5JDCA

Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 91
structure length 248
sequence length 267
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdcA00
3S2EA 3K96A 5TT0A 1LXCA 4RVGA 1KEUA 1IE3A 4RVFA 5COQA 3GDGA 1KYQA 1HE3A 1V3VA 2WWRA 4G81A 5JXWA 3DL2A 1PJ2A 3I9OA 5TLSA 4BO5A 3ABIA 3I1JA 4NH4A 4WPGA 2GO1A 1E7QA 2H5LA 4XB2A 3HDJA 4BNTA 1Y8QA 1LI4A 2PGJA 2GERA 2CMDA 1N7GA 5JO0A 4ONEA 4BKOA 4J91A 4ALKA 1EQ2A 3TFOA 4M1QA 4BNHA 3OA0A 1LX6A 4A2CA 4LGVA 3P2OA 3KHUA 2ZQZA 2YFQA 4CM4B 2Y68A 4E5KA 1NHGA 4OQZA 4J1QA 2C07A 3K31A 2IE0A 1E5QA 4K9DA 3ZU5A 3OJOA 1VL6A 2OUIA 4J4BA 1JAYA 3OIDA 2HRZA 2OGUA 4HBGA 4RL6A 4IIVA 4DLLA 4J0EA 1XQ1A 2VT3A 5G4LA 1XU7A 3C1TA 1XYGA 4GGOA 1J6UA 3GMSA 1CQIA 5A9SA 5AOVA 4GL4A 2WSBA 3C1OA 1WDKA 4KTTE 4YJGA 1SO8A 1UP7A 5KIAA 3B1KA 1IB6A 1IHYA 3FR7A 3SX2A 3V2HA 3TZCA 5C7LO 4N7RA 3NDJA 4OOFA 4HFRA 2WYVA 4H16A 1P1RA 1DLJA 2NVUA 4QT0A 4R54A 2NU8A 4B4UA 4XYEA 1LSOA 1ULUA 3V5NA 1PJTA 3WGHA 1CIVA 3BMNB 3LK7A 1U8XX 3HNPA 3IAHA 3I9MA 3LYLA 1U5AA 1ZBQA 4D46A 5JYDA 4M89A 1DC3A 2C2XA 1HE5A 4PLPA 2AA3A 4UVGA 1IYZA 4D3FA 1EVZA 2JL1A 4GMFA 3GA0A 1DHTA 2DU8A 2UVDA 3ETDA 1SOVA 2YW9A 2FHSA 3WFJA 1HDCA 4XYBA 2B4QA 4MDHA 3MWDB 1SMKA 3OIFA 4LCJA 4L9RA 1B14A 1NQTA 4RVHA 1S6YA 3MJ4A 2Q50A 4YRBA 2VUTA 4LK3A 3E03A 2BELA 3H9EO 4FPXA 2DTEA 4PLHA 3HWRA 2ZCVA 3DFZA 1KETA 5B4VA 3GRPA 5DBFA 4W6ZA 4HXYA 1QR6A 4UEJA 2HMTA 4W99A 1GCUA 1I3NA 1YQDA 1CDOA 1HZJA 2Y0EA 4RF4A 3WDSA 3ZWAA 4CMBA 4D7AA 2R00A 4I9NA 1I5RA 1MG0A 3BA1A 4PLTA 1WW8A 2D5CA 3AFNA 3OBBA 2QRJA 2AEFA 2Y1OA 5JDCC 3WTCA 3F5QA 3JQGA 1EMDA 3Q2IA 4U5QA 4MVJA 1BHSA 3VTFA 2VQ3A 2H1SA 3DQPA 4AJ2A 1BXGB 1TT5B 3GRKA 4W9NA 5KCZA 5JDIA 1UUFA 1X1TA 4YB8A 3ZCXA 4AJNA 4BNXA 1IL0A 1U8FO 3HZZA 4OIMA 4XEHA 1A5ZA 3I9NA 4IQGA 3WGIA 1ISIA 3WR5A 2HDHA 2CFCA 1Y1PA 4CR7A 2EF1A 3ZNQA 1NM5A 3HB5X 5T67A 1O5IA 4RDIA 5B1YA 4CL3A 3W8DA 2VHWA 3PIDA 4OXKA 1UDCA 1X7HA 2NM0A 4QFDA 1MXFA 5CFZA 2PZJA 4FSHA 4MP8A 3AY7A 5FI5A 4FFRA 3GG9A 1QLHA 4IDFA 5J23A 2GRAA 4KMSA 4XYGA 4Q39A 3KB6A 3EMKA 2AG5A 3E48A 5KJFA 2B37A 3GDOA 2OORA 1F14A 2SCUA 1N5DA 3NEPX 1QYXA 3RC9A 3ZHYA 1I32A 2GASA 4DPLA 4DQVA 3FF4A 5B4UA 4JLWA 3GAFA 5TQVA 1HDGO 1KVRA 4A27A 3C3XA 3KSDO 5MDHA 4UUNA 3PJDA 3AJRA 2XXJA 3TDKA 1DDOA 4R69A 4UVIA 5TC4A 4RZIA 1BW9B 1A4UA 4IGFA 1JKIA 4E5YA 1LA2A 2UYYA 2VZ0A 1SBYA 1O8CA 3PJFA 4ALIA 1XIVA 4C4OA 3D3EA 3RFXA 1VE9A 2W4QA 3U62A 3WOHA 5CAEA 4MP6A 1AXGA 1VM6A 1JU9A 4R9RA 3A1NA 3TZQA 3TPCA 2B35A 3JYOA 4PVCA 1PWZA 4CMKA 1YS4A 3PGJA 5I7SA 3PI7A 3RU7A 1AGNA 2JFHA 2X9NA 4IUYA 1H93A 4PLFA 2EIHA 3BTVA 5A3JA 1HYHA 2J3KA 3GVIA 5ENVA 1E77A 3LDHA 5HTOA 4JXKA 4HFMA 5AVOA 3ZH2A 4KTVE 4P4LA 5TIIA 1PJBA 3DZHA 3SEFA 4RQUA 4F45A 4ZQHA 1UJMA 3QE3A 1ONNA 4AJJA 4IJKA 2A92A 2EJVA 4K28A 3SC6A 1PR3A 4CLEA 5F5LA 5H83A 2EP7A 2EW2A 2H6EA 3EK2A 4R1UA 4XQ9A 3F6YA 2YYYA 5U4QA 5COAA 1PL8A 3BMNA 4JROA 3V1YA 2C7VA 5TS3A 3G49A 5HS4A 1N92A 2ZTMA 3R3SA 3RJ5A 3I6IA 1LU9A 4GKBA 5JC1A 1H2HA 4MKRA 1E7SA 2GN6A 4A03A 2C82A 3DC2A 5KVCA 1NPYA 3W4IA 4YAEA 1GADO 3IUSA 3IP1A 4TWRA 5BNIA 5I9MA 1ULSA 1BGVA 3RCBA 3FD8A 3WIDA 1T2DA 2FR0A 3ULKA 8ADHA 5BNFA 3K73O 3BMQA 3MJEA 3Q11A 1PGJA 4CV1A 4CMEA 2A4KA 4NJOA 2NWQA 2C20A 4TVBA 2P2SA 3MJSA 4DMLA 1Q7CA 2XAAA 2R2GA 3Q0EA 1BXKA 1O0SA 1X13A 5CHEA 3F1KA 3PQFA 5CDSA 3WS7A 2QRLA 2BKAA 4CV3A 2PLAA 4BNWA 3DOJA 4WLVA 4S1VA 1C1XA 3DEYX 4R68A 5JAMA 3VH3A 4B79A 1J49A 1TLTA 3TF5A 3OJ0A 4XDYA 2B5WA 4XCVA 3GVHA 3I4FA 3CZRA 3ZWYA 2Y99A 4JBGA 3H9UA 4RLSA 2GDZA 3GVXA 4UUMA 2CVQA 1BXGA 1TT5A 5AXAA 1IOLA 2DBVO 4A10A 3W6UA 4CODB 1KVSA 1I30A 1U4OA 1A4IA 2GUGA 3ZWOA 5CDUA 2X7HA 2B69A 2JCYA 1ZW1A 3JQDA 5TRTA 3CE6A 1VRWA 3CKYA 1O95A 1DBVO 3MCVA 4INAA 4N5NA 2GLXA 3RKRA 2Q4EA 4A73A 1P77A 4XR4A 1ZEJA 1MP0A 3M2PA 3PFWO 4PG7A 2JD2A 3DBVO 3TRIA 3NDRA 3ONDA 5TGDA 4TRNA 3SC4A 3WQSB 4YAGA 2VYVA 4R1TA 4NQZA 3RUHA 5HBRA 1NHWA 3ZNOA 2NVBA 1KC1A 2I3GA 1NNUA 3FNGA 3H9JA 4ID9A 1SOWA 4E5NA 4R51A 3PFFA 1EEHA 2BFOA 1HSOA 4GX5A 4I1IA 2FP4A 4OO3A 2VHZA 1ZK4A 1B3BA 2IZ0A 2I66A 4X54A 2VTDA 1GAEO 4I8XA 3MJVA 3RI3A 2ZB3A 4GLOA 1AN9A 1KVTA 2EKLA 4P4NA 1WPQA 4WEOA 4BNVA 4D45A 3A9WA 1C0LA 3L6OO 1GR0A 1S7CA 1UZLA 4AJHA 1B8PA 3C8MA 1MA0A 2E6UX 4NPCA 4NR0A 1I0ZA 1Q2XA 1PQPA 1BW9A 2ZYGA 2FWMX 3F9IA 4DA9A 4XJTA 2O3QA 5JAZA 2WE7A 3L4BA 4EJ0A 2X5KO 1RKXA 4FFNA 1VJ0A 2GGSA 2BI8A 4RVUA 2HLPA 3NGLA 3FWNA 4Z3DA 1P45A 3WSWA 2IEBA 3EYWA 3IOYA 5A5FA 3AFMA 2HMSA 5GMOA 4R3WA 3OM9A 3H2SA 1JLLA 5DP1A 5F21A 2DTXA 3W1VA 3F46A 3I23A 3AU8A 3AK4A 2BH9A 4J7CA 4FJ1A 3QA9A 5EINA 1GUYA 4HWKA 1O9BA 2G0TA 2W2LD 4PLWA 2X0JA 4ZQBA 5A3VA 3AUSA 4B8ZA 3MTGA 2FR8A 3VAZA 4FN4A 2O4CA 4PRKA 4FR5A 2YHIB 4P38A 4DIBA 4NFSA 2HJRA 4UREA 4D79A 4CUJA 4F6CA 2X23A 3OHSX 1UXJA 1IUKA 3KEQA 4DBZA 2OP0A 1WMAA 2EEZA 1PQWA 2NU9A 1GTMA 2HKIA 2HAEA 3FN4A 2O7SA 2ZTUA 3RUEA 3DTYA 3FHLA 2Q1SA 1E3SA 1R16A 2Z1NA 4G65A 2BI7A 1R12A 3A06A 4KWHA 3GH3A 4QEDA 4IS3A 3V1UA 1D1SA 2PZKA 1NPDA 3EC7A 3QLJA 1XCBA 4DC0A 1DRVA 1T2EA 1KVQA 2P5YA 4UUOA 4II2A 2PGLA 3AM3A 2UUPA 4ZRNA 2W98A 4OJNA 1SCUA 5CPFA 2Q45A 4NU6A 5JO9A 3RUAA 3S2GA 4Q9NA 3ZN2A 3C85A 4ZICA 3T7CA 2FY8A 1R15A 2Q1WA 1EE2A 4CM3A 2PV7A 3O38A 5DCWA 2CUKA 1GEGA 4WLFA 1YVEI 2GNAA 3ADOA 4K1LA 3S55A 4NK5A 3IJPA 4PZCA 2W90A 3GK3A 5TNXA 1FDVA 2Q2QA 2PD6A 3ZWWA 4BNUA 4XIYA 4XQGA 2DTDA 1E3EA 4XD2A 4Y9DA 2BF7A 2YZ7A 4IIUA 3SBOA 3KM0A 4ZJUA 1H2BA 1TVEA 3MWEB 3M1LA 3GNTA 3W6ZA 1XR3A 4XGKA 1F17A 1DAPA 2PZLA 3LC2O 1LLDA 1Y5MA 5GZ3A 5L4SA 2GCGA 4QQRA 5THKA 3WLFA 4E5MA 2ET6A 1UAYA 6ADHA 2ZJ1A 5AXCA 1PGNA 4CQMB 4H7PA 1BVUA 1BVRA 1F8GA 2EW8A 1R4MA 4K26A 5G0VA 3S1LA 1JN0A 4BQPA 3FTNA 2DT5A 4I5DA 1YQGA 4R01A 3IC5A 5T57A 5JC8A 2ILTA 4L75A 2VZ8A 1IY8A 2CD9A 1RM5A 2EP5A 2IEDA 4J16A 1BMDA 4CUKA 1E0DA 1SNYA 1F12A 2ZB7A 1PJQA 3UKOA 1D1TA 1EK6A 4CM8B 2GZ3A 2O4UX 3NT2A 4IS2A 3NJ4A 3RU9A 1CJCA 3L9WA 3PLNA 3JD4A 3Q3CA 4Z9YA 3OP4A 1GL3A 4D3SA 1EFKA 3ZWCA 2AQHA 3DAGA 3U4DA 1D4FA 5JYEA 4HFNA 4XIJA 4QECA 2Z95A 4O59O 3JYNA 1I36A 1B16A 3IQDB 2LDBA 2YDXA 4AFNA 5JDCA 3B1FA 2CSUA 1O6ZA 1PTJA 4Y98A 5HRUA 1XGKA 4IXTA 2YY7A 4R4JA 4D0RA 1X7DA 1WWKA 3TOXA 4BNYA 3O03A 1YJQA 3HFGA 3ZW9A 3E5MA 1X15A 4N18A 3EDMA 1M66A 2Y05A 4S3MA 4MVJH 1TI7A 1A7AA 1E3IA 3I9JA 1X0VA 2Y66A 3KLMX 3WYCA 2VNSA 5BSGA 2DC1A 1T2FA 3PTZA 4ND3A 1DSSG 2V6GA 2P9EA 3D5TA 7ADHA 2IYOA 3F47A 3JQAD 3VZQA 1SC6A 3CXRA 4NK4A 1WP4A 1ISFA 1ORRA 4D42A 3LLVA 4BB5A 1EBFA 4O1MA 4G5HA 4KQXA 4W4TA 2VUSA 1EVYA 2PD3A 3PZRA 4FCCA 3G17A 4JGBA 3SLKA 1NFQA 2DLDA 2AE2A 2YHIA 4MVJD 4WOJA 4BGVA 4E3ZA 3OFSA 3U4HA 5F5NA 4GVLA 4KP7A 3IUPA 3ICCA 3QIVA 1NX6A 3VOSA 1U3WA 4D3DA 3GGGA 1UXIA 1K6XA 1ZXBA 3AY3A 3JQ9A 1M75A 2VYNA 4JBHA 1ISHA 5KVVA 4CUZA 3D0OA 4A26A 4R9SA 3RIHA 1NVMB 2CDCA 1TEHA 2JKVA 4J0FA 3S2IA 2X5JO 4ROSA 2AW5A 1IULA 1AHIA 3WICA 4FOOA 3NAQA 4JCOA 1IZ0A 1W4ZA 1GD1O 4FJ2A 1X14A 1ARZA 3F1LA 4DC1A 4UEOA 1O89A 2GD1O 3TJRA 2I67A 1KERA 1HF3A 3JQ8B 1MUUA 1ZKMA 3WBFA 2WE8A 4B7UA 5GZ6A 1OAAA 4QFCA 1ZK3A 2F1KA 5HM8A 4PLZA 3HN7A 1HYEA 4MP3A 3ANMA 1YE3A 3RBZA 4H15A 3ZV6A 1A9ZA 2IRWA 1V3UA 3RKUA 1DPGA 1Q7BA 2PTGA 1Y9EA 3GGPA 2YQ5A 3L6EA 4RO0A 4TMFA 1R66A 5FI3A 3VTZA 3ZWMA 4LSWA 5EN4A 5I7VA 2AQ8A 1Q0QA 1YBMA 3P5SA 1XKQA 4KUEA 1HSZA 1FXSA 3GFBA 1M76A 1V3TA 2P68A 3IP3A 1BTOA 4OKNA 4NG5A 3UOGA 2OFPA 3MEQA 3GEDA 5DDIP 4MINA 4BNKA 1HYGA 1I24A 3SLGA 4CQMA 7MDHA 1PGOA 3UCFA 3OECA 4B3IA 1KEWA 3BHJA 5AQ1A 1C0PA 1SZJG 1HWYA 3ETGA 3UCXA 1ZVMA 4FDAA 4CLHA 4CM9A 3BTOA 3ENKA 3BTUA 2C29D 4CLRA 4GX1A 4WLNA 1W0CA 4NBWA 4CL8A 3JQ7B 4FQ8A 2WEKA 3QVSA 4OYRA 3GN1A 3C1AA 4MVJG 3ZW8A 1JKJA 3DMTA 2FPIA 1KBZA 2NV6A 2P4QA 4CM8A 4AJLA 1R6DA 2ZKLA 3GC6A 3NV9A 3PJEA 4WCFC 5JE8A 1E6UA 3VPXA 1B15A 2ZCUA 2BMAA 3BTSA 3LT4A 4LRTB 4BMVA 4YAKA 1NASA 3RJ9A 3JD2A 3JQBA 1ISGA 4NMHA 4DPKA 3C7CB 5KJCA 3WQQA 1N9GB 1DIBA 5CPBA 3OICA 1UXKA 5L4LA 1GZ4A 2WD7B 4WCDA 5JFOA 4ND1A 4YXFA 3DBRB 5F1KA 3GUCA 1PIWA 4MIYA 1HXHA 4BO6A 3V1TC 1DFHA 3A14A 1XU9A 2IYPA 3CMMA 4AJKA 3ZDFA 4IZIA 4CMIA 4Z6KA 3QWAA 1H9BA 4FFPA 4M86A 3OJLA 4E2ZA 2D8AA 3P7MA 3VZPA 2RAFA 3DHYA 1R4NB 2J5KA 1QP8A 1ZO8A 1YXMA 4DREA 4R41A 5DZSA 1HLDA 2BFMA 3WMWA 4E2XA 4ZN6A 2YV1A 2AQKA 3VVCA 1PGPA 1M6WA 4HX5A 5JCJD 1EBUA 1P3DA 2W2KB 2ZJ0A 3O9ZA 5G0UA 2Z5LA 4GSKA 3KBOA 4R16A 5IZCC 2PH5A 4YJHB 3SVTA 2QZ9A 3INTA 3E9MA 1DAOA 3W8FA 3U49A 2E37A 4NBVA 3PGXA 1KEPA 5I7FA 5IDQA 4JJGA 1HEUA 3GEMA 2EKPA 4CQLB 1PGQA 2Z1MA 4IJWA 1ZXLA 4YRDA 3I3OA 1EQUA 3AW9A 4B4OA 3PJGA 2NU6A 3VPSA 2JCXA 4BO7A 2X0NA 3DHNA 1HDRA 3DZKA 3IKVA 4XYLA 1FDWA 1RYEA 3UN1A 4N5MA 1GQYA 2OO5A 2W8ZA 3H6KA 3NJ8A 5IZ4A 4NBTA 3ZU3A 4HY3A 3TNLA 4OXNA 1T4BA 4FS3A 1YB1A 3D7LA 1ZK0A 4IY1A 1U3VA 3GZNB 4Q3DA 4Q3EA 1YONA 4OQYA 1VJTA 3E9QA 4WJZA 1JVSA 1H9AA 1ONPA 1GDHA 1JWAB 1UZNA 1B2LA 2VYVD 3QVXA 4J1NA 3Q9UA 3UFXA 1LUAA 2HMWA 2Q99A 1DRUA 5JAIA 2VRCD 4OMUA 6LDHA 2NADA 3DZFA 4WASA 1VL0A 2DQ4A 2ZYAA 3PXXA 1Q0LA 3SJ7A 3OMLA 1B0AA 3JQ8A 3BIOA 1ISMA 3PZBA 1I2CA 4NBRA 4YAJA 1HL3A 3NX4A 2VCYA 3ZHXA 3L9XA 4NI5A 5A4DA 4W82A 4D44A 1PL7A 3GLQA 3SXPA 2VT2A 3HB4X 4R1NA 1GFSA 3W4JA 1T24A 4BNZA 5IXSA 2X0IA 1DLIA 3T4XA 3HN2A 4TROA 1DO8A 4DGSA 4Z0TA 1FK8A 2DBRA 2CY0A 4PZDA 4MKXA 1DHRA 4XJSA 4XRRA 4E21A 4JN6B 2CF6A 4CMAA 4CMJA 4BNLA 1N1EA 1PJCA 4CR8A 5ILOA 1XA0A 3L77A 1HTBA 2X86A 1P74A 3N7UA 3QWHA 4G2NA 1VC2A 4Y6RA 4GMGA 2Y1CA 4L8VA 5IN5A 1D3AA 1N7HA 3KV3O 2RH4A 1C3VA 1J5PA 2BRUA 5F1OA 4J2OA 3A4VA 4ZRMA 2FR1A 2VHXA 3ZWPA 3K2BA 3VHRA 1EDOA 5TF4A 5BT9A 4DYDA 5CG2A 2Y67A 3DBHB 1DFIA 4CM4A 4YDRA 1U5CA 4MVJI 3DAFA 5BNTA 1H0KA 5I9LA 4B4VA 9LDBA 1SPXA 3RWBA 4D0SA 4DMMA 3M6IA 1LDEA 5G4KB 5DBGA 5GY7A 3G1UA 2V7PA 3JQ7A 4J4HA 5A03A 4L76A 3EW7A 4HV4A 4Q3BA 1CETA 1DJNA 4L4XA 1ENPA 5ENDA 3F3SA 1I8TA 3C7AA 3B70A 4IDBA 3S8MA 3LT1A 4IDDA 4QXMA 3FNFA 1M2WA 3FTPA 2WM3A 2X5OA 4U6QA 1B3RA 2CVZA 3H3FA 3RBVA 3JQFC 5JS6A 1IPEA 2BFPA 3CEAA 2HSDA 2UUOA 1N9GA 3R6DA 3GVCA 4FGSA 2BGLA 1NXQA 3E8XA 2WD7A 3ZNPA 1K0UA 1OC2A 2FSSA 3NUGA 3DBRA 4GKVA 2GN8A 2ZTVA 1PSDA 2GR9A 4HP8A 3EAGA 2V65A 3D4NA 4EJMA 2UAGA 5EERA 1YO6A 3AU9A 4Z9FA 2GN4A 3QW2A 5KOIA 4XDZA 1EFLA 4CV0A 2YJZA 1MV8A 4AICA 3PVZA 4DXHA 1XWFA 4Z0PA 3DB2A 4ALNA 5L7WA 1R4NA 4IMPA 3DBLB 4CMGA 4U8GA 1L1FA 5G0TA 5CEFA 1ZNQO 2GN9A 3INRA 1ZZEA 2JD1A 1E1MA 3TQHA 2Y1EA 4NDNE 3U9LA 4LMRA 2W2KA 4LRSB 4BNMA 1YDWA 3D1LA 2D59A 3VH2A 5CP8A 3T4EA 1N1GA 4O63O 1PJ3A 1UDAA 1E7WA 2A94A 1UDBA 4YJHA 3K2EA 4MO2A 1ADFA 2XF8A 4WOKA 4MOWA 3HDQA 1TT7A 4FD3A 4NNJA 3WXBA 2CDBA 5EQFA 4HADA 5A02A 4I9HA 3EVTA 2GYYA 4CQLA 4M55A 4AJ4A 5JW6A 3I9KA 3TL3A 4E30A 3C7DB 2X0RA 2EGHA 1DIRA 1NR7A 1JDJA 2O48X 3LC1O 3OQ6A 1SAYA 5IF3A 2V6FA 1JAXA 3OA2A 4RV9A 1V35A 4GGPA 5I8WA 3H8VA 1OZAA 3M1AA 5HWSA 3EUWA 4KUGA 3ZU2A 1YQXA 2D4AA 4JNKA 3ZWVA 3VPHA 3DWFA 4Y67A 2FSVA 4J1SA 1EZ4A 4RORA 4PRLA 1QYWA 3O26A 4YT5A 3MJTA 3JTMA 1ADGA 1E6WA 3RROA 2AEJA 4OH1A 3ZV4A 3WGOA 4BQRA 2E82A 3ADPA 3ASVA 3AUTA 1DIAA 1JW9B 4QX6A 4N54A 1IZ9A 2ZB4A 1H6BA 4XB1A 1U4SA 2OHXA 1OC4A 1O94A 4L73A 2WJPA 3H5AA 2V6BA 3GPIA 4PG6A 1T2AA 1GQ2A 3UHAA 1EE9A 3FPCA 5JLAA 1DIGA 1RYDA 3WIEA 5KNLA 4YT4A 4EYEA 2VWHA 5BQFA 2D0IA 4RF2A 1QXSA 5B12A 3BMOB 5G0WA 4CM6A 2VOJA 2ZATA 4I5FA 3JYQA 1G6KA 1P44A 2Y1DA 4GLLA 3WFIA 2O2SA 3IDSA 5TSDA 3TZKA 2PFGA 1DC4A 1P1FA 2VZ9A 4IDAA 1YWGO 5BR7A 3ASUA 9LDTA 1YGYA 5L7TA 3U4CA 4I5EA 3PP8A 3FNHA 1E3WB 1ZMOA 3B1JA 4O5OA 3INGA 2CZCA 2GSDA 2X4GA 3ZWXA 5DULA 3ITDA 1C0KA 3LF2A 3KSZO 1T26A 2R00C 2JHFA 1NTOA 3RFVA 3O4RA 3PLRA 3H65A 4P4GA 4TZTA 4WGGA 2QQ5A 1E5LA 1MGOA 3DBHA 3KVOA 1B26A 3KYCB 3PYXA 1E7RA 3G0OA 3GR6A 4ZVVA 5BSEA 4NU5A 1YL7A 4BO9A 4QUKA 3CTMA 1GQQA 5ER6A 4EEXA 1D7OA 1Y8RB 1LTHR 1QV6A 5G4KA 4DTIA 4OL9A 3V2UA 1YH3A 5A05A 3UGKA 3GVPA 2GZ1A 4DIOA 1BDMA 2P5UA 3JQCA 1PJ4A 1VSUA 3BZUA 4TRJA 4E0BA 4RF5A 2VYND 4EITA 1KIFA 2RHCA 1WAMA 4WNCA 4KUHA 4JJFA 3UICA 2QZZA 3H9QA 4J4TA 4A5OA 5AXBA 1NYTA 1FDSA 1X0XA 4GBJA 3V8BA 3IMFA 2P9CA 3OJFA 5IXYA 2XPCA 4DL9A 3TOZA 4WECA 3KLPX 4PLCA 1RPNA 3OIGA 4XX0A 2VHVA 1ZCJA 1E1KA 1Z73A 4ZQEA 4L4SA 5I8ZA 5L3ZA 3AY6A 3I9LA 3DBLA 1HDXA 1NWHA 1UR5A 3LT0A 4LMPA 1DJQA 3RVDA 4IDCA 4NJMB 2IXAA 3D5QA 4UAGA 3PWKA 2HMVA 2WYUA 5EPOA 3O8QB 4II3A 1I10A 1K6JA 1FMCA 2NTNA 3V2GA 3WNVA 1LNQA 3HFSA 1LDNA 1LC3A 1GPJA 3ICPA 4LVCA 1YOVB 4YCAA 5DN9A 1MC5A 3ONFA 3PHHA 5TT1A 3UF0A 1PJSA 3ZWNA 2TMDA 1RJWA 5KVSA 3PWSA 1E7MA 2HCTA 2R6JA 3GN2A 3TZ6A 3JCZA 3JSAA 5ITVA 4CQMD 2NUAA 4D43A 3WJ7A 4YBZA 5ICMA 1E92A 1LEHA 4EDFA 3VKVA 4MPDA 2B4RO 3B6ZA 2VOEA 4CM9D 1XHLA 4YA6A 4YEDA 1ZUD1 2I76A 2POQX 1PS0A 5L9AA 1U7HA 4ND5A 4OSPA 2Q1UA 4FFMA 4BKPA 2DPHA 2Q2VA 5L51A 1E3JA 2X6TA 4CM7A 4UVEA 4CR6A 1XLTA 3KSUA 5JSFA 4URFA 5H81A 4XGIA 1WXDA 3HJAA 4OSOA 5ADHA 3CINA 4OAQA 4DLAA 4MVJF 3RUDA 2E48A 4EI2A 2HU2A 1ADBA 2I6TA 3L4SO 1QYVA 4IMRA 5IZCA 3GF4A 1OMOA 4Q3NA 2I3AA 3DDNA 4AL4A 1Z82A 2G82A 3ANNA 3K5PA 1R37A 4D41A 5JY1A 4QSMA 1GYPA 3VDQA 1MC4A 3U5TA 5L45A 1PS8A 2AQIA 1BSVA 1KC3A 1JKFA 1HRDA 4PGFA 1BXZA 1U7TA 2YFHA 3CUKA 3I5MA 3MTJA 3BAZA 1MFZA 3U4IA 1MB4A 3NT4A 1QV7A 3N58A 4DQUA 3VVBA 4F46A 1GZ6A 3RC2A 1EVIA 3Q1LA 4CMEC 2Y0CA 3JQEA 1NP3A 3BHIA 5A9SB 4J9UE 3AM5A 2FN7A 3OQ1A 4YJGB 2Q1TA 4AG3A 3KYDB 4JJIA 1E3WA 1DC6A 3NKLA 3DZGA 3U0BA 1H94A 5FFFA 3D3WB 3ZHZA 1QLJA 5AYVA 1GV1A 2C0CA 1FF9A 3QSGA 2FOIA 4MKZA 1OFGA 3U3XA 4JIGA 4L74A 1JVBA 1X7GA 1YB5A 5CEJA 2VTEA 1SEVA 4GSLA 2A35A 3HADA 4BOYA 3KYCA 1XELA 4WKGA 3GEGA 3AI1A 2JCVA 2EJWA 1JWBB 4CLXA 1NAIA 1R0KA 1OOEA 1Y7TA 3GY0A 1NQAO 4GX0A 4GWKA 2QRKA 4DYVA 1QG6A 4QTZA 1K2WA 1F0YA 5C7OO 3CH6A 2D5AA 3AWDA 3GGOA 4PLGA 4YTEA 3WGTA 2X1HA 1VSVA 2H9IA 1NBOA 4BO3A 1B8VA 5LC1A 4FGWA 3GG2A 4BIIA 1EDZA 3LSYA 4YACA 5IDWA 3WB9A 4CM1A 3IS3A 1YRLA 2TMGA 1PJLA 3UAGA 2NSDA 3E5RA 1QKIA 2DPGA 4R5HA 4CMHA 1V0JA 3VKUA 3JQAB 3WWZA 2AEMA 1VL8A 2C54A 3KYBA 2LDXA 4L0QA 4Y8VA 3RAJA 1HDZA 1YBVA 1PL6A 4AJPA 1T4DA 2VWPA 4BO2A 4AJOA 3JQGB 4J3FA 1GEEA 3FWZA 3BXXA 4NJMA 4BUCA 2DAPA 1UP4A 1K89A 1KEVA 1Y5RA 2O3RA 2VWGA 5IFLA 3KETA 3HHPA 2PH3A 4IXWA 3WX0A 3DAPA 3O8QA 3OQBA 3M2TA 2JFFA 4ALMA 2OBNA 1KVUA 3GOHA 3HG7A 3BYZA 1HZZA 1GPDG 4GH5A 4E4YA 1U9JA 3FPLA 1YOVA 4PG5A 3ON5A 3QVTA 4MVJM 4U7WA 4CLDA 2EV9A 3MJCA 1ENYA 1WLYA 2ZYDA 3W8EA 4J90A 2BFAA 2XOXA 1ZH8A 1LRJA 2O23A 1L7DA 1CF2O 3K92A 4KDEA 3T7EA 3MOIA 3P19A 1LDYA 4B4WA 1W6UA 1Z7BA 4Z3KA 1BWSA 3OETA 4ILKA 3GAZA 3TZHA 1H6AA 2O3JA 4J49A 2P9GA 1HDYA 5FWNA 1SEPA 4UEKA 1VLLA 3DZBA 4ZQFA 3GHHA 3PRJA 4R3NA 2C2YA 4BNIA 1A71A 1L7EA 5JPIA 1LLQA 1GV0A 1MG5A 3GPDG 1WZEA 4YQYA 4IINA 3AM4A 3ANLA 4H3VA 3EZYA 4YPOA 4NBUA 2NTJA 3WGZA 2PD4A 4EUEA 4Y6PA 1XDWA 2EWMA 2GPTA 3ROKA 4YT2A 5L40A 1GYRA 1NVTA 2RHRA 2QYSA 3AUUA 4YR9A 1P33A 1U3UA 2V6MA 2VNAA 3H4VA 4YT8A 3TL2A 4LW8A 4BKRA 1J0XO 4FC6A 4Q3AA 1EK5A 4XQCA 4ND2A 4CV2A 1XSEA 3NYWA 3WYBA 1CYDA 4JX8A 5JNLA 2FZWA 3ZV3A 4F3YA 4OM8A 2EERA 4IDGA 3RASA 1VPDA 3LC7O 1PQUA 3X2FA 4M49A 5G2OA 1D8AA 4BO8A 5EJ2A 3GNSA 3VH1A 3ITKA 1GZ3A 4PG4A 3DHEA 3X2EA 1E1NA 2JFGA 4PG8A 4B8WA 2A9FA 4BO4A 4XRGA 3KYDA 2DUUA 2UDPA 1KS9A 3D3WA 5DCYA 3VZSA 1E7YA 1LSJA 3DMYA 1I2ZA 4BNNA 5ICSA 4IQ8A 4PLVA 2B83A 3KTDA 1NPTO 1RM0A 2DFDA 3FR8A 3AOEC 2IODA 4A7PA 2WTBA 1K6IA 3WQRA 3W4KA 2E4AA 3NRCA 1P1KA 1NVGA 3HSKA 3FSRA 4HFJA 2G17A 2PR2A 2QX7A 2G1UA 2O2YA 1K3TA 3BMCB 5I9NA 1WNTA 3ZNNA 1ENZA 4J2HA 3JV7A 2DM6A 3ZHBA 2NQTA 2C7GA 5K6AC 4RPJA 1MFPA 3H3JA 3PDUA 1I3MA 1UAGA 1VKNA 2HK8A 2HO5A 3BMQB 3D4OA 4LSMA 4BGEA 4BL5A 2FZEA 3QWFA 4AVYA 1H6CA 3GFGA 1PS9A 4BS9A 5DBIA 1ZJYA 2NLOA 5IJZA 3EGOA 5JMWA 2GF2A 2B4TO 2FMUA 1B8UA 1PWXA 3DOOA 4KZPA 4GWGA 5KVQA 1I01A 3A28A 4JP2A 3JQAA 4NIMA 1C1XB 3WMXA 5JY6A 1UXHA 2ZIZA 2X58A 5IG2A 4HNHA 4QO7A 1M67A 5DP2A 3VPFA 2EG9A 2PY6A 3F5SA 3Q9NA 3KOUA 2Q49A 5JBIA 1RWBA 3ZV5A 2DFVA 4ND4A 5FYDA 1LDMA 2ZK7A 4O0LA 2BGKA 5K9ZA 1OBFO 5T8KC 1HKUA 4JK3A 2C59A 2UV8A 1OI7A 3RUFA 4TRRA 3PHJA 1Q7GA 2X9GA 2IDZA 2X22A 2F00A 2FPPA 4BNJA 2VRBA 1AHHA 4RLHA 2Y93A 4IGEA 3UXYA 5IN4A 4PLYA 1P0FA 2P91A 3RUCA 1PR9A 2QIOA 3QVOA 1H6DA 2JAHA 3H7AA 2FRDA 3KUXA 3RSHA 4MJLA 4KDFA 2CF5A 2O50A 3HDYA 4GI2A 4PVDA 2J3HA 3WGGA 3VZRA 3ENNA 1NR1A 4CPDA 1HDOA 4I08A 2EGGA 3NGXA 2BHLA 1ZSYA 3PK0A 4ZHSA 1I2BA 4NFYA 3OH8A 1A9YA 1G0OA 1LQTA 2BD0A 1Z6ZA 2J6IA 4TKMA 3D4PA 4FC7A 4K6FA 4GVXA 1EUDA 3VPGA 2RCYA 3RQSA 1HETA 4U0KA 5JCXA 1EUZA 4OXYA 2I65A 4NFHA 1KY4A 4BO0A 1LJ8A 2BLLA 5KJEA 4C7KA 1PZFA 3JQ9C 4CLOB 4Y6SA 3NDIA 1WDLA 3ETEA 5EIOA 2AHRA 3GMDA 4B3HA 3OJEA 2OBYA 1NQ5A 1NFFA 4R5MA 4Q3CA 4RF3A 4FB5A 2JHGA 4UVHA 1U2GA 4OGWA 5ILGA 1TB4A 2HUNA 5EL0A 2Q46A 1E1LA 4IJUA 4WNIA 4YJFB 1KY5A 4CJXA 4E6PA 2PNFA 1PU2A 1FDUA 3TWOA 2AG8A 2Y1FA 5ITWA 1LDBA 4RDHA 2NTVA 1EVJA 2J3IA 1DOHA 4EW6A 4DQXA 1GYQA 3DONA 4O6VA 3ZZNA 4OKIA 4TKLA 3PDJA 4N5LA 5A9TA 1BDBA 2PKQO 2DBQA 3IIEA 4MVJP 4M8SA 2IXBA 4GPD1 4FBGA 5IDYA 1A7KA 3L0DA 4IBOA 4GQAA 3AI3A 3IL2A 1HE4A 5MGBA 3HE3A 3RFTA 3DFUA 1LSSA 4KQWA 3PPIA 1VJ1A 2HK7A 4FIZA 5KKAA 3ZWBA 3H5NA 3NTQA 2O3TA 2D1YA 3IKTA 1E6EA 4TVOA 1WDMA 4MIOA 4EJ6A 4UUPA 4TQGA 5LDHA 4WCFB 5G0SA 1QYDA 5L53A 1ZIDA 1PZGA 1AE1A 1LC0A 3BMCA 1G1AA 3KXDA 3PIIA 4Z9XA 2NNLD 1VKOA 1I3LA 3E9NA 3QP9A 3F4LA 5DF1A 4IJVA 4DWVA 3HQ4O 3PYMA 5FEUA 4W7HA 2NVWA 4BV9A 2Q4BA 2Q2WA 1U28A 1ONOA 1LLCA 3ROPA 1T2CA 1G0NA 3DMTC 3JQ6A 1IHXA 2YV3A 4EGFA 3B20A 1A72A 3NTRA 3PHGA 5I7EA 3LT2A 3PWZA 3E1KA 4BO1A 5K0ZA 1B7GO 2VN8A 5JCJA 1C0IA 4P8RA 1N8KA 1LRKA 2OP1A 1ZJZA 3JQBC 2CDAA 1YDEA 3E6AA 3GZNA 4E12A 3FRJA 4IQ0A 4RVSA 4RVDA 5C3MA 5KJ1A 3HUDA 1DB3A 2IZZA 2JJYA 4EUFA 1HT0A 3ST7A 1YBAA 3TFQA 2JD0A 2QG4A 5DT9A 1T1RA 4B7XA 1TA4A 3FNEA 1MLDA 4XZ3A 1P31A 4MIEA 1DXYA 1ZSVA 4WE3A 4DVJA 5T5QA 3QVWA 4E2YA 2ZQYA 4J7XA 4PCVA 5A5EA 1ADCA 1R4MB 2G5CA 1ZK1A 2DUWA 4ZQGA 1GU7A 4DUPA 1Q0HA 3KEOA 1NAHA 2PK3A 1XEAA 1QMGA 4PFJA 1DEHA 5HA5A 5EESA 4XYMA 2PGDA 3RBXA 4M54A 2O3SA 4B3JA 2J5QA 4EEZA 5CG1A 5KJ6A 1C1DB 3QRWA 3I52A 5K6AA 3D64A 2J8ZA 5CDGA 4YYZA 4JQCA 5TX7A 2O3UA 2WYWA 2VRCA 5L7YA 2VHYA 3KRTA 3GHYA 3QY9A 2B0JA 3FCOA 2OXIA 3CIFA 2PWZA 3I6QA 1LSUA 4BHTA 4E33A 1LQUA 1F06A 2NQ8A 5DOVA 1W8DA 2PKRA 4RPKA 4BMSA 3QWBA 3QHAA 1BRMA 3LLSA 4EZBA 3MOGA 4F6LA 4LCEA 5A9RA 2HRBA 4RGBA 2HJSA 4WEQA 5HS6A 1UXGA 4AJIA 1E3LA 1R0LA 2Y1GA 1RM4A 5A04A 2PA3A 4ZA2A 4BV8A 3GQVA 4W9NC 4TZKA 1U2DA 3K30A 5JDIC 4CLOA 1AXEA 4YJDA 1FJHA 1C14A 3OEWA 4E31A 1UH5A 3FBGA 2YQ4A 2B5VA 1Y9AA 4R1SA 2PKQP 3H9GA 4DRYA 3UW3A 1RM3A 5L4NA 3WGQA 1HLPA 4E2WA 1DC5A 4L4RA 3SJUA 3HDHA 4EBFA 4RPHA 1M6HA 1Y81A 3DR3A 5TJ9A 4E32A 2Q3EA 2DVMA 4U0JA 4OHUA 4YJFA 3GDFA 5COBA 4Z0HO 4CMCA 1DRWA 2I5PO 3EZLA 4AJEA 5B4TA 1LBEA 5U9CA 5U1PA 2RBEA 4YWJA 3BHMA 1TXGA 3EVNA 3PEFA 5EQDA 2QHXA 3TSCA 3L6DA 3ROMA 4BGIA 4YAIA 5TJHA 5EMHA 3GNQA 4BNFA 3JYLA 5CDYA 5AXDA 2VUUA 3E18A 3DTTA 4JBIA 1ENOA 3UH1A 2HQ1A 2OMEA 5LCXA 5T64A 3N74A 1MXHA 1GUFA 2HK9A 4WUVA 1YKFA 1V9LA 2GZ2A 1GY8A 4J43A 3JD0A 1HE2A 2P4HX 3LQFA 1H5QA 1Z7EA 2YUTA 1MX3A 5JMPA 1KOLA 4FJ0A 3WTBA 4XA8A 3QV1A 1WVGA 2D2IA 1YL6A 5KKCA 1U3TA 4RCVA 3WLEA 4WLOA 4WCFA 1JQBA 4DIFA 3WG9A 3RC1A 4K6CA 3ROQA 1XQ6A 5DNAA 3H2ZA 4TSKA 2EHDA 3S2FA 2OZPA 3OEYA 1U1IA 2O7QA 4KOAA 1CWUA 2I9PA 1LRLA 5IDXA 3DO5A 3FBTA 4J7UA 3AUAA 4RPLA 1AUPA 5LDGA 4UULA 3LZ6A 1JA9A 1R0SA 1GCOA 3JD3A 4YVFA 3NTOA 3G79A 1K5HA 3EHEA 3L07A 4NZ9A 1I3KA 1ISJA 4CM5A 4DBVO 1J4AA 4XR9A 4YRAA 5THQA 2JAPA 3UCEA 2OOSA 3TN7A 3UUWA 1PZEA 1SB8A 1P0CA 2DBZA 4EUHA 5C7IO 3PQDA 4DPMA 1QSGA 3CPSA 3U09A 3H5RA 3JYPA 1Y8QB 1PEDA 2I99A 3AOEA 1ZK2A 1X1EA 1WMBA 1V8BA 5H82A 3KZVA 4XGNA 5IAAA 1LLUA 3DOCA 4IPTA 1ZSNA 1PX0A 4ZU3A 2C5EA 3GT0A 1LDGA 3CSDA 4GAEA 1XG5A 2AXQA 3Q6IA 4JP3A 5C5IA 3R3JA 4CLRB 2ZTLA 5BSFA 4J6FA 4RJTA 3STHA 3CZMA 3BMOA 3LF1A 3QJ5A 5B37A 1UZMA 3LVFO 3K9QO 2OL4A 5ES3A 3C24A 2J5RA 1P1JA 2CNBA 3PHIA 2YDYA 4FOSA 4LN1A 4WLEA 4BKUA 1UP6A 1QYCA 1ZEMA 4ALLA 4AJ1A 1C1DA 3WNQA 4LVUA 3ZI0A 1CERA 3GUYA 5CEEA 2WMDA 3K6JA 5A06A 3WGYA 1YL5A 2PZMA 2NACA 4ALJA 4IDEA 1Y6JA 3QQPA 2VWQA 4XWYA 2X8LA 4PIVA 1W73A 2NVUB 3UVEA 3WYEA 3R1IA 1DIHA 4E5PA 4ITUA 5DCUA 2AMFA 4P22A 4BMNA 1NFRA 1ZFNA 1T25A 2G76A 4RQTA 1T1SA 1CRWG 1V6AA 3G1TA 4PZEA 4CMIB 3F4BA 4LISA 4J9VA 3DZJA 4YQZA 2X9VA 5KTKA 1NWCA 4A0SA 1Y8RA 4BB6A 1IPFA 1VI2A 3E82A 3R0IA 5T6BA 4I9UA 3ZU4A 5T8KA 2YV2A 4C7JA 1N2SA 4FW8A 4HUJA 3DZIA 4IM7A 5A1TA 1A27A 3AI2A 4WLUA 2EXXA 4RPGA 3WSVA 3RC7A 2AE1A 2QW8A 1JTVA 4GX2A 4DLBA 1CQJA 4U6SA 3NT5A 3AOGA 4FFLA 4WK6A 1DFGA 5KWEA 3OSUA 4IZHA 5BSHA 4QO8A 2RIRA 1Z45A 4XQEA 1ZMTA 2YHUA 2C5AA 1Z74A 3CMCO 3ORFA 3Q2KA 4I5GA 5F3RA 3PYLA 5FF9A 1FDTA 3WJAA 3P2YA 3WBBA 1QORA 3K8ZA 1ML3A 4PN3A 2HMUA 2W2LA 4ZGWA 2XXBA 2BGMA 4HNGA 2D3TA 4BVAA 1NQOA 1Z75A 3PHLA 4J1TA 2CVOA 4UVDA 1ID1A 2FPGA 2E49A 4BNGA 4TRMA 5C37A 1P9LA 3DXFA 3ZGYA 3L4BC 1F8FA 3ONEA 3GZ4A 3VC7A 2H63A 2Y0DA 4B7CA 4ESOA 2DKNA 3PQEA 2J3JA 3G3EA 3LU1A 1EUCA 1I33A 1QRRA 3QWIA 3VDRA 1Q1NA 3RUIA 1P1HA 2ZB8A 3OF2A 3COSA 1SB9A 4BKQA 1PZHA 5JAQA 3WWYA 1YB4A 2NU7A 5DOZA 3RD5A 3IJRA 3VH4A 8LDHA 4NHEA 4M87A 5GZ1A 4BGUA 3I4CA 4W7IA 4RZHA 4XKJA 5L95A 2WD8A 3JQFA 2EKQA 1CEQA 2B36A 3FI9A 4ZD6A 5CDTA 5ER9A 1YJ8A 1GUZA 3EY4A 2WDZA 3MZ0A 4FFOA 2IZ1A 4OOEA 2QYTA 4E13A 3I83A 3JD1A 1P1IA 1BG6A 3KO8A 4KWIA 1WZIA 5F1PA 4HKTA 4MVJE 2RH8A
chains in the Genus database with same CATH superfamily
2YCLA 1J9ZA 3RTBA 3ZHUA 4G5GA 2YV4A 1UJ2A 3U16A 3F96A 1V8DA 4G89A 4C2AA 2WAMA 2XF2A 3GDGA 3I9V1 2YS6A 5NULA 3MTBA 1HE3A 1L5YA 1TTPB 1V3VA 2R97A 3I42A 2GEUA 2WWRA 3PEUA 4G81A 4IIJB 2BMWA 4NYIQ 3DL2A 1F0NA 4K87A 4UHCA 1YULA 2A7QA 5AVZA 3IB6A 1UK6A 5JZMA 3QTBA 2IYXA 3NXSA 3ABIA 4KNWA 3OQHA 1MD9A 4WXPA 3ESYA 3ZKWB 2GO1A 3A6EA 2POCA 1TEXA 1M5UA 1Y8QA 1ZOIA 2OXFA 2PGJA 2GERA 1GZHB 3DDHA 5CVDA 4M1KA 1A8IA 1EFPA 4ONEA 4N0PA 4N8EA 2C7QA 1NMZA 1PT9A 3K0HA 5EWJA 4YR7A 1OH8A 4NXNB 3OA0A 1YDGA 4OHVA 3ZDXB 1RRPA 2IE0A 4MW0A 3DCYA 3UV6A 3M4YA 3ZU5A 2WY2D 5A6VA 4X64B 4CIAA 2QY6A 3E7XA 4ZO6A 2B1JA 3NDPA 3OIDA 2HRZA 2OGUA 5DISB 5BYJA 4AF6A 4F38A 1PV4A 4EPTA 1XQ1A 3H97A 1LVUA 2VT3A 4V3CA 3RARA 5FPKA 1INLA 1GKUB 1PNOA 2PSJA 2V0GA 3CO5A 3HC7A 3PR2B 1CQIA 4D3XA 5BRAA 1KGSA 2QZ4A 4MCHA 1BD3A 4O4HB 3EVEA 3N07A 2WSBA 1EIWA 1FPMA 1RFGE 2KLBA 2OHHA 3B1KA 2ZSKA 3VI4B 4BAGA 1L9XA 1QDUA 2Q28A 5G40A 1RVV1 3DNPA 3KWJA 4F8YA 5C7LO 4DLPA 1KIAA 1OX5A 3I1IA 3C3AA 4PF1A 4K9SA 3NBFA 3RYFA 2NVUA 4LKOA 4WFJA 1ECCA 2NU8A 5C53B 4DHWA 5KTMA 5IJ0A 4XYEA 2B3DA 5HIAA 2W6CX 1XA4A 3IIMA 4J03A 4EK9A 1W19A 3WLTA 4EY8A 4XVUA 1C9MA 3I2FA 3IAHA 5EIEA 1L0BA 3BWCA 2ZSUA 2FE1A 1ZBQA 3I5YA 1J24A 3PC2A 1ZD1A 3ZE9A 4M89A 1DC3A 3HYNA 2JFWA 2JNWA 3SU8A 2I33A 1U90A 4JLAA 2O0JA 2VZLA 4UVGA 3PQ4A 1EVZA 1Z07A 2H3EA 3AR4A 3GNLA 3ZXUB 1CUGA 2BIFA 2YXLA 4EY6A 3T3HA 1SKMA 4OUDA 2NZVG 2UVDA 2DU8A 4LE0A 3BEDA 2IXDA 4LHZA 4ZOLA 5BQ5A 3D2AA 3UJ6A 4RJJA 3UJ9A 3G0HA 3LIPA 1QAMA 4HMPA 4NZNA 3MWDB 4TLCA 1T8PA 2DULA 3WRXC 2J3DA 2WUGA 3BGIA 4RXTA 1UBFA 1IBLB 2IHNA 2HJHA 3NC0C 2PO7A 1CUXA 3DZCA 1D4ZA 1ML4A 2N1BA 4QE3A 1RQLA 1SCNE 1Y3HA 2BELA 2G63A 2H92A 3B1XA 2ZCVA 4V0ME 1KETA 3CR7A 4K6HA 3N8GA 4W6ZA 3EFOB 1VIYA 4IGKA 5DBFA 5IUKC 1U94A 1DQNA 2JH8A 2HMTA 3CONA 4KE8A 3WK8A 2PRIA 5JSUA 2R1VA 4WJKB 1GCUA 1R0XA 2ZBVA 3WDSA 1CDOA 3CPHA 1GOTA 4ZTUB 2C9BA 4GU5A 3CPJB 3JS5A 4XAQA 5BXQC 1I5RA 3B38A 3OWHA 1FVXA 4PZZA 5J1TB 1MG0A 3BA1A 3AFNA 2D5CA 2H1VA 4JT2A 3U6KA 2ZRGA 5KNCD 3VXKA 1RWOA 4OJQA 4BATA 4LZAA 2AEFA 2CJFA 3WTCA 2PN1A 3QEKA 4IWYA 1JDSA 1EMDA 2WWIA 3JQGA 3L93A 4KC0A 3D7SA 4Q3KA 5FTNA 1X7ZB 1BCSA 5ALNA 1BHSA 3W0LB 2ZCJA 2HIGA 3DQPA 4AJ2A 4KLNA 1BXGB 4MGEA 1W44A 3HBNA 2LIVA 1UUFA 2AKAB 3K0CA 4H6VA 4KXXA 4TYQA 1J22A 4ZU6X 4MWGA 3HZZA 4XEHA 1A5ZA 4R7TA 3WGIA 5IKXA 1H4SA 1ISIA 1JHUA 1U7WA 2H2DA 2CFCA 1Y1PA 3WR5A 2AI2A 2EF1A 4IVRA 3QX9A 1ZUNB 3DOEA 5BMOA 1O5IA 4H6PA 1YRQA 1Z63A 1RYHA 1ICEA 1L8QA 3RW9A 2JBAB 4AW9A 1PSZA 1I5OA 4OXKA 3J81k 3UWMA 3M6LA 4IVPA 3EGIA 2PZJA 1G98A 1LPOA 3GG9A 3REOA 4KRFA 2M98A 4UUAA 3T1OA 3TW4A 2UXBB 2CL7X 2Q7OE 4LRUA 5JVDB 4M83A 3R7DA 1UPFA 3U1TA 4AD8A 4Q39A 3KB6A 3OEHA 4BYGA 2AOXA 1K5PA 3K53A 2B37A 2O8VA 3GDOA 5KJFA 1PO7A 2FXVA 1N5DA 1QYXA 2A0FA 1HQKA 2GASA 1A97A 4DQVA 5BSVA 1WZ2A 1ZKDA 4IFEA 5B4UA 2IA5A 4JLWA 3DVAB 4K88A 3G6KA 5HZHA 3EAFA 2R8ZA 6REQB 2R8BA 3V7WA 2NG1A 5MDHA 2O07A 2P2DA 3H0KA 3Q9LA 4LYFA 4FZJA 4V0RA 2JVIA 2ZIVB 2ZJ3A 1SQSA 3BD6A 3K4QA 2H57A 3WL6A 2DFLA 3IHLA 3W7AA 3MQFA 4M9RA 1IY2A 1JDTA 1DADA 3S40A 1SBYA 1O8CA 3V8PA 2H11A 2Q6VA 5B7NA 3Q15C 5FBWB 3UXEA 2IITA 2W4QA 3QOFA 2G8LA 3U62A 3B7PA 3WOHA 1W76A 4MP6A 1V25A 1AXGA 2ZANA 3ELUA 5DHFA 4AB1A 1QGOA 2QTVA 1KARA 3A1NA 2HA7A 3TZQA 2EBUA 3TPCA 1E4YA 4Y7DA 2AX3A 3BGWA 2JASA 3BFXA 2ZRFA 3AESA 2IZOA 4CMKA 5H9VA 3LDUA 2RONA 1PEKE 3WLIA 2IDMA 3PI7A 4JLBA 3X1WA 2GD0A 1RQRA 4UCFA 1O57A 4CCYB 1AGNA 3CX3A 4PLFA 1EEXB 1PRYA 2O1XA 1IN1A 1T4MA 2PBLA 2P2NA 4KK4A 5A3JA 3GI1A 3MJHA 2VUIB 4OQMA 3LXRA 3O3NB 4GVPA 4EGJA 1Q16A 3K20A 3SCZA 5CH8A 2EDCA 1C8VB 3W5BA 1T5OA 5EXPA 1WLSA 3DZHA 4GPZA 4Y1GA 5EJAA 4ZQHA 3IP6A 4S2EA 1GNSA 2O0HA 3TUJC 2JZOA 1QK4A 5I9SA 4AJJA 3ZBTA 2JDID 1K98A 1U6KA 2Q7XA 3WZMA 3E53A 3CX4A 1EGQA 5H83A 1DL5A 5EMNA 3ZQKA 2EP7A 1PR1A 3DD5A 3CUUA 3KP1A 2H6EA 3EK2A 1GFWA 1I2DA 1U6JA 3ONWA 3OZ7A 4XQ9A 1FSFA 3RWOA 4B35A 3BL8A 4PC2A 4ATNA 3COZA 5ARBA 1PK7A 2HZBA 5BWMA 2CFRA 2C88A 3OWOA 3V1YA 3O1IC 1LWNA 2VJMA 1UT6A 1FMTA 4KVZA 5K3CA 5HS4A 4FYWA 1Z6QA 1OYOA 2ZTMA 3OQJA 3RJ5A 4B9AA 2P0AA 1K4MA 5D7NA 2IIQA 4KMRA 2QGZA 3L8DA 3GAMA 3PGLA 4TTSA 1E7SA 5JC1A 1BOFA 3EHDA 1EESA 2C82A 2HXYA 1NJFA 3L4KA 1GGVA 3I3SR 1SBZA 1CQWA 3QKSA 4ARZA 4DC9A 1NPYA 1G3QA 4JP1A 4ZCRA 2HMAA 1MVLA 1U80A 3VPCA 1TGYA 3IP1A 4LYAA 5AHWA 5KYUA 3KEGA 2HB6A 1N2GA 2J30A 4RKWA 2HYDA 1ULSA 2JCGA 2P6NA 3OWXA 4HXFB 3EW9A 4UNIA 3VO9A 1SBQA 3MTAA 1T2DA 2FR0A 3ULKA 2YV5A 4IYJA 2BEWB 5FR2A 5T4EA 3LPLA 8ADHA 4TT3D 1RWPA 1PGJA 3IUNA 3Q11A 2NSJA 4LC9A 4M1OA 4QPNA 3UY4A 4CMEA 5A5DA 5KOHA 3ERCA 1A4XA 2UXCB 2NWQA 4DFDA 5DN6A 3AUYA 4R84A 2ZWVA 4TVBA 2P2SA 3MJSA 3VI3B 5K3EA 2XT0A 5IJ9B 3DFFA 2RGWA 1XF1A 3Q0TA 1QO0D 1O0SA 1X13A 2FDXA 2N75A 2Z3VA 5AK4A 1JA1A 2HY7A 3E5HA 4RK5A 2RHGB 1ZAYA 5T41A 3B9RA 4R7GA 2ODPA 4BNWA 2B8EA 4WLVA 4AMGA 3IB3A 5EKDA 1EINA 4QQ8A 3R0JA 2CUNA 1J49A 4HX2A 1TLTA 4B79A 5HKAA 3GMTA 4EH1A 2B5WA 4KIWA 4FS8A 3ROGA 4EKNB 3OZUA 4N03A 4JXZA 5JAHA 5H3CA 5LP6F 1JIXA 3U7FB 2Z2IA 3H9UA 1I7PA 4MK4A 3RVRA 4RLSA 5SICE 5ULLA 1QP7A 2GDZA 1EXVA 4UUMA 5EEGA 1E79A 1N77A 2R6ZA 4X1OA 3VU3A 3V4RA 4EO9A 1G8PA 5ALMA 5CUQA 4GOKA 2X7HA 2B69A 1GPYA 2AFIB 1ZW1A 3E2PA 1PK9A 1O95A 1DBVO 2B34A 3IAM6 3MCVA 2E6KA 1GAJA 1PDOA 3QMWA 4KCGA 4M7WA 2Q4EA 3STYA 2I6QA 4TTIA 4XR4A 2YIVX 3M2PA 1Z06A 3B36A 5GM1A 4PG7A 1C9NA 2CDNA 2V7WA 3DBVO 3EGXB 4BLOA 3K70D 4TRNA 3SC4A 1JVNA 2VYVA 1TUGA 2GPJA 2XMBA 1OD6A 4NQZA 1OPXA 1TMGE 3TQQA 2NVBA 1KC1A 2I3GA 1L7QA 1NNUA 1V11A 2ZRNA 4TQUS 1G17A 1PWYE 4HGNA 1RPJA 4ZCSA 4G24A 2FA9A 4MB6A 1F9EA 2Z43A 2CMHA 1ULBA 4KBYA 4X54A 1ZD8A 1HQYE 4HNAB 4ZT6A 2IU6A 1MO3A 4LJLA 4BFYA 4HNQA 4BLPA 1F51E 3FJYA 3IQHX 3N87A 3PKJA 3RI3A 1KVTA 1L3BA 3LUHA 4I0WB 3GLHA 2DQKA 2VJDA 4GPEA 2OYRA 3UMVA 2FFHA 3DUWA 4JJAA 3KZMA 2AFIE 2E6UX 5ES4B 4NPCA 1ONSA 1AKEA 1D9ZA 4NR0A 4WGFA 3KWMA 2PMKA 1Q2XA 1PQPA 1Z4KA 2N46A 1B4DA 3HUUA 1T8SA 2O3QA 5AI0A 4DA9A 2ADFA 5JAZA 4EJ2A 3DDUA 3DDWA 1MCZA 1PQ4A 5KNBA 2OBBA 4FFNA 4C7OB 4OLFA 1W4BA 2H7VA 4NL4H 2W6OA 1FTYA 4LQLA 4DBLC 2NO1A 2R6FA 1NF3A 5JTUA 2AN3A 2R85A 1P45A 2DX7A 3WSWA 1VKHA 4MV5A 4C4YA 4UDOA 2BEJA 3QPCA 3LXXA 4AO7A 3FPEA 2JLCA 3EXHC 2XD9A 2WV7A 3JQPA 3OM9A 4MA0A 3KJZA 3I23A 3IQEA 4KACA 1V7QA 4BWGA 4DDUA 2WRZA 3SYLA 5IRCD 1Q7TA 4J7CA 4JEUA 1PP4A 3SOZA 1GUYA 1QIDA 2YINC 5F78A 5EFOA 4HWKA 2G0TA 3OESA 1GP2A 3ZDRA 4BWVA 1UF9A 3ZUGA 4NNOA 4CT0A 2ARKA 4JMLA 1L7AA 5JXIA 1JHPA 2EP8A 3EF1A 3MTGA 4FBMA 4GW3A 4ILEA 4CCWA 1UZUA 2Z6UA 4EX7A 3C0KA 5B3KA 1P7YA 5FA8A 1MVOA 2UYQA 2XCIA 4TLAA 5ECGC 5K0LA 4LRYA 5BN4B 4XFJA 3VR0A 4BU0A 4CZ2A 5JFTA 4RABA 4UREA 2MIIA 1OLUA 3FOBA 5CGQB 5FBHA 4F6CA 4RIGA 2D3WA 5TMDA 1WOYA 2OP0A 2AOWA 3LFTA 2NU9A 2PX6A 3MFQA 1GZUA 3TFWA 2Q4DA 2TMKA 4MO9A 4QOJA 3FN4A 5E2IA 1Y4SA 4IHJA 4FEYA 5HJ2A 2BRUC 5GGXA 1T3SA 3FMGA 4XLLA 5EIBD 3T7TA 3CVXA 3DD1A 5DM70 4G65A 1JP7A 5G1PA 5LLDA 2V7QA 3G2QA 3NWPA 3R6LA 1R12A 3ZD7A 3MMNA 1FX0A 2EBHX 3A06A 3NBUA 4US2R 1NNEA 2JA2A 2F4NA 3MCWA 4KH0A 1XPUA 2Q27A 2PZKA 2D00A 3A1SA 1NPDA 3JY6A 4G3XA 2I7VA 5IULC 3QLVC 4Q7JB 5GAJA 2Y1LA 5BSTA 3D2CA 1ZD3A 1DRVA 4DSUA 1QQ5A 3FE2A 3MLAA 4ZO8A 3QK7A 3TJMA 4JB3A 5IJWA 4YV0A 4QYXA 2UUPA 1JYEA 4JUFA 5CPFA 1VSBA 3RUAA 5DLEA 1Q1EA 1XZNA 3C85A 1UEXC 1IEWA 1R15A 3QU9A 3HI4A 1PX2A 4HLUC 4CM3A 2IOYA 1AVTA 3ZHQA 2XCRB 3D4IA 3CLTD 4HDKB 1Z0FA 4L8GA 4ZP1A 1R9MA 2PU5A 4JLMA 2GNAA 4R1LA 1BE8A 3CO0S 3KFLA 3S55A 1U5BB 4RIEA 4E51A 4DV5B 1X70A 5EJMA 3EJ6A 4X1KA 3TLXA 4ZOLF 4JKOA 1H5NA 2Q2QA 4Y9DA 3EPPA 1RZ3A 1GWNA 1PYGA 2YW2A 1FSZA 4A0GA 4IIUA 4EHDA 4ZFNA 4JI8B 3MWEB 5DLPA 2NPFA 3TQTA 2QUJA 3W6ZA 4B84A 1LNSA 5G3ZA 1F17A 4N3NA 1K6MA 2VAPA 2C83A 2ADMA 4G09A 1JSLA 3LC2O 5TEVA 3W2TA 1TCBA 1QB7A 3S28A 5GZ3A 4CDMA 3KDSE 4UNRA 4RY0A 2H1HA 1S9HA 3IXLA 1H3NA 3WWPA 3NETA 2FJUA 3WAJA 2C5BA 4LOJA 4E4RA 2ZJ1A 3RQIA 1PGNA 2VSOA 3FGZA 4WZBA 4FX2A 4ND6A 1BVUA 4MS3B 4LF7B 3HJUA 5HFAA 3N2NA 1OFTA 1KFCB 3T15A 5IYZA 1V5GA 1YQGA 4I5DA 4R01A 2IX3A 5T57A 4RTRA 4BVBA 1FFAA 3G0GA 4L75A 4R1PA 2OCPA 4WK4B 1SULA 2VCEA 2WMYA 1L5GB 4DXDA 1CYEA 1RM5A 2VIIA 4H7HA 4JBXA 3KOZA 1DZ3A 2XW6A 4TMXA 3DE4X 3KZCA 4ID3A 2EGUA 3WYAA 4ZEMA 4MUBA 3E58A 4LJKA 5TF0A 2VDQB 6Q21A 1E0DA 1B6SA 1JKJB 4UU0A 2AMJA 1D1TA 1DOZA 2D0OB 3DQZA 4CM8B 4ED9A 3ACBA 4CL0A 1O3YA 4J76A 3NJ4A 1CJCA 1QGAA 1VA5A 2QJRA 2AI3A 3K2QA 3PLNA 4PYMA 4UTRA 3GWZA 2YWHA 4JT9A 5ALTA 3Q3CA 4IIBA 1JF8A 5BT8A 3IO5A 3OP4A 2H5IA 5FOWA 3SNKA 2BGGA 1FB5A 2BGWA 1J0DA 2C00A 3TJZA 1BE1A 3T7SA 1O6CA 5JXHA 3MN1A 1TMYA 4K6OA 4BWFB 1CVRA 4TWBA 3AEYA 3J7AC 3JU3A 1R74A 3HVUA 1KYVA 1UK8A 5D00A 5JG7A 2GJ8A 4I2NA 4C3ZA 3TQFA 1FFXB 1XZ8A 4JENA 3D3KA 4BQEA 2QMUA 1I36A 2JIZD 3ABZA 2E0IA 1SC3A 2QE6A 1CUHA 1GZSA 2YDXA 3F3KA 3LBHA 4LPKA 5KYVA 3TZLA 1GRRA 3KLNA 4LVOA 4CL2A 3B1FA 1VP9A 2CSUA 5EZQA 5B2FA 2X2FA 4BTLA 1G6Q1 4OLAA 1XO1A 2G36A 5JZVA 4K0KB 4BNYA 1XYVA 3C45A 1YJQA 2B99A 2TSYB 1S3SA 3URMA 3HFGA 4P7JA 1OGIA 3G6WA 3ZW9A 2OCAA 3PQ5A 5LA6F 5HPYB 4AI6A 2L0XA 3LO5A 3KIPA 4LMAA 5AMXA 4I4CA 2PBFA 1OT5A 1LV7A 4G23A 2Y05A 5KTOA 3CWQA 1TI7A 2AOUA 2ZR0A 1E3IA 3I9JA 3ZXXA 1QQ6A 1KO1A 1RIFA 1G8JA 2DC1A 3JAWA 4L15A 3V8MA 2IU4A 3PTZA 4A4DA 5IASA 4DV1B 5ALPA 4HCJA 2HTFA 1ODCA 2ORED 1EA5A 1WCIA 1B41A 1FDOA 1OWLA 3M6XA 4PWZA 3D5TA 1TZ2A 3ZVRA 5CFQA 4QJBA 2A9JA 4C21A 2C4UA 4BFLA 2ZZKA 1W4RA 2WIJA 3JQAD 4O1HA 3VZQA 1WP4A 2CL0X 2IPAB 1KK1A 5KYWB 4NENA 2BTQB 4KXLA 4FBLA 4D42A 3KALA 2JRCA 3MD9A 2EWVA 2WHPB 3CN7A 1Z88A 4P81A 5D3MA 4BB5A 1JV2B 1LTKA 4G5HA 3LPDA 5IC4A 2H07A 1AZWA 1IJKA 2PD3A 3F2IA 3PZRA 4FCCA 2X6QA 4JGBA 3CX6A 4LYGA 4UNPA 3KD3A 4BTVA 4OBBA 5BWOA 2AE2A 1Y89A 3BZBA 2E4VA 2UYOA 3HXKA 4PBSA 4TXNA 4BGVA 3BICA 3OFSA 5E3HA 3D6AA 4NARA 4GVLA 4KP7A 3TCXB 3IUPA 5HKKD 3TLMA 3QIVA 1JEAA 2XRYA 2VHEA 1NX6A 3GLRA 3PNSA 2QAGB 4RAOA 3VYRB 4DCPA 4G8BA 3ZG6A 4PXYA 1XKTA 4QPZA 5D6OA 1AGXA 1PVOA 3CEHA 4JBHA 2GCEA 1NN5A 1XD8A 3VISA 1Z3IX 4YGXB 4DCOA 4KRXA 4BU1A 1E9EA 1G5PA 2F3PA 3RIHA 3ROTA 2XWBF 1QHGA 4G0MA 3LH5A 4ZGBA 2C04A 2YXEA 2X5JO 1FRZA 1M6VA 2O2DA 2VDWB 3PC4A 4ROSA 5D5HA 1IQRA 2M1XA 3H05A 3UFXB 5GIOE 4XWWA 4LZZA 4S35A 3LDFA 1MAWA 2B1GA 3S99A 3WICA 1Y48E 4JCOA 4ZDWA 3SNHA 4DABA 3IP5A 4LRXA 1GD1O 1ZPDA 4ZARA 1N4DA 3F1LA 3PTLA 1WBBA 4X1YB 5AJVB 1C5KA 2GD1O 2H4FA 2WVJA 2ZBEA 3LQYA 3ESCA 4C7MA 1LS6A 3GCDA 3KQPA 1PTKA 3QVUA 2Q3LA 2QS9A 1ZKMA 3WQHA 4NBNA 1TTHA 4LGYA 5IVIA 2ERCA 3WHPA 1BDIA 5DYIA 2O7NA 3RVSA 1PR5A 2J9YB 2LV8A 5DNYB 2ZUUA 2OC4A 1FLAA 3L6BA 3OZBA 1QM5A 4Y6QA 2BUCA 2H4WA 3M81A 4H15A 4A5SA 2PWYA 3ZV6A 3H6GA 5CB8A 1Z8FA 3F5MA 1SXJD 2FXIA 2HMYB 1DPGA 2GCOA 3F6EX 5FA5A 3T41A 1Q7BA 5CA0A 3ZWMA 4RO0A 3VTZA 4QHYA 5JYCA 2QL7A 1V1RA 1VE7A 1JR3A 3BAFA 1IRIA 4ZVRA 5ALWA 2AQ8A 1Q0QA 4EQZA 5I7VA 2ACVA 5AVVA 3P5SA 2HSJA 4HAYA 5C8YB 2WNHA 2CLIB 2VF8A 4YRRA 13PKA 5K4AA 3CR8A 3HLYA 4IRUB 3LECA 3IP3A 2AWOA 2O52A 5CYPA 1IWPB 3SQOA 3VPAA 4OUKX 3KSMA 3BDIA 2OXEA 1NOIA 3TGLA 1GPNA 3G8DA 3JASB 5DDIP 4XWOA 1JSXA 2V55B 1AH2A 1PGOA 2ZYHA 4H1VA 1CJKC 3OECA 1QP0A 1KEWA 4RS3A 3COWA 1C0PA 1QHNA 2QN2A 4FI3C 1HWYA 4X61A 5DGDA 4ZQCB 3ETGA 3FZGA 4QBKA 3E23A 3SR0A 3UCXA 1EVQA 2G5GX 2OXRA 3CH4B 4ZT3A 4F0JA 2H7YA 4NV0A 1N8SA 1QC5A 3NQ41 4X90A 2IXFA 4GX1A 1YZFA 4DEXA 1UDWA 2CFTA 2N9UA 4CL8A 1OFUA 2Z98A 4FQ8A 5KNDA 5EZ5A 3QVSA 5C8ZA 4TTRA 3R8XA 2HT1A 1E5VA 1MB0A 3VSAA 4C01A 1KBZA 4O2AA 4C1BA 4EVQA 1F4PA 4HT3B 5JMTA 5KPDA 2PIAA 3HB7A 4KAXA 1CFZA 3NV9A 2I4IA 3UTDA 1BVHA 3HU2A 2R6R1 1M7HA 3BE6A 4CT5A 2WM2A 3QKTA 3A4TA 4I3HA 1H2AS 5DYTA 4AMBA 1R5NA 3C39A 1DS6A 1M0WA 3B89A 1EZ1A 1W34A 3E3NA 4US0R 1M34B 4MKIA 2EJBA 1CR4A 1K8YB 5CPBA 3O8OA 2G72A 3ZGOA 5L4LA 1GZ4A 2DFPA 3LNCA 1FVFA 4WCDA 5ESXA 1XF9A 4YXFA 3F9CA 4AUKA 2YMQA 2H1WA 4EX6A 1XEWY 3PPVA 3T4PA 1XU9A 5KMGB 3K0EA 4H3SA 1YJ5A 2GILA 2W6ZA 4UD6A 3H5IA 1EP9A 1EI9A 3DE0X 4AJKA 4NATA 3ZDFA 2HC9A 4CMIA 3KKMA 4O2BA 4D8UA 4X65B 2FWJA 3C87A 1RZRD 1NMSA 3PKIA 4C9BA 3OAAD 3DHYA 1EXWA 1R4NB 1AX9A 4XW2A 1PJ8A 2XNCA 2JBWA 4J0DA 2IWHA 3CEJA 4YMIA 4DREA 2PE5A 1RBQA 4NZZA 1OLXA 3L7YA 2GN1A 3JWIA 4FXPA 5C0OE 4E2XA 4EHKA 5A6SA 1SA0A 2AQKA 1YBHA 1PGPA 1M6WA 2B2XA 5FXMA 5JCJD 2ZJ0A 1VPEA 2V6JA 4URXR 3L7CA 1VPWA 5G0UA 4WNAB 5HX7A 5TPZA 4R16A 1P5RA 5ECWA 1MAHA 1NXSA 2NV0A 3E9MA 3W8FA 4DCMA 2RHBA 2GK4A 2OY0A 3L8MA 4CE6A 1EK2A 1T43A 4GP9A 3LY7A 3P2KA 1IU9A 4EHHA 4NJEA 1R6TA 1SU4A 1HEUA 3GEMA 4OXIA 3M49A 4A0HA 1P0PA 3PNYA 4K9QA 5TQ0B 1PGQA 1KZ6A 3HRKA 3I3OA 4MMXB 1EQUA 4KL8S 3U4MA 1XMIA 3PJGA 5A71A 2X77A 1N2CA 1Q77A 1TAQA 2JGAA 2QZSA 4WSOA 3VPSA 2JCXA 2XUAA 2ZSHA 5E1OA 3RRNA 2ZYUX 4NPHA 4BO7A 2Z57A 2FMHA 3P9NA 4LNHA 4XYLA 3ZY3A 2YHAA 3NJ8A 1B00A 5IZ4A 4LHWA 5KUTA 4BNXA 4JELA 3ZKAA 3IEVA 3TBFA 2H5EA 5AQEA 4OXNA 2XCTB 1T4BA 2YJ6A 1FP1D 1P72A 4IY1A 2LZ0A 3GZNB 2OGWA 3FCEA 2ORWA 4Q3EA 4QLOA 4D9NA 4YCMA 2CXXA 3VPBA 3HMQA 4XD7D 1VJTA 1J97A 1XVUA 3IEKA 4WJZA 4AIRA 3BD9A 1WHSA 4AZTA 2CLFB 3DP7A 3OT4A 1ZISA 1UZNA 4MV7A 4PAGA 4UBOA 3L18A 4UFOA 5DM0A 3Q9UA 4CPDA 4C7XA 1UKBA 3IV6A 3U5ZB 1LUAA 1UADA 2HMWA 3JARA 5FHRA 3ZY5A 4OMUA 2NADA 4WASA 4DY6A 4M21A 2P79A 3RANA 3JQ8A 4H18A 1ISMA 2BT4A 2Q2NA 2YXDA 2A9KA 4YAJA 5T6MA 1XDGA 1E3TA 1ZIXA 2VCYA 2ZE6A 3CB4A 1R0RE 3ZHXA 3ADBA 5DI9A 4W82A 4TKVB 4CF6A 1AK9A 1P1CA 2GHQA 1QE3A 4WL0A 3PICA 3ZQJA 2VT2A 3BXPA 2FWIA 3HB4X 2D6FA 3P0FA 1JXAA 1B42A 3UYLA 4YRTA 4A8TA 3LP5A 3LUGA 2X0IA 3U0VA 3R3UA 1DO8A 1JB1A 3GIWA 4Z0TA 1Z7GA 3LX8A 4E14A 2CMGA 4A8PA 2CY0A 1QHEA 4G4JA 4H0NA 2R25B 5FWDA 4XRRA 2IBMA 3CB2A 3EIWA 3AHHA 3DFIA 3PKZA 4JN6B 4JLKA 4RELA 4CMAA 4BUJA 5DGHA 2F43B 2PYZA 4BNLA 4DCSA 5B64A 2ZRMA 1FFHA 1PJCA 1CVLA 1T34A 5JPCA 1VGRA 1T36A 3L77A 1HTBA 2X86A 3QKUA 5F3WB 3IPCA 1VC2A 4GMGA 2Y1CA 1USWA 3HI6A 4LG1A 3BXFA 3VR4D 1N7HA 2SKCA 3KV3O 1JFRA 2BRUA 1CSEE 1J5PA 1NR5A 5F1OA 3TLBA 4EW3A 1W87A 3OCYA 3ESDA 3I0NA 1UM9B 2QLMA 4DZZA 2XLCA 3D7MA 3Q1KA 1PT5A 3H7IA 3Q7IA 4S0XA 2Y67A 3DBHB 4MRRA 2O20A 4DCVA 4MSUA 1U5CA 4ND8B 2FN3A 3DAFA 3QLVA 5M7EA 3KVRA 4B4VA 9LDBA 4KIJA 1E9CA 1FRQA 1Z0ZA 4NNPA 1NZJA 1ZCFA 1GKIA 3MGAA 2YOHA 3RWBA 4DMMA 4D0SA 3WLOA 1LDEA 3CC8A 3DTNA 3GA7A 5DBGA 3EZNA 5G4KB 2V7PA 3JQ7A 5P21A 3GLHE 3U1BA 2FSPA 1GVNB 4HV4A 1B2RA 2C0PA 1DJNA 1YZQA 5FOQA 4IDNA 3JZAA 3N6XA 1XTJA 3C7AA 1LVHA 4FR0A 4O4HA 4IKEA 4L16A 3SR4A 3DGFC 4RSMA 4IDDA 1J0EA 3EZ7A 4NP6A 5IYZF 4EG0A 4D0NA 3SOPA 2WM3A 2GTHA 4U6QA 4P3OA 2QSZA 3TLEA 4X20A 1XFDA 5JS6A 4BMCA 2YL2A 2BFPA 1YQQA 2OB1A 2UUOA 2VR1A 1MKYA 4ASUA 4RL4A 4HQRA 3ZNPA 4FZVA 1FJGB 2FSSA 4I99A 1N5IA 4FFWA 4GKVA 2ZTVA 1DNPA 1PSDA 2GR9A 2QX4A 5C4MA 4ZT4A 2A59A 4KPUA 2V65A 5DT2A 5EXEA 3MB8A 4EJMA 2JPDA 1FVOA 4LBWA 2ZLBA 4UBJA 4UTPA 2GN4A 3QW2A 3ED1A 4FEAA 4TL7A 1W30A 2EWWA 2P7IA 2XNJA 2Q8PA 2YJZA 3QMMA 4H1HA 3PVZA 3RRXA 3FFTA 3DBLB 4FCVA 1HNWB 3M1IA 4U8GA 3U37A 3A1VA 4IIEA 2X0DA 3EDRA 2ADOA 1T3ZA 3T9CA 2YZNA 3INRA 3FOCA 3UYKA 3OP1A 1D5WA 5KDDA 1E1MA 3QKWA 2Y1EA 5JS2A 4NDNE 1XZEA 5HHTA 2J0UA 4U7JA 3UFBA 1Y3BE 4ECAA 2HF8A 1TUBB 4CF3A 3TM4A 2CCGA 3TTTA 3T9DA 1AKUA 4M76B 3VH2A 3ZHSA 3T4EA 2I55A 2IEZA 3HEBA 1UDAA 4HZUB 4I50B 1YTLA 2VP5A 1SVLA 3T3IA 4DJEC 4LJ9A 1BJTA 1V8OA 3WK9A 4IIDA 5HNKA 1CUUA 2QW0X 3G0CA 1QH1B 1VGQA 3KU1A 3L0OA 1TYCA 3PQ7A 3TW6A 4YMTA 1GGHA 1MEOA 1XL1A 5A02A 4FM9A 3MWKA 4HDRB 5DJ5A 1LI7A 1R0ZA 2QLNA 4JXJA 4CQLA 2CXSA 3X1KA 4AJ4A 5JW6A 4EZEA 1C1YA 1TCVA 3TL3A 4E30A 3C7DB 2Q21A 4EKIA 2QN1A 2O48X 3LC1O 3O90A 2WWHA 3OLXA 1UIMA 3OQ6A 5IF3A 4FONA 2OHFA 2V6FA 4ND7A 4NMMA 4MUIA 2C8KA 4L9SA 4OXRA 4Q05A 3ZJUA 4Z4GA 4RV9A 3DOIA 3R77A 4ZDIA 1U0SY 2DUJA 4OB8A 3NTVA 5EE0A 1G5HA 1QTRA 3DEAA 5EJFA 3FCXA 4JZKA 2DY0A 2P67A 3DWFA 4QICA 2DKOA 2FSVA 3TSWA 4Y1FA 1QYWA 121PA 5DX1A 2JFUA 2CL6X 1E6WA 2OSVA 2QSYA 3HKEB 3SAJA 3II6X 2YVUA 2AEJA 5CW1A 3OX2A 3WGOA 3MSCA 3T4UA 2I8LA 3VR5A 4N9WA 2CZQA 4QX6A 1JW9B 1UFOA 2I7TA 2QUAA 3GEHA 1RYYA 3W2FA 3ZBQA 2W6NA 4Z4IA 4ZGGA 5DRTA 1OX4B 1IUOA 1H6BA 3FLEA 1P5HA 2ZBQA 4O4IB 4XB1A 3WA6A 5I8PA 2P9YA 3H1EA 5HUJA 2J0VA 4L73A 5JQGA 4A9AA 2YWCA 2XUHA 1JIQA 2WF7A 4N82A 2W6JA 3TLAA 3V3TA 3UHAA 5FNVB 1EE9A 2WQZA 1DIGA 1RYDA 3WIEA 4YT4A 4L72A 2VJLA 3I2KA 3DVRX 3X3HA 3IEMA 3TRKA 4M7OA 1I7LA 3FPJA 4BBAA 2HHLA 3A27A 1EP1B 2Q9BA 1KRHA 5JCPA 3JYQA 4WZBE 3GLFA 4GLLA 3IUYA 3KB1A 2GCNA 3NM4A 3N2KA 2YFKA 4Q18A 1C41A 2PFGA 1PV2A 3AM1A 3Q8MA 3DVAA 1KZ7B 3DXXA 4K1XA 5KX5A 1XMJA 4P5EA 3O8LA 1E1CB 1X77A 5LL6P 3E22B 1ZMOA 2XNDD 5BW4A 4IV0A 1TUEA 1PW7A 3BBLA 4KK3A 3IDOA 4HSEA 2GSDA 1X8KA 3GRYA 3ITDA 1C0KA 3EXEB 3LF2A 3LUCA 3T12A 2OD2A 2R00C 2CE2X 4UOQA 3B82A 4I81A 1A1VA 5CA0F 1V39A 3M5CA 2VF5X 3QGMA 3RV4A 3H65A 4ES6A 2HDOA 2ZIFA 4TZTA 5SZJA 5CB4A 2IF0A 3GO4A 1TJ5A 3EXFB 5EWLB 3TIIA 1CCWA 4IZOA 3M1YA 3SDZA 1AKTA 1DI0A 3GCXA 3GR6A 1GVHA 1RKQA 2VSNA 5DVZA 4ZVVA 5BSEA 3LHDA 2Q41A 4BO9A 1Y5LA 1ZHFA 2OKGA 3CTMA 1UMCB 1FXWA 2G8NA 4QUKA 2C2GA 5ER6A 3AJEA 3RIEA 4CCYA 5K8CA 1SZPA 1W88B 2GJAA 3IEXA 1RXEA 1OYWA 1Y1KE 5BSKA 5CJJA 2KPOA 2WT4A 2YN4A 2WJ4A 4Z51A 4G25A 3SHFA 4XJVA 1PG5A 3O91A 5JZOA 4DIOA 2W4IA 4ISBA 1C8LA 1EFCA 2IOFA 3I62A 2P5UA 3R9XB 1FP4B 5SZIA 1MORA 2WG1A 2ID9A 1KMNA 3BZUA 4BE9A 2CN1A 3I2HA 1BO6A 1JJVA 4BLVA 3RVPA 3N5KA 1BJRE 4HDSB 1MVNA 4J8PA 2Y2UA 4EITA 4COKA 2XHZA 2RHCA 3KQLA 3BFVA 3OE7A 3ZE7A 3LG2A 3L0IB 1WAMA 4HH0A 3ZUPA 4Z54A 4MKHA 1EJ6A 4WNCA 2FPUA 4BFZA 3U7JA 1HYQA 2OBLA 4OHZA 3PGKA 5G3YA 4UMDA 3VMMA 1V4NA 1FDSA 1ZRNA 1K3FA 1NI4A 2V3WA 3MTIA 2JS7A 1OIXA 3OJFA 4JLOA 4J0CA 3AZPA 3KLPX 4PLCA 4XX0A 1K1EA 3UGTA 2DQYA 2IVZA 2VHVA 1KTIA 1E1KA 3H11B 4GE3A 1NG9A 1I3CA 4ZQEA 5L3ZA 1F2VA 5DLQC 3CJRA 5ALOA 3UTCA 5KYYB 4B31A 1HDXA 2KW5A 2AI1A 2D1QA 2J08A 2OOKA 3OQVA 3SM9A 3IEUA 3OOEA 5AW2A 4N3CA 3TNDA 4NJMB 5F51A 4GZ3A 2QV7A 4MUHA 3QXCA 2MSNA 1ORVA 4NYMR 1PR6A 3QXGA 2WYUA 3KJEA 3I72A 4IGAA 3N86A 1WXHA 3B6JA 3KZKA 3CLKA 1R6AA 5JNWA 3SKVA 2ZVPX 1IAQA 1MC1A 4GYKA 1C29B 1X3LA 3PA8A 1U2GC 1YZKA 4JUDX 3VJKA 3PNQA 2NU7B 3ROFA 2ZYSA 1JHAA 3PHHA 3EPKA 3AF2A 4D26A 3RK4A 1N6KA 4QGAA 1TPYA 5CFLA 2WVGA 1E7MA 1U7ZA 3CBQA 3K32A 3U4AA 2E5FA 4OHCA 1IBMB 4N8SA 2Q4OA 2R96A 2XVYA 3JSAA 3P0HA 3SQLA 2OCGA 4CQMD 1LZLA 2NUAA 3PT5A 5ITZA 4ZVUA 3SPXA 3K6RA 4X1IB 5L6LB 1OH7A 4KR9A 2I6SA 2J4FA 3CT4A 1LEHA 1JG2A 3DLTA 3UUEA 4EDFA 5ICMA 3QVKA 2E18A 2QRHA 2B4RO 1L7RA 2IXTA 4JR2A 3P20A 4WESA 3IV9A 1XMOB 1PS0A 4HB3A 4AZ3A 1U7HA 3UMCA 4AKGA 2P2ZA 3BSYA 3BXHA 4GYJA 4L8LA 2CDRA 4NMWA 2P9JA 2Q2VA 3DVSX 2A5LA 4AN0A 3KNZA 1XLTA 1JLMA 4DA0A 1QYRA 2Z5GA 5H81A 4YHHB 2FW9A 1T1IA 2BFFB 1WXDA 3QTTA 4MUXA 5ADHA 2BR5A 4CKZA 4NE9A 4OAQA 3P9KA 1BCRB 4DLAA 3I01M 1Z5VA 2W2MA 4XGQA 2LPMA 3C2QA 3CISA 2PNJA 3RUDA 5EPUA 3BG5A 2HU2A 5GTDA 2O2GA 3F78A 3EX7C 1IG3A 1KPIA 1T6XA 2JLXA 3NBZC 4IMRA 4JI0B 4Q3NA 4AL4A 3P52A 4K9MA 2YJ5A 2SKDA 4AAYA 2EOAA 2G82A 3ANNA 3K5PA 4L2IB 5JY1A 1Z5NA 1QDLB 5AVUA 3C98A 3U5TA 2V96A 2FEKA 1DUSA 1RYBA 3H16A 3IILA 4YJ3B 1BSVA 4ZAYA 5EYPB 5IAJA 3RSLA 3TX6A 2C4NA 5IJAA 1E5TA 2F9LA 1N6LA 3O75A 2LCQA 2SICE 5EG5A 3AH8A 3BWEA 4YLGA 3VVBA 1HLGA 1WUJS 4JVNA 2JF0A 3DPUA 4F46A 2XB6A 1UJ6A 1T6NA 3WISA 1KI7A 2R47A 1YF3A 2HJ9A 3UK2A 5A9SB 4PSCA 2FN7A 3HWX1 4TL6A 2DWOA 6CHYA 1IZYA 1Z16A 1XJWA 2Q1TA 4MPRA 1RKVA 2IUUA 1EWKA 1E3WA 1DC6A 2Q5IA 1XWWA 4B5KA 3U0BA 5DI3B 2HFJA 1HURA 1OA0A 3PFBA 4PSDA 3MG9A 3W77A 1TIPA 2FOIA 1G42A 2P2LA 4A92A 2B98A 1DGQA 2FCRA 5EEHA 4KODA 4L74A 5LSAA 5CX1A 3W5UA 2WFMA 1UDXA 5CEJA 2VTEA 4F1KA 1SEVA 2BFNA 2Y1WA 3JW8A 4IIJF 4F2HA 4RIFA 5AD1A 3H2BA 3KYCA