5JDCA

Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 248
sequence length 267
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdcA00
4FIZA 4IIVA 3DQPA 1NVMB 4B4UA 3ULKA 1MC5A 5A03A 3U09A 3GA0A 2EJWA 1KVUA 3NYWA 5ILOA 2J5KA 1M76A 1PJ4A 3DAGA 2F00A 3RUAA 1TT5B 5H82A 2OBNA 3KYDA 4OAQA 3IP1A 1GAEO 1EQ2A 2JAPA 2DVMA 3D5TA 3GN2A 4QECA 1JDJA 1V8BA 2CVZA 2VZ0A 2X0JA 2ZYGA 1NQ5A 4AJJA 1NNUA 2P2SA 4IDCA 4J16A 4ZRMA 4BNTA 1FDVA 3TZHA 2DC1A 1E6EA 3WG9A 1CDOA 1V3VA 3RI3A 1NM5A 5JDIC 1JWAB 2C54A 3H5NA 2X9VA 3RUDA 4II3A 5BSFA 2EERA 1NPDA 3LLVA 4Q3BA 1OZAA 1U7HA 5T6BA 3WSWA 3QW2A 5KCZA 1ZSNA 2J5QA 1PJSA 1F17A 2VQ3A 3LC1O 1GV1A 1HE4A 3K2BA 3OEWA 4E13A 1NQAO 3WTCA 1ZK4A 4HX5A 2BH9A 2C82A 4LMPA 3U49A 4ZGWA 1ZK0A 4RVSA 4UAGA 2E37A 3KYCA 1QYVA 1LRJA 3GRKA 2QYTA 4J7CA 5TGDA 2VHYA 1CYDA 3JQ9C 2PKQO 1C0PA 1NHWA 2Q4BA 3PGJA 4FN4A 3CEAA 2OGUA 4R5HA 4W4TA 5C37A 4BNYA 5ITVA 1DIHA 1YL5A 4BO1A 4ALLA 4CQMA 1NVTA 3JD0A 4P4GA 1C14A 2NM0A 3BMNA 3U9LA 3FN4A 1MFPA 4TKMA 4CMBA 3DO5A 3CMMA 4TRMA 1E1LA 3JQAB 5JCXA 3UGKA 2NADA 4E2ZA 2Y1CA 4NNJA 1HLPA 1OOEA 2P9EA 1ZH8A 4Q9NA 3QVSA 1NFQA 3VTZA 3WJAA 1Y5RA 4MVJF 1Q0LA 3DXFA 3DB2A 3QJ5A 4N18A 3WYCA 4E2WA 1N9GA 1NFRA 1ZKMA 5FEUA 4DC0A 2QHXA 1NPTO 3UKOA 2VHVA 3OA2A 4IUYA 5DP1A 2DT5A 2WE7A 2WYWA 1GV0A 2JCXA 3OQBA 3PHJA 4JP2A 4LRSB 2JHGA 3I5MA 4K1LA 1T1RA 1KS9A 1YJQA 4KWIA 2NTNA 2OFPA 2WYVA 2J5RA 4L9RA 2O4UX 3FR8A 5GZ6A 2WYUA 4D3DA 1R4MA 4JK3A 4TSKA 2FHSA 3ZV5A 1NWCA 3WMWA 2O23A 4W7HA 5IXYA 1NASA 4ZHSA 1Q1NA 4XRGA 5ICMA 2X5OA 5TNXA 1EUDA 1E5QA 5H81A 3JSAA 1Q2XA 5DBIA 5B37A 2UV8A 3FTNA 5DCYA 2Y1DA 3MJTA 3LVFO 4XA8A 4H15A 4TRNA 1XG5A 2C2XA 4BQPA 4WCFA 2X8LA 4NI5A 1YE3A 4RPLA 4HNGA 4PN3A 3EUWA 3U5TA 4CV3A 4BNHA 2VNAA 3KZVA 2HJSA 1ONNA 3N7UA 4BO5A 5FF9A 1EVIA 3ZH2A 1L1FA 4UUPA 4NG5A 3JQBA 4E5PA 4DXHA 3NX4A 4IJUA 1BWSA 1QYXA 2NQTA 1DJQA 3WQSB 4E0BA 1EUCA 4ND5A 4AJIA 1BXGB 2IZ0A 1E7SA 5A3JA 4EITA 1NHGA 3V2GA 3DTYA 4Z9FA 3S2FA 1I5RA 2AQHA 4JP3A 2JD0A 4R1SA 1ADGA 2AHRA 2OORA 4I1IA 4DQUA 3PPIA 4YACA 2Z1MA 5HWSA 3MOIA 2DTDA 2V6BA 4QUKA 4CM4A 1E1MA 5KOIA 3DTTA 1W73A 5CG2A 5G0VA 4GMGA 1NBOA 4RLSA 4CMAA 3OJOA 5HTOA 1YDWA 4LRTB 4AJLA 4RF2A 4YJDA 4Z0PA 4RGBA 4WCFC 3GPIA 2D3TA 4IZIA 3PVZA 1P74A 3AU8A 3COSA 1HTBA 2NU8A 3VH4A 4H7PA 1CETA 1U1IA 4JNKA 4MOWA 2PD3A 4F6CA 3I9KA 4BNUA 1BDBA 3WFIA 2JD2A 3EK2A 3JQCA 4GVXA 2VN8A 3AWDA 3JQBC 3ONFA 3U0BA 1SNYA 3JYNA 5DP2A 1L7EA 4ZJUA 4AJ4A 3F4LA 4IPTA 1T2CA 3H4VA 4IS2A 3I3OA 2GSDA 1A27A 3Q11A 2GD1O 3AUAA 2NV6A 1EUZA 1OC2A 3BHJA 3VPHA 1YL7A 1N7GA 4FOOA 4YA6A 1Z75A 2W2LA 1QRRA 5F5NA 4IMPA 2ZCUA 2EWMA 4AJKA 4DQXA 5G0TA 1NQOA 3B6ZA 1FDWA 2P5UA 3H7AA 5FYDA 4BNNA 5B4TA 5CP8A 4OIMA 1O94A 3MJVA 3WJ7A 1N8KA 1T26A 3MTJA 5ENVA 3QQPA 1F12A 3DL2A 2EGHA 3PI7A 3GN1A 1I2ZA 4MVJP 4DGSA 4I9HA 1T4DA 3GT0A 4H3VA 1HDOA 4Y9DA 4A5OA 2JD1A 3GLQA 1I10A 3ENKA 3M2PA 3Q3CA 4CLOB 5JPIA 3T7CA 4IXWA 1SZJG 4GLOA 4OSOA 3VOSA 1PSDA 4PLWA 4UVHA 4WLOA 4XX0A 4EJMA 2Q2QA 4PLZA 3HN7A 1N5DA 3JYPA 1XHLA 3FSRA 4XIJA 4BKRA 4KP7A 4RF4A 1GTMA 3QSGA 5C3MA 1EDZA 4BNLA 4FR5A 4U7WA 1IULA 3ZWAA 3JYQA 1KIFA 1FK8A 2G17A 3HB4X 2O3TA 3PZRA 2HDHA 4B7XA 3VZQA 1IOLA 5MGBA 4EUHA 1E7WA 3PQFA 3JD4A 4E33A 1MP0A 1DC6A 1ENYA 2Y1FA 1I36A 3E5RA 3P7MA 4E5KA 2Q1TA 4BKUA 2O2SA 2HQ1A 4ZQFA 3GDFA 3JQ8B 1DDOA 2DTEA 1IUKA 2GCGA 4IDEA 4MDHA 4Z0TA 3GG9A 3ZU4A 3PYXA 4Y6SA 3D64A 1JQBA 2BLLA 3DHNA 3GVCA 4EYEA 1YOVB 3RBXA 5BQFA 1EVYA 2AMFA 3VTFA 2X9GA 4IDAA 2GN8A 4W9NC 1XELA 3CUKA 2VWQA 5L9AA 4FC6A 4IGFA 3C7DB 1EMDA 3PK0A 3AI1A 2Q46A 2BGKA 1IHYA 1XSEA 3PFFA 1R4NA 1CQIA 3NJ4A 4OGWA 1PQUA 1WPQA 5G0UA 3ZW8A 2C7VA 3OIDA 1E3LA 5GZ3A 1PGPA 3SXPA 1GY8A 4BMVA 1R37A 3O9ZA 4Y98A 1PWXA 1V9LA 3C24A 1W6UA 2YUTA 4I5DA 4RO0A 3PHLA 1JVBA 2V7PA 4N54A 5T8KC 1JAXA 1UZLA 2FP4A 1B8UA 3P2OA 3EVNA 2YJZA 3WDSA 2EV9A 2FR0A 4CLXA 5G4LA 3ZWPA 1BW9A 1DRUA 2RBEA 4ALIA 1U5AA 4BGEA 5KJ1A 2ET6A 2HSDA 4CODB 1HZJA 2NTVA 1Z45A 3ONDA 3PP8A 1HL3A 3GEMA 5BR7A 2YDYA 2O7SA 1XA0A 1Z6ZA 3TOZA 4OYRA 2YHIA 3SC6A 2NU6A 4CV0A 3DOJA 3WICA 2C5AA 4YT2A 3BMCA 3W4KA 5ICSA 4RLHA 3IKTA 2EW8A 3ON5A 2IYOA 2X6TA 1P1IA 3NAQA 3TWOA 4EJ6A 2E4AA 1BVRA 1BSVA 3PXXA 2VOEA 4L75A 1E1NA 3BTOA 1X7GA 3I1JA 2LDXA 4NBUA 2YQ5A 4CMEC 4BO7A 4DIOA 3FRJA 4MP3A 1XU7A 4QT0A 1J6UA 5JCJA 1P1JA 4OOFA 1M75A 2DFDA 4CPDA 1S6YA 1WVGA 1GUYA 3NV9A 2O48X 4F6LA 4GVLA 2Q1WA 1LDNA 1LLDA 2GGSA 3WIEA 5I7EA 3O8QA 3ZGYA 2X4GA 4DC1A 3F46A 5TF4A 4ZICA 4J4HA 4DA9A 3AU9A 4TZTA 2W8ZA 1RKXA 5EL0A 2OMEA 2GRAA 5CDTA 2ZTUA 3TL2A 1JKFA 1J4AA 2B4RO 1YBAA 5ILGA 2WD7B 3KYBA 4MKZA 2PKQP 1MC4A 3ETGA 4JIGA 2W2LD 1YB4A 1KY4A 2EGGA 3KSUA 3TRIA 4MKXA 2QZZA 4KQWA 5T57A 1UAYA 3RQSA 4AJNA 2Y1EA 1ID1A 4PLGA 1HKUA 1E7RA 3JYLA 4CMIB 1ENPA 3PQDA 2XXBA 4CM9A 5DCUA 3PHIA 1PL6A 5L3ZA 4DWVA 4CMJA 2ILTA 1UP6A 5HBRA 4GAEA 3UCFA 3JD2A 5I9MA 3V1YA 1X14A 1DB3A 1NAHA 3FNGA 2V65A 3IAHA 3P5SA 3MJEA 3QVTA 4WOJA 3WYBA 4JX8A 4M54A 4MP8A 3H2ZA 3GZNA 2X23A 1UP4A 4XGNA 1E3WA 4RF3A 4ZU3A 1ZK2A 4WNIA 5LDHA 3E9QA 4MJLA 4CM8A 3EZLA 2GR9A 2H63A 2FOIA 3R3SA 1XR3A 4HADA 2VYNA 3DHYA 2GASA 1C3VA 3C7CB 3WX0A 3GEDA 3I9OA 1ZK3A 4TKLA 3FR7A 3VPGA 4L73A 4P4LA 3I6IA 2HK8A 2E82A 3PJDA 2JL1A 2IE0A 3GH3A 5K6AA 1A5ZA 1T2FA 4YT5A 2JHFA 5G0WA 3DZJA 4NIMA 3OECA 1K89A 4KQXA 4HBGA 1DHTA 1WW8A 4MP6A 2PH5A 4KWHA 4B3HA 4IY1A 3KHUA 4GX2A 4XZ3A 2NVUA 3ETDA 3INRA 3ZWOA 3PJFA 4DBZA 4CR6A 3DBHA 2YZ7A 3JQFC 1X0XA 1G1AA 3WWZA 3CPSA 1WWKA 2ZB4A 1HRDA 1LDMA 3GFGA 5L4NA 4A7PA 3Q6IA 4HY3A 5DT9A 4J4TA 1HDYA 4R16A 1DO8A 3VZSA 4J1TA 2E49A 4YDRA 1V35A 3KETA 4YRDA 4URFA 3AOGA 5A1TA 1E7QA 2VUSA 4ESOA 4XGKA 5F1PA 4ND2A 2FZEA 4L76A 3U3XA 1GD1O 2Q45A 4KTTE 2Y0DA 2YYYA 3QLJA 4C7JA 1M6HA 1K6IA 4UUNA 2Z5LA 5JDCC 2OP1A 3E5MA 3LDHA 4RDHA 3OM9A 4O63O 4L4SA 3LZ6A 5IJZA 1KEUA 1LJ8A 2B36A 4OXYA 4P8RA 1PR9A 2ZKLA 4ILKA 5AXCA 5GMOA 4E21A 4BO9A 4B7CA 2VHWA 2NU9A 3RVDA 1PS9A 5KJ6A 1ARZA 1DXYA 4HXYA 3MEQA 4RCVA 5AXBA 3H9GA 4NHEA 3KEQA 2WWRA 4TRRA 4AVYA 3AOEC 1NYTA 4B3JA 2HAEA 4EDFA 5JXWA 4FS3A 2O50A 5JLAA 1ADCA 1Y7TA 4S1VA 5G4KA 4CLEA 1MG5A 3OIGA 3M2TA 2ZB7A 3JQ7A 3EW7A 3D7LA 2I99A 3WB9A 4Q3NA 2J3HA 8ADHA 1N1EA 2B4TO 2Q49A 5A9SA 1PJCA 1YKFA 3UH1A 1HE3A 1F8GA 4PIVA 1I3MA 5KJFA 4YQZA 2PZMA 1NAIA 1YXMA 2D2IA 4UVDA 4YJHB 4IQGA 3EZYA 3EHEA 3FNHA 2BRUA 1ZNQO 4D43A 1VE9A 3I83A 3GGPA 3SJ7A 4U0JA 4B4OA 3GF4A 2CDBA 5C7OO 4TZKA 2BD0A 4U6SA 1MUUA 3RIHA 1ISFA 5JE8A 3P19A 4WK6A 4QFDA 3NTRA 1I33A 3DOCA 4FFMA 1ZIDA 3E6AA 4FFOA 5L45A 3TDKA 1NWHA 4IJKA 4BNFA 4E5NA 4O1MA 3H2SA 3RFXA 3RROA 1J5PA 3VVBA 3V1UA 4YEDA 4BO2A 4DPMA 1VI2A 4GKBA 4R69A 3KB6A 1WNTA 3BIOA 2DPGA 4NBRA 1X7HA 3TZQA 3FF4A 4FBGA 4ZQGA 2D0IA 1HYGA 1SCUA 1U3TA 2VYVA 4XB1A 1W4ZA 1WZEA 5JDIA 3R3JA 3NDRA 2VRCA 3K8ZA 4IDDA 4CR8A 3Q0EA 1C1DB 3ZNOA 9LDBA 3AW9A 3KUXA 2IXAA 2PH3A 2R00A 4M89A 4PZCA 5TRTA 5KJCA 1LSUA 1CEQA 1DIAA 1W0CA 3WIDA 1K3TA 1NQTA 4NBVA 3LQFA 3RJ5A 3SLKA 1QR6A 2RH8A 1GCOA 1XLTA 1GDHA 4YJGB 1HXHA 5EIOA 4D45A 1C0KA 3M1LA 1EBUA 3DZBA 3GNSA 3ZWXA 5HS6A 3GMDA 4L4RA 3BHMA 3JQ9A 1M66A 1PQWA 5CEJA 3DZFA 2D5AA 1LUAA 2CUKA 4R4JA 3PDUA 3SX2A 5IAAA 3HDYA 4JBGA 1P77A 4E5MA 3ANLA 1LSJA 2RHRA 3JQAA 3E1KA 1HLDA 1YH3A 2B37A 4PLHA 1Y8QB 2VYND 3FPLA 5JBIA 4KOAA 4Z0HO 3I6QA 4D3FA 4QSMA 3CMCO 4WASA 2G5CA 3OJ0A 4IQ8A 2P4HX 1ZSYA 4XQ9A 4B8WA 2YQ4A 2Y1OA 1PR3A 5TT1A 4NU6A 3ROQA 3GUYA 2B0JA 4K26A 1I2CA 3QVOA 1I8TA 1KVQA 2OXIA 4KZPA 4YVFA 1LU9A 2GZ2A 2R00C 1M2WA 4W6ZA 2PD6A 3QE3A 4KDFA 3RFTA 1LRLA 3KSDO 1R66A 4RVGA 6ADHA 1ZUD1 4YTEA 2J3JA 2RH4A 3GNQA 4Q3CA 4XDZA 4CLRB 2IEDA 2GNAA 4B7UA 1DC5A 3DBLB 3ROPA 4I8XA 3SBOA 1ISMA 3WNVA 4YT4A 1GYQA 1NX6A 4FGWA 2VTEA 3UCXA 4BMNA 2VCYA 1D4FA 4Z9YA 4JCOA 1Y9AA 2CVOA 4LW8A 3IS3A 2VNSA 3K96A 1E5LA 4R9RA 1K0UA 2DFVA 4MVJH 3NT2A 1E6UA 1X7DA 3ROMA 1PZEA 4WUVA 4BNIA 1KVRA 2C5EA 4BNXA 1RWBA 1HF3A 2FY8A 1B0AA 1P0CA 2NUAA 4YQYA 2IEBA 3WLFA 1PZFA 4CMHA 5ES3A 4O0LA 3ZDFA 3MJCA 3RUEA 4DUPA 4YAIA 1V3UA 1I24A 4J6FA 1BMDA 2DQ4A 3RC7A 1LEHA 1IYZA 2OL4A 5A4DA 2AE2A 1TB4A 1BXGA 1YB1A 4IS3A 3DOOA 4IJWA 4TROA 1HE5A 1KY5A 1B3RA 3RSHA 1ZK1A 2Y0EA 1A4UA 2EXXA 3ZWVA 3B1KA 1MXHA 3EMKA 5L7TA 2OZPA 3DDNA 3H9JA 4J0FA 5HM8A 1F8FA 3A14A 3CH6A 4RPKA 3FWNA 3Q9UA 3D4PA 3D3WB 2P9GA 2GYYA 3D1LA 1GR0A 1LLCA 1M67A 1ULSA 2AXQA 2CF6A 3HSKA 5IDYA 3DWFA 3PTZA 4OHUA 2HK7A 1ZEMA 3NDJA 2H1SA 2V6FA 3FPCA 3H5AA 3CIFA 2O4CA 4JGBA 1KBZA 3LT2A 4L4XA 1JKIA 4DTIA 4N5LA 4EJ0A 4D44A 4J9VA 5JC8A 3I4CA 4QFCA 2ZTMA 4P22A 2PGJA 3H3JA 4MIYA 3U4DA 1Z7EA 1JW9B 2CDAA 4XYEA 3UICA 4EBFA 1UZNA 1CRWG 3ZU2A 1MFZA 1RM5A 1NXQA 4JQCA 5L95A 2AW5A 2IZZA 3AY7A 4I9UA 4U6QA 1LI4A 1P1FA 4UUOA 2BKAA 1PS0A 4W99A 1LSSA 5H83A 2FMUA 2DBQA 3DBRA 3X2FA 2VRBA 5BSEA 2FR8A 2DM6A 4J43A 3QWBA 4IMRA 4EI2A 4YAGA 4R5MA 1GYRA 3IIEA 4QO7A 1Y8RB 1Y9EA 4MO2A 3SVTA 4WLEA 4JLWA 4B4WA 3IP3A 1ADFA 1HWYA 4OH1A 4WOKA 4MVJG 1BDMA 1J0XO 2HRZA 2OUIA 4ZN6A 1EFLA 2Y93A 2PZKA 2XF8A 3I23A 1U2GA 1U3UA 4DLLA 1L7DA 2WMDA 4NJMB 5KVSA 4YPOA 2BHLA 4PZEA 3FD8A 4PG8A 1DIRA 1C1XB 4FCCA 3SJUA 3WGOA 1WP4A 4AJ1A 1ZXBA 3G79A 4J91A 1I2BA 3QRWA 3GPDG 3QWFA 4Q39A 5AVOA 3VZPA 4CL3A 4CLOA 1F0YA 4YT8A 4J1NA 3TJRA 1GL3A 4WEOA 3ZHZA 1BHSA 2Q99A 1E3EA 5FI3A 5C7IO 1RM3A 1A72A 3JQ6A 1SO8A 1MGOA 1Y1PA 4A10A 3KOUA 1Q0QA 1T2EA 5KVCA 5DN9A 1PEDA 4CM1A 5TIIA 2AQKA 2VUTA 3ASUA 3ZV6A 4DLAA 2EW2A 5JYDA 2O2YA 3F3SA 2X1HA 3ANNA 3JYOA 4JJGA 1VSUA 1A4IA 1O0SA 2CSUA 3KSZO 4M8SA 3LT1A 4QEDA 4PLFA 3IQDB 2Q4EA 2QRJA 2H5LA 4CV1A 1P1HA 3L9WA 3HUDA 1H6CA 2C29D 5F1OA 3LSYA 3EVTA 4YCAA 3NTOA 4ZRNA 3RJ9A 1RYEA 4G65A 3CKYA 3JQ8A 2QQ5A 4D3SA 1QLJA 3SEFA 5LCXA 2J3IA 3P2YA 4NU5A 6LDHA 4WJZA 4XD2A 4YRAA 1X0VA 2VHXA 3AY3A 4R41A 4YYZA 3EC7A 1WLYA 4FD3A 3VHRA 3N58A 3GQVA 4DLBA 2VHZA 4XQGA 4DQVA 2P5YA 3AUSA 2BI7A 2B4QA 3K5PA 3ZNNA 1VL6A 5K9ZA 1YQXA 2DAPA 4O5OA 4OQZA 4M55A 2QRKA 3L4BC 4W9NA 2G82A 4YJFB 3HB5X 2RCYA 1XGKA 3OIFA 1MB4A 2HMVA 4DBVO 3UUWA 1CQJA 3PQEA 3Q2KA 2I5PO 3OBBA 4BV9A 3FBTA 4MPDA 4OM8A 1MG0A 3BHIA 4K6CA 5FFFA 1IHXA 4CJXA 4UEOA 1DBVO 2AA3A 2AEJA 4RVHA 5COQA 1O6ZA 1FDUA 5A5FA 3AY6A 1B8PA 1PGQA 3IKVA 4UEKA 4CQMD 1UXIA 4GSKA 2ZCVA 3CXRA 5T8KA 3QIVA 4ZVVA 2DTXA 1B2LA 5F3RA 3UOGA 3AUUA 1ZVMA 4KUHA 5KKCA 5G0SA 4D42A 1WXDA 3ZWBA 4E30A 4MIOA 1FMCA 3KXDA 5AYVA 4OOEA 1PL7A 5JMPA 1TLTA 4R01A 4R9SA 4EW6A 5I8ZA 4LN1A 1VJ0A 1P1RA 2ZIZA 3WNQA 2H9IA 1D1TA 1P31A 5JAQA 1U4OA 4N5NA 1SB8A 5U9CA 2Q2WA 1B14A 1F06A 3V5NA 1R6DA 3C85A 1XYGA 4L8VA 3TOXA 2PV7A 1H5QA 3C8MA 3FHLA 4C4OA 3TFQA 3TZKA 3ZHXA 5GY7A 1DPGA 5KVQA 1G0NA 4TMFA 4PLTA 1J49A 3DFZA 3IC5A 3L4SO 3UAGA 4CMEA 5THQA 4JBIA 2NVBA 1X1TA 1UDAA 4IDGA 3E03A 3F1KA 4LSMA 3LF2A 4B4VA 5CDUA 3RD5A 3TZCA 4F45A 4I5EA 1DEHA 2VZ8A 2IZ1A 2X7HA 3UHAA 1E7YA 1NR1A 2WD7A 3ZWWA 4FJ0A 4E6PA 3E48A 5CFZA 1GPJA 4EEZA 1ENZA 2Q3EA 1OBFO 3V2UA 5CDGA 5JAMA 4GX0A 1YS4A 1FF9A 5BSGA 5AQ1A 1TI7A 1HT0A 3QP9A 4II2A 3S2GA 5F21A 2ZATA 1VL0A 5TQVA 1H9BA 3F9IA 2G76A 3UF0A 2VZ9A 4NFSA 1MLDA 3TQHA 1K6XA 2HRBA 1PS8A 2QG4A 5T67A 4DIFA 1N92A 3HG7A 4NBTA 5BSHA 1VJ1A 1PZHA 4DRYA 4BNKA 1SOWA 3ZU5A 4J7XA 3OHSX 3HDJA 1EEHA 4MIEA 5CEEA 2EP5A 2FSVA 3ASVA 2R2GA 1HDRA 2NWQA 2F1KA 1AE1A 4WLFA 1X13A 1T2AA 4GWKA 4RQTA 3VH1A 3B1FA 1EVJA 2NTJA 4FJ1A 4OO3A 4R3NA 3E9NA 1HSOA 1P0FA 4G5HA 3S8MA 4BKOA 3DZHA 1VKOA 3INGA 1A7AA 4LGVA 4LCJA 2Q50A 2Y1GA 3VPXA 1U7TA 1TEHA 5I7SA 4BNZA 1BVUA 1LC3A 3E18A 4AJPA 4TRJA 2BGLA 1U8FO 1GADO 3WGGA 2TMDA 2IRWA 3S1LA 3GMSA 3WLEA 2X86A 1EFKA 2DPHA 4QX6A 1SEPA 4BB6A 3KLMX 2VTDA 3EYWA 1GQQA 2J8ZA 3B1JA 4NFHA 3ZWCA 4LISA 1JAYA 1UDCA 2X9NA 2JFHA 1UDBA 1KC3A 3NGLA 3C1AA 3GFBA 4EUEA 4CMCA 5A02A 5B4VA 4BUCA 3ABIA 3NKLA 1LQUA 2FWMX 3W6ZA 4AL4A 5L7YA 1U3WA 1UJMA 3L0DA 3L6EA 4P4NA 5THKA 4J2HA 1Z82A 3F6YA 1EE9A 1ONPA 2EHDA 1OMOA 3FNFA 1KEVA 4PG5A 3JQFA 4BOYA 2Y99A 3KM0A 1C0LA 4IINA 3OEYA 2YHIB 5JMWA 1DOHA 3QWAA 5EJ2A 5AXDA 1VL8A 1QV6A 2OO5A 4ZQHA 1T24A 3JD3A 3OP4A 2FPIA 4Z6KA 1LA2A 3AK4A 3I9LA 2Y68A 4EZBA 1Q7CA 5CEFA 4PG7A 1LNQA 3VAZA 4BL5A 1KEWA 2I76A 3ORFA 1VLLA 1ISGA 4E2XA 5JDCA 1U8XX 2PA3A 4BO3A 3OJLA 1O9BA 3OQ6A 3ZNPA 4ROSA 4XWYA 1E3SA 4XRRA 1I3NA 5L53A 1YL6A 2AEFA 5L4SA 3MJ4A 3DBVO 3QV1A 3OA0A 3ZCXA 1JWBB 1DAPA 1WZIA 3PYMA 3WBFA 2GN4A 4TQGA 1OAAA 3W4JA 4GQAA 2A4KA 5B1YA 1IY8A 4BO4A 2Y0CA 1LXCA 3O8QB 3WGHA 2J6IA 1CJCA 4JROA 2HMTA 4FGSA 2EF1A 1QV7A 1B16A 5TJHA 4F46A 5HRUA 3AOEA 3EGOA 5JY1A 1NR7A 1WMBA 2OBYA 3CE6A 4NK5A 5IG2A 3GR6A 3DAFA 1EK6A 2P91A 1XWFA 2Y05A 1FDTA 3HHPA 3ETEA 5LC1A 4I5GA 2O3QA 2GLXA 2I67A 1WDLA 1B7GO 3DAPA 1CIVA 4XR9A 4XJSA 2HU2A 1LX6A 3ITDA 2O7QA 4YJHA 3ROKA 4PRLA 1N2SA 3INTA 4IQ0A 2XXJA 1QORA 2EG9A 4XQEA 5C5IA 5B12A 3JQEA 4UUMA 5T64A 4K9DA 2XPCA 3EAGA 1LBEA 1FJHA 1CERA 2DU8A 3BMOA 5IDQA 1HEUA 4I9NA 5EESA 1T4BA 2G1UA 1H2HA 1GZ3A 4CQLB 2I6TA 5F5LA 4YR9A 2CF5A 2A9FA 5CDYA 5IFLA 5A9TA 3GUCA 1ML3A 4J9UE 3RC9A 3NT5A 2RIRA 4F3YA 5TC4A 3HNPA 4CM3A 2HKIA 3HQ4O 4RVFA 1LDEA 3IUPA 3ZWNA 4HV4A 1E3WB 2C59A 2C2YA 2B5VA 2ZQYA 2Y66A 3DEYX 4YWJA 3SC4A 3O38A 3TFOA 3WR5A 2P68A 4BMSA 1TVEA 3LU1A 1PGNA 3TN7A 5IDWA 2WDZA 3WS7A 4ID9A 4IBOA 2ZB8A 1ZMOA 3D4OA 4XYBA 2D59A 3NJ8A 1X15A 1LRKA 3O26A 3TNLA 2XOXA 1RM4A 1H9AA 3KBOA 5KVVA 3HDQA 3G17A 1C1DA 4GSLA 1JLLA 3MCVA 4QTZA 2FPPA 3RCBA 2WTBA 2C20A 4E31A 1LSOA 3VDRA 1XQ6A 3HJAA 5TX7A 1GEGA 3H9QA 1DC3A 3PIIA 4XGIA 3JQGB 3RFVA 5DDIP 3I4FA 4A27A 4XYMA 2RAFA 2X0RA 4NJOA 3WOHA 3PGXA 4XR4A 4YJGA 4FDAA 1QMGA 3GC6A 3UFXA 1BG6A 3QWIA 2VOJA 1XU9A 1DIBA 1AGNA 4D79A 4M86A 2YDXA 4W7IA 2DUUA 3I9NA 4BKQA 5JCJD 3Q2IA 4J90A 1YQGA 2BGMA 1Z7BA 4INAA 1XCBA 2WSBA 1R16A 1CF2O 4O59O 3A4VA 1LLUA 4XB2A 4BS9A 1RJWA 4D0SA 1Q0HA 4AFNA 4RPGA 4A73A 3KTDA 4YAJA 1Y8QA 4ITUA 1TT5A 1E7MA 1JTVA 4PRKA 5J23A 3RKRA 4BIIA 3JQDA 2AQIA 5JAZA 1IB6A 4ND4A 4WLVA 4Y8VA 5IZCA 3BMQB 5GZ1A 1P9LA 1LTHR 1M6WA 3QHAA 4R54A 3VPSA 3OMLA 2A94A 4CM7A 5JY6A 2J3KA 3NRCA 4CUZA 4MVJA 2A35A 1D1SA 1H94A 3BYZA 3JCZA 1RPNA 3HN2A 4HWKA 2GO1A 3RAJA 2UVDA 5KIAA 1AHIA 1MXFA 4PLYA 3RWBA 5HS4A 3R6DA 4XJTA 1K5HA 4CM9D 4CLRA 1HETA 5IXSA 3ZZNA 1ZBQA 3DBLA 1PJ2A 5A5EA 2IYPA 4A26A 3H3FA 4BKPA 2WE8A 4J4BA 1YWGO 1ENOA 4NR0A 2OOSA 1OFGA 1G6KA 3ZWYA 2Z1NA 1A9ZA 2LDBA 3NGXA 3VC7A 5L4LA 1C0IA 3DR3A 2SCUA 3D4NA 4IZHA 1KVTA 4CMKA 3D0OA 3JV7A 2VWGA 3K73O 4I5FA 3WGZA 1GFSA 1YJ8A 5DULA 3VH2A 3AM4A 1DC4A 2ZYDA 2ZB3A 3STHA 1ZJZA 1YONA 5IZCC 2D1YA 4LVCA 4RVDA 1P33A 2W2KB 3MTGA 4LVUA 4GX5A 3BTUA 5EERA 2GERA 2VWPA 4CM6A 1NFFA 3SLGA 3NTQA 4FB5A 1KETA 3WQRA 2QZ9A 3LLSA 2VUUA 4U5QA 4NMHA 1LC0A 1VJTA 1Y5MA 2O3JA 4M87A 4W82A 4XYLA 2NSDA 1E77A 1PWZA 2VT3A 4R1TA 4HUJA 4FQ8A 3D3WA 2O3SA 4PVDA 3CZRA 2ZJ0A 4HP8A 3CINA 3FCOA 1DFGA 1UP7A 3N74A 4RPHA 4E32A 2H6EA 2DBVO 2FPGA 3K6JA 4TWRA 1EK5A 5TS3A 3KRTA 4C7KA 4J2OA 5L40A 4J7UA 4CUJA 1PGJA 5ITWA 3GGOA 3IJPA 2BFAA 3B70A 3R0IA 4QXMA 3AUTA 4Z9XA 2DBZA 4GPD1 3O03A 1UXKA 2JKVA 2D8AA 2Q1SA 1ZW1A 2BI8A 3W8DA 4CUKA 4FFNA 3B20A 4D7AA 1U28A 3BZUA 4FW8A 5LDGA 4ALKA 1VSVA 3ANMA 1LDYA 1ISHA 3H5RA 3ZN2A 4MVJE 3A9WA 3HADA 4BGIA 1YQDA 3PWZA 5TT0A 4ONEA 5A06A 5JO9A 5JC1A 3PIDA 3WBBA 4AJHA 4WCDA 1Y8RA 4IIUA 4PFJA 1HDGO 4WEQA 4E4YA 2W98A 1IZ9A 2QYSA 3WGYA 5KTKA 2QX7A 3PHHA 1T2DA 2V6MA 3F4BA 2EJVA 4D41A 1GYPA 3I9JA 3U62A 2X0IA 4PLVA 2BELA 3R1IA 5I7VA 1N1GA 2I9PA 3HFSA 1ZCJA 3OF2A 3GNTA 1XDWA 2PGDA 4A0SA 2EEZA 1T1SA 4UVIA 4NJMA 3OICA 2DBRA 1O5IA 1ZFNA 5FWNA 1I3KA 1C1XA 5T5QA 3V8BA 4B79A 1BXZA 2Z95A 5ER6A 2JFFA 3KYDB 3WWYA 4DMMA 4FPXA 2ZJ1A 2UAGA 3GZ4A 1NP3A 4M1QA 5CPFA 1QP8A 2YFQA 3ITKA 3NT4A 2VT2A 4DYVA 1X1EA 2PY6A 2C07A 4WGGA 4BGVA 4OQYA 1UAGA 3PJGA 5JAIA 1V0JA 1MA0A 1QG6A 3GAZA 1S7CA 1Z74A 5JSFA 3TZ6A 1H2BA 2NACA 4TVOA 5EN4A 1W8DA 5IN5A 4YAKA 4WLUA 2GPTA 5U4QA 1Q7BA 1ZXLA 4HFNA 4EEXA 4OKNA 1UZMA 4TVBA 4IGEA 2P9CA 2PZJA 4PGFA 1G0OA 4DVJA 3T4EA 1JKJA 3UXYA 3OJEA 1V3TA 4YRBA 1HYEA 4Y6RA 3KYCB 2JCYA 4QQRA 4NPCA 2BF7A 2UDPA 1GQ2A 1HDCA 3VKUA 3RBVA 3RU9A 1DRVA 2HCTA 1MV8A 5DF1A 2EKLA 3AM3A 3FWZA 4PVCA 5I9LA 4P38A 4EGFA 1PJLA 4CQMB 2BFMA 1UUFA 3GDGA 3RUCA 4PLPA 4Y67A 3BMNB 4FOSA 5A04A 3K9QO 1GU7A 3CTMA 7ADHA 3HE3A 2GDZA 4MVJD 3RUIA 3PLRA 5DOZA 3KLPX 1PTJA 2E48A 4IJVA 4WECA 4NZ9A 1OI7A 2VYVD 4X54A 2PNFA 3WTBA 3WGIA 3NUGA 2HMWA 1CWUA 4J49A 2VRCD 4MVJM 4YJFA 1I3LA 1BXKA 1YVEI 5BT9A 3C1OA 1N9GB 3HDHA 1I32A 4NDNE 3IL2A 3DONA 1HYHA 3L4BA 3M1AA 4FSHA 2NVWA 3QA9A 3T7EA 3BXXA 2EKQA 2W4QA 4BNVA 1GCUA 3GVHA 3ZHYA 3G1TA 4S3MA 3DFUA 4JN6B 1NTOA 4ZQEA 1D3AA 4IXTA 2PWZA 2ZQZA 1R4MB 1VM6A 1AHHA 1RYDA 1DHRA 3JQAD 1I30A 1P1KA 1P45A 4NFYA 3EY4A 1FXSA 4HFMA 1E92A 3OSUA 5CG1A 3NDIA 4N5MA 2X22A 3W4IA 3RU7A 5F1KA 3GHHA 1PJQA 3H65A 1ZSVA 1B15A 2B5WA 4GGOA 4CV2A 1EE2A 4WCFB 3W8FA 4YBZA 5JW6A 1YOVA 3AFNA 1IE3A 4IDBA 1SEVA 5IDXA 2YV2A 5IF3A 4UEJA 5DBGA 3DBRB 3L9XA 2EKPA 2RHCA 4ZA2A 2X58A 3D3EA 3C3XA 4Q3AA 2P4QA 4CR7A 1ULUA 3GY0A 3KVOA 2IXBA 1HDXA 1U5CA 4GMFA 1B26A 3AFMA 3W6UA 4DMLA 2HUNA 5HA5A 4PG6A 8LDHA 2GN6A 3OQ1A 2WD8A 1DFHA 4DPKA 4OJNA 7MDHA 2D4AA 4BVAA 5EPOA 3ST7A 3H8VA 4OMUA 4XDYA 1QYDA 1KC1A 4WE3A 4DREA 3TSCA 2Y67A 2OHXA 4EUFA 3RUFA 4GGPA 1ZMTA 3K30A 4ZD6A 1JU9A 4CM4B 2I66A 1I01A 1DJNA 4OXKA 2B83A 2HMUA 3U4HA 1ISJA 1BRMA 3F47A 3F5SA 1R0KA 1U9JA 4WLNA 1LDBA 3S55A 2YV1A 1N7HA 5ADHA 1I0ZA 1HSZA 2BMAA 3H6KA 4GLLA 4NK4A 3TF5A 2UYYA 4RDIA 5TSDA 4K28A 1RM0A 4GH5A 4GI2A 4AG3A 4ALNA 1XKQA 3OETA 4AJ2A 2EP7A 2NNLD 3QVXA 4I08A 1PJBA 1SPXA 2HJRA 5L7WA 4E12A 2E6UX 4R1NA 1UXGA 1KERA 5JNLA 2WEKA 3WGTA 1A9YA 2ZTVA 3WGQA 3ZU3A 1T25A 4BNJA 4B3IA 3C7AA 1DSSG 2YFHA 4KTVE 3C1TA 1IPFA 3Q1LA 4NBWA 2QIOA 2CNBA 2AG8A 4FFLA 4WNCA 2CMDA 2AG5A 1IZ0A 3AI2A 5KJEA 3E9MA 4FC7A 4ND3A 3JD1A 4BNWA 2PR2A 4NH4A 3UW3A 1F14A 1H0KA 3LF1A 3QWHA 3WFJA 5JO0A 1EVZA 3OH8A 4Z3KA 3AI3A 3GDOA 2FZWA 4BGUA 4R51A 4D0RA 1JN0A 2R6JA 4WKGA 1WDKA 1YO6A 4HFJA 4MVJI 2FN7A 3EDMA 4FFPA 5COBA 4ALJA 1ONOA 5I9NA 2YW9A 4H16A 3DZIA 4Z3DA 1XQ1A 3RASA 4RZIA 4XEHA 3QY9A 4PG4A 3DC2A 3VZRA 2X5KO 4KUEA 1GZ4A 5AXAA 1YDEA 4BO0A 3I9MA 4CMIA 5I7FA 3GOHA 2W90A 5IN4A 3LT4A 1HDZA 2YHUA 9LDTA 3S2EA 3KV3O 1UR5A 3RC1A 3BAZA 1H6DA 2NLOA 4AICA 4ZQBA 2CZCA 2QW8A 3ZW9A 4ND1A 4RJTA 3ZI0A 3ONEA 2CDCA 4R3WA 2BFOA 2PZLA 3RBZA 2HK9A 1LLQA 2POQX 3RUHA 3FTPA 1VPDA 1SC6A 4KDEA 1ZJYA 1E0DA 2JJYA 2PTGA 1U2DA 2O3UA 4BNMA 3E8XA 2HLPA 1P3DA 1TA4A 3LC7O 4E3ZA 1EZ4A 3NEPX 1E1KA 3WSVA 4U0KA 1GEEA 1XEAA 3LT0A 1P44A 3OJFA 5ER9A 5KNLA 4CL8A 1R4NB 1PQPA 5DNAA 3CZMA 5EMHA 1PGOA 2PD4A 3AJRA 2VWHA 4BO8A 5CAEA 4CLHA 1XIVA 3MZ0A 3PFWO 4KUGA 1Y6JA 4RV9A 2PKRA 3GVIA 1LDGA 3DMTA 2PK3A 3BTVA 1BW9B 3PJEA 3M6IA 2BFPA 2ZYAA 4J3FA 3WMXA 3VVCA 4JXKA 4OKIA 3U4CA 1UH5A 3F1LA 4BQRA 1HE2A 4CMGA 1QYCA 2ZTLA 3IUSA 4GBJA 4LSWA 2HO5A 2AQ8A 1DAOA 3A06A 3CSDA 3PDJA 4HFRA 5A9RA 3GHYA 2D5CA 4RZHA 1SAYA 5DOVA 1Z73A 2YY7A 3IMFA 1WMAA 2OP0A 1KOLA 1ZZEA 5CHEA 1A7KA 1E3IA 1PJTA 1TT7A 2EIHA 3BMCB 1PZGA 4GKVA 3TPCA 4RPJA 4M49A 2IDZA 2IODA 3VKVA 2CD9A 3FI9A 1OC4A 1HZZA 5K0ZA 5TJ9A 4WPGA 4BO6A 5BNTA 4CQLA 1DIGA 4L0QA 2UUOA 3ENNA 2JFGA 4CLDA 2QRLA 4Q3DA 5JYEA 3JTMA 3G3EA 2CY0A 4BHTA 2DLDA 2GN9A 4FJ2A 2JCVA 3PYLA 3GK3A 1EDOA 3PRJA 1ORRA 1UXJA 3DMTC 2I65A 5B4UA 3I52A 4G81A 4NQZA 1IPEA 1AXGA 2V6GA 1ZEJA 3G1UA 4J1QA 4IM7A 1GPDG 3E82A 4JJIA 1JA9A 3HWRA 4XQCA 3X2EA 1MX3A 2G0TA 4GWGA 5ENDA 2GZ3A 2NQ8A 2A92A 3MWDB 1DLJA 1YB5A 2PFGA 2Q1UA 1E3JA 4PCVA 2DUWA 1QSGA 3KO8A 1R0LA 1TXGA 4BB5A 1DLIA 4AJOA 2FSSA 3JQGA 4HKTA 4YB8A 1NVGA 1GQYA 3PHGA 1Y81A 2GUGA 1Q7GA 3VH3A 4MINA 5CDSA 1KVSA 3A1NA 3K2EA 2XAAA 5I8WA 1JVSA 1QYWA 1O89A 4Y6PA 4DIBA 3ZV3A 2Q2VA 3S2IA 3VDQA 5FI5A 1E6WA 1O8CA 3HZZA 1SOVA 3GG2A 5C7LO 4XIYA 1NPYA 3FBGA 5DZSA 5BNIA 3F5QA 3WQQA 2ZK7A 4PZDA 1GUFA 3RKUA 4O6VA 4YXFA 2X5JO 3L6DA 1EQUA 1ADBA 1QXSA 3ADOA 3ZV4A 1GUZA 3BMQA 3PWSA 3UN1A 4JBHA 4R1UA 3A28A 1AN9A 4RORA 4RF5A 3GZNB 4LK3A 3WXBA 1YGYA 2HMSA 3DZGA 4OXNA 5U1PA 5JFOA 2WM3A 2AEMA 4CM8B 4G2NA 5EINA 1EBFA 2X0NA 4PLCA 3OFSA 3Q9NA 4ALMA 5K6AC 4AJEA 3GAFA 3ICPA 1YBMA 2B69A 4HNHA 3DHEA 1AXEA 4MKRA 1DFIA 3ZHBA 5JS6A 4DPLA 3DZKA 5A3VA 1DRWA 3AM5A 3ZWMA 4LCEA 1PU2A 3ICCA 5TLSA 4OSPA 3O4RA 1KYQA 5EQDA 4D46A 1ZO8A 4J1SA 5KWEA 1SMKA 3ADPA 2DKNA 2WJPA 3PWKA 4KMSA 4XYGA 2NVUB 5IZ4A 4FFRA 4R68A 3IOYA 3G0OA 2JAHA 4QO8A 3DBHB 3H9UA 4E5YA 1H6AA 3FNEA 4A03A 3K92A 5A05A 3RC2A 2W2KA 1IL0A 1O95A 1UXHA 2YV3A 1GZ6A 1PL8A 1H93A 2FRDA 3L77A 4OL9A 3VPFA 1WAMA 1B8VA 1U4SA 4A2CA 1VC2A 4GX1A 1PX0A 1D8AA 1H6BA 3GGGA 3LYLA 1R15A 3PLNA 3V2HA 1U3VA 3MWEB 5L51A 3W8EA 1D7OA 1LQTA 3IJRA 2C7GA 3QVWA 4RQUA 1K2WA 1SBYA 1WDMA 3BA1A 3GRPA 3U4IA 4UREA 4BV8A 4DL9A 3KEOA 3L6OO 4LMRA 3BMOB 2CVQA 3UCEA 2AE1A 3H9EO 2TMGA 4UVEA 3DMYA 2C0CA 4XKJA 1K6JA 4DYDA 4Q3EA 2GZ1A 2O3RA 2PGLA 4E2YA 1R0SA 4CM5A 1V6AA 4BNGA 1B3BA 3T4XA 2PLAA 4IDFA 3GVXA 3UVEA 3WYEA 3MOGA 4RVUA 4B8ZA 3BTSA 4N7RA 3K31A 1QLHA 5DCWA 1FDSA 1BGVA 4XCVA 3LK7A 5COAA 1YBVA 1R12A 4L74A 4GL4A 5BNFA 4RL6A 1AUPA 2I3GA 1BTOA 1QKIA 1VRWA 2NU7A 1PIWA 5MDHA 5G4KB 5KKAA 3G49A 2CFCA 3MJSA 1VKNA 3JQ7B 4JJFA 2GF2A 3IDSA 1PJ3A 3PZBA 5AOVA 3V1TC 3D5QA 3GEGA 5A9SB 2B35A 5G2OA 5DBFA 3ZNQA 4J0EA 3L07A 1KEPA 1SB9A 5EQFA 1YRLA 2FR1A 3HFGA 1A71A 3GVPA 3PEFA 5CPBA 4YAEA 3TL3A 3W1VA 4UVGA 3LC2O 4U8GA 2I3AA 2UUPA 4UULA 4K6FA 1ISIA
chains in the Genus database with same CATH superfamily
2AOWA 1QHHB 4FIZA 2IGBA 5KREA 2FETA 4MPRA 3DQPA 3NWEA 4EMSA 4DGQA 2M6SA 2J3DA 2ECKA 2AOTA 4HSGA 3DT8A 1WOYA 1L0BA 2QD5A 3IIMA 3TOCA 2GPBA 3E3NA 4WKBA 4CKCA 2F00A 2ZIAA 1FOEB 4C3UA 3KWLA 4OAQA 4J94A 1L7RA 1GAEO 1TQ8A 3VU8A 2QORA 1I2MA 1E2LA 4UD6A 1NVBA 2XMSA 1L7QA 4PYOA 2Q9UA 2ZBUA 5HE8A 1V8BA 2ZYGA 4N65A 2OFXA 1NQ5A 4QBTA 2FSFA 4M9RA 4KXFB 4J16A 3GRCA 1QVWA 2H5IA 2QPAA 5LZ8A 3UJCA 1TTPB 3VFDA 3EPPA 2GA8A 5GTDA 2D5LA 1FDVA 2DC1A 6ABPA 1JWAB 3RUDA 4II3A 4A0GA 1GNLA 3LLCA 1RS0A 2WAMA 3I2IA 3IUJA 1UL1X 2C4UA 4RKQA 2EBWA 1EUQA 3PNKA 3GRYA 4NS1A 5KCZA 4BMPB 1KO4A 1U1CA 1PJSA 3HYSA 4JUCA 2VDLB 3WWPA 1P75A 4JLMA 1QPBA 4G1CA 3WTCA 4HX5A 2C82A 4LMPA 4RVSA 1TZKA 1W0JA 3F6EX 2ZRHA 4WH0A 4W8OA 3A6HA 1LRJA 2WF8A 4U2CA 1YE5A 4MQFB 1NC3A 3CUWA 4EABA 3PNVA 1GKUB 3HXKA 4UARA 2JLYA 4DV5B 1SXHA 2O8CA 1VSBA 3IHKA 2ZWPA 4X00A 5DMHA 1YHZA 2XLBA 1XFDA 4DWJA 1SUDA 1JTFA 1YL5A 3SF8A 3CURA 3AERA 1UKZA 1ZLXA 1NI4B 4LYFA 3MWJA 4TKMA 4CMBA 1L5LA 4ZCTA 4CKXA 3EWIA 3EXG2 4RC9A 3TINA 1KOJA 1T5SA 3ML1A 4E2ZA 1TAGA 3NOQA 5LA6A 1V7PC 5KAMA 4XDGA 1LFAA 4Q9NA 4BLSA 1NFQA 2VATA 1Q0LA 3BD7A 3T6KA 3WA6A 3WYCA 4BEWA 1ESMA 4QPCA 1Z29A 1NFRA 2HT6A 3O3MB 3WB0A 5H7XA 2MYNA 4DC0A 1HX7A 1JEQA 1ZM2A 2QHXA 5B55A 1N6IA 1XCMA 3TIFA 4BB9A 2NZUG 3H2HA 3KOWA 4IUYA 5K0JA 2DT5A 2WYWA 3LUFA 1NA5A 4G5OA 5EJ9A 3O9MA 5E6RB 2J07A 3R5SA 4AG6A 5D2CA 2DR2A 2OC4A 1RSZA 3ET5A 1SVIA 3ENQA 2EJUA 3GFVA 3MS4A 4HRYA 4K1LA 4EYGA 4BXOA 3MA0A 3B36A 1WXFA 4DZRA 4KWIA 1Z3IX 2FPRA 3WNZA 3F9RA 3BQMB 1C4XA 4NU0A 5KQRA 3S1SA 5D1HA 4UHJA 3QVUA 1WEKA 4PYLA 1RRVA 3Q85A 4D8UA 5EP4A 4OUKX 2FHSA 2REOA 4ZK2A 1NWCA 4H3HB 1TM2A 3WMWA 2WF5A 4WV3A 1NASA 4FOPA 1Q1NA 2X2OA 1BO6A 4TV8A 1J1IA 1W75A 1X7YB 4GT1A 5H02A 1OFUA 1U90A 3N3AC 2UV8A 3ODGA 5HG0A 4W1SA 4IH4A 2Y1DA 5IVKA 2QQ0A 4WI1A 3MJTA 1QQ6A 1UIMA 3DBIA 1QHGA 4H15A 4J3NA 3NAMA 4LXHA 5AM0A 4LZJA 5EOVA 3RIGA 4NI5A 4Y2YA 1QH1B 5E1BA 3K0SA 3RWOA 1NP7A 3U5TA 3STTA 1D4OA 1SCNE 4IV0A 1LBHA 2VNAA 3KZVA 3MTIA 2BGUA 1ONNA 5E8JA 1D2NA 1MEOA 1PFKA 1EVIA 1KIMA 5DCLA 1I1HA 2QY9A 3AR7A 2GEUA 5DYYA 2NAPA 1XC7A 5KQMA 1BWSA 4HBZA 5JTUA 2P2NA 4HQRA 4E0BA 1XTPA 3ACBA 4ND5A 2XV1A 1D2MA 1FSFA 1GTZA 2JBAB 2X1VA 2ZAYA 3LLMA 3TBKA 3T1YB 2XMZA 2BH2A 4XM2A 1E7SA 1JXQA 2H4WA 3WMFA 3F6CA 4FUQA 3M7IA 5DISB 5AR1A 3D6VA 3KK0A 3TLKA 1WXIA 2PO5A 4DE5A 5LMZA 1I5RA 1JECA 2QI9F 4K0KB 3SR3A 3ELWA 2AHRA 5GWXA 1P9WA 2DHEA 2F90A 3ZXYA 1JI0A 2YIDA 4MUNA 2QW1A 1DAEA 1KRWA 1RQLA 5HWSA 2V6BA 3ZR4B 4UHEA 2OCIA 2PSFA 4W6QA 2C00A 1W73A 5CG2A 3RU2A 3Q8XB 2VJCA 4GE0A 4GMGA 4F9EA 3CS3A 1KI7A 5AM1A 1QTNA 1I7LA 4KBYA 4LFCB 5KYTA 3NATA 2A33A 2BM8A 4FLMA 3GJ5A 4RF2A 1KPHA 4YJDA 4A8TA 2JW5A 4RGBA 5KSPA 3GPIA 1BFDA 1NURA 5FPKA 4NG4A 4IZIA 4R2JA 1VLJA 3PRKE 1D2AA 4UE6A 2X13A 4BJHB 2D1RA 2IU0A 3LVQE 1Q77A 2ZDGA 2AJ8A 2CNLA 2JG3A 1BDBA 1O54A 1U9IC 2JD2A 1A9PA 4GVXA 4MUHA 5CTAA 2Q7DA 3WFIA 5KPJA 2VN8A 3JQBC 5LLTA 1SNYA 2BFFB 3FWHA 1YVDA 3F4LA 4R2XA 2AF3C 2WM8A 2OCDA 4IPTA 1IIRA 3H4VA 4MMXB 1Q1EA 3HYRA 3I3OA 4YO7A 1JB1A 2NV6A 1RP1A 3U7JA 2FK7A 3DLIA 5JZOA 4IF4A 4KQMA 1N7GA 4N0DA 4FOOA 2X8AA 4YA6A 3JVEA 4QG3A 1VYHA 2W2LA 3JPWA 4DV7B 2DFLA 2ZCUA 1GKIA 1RIFA 4IFBA 4RL4A 3VUFA 4DQXA 3MUEA 5D00A 1NQOA 4LXTA 5DGIA 3QU2A 5IT4A 1YCHA 3V4LA 1FFDA 3FSEA 4RJIA 4N1AA 5CP8A 3ZCRA 4K9LA 3OE7A 4O2AB 2M98A 4YMIA 1QGED 2YIJA 3T5TA 3CG4A 3KZMA 3N53A 5JZBA 3PI7A 1NXOA 1HDIA 1JR3D 1RXCA 4I9HA 4H3VA 5LPNA 4H7EA 5DNEA 5LIRA 2N0SA 1N5OX 2B8TA 2PZFA 2JZNA 3RYHA 3Q3CA 4CLOB 4YUVA 4P3NA 2O2JA 5JPIA 3T7CA 3FVRA 2GEDA 1WHTA 4RXTA 3MHTA 5HKBA 2RGRA 3P97A 3D7NA 5AKEA 2AHOA 3STWA 4EZIA 3SVZA 3R9KA 4UVHA 3NIBA 2E3JA 4F12A 1J0CA 4D9CA 2B6HA 4YNBA 1P80A 3IPAA 4LY6A 4OQQA 3U48A 4B71A 2COEA 3CX3A 4C9BA 4AI6A 3D59A 4WINA 4C0KA 1QB7A 4DRXA 3RHZA 4X90A 1T5HX 5DGTA 4W7SA 1R0YA 1YZNA 3C6MA 2ZR9A 3I34X 1N4AA 3X1ZA 4BFTA 4KO2S 3PRHA 1I4OA 3NIGB 4QBIA 4BNLA 5HVNA 1QHFA 4LWQA 1PT9A 2OWDA 5A5GA 2AC7A 3T0IA 1VJGA 1KIFA 3OAAD 3H9BA 2JFYA 1U2TA 4TN5A 3H97A 3NVDA 2OBMA 3PZRA 4NYJR 3VPBA 5HCIA 2G9VA 2WUVA 2PUDA 1IOLA 5AESA 4EUHA 5MGBA 1FS6A 3NBQA 3PQFA 3VO2A 3WKBA 2A5JA 1GFWA 1TRHA 3E5RA 3TW8A 4ZJPA 5BN1A 3AV3A 3QEOA 4MR8A 3W2TA 1GA4A 3AVXA 1DBIA 3GQBA 2CLEB 4B3BA 1UJ2A 2O2SA 4D3XA 3GDFA 3VC1A 2AMYA 4O1HA 1EX7A 4AC9A 2PZAA 1OGYA 4QGGA 3CLUD 3BRCA 3OOJA 1OX6A 3DHNA 2GEVA 4BZQA 4EYEA 1D04A 3B82A 4G24A 2AMFA 5DX8A 4QOFA 1MB9A 4QYWA 4IDAA 1GL9B 2GN8A 3A26A 3M8KA 4POAA 2HJGA 4DSZA 1E98A 1J0AA 1ZHFA 4F92B 1XELA 5KVAA 4N41A 5IJAA 1UMBA 1FTWA 3N6VA 3RSZA 1YA6A 4OHPA 2TS1A 4KPUA 4BVJA 1SCIA 2AKAB 3AI1A 3MD9A 3NH6A 4W63A 1KQFA 4MDEA 1GKLA 2ZSUA 2IPLA 2Z43A 1XSEA 1G4HA 1VCHA 1CQIA 2Q0QA 4OGWA 2EBUA 1WPQA 2PCJA 4BN4A 5G0UA 5KTNA 5IHXA 2H1OA 4XIIA 3OIDA 3TSZA 5SV2A 1Y3AA 4IVPA 4I4CA 4FZJA 3BEOA 1PGPA 2GCOA 4ZQIA 3SXPA 2ZCJA 4F4HA 1R37A 1M8FA 1PWXA 1U6JA 2GZAA 2OCLA 4UNSA 4YBRA 1Z7WA 4G0ZA 4WDQA 1DEKA 3QLEA 2V7PA 2PAAA 1W581 5T8KC 5FL7D 3IDQA 1JAXA 4HDRA 5B53A 2FP4A 3KWMA 1EA7A 3UEOA 3GFTA 1N3IA 2YJZA 3TB4A 3WDSA 1XJQA 1CR4A 1KSJA 3M5PA 3NBAA 4WBXC 1BW9A 1SC3A 5AW4A 1V2GA 1S9HA 5IT9A 4YCDA 2X14A 3FYDA 2Q2NA 1U5AA 2Z3VA 3BCRA 1AK1A 2EFYA 4Y6OA 3F96A 4NKRA 4NNOA 3R7DA 4ARUA 4CODB 5E6SA 4MYTA 4HDQB 4C78A 5GIPE 3JWGA 1XPUA 2J7PA 4RTPA 1F1BA 2G0AA 1KYIA 1NC1A 3C6ZA 3UBTA 1XA0A 1UINA 1Z6ZA 3CKLA 5BMVA 2ZJ2A 3KXLA 2Z0MA 2YHIA 5MFZA 1R3DA 4RSMA 1J22A 2NG1A 2VK4A 1ICEA 2C5AA 1D2EA 4QDXA 3RRJA 4AQ7A 4YT2A 3AVWA 2VHJA 3BMCA 4UNRA 1X9IA 5AVQA 1WDTA 1L7BA 3JPYA 1CRPA 1WZUA 1C9DB 3IKTA 2EW8A 2IW1A 1MQSA 2FOLA 2BTQA 2V3VA 5FAXA 5LP6B 2VTBB 2X6TA 2VDQB 3VO8A 1YR3A 3TWOA 2QL7A 1BVRA 3U3OA 2EZ4A 1YUNA 3F67A 2VOEA 3V34A 4G6ZA 5JROA 2VBGA 1X7GA 4MS1A 4WAUA 4H3KB 3VO9A 4BO7A 3QYAA 1VI5A 3FRJA 4MCIA 1N78A 1XU7A 4ILEA 1ANKA 1TMYA 2Q0SA 3LL7A 1G8KA 1G6Q1 1TVKA 4QT0A 4C4SA 2JK1A 4GU5A 2QTVB 3WDKA 4EFKA 4P81A 4V0SA 4CPDA 2BR3A 1GUYA 2IFTA 3PFHA 3KUCA 3UH0A 4F6LA 4GVLA 3PKJA 4AYXA 2UXDB 3P2EA 2L17A 1FL9A 3QPWA 2AJBA 3MLEA 2GZRA 2QUKA 3LP8A 3QU7A 4IZ6A 2OCPA 2B2NA 1HGXA 1Q0ZA 1RC0A 3IJEB 3L5KA 4J4HA 4C30A 4DA9A 2W8ZA 4ZICA 4GPBA 1CP2A 1HE1C 2GRAA 2XHZA 1FLAA 3A9RA 3PPVA 1I4EB 1JSLA 4JITA 4S1OA 4D5EA 2ZTUA 4QUDA 1OXXK 2AD5A 4OSEA 3AFIA 2VLIA 5CRIA 4WADA 3KYBA 1IBLB 4C6RA 1W4AA 1RI3A 4HNQA 4BVLA 3ED1A 4Z8XA 3FNBA 3O2NA 3EWSA 3SJCA 1X9HA 2C5BA 3X1WA 1EWTA 1Z62A 1MO6A 3ND7A 4MKXA 3BN3A 4FOTA 4KQWA 1XD8A 3RQSA 2XJ4A 4AJNA 2ZJYA 5BUSA 1ID1A 1XCLA 1C7RA 1Q12A 3FA2A 3P9PA 1UEJA 2C5FA 2ZDQA 3X1XA 3GPLA 2BGIA 2OO3A 3GJRA 1VGQA 4CMIB 1H0SA 3FPHA 2XXBA 3BWMA 1PL6A 2G1PA 3Q8MA 3A1VA 1ECJA 1JBQA 2JB9A 4DWVA 5E38A 2FSVC 1UP6A 2ILTA 1IZYA 1IRXA 2ZG6A 3OQPA 5EKTA 1XD2B 2F59A 4HX9A 3G0HA 3V33A 4TQAA 3FNGA 4IJ6A 5LQUA 3VUEA 2O8BB 1CVRA 4QGAA 3LT5A 4FLEA 3SHVA 4M22A 4MP8A 2E87A 1F8YA 4BO1A 3L05A 5B64A 1UP4A 2GWRA 1E3WA 4LZLA 4LSGA 3EA0A 4RABA 3IRUA 2X0EA 4UPVA 2YHSA 2QU8A 2C2ZA 4MJLA 4CM8A 3IDOA 4TMYA 5KQGA 1KJWA 4F38A 2GR9A 2H63A 3QOYA 4C0SA 4QODA 5ALQA 3NYQA 1XR3A 2OSBA 3D02A 1KZHA 4D9BA 1VG0B 1JIIA 3FVQA 3SK0A 1KOFA 3DG9A 1ZK3A 2Z58A 3U16A 3FR7A 1CR0A 4WW0A 1WCYA 2CFSA 3I6IA 1KS2A 3B6MA 4R2LA 5HKOA 4ROTA 2P9BA 4PAGA 3O3OB 3PJDA 2NO5A 3MUNA 4MGZR 3RG8A 2JL1A 2AWNA 3BB1A 2IE0A 4OHBA 3GH3A 3KZ1E 4KG7A 2JHFA 2WAXA 4YT5A 4WSOA 4ZO7A 2VNIA 1Y3HA 3DZJA 3OECA 4FGZA 2VF4X 5NLLA 4AW9A 4OHYA 3WVNA 1DHTA 5B3JC 3QUCA 4QDTA 1VE1A 4KWHA 3JYHA 3ELUA 4IY1A 4M0UA 2BI4A 1H69A 3HACA 4GX2A 6YASA 2AN5A 2NVUA 1P2FA 3A32A 1N6NA 2VDPB 4JLSA 3ETDA 3INRA 2IV7A 2VZLA 4DBZA 1F3OA 5FOQA 1Z4PX 4QT4A 1RRGA 2YZ7A 3OKCA 3RVJA 1G1AA 4E7PA 3CPSA 1DVRA 5DKFA 1FTSA 3ZD6A 1HRDA 4HY3A 3RTCA 5B2ZA 4G89A 1ODCA 1WOMA 3L1VA 2QD1A 4AM8A 3TEFA 4L4UA 2E49A 2YVKA 4P3OA 5C53B 4ADSG 4KQEA 2G0NA 4ZAYA 1E8DA 2V3WA 3B2QA 5B1HA 5A1TA 2QQGA 2VUSA 3IXQA 4X1KB 2VQEB 1N6LA 2WHPA 1PE0A 5LYJF 3F49S 1BCSB 2LIPA 2O6HA 3OZVA 1TAQA 4BBJA 1B0ZA 1K6IA 4M0EA 4G9EA 1VCOA 2XQFA 4DIUA 1NNEA 5FWXA 2OP1A 3E5MA 3LDHA 3HVRA 1KU6A 4RVCA 3MTDA 4HWRA 4L4SA 5FWYB 5JHHB 5MF6A 3K4QA 1QNFA 1CR6A 4HZUB 5JCZA 1WF3A 1EM6A 2ZKLA 4ILKA 4FMCF 5LM3A 3FOFC 3NIDB 3V2IA 2IYAA 5D86A 1ZJWA 4B7CA 2C92A 4W5TA 2NU9A 4OFXA 3UJ8A 3RVDA 2FZGA 1KYXA 1E2PA 1SHZA 1L4MA 3WLRA 4YC7A 3LECA 2ZU6A 1N2IA 2BW0A 4JCCA 2WU8A 4NOLA 2MYTA 4NYMR 3GT4A 5BPHA 1W35A 3TLMA 4IW3B 4TKVB 4TRRA 2Q5QA 4Y2QA 2HCFA 3ESXA 2XYQA 3UJAA 4B3JA 4ENRA 3T0FA 4EFNA 4EDFA 5DSXA 1XN4A 4L22A 1WKBA 3EG9B 1Y7TA 3NUZA 2EARA 1GILA 4Q5IA 4LCBA 3V00A 3ZJ4A 3WHIA 5G4KA 4CLEA 3CIOA 5DYWA 1XHFA 3V9PA 2X2EA 4PTLA 3EZXA 3JQ7A 3NVKI 3D7LA 1A04A 2EFHB 1BJTA 2H9YA 4JD5A 4Q3NA 5E6UA 3RREA 1ZRSA 8ADHA 2OK7A 5JWHA 1PJCA 3AEUB 5A9SA 5JRZA 3UH1A 1Z63A 2YRFA 1BDHA 3HA5A 5CK5A 1WW2A 3AF0A 3I73A 2A59A 4YQZA 3CPEA 1NAIA 1YXMA 3QNMA 3PDIB 1Y3BE 3PHBE 1JHOA 2C8KA 1N6PA 3MCWA 2H8GA 2A1UB 4IQGA 2PUEA 2J59A 4JSTA 3MB5A 1EXDA 2Q6TA 2CXNA 3NHAA 5BY2A 1QHHA 2BRUA 2IC5A 2V7UA 1ZNQO 1CUSA 2IXTA 2B4AA 3I83A 5A0VA 3L6RA 3NTLA 3UHFA 5ALRA 3HXQA 5HTKA 3A36A 4LA4A 1XL0A 4TZKA 1UDXA 4B9AA 2ZUDA 4RKFA 4U6SA 3ZVLA 1ISFA 5ALXA 1DAHA 2BZGA 1XQYA 2Q07A 1BN7A 1RYHA 3GAMA 4HPWA 1OXUA 2CT8A 3NTRA 3Q8LA 3T61A 2Q1YA 3EEQA 3G5AA 1WM1A 4FFOA 1NVWQ 3TM5A 2BDUA 1GUAA 2AKYA 1XB2A 4E5NA 1NF9A 4FE3A 2BAGA 4I55F 3E84A 3RROA 4JYBA 3MMPA 2XVZA 2NPFA 5HE9A 4F1JA 4PAMA 3KT8A 3B12A 5A62A 4BO2A 4DPMA 2EYUA 3M4YA 3WISA 2A0XA 1CXZA 3KB6A 4FM9A 4RK1A 4M9UA 4YLYA 1GGHA 2V7VA 4FT4A 4G84A 2IYSA 3EVZA 3MBIA 3FF4A 4X1YB 5JS2A 5A2GA 5KNBD 1ISPA 2R97A 2VYVA 1CZUA 4TWZA 3NDRA 2QLTA 4NV1A 2R5WA 5CNIA 9LDBA 4KX5A 3AW9A 3C1UA 2IXAA 3KUXA 1TO6A 3P9RA 1NQVA 3QHQA 4OVKA 4TSFA 5TRTA 1F8UA 3LA6A 4BMZA 4D92A 1DIAA 1ADJA 3WIDA 1Z5UA 3NWJA 4EJSC 1KAGA 2FPUA 3LY8A 4ACAA 4ZJYA 3A9CA 1BCRB 4JYZA 2YHBA 1NLUA 2I03A 1NBEA 3KUUA 4MQFA 4S0XA 3A9SA 4QTYA 2WB2A 1XLTA 1C8BA 3QSYA 3RRZA 1GDHA 1IRIA 2QTRA 2YW2A 3TNDA 5JD5A 1HK7A 1P9NA 4O4HB 2P9TA 1TM3E 3LUJA 2QT9A 1K7CA 3TYXA 2Z9DA 5KEIA 4M0KA 1DQPA 3A4MA 1PKEA 4JLUA 1OYWA 4DR2B 3JQ9A 5G53C 1JMKC 2VQDA 1EZZA 1JQ5A 5IKMA 1M66A 1N3LA 1U8CB 2IOHA 4UHKA 3USES 2CUKA 2ZRFA 3AJEA 4MR7B 5EGNA 3DDWA 3VR6A 1JI3A 4ZVUA 2OHIA 2JLCA 3L8YA 3HDYA 4JBGA 4CF4A 2ZT6A 2NO0A 1LSJA 1OJ7A 3DOFA 2BE7A 2GCNA 1YH3A 4C2UA 2VYND 3DHVA 4DIEA 4H1UA 1ILWA 2AUTA 4ZK6A 3TRJA 1XMSA 1G3UA 4QWWA 5F7OA 2GLUA 1RYMA 4N8EA 1AIPA 2PH1A 4YMWA 4IQ8A 1JEOA 4GQIA 2P6MA 3P0RA 1PG2A 2W00A 4XQ9A 3SOZA 3QELB 4B8WA 4F97A 4YMTA 1IBKB 4QYXA 1PR3A 4C3ZA 4QAQA 5TT1A 2CHFA 3EEOA 3G0CA 1QVAA 2P40A 4YRQA 5TGTA 2HSGA 3NALA 3ROQA 5E6RA 4OATA 2CCJA 1I8TA 4KZPA 3BGWA 4LJ7A 4RD6A 4HYYA 4XWAA 1M2WA 2HLHA 1ZQ1A 4KN6A 5CCEA 5GP1A 1R66A 4MVWA 4EY5A 1ZUD1 4RTRA 4BAUA 3CLRD 1XCGB 2KJQA 3A3YA 3NDPA 2P6NA 4NZMA 3GNQA 5DYTA 4E22A 5B6JA 4YY3B 1X7YA 4I8XA 1ISMA 1U0LA 3ANSA 3B6KA 4JU9A 1IUOA 4FGWA 2VTEA 4MV9A 3V8VA 4BMNA 1D4FA 1G3RA 4H77A 1Y9AA 3B53X 3HK2A 4HSEA 4Q1VA 2DFVA 3CWCA 1Y1SA 4TGLA 2QTLA 4LECA 5EJ4A 1E6UA 2HUPA 1PZEA 2DH6A 3EF1A 1QH1A 1O58A 4XWTA 4HOYA 2C5EA 2RBGA 2P9FA 3WMRA 5JNWA 3LDFA 3G0IA 3VNSA 4EB0A 1RWBA 4HWGA 3M9XA 3AQ4A 4IILA 3OEHA 3KXKA 3V8PA 1EK2A 1IQUA 3ZDFA 1J8QA 2BEVB 4HLNA 1IDOA 4P86A 1IYZA 2JBAA 4Q15A 1N2EA 2CFIA 2IS4A 2XT6A 1VBKA 3DOOA 1Y3DE 4HRAA 5EY5B 1HE5A 1OILA 1XQWA 3QUTA 5BRAA 2XCOA 1E0AA 3DLTA 1ZK1A 1A4UA 3B1KA 4MYRA 4I1YA 2ERXA 3AL3A 1G20B 4V02A 5L7TA 5HM8A 3H9JA 4DUGA 1U9YA 1NDQA 1Z2PX 1RYNA 3R20A 4IH1A 3Q9UA 3D4PA 5AUPB 4G8CA 2GYYA 3D1LA 1GR0A 4ZCQA 1LLCA 4B0PA 3HBAA 3H5OA 3N2LA 4YLEA 1GN8A 3KKOA 1TZMA 2A5GA 1H0HA 2GVNA 2FPGB 1G8HA 1H1TA 2CF6A 1Q1ZA 2VHCA 4TMKA 3DWFA 4JLKA 4WY5A 4OU4A 3PTZA 4OHUA 4X63A 1ZEMA 1UMDB 3DLCA 2QRZA 3CIFA 4JGBA 1KBZA 3DVAB 3W9BA 4L4XA 4P4SB 3WLQA 5CMLA 4DADA 2FMHA 4EJ0A 3I8OA 3DFKA 1U28C 5ED0A 2F1RA 3OD1A 3I4CA 3AP3A 1I6KA 2SICE 3DCYA 1OLXB 4QFCA 1YULA 1BH6A 4H31A 3H0EA 3I32A 4PBSA 4BFXA 2PUGA 4ZPJA 4DCTA 1JW9B 1PNQA 2G06A 1NKTA 2ZJ4A 3H0CA 3QPBA 1K92A 1RM5A 1RYZA 4N5HX 3SQDA 2AW5A 2WJIA 4GEGA 4ZZ3A 1XAGA 1E3DA 4L6CA 4C0AC 2BFFA 1KI6B 3HL4A 2BKAA 1BMTA 1LSSA 2HA7A 2ZR8A 3F90A 3IELA 5H83A 3RSCA 2ANBA 4KR6A 1C0EA 1PN3A 4MWGA 5BSEA 1MC8A 1ZQ9A 2CYAA 2DM6A 2X9LA 1K63A 3BGOS 3QWBA 4IMRA 5JASA 1DKPA 5F7ZA 3IIEA 5ECWA 2O2CA 1RYFA 2EC5A 4HXGA 4QQFA 4WLEA 4B4WA 4LC9A 5J1SB 3ROGA 2ZBEA 3R7SA 1VHLA 4P0PB 4Y2VA 1M7BA 4OH1A 4UNPA 3E9ZA 2BEUB 4MVJG 2HRZA 2PLFA 3AFGA 1XWIA 1QBGA 2OUIA 4L28A 5D5HA 5DLEA 5JQGB 2I1LA 2ISQA 4KWEA 1UBGA 2D3WA 2CUZA 2ZXUA 2WMDA 2Q5EA 3HXLA 4LWOA 1AKVA 1X3LA 2ZIXB 1OWLA 2WJVA 3AMVA 5DMXA 3R3ZA 5EE9A 1NVVR 4YPOA 5LXTB 1RVDA 3HO8A 2XQGA 1WY5A 2RE8A 1V3QE 4LI3X 1DIRA 4AJ1A 1WP4A 4TTIA 3I5UA 2M1ZA 3G79A 2XD9A 3VZPA 4FI3C 5DGXA 1RC8A 4PX5A 3DVLA 3IUEA 2PQ0A 1MOPA 3OQJA 4J1NA 4RQAA 2VJBA 4MEJA 4CLOA 4WEOA 1YIDA 1TK9A 1U2SA 2Q99A 1YRBA 1E3EA 2XWJI 3Q5EA 3TIXB 4HB2A 1GGNA 1A72A 2EW1A 2GRJA 1S8OA 2XRMA 4H2DA 4TT3A 1A7JA 3AP1A 1R9NA 1OTXA 5KVCA 2O59A 1UPTA 1AC5A 1Q15A 5TIIA 3WB1A 5HK9A 2FZ4A 4ZOCA 2EW2A 3D0QA 4DLAA 1WXEA 2IU3A 3F3SA 4ARBA 2O5EA 1ZVKA 5IWCA 2H1HA 3QE0A 3C7KA 3QFSA 1J5EB 1VSUA 1FMTA 3JZFA 1LV7A 3N0TA 4FK8A 5SY4A 1KQGA 2XUGA 4Q01A 5IBQA 4M8SA 3LT1A 3PFIA 5IT5A 2FLWA 3QTBA 2Q3DA 4EO9A 1S8AA 1JKJB 4AS1A 3PNOA 1P1HA 4FHGA 2K87A 4DJTA 1QF9A 1O7JA 3HUDA 1WA5A 3IVAA 4K9OA 4M6WB 1R18A 2C29D 5F1OA 2Y1KA 3LSYA 3EQZA 4YCAA 2WYIA 3W6PA 2ZUFA 2TMKA 4FFVA 4WHMA 5CM9C 2BHNA 1QDLB 1RYEA 3R6TA 3WGNA 1TJYA 5CCDA 2V9PA 3S3TA 5A0FA 2J3LA 1RI5A 2PUHA 4HDNB 5BMOA 5K1ZA 5J4LA 4K6MA 5AI5A 3S4YA 2QP9X 3MCTA 3G7UA 3M6FA 3IQGX 3MMXA 2VHXA 4R41A 4X0EA 3FTFA 2XADA 3A7EA 3AV0B 4M99A 1SUWA 4KXXA 1BHO1 2PQ2A 1Q16A 2EZTA 3GQVA 3O92A 4LYDA 1ILEA 2VHZA 1ZYUA 2H3HA 2VSQA 2XAUA 2I3DA 4Z1OA 4Z3OA 2B4QA 3Q1KA 3ZNNA 1VL6A 5K9ZA 4INJA 4O5OA 3ZTWA 3D7RA 5CD9A 2FCRA 1A5TA 2CVFA 2QRKA 4D98A 4BGDA 1Y4UA 3FOBA 3L4BC 1UKYA 2R7AA 2R66A 3FJYA 4MW2A 3HB5X 3PHCA 4GKAA 4YWJA 4WZBE 1MB4A 3BD8A 4DBVO 1CZRA 5DK6A 4RBNA 5K03A 1Z88A 2I34A 3PQEA 1N36B 2I5PO 2PMFA 4DHWA 3JS5A 4JI1B 3C5CA 3R5TA 3FBTA 4KSCA 5T3YA 1MG0A 1N5KA 5I01A 2C9YA 4UEOA 4RVHA 2ZUVA 1SBHA 3LUKA 3BILA 1M2FA 5E9WA 4J0JA 1H8HA 1FS4A 1KR2A 3W34A 4QAJA 3HBNA 5EFZA 4KWCA 4ATNA 4BLOA 4B3GA 1B8PA 2L69A 4EM6A 2ZULA 4GSKA 4HH3C 5EI5A 3TR5A 4IRMA 3PSAA 3UOGA 1ZVMA 3L7LA 1WR8A 3AIOA 4ZV4A 3Q72A 2JDIA 4EUKA 4D42A 1WXDA 4ISBA 4WBNF 4F4IA 1L4GA 1MH1A 3D7SA 1LPMA 2XZDA 3LOQA 1QO9A 4B44A 3U7FB 4R01A 2R65A 4DTCA 1IEQA 1Y6QA 3RTBA 4OJKA 4KQ6A 4YGYA 3CZ9A 3BPSA 3R76A 3AVUA 2FV8A 1YQ9A 3DA8A 4WN9B 2FMKA 1IPHA 1NRWA 3BS4A 4GMDA 4JOCA 3RS0A 1BQEA 2N1MA 1O6GA 1K2VN 1QVRA 5F51A 1ISRA 1Z2CA 4PNHA 4O4JA 2WVJA 2Q2WA 5B5SA 5LP6A 1CX9B 3GV0A 2VTBA 3HJHA 1F06A 2O2GA 4RD1A 4FT2A 4RLFA 5YASA 4FBMA 3FPBA 1AV6A 2V98A 3SX4A 421PA 4DYHA 2GCIA 3AKCA 3ETHA 4WA8A 2WSIA 5F5XA 4DSNA 5JBNA 1S2LA 4C4OA 4A82A 3U31A 5T4HA 3TZKA 5LMNB 1C3JA 3EJWA 5GY7A 1NZJA 1DPGA 3AZPA 4RHXA 5HKLA 4KQKA 4KEAA 4DMRA 4E11A 2CL0X 5K8IA 5J3JA 4M0DA 1CY0A 1T9GS 2OXFA 1I80A 3DFZA 3UAGA 2P78A 4PR3A 5K8CA 1FFXB 3ZJUA 4GIBA 3FFXA 4XD7A 3V7FA 4KU4A 4UTRA 4L5BA 4J03A 3HEMA 2VBIA 4Y6LA 3UYLA 1F0NA 2WJ3A 1TJNA 4LSMA 1P9OA 3AQIA 3FDIA 3QFRA 4G3XA 5LKRA 3Q7QA 1E0JA 5CDUA 4GP6A 3TZCA 1DEHA 2PGXA 4XEUA 2VDJA 2X7HA 5DM60 3Q6NA 4WK2B 3ZWWA 2BM9A 3ONWA 3PNYA 3PFBA 4L50A 5IVDA 4E6PA 3B51X 3ESCA 5CFZA 5K4HA 3UB4A 1OBFO 4X3PA 1JDPA 5E2BA 3V2UA 3PNBA 4GR5A 3ZHTA 3WL8A 1U63A 4RK5A 3GLIB 1HT0A 3ZY6A 1MENA 1Z5NA 4MGHA 3KU4A 5C1IA 2DFPA 4II2A 1VL0A 3JXEA 3H5VA 1KKMA 5TQVA 2AVNA 2G76A 4EUNA 4OJQA 4NFSA 1X38A 3GPBA 2HRBA 5GONF 1QKJA 4A9AA 3W3AA 1PS8A 2W6IA 2FUNB 3FGNA 2A0FA 1KYWA 3O4JA 2PRZA 1FRFS 1IXZA 1MA3A 4MWTA 4CI9A 3FOEC 2A9QA 1A9TA 1UT8A 4AYTA 1B73A 1K5PA 2F43B 3N7AA 2A7QA 2HBYA 4NOMA 5CBKA 5EJMA 2ZYSA 5BQPA 2GD0A 2ZBQA 1XD2A 2V7TA 3ID6C 4JI7B 2BBTA 1ZA1A 2D1FA 3WP0A 4GF5A 2UZ0A 3RF6A 2H29A 2O8BA 3UG6A 2HMYB 4MLCA 1G3IA 3ASVA 1POWA 2NWQA 5K99A 1JEJA 3IOBA 3SZLA 5HM6A 4RQTA 3B1FA 3QPUA 5AW3A 1XRRA 3RS3A 3TE7A 1S2OA 1P0FA 4M53A 1GGKA 1XDDA 3UB2A 2Y0BA 1AK2A 3INGA 3B60A 4IX1A 2GEKA 2Y1GA 3NHRA 2WU0A 2XNSA 4UHCA 4F3KA 1XI2A 2JLRA 2FWBA 2YZNA 2O0HA 2CE2X 3QBJA 4XM0A 5AQEA 3GFSA 3WLHA 4OLBA 4UBLA 5EA2A 3RVRA 4BAGA 3BWDD 2Z6VA 1LVGA 3PPYA 4YMLA 1AHPA 5J4KA 2QX4A 2IRWA 3KIPA 3OLYA 1QPGA 1FUEA 5AM3A 4KACA 5B7NA 3FM9A 1L4YA 3ROFA 3EVAA 2ETVA 2WNHA 3BIFA 4QX6A 2OA0A 4BB6A 3KAQA 3PD1A 1DDIA 1UT5A 2IHYA 3C8ZA 2H1LA 3E23A 2XUOA 3KPYA 4LQCA 4NFHA 2PVCA 3ZK9A 4BZPA 3H19A 5A7FA 2X9NA 4NESA 1UDBA 4DNXA 1KC3A 1YVPA 5B4VA 4XIGS 5A02A 3UUFA 1MVLA 5THXA 4BUCA 5MGNA 4LDPA 4EKGA 3KQUA 1P3Y1 3K9HA 4H4CA 3NKLA 3OMWA 5KTSA 2A9PA 2W2PA 3LRXA 2I7TA 3I9V1 3DS8A 1N8NA 4N01A 4JJEA 1U3WA 1TF5A 2AR9A 3VVMA 5THKA 2WUFA 4OFBA 4CKZA 2ZJ8A 1L3IA 3EPJA 1Z82A 1M0WA 1EE9A 2DSTA 4OGFA 1X1DA 2RAUA 1OMOA 2IEZA 2JFUA 2XCLA 2XRFA 3BJEA 2IPMA 3FNFA 1KEVA 1U65A 1XVTA 3GT3A 3IV9A 1E5VA 3JQFA 4IXDA 2CV1A 1EP2B 1NT2A 4IINA 1U2DC 3OEYA 4OI4A 3S6JA 5EJ2A 1YS6A 2ID4A 1E9VA 2GOYA 4QYIB 4RY9A 3IIKA 2A9JA 1CPYA 2OO5A 1CJSA 1DAGA 1WX1A 3KTOA 3Q7IA 4E46A 3OP4A 1ZM9A 3FFBA 1QHXA 3AK4A 3I9LA 3Q3JB 4S1WA 2ZQ5A 1H3NA 1XP8A 3IAM1 3HCEA 3ORFA 1ISGA 2OBBA 2B1GA 2CJFA 2PCLA 4BO3A 4F9GA 1BWRA 1YTLA 3NBMA 4Y18A 2VPWA 1EAYA 2FU5C 4CKEB 4B85A 4PAQA 1E3SA 1L7AA 1YL6A 1PJAA 3NKFA 3QV1A 2F8SA 2R6AA 1JWBB 4M2LA 3V3TA 1MVNA 3WBFA 1HOXA 2XODA 4G07A 1JYEA 4QDJA 4UU7A 3W4JA 4B76A 4DA7A 2A4KA 1TW2A 1ZOOA 4TKVA 2VXOA 4XVUA 4MUEA 3DLHA 2PGOA 2AZTA 1EFRD 2HMTA 1QK5A 3EG9A 1QV7A 3SOPA 1URPA 4WA7A 2AFHB 2DUNA 2ZYTX 4EY8A 3EGXB 2HW8A 4BVEA 4DV3B 4ZYTA 3RR2A 1NR7A 4IVQA 1WMBA 2FZ5A 2OBYA 1W48A 3C15C 3CE6A 4MIKA 4FHCA 2C1XA 4LDRA 5HJ2A 2F62A 3DAFA 2HBQA 2ZDHA 1FDTA 4UJ3A 5DX0A 1SN7A 1UFQA 2ZTHA 3AEUA 4I5GA 4QM7A 3RTGA 2O8FB 2CW5A 5LZ5A 1DXQA 2GLXA 1X1SA 1TYZA 5C0OE 1XZBA 1Z7GA 2SBTA 5CJ2A 2Q2OA 5B7GA 2AOUB 2CXXA 4PFQA 4PN7A 1BE0A 1C9KA 3PDIA 4XJSA 2XGOA 1RKQA 2C4HA 3ROKA 3ITDA 1ULTA 2UYOA 3RHTA 1PTKA 2A1UA 2QROA 1LKZA 3WRYC 2GYUA 1N2SA 1LF5A 3INTA 1R8JA 1QORA 1R5BA 1TQ6A 2EG9A 2XMQA 2ZYUX 4TS4A 5EE0A 5C5IA 3H1PA 1Y8ZA 2H2DA 3URMA 3NETA 2NO1A 1LB1B 3H18A 1RVV1 5ALSA 1FVXA 5DWQA 2C88A 3P94A 4F4UA 5EESA 5B2FA 4QUIA 1RLIA 4ZEVA 1RXWA 2I6TA 1BHJA 2XZOA 1MHPA 3LCMA 3LZDA 3W78A 1QFSA 3G5MA 1NXXA 2ORWA 3I39X 3UOAB 1RPTA 3DPIA 5A9TA 5CA0B 3UQZA 1RQGA 1QIKA 4FLFA 3R6LA 4IWXA 5K0SA 2ONCA 1T9BA 3L1UA 3N2ZB 5TC4A 1I6LA 2H18A 1FRZA 2O7RA 4A92A 5J63A 1NUHA 3HBFA 3B52X 4C6HA 3BFXA 4ZYVA 2NZVG 1Z2OX 1OVMA 4F1KA 1ZI6A 2QXUA 2ZQYA 3IAXA 3SC4A 4W5QA 4Z7NB 3DE4X 2D0DA 1ZN8A 3U4AA 4BMSA 3THOA 2JH8A 3VA7A 3L84A 1GRQA 1TVEA 3HBMA 1PGNA 1GNQA 1JEEA 2FQWA 4MV1A 2ZVQX 2WDZA 1YD7A 4ID9A 5ESRA 3SD7A 1AZLA 3O26A 3K0CC 1XHEA 4V03A 4LRQA 1H9AA 1ZHOA 3SYMA 3HDQA 4Y9UA 2QW0X 3BXOA 4GSLA 3WSTA 4QTZA 4UTVA 4BFYA 5EZ5A 3CVVA 5AK0A 2WQZA 3G9QA 4LQ4A 3H9QA 1DC3A 3IKLA 3PIIA 1QIJA 5AUNB 2GPAA 1F6BA 4A27A 2AJLI 2X0RA 3H5LA 2EQAA 2IZ6A 4LUCA 2A7XA 3PD0A 1QMGA 1HYBA 2PM8A 3GC6A 4ZYUA 4O4HA 1XU9A 1DIBA 2B1QA 3EF0A 4AX4A 4GVPA 3FYSA 3ACCA 4Z51A 3DFIA 3E58A 4EWLA 4WZZA 2K4MA 1XCBA 1IM8A 1RE1A 1V39A 3GDWA 1XTJA 2AT1A 3KV1A 3VHQA 1W25A 4MUAA 3E7WA 4MR7A 1VA5A 4O59O 1LLUA 2HQRA 4XB2A 1RJWA 4RFVA 5E95A 4D0SA 4AFNA 2HNBA 4RPGA 4BWFB 3HP7A 3NQ41 1G3MA 1Z4KA 1E7MA 2VDMB 4IIDA 4PRKA 4QYSA 4G1FA 5JIBA 5LJLA 4BIIA 3JQDA 3CLTD 5CLHA 1IB6A 3KEFA 3K8YA 3MTEA 1RQNA 2H4HA 4Y8VA 5IZCA 3BMQB 4H7KA 2YNMA 2EF0A 4X8MA 4JHLA 3QELA 3W3ZB 2FF5A 3OMLA 4D8VA 1M34E 5LUAA 2QMZA 1RYYA 2YJ5A 4CUZA