4NBWA 2M6KA 1KJNA 2W5UA 5GJCA 1H05A 3TLBA 3W1EA 1PJAA 3L01A 4Z99A 4AW9A 3PHCA 3LUBA 1ULTA 1FSFA 1TM3E 3QG1A 4IUDS 5TC4A 2BUBA 4BJ5A 4OHYA 2LW7A 5AW0A 1FRQA 4YA6A 5FUBA 2EGHA 1D8AA 3DFIA 4KJZA 2WJIA 3WGMA 4BL5A 4E1BA 1Z7YA 3DO6A 3ZHZA 5A5EA 1Z5OA 2DEUA 3GWZA 1W1WA 3K9HA 4UMDA 5A6SA 1NI3A 3L7AA 2J08A 1NVBA 3NM4A 3FOZA 3FTNA 3NAZA 2QXYA 3H0EA 2RGCA 2CE2X 2QX7A 3WJ2A 3AEUA 2YIDA 4GR4A 3IULA 4W82A 1QZZA 4QPPA 5J4HA 2HZ7A 3OIWA 4IOKA 2HIHA 3EAFA 3OPQA 4RA9B 1SCUB 2J6BA 2UUOA 2B8EA 3DBLA 1KZ7B 3L0OA 4QQKA 4CIXA 1SCIA 1M8FA 2B7LA 2CE7A 4GI5A 2IU3A 5CLQA 3BL8A 2I91A 2XZOA 4GSYA 3PD1A 3R3VA 4RVGA 5LB4A 4BMDA 4E12A 4C0JA 5BXQC 2QUAA 3G0BA 1CSEE 4IUYA 2OFXA 2H1CA 3ZWOA 4K8RB 5JROA 1S3SA 2MSLA 2WUVA 3DTVB 5CEEA 1FUKA 2ZIFA 3EIQA 2CFCA 5H4HA 1G0OA 2A0XA 3O82A 1CFJA 1QE0A 2XOKD 3EBPA 4PYMA 5BW6B 5G3ZA 3BMNB 1OWMA 4LDPA 5H16A 3T3GA 4AJEA 2I87A 1B2LA 4JLJA 3ZXIA 3IUYA 5T8KA 1YA6A 4LFBB 2NO0A 1NQOA 5CLHA 5KNBD 5L6LB 1YF3A 4BMPB 1BEZA 2RK3A 4QPNA 4FSDA 5E7MA 4BMSA 5TV2A 1VIYA 5CCXA 3ERCA 5JJKA 3AZOA 1J5EB 1DQZA 3VO1A 4NCHA 4E51A 2BCGY 2WSLA 3MMZA 4WY8A 5JCOC 4C4AA 4K9KA 3FTPA 1PLKA 3X1MA 3MIIA 2YR0A 1JILA 4O3FA 2ZRJA 1BVYF 4G1CA 1WXHA 2VP9A 3SMQA 2C5FA 3DZ8A 3Q7EA 4PTYA 3AL0C 3FTQA 4OB7A 1ZJ5A 1K6EA 1M10A 1TJ4A 1YRLA 2FHSA 4G5FA 3CZAA 2YMLA 4BKPA 3MYYA 5AQEA 1XSEA 4QHSA 3JWPA 1LPSA 4RBNA 2JS7A 2SHKA 2VDLB 4BBAA 5JAOA 4XRRA 1CHDA 2G9UA 3C6ZA 1JEJA 1TU3A 1XIVA 2FZCA 2RGWA 4PC7A 5A03A 5JATA 4EKNB 2R5WA 3EXHC 1DC7A 1G9TA 2C5BA 3JQBC 3L7LA 1T2NA 1YCGA 5AW1A 4WLOA 4A1FA 5JAPA 2QT0A 4HUJA 4FR5A 3P94A 4Z9YA 3VNBA 5DSZA 5FV4A 1QH1A 4IJ6A 2CFSA 2M1XA 3GMDA 1Q14A 3ILSA 4K6HA 1CE8B 4I55F 4S1PA 3LW8A 5ALOA 3WWEA 2OYSA 3K1AA 3Q7PA 4OQZA 1ZRMA 2VDWB 3TJMA 2EW1A 4WNAB 3IAS6 2JIZA 2NOAA 1ECJA 5LP6B 2I4RA 4WINA 5E0KB 4AJ9A 2NO7A 2ZKIA 2J0SA 1QP0A 3CZ5A 3UH1A 3H5RA 1BMQA 1BH6A 4X0EA 3SZMA 1NTOA 3PD7A 2CLOB 3HN6A 1Q7EA 5DRTA 2GRUA 1ZU5A 3CRZA 1OH5A 1ECFA 2EG5A 3IODA 7REQA 2ACVA 2J5BA 1MENA 1WD5A 2OK7A 2XMDA 3LHIA 4IVPA 3EGEA 4XCXA 4HLUA 1HF3A 2FK8A 4RS3A 2IUYA 3PD0A 5J4KA 2BR5A 5KNDH 1ZGHA 3S5JA 1GSAA 1MJGM 5CB8A 3U7EB 3IEIA 1SCJA 1GVHA 5IUNC 3KZNA 4EDHA 4QXPA 4Z9AA 1SCBA 2IEDA 1SELA 3MGGA 4Q16A 2AWOA 4BB9A 4JQCA 3IS3A 5JNLA 3O8LA 2BF7A 1QF7A 2QRZA 4XUCA 3OKCA 4PZYA 2J3MA 2G5CA 4KRYA 3TE6A 5AHOA 4EFMA 1UEIA 3ZD8A 3KQPA 3GLIA 1QVRA 3LFTA 4CLOA 3G5LA 4MQ4A 3AKYA 1J07A 4CZ2A 1PLLA 3EFEA 4YAGA 4LCBA 4CETA 1ZVQA 1PVVA 3I2JA 5AP9A 2IH4A 2E55A 1U0OC 3AY0A 2EBHX 3JTMA 2E6KA 2OGWA 1S9HA 2OCPA 3UKJA 3ADBA 4HNQA 1QGED 1T5LA 3MLBA 4PICA 3GWGA 4XX1A 3OCVA 4ZC1A 4JQSA 4BB0A 5YASA 4C2UA 3C3CA 4B3JA 1WDWB 2UXCB 3IUEA 4QX6A 2WSSD 3FGPA 3B9PA 4GMHA 1RLOA 1CLEA 2QRUA 1IQ0A 3LPDA 2ACWA 4MKRA 2WJ3A 1PQUA 2GA8A 1YKGA 4Q6WA 1TVMA 3N9IA 2B1QA 3DBOB 1EUCB 2IPNA 3B1FA 1K8YB 1JG3A 1EX6A 1FSPA 1LDNA 2HSEA 3G13A 4Z7JA 2YHAA 3T3MB 2N1BA 2R96A 4ENVA 4D97A 1J39A 2QQFA 3KSAC 3W5BA 3SJAA 4M7RA 3A1VA 2VF7A 1DKQA 2FPXA 4LMBA 1JAYA 3FLMA 3KLBA 4G41A 4JUBA 3VC3A 2HLDA 3VKWA 3HDQA 1D6JA 4YT5A 4YMHA 5H3HA 2P40A 3TFOA 4CEJA 1U6KA 2IRWA 2PKQP 2W6ZA 4C4PA 2WHPB 3VM6A 1T9KA 2ZAIA 3LQRA 4BV2A 4DSUA 5JZ9A 3NHSA 3STYA 1DP4A 2V45A 3D4PA 1JF8A 1EJ2A 1P45A 2JRCA 4JLNA 1IIRA 2JH3A 2JZNA 3B3JA 3O75A 4EUEA 1FYWA 4LV5B 2XCQA 4AYWA 5KOYA 3GROA 3THRA 4ENRA 2OVFA 1ZMRA 3RJ9A 3MSXA 3VH1A 1E0DA 3G2NA 3WQQA 4DMCA 3TR5A 5ULLA 2QRGA 2GK6A 5KDOA 4DBLE 4G9GA 2W42A 5A7GA 4RV9A 4JQOA 2ETXA 4R81A 4RKQA 3F71A 3KM0A 4POAA 5AM4A 1Z8HA 5AVQA 4M55A 3PXAA 2O5EA 2YL2A 3E7DA 1CIVA 2GS9A 2IQIA 4KFSA 1SKMA 1EVLA 2I99A 2FOIA 2Q0XA 1P3Y1 3I01M 2QSJA 3JPYA 3N8NA 4I0WB 3VR5D 2VJDA 3AR2A 3IQGX 2QEQA 3EGDB 3PFKA 3L93A 3GJ3A 2JIPA 3N39C 3I2KA 5AT1A 2EJTA 3JVUA 2LCQA 3S1SA 1Y3BE 5FR2A 4MGHA 1WZUA 3UKDA 4B4KA 1AY0A 3H7IA 3TUIC 1Q7BA 2L42A 2OD2A 3QVOA 3VC2A 1CF4A 3A6JA 3AVTA 2ES4A 1L4EA 3WOVA 2ZUEA 1Z8NA 4K9MA 1Q21A 1TYEB 1WCV1 2JCXA 3QP9A 3VU8A 3ZTTA 5D01A 1C9YA 1TTPB 2OUIA 4YJ3F 3HXPA 2HJWA 3HACA 5EE0A 4BDSA 3CRW1 4ZZ2A 5TF4A 4B6PA 1ZNYA 2Q1UA 2Q07A 1CJKC 2X1VA 2XYQA 4KQJA 4NNJA 4IUBS 4BPRA 1J00A 2RG1A 4EMSA 3PGXA 3SBOA 1XG5A 1VL6A 3CPSA 1Y7TA 1N25A 3H05A 3GJ5A 1OBFO 2A1TS 1NI4B 4IMIB 1YE3A 2GPJA 3DEAA 3UAZA 4ND5A 4EY4A 4RX1A 1YBAA 3ASZA 3WLMA 3PCTA 3W2TA 1GT6A 4YRCA 1M34B 5IDYA 3VZRA 5HHTA 3TXAA 2HPHA 3EC2A 2PX8A 3WC4A 3MT7A 5DMXA 5JVDA 4MVCA 3O1JC 3TGWA 1FP4A 3FPFA 4HGNA 1B8PA 2PG3A 1GNPA 1NW3A 3Q3GE 4P3OA 3QMPA 1TEVA 2ZSDA 1V5WA 4E21A 4EBFA 1YVPA 4M99A 5IF3A 5BVHA 4AZWA 1PDWA 1P2SA 1OBCA 1TU4A 4C4ZA 3BSWA 2UU9B 4DM7A 1A2KC 4M7WA 2CYBA 1K63A 1WNTA 1ZOOA 5JAIA 1KIFA 4TVOA 5CVTA 4N6OA 5KYXA 3DAPA 5E95A 4H4DA 1QP8A 1HLFA 1VCMA 2OSVA 1RT9A 1WPXA 2H2GA 2X8JB 4W5JA 3ZWAA 4EGJA 2C2OA 4R40A 3N7TA 4AJLA 1C4WA 3S0JA 4FDVA 3WIBA 3FHLA 5I5GA 4QEDA 1I5EA 1TIBA 4BN4A 1VI5A 3L06A 4TL7A 5I9BA 4CU2A 3TBFA 5TNXA 2J9YB 4MR7A 2V6JA 1OLXB 5F12A 4O1MA 3LKBA 4C4SA 1G7RA 4BLRA 4DEXA 2AJTA 2BF4A 3NJ4A 2YFKA 4GX5A 4O0LA 4YDQA 2FEMA 4JLWA 2D2VA 4JI7B 2GVZC 1A5ZA 1QH1B 3NASA 1H23A 3ORHA 3R6WA 4KXQA 4QGHA 2F55A 1G20E 1QOPB 1DQRA 1B4DA 3DXZA 3WE7A 2UUAB 1SXHA 1Y7PA 4RH0A 5KNDD 3PFCA 3NUGA 5DGXA 2P3SA 3HY3A 3HUEA 1A95A 2CFRA 3IPLA 1VBKA 2X3UA 3QU4A 5EXXA 3UHPA 4RK6A 4MEAA 1Z6AA 4QYWA 1XO1A 3ONDA 3ZE7A 4K0KB 3FUXA 6REQB 4YC7A 4G81A 1SIOA 3B85A 2VXOA 1ZUNA 2HEGA 3RVRA 3QVXA 3IALA 1M0WA 7ADHA 1UADA 4RFVA 3RS0A 1QR2A 2LIPA 2C9YA 4B43A 4Q4JB 3SC2A 3TIFA 1EWKA 5EE9A 2N0SA 4CM6A 5LQKA 3U5ZB 2PK3A 2W70A 3WKDA 1ZNWA 2BSQA 4XEUA 1RWVA 4ARAA 2V4UA 1QPZA 2EARA 3R5XA 1E1CA 3SX4A 2LZ0A 4EY5A 3JD2A 3T7JA 2AKAB 4LGYA 1M1YB 2VP3A 1NYRA 1DKMA 4HX9A 3VH4A 3OOWA 4FX5A 1YNOA 2J85A 3ND9A 4HAIA 4Z9FA 2HK8A 1JIJA 4K03A 4QTUB 2C98A 2RH9B 3BIWA 2PSSA 2R6JA 3D4OA 3OZFA 3R74A 4CTOA 3GLIB 1TC1A 2PTHA 4K9OA 5FPHA 3PPXA 1Q3HA 4R68A 1RBZA 2IYYA 2H7CA 2HV8A 3L46A 4CLOB 2H1VA 5BW4A 4N48A 2QXUA 3G02A 3O38A 4NZNA 5FA8A 4HT3B 5CG2A 1GAXA 4FB5A 3EG9A 3DLTA 3LBYA 3IRVA 2ATCA 1P2DA 3PIIA 3DMFA 4LI0A 4JV5B 3GH1A 2BEWA 3F5SA 3RPEA 1HL3A 2CDRA 2PXHA 3OIGA 1M2HA 1TAHA 2GZSA 3LL4A 1CT9A 3RYHA 5B4TA 2B5OA 3ADCA 2ACEA 4TL9A 1GSIA 3JQ9A 1T6NA 1YR1A 2EGUA 3A1EA 3QH4A 3QI7A 2JIMA 4LF6B 3FOCA 1AM4D 2FLWA 3DDNA 2DQKA 2WF6A 2HDHA 3QTBA 1XALA 3ZDDA 3GT0A 1MT3A 1KQNA 4UXHA 1IQUA 1GFWA 3GU3A 1CRLA 1JB9A 1L9KA 1Z6QA 1JU3A 4IRUB 5J2TF 5EPEA 2DJIA 2CUNA 3IPRA 3O90A 3V6LA 5JYBA 3NNDA 1HDEA 2VHXA 3HBAA 4TYPA 1KBZA 2WZQA 3IUQA 2FSVC 2UZ1B 3CT4A 4HQ6A 2WAYA 1ZVVA 2IEYA 3FOBA 3FZNA 3OTQA 3RSCA 1RTTA 2D3TA 1LDEA 2W4MA 3L1VA 3BXPA 3R44A 2GYYA 3ZNOA 4F1JA 2HU2A 3Q1KA 3PICA 3S8MA 5KQRA 3ADPA 3DLCA 4OLFA 4DMMA 5C32A 2D0PB 1N6HA 3PUZA 4RSRA 4CTMA 2IX3A 5ALKA 2O2YA 1FUIA 4LF5B 5HR5A 2C0CA 2QUIA 4XLZA 1BIFA 1ZIOA 4K3UA 4MCAA 3P20A 2WKWA 4LJSA 1OD6A 4AMZA 4B6QA 5FULA 4DLYA 2M6SA 1TEZA 1FZTA 1I4EB 1OROA 4O2AA 5ALEA 5AI6A 4E6PA 1GAJA 4C21A 2V65A 1Z28A 2FQXA 1ABEA 1VGQA 1YZ3A 2NUAB 3E9EA 1XTIA 3MWEB 3D81A 4B6EA 2PUDA 4ZK6A 3JYHA 3PC6A 3BMXA 5H81A 1FFHA 4M9RA 2FN3A 2DKOA 2WDZA 3E7FA 4Z7QB 1UXOA 4NQRA 5F1YA 1NMXA 3FVRA 4O29A 3SC4A 5LMNB 2VZ0A 1UDCA 2EKLA 5JO9A 2C4WA 4OIMA 2FK7A 5IXYA 2H8GA 4U7HA 3BK1A 3LMKA 3TOXA 2IDMA 1UK8A 2X23A 3MT0A 4AL4A 5KYWA 3K9BA 4ESVA 5B7GA 5K5EA 3FCEA 3PNSA 3NTLA 1GUYA 4R5MA 3PNKA 5C5IA 2IJGX 5IARA 2WM2A 4IJKA 5JLAA 5K3FA 4RJTA 3H1TA 2F8LA 3QXGA 4DDVA 1ZCJA 1P6UA 3CRRA 3DWFA 4O25A 4NC9A 2V6IA 4HLCA 3BEDA 1QIKA 4JSRA 4EY6A 3FCAA 2I0FA 5LCXA 4ZYYA 4HEA1 1YASA 2OBFA 1TJPB 2I78A 2VRNA 4Q4HA 1ORIA 8ATCA 5HQ3A 2FTKE 2HGZA 4KMMA 1AA6A 5AKJA 1BC5A 1HPLA 4UNQA 3N2EA 4HAZA 2R6R1 1ZG3A 4CN9A 2ZG6A 1DI0A 1T5SA 1EGAA 2A9JA 2BJWA 3DMDA 4E7PA 3HLYA 2O8CA 3GPIA 3EW7A 5TB5A 1K98A 1JDUA 4I6EA 3TTYA 3WGYA 4PNPA 2PUVA 3GDFA 1DJOA 4EY8A 5CEJA 2O6LA 3ETHA 4D9GA 3ND5A 1YS7A 4UU0A 1F2TB 2IS1A 1V5FA 1ZGJA 2IW1A 3WNQA 1JAZA 2OXEA 4OI4A 2R1VB 4CMIB 2VJLA 8ADHA 1J1IA 3PEUA 3PE6A 1IJFA 1QPBA 3QPDA 1S8AA 2Z5GA 4GYJA 4MCJA 3RTEA 3KKPA 3KVYA 5DHRA 3B3AA 3K6RA 5IC5A 1Z6TA 3NDBB 1NJ5A 2H59A 3ZC3A 1TKCA 5I7AA 3BCUA 3O9MA 3VX4A 3ET4A 4PQRA 1HOTA 1CUEA 1N2CB 2HIAA 3HXTA 4WCVA 1DV2A 4KK4A 2B5VA 3DNPA 3GNTA 3ZTWA 3AJAA 1OV6A 2ZYRA 4QPZA 2PCLA 2IODA 821PA 5JCJA 2Y0EA 2X3FA 4NS1A 3THSA 1OI3A 2WIAA 4LNAA 5JY6A 2Q0QA 4XCVA 3TPCA 1FS4A 1GHTA 4PU0A 3ANLA 2ZSAA 1D0VA 2PO5A 3OBIA 2O4UX 3EXFB 2BFWA 4QRDA 1TQHA 2P6UA 3DOCA 3F2VA 1C7FA 2UV8A 1AGNA 4QTTB 3ZWVA 2ZCJA 4YAKA 2YJ5A 2ZI7A 3AUTA 3QLJA 5TQ2A 5G53C 2ZK7A 4HNGA 4Q7LA 5HF8A 3RC3A 3SEZA 4XYLA 3A6EA 3DBVO 3GRFA 4MW4A 4ZYTA 2QAJA 1T25A 3UC5A 2E6UX 2YWHA 2ZWVA 3C74A 1Q6YA 3CLSC 4FQ7A 3SR3A 3GVPA 2VF2A 1XLUA 4KPUA 1ZL0A 2E18A 3P71T 1B0AA 1VLZA 2R6DA 3MAJA 4A8JA 2W2LD 2YS6A 4EJSA 3KHUA 4NR0A 4RF3A 1R15A 3EQ8A 4V1CB 5KSOA 3I6ZA 3AG6A 4OHRA 4DR4B 3TH5A 3EY9A 3V2HA 2ODEA 3QHPA 1PL6A 4F0JA 4UPDA 3AVYA 1Z13A 2O1WA 3GELA 3R3JA 4HGQA 3KKOA 3KAPA 1Q19A 3CZPA 3GBVA 4YBZA 5SY9A 2AC7A 2OFFA 2C4MA 4EJFA 3FYTA 1QIMA 2K2WA 4RVFA 4MCIA 3QUQA 4HB4A 1NASA 5HA5A 1SKQA 5E1OA 4EG3A 4OQMA 1U0HC 5J1TB 4JJAA 1DCTA 4S3MA 1ZMTA 2VHTA 5BWCA 5F52A 2NWQA 3CYFA 2WWVD 2VWQA 3SC2B 1U3TA 1EPUA 1XDSA 2ECKA 3HC7A 1D5CA 2GCOA 2VT2A 2Y05A 1ILWA 3G2PA 4JOCA 3IQZA 2QPOA 2WWTA 4YQZA 1YCDA 2B9VA 5K8TA 3K8YA 4G89A 1X7DA 2GCPA 5CU7A 5EMHA 2WHEA 1BYIA 2WIDA 3C3DA 1EJBA 4QXMA 2IYOA 3PFWO 1EDEA 4L4RA 4Y2RA 2EIHA 4NAVA 4KK3A 3D2BA 3WADA 1ZEJA 4H0FA 3OQNA 2AZ4A 3PEEA 4N5NA 4O2LA 4ACAA 2DG2A 2IZOA 3OJ0A 3RK4A 3KU4A 4JROA 2HV9A 4MARA 3GNSA 4LZOA 3WL7A 4L6IA 2C7BA 3CH7A 4NFHA 2A9KA 3VR4A 1RXEA 1XMXA 1DXYA 3UB3A 1BCRB 3FJ1A 3K6SA 2BEWB 5LA6F 4ENUA 2OT3B 3DVSX 4XWKA 2JASA 5L95A 2BGUA 4EUFA 3IHKA 4TZKA 4BP8A 5E1BA 5CXQA 4P0PB 1P9WA 3OQVA 5JQGA 3K72B 1ONSA 1FFDA 1Q1ZA 3CW9A 2V7VA 4MUIA 1KVTA 4PHCA 4LK2A 5LYJA 5ILGA 2JRLA 4ZPXA 3HCCA 3BH7A 3IE1A 1C29B 2C7GA 2XVXA 3HLTA 4L78A 1JHMA 2XQJA 1UXHA 4K26A 4A73A 2X8WA 4XI9A 3U6BA 5L53A 2EWWA 3CLUC 1XXHB 3IKVA 3QPCA 1AZLA 4OLAA 1E63A 4RIHA 3SD7A 4EP1A 1ISRA 4C0KA 1G59A 2TRSB 4UM9D 3LGXA 3BWYA 4FFDA 1I80A 2CB9A 3AB8A 2OBBA 4D4MA 4KYVA 3T41A 2Q4DA 4RZQA 2R3SA 4G8BA 4LVCA 1ENYA 4ZCMA 4EEZA 2AT1A 2JGDA 1U8AA 1FUYB 3W9UA 5AVVA 2ZANA 2B99A 2J41A 3OQHA 2PH3A 4U2DA 4TM7A 3K96A 1AUOA 4WQMA 3FWNA 3GCXA 3S2SA 4NBLA 3BDIA 4XQ0A 5CDHA 2Q3CA 2QGNA 3GFVA 4E5VA 1U99A 1TFRA 1IPFA 1WW3A 4A6DA 1DAGA 2AG6A 1QYVA 2QSUA 3ZI4A 3TFQA 4XQGA 2EQBA 4H1HA 2A0YA 2Y27A 4ZJUA 5CLGA 3S7ZA 5KO2A 1G60A 2INGX 1AD2A 2K4MA 4CQMD 2AK3A 3O8DA 3PDUA 3NJRA 1DOAA 4TV8A 1GKKA 4JT4A 4WXMA 2HLHA 2PLAA 1PG5A 3T3EA 4ZYXA 5AOCA 1TX4B 2XB8A 2XA1A 5D87A 4F11A 2BN4A 2VF4X 5FTKA 2CXXA 4AJKA 4N76A 3BGOS 3T9CA 5EJ6A 5EJ8A 2JLRA 3FUVA 5JRDS 1ZK2A 1XPJA 4Z4GA 4RZIA 1KNXA 4C78A 4IF6A 1MVLA 8LDHA 2ZJZA 3EPPA 5AXDA 4MV4A 1YB4A 2FPIA 3HB0A 4EKIA 3MJTA 1P73A 4IS3A 5DEOA 2OLEA 2QJTA 2Y4NA 2ZUSA 3R24A 2C94A 5FQNA 4CQLA 4HQLA 1T3GA 4NECA 3MRVA 1G9XA 4E5MA 3SHWA 4B47A 2AK2A 3BB3A 2N47A 4O4IF 3UT5B 3L84A 5KNCA 2WRZA 1SBNE 4AJ2A 4UPEA 3GZJA 1JZQA 1H5QA 1OAKA 5IPFA 2IXDA 2QZSA 2Y6VA 3A1CA 2IXAA 3EB9A 2YMQA 3IOYA 5HZMA 4DM3A 2XF2A 4YRDA 3IDQA 4F56A 3HKEB 1TZJA 2CNKA 2G28A 3EZFA 4F4JA 5A62A 1SQSA 2XODA 4DZRA 5TMPA 5CDTA 4WJLA 1ONPA 1NJ2A 3SG0A 3BREA 3NKFA 4CVNA 2GX6A 1U2EA 2D1QA 4F3NA 1VL8A 2I7CA 2I7XA 2R0QC 2Z04A 2XWQA 4PM4A 3SZUA 2C00A 3K4QA 4QOJA 5EZQA 1QGAA 1RZUA 3W4IA 5JG7A 3ZE6A 3EGCA 4FGLA 2ORIA 5JZMA 2FU5C 4IHKA 1D2RA 5EUBA 4RC9A 1Z4OA 1LI4A 5B1EA 2HA2A 5AICA 3UJ9A 4BNTA 2D2EA 3PJFA 1QO9A 1Q0HA 2WYOA 2WZDA 3AEXA 5T4HA 2G08A 4AD8A 1TM4E 1BDMA 2LD4A 2MMGA 3OOSA 3H2BA 3EVDA 5DHAA 1EGHA 2IOFK 4LXUA 3LP5A 4XW2A 3R0XA 1OZ0A 1U2ZA 3RRYA 3JQPA 1G8HA 2F6RA 5EZ5A 2FF7A 5F2KA 5G0SA 2FMFA 3USCS 3W1WA 3ER6A 2NO6A 3ZWCA 4DYVA 4QE3A 3WBBA 3RUFA 4YRSA 4J4HA 3REOA 1N6LA 3FB4A 5AXBA 2DWPA 4FDAA 3JAWB 3MTDA 3RWMB 2CVQA 3G9TA 4JBXA 1EE2A 2RBKA 2PQ2A 3GPLA 2DUMA 4IMJB 4P80A 2WUFA 3ZGZA 1CUWA 2PPLA 1W2GA 1OI2A 2PX0A 2WWFA 4IS2A 5EHNA 3TK1A 5IT5A 4TTRA 2PRKA 3LFUA 2X8AA 3JQ9C 4KPUB 1KDVA 3GLTA 1PNRA 1WU8A 1UC5B 2ORWA 4HC4A 2XADA 3QPWA 2VUIB 1UMBA 1X0XA 2DFNA 2JDID 2VHJA 1D6MA 1R5BA 2R7NA 3JWEA 3KSZO 3LQ4A 3QE2A 4K9RA 4YMVA 1QTRA 1Z5UA 1JKJA 3JQCA 5KIAA 5M04A 2HM7A 2Z09A 4P54A 3B1XA 2WJZB 1ZWLA 2PMBA 3JZFA 3KQYA 4GQBA 1NRJB 4M76B 4IP0A 2C95A 3JWGA 2MT9A 1GY8A 3FR7A 2JZCA 1JHYA 2CYCA 3RF7A 5IHPA 4WFJA 3DWEX 4YRIA 4CXMA 1QVZA 2OFPA 3FGZA 3PK0A 3GG2A 3PTLA 4CDNA 2CFOA 3DF7A 2W6JD 1J7KA 4WNYA 1PQYA 4EGSA 1M3SA 4D4LA 3M1YA 4X90A 3FI0A 3KFVA 4MR8A 3C0KA 4YY3B 3NVMB 4RTRA 1EJ6A 4JLPA 3L18A 1GV1A 3P96A 5DGDA 5I7RA 3P4YA 3OWOA 3ESCA 3O7MA 4WLVA 4HXEB 5CA0B 1MH9A 1P60A 1DIGA 3FF1A 1HC7A 2Q9CA 1NLZA 4WZAE 5EJ5A 3SNHA 4PYIA 5IW8A 3TB4A 2CZQA 1HE5A 1MRSA 3JQGB 5DEIA 3SHQA 2KQUA 1KZ1A 3E35A 1OJ7A 1PJSA 1TI7A 4QYMA 4JJGA 1U8XX 1LW7A 4BOYA 1P0IA 3AVQA 3LZCA 4ZKDA 1Z06A 4CMEA 1K5DA 3NO4A 3CFYA 2ZOSA 1J2EA 4F96A 4B2PA 3LBNA 4D96A 3ESBA 1IAQA 2O57A 2NNLD 3NP7A 4Q3KA 4R83A 3F6YA 4DFDA 1XDUA 3ZE1B 1HURA 3WZLA 1EB9A 1D2CA 3R3HA 4QUHA 1K08A 5EJ2A 2CLSA 1EUDA 1ML3A 1RM4A 4PLTA 3AJ8A 1FNMA 3X44A 1R9JA 4H27A 1B93A 4O1IA 2C97A 1OA0A 3DBHA 1JU4A 1ZJ4A 2B4QA 1PX2A 4O4LA 2FFBA 5CCBA 1AQ6A 2GKSA 1GL3A 1B74A 1KZ9A 4QC2A 4XDYA 1KE1A 3SKVA 2VP2A 4ESHA 3KDAA 3OJXA 3D0OA 2BKVA 2J07A 4D5EA 1KY5A 2YWGA 2YY6A 3TM4A 5I7VA 1UFVA 5IVKA 3ZI7A 3EQ6A 2BZ1A 2FP4A 3UAYA 9MHTA 1JQBA 2ZROA 3RRZA 1PL7A 1RFGE 3ZCTA 4UVHA 2OQVA 3UTCA 5IX8A 1A9OA 4ITUA 3E5MA 3HV0A 3PRJA 4WVLA 3IDFA 3IP6A 2GNOA 4UVGA 1AUVA 1RXVA 4MV0A 4ZAYA 4O8CA 2AE2A 3ZV5A 4AN1A 4CM5A 5EZYA 2LBPA 2Q7OE 1YDGA 2OM2A 3AR4A 3LF2A 4GKBA 4H0CA 4J0FA 1CS4C 3R8CA 3COSA 3TLCA 5JS6A 3WP1B 2XTJA 1DO0A 4EB6A 2Y76A 3WWPA 3R0JA 5K8CA 1YOVB 1T5BA 5BRAA 4LNUA 3EOZA 1R4AA 5KHOC 1RIFA 3BTSA 2FNAA 1KAHA 3GGCA 1EFVA 4LIPD 4QVKA 1I1OA 4JOSA 2BZ0A 3I6YA 4HP8A 5JVDF 2BGKA 4MP8A 2X0FA 1GPUA 3N07A 4WEQA 2WVJA 1NVMB 3ZDBA 2VDUE 1XEXB 4K7JA 4MPDA 4I6JA 4PHFA 3CUYA 3PWZA 4P4UA 3HUFA 4IBOA 4LFCB 5JEEA 3NEPX 3QI2A 5H9VA 5EHXA 1CZUA 4KEAA 1LF0A 3CVOA 1OMOA 4CQLB 4PC6A 1AV6A 4M49A 1E79A 2CJFA 1NNUA 1VCHA 1NRXA 2V7QD 3I3SR 3L41A 4HEJA 4MMYB 5AVYA 5LFAA 1TZ2A 1RHUA 4G9BA 3WK5A 2Z9BA 3A3NA 3UK0A 2G1UA 2Z3VA 1MJGA 1BX3A 1L3BA 1KO1A 1PRYA 1Q1QA 3AFOA 3QKUA 5DYIA 3WHPA 1Y3FE 4MULA 1BE1A 1RS0A 4JA0A 3ETGA 2MSKA 4M0LA 3ICVA 1OFGA 3QPBA 5KKNB 1XTQA 3ZWXA 1JT9A 2NTJA 3OF2A 3AU9A 5AHXA 2EKZA 4EJSC 1MC8A 4A8JC 4IHQA 5IAKA 4ALIA 1W0JD 1JX6A 1AA9A 1JDBB 3CKMA 3PX2A 1IUPA 2R6GA 1K8QA 4Y2SA 5ICEA 1I6LA 1SZCA 4DCGA 3E9ZA 2CJWA 4MS3A 5KYUB 1FDWA 2AN3A 2YMPA 3PNYA 2WD9A 3DE3X 4X94A 1QU3A 4YRAA 1PT5A 2B30A 1MR3F 2NU8B 3RYIA 1Y8AA 4ZKEA 2ZBEA 2X4GA 2UXDB 5LSAA 4L27A 2QRKA 4LRYA 3RAEC 4B7ZA 5EC8A 2BTQA 5IBCA 2NYRA 2FE1A 5JNRA 3K5WA 1MQSA 5I7OA 1A71A 3RREA 1U3VA 4U6QA 4EA6A 4KH1A 2C9CA 5FA5A 3EVGA 3NXKA 5KTNA 3HJFA 4LSWA 2EXXA 5C1BA 1KP2A 4PXYA 2ZBQA 4H3HB 2I8LA 3KKKA 1WCXA 1YCFA 4GAEA 2W6PA 4NJMB 4Q82A 2BMEA 1N5RA 1WE2A 2Q45A 4OXNA 5DYYA 4RESA 3ICEA 1VE3A 1ZIXA 1I7LA 1IZ9A 2XV1A 4K3VA 2Z95A 1A9RA 4WFIA 3WBJA 3GT3A 1O9BA 4WOKA 1VTKA 5LUBA 3L4EA 3JV7A 2GO1A 4IVRA 1RYDA 1KDOA 2JKZA 3NWEA 4CV0A 3NTOA 4ACBA 1N9GA 2AC4A 1A8SA 1LSUA 1SGWA 2O06A 3KD2A 1E7SA 1YZTA 2HUPA 3TW4A 5IDVA 4FKBA 4A0FA 1GRCA 5BSGA 4IXDA 2ZR8A 3L8GA 4TKZA 4ENQA 2OUKA 3T1YB 1ZN2A 4IZHA 3TRKA 5BOSB 2PQMA 3O2JA 4CDGA 2BTOA 3T9FA 4QPJC 1E9EA 3TN7A 3WWZA 4CTJA 5IRCD 5TJHA 4WHMA 1YKFA 3ABSB 2PS3A 4PYLA 5KYYB 3LGAA 3DTNA 2YWFA 4JP1A 1QH9A 1H2ZA 4FHFA 3M6MD 2VSOA 1VECA 4OMDA 1OF1A 3EE6A 3F98A 5ECDA 4PPFA 4PZ0A 1DIAA 1JKJB 1VRVA 3HR8A 5I9SA 4YH1A 2D59A 2QD1A 3I39X 4JC8A 1GSHA 1N0HA 2V8OA 3WK4A 4JI6B 4A8TA 1ZHHA 2PUHA 2QDKA 4R16A 4LPSA 1UXIA 5ALHA 3TS1A 4ARBA 4NCBA 2UYQA 4KXXA 4P5EA 5IKOA 1D5WA 1DARA 2OE2A 2IYQA 3I01A 4JJFA 4M89A 4S1OA 5CT4A 4B7AA 2CL0X 4LAFA 3IUJA 2BHTA 2M98A 1ZJ6A 3OKAA 3JYNA 3TW8B 1P5RA 3ROKA 1TKRA 2ICAA 2WOOA 3FWPA 4CYMA 4MR8B 5FUVA 3OY7A 4L5BA 5B3LA 1W46A 2GUWA 4R8LA 4NV0A 3KT8A 1QONA 1E0KA 1I24A 1O58A 1TGYA 3ABIA 4HDOB 2AI2A 2HLNA 1LNSA 1SULA 5K3BA 2B83A 2NZVG 3CLHA 1Z37A 3JYPA 3CHYA 1P17A 3JWIA 3NTVA 4LYEA 4YMGA 1T9AA 1EVYA 1Y48E 2IXTA 3N2ZB 4US2R 1QV6A 2FCAA 1D2EA 1G64A 5A02A 3L8EA 2R7KA 2WWIA 1EXNA 2O2EA 2Y93A 5DISB 1NA5A 1Q3TA 4WN9B 1QO0A 4FZJA 1OFUA 3HYSA 4RO0A 2A94A 1W36B 3TQIA 1LPNA 4YUWA 1MDBA 4NYIR 5J5VA 4OKIA 2VOEA 4O2AF 4OYHA 1BROA 1U0NA 4MRNA 1IPHA 2XGOA 1U8EA 3KR0A 5FF9A 3KOOA 3PNVA 4RWEA 1JQAA 4DUZB 2BD0A 1TCUA 1GRVA 1ZINA 1ISFA 1N33B 1B6RA 1TA4A 4RY9A 1KJQA 1EUDB 3B1YA 5DE3A 5KB3A 4P93A 3K1ZA 4Z5XA 3GX1A 3DUWA 5LBTA 2WM8A 4HWPA 1SHUX 2DFKB 3DBHB 3HCDA 3K94A 3V3TA 2CNWA 5B6JA 4ZAWA 1F17A 2RAUA 5LKRA 4GZ6A 2B7CA 3IBCA 4IEFB 3B82A 1BZYA 5HFAA 2HBYA 4OQQA 5KKCA 4X91A 3WK7A 3IUMA 5JSQA 4YT8A 1PP4A 1S2NA 4V24A 3T12A 4M1QA 2PX6A 4IJUA 2XKKA 3TZKA 1ODJA 2GF2A 1BWSA 3IDAA 3RAPR 1ZW6A 2O2JA 3DEKA 1COWA 3D8NA 5KOIA 3U09A 2FP4B 2QMZA 3HDGA 4UTRA 2Q5EA 4G25A 1WCIA 4MP6A 5JC8A 1G6Q1 2WD7B 1EWYA 1SXJA 3C85A 3V97A 2ZIXB 3WLPA 4BGUA 1C0PA 1B0UA 2I3BA 1X1TA 4HDRA 3MCWA 3MXTA 4L15A 4NK5A 4TRRA 5E2AA 4GPIB 3INNA 3RIMA 5EZYB 2WD8A 3OQBA 4MQEB 4HPJB 4MI3A 3TX6A 4HNAB 4TKMA 3HEBA 2VH1A 4JP5A 1ZNXA 2I5PO 1X92A 1U2GA 3NW9A 4MGKR 1LLFA 3L0CA 4LNUB 3ODGA 2WEKA 5C0OE 2IPMA 2IYZA 2O7VA 4MSUA 5DYNA 4RFLA 1GZUA 4XDHA 4DBZA 2OV2A 3QVKA 4Y0VA 4EATA 1KYXA 2OV1A 1P2UA 2CLEB 2HJSA 4B4WA 1XU4A 3GDWA 4YP6A 1VG8A 2FMIA 1SHJA 2OR3A 4E4TA 3S1AB 4UOEA 3DMGA 1L7VC 3AF3A 3IVRA 1L4LA 3R7AA 2P6PA 3VOBA 4BQOA 1Y5MA 2OO5A 4EBBA 5BSTA 3VPHA 1XLVA 2WTAA 4M88A 1XTBA 4A7PA 1AG9A 4P35A 4YCDA 2X5XA 2J8ZA 4FFWA 1AGRA 1BS9A 3FJYA 7GPBA 3GMTA 1XL1A 4CGYA 1JBKA 1DIBA 3GJTA 1VG9B 3MTEA 2I33A 3HKCB 4K46A 4N8DA 4BTEA 2VTBA 2XSZD 2VNAA 2XE6A 1XNJA 3IH5A 4LHEA 1KJJA 1RYHA 3PX7A 5ICGA 1XJ0A 2C61A 3UM9A 5DT9A 2NUTA 2RGAA 3GJ7A 3VO9A 1DJQA 2DFDA 2YXBA 4LJ9A 4ZVSA 3WL8A 5BNWA 3H7AA 4W8GA 3KJHA 1BU8A 2XWBF 5CVUA 1XA3A 4XYEA 3H8VA 1ADYA 2GNPA 2XH8A 2XRYA 2F43A 2QDXA 4P33A 4YB8A 5B4UA 2Q0SA 4GRAA 4C3OB 1M33A 5IM4A 4M0PA 3RYIB 4BVKA 3DYVA 2GZHA 4M9XA 4MWEA 2FPWA 4Y8VA 2WM3A 2OCBA 2XOXA 1U1CA 1E6LA 1QF6A 3OX3A 3U16A 3A1FA 1DX4A 1HRKA 4D8TA 4Z51A 5AW8A 4FOTA 4GKKB 1U5BB 2IQ5A 1PU2A 2QSZA 2XAAA 3BH0A 3BXXA 2YH2A 3P9IA 2CXTA 2QMOA 4FOSA 1G5TA 5CLLA 3C6BA 3TPZA 5A1TA 4QDJA 3ZKWA 2O0MA 1EHCA 4TOIA 5IH7A 3IT2A 4XX0A 2DFPA 5KNBA 3UQZA 1N9ZA 1C3OB 2F3PA 4OXKA 1UT6A 2IOYA 2PIDA 1B8VA 4HX5A 5H5JA 2B82A 1W85B 2DPYA 2X2PA 4HTFA 4XLTA 4YT2A 3PR1A 1MD9A 5BWNA 3HVJA 3OOHA 4QYTA 1C1DB 4MTCA 1UJ6A 1QWOA 4NOLA 3U1VA 5ED0A 1VPTA 3WLOA 2FPUA 2H1WA 3SM3A 3UJ3X 3CIOA 3ZHUA 4PG6A 3UB2A 1CQXA 4G36A 5EHQA 4ZXPA 5TEVA 1U9ZA 3BE5A 2YJ4A 3V1MA 3WDLA 3GD7A 4NBRA 1T1SA 1X0VA 3ZCRA 5K6AA 2AQHA 3A9CA 4U6SA 4ZI7A 5LD2C 4EG4A 2PUBA 1PGOA 4YMWA 3AJRA 3IQEA 1H6AA 4IV8A 3RS9A 4BJHB 5JD6A 3OQMA 1THTA 4CMEC 4TZ0A 2VYVD 3KC2A 4CKWA 3ZH2A 3Q6NA 3QVJA 3U17A 1U9YA 4MAAA 2Q5FA 2Q4OA 4YMLA 1GQYA 3D0KA 4HGYA 3A2LA 4BLQA 1E8DA 3TZEA 1XDGA 2GN4A 4HZGA 4U2GA 4M53A 3A4IA 3GZNB 3QWHA 3BQMB 3CUEF 1VCIA 1WVGA 3F7OA 5TDHA 3VU1A 2RD2A 4J7UA 1Z74A 2ASEA 1NE7A 2ID4A 3L6DA 3PUWA 2NV0A 1I2ZA 2V54A 5AH0A 1A9XB 4IIDA 5DNDA 4BE4A 5JQGF 4G0ZA 4LFAB 1YV9A 2YN4A 3D7LA 4N41A 3ZLVA 1UK9A 2OXCA 4BUCA 3A28A 3RBAA 5EFZA 3QG5A 4JL8A 4MS1A 4ZMBA 4JSYA 4Q66C 2A9OA 5LYJF 2H4JA 4AN4A 3IB6A 1FUEA 4INPA 1H93A 1LWOA 1NX6A 4LOAA 4P7FA 1QQAA 1I4OA 4L2IA 1P3JA 1URPA 4Y1GA 1X3LA 4EW1A 1GGFA 1LX6A 1JMVA 3I9FA 4LE0A 1Q91A 2H3HA 3VZQA 1W94A 4ME6A 1NHWA 4DV5B 2QK4A 1CIJA 3KV1A 3MTIA 4ND2A 3UJ7A 5A5GA 1K86A 5H9WA 2ODNA 3WB9A 3INGA 1UKAA 5IAOA 1CUFA 1NP7A 4Z3OA 4MPRA 1F0YA 3KKMA 5L8VA 3IEXA 1N8SA 1MQ8B 3GUYA 1WUKS 1EUZA 5ERXA 2DPGA 2WICA 3B53X 3BE6A 3D5QA 3NH6A 3MRXA 2P27A 2SCUB 3O0DA 2AFIA 4U9HS 3X2EA 3STVA 3Q7SA 2EQ5A 2GTPA 2HREA 2QUZA 4HOYA 3VAYA 4JR1A 3UMRA 5C5EA 3L79A 5ALFA 1PX0A 4J0EA 3TNYA 3PEFA 1RRKA 1U2PA 2VPYA 4ZDJA 1ETHA 2PL9A 3HUUA 5B3AA 1UBJS 5HGJA 4DCSA 4KTVE 4W5TA 1CY6A 1J8VA 1G9SA 5DXJA 5A1JA 1I3MA 3PJGA 4RDHA 1WTAA 2FX2A 4TV8F 3A4NA 2FPPA 4YMSA 1Z08A 3L8DA 3OF5A 3SHVA 3PF8A 2DJ5A 2C99A 4DCTA 2XITA 1T2UA 1VPDA 4TKUB 3GHYA 3RSLA 1LDGA 1XYYA 1BRTA 2ZZKA 5J59A 5EE3A 2ZKLA 3G9QA 4Y2JA 5D2CA 4E07A 3O8CA 1KR2A 1E4OA 3RUPA 4F46A 1YI1A 5FOQA 2F1RA 3RRMA 1E2HA 3K15A 4EMUA 1KTVA 2VNSA 4H7IA 2QN6A 4IF4A 1EI9A 1XF1A 2X22A 3VHQA 2BDEA 4ZTUB 2H4YA 2ZJ4A 4CMHA 1W6RA 2A0FA 1CZKA 3LJKA 3I2FA 2BMFA 3RHFA 5LQAA 1OU0A 1RWBA 3OAAD 4ZVTA 2DFLA 3VR6H 3N59A 2HMUA 4J16A 3DCNA 2JFUA 1E1MA 5FPKA 3AF6A 4AMYA 3BWDD 1QHGA 4Q1CA 4IL5A 4YROA 2EGGA 3EQ2A 1TVKB 2I67A 2G0AA 2OBNA 3AH8A 2WVGA 2IY9A 3BSSA 1ZRSA 3DE5X 4NV1A 5DP2A 3FFWA 2JGIA 3QKIA 3ZZNA 3H5NA 2QS9A 5K7SA 2P0AA 3VNQA 1HM5A 3WSTA 4YRNA 4NU6A 1EM6A 3CF0A 4MAFA 4PS1A 5FWYA 2Z3WA 3NETA 5F2OA 1BXGA 4R8RA 2P6OA 4A2QA 5TPWA 5CAEA 3I0ZA 4MVJH 4QTYA 1FXUA 2C9OA 3T1QA 4X66B 4AAYA 4AROA 4RVDA 1KYVA 1QU2A 3LBHA 5GADl 2ZTHA 2ZPAA 1T8SA 1R4NB 1V3QE 3VR5A 3GZTB 4ZEOA 1F6WA 1PFYA 1P1KA 1YL5A 1YMQA 1G6KA 1H1LB 2C8LA 2XW6A 3RT9A 1INLA 2G8LA 1MO5A 4MV5A 2ZSHA 4P22A 1NQTA 3DE7X 4UCQA 1EFUA 2FJUA 4YIHA 2A4KA 3A0RB 3GEEA 3AR6A 4I66A 4AF8A 1HMPA 4QKQA 3WLTA 3BHNA 4TXHA 2FZWA 2NUTB 3M3PA 4LVNA 1KI8A 1T6ZA 3BD6A 3TKLA 1V45E 5EP1A 5IVHA 2M6RA 2YV4A 4FFOA 4KO8A 1JEQA 9LDBA 1ZD9A 1I0ZA 4ZVNA 5L3ZA 4UTZA 5J43A 3SXPA 1LBTA 2BPOA 2F43B 3BRCA 4UVDA 3ZQJA 1NDHA 4XWGA 1D4FA 3HI4A 3O74A 5GONA 3D7RA 4LZWA 4OL0A 3WB0A 4JGIA 1R8XA 1E3IA 4E2FA 5F3WB 3PYLA 2GLTA 4AJJA 1WO8A 2ZIUB 2P0EA 1K5GA 2ZYIA 3AM3A 3HA5A 4FZ3A 1JEYB 4B9EA 1A7JA 4AVYA 2PS0A 1QCDA 1N5MA 2CMDA 5BWMA 2XZLA 4UREA 1R27A 2HHLA 4WBNB 1MOZA 2HPAA 3P5BA 1T1JA 2CEAA 4GECA 4OX9Y 1Y7IA 4LXIA 3SX2A 4XIJA 3ED5A 2PYDA 4YJ2B 2HFJA 3ZKWB 2BGRA 1SXIA 4XX0B 2WKQA 2XGSA 2CK3A 2JEYA 5TQ0B 2DGDA 2DHCA 5BQFA 2HRZA 1QG4A 1YZKA 3EUFA 2C7OA 1AXEA 2VXYA 4FR2A 1PVDA 1RKUA 4FKZA 2ZJ2A 4IGEA 1GCUA 1IUOA 1JZSA 4B1FA 4B32A 1U8UA 4F3RA 3KB1A 4TTSA 3B8HA 2G17A 1Y8RA 2I1WA 3G8CA 1Y8CA 1H2BA 4TT3A 5AJVB 4NNPA 2XQKA 4P4TA 2B4KA 1QQTA 3PU6A 4WK4B 3A37A 4P4SA 3UW3A 4AP9A 1YOBA 4R7ZA 5CA1A 2WWHA 4EI7A 5K0SA 4OHCA 3E81A 3C4QA 1IY8A 1YBMA 1HTBA 1YJ5A 4DUYB 1NMEA 5G02A 3TD9A 3IPAA 4DIUA 1FRFS 1ZO8A 1YH3A 1EFPA 1XNGA 3N3AC 1P4AA 4UTVA 2RHMA 1T0BA 2O5RA 5CT8A 3VYRB 2PD4A 3BMQA 2R6ZA 3Q0EA 5I45A 1H4QA 4ZAGA 1O6BA 3A4LA 2JGEA 2W8BB 4PLPA 3T9EA 1EBBA 2XNHA 5IT4A 1XEWX 2CXOA 5KNDA 3F6EX 3GC6A 2QQ5A 1NR5A 1DEAA 1PI3A 1Z0AA 1EFLA 2JFFA 3DL7A 4XM0A 4YP1A 5M5BA 4KLRA 1ZCAA 2DB3A 1KRWA 2Y67A 4BKQA 2D74A 3K9LA 1UMCA 3B1VA 2GARA 1B8UA 4QOSA 4LKOA 1KI6B 2RIRA 3F6BX 4NDAA 5I9LA 4MS1B 4L74A 3GQBB 5B2ZA 1Y3HA 3HXKA 1ZAYA 2YQZA 1RXWA 1UAAA 1ND5A 2FJ0A 3E8SA 4OMUA 4NMMA 5LMZA 1H1TA 2DWUA 1VCOA 1XZIA 3E5NA 1T24A 4PR3A 2PMFA 5L3RA 4I5EA 2IELA 3Q40A 4O4LF 4FP9A 1ZQ1A 1SXJC 4S24A 5HGXA 3R7WB 1DBSA 3PQ8A 5HK8A 4KOEC 2I6TA 2VAPA 1SEVA 4YMIA 4BO9A 1AKRA 3EIOA 4M1EA 1QFZA 3L8CA 1PYDA 3NBQA 4BKOA 1NRIA 1W5EA 1L7BA 4I4CA 4AY6A 3EH1A 4HQKA 1RRVA 2FLKA 2OP1A 2QRMA 3LT1A 4NICA 2VJQA 1HOXA 3B6IA 4H7EA 1U2GC 3SSOA 4D46A 5HRAA 1KFKB 1VE7A 1SWWA 1DSSG 1M6HA 2AXQA 2HLPA 2V5VA 3MWDB 5FI3A 4DNXA 3PHIA 2VYND 5IKEA 1Z2CA 4FQ5A 1TM2A 3NCTA 1UJCA 5EEHA 4AS2A 5J4YA 3KVRA 5CPFA 3RFVA 1GYRA 1WXXA 1RSZA 2HNAA 2IP2A 2JVJA 3FYSA 4N6NA 2TSYB 3FPCA 5E6RB 5FNZA 3OC0A 4HQOA 1SZDA 4ZRMA 2IV2X 3ADDA 4E09A 2I3AA 1V95A 1SG9A 1P1HA 2OO5C 3GUCA 5JFGA 1TTTA 2P7HA 3CJQA 3VVCA 1AKYA 1B14A 4ZOQI 3IT3A 1FJXA 3AK4A 3P2MA 5G1NA 2OCKA 4OJYA 2GJ4A 3DE4X 2XMRA 5ARCA 1ECCA 4BRZA 3O4GA 4E31A 4D99A 3TRJA 4YX9A 5L3SB 4GBJA 3EZLA 1GNQA 2GDJA 1JIIA 4K1LA 3EEIA 4E11A 2DP4E 3TLXA 621PA 2MDTA 1BE8A 4CFYA 2FJPA 1FMCA 1TMKA 5F98A 5BR1A 1GPNA 3H97A 4ZTZB 1NN1A 2QUJA 3W79A 3L04A 3ACCA 3B6KA 1OC2A 1RAHA 3BORA 4MUKA 4U1RA 5MFZA 5CFMA 3DDHA 1Y6GA 2VSQA 1MVOA 3GARA 4P98A 5K0CA 2ZS7A 1W48A 2VHWA 4Z54A 3ORYA 3VNSA 4ZO6A 2NAPA 4CNQA 4IG4A 2CNBA 3H0CA 3L3BA 4ZD6A 2PAFA 3OC6A 3QKRA 5AKXA 2O2ZA 2RBGA 4KFRA 3SQMA 2YWCA 1NPDA 1WUIS 1X80B 2ODQA 2P9CA 4JLMA 3HMQA 4K87A 1PBNA 4WACA 4F1WA 1L5FA 4QULA 2FA9A 2EZ9A 5C52B 3ZGYA 5U4XA 4AY4A 4F85A 1IQRA 1LK7A 2J3EA 4D4IA 1IYZA 3JAMA 3KEOA 2O0HA 3N76A 3GIDA 2YJ3A 3QF4A 4X44A 2YV5A 4X8OA 4MWBA 4D1YA 3JARB 3P0HA 5C3UA 5FWYB 1L0BA 3O31A 5CR9A 5HF5A 5D5QA 3U3OA 3HV2A 4A0HA 1F9AA 5AJWA 5FCDA 4BGEA 4IRMA 4A0GA 5TY0A 3PDIA 4FFPA 4AJ1A 4BU0A 1M67A 1U81A 1SBTA 1EBUA 3M9WA 2PLRA 2B1JA 2WZBA 3EOAI 1Y63A 4TXJA 4EF5A 4NCNA 2JANA 3NT2A 4UDOA 3U80A 4HYTA 2Q4EA 1JDNA 1QHIA 4MS4A 5EMNA 5KMGB 8MHTA 1AB5A 3OJFA 5BPHA 3KB2A 4WSOA 4JI3B 4RK5A 2X2OA 3V2UA 1WZ2A 1R6BX 3S2ZA 5K6AC 1R6DA 2M32A 2P5SA 2XIJA 4LWPA 3PLNA 2IYRA 4LQLA 4DMFA 4AG3A 2WK1A 4MH0R 3RRNA 2UUBB 1GPAA 1TPZA 3MTQA 3KZ1E 2V7EA 3T1OA 2IYNA 4IJQA 4GL2A 4N9WA 4E2WA 2D1RA 3UYLA 2Q6TA 1HQYE 2I4LA 3SS7X 1XDDA 3UWPA 2WG2A 4DIFA 4PYJA 5BQ5A 3HZHA 4JT2A 3QTTA 3CPEA 1JEQB 2X9QA 4P7GA 4MKHA 4DTCA 1X3SA 3L5OA 2K5UA 2C84A 4NENB 2MSNA 3F74A 4E7OA 1PUJA 5BNZA 1J1ZA 4LHZA 4ZVKA 4EO4A 1S2LA 4M0DA 2NLOA 3UQYS 2H65A 4RVOA 2IZ0A 4I4LA 3KE9A 3CW2A 4Q9DA 4RGYA 4W7SA 5DCUA 2C2BA 2I62A 2IF0A 3L8FA 1ZI8A 3OY2A 2AHRA 1H2FA 1RADA 4D45A 4OH7A 1NSYA 2XKJE 4UDXX 3RSSA 2ANBA 3KVNA 4JHLA 3IB3A 3UNXA 3SXUB 3AUSA 3LXUX 5BR8B 1NV8A 1JLHA 1PWEA 4I9FA 4MV8A 3PCXA 4J7CA 1JUDA 4J49A 3SJCA 1PR0A 3TB6A 1IRIA 4BN5A 1HX7A 4YRTA 3DFKA 4HDAA 4FZ5A 3PYMA 4LJLA 2W6QA 3KBBA 4DB2A 3EGOA 3FLEA 4YRRA 3UMGA 1Y4DE 2J7PD 1XRMA 5TE9A 1P7CA 2BFFA 4FX2A 4JU8A 4ANFA 4ABYA 2XTZA 3CNOA 1E0SA 5CDFA 1J8DA 2H17A 3DBRA 1N57A 3NT4A 2JVIA 4KE7A 4G8CA 5EQFA 5SYMA 1KP3A 2IEIA 3JQ8A 5LWQA 2QV7A 5B1SA 4P4SB 3TDKA 4KNVA 4DLSA 3MD9A 1F0NA 1O5IA 2BFEB 3OX2A 1HMYA 1T8YA 3DHYA 2MYPA 4RZSA 1Z6YA 1RLMA 3G2KA 2CW5A 4BMNA 1KYIA 3GLHE 3UCEA 1Y1KE 2ODTX 4HXFB 2VEDA 4QZVA 1JYEA 4C0HA 1J4AA 4YCAA 4HDCA 1EFPB 2BJVA 2OV3A 1FFSA 1L1RA 1QB8A 1X42A 3KV3O 5AW4A 2P2LA 4Q4CA 2HBZA 4TLMB 1T8UA 2JJ1D 3BIXA 3I9JA 3OM8A 2RHJA 2QL7A 1U8FO 1ADCA 4YO8A 2C9BA 1ZVKA 2A88A 4DCOA 1UBNA 5DM60 5KREA 1U2QA 1C50A 2W2LA 2DBVO 3NIWA 2REBA 2FRXA 3CZ9A 5T57A 3UMBA 2PXCA 2EBUA 1UMCB 1KOFA 1RYEA 2D1TA 2UDPA 3FBWA 1C1XA 2CXQA 2WZCA 2GYVA 3FUUA 3SBXA 4MLCA 4C7KA 1W88A 4OFXA 4X8HA 4DZTA 1QM5A 1X13A 2VTVA 1ZUWA 2BBTA 3U19A 1XTZA 5GZ6A 3VYUB 2WWRA 9ABPA 1BWPA 3AHEA 1LRJA 4EEXA 1ZSYA 2GZAA 3OMWA 4YUXA 1Z4LA 2WPDD 5AHRA 1W8DA 2E4WA 5GZ1A 3VSCA 4DLXA 2ZXEA 3RFTA 3CH4B 6PFKA 4J16C 4IJWA 2W7TA 4MUGA 4Q1EA 3W05A 2NX2A 1OW3B 3VJRA 4M6WA 5ECYA 4FNAA 4B2YA 3OTHA 3DEZA 3PLAE 4IKEA 2BGLA 5E2IA 3DZGA 5IMBA 3IA7A 2P11A 3LDGA 3UTDA 5LNK1 4FU0A 2DWOA 2Y0DA 4IGAA 5JHGB 3SNKA 4EG0A 3PNPA 4OK6A 3T7RA 2XKBA 5C4GB 4J1QA 1J2TA 2FUG1 1BS1A 4JJ7A 5E0OA 5AM0A 3K5IA 3MLAA 4OXYA 2E87A 4Y1FA 2O05A 1E2NA 2AUMA 4A1OA 2BGTA 3SXJA 3OEHD 1FNNA 5SZIA 4E0BA 3CT6A 4R8VA 5JDCA 2XHZA 1AK9A 1E61A 3U3KA 1OGJA 3N7UA 1AX9A 4KB5A 1N2OA 3H8SA 4M38A 3FPSA 4S1VA 5LIRA 3KU1A 3TAHA 1HLDA 4ZEWA 2FW8A 3G0DA 2QYSA 1Z07A 5BR4A 3RFFA 4D9IA 4ENWA 4JDPA 2VP6A 4FYPA 2B20A 1O6FA 4WW0A 3NXSA 4PSKA 2R6HA 4H4CA 1U9CA 4C6TA 3TWOA 3C5HA 3LIPA 2FR0A 1HLPA 1K68A 2A1UB 1C2TA 2D3WA 5EXEA 1NBMA 3GPBA 2CVPA 3KKZA 4MQFA 5FYDA 2GJAA 4G6ZA 4BU1A 4PNHA 3GAAA 2OAEA 1VGVA 4JVSB 3UOAB 4AYTA 3ETEA 5CHYA 1ND6A 4XJTA 5G1OA 3BRWD 1T9BA 3BB4A 1VM6A 2H63A 4DKJA 5EMMA 2Y99A 2QM8A 3EIHA 3VDMA 1LH0A 2P79A 3FZQA 2GZ1A 2HOQA 4UU8A 4WFQA 3PDJA 4QD3A 3IERA 4LTNA 2OO3A 4V39A 3ZE0B 2FZVA 3V1LA 4FEYA 3ZU5A 2BBSA 2FZLA 2QN8A 2VDJA 3AMVA 3QX8A 4KH0A 4NABA 4PX3A 4DHEA 2RG7A 2IU0A 4EFKA 1M1UA 2FPGA 1S2DA 2O1SA 4JD5A 3TAUA 4LV8B 5CB4A 1SK8A 5B37A 1HG0A 3P8ZA 4N0PA 1AK2A 2BLLA 2HDOA 1E3MA 1GRRA 3ETDA 2OV4A 1XRJA 3JQDA 1U3GA 2QLNA 3MUEA 4ZZIA 1A0OA 3Q8XB 2XNDD 1ZM3A 1I4LD 4BFSA 2UZ4A 3BTVA 1J21A 1O6GA 3H16A 1E9CA 3PXXA 1YK1A 4FPXA 3MOGA 1LU9A 4HRXA 3QOYA 3JVDA 4D9MA 3BAZA 4OKSA 3DHVA 5LQDA 3E03A 3HJGA 3MOIA 3CF4G 1C7RA 1OREA 2KBFA 1QHEA 3HP1A 4KGZA 1G66A 1G8MA 1YXMA 1FZQA 3QOFA 4CQMA 2YWRA 2ZRBA 3C8HA 4B3MB 4J3FA 3G85A 2JH8A 3A11A 4NI5A 2HRCA 3GFTA 1JLLB 1J42A 4MRMB 4YNBA 4F92B 2DULA 1HDZA 2QG6A 3ZHTA 4WJKB 5ANRB 4MS4B 4EQZA 3PQFA 3EMDA 3T38A 1IQPA 5EERA 4J4BA 2ZRAA 3UA4A 5JNSA 4QPDA 3OZ7A 4DDWA 5KTKA 4NSNA 1U94A 2L69A 1N2EA 3KTOA 3PIDA 4PRZA 1BFKA 2FZKA 4R41A 3ZU6A 3W7AA 3I4FA 4A0QA 5IZ4A 3SI7A 3UK2A 3RUHA 3EDRA 2QE7A 4RSHA 1N4AA 4CM3A 1I14A 2QROA 1O2DA 4YXWA 3HJHA 3GFFA 4AWXA 1T4CA 3MUNA 3R5FA 4EFNA 5TARA 2C92A 4I1PA 5CNIA 3HB5X 4DF3A 1FRNA 5FPPA 4ZI7F 4OHWA 1XU7A 1X9HA 1DPGA 1T5OA 4UHJA 1L5LA 2ENWA 1ULHA 2QYTA 4G67A 3TBKA 3EPJA 1Q20A 1D2HA 2GPAA 4JGGA 3BZBA 3R6GA 4PFJA 1O1YA 3H4IA 1Z0SA 4XEHA 3KRTA 2Z4SA 4DMGA 3CR7A 4IDGA 3ADKA 1SPBS 4HMOA 2QX8A 1UJ4A 2Q1SA 4JB0A 1F3LA 5D00A