5CT6A

Wild-type bacillus subtilis lipase a with 20% [bmim][cl]
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lipase EstA
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
total genus 67
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ct6A00
3A2NA 1D07A 4CG2A 2WIFA 1SCIA 1LPAB 3DCNA 4X00A 1FFAA 3K9BA 3QYJA 5HF6A 2WILA 2OCGA 3GUUA 5HKBA 4DGQA 1MX5A 4K6HA 3DYVA 3STVA 4BBZA 5FUMA 1ZJ4A 4EY7A 1QOZA 1EVQA 3PDCA 3AZQA 4ARBA 4WJLA 2RONA 5LZ5A 3NGMA 3VKFA 4IH9A 5HF8A 1DT3A 7YASA 2RHTA 3F67A 2G5TA 3GFFA 3HSSA 4DM7A 1BCSA 5ALVA 2Y1KA 3HLKA 3HC7A 1UOOA 5FDFA 4S0XA 4EY6A 4ZGBA 3V9AA 2HA4A 3I2HA 3WWPA 3NUZA 1B6GA 4EBBA 1EDEA 3FCYA 5AI6A 2QTBA 1CEXA 2WUFA 4QZVA 4C4ZA 1MX1A 4CG3A 4OCZA 4NVRA 4BZWA 4QWMA 4Y9SA 2XMBA 3QVMA 3T52A 2OLEA 3KSRA 1H2XA 4U2DA 3TJMA 4FFWA 5A7HA 3WIBA 1SC9A 3AUKA 2ACKA 4L0CA 3G0IA 4Y2VA 1QIHA 5K3FA 4LHEA 3G9XA 1WB4A 4AZ3A 1BN6A 2QVBA 1DU4A 2WTMA 4PV7A 3Q8WA 4YASA 1ISPA 2HFKA 4C4YA 1CPYA 1PV1A 4N8SA 2PL5A 2UZ0A 2J4CA 3E3AA 4JYMA 3CXUA 5ALQA 1N1MA 1YA8A 2WG0A 1AQLA 1THTA 3L1JA 3FLBA 2H1IA 4QA9A 3R3VA 4B85A 4C4XA 3M83A 3H2HA 5AM2A 1UOQA 2DQYA 1X2BA 3G8YA 2XQIA 5T4BA 5DNVA 2PSDA 4X3CA 1QFSA 5LZ2A 3IURA 5E2IA 4LIPD 2W6CX 2VAVA 3D2AA 4ZI5A 1WPRA 4LXIA 3ZLVA 2Y6VA 3H18A 2WHPB 4W1SA 5LZ9A 3EF3A 4H7EA 1ZGCA 4BVJA 4ARAA 2ES4A 5CT5A 1CUCA 4B80A 1KU6A 3RKSA 3R3ZA 2HDWA 3I1YA 4OU5A 1F8UA 1UOPA 1CV2A 5AKLA 5FLKA 3QMVA 4UBIA 5IVDA 5BWCA 5JIBA 4W1RA 1CUGA 1CUIA 4WFJA 4DNOA 4UHEA 2OAGA 3WK6A 3R3XA 4U2BA 4J3JA 5CH8A 3DEAA 2XUGA 5T4EA 3WKBA 3OC0A 5JZSA 2GBFA 3C6XA 4DLNA 3WA7A 4U2CA 3AINA 2C0PA 2IIVA 5CURA 2J4FA 1GQRA 5AP9A 5AKEA 4WDQA 1DT5A 2WG2A 2WHPA 2CKMA 2V98A 4FMPA 3IDAA 3HRHA 1LPMA 2Z3WA 5ALLA 2XUQA 1M33A 5EHNA 3C6ZA 3X3HA 4GWLA 2QJWA 1ZI8A 2R11A 4HRXA 4OSEA 5D6OA 1BU8A 1DWQA 4EY5A 3W04A 4AB1A 3R0VA 4NMWA 5EIEA 4JUIA 1LPPA 2V96A 1ORWA 2HA0A 4Y2TA 1QIDA 2WJ3A 4B9EA 1S8OA 5DYWA 1SCKA 2IITA 5E4JA 4Y2SA 5AJHA 2H7CA 3V1LA 4BDTA 1C7JA 1GT6A 1WHTA 3BDVA 3BF8A 4W63A 4U2EA 3O95A 4MWSA 5IVHA 3WKAA 2VJBA 5DLPA 4PSCA 4HZGA 4WFKA 4EY8A 2XUIA 4JNCA 4RE6A 4KAFA 2I3DA 3R40A 1VZ3A 2VTVA 1WM1A 3FAKA 3V1KA 1CUBA 1JJFA 5ALDA 3DKRA 2OGTA 1H22A 3M3DA 1YSCA 5CT8A 4YK7A 5ALMA 2D5LA 1AX9A 2FJPA 3PE6A 4K2AA 1IZ7A 2C58A 3OM8A 5HKAA 2OGZA 1XZJA 4GEGA 5EIHA 4EZIA 1JJIA 3BJMA 1UFOA 1LGYA 4GLBA 3T4UA 4RNCA 4BYMA 2C0QA 3LLCA 3WK8A 2Y2VA 2XUFA 3DS8A 2PSFA 2G63A 1VA4A 1E8DA 3RM3A 1RYYA 4MXDA 4YX9A 2RI6A 3G9ZA 3H04A 5C7YA 3RLIA 1P0MA 5JAHA 1G42A 2O2GA 3OOSA 3LCRA 4X91A 2XLCA 1W75A 2RAUA 3ICWA 4QDTA 3S8YA 4EA6A 3QM1A 1G4HA 1HKHA 1YR2A 3FBWA 2AJLI 2HRQA 2ZVDA 4RGYA 4LYEA 1QZ3A 1EDDA 2ACEA 4XWGA 2WU4A 2WKWA 5JAPA 3MUOA 4KE8A 2XDWA 2CBGA 1W4LA 4F60A 3AJAA 4BTVA 3DOHA 3O9MA 3F98A 1VE6A 5JD4A 2JBWA 4PNZA 1MJ5A 4AX4A 4X90A 5EIAA 3I6YA 5LYYA 5LZ8A 3DKKA 3WK4A 4AO6A 5LKRA 2AJDA 2JGLA 4BCCA 2P8SA 5JD6A 3QH4A 3PFBA 5FXMA 1P0PA 2O7RA 5ALTA 1RWQA 1VA5A 2CZQA 3G02A 5AKIA 1Z68A 4JYPA 1AZWA 3AILA 5ALOA 2PX6A 4KEAA 1UK9A 5AKYA 4Y2PA 1QIEA 4ZV7A 2QZPA 2GZSA 5AO9A 2Z3ZA 1EDBA 5EI5A 1Q0RA 3OG9A 1XZEA 3NOXA 5AIAA 1E8MA 2DR0A 1N8SA 2DHDA 5AOCA 3MGAA 3WZLA 3W9BA 1XRLA 1MNAA 2OQIA 3FYUB 3WJ2A 2PSHA 4X95A 5AKHA 3PF9A 2JGJA 3ANSA 5JASA 3KOOA 2WUGA 4J0CA 3FYUC 1AGYA 3G9UA 4BVKA 1R88A 2OG1A 3LP5A 4QNNA 4DIUA 1CR6A 5ALWA 2BGRA 4ITVA 1I6WA 2JGEA 1ZD4A 4GDMA 1QE3A 3G0CA 3ZI7A 5EHZA 4QDZA 1TIBA 3D7RA 3VISA 1XQYA 1THGA 4NZZA 5JAUA 3R3WA 4J0KA 4G8CA 5JZBA 4IHAA 5AI9A 5K3DA 3QPDA 3BE8A 1Q0ZA 1ACJA 3WL8A 5AOAA 1LPSA 1CLEA 5AM0A 4KE9A 1AC5A 4N8EA 4BE9A 1BN7A 3I2GA 1QGED 4BATA 3PF8A 4PO3X 3WK7A 4BE4A 3ESBA 4DNPA 4UBMA 3E1GA 1C7IA 2D0DA 3CCCA 3UUEA 2RGUA 5E4TA 1UK8A 1FFBA 3ESCA 1YASA 2WTNA 3BXPA 3TGLA 1QTRA 1ZGBA 3O9VA 4Q3KA 2WUDA 4Q05A 5AICA 1XZMA 1XKLA 1VXRA 1Q84A 4CI9A 3MUNA 5EHQA 1EB9A 2WHQA 1CQWA 4LKOA 4KAJA 4F21A 1SFRA 2ZJ7A 2B20A 3JW8A 2AJCA 1UKBA 5IVKA 5CRIA 1O6FA 2EEPA 5CXUA 3HJUA 4H7JA 5AK5A 5AK3A 4ZV9A 3I2JA 4OB7A 5BOVA 1EA5A 1X70A 4G9EA 5A7GA 2Z8ZA 5ISMA 4A5SA 2ZSIA 2YYSA 2PSJA 1XZDA 4I4CA 5DYTA 2OPHA 4BC0A 5I8PA 3C8DA 4DYHA 3IVMA 5CW2A 2O2IA 1A88A 5A6VA 1UXOA 4OPMA 3IBTA 5ALJA 3ED1A 1ODCA 2GYWA 3ZLTA 3AIKA 4Q1VA 3KD2A 2DHCA 4Y2YA 3DJYA 3I6ZA 2C4HA 3I6MA 5DWDA 5EHXA 4K6GA 3GELA 1G66A 2VT6A 4CCYB 1MPXA 1BS9A 2WIDA 2JIDA 4U2FA 3WIOA 4FOLA 4OU4A 2HA5A 4GXNA 1ODSA 1CUZA 2WJ6A 3CN7A 3WKEA 2Y6UA 4B0PA 3WWEA 1CUUA 3G0DA 1XZFA 3C87A 3WKCA 2WJ4A 3O4GA 2GBIA 4JH0A 1TCAA 1R50A 4DNQA 3CCBA 2QR5A 4FLMA 5DJ5A 2Y2UA 5F4ZA 1IZ8A 3WWDA 3STYA 4X92A 4KRXA 1LPOA 4DMHA 2GBGA 1MAHA 4J0IA 4BP8A 3JWEA 4AXBA 5AKZA 3HI4A 1UKCA 4FWBA 2QT9A 1WCYA 3BJRA 1CUEA 1JMYA 3MVEA 4MQLA 3IIIA 3VVLA 5AHXA 2WIKA 2VA9A 3U1TA 3E4DA 4IQ4A 3ESAA 3IULA 4CCYA 2X8BA 4UHBA 3FOBA 3FSGD 2V9ZA 1QIGA 4J0HA 4OUKX 1H23A 1BRTA 3V1MA 3LIIA 4K6KA 4GI1A 3ZV7A 1H2YA 5JAOA 4G8DA 5A62A 4P08A 4Z49A 2H7XA 2J3DA 5IKXA 1TRHA 1XRPA 2DHEA 3VXKA 4I19A 4X6YA 3DNMA 4DSAA 4EHBA 3WLAA 4YPVA 2WM2A 3DDUA 3F8SA 1SOMA 2XQJA 5LIPA 5K3EA 1IVYA 3C6BA 1QO7A 1FFCA 5KREA 1DQZA 1A8UA 1DWPA 3L1HA 2DSNA 1LLFA 4Q82A 1ZD2P 4M0FA 5JADA 1TCCA 2RIPA 3WKDA 5ALKA 2YH2A 1YS1X 2O7VA 2HU7A 4E14A 2WFZA 4EB0A 1EINA 2X76A 1CUWA 4Y2QA 4UHDA 1W1IA 3H2JA 1XROA 4KYVA 5HFNA 1A8SA 4G4JA 1QONA 2QOEA 3HACA 2XB6A 4LXGA 3PUIA 4RPCA 4G8BA 3M81A 2QUAA 1QLWA 1VLQA 4H7DA 4F0JA 5CT9A 4K5QA 4KR0A 5AH0A 4B83A 4BDSA 2DFPA 5J3JA 4KRYA 2H9YA 1SCQA 1BCRA 1YS2X 1XZGA 5SYMA 2XMCA 3R41A 4B82A 3AFIA 2HHAA 1UK7A 2PUJA 4C88A 3RARA 5E4YA 1TCBA 5AM5A 3UUFA 2JF0A 3F97A 3AIMA 1MX9A 2Q0XA 5LP1A 4KAAA 2Z5GA 2FX5A 1CUXA 4DSZA 4H0CA 1CUSA 4DMFA 3BDIA 5ALRA 2OAEA 1DWOA 5KBYA 3R3YA 1UZAA 2I78A 1VXOA 4BCBA 4UBOA 1LPNA 2OCKA 1XQVA 1XZBA 1TK3A 2HRRA 1DQYA 3ZLUA 2QXTA 1OILA 1L7AA 4MWTA 5KWJA 5CH3A 1K6EA 3N0TA 1CUYA 4P92A 4BZZA 3C45A 3QPCA 1CQZA 1JMKC 1NU8A 1JKMA 4B6GA 3IUQA 1F0PA 1MN6A 4A23A 5D3KA 5HK8A 3K2IA 1VJ5A 2XUDA 3FNBA 2XUPA 4CIAA 1XLVA 2B9VA 5ALZA 5CXXA 1ORVA 3O4IA 5JANA 2OQVA 1UWCA 1WB6A 2QXUA 4FDMA 3STUA 3OPMA 1MAAA 5FOQA 1EHYA 4WY8A 4D9JA 1NX9A 2BAGA 2XQGA 3H2GA 5JYCA 2WHRA 2HA2A 4HXGA 4FFVA 1GKLA 3DOIA 4HXFB 1UT6A 2LIPA 2BUAA 5LZ4A 2XUKA 5AI8A 1XZCA 3G0BA 3FVRA 2GZRA 3IUMA 1FJ2A 1AURA 4G4IA 2XUJA 3D3NA 2PKYX 5CH5A 5FV4A 3L1IA 4E11A 2HU8A 2PU5A 5A2GA 2PVSA 3B5EA 1ODTC 3N2ZB 3KWFA 5LKAA 4B84A 1YCDA 1CUVA 1R1DA 3WI7A 1W76A 3W2TA 5AK6A 1RP1A 3H19A 4H7FA 3BWXA 1QTIA 4PW0A 1A8QA 2GBCA 1XRMA 4H77A 4C89A 1XZIA 4PQEA 3W05A 1CUFA 2JGKA 3ICVA 5JZ9A 5DNWA 3VJLA 4KE7A 4X94A 1H2WA 4Q34A 3WZMA 3WJ1A 4PF1A 2XMQA 3W06A 4C87A 4QE3A 1CFJA 5JALA 1BEEA 4BP9A 4W1PA 1YB6A 1AMNA 3WL7A 1UK6A 3A2MA 2WIJA 4HAIA 5CBKA 3R3UA 4H7IA 1T2NA 4GBGA 5K3BA 4BRZA 1JJBA 5ALUA 5CMLA 4CG1A 1Y37A 2VSQA 3DQZA 2HA3A 3PFCA 1U65A 5FP0A 1CUHA 3WWOA 1TQHA 1H2ZA 2C5GA 3C5WP 3GBSA 4HXEB 3I2FA 3KDAA 3SWWA 4UUQA 3C43A 1YAHA 2VJDA 3WWCA 4X6UA 1N5MA 2JEYA 2XUAA 3K6KA 4JEIA 2AJ8A 3H2IA 4Q3OA 4M0EA 2HA6A 4BAGA 4XVCA 2XQKA 2DQZA 4J0JA 1XRQA 3QPAA 4B0OA 3Q0TA 4N5IX 1GPLA 2XMSA 2C5FA 5I7UA 5IH7A 5T4HA 1JU3A 3SC2A 4AMYA 3DD5A 5ALIA 3F96A 2JGFA 3F9CA 1XQWA 3FYUA 1QO9A 1CVLA 4RE5A 4H7HA 3DYIA 2BCEA 2HU5A 2EDCA 3GROA 3FWHA 2QS9A 2XI4A 1EX9A 4Y2JA 3DLTA 5ALHA 3WMRA 2VQ6A 1KEZA 1A7UA 1Y7IA 2VAXA 4EUSA 1J06A 2VJCA 4TGLA 4HVTA 2J3QA 1QIKA 2WIGA 2PU7A 1JI3A 3D2BA 4UBJA 3STXA 4L9AA 4IH4A 2ONCA 5I9IA 5ESRA 5HF5A 1LPBB 1K5PA 2O2HA 3D5EA 2WFLB 4BCDA 3YASA 2RHWA 4QDXA 4QLAA 1U4NA 2X5XA 2G4LA 1LZLA 5HQ3B 3BF7A 3P2MA 5ALSA 2QKYA 4ZWNA 1HL7A 1IUNA 1ZI6A 1TKRA 4QDUA 3W9UA 3C5VA 4UBKA 1P0QA 4ETWA 1R9MA 5JD5A 2ROQA 3EQ8A 4J0GA 1MNQA 3IB3A 5K3FB 5AOBA 1XZKA 4OD0A 4G1FA 4OB8A 3O4JA 3D0KA 2OCIA 4H7KA 4UPDA 4BB0A 5A7FA 3KXPA 3I2KA 1USWA 3VJKA 1P0IA 4OB6A 5C8VA 2QMQA 1XZLA 4FLEA 4ZRDA 2I03A 2GYVA 1KU0A 1O6GA 1ZOIA 1LBSA 1HBJA 4INZA 1UKAA 2HADA 4XIIA 4IH1A 3ZWQA 2XQFA 2ZJFA 4X85A 1R3DA 4WCVA 1XLWA 1J2EA 4BTLA 1R4ZA 2FJ0A 5FPQA 2CMFA 1ETHA 3I28A 4P9NA 1VE7A 3LS2A 4WFIA 5ALXA 2WFLA 1ZICA 3GA7A 1BEZA 2ORYA 1CRLA 5LZ7A 5JATA 4AN0A 3AIOA 1ZIXA 4G5XA 5K3CA 5HQ3A 3QBJA 2R8BA 1GQSA 5AI0A 3WQHA 3C8HA 2BUBA 5H3HA 5AKGA 4M0MA 2XMRA 4I3FA 2DCMA 1HLGA 3A2LA 1W52X 4H35A 1OCEA 4X71A 5LLSA 4O08A 1YAJA 5EFZA 1JU4A 4FLFA 2ZYIA 1VKHA 2GYUA 2E3JA 2XT0A 5KWIA 2CB9A 2PM8A 4UBLA 3V1NA 2HIHA 3LIPA 2WQZA 4L3WA 4LYDA 4Y2UA 1XRNA 4ROTA 4N5HX 2W22A 2PPLA 1WB5A 3EQ7A 5HCUA 1K8QA 4MYSA 3S2ZA 1GGVA 3WA6A 4P93A 3TEJA 1QIIA 1JT2A 2OXEA 4GW3A 5AKXA 2ECFA 3DL7A 3G9TA 1XKTA 4J7AA 4XJVA 4FNGA 1E89A 5CT6A 1XFDA 3OTQA 1PFQA 3FLEA 2WU3A 3BL8A 5AI5A 3UMJA 4BC1A 3PICA 1QIFA 4UFNA 3A70A 1GPNA 3TRDA 1QFMA 1JFRA 3EQ9A 1WHSA 4AZ0A 1MU0A 2PSEA 2CJPA 3HXKA 2JGIA 2HM7A 1T4MA 4AO8A 3ESDA 3IUNA 4NS4A 3HYSA 5AM4A 1QIMA 3WYNA 5FRDA 1YB7A 2Z8XA 2BKLA 3GZJA 3EIOA 1DX4A 3STTA 1F6WA 2ZYRA 2QM0A 3NWOA 1XZAA 1CUJA 2HFJA 4DMCA 1EI9A 2BJHA 1DX6A 1Y7HA 2VEOA 2QJRA 2WG1A 4H18A 6YASA 4UFOA 1VZ2A 2OCLA 3H17A 5DTJA 5ALYA 3QZUA 4FHZA 5AM1A 1B41A 2WLSA 4UHHA 3VDXA 4B81A 3ILSA 1W6RA 4PSDA 1FFEA 3ZPXA 4AO7A 2JEZA 5CT4A 4CFSA 5AIBA 1ACLA 5BWBA 4HTAA 3FCXA 1BE0A 1J1IA 1QIJA 1AUOA 5JARA 5AI4A 4LXHA 3SK0A 4A16A 4GECA 4W1QA 1ZI9A 4AN1A 5AM3A 2EDAA 4TPKA 3WYDA 3VJMA 1L7RA 1WPXA 2OGSA 5K5EA 1XLUA 4GHWA 3I1IA 3I2IA 4BAUA 4BAZA 1EB8A 4E15A 2JGMA 1CUDA 4N8DA 3WL6A 3PI6A 2CEKA 4EY4A 1ZJ5A 4KJXA 5BV7A 3BIXA 4OYYA 4F5ZA 5EGNA 2AXEA 1R9NA 5AKKA 3SX4A 2VT7A 4FKBA 5A71A 3C6YA 1WOMA 3G7NA 5CTAA 4J0DA 3FLAA 2WUEA 3C70A 3RK4A 2H7YA 2XMGA 3FYTA 1K63A 4IO0A 2VJAA 3ANTA 2G5PA 3FSGA 5HF9A 1U2EA 1LZKA 3CN9A 3BIWA 4X93A 5ALEA 3IUJA 2K2QB 2PBLA 2VF2A 1E66A 4U2GA 4HS9A 4MJ3A 2XLBA 3B3QA 2NW6A 1MO2A 2B61A 4FTWA 5ALGA 1E5TA 4AMZA 3A6ZA 4QWWA 1EK2A 5DYYA 2XUHA 1G5FA 4MQMA 4KE6A 1N5RA 1PJAA 4C6HA 1CUAA 1TAHA 2ZYHA 3B12A 3EBLA 1ZD3A 4Y2XA 4C01A 4MEAA 2BGNA 1IUPA 4MYDA 2HA7A 5D7BA 4X6XA 4DNFA 4W9RA 1DINA 3O4HA 4MEBA 3AZPA 2WSLA 3H1AA 5IVIA 2FUKA 3H1BA 1GZ7A 3JYHA 4CIBA 1J07A 2PUHA 3AZOA 4UBNA 2ZSHA 5T4FA 5HZGA 1HPLA 1GXSA 5ALPA 1ZD5A 1MT3A 2BUCA 3DL4A 4B7ZA 3QMWA 4UFPA 2QRUA 2I3ZA 1FSSA 4OYLA 1F0NA 1EXWA 1GKKA 4B9AA 3WL5A 2BFNA 1GPKA 1E8NA 4TVKA 2QUBA 5HFAA 4WDRA 1HDEA 5YASA 3IA2A 3WK5A 1HQDA 4AQDA 4J03A 3KWJA 1LNSA 4DTCA 4FNMA 5ALFA 2CUTA 1LBTA 3D2CA 3HZOA 5DTIA 3OURA 2AJBA 2ZYSA 3HABA 1NU6A 4QLOA 4X7BA 3V48A 3FVTA 4G4GA 1XQXA 1CIJA 3D4LA 4BVLA 3HEAA 3U0VA 1IUOA 1Q83A 2B4KA 1IMJA 2YASA 5SYNA 4Y2RA 1AKNA 3PUHA 5AK4A 1C4XA 4KACA 2XMDA 5AKJA 4ZREA 2WFMA 4X97A 3M82A 5C8ZA 1K4YA 2XE4A 2HL6A 4L72A 4XX1A 4QEKA 5FPPA 2C7BA 1EK1A 4UHFA 3D59A 4Q3LA 1XZHA 4BRSA 4PSUA 1BROA 4FBLA 5D3ZA 5C81A 1ZIYA 1MTZA 4WY5A 3QMMA 3O0DA 4QDOA 2XMZA 1U8EA 1X2EA 3QITA 4Y7DA 1L7QA 3VVMA 5C8XA 2XUOA 4E46A 5DNUA 3STWA 4FBMA 4UHCA 1XRRA 4HRYA 1VOTA 1EVEA 3H2KA 5ALNA 2ZJ6A 1DTEA 1YA4A 1E3QA 2VATA 3E0XA 4V2IA 5HK9A 1FFDA 2YXPX 5FKJA 2IX9A 4CCWA 3H0CA 3G0GA 4G9GA 1QJ4A 3WK9A 5K3AA 4DMKA 1EH5A 1OXMA 4ZXFA 2V97A
chains in the Genus database with same CATH superfamily
2VBCA 1SQSA 1T36A 5ECDA 4FEGA 3L0IB 1PUXA 3E9NA 4XJTA 3C3BA 1WUKS 3EZFA 2JARA 1Q0TA 3A2NA 4P82A 3PPWA 4J6EA 5LYJF 5JISA 3CQ9A 1A9RA 4RTMA 3Q2IA 3C39A 5FOVA 2QDXA 3RVLA 4A8JA 3R09A 3NVKI 2X9LA 3OKCA 3RV4A 3NU1A 2VI5A 3HNRA 5HKKA 3P27A 2YRFA 3CNLA 5IPFA 3V2UA 3QOFA 2P6UA 2WILA 3MSCA 1G3UA 3U13A 3BERA 1XSEA 2YIJA 3B1VA 1EHIA 4O59O 4AJLA 4C7KA 2WM3A 5TPZA 1PFKA 4K6HA 3CIOA 3AX6A 3PGA1 2LRHA 2AZ4A 3DPUA 3STVA 1DQRA 4QQ8A 4YRRA 3S2EA 2XXAB 1VFPA 3QHPA 2LE0A 2FW1A 3VGJA 3AUYA 2C7PA 1FU7A 1NVEA 3VU9A 4ARBA 1Y3BE 1YDFA 2WE7A 2XKJE 5CHYA 1ZX1A 4WJLA 5JHGB 3RFUA 2FEWB 1QRRA 1YE5A 2VJQA 2CLKB 2BKXA 4RKEA 1Z2PX 1UKVY 2JFXA 4JHXA 4TX1A 1Y3IA 5CHEA 1GA4A 2DBVO 4YFYA 4PN3A 4EMUA 1XDZA 1JTVA 3GLUA 1KMHB 1PBTA 4OQPA 1AF4A 1NXOA 3AHCA 2QD4A 3FHJA 2BMWA 1LLCA 3DV9A 1DT3A 1TKAA 2F7SA 3ENKA 3LC1O 4H1VA 1E2UA 4IV8A 1X1RA 1I4EB 4FIDA 4FFDA 2C2WA 3LQKA 4MP3A 2RHDA 5EP1A 4CTNA 2REOA 4D0NA 4FW9A 2R6DA 1T8TA 3HLKA 4LDAA 2WVAA 1UBJS 3HC7A 2J85A 4P2BA 1MH9A 1FXSA 2GO1A 2N9UA 3N58A 4HC4A 2W9XA 4NU5A 2VAPA 4UU0A 3TQRA 4CM9D 3EUAA 1FNDA 3K8OE 2VO1A 3HPRA 1UPBA 3DFFA 3CVUA 1QZUA 1E94E 1ICEA 1KQ3A 4ITUA 3LY9A 2Y1DA 2CUNA 3ZNQA 5JTUA 4L2IA 1R0XA 2J3LA 3F7NA 3N0WA 4CKEA 1Z28A 2CEAA 2NN3C 1AKWA 5MFZA 5JI2E 2NSJA 2Q6OA 2DWUA 4UAVA 5EP2A 4PN7A 5U1PA 4EF6A 1QU2A 1RYFA 2O2JA 4EDHA 5JROA 4OI0A 5DTRA 4HBGA 4CJXA 3IPYA 5BV1A 3QVWA 1NNEA 2HN9A 1PX2A 2PX4A 3PJEA 5AJXA 3UXYA 2WUFA 4MITA 4M38A 4OMFG 3N0XA 2BM0A 4QZVA 3BWEA 4ZVOA 2ZT5A 4AP9A 2ZFUA 1PR1A 1TXGA 2C61A 2O2EA 4OCZA 3TMKA 4BVEA 1TGYA 4CG3A 1JFSA 3JPWA 1UZLA 3OIWA 1LXCA 1L5KA 1UJBA 2WD7A 2ZTLA 3JQQA 3GFRA 3REQB 3NVMB 5E0KB 2O8NA 5J9FA 5LSAA 3KSRA 3UJ7A 1OQAA 1HYQA 1ZN8A 1NYTA 3TJMA 2GGSA 1N5KA 4F96A 3AEYA 3TZKA 4ESOA 2WSYB 1J7KA 1O89A 1HLPA 4L9SA 1R8SA 2D1SA 2JRLA 3TLZA 3WISA 4BB5A 5A7HA 1AMUA 1K3TA 2KWIA 2O48X 4JYCA 4MAFA 3WLKX 3UT5A 2XXAA 4RD6A 5B7NA 1YR6A 1SC9A 3TYXA 4ASUD 3GLHE 2ACKA 2F43B 3ABRB 4UM7A 3OJLA 1IBRA 3CZCA 2BI4A 3U81A 4B87A 3VR4H 4GZ3A 5J23A 2H2DA 1L7XA 1N2ZA 3U9SA 2XRZA 2E49A 4ZI3A 1DL5A 5GV8A 3HNPA 2ZEJA 4NJOA 2C3YA 4F9EA 1ZN9A 1JGTA 1FS4A 1OFVA 3GQVA 5FHQA 4EB6B 4RPGA 1M76A 1ISPA 4OKIA 4AJIA 2VBGA 2I87A 3VHRA 4F6LA 2FQWA 1NZJA 3ASYA 3O4RA 4PO9A 3TIIA 3TINA 4DCTA 2K2WA 2X2PA 1MGPA 1Q57A 1SK8A 4P0TA 2HSZA 4KFTA 4DV1B 1P9OA 3A14A 3OESA 2J4CA 3E3AA 3OPXA 2JJ8A 1Y3DE 5GTDA 3Q8MA 4QTTB 3PTAA 1UQRA 4MR7B 4EW2A 4IDAA 1GITA 1N1MA 4GRAA 1G18A 4YAKA 1SZCA 3FLBA 3L1JA 3NYRA 4DV7B 4KBFA 3WO0A 3L02A 3X1ZA 4HX2A 3E5RA 1V16A 4B85A 5BW5A 2XYHA 3WJ7A 3PPVA 4CIDA 4YN3A 3M83A 2OO5C 1H6CA 4EGSA 4HQ6A 2M6LA 1SIUA 4DOMA 1UOQA 2G17A 2G0TA 4RHFA 4OBWA 5A3RA 4H3VA 3L4KA 4TQAA 2DQYA 2QQ5A 3KQKA 1TYEB 3DMYA 3Q6MA 1E3MA 3MF4A 4X3CA 2BFPA 4QNRA 3MTQA 1PJBA 2QQEA 4Y1RB 4QRIA 1SJ9A 2I80A 2PRSA 3WLLA 1VG9B 1H1TA 1PBNA 2BBWA 4Q6WA 1QWSA 4TL9A 4B3JA 4XSHA 1DZIA 3RC1A 2PZEA 5E2IA 4JB0A 4E3WA 2W2QA 2PHZA 4LIPD 2W6CX 1RLMA 5EN4A 3V1UA 5E9QA 3A26A 5LMNB 3AOGA 5K3SA 2M32A 2GEKA 4LXIA 3W7VA 5LU8A 1BFUA 4I55F 3FSRA 2HCJB 1Z07A 3M6UA 3H18A 3HMKA 5CCXA 4PFSA 1DXHA 2GVZC 2H5IA 4R3WA 4CN9A 2PWBA 3U5ZB 4FX2A 1RI1A 2QW8A 3RVOA 4KSBA 1YRLA 4HRAA 2IKSA 4ZT7A 3TIXB 3SIXA 4EVIA 3UGTA 4G1BA 2QG4A 3A9SA 4OUDA 4D5GA 2YCLA 4LSZA 1V8OA 2YN0A 1KC1A 5EIOA 2PL3A 2ZAYA 4ACBA 4JV5B 2FPWA 1KQGA 1QWOA 4G5SA 3PDWA 4MW5A 3HADA 1GUYA 1HEUA 1QM5A 1XNJA 2ES4A 4A1FA 4ARAA 1KJWA 1J2RA 3F5DA 2F43A 2VF8A 4QRDA 1GPUA 2J3EA 1FSGA 1UINA 1LFDB 4F97A 3RKSA 1GNLA 1Z37A 2D2FA 4JSYA 1E3DA 3SYNA 1A76A 3I1YA 1VYVA 1INLA 2GKSA 3BQMB 1L9KA 2VWGA 3PGMA 1W5EA 1OJLA 4U4AA 5DK4A 3K70C 1T3LA 1UOPA 3PB3A 1OPXA 1Z4PX 1OD6A 2ZJYA 4FGSA 1B0AA 2Y0PA 4RD2A 1HY3A 2W6NA 4MB2A 5JS8A 2P0AA 5HDQA 3QXHA 3BHMA 3RS3A 4Q21A 2D00A 3TZLA 1EWVA 1P44A 4TLLB 4YMGA 3GYBA 4XM1A 1V1MB 2X3UA 4JL8A 5JIBA 1BQEA 5SV2A 4O1IA 4YLEA 1DEAA 2A86A 2ZR7A 5H82A 2BH9A 3OVMA 5ADUS 1T8SA 1UFKA 4DC9A 1EDZA 2JC3A 2V4MA 4JBNA 4MX8A 5E7QA 4WFJA 1M6EX 2DSTA 3CF6R 3OM0A 2BR5A 1IK6A 3DC7A 1NJ6A 2GHRA 2Z8YM 3ITKA 2A57A 1EUZA 1RQRA 3B60A 2JZOA 2ZSUA 2YL2A 3GEGA 5C18A 4YHHB 4B7AA 2ID9A 4TS4A 5C0OE 1FXUA 3TX2A 4QTXA 1L7DA 3KKKA 4JT8A 3T3DA 1HF3A 1WSAA 4IIEA 5T4EA 2XCQA 3U4CA 4EG7A 3GP5A 4RVNA 4PX3A 5EXTA 1ECLA 4Y1RA 2MSWA 1P7WA 2GBFA 3THXA 2ERXA 3X1WA 1XF1A 2C0PA 3BICA 2G1PA 3F9IA 4HMPA 4DTIA 4NAVA 3L18A 1LBQA 1D0SA 2JJMA 3P94A 3ZWXA 3VR4D 5KWVA 1DKRA 2P79A 4DR1B 2O0KA 3O2NA 4GOJA 5KKAA 4JYZA 2OHFA 1GVHA 1UC4B 3DZGA 3I9JA 4B4DA 3AKCA 1IZ0A 2I4TA 2AK2A 5I47A 3UICA 1ZM2A 3ZJUA 2CVPA 4J1QA 3SOZA 2OB1A 2B30A 2BE9A 1I3CA 3DZFA 4C4PA 4N3NA 4OP3A 2QG9A 3CEMA 1M33A 2EGGA 4IIJB 5K09A 1V7PC 3C6ZA 3GMDA 4QUKA 4GWLA 4L8VA 4BIIA 3CKLA 1AN9A 1U2DA 1YC5A 2XSZD 2YS6A 1S6YA 1YZUA 1PS0A 4C4SA 2XH8A 4NPCA 1KS2A 3Q5EA 4Q1AA 4Q00A 1E58A 2EFYA 5IRCD 2FCAA 1P1FA 1M74A 4NNOA 3L4EA 4HYEA 4CGYA 4F8YA 1AV7A 1MCZA 1U2SA 2HT6A 4WBSA 4PZPA 4AFNA 5CLGA 3LCMA 3PDHA 1NFFA 1YCGA 3MK31 5CEEA 3TTSA 1OVMA 5EIEA 4JUIA 4YMLA 3HWSA 3HU2A 3K1JA 1QYCA 4YAEA 2FI1A 3EGOA 1QIDA 4CNQA 2M1XA 3FGPA 2WJ3A 3OU6A 4G0MA 4O4LB 2ZJZA 4FOPA 5IVPA 4F7WA 5E4JA 3VMMA 2XW6A 1V1MA 4UEQA 4N0EA 4BDTA 3KO8A 1ORTA 2IP1A 3ER8A 3R77A 1ZN2A 2WMOB 3BDVA 3BF8A 3DBHB 2PZ8A 3PT9A 2Q7OE 3BTOA 3O95A 1K27A 4UAUA 4E5NA 4KHZA 4OMDA 2X7JA 3ZQ6A 5I7EA 1CRQA 1VE1A 121PA 4KNVA 4PRYA 1V95A 2NZWA 4ZOBA 4E21A 3IEUA 4PSCA 3CE6A 2RGEA 4EY8A 1ZGJA 1E2LA 2XUIA 4Y8VA 4BRWA 2BHNA 4LQCA 4AICA 1J8VA 1P4HA 2I3DA 1ZISA 3JQ7A 3PFGA 5FBWB 3RRBA 4C4AA 4MGEA 4RH3A 1VZ3A 5FB3A 4KOAA 2V3CC 2PQMA 1WM1A 3LP6A 5TF0A 2EFGA 1YONA 3DTNA 4MV9A 2G71A 5EP4A 2RHMA 2XIJA 3HBLA 3DKRA 3MOSA 3F3MA 2LDXA 3BC1A 3K2QA 2AWOA 2A58A 2IYUA 1HT3A 2QTFA 3M3DA 1YSCA 5CT8A 3W9YA 4P83A 4ZCIA 1V2HE 4DADA 4K46A 2IEBA 3PE6A 4Q3NA 9GPBA 1ZH2A 2P78A 4LNUA 3EUWA 4HCJA 3TTYA 4X60A 5KYXB 4BMNA 5JH7B 4GEGA 1ZJJA 2HV8A 3ZVMA 1VHTA 1UPCA 1UFOA 2OILA 3L6BA 2UYCA 3RSCA 1AQNA 1NULA 3FPCA 3L01A 1VMEA 4IIJA 4BWFB 4RZ3A 4Q7LA 1MG0A 4COKA 2XUFA 1UAAA 2B1QA 3VX3A 3Q3GE 4EZEA 4YT8A 3G23A 4B6FA 4AJKA 1AK1A 4HOYA 2ERYA 3PL1A 4F46A 2QAGB 1OR8A 3FVQA 4P4NA 3PFWO 2I4NA 3H04A 4DV3B 4ZTZB 2VCEA 1P0MA 3D8UA 3H5NA 1NW3A 3BHJA 3IXMA 4M53A 3IHWA 4JB2A 5F51A 1T9GR 2P41A 1U0NA 1GAEO 1U9JA 3LSTA 4ILEA 1OKKD 2OESA 2UVPB 2PWZA 2J3HA 4QSMA 4BVHA 2I8LA 2FRXA 3RBZA 1ZJ6A 4DIKA 5IMSA 2ZYWX 5JVDA 2O5EA 1QQ7A 3FCCA 4PWZA 1JG7A 5M34A 2BFCA 3BD8A 1IHOA 5E4FA 1OXTA 4U39A 1E9AA 1NXPA 2WJYA 2CF5A 5DIZA 4MA4A 1EXNA 3Q8LA 1AO0A 1RP7A 4FU0A 1CVIA 1GTJ1 2JAUA 3ICWA 5CNJA 3N28A 1HE4A 3OY2A 4C14A 5B2EA 1HKHA 4AG3A 1W29A 3REGA 1AK2A 1E1RD 1T5DX 2HJSA 2J45A 2JVJA 2WT9A 3AEKB 1G5QA 3LZCA 1DARA 3H1GA 1J5PA 2AJLI 2RGGA 5AQEA 4NDAA 3C3XA 4E88A 4I1PA 4RFSB 1SXJA 3ANXA 4K87A 1E3WA 3VOSA 1RAAA 4ECAA 4LYEA 4NY1A 3RVNA 1NN0A 2C07A 3EVFA 1QC5A 3BXEA 4HNQA 3UGJA 4YJ3B 4KXYA 1RHRA 2HK9A 3K94A 2Z2ZA 3INRA 3LWZA 4JIMA 1TO6A 3BDAA 2I4LA 1SBYA 2VTDA 1QV7A 1KP3A 4GYJA 1TA4A 5JAPA 1ID8A 1VPVA 2B2NA 3PE3A 2BFMA 1Y4SA 1FDUA 5B6IA 1U8YA 1UBEA 3AJAA 3LKVA 4LOIA 3TM5A 1SQGA 3LOPA 2JZCA 3D4OA 4L7QA 5G0WA 4BTVA 1U3FA 2BGTA 4D9IA 1E1YA 2FSGA 2PKWA 3HWWA 2B1GA 3WNVA 3FTCA 2J5QA 5EEGA 3RF6A 3SJAA 3KJEA 5KYXA 3KPWA 2Q29A 4DA6A 1MJ5A 5EIAA 1K0UA 3U26A 4Q4HB 1XEWX 5LZ8A 1ECJA 3TQOA 3WK4A 3ZE9A 2O6HA 4B2IA 4ZHQB 2AJDA 4C0KA 2FCRA 4R8VA 3I58A 1KY3A 1XVUA 1HFEL 2XNSA 1DXYA 2O7RA 3GWZA 3PFBA 3QLVC 5FNVA 5FXMA 5J4HA 3PXDA 1RWQA 4D4KA 1U0LA 1VA5A 5FADA 1U63A 2ZRKA 3I73A 3VYRB 2XYGA 1L0BA 2HJVA 2P9CA 5AKIA 4DE5A 4XTCS 1RAIA 1RM4A 4LCJA 3H5LA 1AZWA 1K8ZB 3NWJA 5JDIC 3HGQA 3VH4A 1ZUD1 3AILA 3ABSB 4TLDA 3TRKA 4U9UA 4H1UA 4JLAA 4JP2A 3RIYA 5DK6A 4EYKA 4LRTB 2Y66A 3L0BA 1KARA 3RO7A 4DSUA 2WPDA 2EU8A 3BL6A 1GCOA 1UK9A 2UVPA 3GCXA 3IQGX 2GK4A 2V6MA 3KJFA 3LC2O 4JY7A 4Q7JB 2HC9A 5LP6F 1WLSA 5HTOA 3BJZA 5CYFA 3R7SA 5K8JB 4NBKA 1YBHA 1QIEA 2PGLA 3GQBA 3DO5A 1D9XA 2GZSA 3R7AA 4KR6A 1E9RA 2Z1DA 1SKMA 3ZYZA 2FFHA 2FPUA 5AO9A 2R47A 2JAHA 4GLFA 3HCEA 1P0FA 4TMTA 4ZCSA 4KCGA 3DFUA 2B1JA 3SC2B 1ZZGA 2OXIA 4F3NA 3QBTA 4CI0B 3JQEA 4ZIRA 5SZKB 2NZYA 5BSKA 1RIFA 3ZGNA 5AIAA 1MHTA 4DMUB 2F17A 2XRYA 2FMHA 3MGAA 1U8ZA 3BZWA 1M2OB 1B4DA 3PXCX 4U8HA 3ZWAA 1XRLA 5J2UF 1A82A 3N0RA 3CNHA 1JG1A 3ZTTA 4RXUA 2R68A 2BOVA 4REMA 3ZWBA 1DBWA 3DZDA 4HEA6 5D85A 1P77A 3GVHA 3CZMA 4YJ3A 4AY4A 4K9LA 4DANA 4DILA 3DXFA 3PF9A 1QHFA 4S04A 3ANSA 5JASA 4JR1A 5L4SA 1HURA 3KOOA 4J0CA 3BQNB 3AQIA 1IDOA 2BTQB 3M5WA 2VS1A 2GDZA 5LDGA 3LY8A 1W5SA 2A0YA 3QWFA 4CF6A 4NU6A 1P7YA 3QK7A 1TYBE 2V9PA 3K6RA 1E1QD 3ZU4A 2FMFA 1I01A 5JJLA 1KVUA 1SPBS 1X80B 3LP5A 2A9VA 1TPYA 4JLPA 4G5GA 4RHXA 2GN0A 4QT0A 3DFIA 3WTCA 5JAQA 2BGRA 4TVSA 4O2AF 3WGVA 4B1FA 4UXJA 4GYYA 4MGYR 1VE9A 4GX0A 1V8BA 1R0RE 4NJEB 2YXLA 2G1JA 5H59A 3RAJA 2QTWB 3VZSA 2FEPA 2ZIAA 1Q7RA 2YUTA 3PRKE 2JFBA 1L7NA 2VPYA 4HRVA 4ZHQA 1KZ9A 4QUIA 2GN9A 3WFJA 3IP9A 4DBVO 4Z54A 1SHLA 2OLJA 4C08A 4J0KA 1TD9A 3GFTA 2P91A 4IHAA 5E38A 4G5HA 3P19A 2APJA 5AJWA 5K3DA 1EE9A 2CWWA 3R8XA 5DT9A 3AR9A 1VKRA 2AQKA 2Q1WA 2BKEA 1G21A 3GRFA 1RYMA 5IP5A 3WQSB 5B3JC 3U60B 2FDRA 5AOAA 3WLJA 1SKYB 3SEFA 1CLEA 3Q98A 3MCZA 4YJDA 4DZRA 1JIIA 2HUPA 1A7JA 2P2YA 2ZUWA 1E9CA 1HDZA 3BMCB 2CZGA 3JAWB 4JLBA 4QXMA 4US1R 4WKBA 1KEEB 3UANA 4DPLA 5BUCA 3UK6A 3FA2A 3I2GA 4TN5A 3F9RA 3MRSA 2BEVB 3IMGA 4PO3X 4BATA 3LUPA 1FP4B 3WK7A 4Q4CA 2LCIA 1G3RA 3QW2A 3ESBA 2W2MA 1UCFA 3OOEA 3I12A 4D2IA 4DNPA 3ZU3A 4U3JB 2JAXA 1L5WA 5EJ6A 1AA6A 1YF3A 4QXQA 3WOVA 1PE0A 3EWSA 5TQ0B 3GLFB 2NU9A 2XB2A 3ZN2A 4LF8B 1JEAA 1R9JA 3GFOA 1GAQA 4NS1A 5DIFA 3UUEA 2Q3CA 2Q9AA 3CIFA 2D3TA 2XCTB 3OE7A 1FFBA 3G1WA 2GAIA 2WICA 2JGNA 2YRWA 2W6JD 4FHDA 4PANA 5C5EA 1U2QA 5HIKA 1QPBA 2XNDA 4NV3A 4II2A 4FGUA 1YB4A 1W2HA 1MO6A 1XL0A 2B1IA 2JIZD 2ASEA 2JIRA 3BXPA 1G20E 4EHAA 1IXYA 3FDFA 4H27A 3SDSA 4XW2A 1WB9A 3Q85A 3E9EA 1TO1E 3O9VA 3QFHA 3THOA 2B92A 2WUDA 5LQNA 4KI0A 4WA8A 5ARBA 2BGKA 4GM1A 2IZOA 4ZAGA 3EIFA 3PNBA 3Q3EA 3TK1A 1X80A 4V0QA 4A0FA 4KR2A 1T10A 5HJ2A 1VXRA 2HWYA 3EVEA 1ZUHA 5H9VA 1SELA 4XAQA 4AJPA 5TGTA 2TECE 3TMAA 4F84A 4KGXA 5DN6A 4BASA 4UW9A 4UASA 1JLSA 2W2LA 1CQWA 1HE5A 4ARZB 4UEWA 5JQWA 4F21A 1FP1D 4IIXA 3IODA 2ZJ7A 1CY8A 5LXTF 1W4CA 1KWGA 4XCXA 3BSWA 3I76A 3OJXA 1DQPA 1WF6A 3KSUA 4WXRA 4W5RA 5CA1B 2VNIA 5CRIA 4Y6QA 2G09A 2JPDA 5I6DA 1EYZA 2ZJ5A 3DQPA 1XA0A 3NTVA 5AJYA 2EEPA 2QIOA 4LE0A 3K0BA 4QGGA 4ZOEA 5GONB 3ZUGA 1AU9A 3HJHA 3P26A 4OFXA 4M0CA 5DB4A 4DQ0A 3TCXB 2DXIA 3AUAA 4MR9B 4Z7QB 1VJRA 5CXUA 2ZGVA 3VPCA 4ZV9A 5AK5A 4YV2A 3NW9A 2VYVD 5H7XA 5KJFA 3LECA 1EA5A 1NLZA 1X70A 4DR3B 3R4CA 2PWPA 3DE0X 5ELLA 2EJVA 4ZGGA 4XEUA 2GRUA 2GF0A 1QG2A 5EIBC 1KEEA 3FCAA 3V2HA 4A5SA 3HGTA 4LJ4A 1MIHA 2NO0A 2ZSIA 2HRBA 2UVDA 1U31A 2WSIA 3F5FA 3FUCA 3UIEA 2BEVA 3VR3D 4YR9A 1GYRA 3KL2A 1XZDA 1ODLA 3SBEA 4RF3A 3B1ZA 4RH0A 2JI6A 3C8DA 2EATA 4OXXA 1TCUA 5LBTA 3P2KA 2BL4A 5TQ0A 3GLFA 1ZKMA 2IS2A 3ZXSA 3SHTA 2E4ZA 2WJJA 2JZNA 4R16A 4YO7A 4DL9A 2RIRA 2F3TA 3PS9A 4HN2A 4AIRA 1ISIA 3AWDA 5GY7A 4BNUA 2QSUA 5A6VA 3TZQA 5SYAA 4R8SA 5ALJA 3ED1A 4O3FA 4HH0A 2IV2X 4OXRA 3K7EA 4JP1A 2N3ZA 5TQ2B 3E8SA 3KD2A 1V71A 5EJ9A 2VDQB 1HTWA 4Y2YA 1CE8A 3LW7A 2O50A 3PXEA 2EEZA 3QA9A 1SVOA 4Q24A 3I6ZA 2WJGA 1XMSA 3TOSA 1H2FA 4KFSA 3ZY5A 1IRXA 1PR9A 2XHEA 2FWBA 5EHXA 4JEHA 4YS6A 2F90A 2A9QA 3WWZA 1I3KA 3Q2KA 4KQCA 4L6AA 1IATA 3LBFA 1NZDA 3ZY6A 3GYGA 4MHSA 3VDRA 1JH9A 1MPXA 3P5BA 3ZH9B 1H9AA 3TQSA 2M1ZA 5DLDA 4ARZA 1UMBB 4PS1A 3OLYA 2O05A 1SIBE 1U0RA 4FE4A 1B8OA 3TTXA 2ILVA 3FZYA 4NTZA 3HVRA 5BSWA 4G26A 2AUTA 4U2FA 4W4TA 2P2SA 3MJCA 1XELA 1GNPA 1N5OX 1PWYE 4RMNA 4FCTA 1YZFA 1ZK1A 1GNQA 2AFRA 2HA5A 4M9XA 2PT7A 3H5OA 4DDKA 5BNTA 1H94A 5CA1A 1BHJA 1T1EA 2WJ6A 3NV7A 4YJ2F 1Y6ZA 4UAJA 5L3RA 2BH2A 1K8XB 2QYSA 4DV4B 1ESZA 4DDWA 4PLHA 1RMTA 3S8EA 1B8UA 2QYTA 3NGLA 1NE7A 4MR9A 2IH4A 1UPUA 4IMRA 1X3LA 2ECOA 3OICA 4DLBA 1Q1EA 4MUBA 3VO1A 1JKXA 1S96A 2F1OA 1CUUA 2GN1A 1H42A 4LVCA 3TN7A 3W7AA 3GUVA 3TLGA 2HQBA 4YDSA 3C87A 4PFKA 1ZOPA 3SZRA 4F1KA 3WKCA 5ESWA 2POQX 4XVHA 3RBXA 3N8GA 1TCAA 1R50A 4DNQA 5I51A 1ZK0A 2QR5A 4UVIA 3U09A 2W71A 3OTWA 4OHXA 1E0KA 3HXMA 4AY6A 3ZH2A 4R83A 1CXZA 4YP5A 4V0SA 5DYIA 3UMGA 1XEFA 2RGNC 3K0AB 4BV8A 1R6VA 4NCIA 2QK4A 4K9PA 4C29A 3KP1A 2QJFA 3O2JA 3VR6D 3DWFA 2GEFA 1WQ1R 3CLTD 3TPCA 1GYPA 1T0BA 2JEOA 2NM0A 4KRXA 4X92A 2O8BB 1F1BA 1FEZA 3UPTA 1TB4A 1Q22A 3R6WA 4E5YA 4AYTA 3OZGA 3HBMA 4Z1MA 2GILA 1C2TA 4AZSA 2H54A 4P4GA 4AZ0B 2FOLA 4GPEA 4I9NA 5TR9A 3U9TA 4J43A 1V3VA 2YY6A 1Z6ZA 1FFYA 3FN4A 1JR3A 3AUUA 3SEQA 1L5HB 3CF4A 1U28A 1K86A 1P9RA 5BN3B 1TYAE 1Q2XA 3QG5A 1WCYA 5ER9A 3DDSA 5BQ3A 1WBBA 2J3JA 1EM6A 4FDAA 1XPRA 5F1PA 4MQLA 1Q0LA 5F7ZA 1O5OA 5MGBA 4LJ6A 1QQAA 3WGGA 3VVLA 5BMVF 1OI3A 5ICEA 1N2XA 3O82A 3ECAA 2C3UA 3E7WA 4RNDB 3UPDA 2HBYA 2X8BA 4UHBA 3A3KA 5AVWA 2X7XA 1AM4D 3ACDA 4LRWA 3FSGD 1DXOA 1UMBA 4TTPA 4RHEA 5KHAA 1NUUA 4Q15A 3EPLA 4L0DA 4EL5A 1VIVA 4M8LA 3H6HA 4XPIB 4GF5A 4D4IA 2JK1A 3BM5A 1KPIA 3Q9UA 1N57A 3WNBA 1QIGA 4D8YA 1I30A 4J2TA 4M98A 4OUKX 3ZW9A 3RV3A 1K4MA 3X1DA 5DNEA 2K4MA 3V1MA 1LC3A 2XOKA 4P53A 4NXMB 1EK0A 2FTKE 4P36A 4KXNA 2VH1A 4I5FA 5IARA 3VH1A 3ZV7A 5CFNA 3PVZA 1MEOA 2QVCA 3DKIA 3TXYA 4P3NA 4ARVA 4DLRA 2PX2A 2R86A 2ZXEA 2IZ6A 2AB0A 5IAKA 3GK3A 1WDWB 4AULA 4YMVA 2R6GA 3KEOA 3UKJA 4P08A 1NC1A 2PA3A 4YH1A 1IQRA 2PUDA 1J09A 4D3DA 3LYLA 4GMHA 5IKXA 4PZUA 1ZUIA 3RF7A 4RZSA 3RJMA 4WZBE 3KTAB 1DAGA 1AK9A 3A9UA 4S24A 4YEDA 3VR5A 4LWOA 4A3SA 4B32A 1F8XA 1L8AA 1ZN7A 4GR5A 1EXVA 2B0JA 1FS6A 3DNMA 3WGLA 4DSAA 2HHCA 4XJXA 5IDYA 3DOFA 1FP7A 1J5XA 3NC1C 4NARA 1VDZA 3K0AA 4M7WA 5IYZA 4LFAB 1M2KA 4YP0A 5TX7A 2HU2A 1X7GA 4M49A 5ED0A 2P1RA 3FVVA 2XQJA 4OHVA 2C2MA 4QREA 1KYYA 2REXB 3MMXA 4R54A 3V2IA 3K5IA 2O8BA 2JBHA 4FMCB 4CIWA 1T6NA 4CV0A 2VWPA 1QCZA 3IP1A 3LH5A 1RCFA 1HE3A 4CYMA 1FFCA 3P9IA 3N2KB 2QD3A 2I22A 3ONDA 2QE7D 3LVRE 2HXSA 4QEDA 1YZLA 3KZNA 4Q39A 3TLJA 1XMIA 3D8BA 4IXDA 3ET5A 3HR8A 2R4TA 1L5HA 3RUFA 3NETA 3WXBA 3AKYA 3PGKA 1TCCA 3EK2A 1NUAA 1ZIOA 4H7PA 3N7AA 1ZM9A 2ZRCA 3GVPA 4QJ4A 1YS1X 5FQNA 1DJNA 3AIIA 4R5MA 5CXSA 4PG7A 3ZR4B 4F4JA 1DAFA 4XRGA 3TD9A 1FMFA 2IPMA 2IYPA 2H3EA 2GN4A 3OQBA 4Y2QA 2GCPA 3TTTA 3FI9A 4ZK2A 3OPNA 3EN0A 3IDFA 3H2JA 3KTOA 5THQA 1X3SA 5H1YA 1FOEB 1XROA 4R5HA 5HFNA 4CVNA 1L2TA 3OPVA 2AJTA 3UT6A 2ZSDA 3TOVA 1H2BA 4MH0R 3Q3IA 4LXGA 5J4YA 4ZEOA 2MYTA 4EHNA 4RPCA 1C3LA 1JQAA 4B4KA 4B3SB 3K9FC 1CX9B 1DUSA 1PZXA 2E5LB 3IAM6 1G4UR 2QRJA 5DE3A 1Q7TA 1U90A 2Q46A 3M81A 3R3JA 4JA2A 4QBFA 2WYUA 1IDN1 2EYUA 1G60A 2B36A 2QUAA 4OMCA 3NALA 1QB7A 1VLQA 2B9EA 3IR7A 4X1IA 2H00A 4H7DA 4Y1FA 3T9FA 5KQSA 2N46A 5CT9A 3SQOA 4K5QA 3GEPA 4QVGA 1OLUA 3IMCA 4Z8YA 1KI7A 2X4DA 2BHSA 1CY1A 2QHXA 3MBOA 5J3JA 2XB4A 3Q0EA 3T4EA 4KRYA 4MYRA 5ESXA 4PG6A 2XVMA 3ND5A 2WKQA 4H6XA 3OZIA 4DA7A 1YS2X 1LC0A 5A5VA 3RC8A 4ATNA 3ZJTA 4CETA 5AVQA 4AF8A 3DXXA 1ZVVA 3RSOA 1JQJC 3DEFA 5IW8A 3VH3A 5CB4F 4HX5A 5CVTA 4OI2A 1QV6A 3SLKA 3HA2A 1K5DA 4FN4A 1MC8A 4FR2A 3OAAD 4JLKA 3ZHCA 3IP5A 4C88A 4NCHA 1KQOA 3CSUA 3RAGA 1BS1A 3RWOA 4IBOA 4ALNA 1GRVA 3PXGA 3VRHA 1HEIA 2I29A 3GFSA 2LP4Y 3PEVA 1RWNA 2P9YA 2ZBPA 4ND7A 4TLMB 2XRFA 3AIMA 4K9RA 1YZKA 1U2GA 4ARCA 1YI0A 1Q7GA 1OTHA 1XP5A 2Z5GA 1NZFA 3A4YA 7REQB 1WCIA 2C9MA 4PC3A 4CDGA 2JJ2A 2HY7A 3EMVA 4K9SA 4D97A 4DSZA 3GT4A 3JD3A 4Z0HO 1CUSA 3ZE8A 4DMFA 3LD9A 2V3WA 1PL6A 1N8TA 1TKCA 3T3EA 4EO9A 1EFLA 1R4NB 1H5UA 5HVNA 4PU0A 5GJVC 1J4AA 1YD7A 3PFKA 2FAXA 1V7QA 2P90A 4HVCA 1UZAA 2AWNA 1QSGA 3CZ5A 4MWZA 1ZC3A 2BF4A 4RTLA 1EUQA 3MCUA 1F2UA 1WMBA 3KB6A 1G63A 4BO5A 4BCBA 5BT8A 1H3EA 2ZREA 1FVFA 4LF6B 2OCKA 1XZBA 3BTUA 3H5TA 3JZIA 4IZOA 3AF5A 2W2KB 3CNQS 4YDHB 4EG4A 1EAYA 1G6OA 4MIOA 5EJEA 4URHA 3ZLUA 3ZDCA 1OILA 2EFEB 1UP6A 3BBLA 3ZJYA 1U8TA 2OVFA 4ZODA 1E1LA 3FG9A 1I80A 3G5MA 4G0XA 2B5WA 1XTPA 4IIYA 3T6KA 4WK0B 4UCQA 2ZWAA 3IESA 4HNGA 4G0WA 1CQZA 1NU8A 1MABA 1VJGA 2V6BA 3QE0A 2GPSA 4B6GA 4P0QB 1ZW1A 3NHZA 1F0PA 1MN6A 2W6PA 2XWQA 1JLRA 2VJKA 4DKXA 5BQXA 5DBGA 3EEYA 1Z2CA 1Y1QA 1YQXA 1NE2A 3H9QA 3I53A 3K2IA 3GGPA 4ZU6X 4UXHA 3SZLA 3ZHSA 2H1OA 4CIAA 1IHDA 5ALZA 3K3PA 3PYXA 5AJTA 4A36A 5CXXA 4YPOA 1NSFA 1F2TB 2XMPA 4BQNA 3K31A 1FB5A 3LDFA 4EZBA 3PQ6A 1JVSA 1ORVA 5FO1A 4AM8A 2UZ3A 5I3ZA 3TLBA 4MVJF 2OQVA 3IEVA 4QBHA 4MUHA 4CDRA 1WB6A 4QQRA 1O4WA 2QXUA 4HB4A 3KG2A 3E2PA 5B1IA 1JIQA 5K03A 1QYXA 3FOEC 1MAAA 4CW7A 4LYYA 4X5OA 1Y3AA 2HWKA 3RJ5A 1LW6E 2JLCA 1Y1LA 2QTZA 5EHIA 4X45A 3H2GA 3MINB 4G0QA 1MB9A 4WCFA 5K0BA 2CDBA 3R7NA 1D2CA 2HA2A 2YV3A 3KKEA 3KXLA 1KHTA 4HXFB 3KLMX 4I3HA 1CR2A 5AI8A 5EL0A 1O5IA 1Z6YA 5B6JA 7REQA 1SBQA 1QGZA 3JQAB 3KEFA 3G0BA 2I8CA 2QVZX 2QX6A 3T7TA 1SCAA 5FD8A 1F2VA 3I09A 2ZKIA 3IAEA 1IN4A 4P84A 2Z6UA 4S1NA 3UCXA 5I9NA 4BX8A 3D3NA 5EXPA 5IS2A 1AUPA 1BKDR 2E4XA 3AJ8A 4CMEA 1POXA 3TIFA 2ZTMA 3GLQA 3KJIA 3KTFA 3GC6A 3L1IA 1U9ZA 1ZVQA 2HU8A 1GU7A 2VK8A 1RCTE 3K0EA 4XVRA 1Q19A 5JTTA 1ZM7A 1HG1A 3OQHA 3VPFA 2ZQZA 2QN2A 1C7EA 1N2CB 1YQDA 2Q5LA 1QMPA 2DBQA 3ND7A 2I9KA 3LNTA 2BEWB 2HO4A 2BW0A 2Q50A 5BQPA 1KZYC 1Y6QA 5IZCA 3VNRA 4ZZ1A 1KMMA 1V1RB 1MJGA 3I8XA 4JC8A 1LSOA 5LKAA 4HFMA 2MSEB 2V0NA 3RSGA 4UTNA 1X1BA 3V42A 2Z2JA 1GUAA 1IHYA 1XCBA 1YVEI 3DM9B 3EY4A 3HL4A 3JZFA 2YZKA 2QPOA 4G97A 1LK7A 1W76A 3D6UA 2HBRA 4KPUB 2KHZA 1QFJA 4YROA 3D7NA 1E2HA 3A3OA 2YXDA 1L5VA 4DY6A 4N0PA 5ICSA 1O0CA 1OYVA 3TZBA 4UUNA 2C78A 1OJ7A 4WK4B 1SZDA 1ECBA 5T3YA 3T7SA 3GFQA 4F1WA 3ML1A 4RDXA 1TPZA 3GRZA 1H2RS 3KFLA 2Q4RA 3P0JA 1SUCA 3HS3A 3L1KA 2JGKA 3ICVA 3M4XA 2I76A 5LQJA 1G38A 2ILTA 2Q21A 4TL6A 2YY5A 4IX9A 4BJ5A 4O8CA 5DTMA 3KXKA 2DPMA 4MJXA 5KCZA 1X8JA 2EZ4A 3FRHA 4KE7A 1H2WA 1USIA 2GFQA 4H6VA 5DGCA 5I5GA 3V7YA 5A9SB 4FDLA 1FFGA 5F73A 5I4BA 1PT8A 2FEXA 2QZZA 5AUQA 1QH9A 2C8KA 2QX7A 3N8IA 1QUEA 2AYYA 1NRJB 2YQ5A 1SQFA 1LRKA 1QO0D 2I34A 3HM2A 3PC2A 4PQYA 5FFMA 3ZGVA 3ZTWA 3JQAA 1G55A 2E4UA 1ISGA 3RU2A 1T2FA 5JALA 3B13B 1P9NA 5FI1B 4W1PA 1O08A 4QOIA 2JATA 3BX1A 3PSHA 2JVIA 4QU0A 4RKWA 3OC6A 1J21A 2VP4A 4L3VA 1C9DB 3HP1A 4URXR 3F7MA 4XYBA 3IKJA 2ZBVA 1Z0JA 4FEYA 2VDWB 1J20A 2Q27A 1AG9A 3FY4A 4TQUS 3SE7A 3B6IA 2W6OA 2YX1A 1VYTA 1NA5A 2C98A 3O7MA 1ZR2A 1T5SA 1YKSA 4ND4A 4ARIA 3BEOA 5C5IA 3TJZA 5BYAA 4GBGA 5MFPA 3VNAA 4P3KA 1JJBA 2BEWA 4YDQA 2X42A 5KJEA 1BGVA 5ULLA 2YMPA 4CKYA 2GAOA 1U7HA 2V59A 4F2WA 4BUJA 2IKQA 2V7PA 2BMFA 2AC7A 3KJZA 5COBA 3ROKA 3ZOZA 1WZEA 1F8GA 2BC9A 2ORVA 2FGKA 1IU9A 1WXIA 2W4QA 4G0YA 1AO3A 1N2HA 2BHRA 4G0OA 4M8NE 1TQHA 2PFSA 1TQDA 3ZNOA 4QOSA 3L8GA 3HDTA 4TM7A 2C5GA 2PGIA 3JWGA 1M7GA 1F20A 2C31A 2DJ5A 4JYBA 1X9IA 4EABA 4XVUA 3ELDA 3FNQA 3GRYA 4GX2A 4JI1B 1OU4A 3AHDA 4TWZA 3I2FA 1OYWA 1TVMA 1UXHA 1QRUA 1KK3A 1XCOA 2WNHA 3P20A 4KXQA 5ICCA 4LJSA 3C43A 4Y6LA 3SWWA 1L1EA 1IMOA 1HE8B 2VJDA 3QEOA 4Y3UA 4QIHA 4X6UA 3WWCA 5EJ8A 2YINC 1V4VA 1J8QA 1DOZA 2OD2A 3MJVA 2Q1XA 4N0QA 2D13A 4Y1EA 3Q1KA 5ANRB 3SS7X 5BNWA 2JEYA 5BQFA 5JI3E 1GD1O 1SULA 3QLJA 4R8RA 2RBGA 2ZR8A 4OH7A 4GI2A 1DGQA 4Q1EA 2AJ8A 2CW5A 4N9QA 3LX5A 1NF9A 2VTKA 4KLCA 4M0EA 3GW8A 4RHCA 5IBRA 4RX1A 3WX0A 5IM4F 2EZUA 4OJQA 1YQ9A 4WNCA 4WKOA 2V4UA 4HAWA 4FR5A 2XQKA 2DQZA 4J0JA 1R4AA 5KEIA 1G5HA 3ELBA 3M6VA 2DFLA 3OIGA 1KFCB 5DTEA 5EKSA 4OHZA 1BDJA 4N5IX 1P9LA 3FKJA 1N2BA 4OFBA 1YZVA 1GPLA 3ZHXA 5B2FA 4M9SA 5HBGA 2XMSA 2PKQP 2NUTB 1NQWA 4TUYF 5BWMA 1WG8A 3IQWA 4DQUA 4NBVA 4JYAB 1E2IA 2IK8A 4R2XA 5K8UA 5EWLB 2KSQA 5KTKA 4NMLA 3IBYA 4PG4A 4UE2A 2VQSA 4C3UA 4O4HB 1YQEA 1I4TD 4A8JC 3AY7A 5EMJA 1U8AA 2Q3DA 3KEQA 4AMYA 3H86A 3ZE0B 1G0NA 3JAMA 3A1WA 2VDWA 3NC4A 3ESXA 1NLMA 4FDTA 4HPXB 4YIKA 3SJ7A 4OGKA 1KIFA 1DKLA 4CMKA 3WQRA 2E4WA 3FYUA 1CJMA 2AG1A 1PUJA 2IZ7A 2VF4X 5IAEA 2D74A 4KN5A 4JL6A 1ZM4A 3N8NA 4HGRA 2DB3A 2FSUA 2Y93A 3TL6A 3BWCA 3OZDA 4V0OA 1JJ7A 3DYIA 3KZMA 2DH5A 1C9MA 1MBZA 2GBPA 3UENA 2HU5A 4ZCTA 4RQAA 2VQFB 2EDCA 4XFDA 4DLPA 2ZIEA 4M0KA 1WCV1 4BNLA 2RAPA 1C1YA 3NAMA 4TV8B 3FPHA 1SOVA 1BCSB 4V0KA 4Y2JA 3UHFA 4G85A 2O8FB 3P5SA 4BX9A 5DI3B 3JYLA 1H1LB 4CUZA 5A4AA 3V8EA 2O8EB 1A7UA 1PJRA 2BJVA 3KOMA 2X0IA 4JP5A 4L78A 3TPZA 3C6MA 3CA8A 1J9EA 1Y5RA 3NT4A 4XDGA 3JWHA 5I9MA 4HZUB 4IM7A 1MC4A 4CR8A 5JNWA 3LRPA 1J0AA 4IS3A 1U0FA 4BB6A 2IF2A 2YMLA 5B12A 1RAHA 1JI3A 2CNNA 3D2BA 5D86A 1IY0A 1HDRA 1C41A 2J9YB 3STXA 1NVMB 3KOZA 4ENSA 1OB2A 3GN1A 3U40A 3KQSA 1P6XA 1T5IA 1G2PA 1QYRA 1MKYA 2QSZA 1E6KA 2BGMA 1CBUA 3KE8A 1KI9A 5FT9A 4ZJYA 3K53A 4X65B 2JI8A 4YXWD 1MO3A 1TT5B 2G28A 4FKZA 5HF5A 4PICA 1K5PA 4ESVA 2DTEA 2RI1A 3G2JA 3MT7A 3OIVA 1WY7A 5LM3A 3ZWKA 1MFZA 1Q3KA 2PUVA 3O1LA 1JVNA 1IJEA 4RD1A 5LOVF 3U4IA 3YASA 2RHWA 1FQJA 4MLDA 4BMZA 5AXDA 5FLXA 1PG2A 1ZRMA 4OY3A 3W6UA 1XJQA 2V54A 3D02A 5DBOA 5FUQA 4QDXA 3TSAA 4L16A 4WACA 1KI3A 2QTNA 1LZLA 1KL7A 3DPSA 4FD2A 4WL0A 1Y8CA 4IUBS 2HIAA 4D7AA 2HQSA 2GLTA 4O4HA 1F1JA 5KU7A 3A6GA 2JHGA 3JPYA 4ZOCA 2ZVJA 1Z6XA 2DQSA 5FPHA 4QDUA 3WLOA 1Z2DA 3C5VA 3A6PC 2PX0A 3W90A 1VKJA 1L8LA 1BHO1 2AA3A 5JXIA 1XD8A 3CUSA 3OTHA 4J0GA 3S2GA 3CVXA 3IB3A 1YVRA 1PZEA 2DQ4A 4DCVA 1SCUA 1XZKA 1YTLA 2X4GA 3WGHA 2YHIB 4OD0A 4EGAA 1TIPA 1YQQA 5F52A 1CK4A 3M1LA 3VZRA 3ZJ5A 1JA9A 3UUGA 2OV8A 4WJZA 4PCLA 3OIUA 4AY5A 1A1VA 3EA4A 1NW4A 4ZKDA 3KZKA 1L4MA 4EGQA 2PV0A 4WLVA 1EBBA 3RYCA 1G6KA 1XU9A 1MR3F 1PHPA 3H4MA 1WOYA 3T4PA 2O8FA 3BS4A 4C0WA 3G88A 1LBIA 1H1LA 3MELA 3VJKA 1WBDA 3SLRA 2PZMA 1JLKA 4OB6A 4ZTUB 2ZB4A 5C8VA 1CJTC 2PT5A 3E3MA 3OEEA 3P9SA 3X1YA 4BECA 4ENQA 2O8EA 1A4IA 1N33B 3RRJA 3PL5A 4L27A 3I52A 4F91B 3L6EA 1RYHA 1AUQA 3KQPA 3GFVA 4WK2B 2SKEA 3LHKA 1ULSA 3PFFA 3KZVA 1BMQA 2GYVA 2I03A 5FL3A 1O6GA 2E87A 3IVGA 3GVCA 4W5OA 1LBSA 5A6SB 1YTUA 1E2DA 1HBJA 1P4AA 4QBGB 2IEDA 4INZA 1FE8A 5DEOA 4QYWA 1P7CA 1RHUA 1XDSA 3ODGA 1I2MA 2HADA 3IPRA 1JA1A 1MQAA 4XIIA 3JVDA 4RTPA 2Y0EA 2WYOA 4YCDA 1R3DA 4WCVA 3ZIAD 2XNHA 4O1MA 4IILA 2RHLA 2VJYA 1CB7A 4G2NA 4BTLA 4DCCA 5ADWA 4WZAA 4DT1B 4PC1A 1TT5A 1EFRA 1IL0A 3MPOA 3PZBA 4LXTA 2I9PA 1ZNQO 4YJFB 2GLUA 4DHWA 4NXNB 2QLMA 1DIHA 3NEPX 1E77A 3UB3A 4WFIA 4QSHA 5ALXA 4BNZA 5A5DA 2CCJA 3HJAA 1NJ1A 3TLMA 2GPNA 5AW9A 5E6UB 5DBIA 2QX8A 3AR2A 4WKNA 1BEZA 2ORYA 3ENWA 5JHHB 1CRLA 1E60A 5CVEA 5G3ZA 5ICGA 5JATA 1EVIA 3CX4A 2FPIB 1PZNA 1HX7A 1W96A 3JD2A 4Z7JA 2PMDA 1DCKA 3LT4A 1L4UA 2WJWA 3QBJA 1JHPA 1UWVA 2ZJ2A 1DO2A 3DEYX 4LQ4A 2IBMA 1QZTA 3CRQA 1GQQA 1XD9A 2EF0A 3H4TA 4K81B 3C8HA 4OF4A 4ZVNA 3SFZA 2VYNA 4MVXA 4Y0AA 3WGUA 4M0MA 3RD5A 1WHSB 3D7MA 3K0SA 1HV8A 2BVNA 2G0NA 3COZA 5KX5B 2IIQA 4JUFA 1W52X 5E7IA 1IH8A 2C7OA 3B36A 1SNYA 2YHIA 3BMNB 4AJEA 4BNVA 2H07A 4I46A 2Z0MA 2CVZA 3CGGA 4Y18A 4ZVTA 2C4NA 4CKCA 4G1UC 4D98A 1R74A 1ATZA 1G8AA 4PX5A 4LV8B 4II3A 3KR9A 1OASA 2BI7A 5LB2A 4GQAA 2GPYA 3HN7A 2EL9A 2E3JA 2ZDHA 2ZWOA 2B8JA 4EFMA 3WV5A 5EE3A 3D9QX 4G8JA 3ZHRA 2QTVB 4RORA 1NX6A 2CJFA 3LIPA 3HXPA 2YZGA 2XR1A 4F72A 4G5OA 3Q41A 4NKRA 3DP7A 2AUNA 2GM9A 4LYDA 1EG2A 1XRNA 1T5TA 1SU8A 4I08A 4PTLA 3RHTA 4WEQA 4E4TA 3GJTA 4L5IA 2PPLA 4BKUA 3R7WB 1PFUA 2VDPB 4I4IA 4B7CA 1RIIA 4D42A 4A1OA 3DEZA 2NT3A 3QVXA 3CU5A 1KZGB 2ZS7A 2P11A 4MYSA 5HCUA 5DNDA 2AN4A 5KYYA 1GGVA 3U17A 4AURA 5A4DA 3ZZNA 2HZBA 4JUBA 2FZEA 3QFCA 2J46A 2NQ2C 2AZTA 3Q3VA 1A27A 4KITB 2BDEA 1F51E 3P96A 1A0OA 1QKIA 4PPNA 2X0FA 3WLSA 2FJUA 3G9TA 1M83A 3FHLA 3FUWA 5IUNC 5E8JA 4J7AA 2Y77A 3B7WA 2AG5A 3NJRA 1IZ9A 3KYCB 3M8KA 5CT6A 1C2YA 3DDOA 4RTSA 4BY9E 3DULA 3NC0C 3OTQA 3IS3A 4L02A 5J2UA 1PFQA 1VCOA 3FLEA 3L7IA 4RJIA 1AKTA 4YHBA 4FSXA 4H0NA 4MRAA 2UUOA 1Z7GA 3F4LA 5FF9A 3OM1A 4N3CA 4LOHA 2GHQA 4ETIA 3Q10A 4RPLA 1PDOA 3CUYA 4I1RA 5L3ZA 4MW0A 1RJGA 3V1TC 5KDOA 4X62B 2YR0A 4GO1A 4HO1X 1J42A 1CY6A 1T2DA 3E27A 1O77A 4AZTA 5MHTA 1IXKA 1FMLA 3IT2A 3ZD7A 1CWUA 1WHSA 1MU0A 4RDIA 4XYMA 1KPGA 4G09A 2Q9CA 5KX5A 3JR7A 2JGIA 4J2OA 4ITRC 1SOUA 1UL1X 1TW2A 1U2DC 2EG5A 1IN7A 1GKUB 2IEZA 3OY7A 4CN8A 4DDTA 4MUIA 2HM7A 4GU5A 1T4MA 3ESQA 1K9VF 3ORQA 1L6IA 2OFOA 5FPSA 5EMMA 4P5EA 2HEIA 2R7MA 1TZJA 3AFGA 3IUNA 5FCDA 4YI5A 1ZQ9A 3O83A 5IN5A 4AT1A 3E9QA 3RNOA 3TLCA 3HYSA 4MKXA 4NOKA 5AM4A 2J9GA 3DOCA 2XV1A 1S4MA 4QDJA 4DRYA 1L7OA 2HV9A 3IYLW 4JBGA 5F2NA 3ZCUA 4IEEA 5K0LA 1CP3A 4G2TA 3TKAA 3FUXA 5KNCD 4JLJA 4UNPA 3STTA 2QTVA 2DEUA 2OV3A 3GLKA 3NRJA 4RLHA 2LVBA 3X1JA 4DG9A 3OQOA 3DOEA 1QE5A 2YJ6A 2QM0A 4E7OA 2G88A 3WQQA 3CW9A 4KVZA 1XZAA 3C1OA 1LSUA 3WGZA 5IHXA 3G6KA 4BTEA 4KJZA 3DF7A 1LF0A 2NTEA 3SZ3A 1IEQA 1ZSVA 3I4FA 5TMDA 4EB8A 5C1BA 2BJHA 3TZHA 1RWKA 4FC7A 4BLOA 2IODA 1CS4C 2R751 1U0OC 2PL9A 2WG1A 3F3YA 3HJRA 3ONNA 4C0QC 1QKJA 5LLDA 2H16A 4P4UA 2Q4DA 4W7IA 5ALYA 3QZUA 4XWOA 1W4ZA 3WWYA 2RAVA 4C0BA 1X77A 3PR1A 1X8XA 4AS3A 5J4KA 1ZM3A 4XJSA 3PQCA 5ERGB 1LVUA 3I92A 2G6TA 1C8KA 1FW6A 4PYMA 3FROA 4DUGA 4RK6A 3ZPXA 4MRMA 1B23P 2C1ZA 2GA9A 4D8UA 5ES4B 5CT4A 3WL3A 2Z2KA 2CXHA 1YBFA 2V74B 2JGAA 2WPDD 4LJKA 5JW6A 3BJEA 1U0BB 5BWBA 4HTAA 3FCXA 4Q3EA 3ET4A 4NYJR 1W46A 1LI7A 3QUAA 3PI7A 3K8YA 1VLJA 4JKIA 3TE6A 1J1IA 4C7MA 1E32A 3K9HA 4Q47A 4TYMA 3PK0A 1DKNA 1H3FA 1RI4A 3KFXA 3SK0A 1Y8RA 1MOSA 4YMTA 2L17A 2RHHA 4CMIA 1SCBA 2JJ1A 1G5TA 2IZZA 3NEAA 5FORA 4BNGA 3IBSA 2EDAA 2XE7A 2IYLD 3RBAA 3ZD6A 4ZO4A 1Z6QA 3VJMA 3BZBA 1YRAA 4HQ0A 1G6Q1 4ICIA 1FBTA 1XLUA 1B8PA 1U0GA 3DAOA 1QQ5A 4MCJA 3A6EA 1D6NA 3B20A 4YRTA 4NOMA 3SC4A 3BA1A 1Q15A 3MBIA 4H31A 4RACA 1CJBA 1EB8A 2VJNA 3G2HA 3KYDB 2H2WA 4JVSB 4BKRA 1A2KC 3GH3A 2JGMA 2GCOA 2GYYA 2OCDA 1LDGA 4OM7A 1PSWA 4DIOA 1FTYA 1JS1X 1NLFA 4KQFA 2R44A 3AKEA 2J48A 4TXNA 3WL6A 4ZMBA 3PGVA 1R5BA 3TZCA 3L7KA 3HCNA 3LPMA 3OETA 1DO8A 3KB8A 1E2NA 3H11B 3HYRA 1OBCA 1ZJ5A 4MWCA 4KJXA 4POAA 3K09A 1GCAA 3DR5A 5ITSA 3GLHB 4OYYA 5FWXB 4F5ZA 3ZCTA 3PHCA 1BKYA 3SX4A 2HJHA 3QEJA 3W4IA 3KJXA 1L5ZA 2LGJA 1K3FA 3AHIA 2WFAA 1Z38A 2JB9A 3M5DA 2CFTA 4QUHA 1N6HA 2AD5A 3R24A 1T5BA 4WLFA 1NN5A 1SXJC 3FLAA 2WUEA 4CODB 2IXTA 2PIAA 3I32A 3RC3A 1F06A 3FYTA 3RFFA 3VC7A 2TMYA 2WKRA 3D0RA 2H18A 1KO7A 2DP4E 4P7BA 4FINA 1COWA 1L8OA 4IKEA 2ATXA 2VPZA 4M9QA 2FUG6 4MB6A 4D74A 1FQWA 4LISA 1U2EA 3HYNA 5D2CA 3O38A 2VAMA 4G24A 5AVJA 4AJJA 2CD9A 1GL9B 2ZI3A 5KYUA 4B3RB 4RGBA 2QVXX 1U0EA 4BO6A 4YB8A 5I4KA 5DSXA 3T4XA 3U37A 2BCGY 2VF2A 3TDMA 4U2GA 2QTLA 4MJ3A 4X6LA 1KYWA 1YJ8A 3SZMA 4E51A 4KXWA 4ZOLF 5EXEA 5IBCA 1CLUA 2WD8A 4OBXA 5IF9A 2PMCA 1FYVA 3B3QA 3ZS8A 2IYSA 4DIFA 2GPAA 2B61A 2MR5A 5EWMA 1TMKA 1H9CA 4FTWA 4PCAA 2H4ZA 3FFXA 1DMRA 4JLMA 2DVMA 1A2BA 1BGXT 5DYNA 4NP6A 4LF9B 1ECFA 1H4QA 1I2DA 1ZL0A 3AHGA 2EZ8A 3OE7D 3OX1A 4WNAB 1ZKDA 3HEBA 2PH3A 3B82A 3PUWA 4EKIA 4DLXA 3AVPA 3KYDA 3VHQA 1GGFA 1K7YA 5F1OA 4LMPA 2XNDD 1EK2A 4F3TA 4FYJA 3ESRA 4HPWA 2C83A 1P5FA 3CRNA 2HMVA 1RS0A 2C7VA 1DAIA 1NI5A 4A6EA 4RKYA 4KE6A 4DAOA 3HK2A 1R8QA 3NIGB 3NDRA 2NUBA 5G40A 3TO5A 3H5RA 1FTSA 1M7BA 1PJAA 4YJ2A 2OV2A 5DMHA 2AD1A 4RCVA 1MA3A 3V4FA 4ZJZA 1MZPA 5HRUA 1YIOA 3RC2A 1IE3A 3IR5A 5FUXA 4PQGA 1GGEA 1A2OA 3H11A 2KYRA 1KBQA 1W19A 3B12A 3L7OA 3EBLA 3IO5A 4LMRA 3GGGA 4KIWA 5D3MB 1PF7E 1WLYA 1XNRB 3BGVA 1SVLA 2EIXA 2VHTA 3R9XB 2J3MA 5H4GA 4WVLA 2WNSA 1ZD3A 1T4DA 2RGDA 4MEAA 4U0JA 4Y2XA 1MZVA 3HB9A 3VI4B 4CM8B 2QN7A 2W2LD 5BV0A 3ORSA 3REOA 1EESA 1UDCA 1NMSA 4GBED 4YWJA 3VYSB 3JQFC 4EPVA 4KVGA 4MK4A 1NL3A 1YR9A 1MV5A 2YXBA 3MQ4A 4G63A 3ROMA 4P33A 1A04A 1SD2A 4K3VA 5AWFC 1JXQA 4BNXA 1VHWA 5EE9A 3H65A 3BN3A 3V7WA 3AP2A 1RDFA 3H1BA 4FZ5A 2QV0A 4RA6B 2QNIA 3CFYA 1GZ7A 2QN1A 2Q0HA 5FTNA 2QJTA 1EXDA 4CIBA 3LRXA 1IZZA 3B1JA 5J47A 4KGVA 4ZYVA 1J07A 2DUJA 3JARB 1OXVA 3ESZA 2D7CA 3AU9A 4ZMRA 1FUUA 1PGNA 2VJPA 4MDHA 3L7YA 4FNOA 2ZSHA 4UBNA 5T4FA 3GNSA 3KAKA 4PHHA 1CC1S 5E7JA 4WAUA 4F6RA 3Q9LA 2BUCA 2NAPA 3HUEA 4ZOAA 4BO4A 1QUFA 2ISSD 2B8EA 3LHDA 4V03A 3ONFA 3IT1A 2BP7B 2IU0A 4ZO8A 4KWTA 2FDXA 3DBOB 4QULA 3P71T 3JAKB 2JKYA 4EKGA 1F0NA 3Q8XB 3AVYA 1RRGA 2C2XA 1EBUA 2WU8A 3HDVA 2L19A 1WNTA 3HJCA 2DYKA 4PGGA 4UMEA 1NWCA 2VDNB 3OSUA 2EJUA 1XVTA 3K35A 4JJ7A 4N12A 5BMVA 1UJ5A 1RLJA 2K87A 3FF4A 4XIYA 3RRMA 2BFNA 1TEVA 1C9EA 1LW7A 1RBYA 2FSPA 4PM4A 5EUMA 3TTWA 2DFDA 3A31A 4C9BA 1KH1A 3U5TA 4WNAA 2VHYA 4DSNA 2ZRPA 4RU1A 4XLTA 3VZQA 2PQ0A 4YP7A 5ENZA 4B4UA 3IA2A 1ZSYA 1CJVC 4J91A 4AJ2A 1C8LA 2PRKA 1U7UA 1HQDA 1QHGA 2EKQA 2P6PA 4AQDA 3LZDA 4J03A 1I36A 5HCNA 3VR5H 3KWJA 1N6PA 1LNSA 1EK6A 4URUR 5C4IA 3Q8KA 2QP3A 1E3IA 1US8B 3TZEA 5CVUA 4W5NA 5LJIA 2CUTA 1YZHA 3KUKA 3BFXA 2RG1A 4ZVMA 3HZOA 2DZDA 3W2HA 4ZQCB 1ESMA 4OXYA 1J24A 1OROA 3BWDD 5FYQA 1Y3FE 3HABA 3UCFA 4NBSA 1NU6A 4X7BA 3NHFA 3RAPR 5K0CA 3EZ6A 1U02A 5IKPA 1QG4A 3IDZA 4RAOA 3B9BA 2OMKA 4KG7A 1ZJZA 2DLNA 4OXKA 3S3TA 3VUEA 4JN6B 1RYZA 4CM8A 2FW6A 2D3WA 4H9GA 2GWHA 4J0FA 4V2UA 1K8YB 1JNXX 2I6FA 4JKOA 2WABA 3AFOA 3GEHA 3ZQUA 5FBQB 1JDUA 3HEAA 2VPIA 621PA 3IBFA 4LKRA 4XM2A 1IUOA 3MT9A 5J5VA 2I62A 4IHJF 1F2DA 3LT2A 1E9EA 5DDIP 1FJXA 3Q6NA 3IAAA 4HUJA 1EGAA 3UJPA 1Q1NA 1WEHA 3S2FA 4FOOA 4EKYA 5CDSA 1V3UA 3IO3A 3PPXA 3G82C 1ADFA 4HDMA 4N5DA 4TLEA 5C7IO 2J3KA 4UQLA 5ITWA 4KACA 3JARA 4TMYA 3T35A 3I3OA 4RZIA 4BQPA 2BT4A 1IIRA 2PKQO 3N2GB 2YWCA 4ZREA 2JH9A 3VYTB 4A5OA 4AI6A 1SWVA 2UYYA 4QD3A 2RCYA 3W6OA 2W37A 2SBTA 2ZUBA 3PHIA 4ZQFA 4ZI2A 1SUEA 2EX1A 2OZLB 1H2EA 1Q1AA 4MI6A 4BNKA 5HOEA 4V1CA 5K3OA 2BP7A 1JN0A 2IY7A 1AS3A 2FMKA 1E3EA 3ZGXA 4CQLB 2HB6A 2XE4A 2HL6A 3B1YA 5J4VA 5B3KA 4AKHA 4G1CA 4L72A 4TXJA 4L5CA 4RY2A 4WOCA 3HKDA 4QEKA 4EVSA 5GZ6A 2ZIZA 4LJ7A 4K9DA 4RSMA 4BP1A 4YDRA 1DAKA 2A5JA 3F2VA 1JHDA 1YOVA 3SHVA 3JQBA 3WY9A 4P4SB 4ZAYA 1OBVA 1TYDE 1FNBA 4IS2A 3I9KA 1I6KA 3HGMA 2C2ZA 2RE8A 1MO5A 2RH9B 4Q3LA 3B1XA 4EK9A 4B4VA 3EVBA 5DU2A 4S0ZA 2QZ9A 1VI5A 2J5XA 3C8MA 3TSZA 4Z1MD 4BRSA 1XPOA 1GV1A 2G5GX 3QVTA 4KUHA 1M8FA 3TW0A 1NI4B 3WHKA 5D3ZA 3AY6A 1PEDA 4Y98A 3QMMA 3O0DA 1JR3D 2VLIA 1E2JA 2GZ2A 1E99A 3JY6A 5DX1A 1QHNA 3UG6A 3QITA 4B2PA 2NO9A 3MNFA 1YJQA 2RGWA 5ITZA 2OV6A 1UP4A 4X84A 1US8A 3ZKWB 6Q21A 2UYOA 2KI5A 4EA8A 1EQAA 3OO0A 2ANCA 4IGKA 1JSLA 1W0JA 4RVCA 1V2GA 4LXXA 1EWRA 2QTTA 3STWA 4XLZA 4Z3DA 2JAWA 1RHQA 2W90A 1ISRA 5CFQA 4CE6A 1GPDG 4HRYA 1D8AA