5CT6A

Wild-type bacillus subtilis lipase a with 20% [bmim][cl]
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase EstA
molecule tags Hydrolase
source organism Bacillus subtilis (strain 168)
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
total genus 67
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ct6A00
2XMCA 1LPOA 2FJPA 4UFNA 4C4YA 1DWQA 5ALVA 2BUAA 2HA6A 1S8OA 3RK4A 1CIJA 3FLAA 3GA7A 2XMSA 1J2EA 1OILA 4P93A 1ZD2P 3FOBA 4GWLA 2HL6A 4XVCA 3DOHA 2JEYA 3F8SA 5T4FA 4W1RA 4MYSA 1Q0RA 4X85A 4KE8A 4MYDA 3GZJA 5ALRA 4GBGA 1SOMA 4WFKA 4UBOA 5EIAA 1Q84A 5AHXA 5K3FB 4BVKA 1ZIYA 1G66A 3O9MA 1UOQA 1EVEA 4DGQA 1CUIA 2H7YA 1R3DA 4MWTA 5AK3A 4ETWA 3L1IA 3KSRA 1MX9A 1QFMA 1ORWA 4TPKA 1UKAA 1IZ7A 5ALWA 2WIFA 3WWEA 2JGIA 1SCKA 4HXGA 3D5EA 1GPNA 4OUKX 3FNBA 5KBYA 1ZIXA 1BN6A 2WIGA 2WM2A 5FRDA 3R3XA 3M83A 2RHWA 5IVKA 4HXFB 3HI4A 3WKBA 2VF2A 2Y6UA 5ALHA 1CUXA 1MNAA 4JUIA 5K3CA 3FLEA 5A7GA 3PUIA 4EB0A 1W76A 4Q3LA 1WCYA 4H77A 1LPMA 5AO9A 1JKMA 4J3JA 4P08A 4QLOA 5K3AA 2X8BA 5HQ3B 4J0GA 4QDOA 2ZSIA 5AM5A 1F0NA 3A6ZA 5ALGA 2Y6VA 4INZA 7YASA 1HPLA 5EI5A 2YASA 1G4HA 4X71A 5K3FA 4OPMA 2XUJA 1VJ5A 5HK8A 4WFIA 3WWDA 4Q3OA 1QZ3A 2EEPA 5I7UA 4JYPA 5AKIA 3TEJA 5D7BA 1UKCA 4ZWNA 3LS2A 3R0VA 5HF6A 1CQZA 4B0PA 1HDEA 3UUFA 3IB3A 1H22A 3I2JA 5LP1A 4UBIA 5AOCA 3GUUA 4DMFA 2G5TA 3FYUA 4LKOA 1MNQA 4PO3X 4DMCA 4X00A 2XI4A 4H7JA 1MTZA 4GEGA 2WG2A 3QMWA 2QUBA 5AI9A 1DWOA 5CH8A 2D0DA 3IUMA 1GPLA 2X76A 4JH0A 1IVYA 1CFJA 4ARAA 1SFRA 5HF8A 3H04A 4B81A 1CUWA 2OGSA 1XZCA 4G8BA 4W1PA 4AB1A 4XJVA 2WIJA 1TQHA 4Q05A 4CCWA 5FDFA 2ZJFA 2WTNA 3RM3A 4NZZA 5AI6A 3WKCA 4AO8A 1XQXA 3V1MA 1L7AA 3WWCA 1QIDA 3WIOA 5ALXA 3RKSA 4FOLA 1K8QA 2OLEA 1SCIA 4LYEA 3C87A 1WPRA 4DSAA 5EGNA 2VSQA 1LBSA 4NS4A 4RE5A 3VJMA 3FVRA 2FX5A 2PL5A 4ZRDA 4QDXA 4A16A 2C0QA 2VTVA 3G0GA 1TCBA 5AM0A 4HRXA 1X2BA 1QIJA 2R8BA 1FFBA 5C8ZA 2DHEA 1BCRA 1CLEA 4IHAA 1J07A 1NU6A 5ISMA 2XUDA 3DL7A 3F97A 1LPPA 1EHYA 5E2IA 5AKGA 3B3QA 3LIPA 2XUGA 2WIDA 4WDRA 3T52A 3O4JA 5AH0A 4N8DA 1DINA 1DQZA 2Q0XA 1QTIA 1H2ZA 2WSLA 1BCSA 2CMFA 3FYTA 3WMRA 3FSGD 1CV2A 5ALJA 2XMBA 3R3UA 1DQYA 5EIHA 2ZYRA 5BV7A 1PV1A 1AGYA 2JBWA 3QBJA 4MEAA 4BC0A 1ZJ4A 5HFAA 1RP1A 3EQ9A 4IH4A 3DD5A 3WJ1A 4G8DA 3WK9A 1EDDA 5C8XA 3A2NA 1NX9A 1CUSA 4MXDA 2XMDA 5CW2A 3WZMA 1A8SA 4BAGA 1TCCA 3A70A 4N5IX 2CJPA 1CUGA 1U8EA 1FJ2A 3OPMA 4J0JA 2AJCA 4H0CA 2DQZA 3NOXA 3OOSA 4UBNA 3ZLTA 4WY5A 1EX9A 1MX5A 1TIBA 2UZ0A 3ZLVA 1N1MA 3ED1A 4J0KA 3UUEA 4E15A 4DLNA 1W1IA 4FDMA 3L1JA 4UPDA 4UHFA 4Z49A 2RHTA 5AK6A 4N8SA 2WUGA 2J3DA 5DTJA 2P8SA 1AUOA 3WYNA 3FCXA 4LXHA 2BKLA 3PE6A 2C0PA 4W1QA 4EZIA 1Z68A 4CG1A 5KWIA 4E14A 5DTIA 4MJ3A 2JGFA 1KU0A 1VXRA 1J06A 4QLAA 4BP8A 1JT2A 4DMHA 3G9ZA 5HF9A 4X93A 5YASA 4BC1A 2OQIA 1OCEA 3G8YA 2QXUA 5JD6A 3AZPA 4E11A 1ACLA 2RI6A 4MEBA 4QWMA 2FUKA 2WU3A 4U2DA 5I8PA 4HS9A 1WOMA 1JJFA 4K6GA 3EF3A 5AI8A 1TKRA 2IX9A 4LHEA 4LYDA 5KREA 4G4IA 2XUOA 4AZ0A 2WTMA 1BRTA 4C89A 3YASA 3WKAA 5K3DA 1XZHA 3G9UA 4Y2PA 1F6WA 1AZWA 3DL4A 3CN7A 4F60A 3PFBA 5CXXA 1MX1A 5J3JA 3O4IA 4FFWA 2WILA 2QXTA 5CT6A 5ALQA 3AZQA 5IVHA 5H3HA 4EY6A 3WWPA 4C4XA 3WK6A 2HHAA 1YSCA 2Z5GA 4PSCA 3OTQA 5AKXA 2VJCA 4BRSA 3WL6A 3OM8A 4QEKA 4A23A 4AZ3A 2WUFA 2WU4A 1EB8A 4QE3A 2RIPA 5ALDA 1OXMA 3AINA 5DNVA 4EUSA 1N5MA 3PDCA 3R3WA 3C70A 4G4GA 4QWWA 1I6WA 1GQRA 2R11A 3LIIA 4IH1A 2CEKA 5ALLA 4I19A 2HU7A 3JYHA 3MVEA 3M3DA 1ODTC 4UBKA 4OCZA 5AKHA 1FFCA 4ROTA 4X90A 2ZYIA 3VVMA 4AX4A 1EK2A 1XRRA 3ICVA 2JGKA 5AI5A 3GFFA 3F98A 1XZEA 4C88A 4BCCA 3A2LA 2JIDA 4ZGBA 4CG2A 1ZI6A 4PV7A 2O2HA 1EH5A 2ORYA 3W06A 4JNCA 4U2FA 4Y2VA 3R3VA 3BF7A 2H1IA 2Z8XA 1XQYA 5IVIA 2ONCA 1BN7A 2XQGA 1CUVA 4H35A 1J1IA 5JD5A 2JGEA 1WB4A 3KOOA 1QTRA 3H17A 3DYIA 1VZ3A 3VJLA 3C5WP 2XDWA 1RWQA 4ZI5A 4RE6A 3ANTA 3WL8A 5JAPA 1TAHA 4Q34A 5ALEA 1IMJA 3H2GA 5LZ7A 1CUCA 3G9TA 1XKTA 3AIOA 4NVRA 3W9BA 5A7FA 3E4DA 4CCYA 1R4ZA 5K5EA 1YB6A 2DR0A 3W2TA 3N0TA 4N5HX 4UFOA 2Y2UA 1JMYA 4KAJA 5ESRA 3WK7A 2HDWA 3IURA 2WFMA 4J0IA 4FWBA 3KWFA 4BE9A 4CI9A 2VT7A 3WJ2A 2WLSA 1ODCA 4C4ZA 4B83A 1FFDA 5EHQA 4OSEA 3OG9A 2QKYA 2O7RA 3TRDA 5ALNA 2BGRA 3BXPA 2HRQA 3ANSA 1IUOA 1XZFA 2XQIA 1ISPA 4BBZA 1CUBA 3C8HA 1UXOA 4OU4A 3D2CA 3KDAA 2XUHA 1A8QA 4FBLA 4NMWA 3WL5A 1ZICA 5K3BA 4ZXFA 1MO2A 1E8MA 1H23A 5JD4A 2OQVA 2I78A 2DHDA 4AMYA 2GYVA 5EHNA 3GBSA 3WK8A 2V98A 1GQSA 2OGTA 3BIXA 1YAHA 2Z3ZA 4G4JA 3T4UA 2QUAA 4KAFA 4C87A 1BS9A 5AKLA 1GKKA 1CPYA 1QO9A 2JEZA 4G9GA 2HU8A 4GXNA 4UHEA 1WB5A 2ECFA 2PX6A 1XRLA 3N2ZB 3VISA 1AX9A 3MUNA 3PICA 5I9IA 1LGYA 4WJLA 3RARA 2OCKA 2XMZA 4W9RA 3V1LA 3VKFA 2H7XA 3IULA 3WZLA 2DSNA 4M0MA 4BE4A 5FKJA 1EB9A 1QONA 1AMNA 5HKBA 3M81A 1NU8A 5ALPA 2GYWA 3ZV7A 2C58A 4Y2TA 1UOOA 1YA4A 1CUJA 4G8CA 5DJ5A 3WKDA 4HZGA 2HRRA 1HKHA 5JARA 1WM1A 1U65A 4PW0A 2GZRA 2J3QA 2VJBA 2OCLA 4G9EA 3QPAA 2QJWA 1Y37A 4X97A 6YASA 3STXA 3BWXA 3SK0A 4RGYA 4G5XA 2PSHA 5JAOA 2B9VA 4KJXA 1GT6A 3ICWA 4FNMA 3I1IA 4B6GA 3K6KA 1IUNA 3R40A 4DYHA 4CG3A 3PUHA 4BZZA 3ESAA 4UHDA 5D6OA 5SYNA 4Q3KA 2ZJ6A 3O0DA 3V1KA 2G4LA 4U2CA 1O6FA 5C8VA 3HSSA 1DU4A 4Y2SA 4X94A 3SWWA 2AXEA 2HA7A 4FNGA 2DQYA 4H7EA 4B9EA 4OB8A 4KE7A 2PUHA 1QIHA 3BF8A 4X92A 3HXKA 1YA8A 2XMGA 3F9CA 5D3ZA 4DM7A 3QM1A 3I1YA 1MJ5A 3QPDA 5FPQA 1CQWA 3CCCA 3H2HA 3C6XA 4J03A 1K6EA 1CUDA 4AMZA 1E5TA 3C5VA 1QFSA 4X95A 2AJ8A 3Q0TA 1EDBA 2EDAA 4BVJA 1R9NA 3SC2A 4BZWA 3O4GA 3SX4A 2VA9A 4DTCA 5ALUA 2XUAA 3BDVA 3F67A 2CZQA 3BL8A 1CUFA 4KRXA 4WFJA 5IVDA 5SYMA 2PM8A 2VQ6A 3WA6A 5K3EA 4KE6A 1UT6A 4OU5A 1ZD4A 3V1NA 3RLIA 2PU7A 3EBLA 1LPBB 3IUQA 1ZOIA 4TGLA 2C5FA 4O08A 4LXGA 2ACEA 3FSGA 1SC9A 1QIGA 1K63A 3S8YA 5DYWA 1EDEA 4B84A 2Z3WA 2QR5A 3GROA 3I2FA 2PSDA 1C4XA 1LPNA 5AP9A 1JI3A 1XZKA 1XKLA 3HJUA 3AFIA 1EINA 1W52X 3R3YA 5CBKA 3G0BA 3BIWA 1HBJA 3HZOA 4BDSA 4PSDA 1MT3A 1THTA 1W75A 3V9AA 3VDXA 3AIKA 1XZAA 3G0DA 3L1HA 5CT4A 3STUA 4DNQA 3I6ZA 1TCAA 5LKAA 5HCUA 5ALZA 2XUKA 2OGZA 3IA2A 2ES4A 2HA3A 3BDIA 5AKJA 3PF9A 2I3DA 4YASA 5CT5A 1DT3A 4FBMA 2HA2A 4KEAA 2XQJA 1EXWA 4F5ZA 1KEZA 3DKRA 1VOTA 1BE0A 1WB6A 4QDTA 2HIHA 1P0MA 2J4CA 5FUMA 3W9UA 3HABA 3DNMA 3HLKA 2QZPA 5AKKA 1XZMA 2JGMA 1QIEA 3DOIA 4BTVA 2VAVA 1B41A 1CUEA 3D2BA 1CUAA 1VE7A 5DLPA 4BCDA 3IBTA 4MWSA 3CXUA 3HYSA 5FOQA 1QO7A 4MQMA 1WPXA 2PSJA 5ALTA 5C81A 2PVSA 1ZJ5A 3C8DA 4AO6A 3WA7A 1DTEA 5CMLA 4HVTA 4UHBA 2OAEA 5ALYA 2PSEA 2D5LA 5CH3A 1XZIA 3HACA 2AJBA 2XB6A 4B7ZA 3HEAA 1LPAB 3R3ZA 4Y2UA 4JYMA 2QM0A 4OB6A 1MAAA 2X5XA 2I3ZA 5E4YA 1O6GA 3TJMA 2ZYHA 4K2AA 3K9BA 4BYMA 3HC7A 4LIPD 1JU4A 1VKHA 4Y2QA 1VZ2A 1BROA 1BEZA 1UK9A 2PUJA 5DNWA 1CRLA 1VXOA 3S2ZA 2YYSA 5JYCA 4YPVA 3D2AA 1P0PA 3ILSA 3X3HA 1LNSA 1YB7A 4HAIA 1CVLA 2B4KA 2HU5A 1QLWA 1VA5A 4GECA 1FFAA 2B61A 3C6ZA 2YXPX 2GBIA 3AUKA 3ZI7A 2WIKA 3QVMA 4CFSA 3IUNA 1QOZA 4P92A 2QT9A 4X6YA 3WL7A 1AQLA 2HM7A 2AJLI 1G42A 2V97A 4J0HA 4ZREA 1ZD3A 3QMMA 3WKEA 4OYYA 5EFZA 5AM4A 2H7CA 4HXEB 4DNFA 1AURA 4X91A 1CUYA 5BWCA 3NUZA 3C6YA 2W22A 2DFPA 5A2GA 1R50A 3QZUA 1XZGA 3ZLUA 3QH4A 3G0CA 3CCBA 4WY8A 5CH5A 3D59A 5ALFA 4U2EA 3QITA 4RPCA 2WHRA 4I4CA 1DT5A 3V48A 1AC5A 1QJ4A 3IVMA 4KRYA 1A8UA 4E46A 4C6HA 3ESCA 5AOAA 4BVLA 2JF0A 1MAHA 4H18A 1XLUA 3I2KA 5F4ZA 5CT8A 1IZ8A 1VA4A 5AM1A 2RONA 2VATA 2PBLA 1BEEA 5AKEA 3DS8A 4Q1VA 3I6YA 4GI1A 3I2GA 3FCYA 4DMKA 4BTLA 2RGUA 5IH7A 1YAJA 1ZGBA 2GZSA 5AK5A 3QPCA 2WQZA 4DNPA 5A6VA 2QRUA 4UFPA 1EI9A 3U0VA 4X7BA 3G02A 2E3JA 2XUPA 3CN9A 3KD2A 3DDUA 5JAHA 1GXSA 1GPKA 1XQVA 1XFDA 1UFOA 1UK7A 1P0QA 1PJAA 3OC0A 3ESBA 5LIPA 4Y2JA 4LXIA 4PQEA 4FHZA 4KAAA 4H7KA 1N5RA 3EIOA 5C7YA 5LZ4A 2WFLA 5T4HA 2ACKA 2IIVA 3DYVA 3E1GA 2G5PA 3FYUB 1HLGA 2FJ0A 2JGLA 3F96A 4BB0A 2XUFA 1W6RA 2BCEA 2WHQA 4L0CA 3W05A 1DWPA 2DCMA 3PF8A 3MGAA 2PPLA 3H18A 1LZLA 1LBTA 5CTAA 1E8NA 4EY5A 1R88A 1T2NA 2HA4A 1E89A 5CRIA 4BATA 3DCNA 5EHZA 2WG0A 4L9AA 1JMKC 1GZ7A 1L7QA 1JFRA 1XRNA 3PI6A 4J0DA 3FVTA 2V9ZA 2CKMA 4GHWA 5AKYA 4BP9A 4WCVA 2OCIA 5AM3A 4GLBA 2XE4A 2CUTA 4A5SA 5HF5A 1EA5A 1YASA 2XLBA 1P0IA 2PKYX 4XX1A 3STVA 2XLCA 3ZPXA 3H2KA 4GDMA 3W04A 1QIFA 3H19A 4W1SA 4FTWA 4J0CA 2XQFA 1JJBA 5AK4A 4KE9A 2I03A 1RYYA 3KWJA 1JU3A 1YR2A 5AKZA 3AIMA 2Y2VA 4YX9A 2O2IA 4B9AA 4FLFA 3EQ8A 1A88A 1EVQA 2OPHA 4GW3A 1UOPA 1ACJA 4TVKA 1WHTA 2CBGA 3WIBA 4UUQA 4Y2RA 3H1BA 2Y1KA 4X6UA 2ROQA 4HRYA 2WUDA 4QA9A 4L72A 4P9NA 5JASA 2W6CX 3LP5A 4ITVA 3WQHA 2WHPB 5ALOA 5JIBA 3DQZA 2HFKA 4MQLA 4U2GA 3DJYA 4K6HA 5ALIA 1UK6A 1TRHA 1UKBA 5LZ8A 1R9MA 4Y7DA 3IDAA 2QJRA 4BDTA 1B6GA 4FLEA 1CUUA 4FLMA 1QIIA 3FLBA 1W4LA 1BU8A 2QS9A 3HRHA 2OG1A 5KWJA 1FSSA 3I2IA 3AJAA 1HQDA 4OYLA 3I6MA 4AO7A 1E3QA 2O2GA 2VEOA 1ETHA 1E66A 1Q0ZA 3QMVA 2VJDA 3VJKA 4I3FA 1XROA 4AXBA 3R41A 1L7RA 1DX4A 1XZLA 2BGNA 3G9XA 3G0IA 2XQKA 3STYA 1DX6A 4DSZA 5CURA 4IH9A 5AI4A 5LLSA 1ZI8A 1XRMA 2WJ4A 3D7RA 2ZVDA 3C43A 4H7HA 4EBBA 1XZJA 4FMPA 2HFJA 5FXMA 1QIKA 4QZVA 2WHPA 1CEXA 3WYDA 4B0OA 1XLVA 3TGLA 3VXKA 5AIBA 5EIEA 2WKWA 4V2IA 3JW8A 2QMQA 3JWEA 4ZV7A 4B80A 3WWOA 3BE8A 1K5PA 4BRZA 1KU6A 1XRPA 1C7IA 1MPXA 3LCRA 4K6KA 2HA0A 4KYVA 5A71A 2K2QB 3E0XA 3GELA 1H2YA 1USWA 3STTA 3QYJA 5JADA 4CIBA 5HQ3A 1HL7A 1CUHA 1XZDA 2WFLB 4H7DA 5IKXA 4OB7A 4Y2XA 1YCDA 5JATA 4Q82A 2XMQA 4M0FA 1UZAA 2GBFA 2ZSHA 3BJRA 2ZYSA 5E4JA 2C5GA 1XZBA 4U2BA 4IQ4A 4JEIA 1ZD5A 3FWHA 4D9JA 1D07A 3O9VA 1ORVA 4AN1A 4AQDA 3EQ7A 1Y7HA 4B82A 2VT6A 3H1AA 3STWA 4BCBA 1C7JA 1QIMA 4N8EA 2BUCA 1ODSA 2J4FA 3E3AA 5LYYA 3ZWQA 3D0KA 1XLWA 5DWDA 5JZBA 5T4BA 4S0XA 1K4YA 1XRQA 2GBCA 4G1FA 3M82A 1VLQA 4EA6A 5A7HA 1CR6A 1LLFA 3U1TA 1LZKA 2HADA 4UHCA 1THGA 3I28A 2BAGA 2B20A 3WK5A 2QTBA 2GBGA 2OXEA 5CT9A 1QGED 5JZSA 2WJ3A 5LZ2A 1Q83A 5FV4A 5JZ9A 3D3NA 4L3WA 3FBWA 1H2XA 5A62A 1ZGCA 4DIUA 4IO0A 1YS2X 1X2EA 5HK9A 3A2MA 4WDQA 4PSUA 1YS1X 2RAUA 1GKLA 3NWOA 3KXPA 5DNUA 2BUBA 2EDCA 3H0CA 4OD0A 2DHCA 4X3CA 1H2WA 1JJIA 1A7UA 3WI7A 5ALMA 3VVLA 4XIIA 4XWGA 4ZV9A 3G7NA 4EY4A 2ZJ7A 1QE3A 4KR0A 3NGMA 1F0PA 1SCQA 1TK3A 1ZI9A 4CIAA 2BJHA 4FFVA 2QOEA 3K2IA 3FYUC 3I2HA 4UBLA 1MN6A 4C01A 5AI0A 1T4MA 4BAUA 5JAUA 3D4LA 4UHHA 2GYUA 4HTAA 2WJ6A 2YH2A 1IUPA 5ALKA 1G5FA 4BAZA 3DKKA 2WFZA 4KACA 5T4EA 1N8SA 1WHSA 5AJHA 4YK7A 2G63A 1M33A 5JANA 4UBJA 2WUEA 3PFCA 5DYTA 4B85A 5LKRA 2Z8ZA 1AKNA 3IUJA 3AZOA 4PF1A 4F21A 3Q8WA 2NW6A 2HA5A 2PU5A 3DEAA 3LLCA 2O7VA 5BOVA 1GGVA 4PNZA 3B12A 1R1DA 4QDZA 5E4TA 4FKBA 1PFQA 2OCGA 3IIIA 3OURA 4Y9SA 4DNOA 4QNNA 2XUIA 3H2IA 5DYYA 1UWCA 5HZGA 2JGJA 4UBMA 1F8UA 2VAXA 2C7BA 1VE6A 4EY7A 1LPSA 1EK1A 3WK4A 5AIAA 3C45A 4J7AA 2QVBA 5AICA 5EHXA 2XMRA 2IITA 4RNCA 5FLKA 2VJAA 4EHBA 2XUQA 3BJMA 4Y2YA 4QDUA 3H2JA 5AOBA 4H7FA 4F0JA 4M0EA 4AN0A 3B5EA 2H9YA 4W63A 2WG1A 3P2MA 1Y7IA 5LZ5A 4X6XA 1MU0A 1XQWA 5JALA 5ALSA 4ARBA 3DLTA 5AM2A 4H7IA 4EY8A 5FPPA 3FAKA 2AJDA 2PSFA 3O95A 5HFNA 5D3KA 3MUOA 5CXUA 3C6BA 2V96A 5HKAA 2BFNA 1U2EA 2OAGA 1CUZA 2XT0A 4K5QA 2LIPA 3WLAA 3AILA 2C4HA 1FFEA 1UK8A 1X70A 3UMJA 2CB9A 4CCYB 5BWBA 1E8DA 1U4NA 3ESDA 5LZ9A 3O4HA 5FP0A
chains in the Genus database with same CATH superfamily
2GK6A 2XMCA 3TIIA 4PRLA 1TMOA 2EWWA 2FFAA 1I14A 2Q7XA 3N2NA 3OZDA 2IH4A 3A11A 3VPCA 1DWQA 2QI9F 1XDSA 4L7QA 1ZH2A 2BV3A 1ORIA 1XL1A 4HP8A 4KTTE 2PMDA 3A4MA 3KZNA 2AEJA 3GLUA 1V5WA 1YJQA 3IOMA 3LFTA 4BB9A 2P69A 4WTOA 1UAGA 2QAGA 3TB6A 1QYIA 2XMSA 4P7JA 2PAAA 1KARA 1ACMA 3LBIA 3CMMA 4TYPA 1OX5A 1PLKA 4E5KA 4HWRA 1J2EA 4R6WA 4ESHA 2A3NA 3AETA 2GYYA 4DQDA 2VZEA 1ZD2P 5JDIC 2HWUA 2NU7B 3AGQA 3WGYA 2X86A 5F3RA 4N47A 3DOHA 4XVCA 4PHTA 4ZT7A 3N2EA 5F64A 1K27A 4K9SA 2B78A 2GF0A 4MYSA 1RRVA 2JD0A 2YJ5A 1O58A 4FZJA 4D82A 4X85A 2AS0A 3HB7A 3ASZA 4KE8A 5TDHA 5JJ5A 1SXJD 5IJWA 2P78A 3O8RA 1NMYA 1XE3A 1G5HA 2I65A 5DISB 4EKIA 2OEPA 4UBOA 2IEDA 2GTPA 1DAFA 3MWKA 3GGDA 2H1LA 2X6TA 2XRMA 3S4YA 1KORA 2H1VA 1D8AA 3DP7A 1MC1A 3AB8A 3LQRA 1SKYE 4I1SA 4MJ7A 1JDZA 5BT9A 3ZHZA 3PXXA 4RTLA 4DEVA 4B7AA 1ZIYA 1G66A 1I3KA 4JIMA 2VH5R 4I4TA 1JHRA 2CVHA 1UOQA 1PAUA 4ETWA 4DCMA 5FFNA 5FUYA 2D4HA 5CDFA 3GZ4A 3O3MB 5DZSA 3LCCA 4YUAA 1QFMA 3EOBI 1IZ7A 5BV0A 1II8A 1KC3A 2P7IA 3RDPA 1U8UA 2OUIA 1OPRA 1J1ZA 2QVLA 4HXGA 5LD2C 1VL8A 3D5EA 3TGPA 3I9MA 3NP9A 2XXBA 1QMPA 2LKCA 5CAEB 2BFMA 4C2UA 5CYPA 1M7GA 2QTTA 4FFNA 3TW8B 5KBYA 1ZIXA 4DS3A 2VF8A 3C3WA 4UUOA 3UWPA 2I4MA 1N5IA 2NTJA 1GNSA 3CU5A 2WM2A 5M3BA 5C4MA 3KQHA 2ENWA 3PXDA 3QV2A 1CF4A 2ORED 4I1OA 1SHZA 3TSWA 1IOWA 1JFFB 4MW0A 1Z2AA 3OUTA 2ZS8A 4AY5A 1M83A 3GVPA 1E1RD 3TOVA 4EMTA 3QUBA 1EJ0A 4KHZA 3N3BC 3T35A 4XDHA 2A3RA 5GM2A 4KZKA 1G2OA 2O2SA 4WACA 1MNAA 2A7QA 1JDJA 2WKSA 5DGHA 4U02A 5EIOA 1TTPB 3OOWA 2CL0X 1YZQA 4EB0A 2JVKA 2P77A 3IT1A 1J21A 1IWBB 5JEEA 1QP8A 4ZT6A 3RYCB 1TPYA 3R5JA 1NT4A 3CT4A 1GTZA 4Q3LA 2Z8YA 5IBCA 1LPMA 1V2GA 3EUEA 3FOCA 3GFRA 4LSZA 4DPKA 5LQAA 5TRTA 2GZAA 4UOZA 2Q28A 4KDRA 5CJ2A 1GZ6A 4RORA 3VYUB 5LMNB 3LK7A 2P1DA 3OIGA 4QL3A 1E0AA 3VPFA 3LQQA 1VL2A 1DBIA 3HSKA 4JASB 3LBAA 4K1XA 5JSYA 3W5DA 1MOZA 3FX2A 1Q7EA 4QDOA 4E2ZA 3HU3A 3KR1A 1V47A 4FYIA 1F0NA 4F7WA 3L4EA 1X7ZA 4DLTA 2IELA 3X1WA 4INZA 3A4NA 4YECA 5GQSA 1JGTA 4MV7A 3M5DA 1NN3A 3MGGA 4EP1A 2W6ID 1E79D 4QOJA 1A5TA 2H06A 3DTVD 1HDCA 3RT7A 4HB0A 3R0IA 1BX0A 3JPYA 3EWSA 5K3FA 5BSRA 3SFZA 3EPRA 2XBMA 1JV2B 4QBHA 5TF0A 2IZZA 4GR9A 5BV2P 2OXRA 1UBTS 3A1VA 3LZ6A 3U9SA 3WWDA 1A69A 2HXYA 4PLHA 2EEPA 3CRMA 3F8WA 4Q4LA 1G38A 1KZ6A 5I7UA 1S3GA 2J9ZB 3CS3A 4X66B 5AKIA 3TEJA 2XB9A 1UKCA 821PA 2D06A 1XXLA 2ZT6A 3LS2A 5HE9A 1QVAA 2WYVA 1RXVA 2ODPA 1UIRA 4UEWA 3EZGA 3I6BA 4B0PA 2JFPA 4EO9A 2WA1A 3IOBA 2ZJ1A 3T1NA 1ZNXA 4UCXA 3TKLA 3PRKE 4F3YA 4L73A 2Q29A 2OORA 5IDXA 4GZLA 2VSYA 2W2XA 4YRQA 5D51S 3B20A 5D5PA 3UUFA 4KWCA 4MWCA 2FOXA 1UKZA 3UAZA 2G76A 2V7PA 5J2UB 5A0TA 4ALIA 5ELMA 3SEZA 3HE3A 4D9IA 5TQ0A 2J33A 5D5HA 5LP1A 3WRYC 5IWAB 1B43A 4BU1A 4ZAFA 1Q20A 1OLUB 2C2KA 3V8MA 1SCAA 1NQWA 3A6DA 2EWMA 2FLKA 2GERA 3IAFA 4JBIA 1JSXA 5ER9A 1H8EA 4DMFA 4BFUA 2ZTHA 1M1NA 1BH6A 1DOZA 3OD1A 3LBFA 4PO3X 3RTBA 3B1WA 3I01A 2AE1A 2ZE8A 3EXG2 3D1VA 4OP1A 4Y0VA 3TZQA 1ABEA 1ZO8A 4N41A 2W2KB 4FOPA 1DUVG 1Y5IA 3Q7PA 1SAYA 1U28C 1L0BA 3EWIA 4CUJA 3B5JA 5BVHB 1SUBA 1ZH6A 1TU4A 5E7JA 2DB3A 1YI0A 4DIFA 1DWOA 1OB5A 5HMLA 4DJFC 2WM8A 1RYEA 5BMOA 5KC9A 4LNUB 4PG6A 1GGMA 1YFLA 1GCOA 1R4MA 4GMGA 2GCEA 1A9RA 4HDKA 3TNYA 5AJVB 3VVBA 2Q6TA 3FYHA 3HYCA 2YZ2A 2B3DA 1BQEA 4ARAA 3MTGA 1IN4A 1Q0HA 4HNAA 4HJRA 3H04A 3NX4A 1FBTA 4ON9A 2FSUA 3U4MA 2OGSA 2C7RA 3BXHA 1XZCA 4O4LA 1W48A 2MYPA 2R62A 3WADA 5H5JA 3KEOA 3EGCA 4YMLA 4WEQA 2B92A 1AKTA 1TQHA 5EQDA 3RIGA 3TR0A 1IBMB 3HM2A 1IEQA 4Q05A 4JLMA 2ILVA 3W1EA 2PO7A 4PFKA 1YFKA 2JGDB 2J6HA 3C3XA 3TBKA 4ETNA 1J9GA 4N0QA 4CCWA 4I3HA 4II7A 4GPZA 1T6YA 4JBHA 3BMOA 1T8SA 2ZJFA 5JQWA 3U60B 2WTNA 5DTEA 4NZZA 4GOJA 1X39A 3RM3A 2BKVA 3CZ4A 2FWBA 4AO8A 4E51A 4LUCA 2PRJA 3QLJA 1GDDA 5B1YA 1K3FA 3WLSA 1A1VA 1AKUA 3M6WA 4AJEA 4WXPA 3H6GA 2E2WA 4MI9A 3FPHA 2X3YA 2OLEA 4EFNA 3D64A 5FNVF 3FHLA 2XXAB 4M7OA 5GONB 3GRRA 2X9NA 4C0WA 4F04A 4AD8A 4DSAA 2MT9A 5EGNA 5FPSA 1NVTA 4M54A 2BOVA 3VR0A 1LBSA 4PWYA 3SU8A 4MQ5A 1AUXA 2B5OA 3G0HA 1N4AA 3VHXA 2NUTB 4UNIA 2GAOA 3BBLA 1F0KA 3AEKB 1Z6YA 4GI7A 2XYVA 4BN5A 3MWEB 1HFKA 2ZGVA 4QNRA 2XCTB 1NZJA 1ZIDA 5DGIA 4JJKA 1PL7A 1KFKB 2EARA 3F3YA 2Z2ZA 3T4EA 2O05A 3V8VA 2JJ8A 1T9CA 1V71A 1ZH8A 1UIMA 2PZGA 2GAAA 4H3SA 3RPEA 5E3JA 3VPBA 3IOYA 1LNZA 2MINB 4ML3A 3TR6A 2RGBA 3A04A 4A16A 3VR6H 1FDRA 4N18A 3G0GA 2GQ0A 1MDBA 3H8JA 3PXEA 1TCBA 5AM0A 1C9KA 1UEXC 2C94A 1JDBC 3T5DA 2REQA 4KUEA 4KO2S 4UNRA 2RK3A 1VCHA 2I7DA 3JQGB 2PSSA 1RRCA 4V03A 3NHMA 2Q9BA 4HGYA 4B2LA 2SKDA 1WSDA 1Y6QA 1NRWA 2GSDA 1IZ0A 4IHAA 4XGNA 2GKGA 2A84A 3EGDA 3K9FC 4Q39A 5ELXA 3JQ8B 4L5JA 2DE0X 1Q17A 2QNRA 2XUDA 4P84A 3W3AH 5ISMA 1G7TA 1EQ2A 3IB6A 2HKIA 2HRZA 3PZBA 1PTJC 1XT6A 3ABRB 5TVKA 3SR3A 3SC6A 4BJ1A 4YRIA 5A4KA 2AF4C 3WR5A 3SVLA 3F0TA 4X63A 2C3YA 1TM2A 1OI4A 1E3SA 1QYDA 1TF7A 3IJPA 3Q6NA 3T52A 1IJEA 2O8DB 1Z3IX 1BXRB 3O4JA 3G2IA 4N8DA 3TLKA 2HTEA 1C8VB 1GFZA 3W6NA 3O9ZA 4O1MA 1C7EA 1F5SA 2JFNA 3NH9A 2RSLA 3MT0A 4B87A 1H2ZA 4PYOA 3QENA 1GG2A 3SSAA 4NBLA 4LJRA 1NDUA 1N2EA 1JMVA 2BR5A 2MSLA 3FYTA 3PV0A 3FKSD 3W90A 3GJQA 5HOEA 4HFRA 3FSGD 4EJSC 5IXJA 2XMBA 3UMFA 4MVJH 3PWZA 3SYNA 1OPXA 1M2NA 2AXQA 3G2MA 2ZYRA 5J5AA 5ER6A 1EBFA 3FKJA 5DHUA 3F4KA 5FT9A 2QLBA 4DAEA 1ARZA 4IDNA 1AGYA 4WA8A 5TLSA 4BC0A 4URWR 2YY7A 5C1IA 3VKUA 5HFAA 1RZRD 1ML3A 5IFKA 1DKRA 1RP1A 4P58A 1WKBA 1ZHHA 3MRVA 2RH5A 5DX1A 4QGFA 3DD5A 4URHA 4G97A 2B37A 1U3CA 1JQ3A 3F5SA 3A2NA 4MR8B 5A4FS 4H6PA 5FULA 1JSZA 3LGAA 1CUSA 3T4XA 5SZKB 3VTZA 1M54A 1GLGA 1C3OA 2HB6A 5DXAA 1RADA 5IN4A 1A8SA 4BAGA 4BB5A 4H3VA 2X2EA 5A5FA 1TCCA 4YUVA 4Q7EA 1G7CA 4LPSA 3ETJA 2QD3A 2YZKA 3T12A 3A70A 3AI7A 3DAHA 4IV0A 3WGZA 3PHCA 1FJ2A 4FFOA 3M3PA 1D04A 1VLLA 1F7VA 2DY0A 2LDXA 1DJOA 3L8EA 5I5EA 2GF2A 4NIMA 4IOKA 3SSMA 2NACA 1QH8A 3ZLTA 1EX9A 3HFSA 1MX5A 2VPQA 3GZNA 4MV3A 4F92B 3PFNA 5TGZA 5TS3A 1ODJA 2JFFA 1N1EA 3GGGA 3ZLVA 2XSZD 5KSWB 1N1MA 1E3JA 4YQZA 3RSQA 1HLPA 1THMA 4XFDA 4J0KA 2QSYA 2ZAOA 2ZJYA 3VZCA 8AT1A 5F3DA 2VNKA 5FNVB 5JLJA 3DTVB 2HZBA 4IKPA 3QP9A 4JN6B 1OXVA 2I66A 4PLZA 4F1JA 1HL3A 3NETA 4OXIA 3PFFA 2YN4A 3F5QA 1DE0A 1J0BA 1T5IA 2PMWB 3O6VA 3GUZA 3PQ4A 4LQ4A 2ZIEA 5AK6A 1D7AA 4IDFA 4J16C 5B5SA 4WBNA 2J3DA 4GICA 2P2YA 1OAOC 1PSWA 4KC0A 1J2YA 1I4LD 2ANBA 3R5KA 4NU6A 3MOIA 2ID7A 3PE6A 4BV3A 2XNJA 2C0PA 4NOKA 2C9DA 2JZCA 1JEEA 2G08A 2J9FB 3ILVA 1L8XA 4KLRA 4OQ4A 1DIAA 3JVEA 1JW9B 3DT6A 3D6HA 3IDZA 4Q3AA 4QQNA 1RWKA 3RUDA 4CG1A 2GFIA 4MYTA 3QMPA 1P91A 1I1OA 4N49A 4JBNA 1EFTA 1EWYA 2WWGA 4MJ3A 2F90A 1Z4IA 1KKUA 2F64A 3GO4A 1V5FA 3Q1KA 1KU0A 1L4NA 2ERXA 2X5NA 2XYHA 2Q3MA 2QV7A 3KRTA 2E5FA 3L6EA 4PSKA 5GM1A 3AVYA 2AI3A 2XKBA 1IB6A 1MO5A 4QLAA 2YNMA 3ECCA 4BP8A 2HT1A 5ADHA 3WGTA 3TDNA 4UCWA 3AF2A 2ADMA 4OJQA 1CQIB 2PRIA 2X5KO 3OECA 3OWXA 5YASA 2B1IA 5GGYA 2A92A 4AS3A 3M33A 4IRMA 5EP2A 4BC1A 2O5VA 1ORHA 3TNJA 4GXRA 1VDZA 1NSFA 1JXAA 1UDXA 1V8OA 4IDBA 3JVUA 3CR7A 4MPDA 4ZARA 3U4HA 3EA0A 3T5MA 4QFDA 4ZYWA 2A4MA 1ACLA 1JHQA 4NBWA 1H8HD 2FMIA 2RI6A 4JOSA 3F73A 3T7TA 2WUVA 3L0IB 4I0WB 3N6RA 2BJWA 2R1TB 3IP9A 2X0IA 4FQ8A 2VDKB 4HN4B 1R0BA 1ULHA 1R0WA 3OU7A 1NKVA 4HS9A 4A6PA 5LD2B 3F71A 3NCTA 5KHLB 4JROA 3EWAA 4OYRA 4QUAA 1WOMA 5CLLA 4DW8A 3KT8A 4K6GA 2W71A 1IUKA 2IBMA 1XGKA 1E64A 1TKRA 2X6QA 3L4BC 4IOJA 4LHSA 2QB5A 5T67A 5EGSA 1K89A 4LYDA 1OH5A 1VGRA 1RJGA 4ZI3A 4PHFA 5KREA 4DA0A 5K0JA 2QPAA 1AHNA 3Q10A 2FTKE 4JS0A 1GGKA 4NATA 3T9CA 3U3DA 4JAVC 2J3KA 2FQ1A 4C89A 3KYCB 4Z4GA 1E2DA 2W6NA 4Y18A 3WLIA 1HTBA 1UT5A 3JARB 2JLBA 3HXPA 2ZYVX 3EC1A 3T5PA 2ZLBA 2HPAA 3ZNNA 4Q1AA 3N28A 3QTBA 1XJ0A 1QKKA 4AT1A 3NYRA 1AK2A 2ZEJA 3JWHA 1C8BA 1Z9BA 1RP7A 3U40A 4WGGA 2Y0CA 4ER3A 2O3JA 3KV1A 2NP7A 3RC3A 1YS6A 4CQLA 2C9YA 3PR2B 3KQMA 4HDMB 4F60A 5HGXA 1IOVA 1J6UA 1JQAA 4O5OA 3CTMA 3U3RA 4DKXA 1LI7A 4CM4B 1EG7A 3QF7A 5DT9A 1YWGO 2WILA 2GLTA 2IT1A 4YT5A 5ALQA 1JIVA 4HBGA 3TZLA 2P6UA 4Q9JA 4G37A 1ZGZA 3KTFA 5IVHA 5TQ2A 5FTJA 4HN9A 4AZWA 4CLXA 1KEPA 4KZPA 2Z0MA 4LY0A 1ZVJA 3Q3VA 2NUPB 4QKQA 2R25B 3OTQA 2OTCA 4MNTA 2LZ0A 3P9XA 4TVOA 5EJ4A 2OCDA 3HP7A 2H48A 5AKXA 2FP4A 2RMKA 2Q6VA 5FCDA 1G4AE 1OFTA 1WIWA 4FUQA 4W7IA 2BFPA 1JVBA 1ST3A 1XEAA 3OM8A 2BEUB 4A23A 3D0QA 5K8TA 2NU6A 2XF2A 3ITKA 1RRKA 2DG2A 2PO5A 5KKNB 1U2GA 3M6IA 2IZ6A 1F9EA 4E5NA 3WYEA 2OO3A 1SVMA 1RLTA 2GVDC 4NXMB 1SA0B 2WUFA 5FLEX 4KKXB 4PC3A 4Q9KA 5HTOA 2EGGA 2PKEA 3I2YX 4GOKA 3I1JA 1LTHR 4FW8A 1IYZA 1SK8A 2CUKA 3AV0B 4ZI2A 4MI3A 2XNHA 1V9CA 3UF0A 1KYXA 4EUSA 2IXBA 4M4SA 1L5YA 3AFNA 4MUHA 3I4LA 5J2UF 2QTCA 3GJ6A 2BGLA 3P5BA 5D3MA 2J0UB 4IGAA 3I8OA 2E6UX 3FAZA 1SUDA 3OLQA 4ZOBA 5SY9A 3RU9A 4B2IA 1QVRA 2FWRA 3CVWA 4MPJA 3C14C 3LQ1A 2HC9A 4N3CA 4JY7A 1R5NA 1VGVA 1I6WA 3ZZMA 5BWLA 2IYAA 1VL5A 5KCZA 1B93A 4E31A 1CP2A 4AQYB 4Z8XA 3F6EX 5L3VA 4JXZA 1STOA 4XLTA 2ZBRA 4RIGA 1XD2B 4TV9B 2GCOB 4KR9A 3TTWA 4EELA 4CEHB 4NYMQ 1ODTC 3FFXA 2NUBA 3PEEA 4Y2HA 1NC1A 1NTRA 3PGVA 1TVMA 3GRVA 3ZU2A 1X7GA 1SQGA 3LVRE 4ROTA 2IEAA 4A15A 4FWTA 2OOKA 3JZFA 6PFKA 4S1NA 3KPJA 3D8UA 1EK2A 4L85A 3ZY2A 3G5MA 4AX4A 3VVCA 4E07A 1V16A 4FNAA 2QTAA 1XJCA 4E6PA 1IPEA 2FGJA 2QROA 4DREA 1JNYA 2YTZA 1E96A 3NVMB 4DDHA 4NF2A 3AU8A 5ICEA 2IVFA 1MABA 4MW1A 3F98A 2AXPA 1E58A 1WS6A 4C88A 1GPWB 3OF2A 5CDUA 1FXUA 1B00A 3N2KA 1TJYA 4ZOLB 1S3FA 3SOPA 1AKQA 5AVXA 3Q3HA 4GM1A 3ZEAA 2AE2A 3MFQA 4ZGBA 2QQFA 1QNLA 1ZI6A 5J5CA 1EH5A 1VMAA 2O2DA 2ORYA 4G56A 1SB8A 1X13A 4PANA 3OZ7A 2XZLA 4X1KB 1IY9A 1KK2A 4BWGA 4CNBA 2PGLA 3RCBA 1T9BA 3MMZA 4LRUA 3OCYA 1JFLA 1UJ5A 1XMJA 4YFVA 4LWOA 3BF7A 1RLMA 2WTXA 2J8ZA 4DDWA 1XQYA 1AXRA 2JAUA 2OZPA 4CE6A 1O77A 1H6AA 3ZHTA 1ENYA 2IYSA 3TIXB 1NBEA 4MHTA 1CUVA 3NEJA 1S7GA 4IWXA 5AQEA 2GMWA 3R0XA 4H35A 3U5ZB 4BVAA 3SD7A 2XBUA 1S96A 4F84A 3V7YA 4EPTA 4JJ4A 1QTRA 3A7EA 5JSUA 3VJLA 1RWQA 2IHNA 2XB8A 2JCGA 1CQXA 3NDJA 2HMVA 2WI8A 1E9RA 2XOEA 4G9BA 4ZCMA 5JAPA 1F6BA 2YWDA 1TAHA 1M66A 3RG2A 4OHUA 1RWMA 1ZX1A 1JKXA 2H59A 2HJRA 4PINA 5ALEA 2GEUA 3LY8A 1U2RA 1U3UA 3ZHCA 2FWNA 3SS9X 3UJ8A 3DEYX 1CUCA 2DWPA 4LZAA 4UUBA 2Y93A 2NYAA 2EEZA 2CCJA 2XE7A 1WZIA 3G9TA 3TG2A 4MVJD 3V6LA 3HJNA 4OHFA 3AIOA 3R24A 4JI5B 2O0KA 2WU0A 5CB4B 3QE3A 3W8RA 1YHYA 3GARA 3V7NA 2YJNA 2JFOA 1P1HA 3QF4A 4EL0A 4CCYA 5JRDS 3P9PA 4RAQA 1QP0A 2ODTX 4OOFA 1CD5A 1GLNA 1P9RA 3ND5A 2PZFA 4WZZA 3RYFB 4IDAA 4JI2B 1B23P 1NXTA 3GQBB 5IKPA 1LTKA 3GH3A 3R6WA 4UFOA 1UXKA 3KZKA 5E7QA 1VFPA 3ZLJA 1ZMRA 5IAKA 5E9WA 2ZYUX 4PR3A 5ENZA 4F3KA 2RAPA 1BW9A 3QVVA 3IQIX 4KAJA 1ZXXA 2C57A 3D6FA 3IURA 1N2CA 4RSHA 4RW0A 1C3VA 3AY3A 4LE1A 4A82A 4DQKA 1G63A 1QKIA 1ZM7A 4D9HA 3QTLA 3NLLA 2EQBA 1YQUA 3KNZA 2F62A 1X38A 5J2TA 3H6KA 4D3SA 2IYFA 2EX4A 4UAUA 4A8JB 5TR9A 3WMEA 2A9QA 2Q5JA 2APJA 1H2FA 4YDSA 4B4DA 3K1TA 1DDGA 2CLHB 1B2LA 3KU4A 4BIMA 4UD2A 3RS7A 4L6CA 2A9VA 4JU8A 2X9LA 1J97A 4OSOA 1QJCA 4YS6A 3FOFC 4DSUA 1GTVA 3HL0A 3K9GA 3U4IA 4P3XA 4R0NA 1ODCA 3B7PA 1HQKA 3B82A 3DZCA 4PCLA 2X9QA 3N7AA 1JQ5A 4TS3A 3CVXA 3GFPA 3FR8A 3OT1A 4U8HA 2XCIA 4CL3A 4E3WA 1CHDA 3V8PA 1C7RA 1J4AA 2YHAA 3FVVA 3NBAA 1AQYA 2WIBA 3BFPA 4JGBA 4KPUB 4NE2A 2ZUDA 1RVV1 4BNWA 5AD1A 2R86A 4OSEA 5AXAA 2QKYA 2O7RA 4BIIA 4CLOB 2EKDA 3MAGA 4P36A 4J91A 4BNGA 3TX6A 4ZCQA 3KQQA 1YJ8A 4AS1A 1ADBA 3LQYA 1O03A 4AIRA 5LWQA 1E3LA 4F2WA 3IHWA 1WPQA 1N0WA 1OBOA 1T0UA 3ANSA 1M72A 2JASA 5L3SB 1NUTA 5LDGA 2XQIA 1ISPA 3DZJA 4KFSA 1NAIA 4MRMB 4F5WA 3PGLA 1QQ5A 4WCFA 3C8HA 2NXEA 4N82A 4OU4A 1J0CA 2AZ4A 4F97A 1ZZGA 4QOFA 3T5GA 4FOTA 2CUNA 1A5SB 3HYRA 2YHIB 5IXSA 1I2DA 5C7OO 3A31A 4KJZA 1JG6A 1XVIA 5DM70 3HDHA 1UEJA 3QHPA 4FBLA 5C7LO 3MT8A 3OFND 3ODGA 4I9UA 2DTXA 3PX3A 1TTTA 4I7EA 2ETXA 5BUZA 1VI2A 1J2UA 3KKLA 3U3JA 1PEYA 2EKPA 1MO2A 1ZGJA 4N7RA 2BGUA 4X7RA 3EK2A 2QN8A 2O7QA 3OUZA 2OQVA 3AEUA 4DILA 1EXDA 1PZMA 3MTJA 3R5HA 4KXNA 3RC1A 1VIVA 4MICA 4YQFA 1U8YA 4X65B 3K9HA 3LY7A 1A9XB 1NKTA 2GAFA 1YGYA 3M2TA 4K9MA 5CLJA 2P4SA 1CK4A 3WQQA 3ZQ4A 2VRCA 1QYRA 1GD1O 1L7BA 2NOAA 3CB4A 4TWIA 3GBSA 2FDRA 1J7KA 4YJKA 1MMFB 2D0PB 3ZE9A 4ENWA 2X3UA 4LK3A 4WNAA 4HAWA 5CDHA 5FWDA 2OGTA 2FEXA 1QK4A 2VOJA 2CJWB 2VK8A 3FD8A 3I04A 4TM7A 1RAIA 1YAHA 2CNDA 4MP6A 4YBRA 1VHDA 5ICSA 5G4KB 4DL9A 3TECE 2ZUSA 4HEQA 2OAP1 4TSFD 4UU7A 3FB4A 5LYJA 5C2JB 1GAXA 4UAGA 1MOSA 1OD6A 4RIFA 1SVLA 3DMTC 1R27A 2FFBA 5CB6A 1CPYA 1OFHA 2N47A 1L5HA 2JEZA 1GPMA 4KN9S 3D8BA 3KR9A 3OZCA 5B36A 2IP4A 3L7MA 5KB3A 1E2NA 1D2AA 1WB5A 1D6NA 4G26A 4RQTA 4PO1A 4RV4A 1M6EX 1RAAA 5KOIA 2Z1DA 3JYOA 1IY0A 2NZUG 4IGEA 3R7WB 1DAMA 1MEEA 3AFOA 3QHQA 1G19A 3MUNA 4LV8B 4TRRA 1YBHA 2I99A 4U0JA 4E70A 1LGYA 4AWXA 1LU9A 3MYRA 2FQXA 4FCTA 4WJLA 1VPDA 3UB3A 3BUSA 3EPLA 2OCKA 5CX1B 1HY3A 3GFSA 4MW7A 5FEMA 4YLYA 2IWHA 3SF8B 2ZT7A 3IULA 3GLRA 4OH7A 5DW0A 2DSNA 4PZ0A 3VR3D 5FKJA 3WZLA 1QONA 2B2CA 1EHCA 3KV3O 1AMNA 1Z13A 4JVNA 3OBBA 3VTKA 4D9MA 5M04A 5K2OA 4ITUA 3NUGA 3AW9A 3M81A 4TUYB 1ZKMA 2RFLA 5JWHA 2C58A 1G5RA 4B6OA 5BQ5A 1CUJA 1NI4A 3VHLB 3WLQA 1HKUA 5DJ5A 4A1OA 1P17A 2OHGA 3VZPA 3B52X 5B4UA 2XGSA 4BO9A 3URMA 5AUQA 5JARA 5JS8A 3GVIA 1P45A 3BMNB 4F1WA 4IW3B 2GZRA 1KWGA 2J3QA 2P0AA 1Y6FA 1KK0A 4G9EA 4LC0A 3STHA 2DWOA 4NI5A 3ZBTA 4J7CA 1RJDA 4KQEA 3KUKA 4OBXA 4IXMA 2QJWA 2VHEA 5D3MB 1E3IA 2VNHA 3DXZA 2HK6A 6YASA 3BWBA 1XNGA 1W29A 3BWXA 4HKTA 4EI7A 1N2CE 3V32A 3EVFA 3ZCRA 1O94A 2ZAGA 4GMDA 4G5XA 2TRSB 2O0LA 2ERCA 3GYGA 3PTLA 4TXHA 3B38A 1J0DA 5FO0A 1CS0B 2VRBA 1J0AA 1QTNA 4QLBA 3FH0A 1NOKA 2J6CA 3I34X 2B9VA 4Y1EA 4Y67A 4D4HA 4JYAB 4UNNA 1GT6A 4KDFA 2Q99A 4J2OA 3D1JA 1A0OA 1P3DA 1PK8A 2CMGA 4RENA 2R85A 5CA0B 3VHQA 2V6IA 3HBMA 1E2JA 1NBIA 3K6KA 1AQIA 5BSFA 1IUNA 2H2DA 4HVAA 2FPUA 2R6GA 3F46A 1XEWX 1QYCA 1UWKA 1J2RA 1ESZA 1IRIA 1PUJA 3ELYA 4HQLA 2XEXA 5EJEA 1MB0A 5IJZA 1NJ5A 2E6KA 1SBQA 3Q0IA 5ICMA 2L17A 1KS2A 1IHUA 2O4CA 1NY5A 4TS1A 3L0BA 1FY2A 5LQRA 2GK4A 2QN1A 2WSSD 2YWGA 2DBQA 5C8VA 4Y9DA 2O48X 3N2KB 2IY7A 4ZOLA 1UJMA 3EGIA 4OM8A 2CXPA 4YTEA 5EZQA 5G1NA 3W5UA 5EJ8A 4BXOB 3KSAC 2DVMA 4EOGA 4E08A 3ZV5A 3AVUA 4UVIA 4X5OA 1Q15A 2MDTA 1TA4A 4LXQA 3SLKA 3W0LB 2OXIA 1FYEA 2HREA 2ZUCA 4JYBA 3UC9A 1JWBB 2QP3A 4GBMA 3X2EA 2YWBA 4ZVVA 4AJIA 1ICEA 2WWWA 2Y9MB 4KQKA 4UU1A 5TMEA 3A0UA 4ED9A 5KWVA 4F9EA 2COKA 1T36B 1CJKC 4MCIA 5HILA 4CTMA 4KVFA 3ROQA 2GETA 3IOCA 3O8QA 4M0CA 5CFNA 1REQB 4OI0A 1GLVA 3HXKA 4MH0R 5IJAA 4TRJA 3RRFA 4A8JC 2YS7A 2PV7A 1YL5A 2E7ZA 5F1YA 3GLGB 4IHQA 5AW5A 5B6JA 3ZJ5A 4M49A 5FPQA 3S5UA 1QAMA 1NMSA 4IZ6A 3PPYA 1CQWA 2PR2A 2VJMB 2ZRCA 3EXEB 3MBKA 4PZAA 3RT9A 4HQFA 4ND1A 4NXNB 4QTUB 3OESA 1K6EA 1E9DA 1ORTA 5A5VA 4TKVA 4X44A 4PX5A 3D7SA 4ZOAA 2OCBA 2H11A 3IEKA 5EL0A 1FX1A 1XEXB 4X95A 1T2AA 1P62B 3E4CA 4QELA 4OI2A 1IAQA 1NLFA 1QORA 4IWNA 5EA2A 4DNXA 1RKBA 4AL4A 2I76A 4LDNA 2EDAA 3L6OO 1MX3A 3ODPA 1E60A 4LGCA 5KWSA 3ZJVA 5BO5A 5IJ9A 4BZWA 5AXBA 2XZTA 3HKDA 1W9MA 2Y0BA 3GRFA 1E6KA 1NZDA 1ZU4A 4FE3A 1Z4LA 5G53C 3SX4A 4NCKA 4QBKA 3TZ6A 2VA9A 1TLTA 5CLGA 2WJWA 4LTMA 5IBQA 4DTCA 3IP5A 3EPHA 1E7QA 4TTPA 1C7ZA 4BE7B 4ZO9A 1Z5ZA 1HEYA 5CA0F 3WMWA 2XGJA 3AR8A 1WMFA 4XQ0A 1TUIA 2PS9A 2Q6OA 3P97A 4YJDA 3GAZA 5DNCA 2ECKA 3K9WA 3EN0A 2V7XA 1FP4A 5EFOA 1CUFA 4KRXA 1RSZA 2I4TA 3QPBA 4L6AA 4LHWA 1SKAA 2H17A 3IODA 3JVIA 5DEIA 1H4QA 1R10A 2PM8A 2ZR0A 5SYMA 3P32A 5LXTF 4IO1A 4GXTA 4LECA 2PD6A 4TSRA 4ER6A 4G23A 1EE9A 1FLVA 4Y6SA 2P8JA 4OFWA 1FTGA 3BE4A 1ZJYA 2NM0A 3W5AA 2ZT5A 4LDJA 4KE6A 4QAQA 2Q0SA 1V6AA 2KMLA 4US0R 2PU7A 1LPBB 4PLWA 4CBVA 1LJUA 2ISSD 1PSZA 3CF4G 3CLHA 1ZOIA 1Z07A 1ZM2A 1Y6RA 2EW2A 3B36A 3ET4A 3UXMA 4HV4A 4BJ6A 4YHHB 2BELA 4LSWA 4PPYA 2Q1XA 2ACEA 4NKRA 2RHGB 2ZITA 5CA0A 3BJIC 3PFIA 4FHFA 221PA 1ISSA 3EEBA 3P8ZA 4L75A 2PGJA 1QHGA 5K09A 4QD3A 2OHIA 4QVIA 2WOOA 4EHDA 3S8YA 3DOFA 4UREA 3R20A 3LP8A 2YVLA 2O8FA 5DYWA 2I1QA 2FW9A 5HTKA 1QUEA 3EIHA 4LI0A 4AJJA 3AIIA 3EIUA 6CHYA 1N2GA 5FD8A 4MUFA 3IELA 3ID6C 3GJ7A 4GZ3A 4UTNA 1KGDA 3THYA 1A04A 1Z4JA 3TE6A 3LVQE 3ZCQA 1W52X 4YCMA 5H9VA 1EQUA 1DXOA 1FCJA 1HBJA 1MLDA 3BIWA 3DTNA 1NBMA 4ILEA 4BDSA 1RJEA 2IXDA 4Q0MA 3NEYA 4XFJA 2G77B 2EP5A 3PS9A 4ZQBA 2QRGA 3V9AA 5ECDA 3AIKA 1RABA 1TF2A 3Q9SA 1R16A 4FGZA 4I6EA 3RF7A 2B3TA 1YBVA 3G0DA 4IQ0A 2FN9A 4X1OA 5DO9A 3RRZA 2CDCA 1XWFA 4YP5A 3UWKA 3I6ZA 5A3JA 1OF1A 4ZVPA 1JAHA 1OLXB 1P72A 3L8MA 4FK8A 5HCUA 1OA0A 3OHSX 4Y1FA 4TN1A 3TH5A 1MH1A 4BUZA 4Q7QA 1YA6A 4ZMSA 4Z86A 1NXVA 4L51A 1KI8A 4DWVA 1KTIA 3WLRA 3TAUA 4FHCA 1XCBA 3H1EA 3E1SA 2ES4A 3DT8A 3LVFO 4S24A 4PG7A 4PZPA 5AKJA 2BFBB 4G5YA 1U8TA 2XDAA 3ABIA 4GT1A 3PF9A 1G7SA 2I3DA 1Z17A 4L4ZA 4EF5A 3U7RA 1DT3A 2Q0HA 5EJ7A 2QDXA 1N77A 2WABA 2XTZA 4E32A 3GFQA 3KTDA 3LCUA 2W93A 3I92A 2XQJA 4RL4A 3RS3A 4F5ZA 3IPYA 3UJNA 5KNDA 1VOTA 1BE0A 1QH1A 4MV6A 4F2HA 4LKRA 4MWZA 4NAVA 2YZ7A 1DKPA 2HIHA 3D7MA 4EVSA 2MSNA 3W8NA 3WNBA 1P0MA 1NM5A 4ZOLF 1Z8FA 2ZPAA 3W9UA 3DNMA 4L2IB 1N2JA 1FLAA 2GZHA 1O96B 3A9RA 2MJLA 3ELUA 4RACA 2W70A 3TVTA 2W11A 4RCYA 3Q2OA 1OWOA 1QVZA 1OASA 2AR7A 2RGWA 4DG9A 1PNRA 1JDBB 2R751 4TYMA 5AW1A 1QLHA 5C5CA 4MB0A 4ZQGA 1N6HA 2JGMA 4AF6A 1P2BA 3ZV6A 3AB7A 3WSTA 1J8YF 3ZNQA 3ZHQA 2ZI5A 4U3JA 1FL9A 5IABA 5I7VA 2P2ZA 2R0QC 3ENNA 1O8CA 1H0KA 3L04A 4C14A 1YDHA 1OH6A 5HXAA 2E4VA 1VE7A 4BCDA 5FWXB 4P81A 4AKIA 3KVNA 4ADSG 2J9YB 1GKYA 1XVUA 1YJBA 1XX6A 2COEA 2QE7A 3VUFA 5BN4B 1LV8A 3L93A 3HYSA 4MWSA 2R97A 1EWQA 2AGVA 1M6VA 1TW3A 4XJSA 5DULA 4OVKA 4D46A 3PHIA 3DQPA 3G2QA 1WPXA 2PSJA 3AW8A 4YJ3B 4C1BA 2CE7A 3HTXA 5F2OA 3BVPA 2VJKA 3WA7A 5EIXA 3MCVA 2IPNA 4HQKA 3B85A 4IIBA 1ZH0A 4KXYA 3U09A 1BD4A 1KH1A 4UHBA 5ALYA 3W6ZA 2FWPA 4QYIB 1XSEA 2PSEA 3BREA 3GVXA 3IPLA 1L4FA 4GKVA 2OV6A 4IDEA 3L05A 1XQ6A 3RVBA 3WGIA 4I9FA 3PQ8A 3Q5GA 1EP3B 1V39A 1VYUA 3M7IA 1AKEA 4IQFA 1BE6A 5F7OA 3B8HA 3HB5X 5D00A 5ECGC 3OFVA 3PUKA 1JSRA 3K2BA 3BFXA 1Q3HA 4RCZA 3TOCA 4AI6A 2DUJA 3B9PA 1W0JD 4FI3F 2Y1CA 3TN7A 4MRRA 3NBYC 2D1QA 1D4ZA 1IG3A 3FE2A 1PGJA 1TQ2A 4C7BA 1QFYA 4CMAA 1Z0ZA 3GRUA 4LJAA 4AG6A 4BFSA 2PD3A 3HXOA 2Q8NA 1LPAB 1N92A 3L4BA 4M83A 4PC2A 1JEQA 3W79A 4G0ZA 1ULUA 4HNAB 2G1AA 1JSCA 4C0BA 3MS2A 2R44A 1E92A 1YBFA 4K3VA 1E2BA 4K9RA 4XGRA 1EAYA 2WV9A 1U4OA 3VA7A 1INLA 4EL5A 2LP4Y 1G9SA 4OB6A 3DBRA 3QOFA 3IKMB 1G8SA 1SZPA 2J5QA 2Z58A 4NBNA 1T0BA 3HY3A 2R8EA 2XOXA 4A0QA 2XE8A 2OYRA 4KR3A 2GCNA 3Q3CA 3HXMA 4K2AA 4BYMA 4Q37A 3H8WA 1TB4A 3O74A 5B1EA 3BN3A 3H97A 2MYUA 1JP7A 5J4KA 1VG0B 4RF4A 5C51B 4IGKA 2P9GA 3LDUA 2A5GA 1L7OA 1TCVA 2Y76A 3KVOA 3OO0A 2C2GA 2OHJA 3Q9LA 1V43A 1ZAKA 4WD3A 2GPWA 1Y8RB 2C8KA 2LPMA 5FUVA 4AKSA 2GHRA 4RSRA 4ZDJA 1VXOA 1YV9A 2UZ1A 2JI8A 3KL4A 1T9KA 3C3AA 3S8EA 5CX4A 1O1YA 1SVOA 1JYEA 4MGEA 2ECPA 5JXJA 2EKQA 4PNPA 1EAMA 2REBA 3D2AA 3UUWA 1LNSA 1YB7A 3I30X 4HAIA 4HI0E 3MMPA 1JWLA 2IDJA 1U7ZA 3HBAA 2NUTA 1BG6A 5GY7A 3ENVA 1VLZA 2FSVA 3VNUA 1W2GA 2H3EA 5C35A 3SAJA 1VSTA 2G9ZA 2Q62A 4MRPA 3IV6A 5DT2A 1RC8A 1J5EB 4P92A 4ETMA 4X6YA 3A36A 5D85A 5EIWA 2AOTA 3IP6A 2PS0A 4FFSA 5BURA 5IUJC 4DRYA 1X1RA 5IP5A 5JY1A 1SCBA 3NC1C 4ZREA 3QMMA 1JLMA 3CUUA 3WKEA 2VYVD 4P4SA 2C1ZA 2BGTA 2BJVA 5EFZA 3AP1A 3WS7A 1RLIA 3KE8A 2BMEA 1Z12A 2CB0A 4Q16A 4CMEC 5EMMA 1O6BA 3CCFA 4YUYA 1N34B 4RPHA 3KSUA 1RXYA 2Q2QA 4YJ2F 1CUYA 1HRKA 5BWCA 1VHWA 3CSUA 4YRAA 3WFIA 3CQ9A 2DFPA 2MCFA 4C5BA 2XECA 2P6PA 3VPSA 2FMHA 3CLTC 3P96A 1XZGA 3DVAB 3OO1A 4GVLA 4TWJA 1Q7RA 3IAM6 3IX7A 3C0KA 4R8MA 4J75A 3ZWPA 4BNTA 3QH4A 2V03A 1KQGA 5FORA 2QPLA 2QTVA 2PA3A 4YWHA 3ZVRA 3EZYA 3Q87B 3I8SA 1HUQA 5CH5A 1KNXA 3NXKA 3ND8A 3QNMA 3Q7RA 1KQOA 2E4UA 3JD1A 4RPCA 2JHPA 2AYZA 4ZEVA 2CVFA 1HYQA 3CVOA 1V26A 1YIDA 3I23A 3LHKA 2A59A 5JEDA 2CXQA 4AULA 3V46A 4CF6A 4A8HA 1D4FA 1U3DA 3GP5A 5REQA 4DIBA 4ZEXA 1KYYA 2QVCA 2J4DA 2FZKA 3TQSA 3PFKA 4KRYA 4N3BA 4C6HA 3ESCA 3EAQA 1PWYE 3CRRA 3IEPA 3L07A 4RIHA 3Q8LA 4V0QA 1MAHA 4D1YA 2H18A 1J23A 5TV2A 1XLUA 5LIRA 1UP7A 5F4ZA 1VL0A 3C41J 4D7AA 1IPHA 1MAWA 2DRIA 4N3AA 5LP6B 5AM1A 4HAOA 3WYAA 1PQUA 1P33A 3PRYA 4I9NA 4FHDA 2GTHA 4G1VA 2RONA 2JLUA 1O8BA 1G9TA 4LJYA 2ZJBA 3D8TA 2JH8A 4UE3S 1MORA 3DS8A 3E48A 3H5OA 3I2GA 3DFKA 2HBZA 3BE5A 3FCYA 3F5FA 3GT4A 2RGUA 3K0FB 4AMBA 1RRFA 3TM4A 4BTLA 1GR0A 5IANA 2QK4A 1HE2A 1QFXA 2H4XA 2Z4TA 2B35A 2HQSA 3TLCA 1S02A 2V7GA 4BNXA 5FYQA 2WQZA 2OP1A 3DNFA 4CM9D 2EFGA 4DNPA 4R3WA 4ZIRB 3ONWA 5CCEA 2QRUA 5F5XA 4BJHB 4JMPA 1A4XA 1V48A 1EI9A 2VBFA 1SZCA 3ZY4A 4RVUA 1AMOA 3AUJB 2E3JA 4AZ3B 2ETVA 1RC0A 2YBEA 2HEGA 1HSOA 2DPMA 3DDUA 3MLEA 1TW2A 2X4DA 4QHYA 5TVGA 5JAHA 2B30A 4BO7A 5COQA 4BJ5A 1G8PA 4CL8A 1C1DB 1XQVA 4IDQA 2YDYA 1UFOA 4ZQHA 2O8CA 5DOZA 2B9EA 4BMNA 1EZ1A 5J5VA 3DEZA 4IG4A 1QHNA 4OBBA 4RH3A 3WXBA 1OLXA 2B82A 4S0ZA 3ZWOA 2PEYA 3KL2A 1SXJE 1P4JA 2QPOA 2XYPA 1US8B 3HCNA 3I9JA 3K8YA 2SECE 5LDDC 1XDUA 2OSBA 3A37A 2P2NA 3KB2A 3UENA 3ILXA 5G2OA 2E4ZA 2P40A 1F0YA 1RAHA 1NMXA 2F1KA 1FLDA 3UO8B 1E1CB 1HDOA 2HSZA 4FHZA 1ENPA 4KAAA 2XIJA 3NUQA 3HUTA 3DE6X 3T95A 2NPIA 1ISFA 3PL5A 2ZE7A 3B53X 3PXCX 4HATA 2RH8A 2OXTA 3SZLA 3PP8A 4L8VA 1KDRA 2AMLA 2O52A 5FWYB 2IIVA 1ESDA 3E9MA 4QDKA 2GCPA 5T6BA 4CCSA 3WBBA 3WISA 4EAQA 2E9SA 3BMQB 3K09A 2ZK7A 1WP4A 3ZS8A 5I6DA 2OZLA 3DMNA 2VFAA 1DDIA 5E0KB 5FF9A 5AW3A 1W6RA 4V0KA 4B31A 1P2TA 1WMSA 2VDOB 3TTYA 4EZIA 5ADVA 3FCEA 3PX7A 1PCXA 1Q1BA 2D1TA 2I7VA 2P65A 2W6JD 1TPZA 4R6XA 1YVEI 3S2FA 3W05A 2AOVA 4AN4A 4CM3A 4YR9A 4B6SA 4JI0B 2O3TA 3BRWD 4GX2A 2Z6VA 4DRXA 4FOSA 1LZLA 1RPNA 1YJXA 2O6HA 4E4YA 4MQFB 1T5BA 1V1JA 1SEVA 4EYQA 5EYPB 1WXFA 4JI1B 1R88A 1TYEB 2RHLA 4G01B 3NYWA 4OJNA 4EY5A 1C50A 4XLZA 3OHPA 5EJAA 4L9AA 2ZR9A 3WOVA 2A4KA 1U9IC 1WUHS 5M2QA 3DOUA 4Q12A 3UQZA 4ZQFA 3W4JA 3F2VA 5G0UA 2PMEA 4JQOA 1RI1A 5CYOA 3ROTA 1RZRA 3QLUC 1G21E 3HXQA 1NW3A 2AEMA 5EUQB 1Z2DA 2A1TS 1J56A 3QX9A 4PTLA 4H6VA 3L0CA 4ALLA 1L5LA 1YOVA 1MB3A 2FZLA 2A67A 4WCVA 3MS4A 5LA6B 4JBYA 3AB3A 2G0AA 5AM3A 1PV2A 4GLBA 1BWRA 4PTYA 3VI4B 4GGPA 5JXWA 1K6IA 2X23A 3WLKX 4K9PA 4LE2A 1Z5NA 4UASA 1U2TA 2CUTA 4NCJA 1SVSA 5HF5A 1PFGA 5CPBA 4RD6A 2UUAB 1H42A 1EA5A 4M1MA 1RAGA 1JQKA 3NTXA 4DZRA 2PKYX 3DOEA 3R3JA 4E09A 4CQMD 3LHIA 3RHTA 4NTZA 1W34A 1WMAA 2K7ZA 2BEKA 4IIXA 2VBGA 4FGSA 4A36A 1U8XX 3UJBA 2PLFA 1U99A 3VZDA 3B1YA 3ZPXA 4YCDA 3OX1A 3S1AB 4ENQA 1ZK0A 3AHDA 3AM3A 3Q1LA 3W04A 3TF5A 1QIFA 5JCPA 1VE1A 3EAGA 3LC7O 1UBCA 4FTWA 2PRKA 1LX7A 1YRBA 4OQXA 1YUBA 4J0CA 4WN9A 5PNTA 2QMEA 3EEFA 3NAQA 4UUMA 4NE9A 4XDYA 5FOXA 3RS2A 2I03A 3H65A 3FTDA 3CG4A 1JE0A 5D1HA 3P9YA 5CDFE 2R6R1 3U2QA 1RYYA 2YJZA 5KX5F 3QWHA 1RXEA 2Q4OA 2AUTA 4Q4JB 3F78A 3R4CA 4EEXA 2B0CA 1JFSA 2O57A 2RGNC 1JU3A 1N6KA 1YNOA 3LDGA 1C9NA 1XHEA 1N0IA 4PCUA 3SLGA 2AZXA 4OQNA 2PYDA 5AKZA 4BLTA 3O91A 2C00A 1I5RA 3AIMA 4R05A 2ACVA 4XEUA 1OGYA 2WYHA 1AIPA 1E4YA 2D1YA 2G25A 2REOA 2QYHA 3DVSX 1RHQA 3E23A 3PQ7A 3KEQA 3IQDB 4IF6A 5E0OA 3JVVA 4FLFA 1VPVA 5F12A 4B40A 1EUYA 3PJRA 1A88A 1QB7A 1CY1A 3MQ4A 5AUNB 1HNXB 4RZQA 4GW3A 2V6FA 1XU9A 1UOPA 2Q2NA 1ACJA 4I08A 2FPIA 4H15A 3TQQA 1YJAA 1I6LA 1SVKA 2DLCX 3PX2A 2YV3A 5E8RA 5EP1A 4ACBA 3DKIA 2W43A 3F9IA 4QGSA 4G0XA 4YRCA 4ARZB 2GZ1A 3H9JA 5FWAA 1N1DA 1QHHB 2YNMD 4X1YA 2RHJA 3U39A 2WV7A 5BXYA 4X6UA 2HIAA 3Q12A 4FMDF 4Z51A 4HRYA 5IHXA 4L72A 3DLIA 3VTFA 3OQ6A 4XWAA 1M8JA 5DHTA 1C4KA 2MYNA 2HLNA 4HPXB 3C24A 1FYFA 3WQHA 2QI9C 3ZGNA 5JIBA 1JXOA 3EC2A 4H7PA 1I3NA 5CA1F 3HCWA 4F4FA 2REQB 4KWIA 3FM9A 4K6HA 5ALIA 1UK6A 3GUYA 1W47A 1VL1A 5FUXA 3KM0A 2F3SA 3CF2A 4NFYA 2I7XA 5ARCA 1L1QA 4CV3A 4Y7DA 1JIXA 2FW1A 1B6GA 1KI1A 3NHUA 4ZMBA 5IT4A 2RHOA 1CUUA 4OMCA 3ORSA 3BGIA 1FYVA 4PLYA 3FLBA 3GXOA 3HB0A 3JR3A 5AW4A 1YRAA 2PY6A 3CZPA 1MQSA 1BU8A 5F7ZA 3HRHA 3WNQA 2B8NA 4HYEA 1QK5A 2J85A 3L6CA 5KWJA 1UMBA 3UWOA 2BVNA 4IIUA 4P3NA 1T4CB 2PWYA 4CRWB 1PS9A 5EE5B 1BXRA 1Q7CA 2R8PA 4KQ9A 4NHOA 3TZEA 1DX9A 5I48A 5D6NA 3S27A 2VH1A 5K4HA 1P7ZA 4L50A 3PNPA 1GM5A 1EG2A 5L3ZA 4C76A 3LMKA 2O2GA 2I7CA 2ZFUA 4CI0B 1F7UA 1L5SA 2VEOA 3PDWA 1VG1A 4HUQA 2HLDD 3K96A 1I4TD 4BZPA 4CM1A 1MVNA 1Q0ZA 2BF4A 4U7DA 3QMVA 4IDOA 3X0DA 1XDWA 4ZRMA 2VJDA 3S68A 1PQWA 4YMTA 1AO3A 1Z0JA 1A77A 2VP3A 3QGMA 1KSHA 4AXBA 1G6OA 2GAJA 3GRZA 2UDPA 2FG5A 4RMGA 4W9NA 5JJLA 1XZLA 4YQYA 3BFJA 4MYHA 3A1NA 4QM6A 4Q9IA 1XNHA 2DBVO 2XWQA 4OBWA 3NCHA 2XQKA 1PZXA 6ABPA 4FNOA 4Z9AA 3TIFA 1ZI8A 3E9ZA 1YFJA 3DHNA 1TVKA 1OFUA 3OEEA 4CU5A 2Z9BA 1WDKA 1XAJA 5B7GA 4KN6A 2PTGA 1LKZA 5NLLA 1JX6A 4PYQA 4I4TB 5E6RA 5K8LA 1BDBA 4RMJA 1II8B 1MZVA 3CT6A 4WXEA 3WIUA 2PWZA 2YW9A 4EPWA 1CNMA 3DPUA 4RTNA 1FDWA 4TYNA 1S9DA 4BO4A 1Y1KE 4XW2A 2EBHX 4U7PB 4RUKA 4ZOCA 2C2BA 1RAEA 1G2PA 4OXNA 3BXZA 3L41A 2QR3A 1DAGA 4H7HA 4WW0A 3WO1A 3P1JA 2G17A 4MITA 1LVUA 3E61A 4GO1A 3UXYA 1PJBA 3LGXA 3HJRA 1P4RA 5DHPA 2WHPA 2C2ZA 1HMYA 1UFQA 5FL3A 1U9YA 4WY2A 3ZIUA 4DR2B 5ICFA 3BGSA 4YA6A 1WMEA 4J94A 1SXIA 3PR1A 2CXOA 2NXWA 3WRVA 1TEZA 5M34A 2XD4A 1PJTA 1NX6A 3N1UA 4RGVA 3CMCO 4EUHA 2VZ0A 4IX1A 2GM9A 1W87A 4V2IA 1IEXA 1H94A 1NC3A 4GSYA 1T6ZA 2QMQA 3EXFB 4OKNA 3RIMA 1SD2A 2GJ8A 2ZIUB 2ZVQX 3TCKA 4YRDA 5KYTA 2OWEA 4B80A 3QQ5A 4NECA 2VTBA 4JBGA 5AVOA 1WU8A 2IPLA 3BE8A 5ILGA 4A2PA 4K0KB 1K5PA 1CRZA 1FTQA 2QZ4A 1XRPA 3E8MA 4EDFA 5JNRA 3CO5A 4J0FA 2VSXA 2A2ZA 4CHGA 2WAMA 4XRGA 1C7IA 2IE8A 3BSSA 1Y63A 1LFDB 3LCRA 1BS1A 2FN3A 2VP2A 2Z9CA 2Z83A 2ZRLA 1FDSA 1DP4A 2K2QB 5FR1A 3VC3A 5AXDA 5DP2A 2HJHA 3CH5A 5L4NA 1KI2A 2E0IA 3LCMA 4HQ0A 1UBMS 3T3MB 3F5MA 3TDMA 3TLYA 2R84A 3T4PA 1NQXA 1DTSA 1GCIA 3EHEA 1Z5PA 3QYJA 5K0EA 4KYUA 1EGQA 1S4MA 3JRWA 1SMKA 2X2FA 3FFAA 5JQGF 3OA0A 2BFEB 2PUEA 2R1VB 3O4VA 1WWKA 4B8ZA 5IKXA 1XN1A 4JEMA 2WSSA 1OYVA 1NPDA 1SHUX 2XWSA 3FA2A 4NMLA 1DL5A 2OZLB 2WZBA 4KQ6A 4GX0A 4QGBA 1MFPA 2YZNA 1W5SA 2OG2A 3DKPA 3KPWA 3RBAA 3UJDA 4EF4A 1SG6A 2EFDB 3GDHA 2WC1A 2HSJA 2XADA 3LT0A 4LRTB 2A1IA 1SK9A 2C9CA 4E12A 1EKXA 3C3PA 3NAMA 2I0FA 4UXIA 3RSZA 4Q7KA 2O54A 3NIWA 2KW5A 4O4LB 3TQIA 3VYVA 4AJLA 2OBFA 1IG0A 4FT2A 2HGZA 3OM9A 2ERYA 1XZBA 1B6SA 2JA1A 4U2BA 4CDRA 1YCGA 2WNIA 1LI5A 4IQ4A 1EVJA 4KFUA 4YROA 1Y5LA 3T5TA 2Q45A 2P1ZA 3UJ3X 5JHGB 2AQIA 3EH2A 1A8IA 1ZD5A 3MD9A 1KQNA 3VR4D 3ZWYA 2I8CA 1KAOA 3WE7A 1YE8A 2A0UA 2EZ4A 2R2GA 1AQNA 5IK2A 4YRBA 5BN3B 4HDAA 2PKRA 3EQ7A 3COZA 3FLMA 1KGSA 3NM6B 1U7TA 2C3MA 4PYMA 4X3PA 1JXMA 3S2EA 2WM9B 1Z5VA 2YMMA 2UVPB 3EW9A 5CITA 1C7JA 1D0VA 4UVDA 5DBGA 2BUCA 5THQA 1ODSA 2X0RA 1PZNA 4LWZA 4UJ5A 2J4FA 5BSHA 9ABPA 4PSVA 3LA6A 1TLLA 3ZWQA 2OR3A 4EW2A 2DR3A 1A9XA 1DVRA 2J67A 3DBHB 2AI1A 5DWDA 5JZBA 3EGXA 1GTL1 4BGIA 1LC3A 1UBSB 4X41A 3WWZA 4EAAA 4XDZA 4ZO8A 4U1RA 5ICGA 4PHHA 2IUYA 4LOHA 4RPLA 3WQRA 3R6LA 3T3EA 1DCTA 4NEQA 4R8KA 4YJFB 3IDFA 3M1LA 4TMZA 1FSZA 5JAQA 4ERXA 3GLFA 1E4EA 3H4IA 2B4YA 3WG9A 5B55A 1IK4A 1PX2A 3INGA 5F5LA 2MSKA 4TKLA 5JZVA 1UINA 3KJGA 3OZXA 4FQ7A 4TTAA 4WOKA 3RQSA 4ZZ2A 1UMCB 4C0HA 1THGA 2EJBA 4HBZA 4M76B 3TJZA 3F90A 2YXBA 5CM8B 3IKVA 2CLCX 2O7SA 3P9SA 3WK5A 1P4SA 3ZQJA 4JI3B 1Y3FE 2WMDA 2OXEA 2DQSA 2QM7A 2QY6A 3DULA 4V0RA 1LXCA 3WRYA 2GK7A 4AZVA 8ATCA 4BASA 1WMDA 4C2TA 3DH0A 2DT8A 1NT2A 1EDOA 4MKFA 1P1BA 3ZWXA 1H2XA 4NZMA 5EMKA 4M8KA 4DIUA 3WGJA 4Y30A 3PJGA 3ZK9A 4F93B 2BHTA 3LXUX 3EZFA 5BY2A 1DAKA 3SC3A 3H7AA 3T9BA 1VG8A 2GDZA 1P6XA 2BH2A 1TQ6A 2NVUB 1YS1X 1IN6A 1K5HA 4P4UA 1JHXA 3NWOA 5EQJB 4C7OB 4WASA 4YCJA 5JS7A 3GD5A 4ABTA 2YC2C 3DBLA 2I67A 2ZCUA 3NATA 1WF6A 1QVWA 3QVLA 1IWPB 2QN7A 3RC8A 1J42A 3V00A 4TMTA 4EYGA 4CN8A 2OLKA 4OYHA 3Q8KA 3RW9A 1QRUA 3QU7A 2DHCA 3H2YA 4PC1A 4KFRA 2ZRHA 1H2WA 5TS2A 4A5OA 2GPSA 1DDOA 3WSWA 4EABA 1GNLA 1OH7A 5CFMA 4QGHA 1I7DA 5HHTA 1A7UA 2IE0A 2WDZA 3VVLA 3WI7A 3O94A 5CG1A 3LYUA 5KVCA 2GI4A 2PD4A 3V8QA 2VKQA 2IIBA 4COKA 1JHMA 3FN4A 1E7WA 2ZJ7A 2IXEA 2ZJOA 4KR0A 3NGMA 5FI0B 5E1OA 1SQSA 2C9ZA 1ZI9A 4CIAA 1EFUA 3N7UA 1YR6A 2BJHA 2N3ZA 3N8KA 2C4MA 1F8FA 4CJXA 4DR3B 1LQTA 2D3TA 3TOZA 2EKLA 1YE3A 3O84A 1DC5A 3QHAA 4G63A 4LOAA 3RJZA 4UBLA 3SGLA 4A0FA 1U9JA 3ZE2B 1ZC3A 1T4MA 1Y6GA 2NU9A 4BFVA 2VRCD 5JAUA 1LLCA 2P30A 3NO4A 4UHHA 1Y6JA 1XF9A 5JVDB 2OZVA 3SYRA 4BMZA 3HBFA 3K5PA 4RVSA 1SQ0A 4LX8A 4WOBA 5BSEA 1IRXA 3KJIA 3SX0A 1XJQA 3EXG1 1JIKA 1SUEA 5KTMA 2ZM6B 3ZDQA 4BAZA 2Q0QA 3FF4A 4MRVA 4PYKA 3Q15C 1QRDA 4GRIA 4A3SA 4HB4A 4E5VA 4PBRA 4YUWA 4IJWA 1N8SA 1WHTB 4Z9BA 1FU4A 1QPGA 5C1DA 1H4SA 2I80A 5J4LA 3SFVA 1XCOA 3LUPA 2A0WA 1VLVA 3BCHA 2AXNA 4Q3NA 2GZDA 1FNBA 3BTOA 5FL7A 4OXKA 2OKCA 3IBSA 1GGFA 3EIQA 3U6BA 3GJ4A 2FSGA 3DA8A 4DMRA 3LFHA 3PFCA 1GU0A 2PGNA 3D9QX 3IILA 3MTIA 1AN0A 1Z29A 4OJMX 2LUOA 1MA0A 1DS6A 2H2FA 4OJKA 4E88A 1GU1A 1KAHA 3OZTA 3VR3A 1P9WA 4YLGA 1AKNA 2DU8A 4MLCA 4IXNA 4LF4B 1GILA 4F21A 1Y34E 2HA5A 3P0HA 3P7MA 4MAFA 4ZU3A 1QOQB 4FB5A 3B2NA 3CLUD 3R6GA 3JTMA 1UZLA 1N6IA 1J49A 2X7HA 4WOPA 5IMBA 5BOVA 4DN6A 1YQDA 3IJ5A 3O2QB 4HLQB 4TS4A 3K7EA 1XRSB 3B12A 2HJVA 1YH3A 4HD8A 4WKPA 5BSWA 1NVBA 4PIMA 4QDZA 5JCJA 1B8PA 3OA2A 3PFHA 3PUJA 1FFXA 1LBEA 3LLUA 5IYZB 3FTQA 4P54A 1E7MA 3CKMA 2OCGA 3ZHVA 1ZMXA 1FUYB 3SIRA 4YMWA 2C1XA 2C5EA 5KTYA 1FZTA 3H2IA 1UWCA 3HLTA 2FZGA 3IVXA 2J3LA 3ORYA 5HZGA 2WB2A 1RPAA 2VYCA 3K5HA 2UYGA 3D6NB 4N6GA 5EXPA 1F8UA 2YIMA 5A9RA 1HC7A 4KLAA 5BYKA 5L51A 1J22A 1Q6YA 4MR7B 4YP7A 5LA6F 5G0WA 1XTQA 4O4IB 4IBOA 3K2QA 5AJUA 2GASA 4DCCA 3BXEA 1NFQA 4BFWA 2PRSA 4M9SA 1T2CA 1YB4A 1ZITA 1KDVA 4B75A 1EK1A 3FI0A 2OT3B 4GMXA 4S35A 3QSGA 2DX7A 3USZA 3HNPA 3CIOA 5JMPA 5K6AA 2JK1A 4BJ3A 2YIDA 3A3PA 4BO3A 3IDOA 1BA3A 5CG2A 1J90A 3O1IC 5AIAA 4RFSB 3T0FA 2CHFA 2W0SA 1S0UA 2PAFA 5CEJA 2IUTA 2AFHE 3PNLA 2DBZA 2I3AA 2EJTA 3CPJB 5I9BA 3UGTA 5ILOA 2PT5A 1RHKA 1K86A 5B1DA 4JI6B 4B6JA 1X19A 5H82A 3SZOA 2FWJA 1XMOB 2WU8A 2XNCA 1E5QA 3NT5A 5EHXA 3VU1A 5JT1A 4ICIA 4YJ2B 2J6BA 4D99A 2ZWOA 2PJRA 2VJAA 3ZI4A 4B3BA 1OWMA 4TQ9A 5J58A 4N5DA 3OQPA 5JCOC 2AVDA 4NZYA 1N3YA 2C07A 3IP7A 4Y2YA 1M1XB 3DBOB 1XO1A 5E7MA 3R7FA 4AF8A 2Q5FA 4H7FA 2ZWVA 2FZVA 3JSAA 3VSBA 5U9CA 1B73A 3QLTA 3KXKA 3RYIB 3B48A 3RK1A 4M0EA 2YFQA 3ZKWA 1T34A 4TT8A 5L7YA 4X20B 4DANA 3LPMA 4DQ0A 2HHHB 5ENVA 2R48A 3SQXA 5KKAA 4F1KA 2EOAA 3THWB 4X6XA 1QU3A 721PA 1USUA 3BERA 4IIGA 2IY9A 3NTVA 3ZGOA 2