5JDCA

Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 248
sequence length 267
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdcA00
1HT0A 2QZZA 2FSVA 4XDYA 1ID1A 4Q3NA 1Q1NA 2NWQA 1Y7TA 1Z45A 4CMHA 2C2YA 4XB2A 1R4MA 1G6KA 2TMGA 1C0IA 4L8VA 1UP6A 2GN6A 2J3KA 1UZLA 4LW8A 2Y68A 3VC7A 2HCTA 4BB6A 4TQGA 3TZHA 4GI2A 4BVAA 2YHIB 4RQUA 3GRKA 2C29D 1PQUA 4RL6A 5G0WA 1KYQA 2HQ1A 2V65A 4OKIA 1GTMA 1E3WB 4OSOA 4YRAA 4GWKA 4JP3A 1LLUA 1O6ZA 3N74A 1V3VA 1E3IA 1HKUA 4KDEA 4J90A 1PJQA 4F45A 1N2SA 2FN7A 4LMRA 1HE2A 2NQTA 4BNFA 1ZCJA 5AXBA 4YT5A 4KWIA 2IYPA 3MWDB 1E3LA 2HMWA 4I9HA 5JW6A 4W7IA 1BRMA 1NQAO 4RF3A 1K6XA 3S2FA 3K2BA 5T64A 2QW8A 3PHLA 4WLOA 4E12A 2O3RA 1PGOA 3F6YA 3RC9A 2DQ4A 3R3SA 1VE9A 3TL3A 3QWBA 1OFGA 5I7VA 2X23A 5KJCA 4ND1A 2WJPA 3OEYA 4WLFA 1PIWA 4IM7A 2DLDA 4MDHA 4TRJA 1LRKA 4OQYA 4ZJUA 4XKJA 1U3VA 3PXXA 1IE3A 5BT9A 1I01A 4JJFA 2W2KB 4NHEA 2J3HA 3PQEA 4YJFB 2FR8A 4Z3KA 4L73A 5T57A 1PQWA 5JCXA 2YV1A 1U1IA 6LDHA 1EUDA 2QHXA 5BSGA 3JQGA 3AI3A 3Q2KA 4MINA 4C7KA 4CL3A 5KIAA 3L07A 5U9CA 5CG1A 3WS7A 5ICMA 3GDOA 1YOVA 2O3SA 3SXPA 1GCOA 4GBJA 4GL4A 4AJIA 4XD2A 1U7TA 4GQAA 5ITVA 2ZQZA 4WCFA 1Z7BA 1YB5A 3AFMA 4ZRMA 2OORA 1DRUA 3VZPA 1Y8RB 1PEDA 3SC4A 5KCZA 4R4JA 4DBZA 3PHHA 2X1HA 1JAXA 2AQ8A 2B83A 3BMOB 1V3TA 4DQVA 4DYVA 2H63A 3AM4A 5DCUA 4MP8A 3GMDA 3DZHA 2NUAA 4Q3DA 1ZVMA 4CLDA 4ONEA 3ZHBA 5L9AA 1A27A 3S8MA 3D0OA 4CM4A 4J6FA 3WBBA 3ZGYA 2EW8A 3LC7O 4C7JA 4PZDA 4TKLA 1NP3A 1B7GO 2EW2A 1LQTA 1UP4A 4FOOA 4LCEA 1DIGA 2FHSA 2FPGA 3V2HA 4A73A 1P1JA 3EGOA 4TWRA 5A4DA 2C59A 1LLCA 3UICA 3A4VA 2GN8A 4I9NA 2C54A 4PLWA 4JIGA 3U62A 3GN2A 1PZEA 5U4QA 1BHSA 2NVBA 2RH8A 4J3FA 3H5AA 3GPIA 4QFCA 1LSUA 2I3AA 3ROMA 3RWBA 1VLLA 1T2EA 4ALNA 2FRDA 2A4KA 3EY4A 1HZJA 1Z75A 1K89A 4R01A 1MA0A 2DBQA 1KVTA 1QKIA 2W90A 1RM0A 3RKRA 4A5OA 3WTBA 2BI7A 4CM8B 4MVJP 5T67A 5G0VA 1ISJA 3QIVA 4Z9FA 4EDFA 1E7QA 1VSUA 1F14A 2W98A 5L51A 5G2OA 4DLBA 3UGKA 1HDYA 3JQFC 2UVDA 3OHSX 2ZK7A 2OOSA 3KXDA 3PYLA 5L40A 3FR7A 1B3RA 3NYWA 3NX4A 1Z6ZA 4YRBA 3MJVA 3ENKA 5DOVA 2VOJA 3DHNA 3KSUA 2Y1FA 3I52A 4Y6PA 4EGFA 4ND3A 2NQ8A 4WCDA 5FFFA 2CF5A 1QYWA 4GSKA 3L9XA 4J1SA 1H9AA 1P33A 1WWKA 1M66A 4F6CA 3W6UA 2Q46A 3BMQA 5G4KB 1QXSA 1WVGA 4B7XA 4E5YA 3IUSA 4FPXA 4DMMA 3PYMA 1QSGA 4MVJF 2PGJA 1S7CA 2H6EA 4GLLA 1C0PA 3SLKA 4PN3A 1MG5A 1JW9B 3QJ5A 4X54A 1ONOA 1GD1O 1T24A 2IEDA 1O8CA 2EEZA 3GLQA 3PLRA 4TVOA 4EZBA 4GAEA 5JC1A 1P1FA 3M1LA 4FSHA 4AJ2A 4O5OA 1ONPA 4KP7A 3I6IA 4GLOA 2DPHA 1GV0A 1K6IA 2DTEA 3LZ6A 5CG2A 2I6TA 1PR9A 3BA1A 2ZTLA 3WYEA 3LF1A 3GNQA 3VDQA 1U9JA 4XR4A 1ADFA 5L3ZA 3WMWA 2CF6A 1CERA 1QYVA 3TPCA 4B4WA 5A03A 1WDKA 3VH4A 5JNLA 4DQUA 1MP0A 4RLSA 3ETDA 2IZ1A 3ENNA 5B37A 4XZ3A 1GPDG 3E48A 5GZ6A 2DBRA 1BVRA 1GZ3A 2G1UA 3I5MA 4LN1A 4BUCA 5DF1A 1N5DA 2BRUA 5ICSA 2AW5A 4PLTA 4A03A 1GZ4A 1GYQA 1H6CA 4YBZA 2YV3A 3JQ8B 4OH1A 4YWJA 4J1NA 2P2SA 4J0EA 5DBGA 1PGPA 3D4NA 1CQIA 1DEHA 3DBLB 1DRWA 1ZO8A 2P4QA 2C0CA 4R5MA 4B8WA 1U8FO 4NDNE 5B4TA 1RKXA 4CLRA 1HYHA 2O4CA 3DMYA 4JQCA 5COBA 3VPFA 3GG9A 3KYDA 4ALMA 3SC6A 1YDEA 3CZMA 2VWQA 1L7EA 3GGOA 1UDBA 1EVYA 4AVYA 2IXBA 1ZEJA 5L7WA 1EFKA 3W8FA 4E31A 5K0ZA 2VYVD 3D64A 4WNIA 1YL6A 3U4HA 5JDCC 3ITKA 1E7SA 1LSJA 4FFRA 3ONFA 1U2GA 3U0BA 1U3WA 1R37A 5A9RA 3KEQA 3AY7A 3OM9A 1BW9B 3CH6A 1MXHA 3F47A 3ZHXA 5JAZA 3CZRA 1WMAA 3AWDA 4M49A 1R66A 2JCXA 1GAEO 4QSMA 3P19A 4WLEA 2EXXA 3NTRA 2ZYDA 5A06A 1AXEA 2GO1A 3WYBA 2Y67A 1G0NA 3HN2A 3TL2A 2F1KA 2BGMA 4MVJD 2JKVA 1B8PA 4DLAA 5A9SB 4RORA 3BHMA 1UAYA 2R6JA 2YDYA 2WYUA 3E1KA 4L4XA 3H2ZA 1B2LA 1YQXA 3DMTA 5L7TA 4W9NC 3B1JA 3G0OA 3GZNB 1SB9A 1ULSA 2PKRA 3JQBA 1EBUA 1LJ8A 2A35A 5FI5A 2GN9A 5L4SA 1UUFA 2EF1A 1GFSA 4FFOA 2DPGA 1V3UA 4UULA 1EE2A 1Q0LA 2PH5A 2GN4A 4GMGA 4M55A 1JQBA 1NWHA 4R3NA 4G5HA 1LRJA 3PGXA 2EWMA 3ZWVA 1KS9A 1IULA 1VL6A 4RPJA 1LLDA 1KEPA 5TQVA 1PZGA 4YAKA 3IUPA 1K6JA 3M2PA 3WQSB 1S6YA 3ASVA 4ALKA 1EZ4A 3TZCA 1ZSYA 2VTDA 4IDGA 4OHUA 1PJ2A 4E2YA 1Y9EA 1QV6A 1R16A 3H5RA 4HADA 3OIDA 1YBVA 3ANNA 1I0ZA 1X7DA 3H9GA 4DIBA 4WEQA 1G0OA 3PWZA 4DBVO 3LQFA 4XQGA 1XHLA 5KJ1A 5IDWA 1TVEA 3OECA 3OJOA 4CMGA 2Z1NA 5JMWA 1U5AA 4PRKA 4KQWA 3K9QO 5TNXA 1T25A 1HE5A 1ZEMA 3WFJA 1UP7A 1E3JA 3MCVA 2WYVA 3WNVA 2VQ3A 1HSOA 3NTOA 1C0KA 2HJSA 5ENDA 3D4OA 4J2OA 3KHUA 1KOLA 1UJMA 3PHGA 3FBTA 1LX6A 2D5CA 2B5VA 2Q1WA 4D3SA 3G79A 1SOVA 2R00C 2VHYA 3N7UA 5CPFA 3KRTA 3TJRA 1Q7BA 3VPHA 5I7SA 1D1TA 1O5IA 1RWBA 4IQ8A 3TQHA 1HTBA 1TLTA 2C7GA 2Z5LA 4YRDA 4BO0A 1VKNA 1C1DA 3LYLA 4CMEC 5JBIA 4E32A 3JQAA 3AFNA 1Y8QB 3IIEA 1NXQA 1LSSA 4BIIA 3WB9A 5B4VA 4MPDA 1E6EA 3AUAA 1ZMOA 1DOHA 4Z9YA 2FR0A 4YJDA 1QYCA 4XGNA 4D0SA 3QHAA 4EEZA 4MVJH 2PZMA 1ZNQO 3JYLA 2VZ0A 3F1KA 4N5MA 4OQZA 4N5NA 4DC0A 3GDFA 3FSRA 1LI4A 1JTVA 3PQFA 1D7OA 1WPQA 3ANLA 3TOXA 2QYTA 1ZW1A 2W2LA 1D8AA 4NK5A 1PGQA 4RLHA 4BV9A 1PL7A 3U3XA 3ADPA 2VRCA 4ESOA 1E77A 4J2HA 4LSMA 2AMFA 4K1LA 2DTXA 3TZQA 1PGJA 3I4CA 1P0FA 1UAGA 1DAPA 4GSLA 4CM6A 2DUWA 5F1KA 1LEHA 5F21A 5JFOA 4U0KA 3JYOA 3D5TA 2JD2A 1H9BA 4NJMA 3VH2A 2YHUA 3OP4A 5IDQA 3E5MA 3X2FA 4XA8A 2EP5A 4PLYA 3DBHB 4WGGA 4R54A 1QLHA 2VWPA 5K6AC 3BTSA 4HWKA 5JMPA 3UXYA 4O1MA 3G1TA 3DO5A 4M1QA 2VYNA 2Q49A 5TX7A 2B5WA 1WZEA 1GQ2A 1ZK0A 4B8ZA 1L7DA 2VTEA 1GDHA 4GGOA 3E9NA 4BKPA 5A9TA 3WWYA 4JNKA 5DCWA 1KEVA 1NVTA 2G82A 1AUPA 4K26A 4NFHA 4PG8A 5HRUA 1O94A 4WJZA 4ZA2A 1DFGA 4E4YA 2H9IA 1E92A 1J49A 1A72A 3GNSA 4QX6A 3PWSA 5IDXA 4IS2A 4YB8A 3PHJA 5TJ9A 2PNFA 3LLVA 2WE8A 3DTTA 3QWIA 2ZIZA 1UZMA 4FD3A 4FS3A 1W6UA 1YJ8A 4XWYA 3ZH2A 3BMNA 3PGJA 5F1OA 1E7WA 1VI2A 4IIUA 1HYEA 4ITUA 3GVHA 5EPOA 3H4VA 5FF9A 2BH9A 3IDSA 3AI1A 2DU8A 1DLJA 1NFQA 2D0IA 3EVNA 3PJGA 3FN4A 3K6JA 1JDJA 4A27A 4JK3A 1SC6A 2YUTA 4OXNA 7MDHA 1PGNA 3I9MA 2NVUB 2BF7A 4BO2A 3Q11A 1UXKA 1U3TA 3VAZA 2CUKA 4NK4A 4O63O 5CPBA 1A9ZA 3AK4A 1HZZA 4BHTA 3VDRA 1O89A 3CUKA 4J1QA 3OETA 4CODB 4J43A 3NTQA 2GZ3A 5KKCA 2VHXA 4I08A 1HDOA 1N9GB 3VKUA 2E4AA 4PG4A 4PG5A 1YB1A 3ANMA 1YQGA 5AXCA 5CDUA 4NBTA 5A5EA 3VZSA 1XR3A 5KVQA 3DZGA 2IEBA 1FXSA 4HV4A 3NDJA 5JO9A 2EGHA 3DBRA 2EP7A 4R9SA 1PR3A 3QWHA 4UUMA 3ROQA 4O59O 4KOAA 3AM5A 4PLZA 3SEFA 3PDUA 3NRCA 1NPTO 3PDJA 4HFJA 3VPGA 5B1YA 3CTMA 1KETA 3HFSA 1AHHA 4R68A 2X22A 5CEFA 4CQMA 3BTUA 4KUHA 2JCVA 3L6EA 1EDZA 2P91A 2O48X 1WDMA 1DO8A 1EEHA 5TT0A 4DMLA 2WTBA 4XIYA 5HA5A 3H65A 4YT4A 5T6BA 1ML3A 3H7AA 3Q3CA 3C7CB 3IC5A 5JS6A 4CL8A 2AG8A 2D2IA 4IDCA 1RM5A 2O3UA 2W2KA 3LDHA 4TROA 1VKOA 1U3UA 3OSUA 4UVDA 4RVFA 3JD3A 3I23A 2GPTA 4FQ8A 4DIOA 4FFPA 1XQ1A 4IPTA 5F5LA 1TA4A 1W0CA 3G49A 4RPKA 4J16A 3GOHA 3BMCB 4Q3CA 4ZD6A 2E82A 2OBYA 2Z1MA 3OQBA 4NJOA 3FNGA 3GH3A 2WD7B 4XYGA 1T1RA 1BTOA 3AY3A 4J4TA 1EUZA 1XYGA 5HTOA 1KERA 3DL2A 1IZ9A 2ZTMA 1DIAA 1ADBA 2VZ9A 1XU9A 1MUUA 5KNLA 3KYCB 4TRNA 2ILTA 3RUEA 3CINA 1GU7A 3VKVA 1KC1A 1XQ6A 3QY9A 3C8MA 1BVUA 4YCAA 3UVEA 2V6MA 3Q9UA 2O2SA 5BSHA 3IMFA 3OJLA 5ENVA 4NR0A 4P8RA 3DDNA 1AGNA 1Z73A 2Q99A 9LDTA 2HRZA 4BS9A 4D44A 1HDCA 3V8BA 3KLMX 4CV3A 2OFPA 1TB4A 3QVTA 5T8KA 2FP4A 2Y93A 1N7HA 4UEKA 5JXWA 5MDHA 3C24A 4M87A 5H82A 3ZNOA 3AOEA 1A4IA 3RBZA 3AJRA 2BLLA 2VWHA 3W4IA 4BO6A 2AQHA 3BTVA 4U6QA 1C1XB 4IXTA 4GKVA 1PZFA 2Y1DA 4OSPA 1EK5A 3ULKA 4I1IA 2O4UX 3OEWA 4L75A 3I9OA 4RVUA 3F9IA 3WGIA 1OC4A 1M2WA 4D43A 5DULA 3MJ4A 1SPXA 4YR9A 3C1OA 1BSVA 1XELA 1X0XA 4P38A 4B4OA 1H6AA 5I9MA 3ICCA 4WE3A 4DL9A 3BHJA 4E6PA 4E2WA 4MVJI 1U2DA 3PVZA 3OICA 4IXWA 3C7DB 1C14A 3UCXA 4WLUA 1EQ2A 1NPDA 1KVQA 4R1UA 2CVQA 3MTJA 4WCFC 2O7QA 4IDEA 3TZKA 3VTFA 3WYCA 3PZRA 3T4EA 1XA0A 4NMHA 1R6DA 1TT7A 5JAMA 3AU9A 4E5PA 1J0XO 3QVWA 4NFSA 2IZ0A 3I9KA 4QTZA 2RAFA 4NI5A 4WEOA 4I5EA 2QZ9A 1GV1A 2Y1CA 4OKNA 4M86A 1DLIA 2VOEA 1VL0A 3CKYA 4DGSA 4OJNA 1NR7A 5HBRA 2B36A 1OMOA 2OO5A 1DXYA 2ZJ1A 3HWRA 3WLEA 1WDLA 3EK2A 1E7YA 1PS0A 1QLJA 2WMDA 5C7OO 3F46A 1JLLA 5G4KA 1FDWA 4YEDA 3O9ZA 3GA0A 5I9NA 5KJEA 4JXKA 2D1YA 4AJLA 1F8GA 3HDYA 5C7IO 3ON5A 3WGGA 1BXGB 1Y6JA 3K5PA 2Y99A 4H15A 1Y5RA 2FSSA 2J3JA 4UVGA 2P5YA 3HADA 4QQRA 5AVOA 1YB4A 1PJ3A 4W82A 4YAJA 4LMPA 1F0YA 2I66A 2GERA 2ZATA 4BO1A 3DFUA 4KUGA 1HDZA 1ZXBA 2VNAA 4IQ0A 2HMTA 1BXKA 2QG4A 1OZAA 3F4BA 1R12A 2ZB3A 5TS3A 1UR5A 3WGTA 2ZB4A 3I83A 3Q2IA 3U4DA 3NEPX 4BQPA 3FPCA 3JQCA 5IXYA 4BO9A 1R0LA 1GCUA 1GEEA 1NX6A 2BGLA 1T2AA 1DFIA 1B15A 4YJGB 4BNWA 3P2OA 4J7UA 4WOKA 2BMAA 4MVJG 3KLPX 4XRGA 2ZJ0A 1UZNA 2BHLA 1U8XX 1JWBB 2DUUA 4W99A 1N92A 4UUNA 4BNNA 3UH1A 4M89A 2R2GA 4J91A 4Y6SA 3PFFA 4YYZA 3VVBA 4Z9XA 4BNXA 1AXGA 3HHPA 5HS6A 4D3FA 4AG3A 3JSAA 1PSDA 2IRWA 3ZV6A 1I8TA 5BNTA 2HRBA 1ZK4A 3S1LA 4R51A 3OF2A 3WBFA 3DOCA 5THQA 1XDWA 4Z0TA 3RUIA 4ZRNA 1MFPA 4GMFA 4CQLA 1FDSA 5A1TA 5F5NA 5ER9A 3FNEA 1CIVA 3BAZA 4CMBA 1NM5A 4TKMA 1HYGA 3JQ7A 4IS3A 4UVHA 3PQDA 3VH1A 2EKPA 3MOIA 1LXCA 5DOZA 1P1KA 4A26A 3JQAD 3GEDA 4FIZA 1XSEA 2X9GA 4IJWA 4PG6A 4R1NA 2CMDA 4P22A 1I36A 5C5IA 4LSWA 4AICA 2FZEA 3GDGA 3PIDA 4QO7A 4FGWA 3OFSA 1GQYA 4FB5A 1EUCA 1SB8A 1VSVA 4MIEA 2VZ8A 2NU8A 4MO2A 5BQFA 3ZW8A 4K28A 1CRWG 4EJMA 4PLCA 1XKQA 3GGGA 1LDMA 2FR1A 3ZWCA 4BO5A 3RBVA 1T4BA 3PK0A 1LSOA 1X15A 5L4LA 2NNLD 3CEAA 1WW8A 9LDBA 1E3SA 1PL6A 2CFCA 2W2LD 3NDRA 1F06A 3W8DA 2I65A 2OZPA 3A1NA 3RQSA 5EQDA 4BGVA 3DWFA 3ZV5A 4EJ6A 2VRCD 4WASA 2YZ7A 3H3JA 4PZEA 2B37A 1P1HA 2B4RO 3ZU2A 2VHVA 4R41A 3D1LA 3QLJA 3BIOA 5CAEA 5AXDA 4NBRA 2GYYA 1NTOA 4AJKA 3VPSA 3Q6IA 5IFLA 4RO0A 1GQQA 5JAQA 1IUKA 2UUOA 4MJLA 4OO3A 4CV2A 3JQ9C 5LCXA 4IZHA 3S2IA 3NUGA 4J4BA 4ZQEA 4ND4A 5GZ3A 1LDBA 2PKQP 3AM3A 4J7XA 4BMSA 4PGFA 1YDWA 4BKQA 4PFJA 3WNQA 5G0SA 3IAHA 4AJEA 2RHCA 3CMMA 2VYND 3RUFA 3E82A 3JYQA 4RF2A 4RV9A 3WGOA 1B26A 4L74A 4DXHA 5AYVA 2H1SA 3B1FA 1ZXLA 4DPKA 4R5HA 4OXYA 1NHGA 2WDZA 1PWZA 5IZ4A 5JYDA 3KB6A 2NADA 2YQ5A 2PWZA 5TC4A 5BNFA 1H6DA 4BNGA 3JD0A 2AE2A 5TF4A 4YTEA 3IS3A 4NIMA 4Y9DA 3ZWAA 3UAGA 1GPJA 1MC4A 4WLVA 1VJTA 3JTMA 3DMTC 1M67A 3DZBA 3JQGB 3P5SA 3ZZNA 5H83A 3JQBC 1NQTA 1PJTA 5ILOA 1M6HA 4A2CA 3FTPA 3QRWA 4E5NA 4DPMA 1YOVB 3EVTA 1WMBA 1XEAA 1Y8QA 5KVVA 2GZ2A 1GL3A 1CJCA 4XQ9A 2JAPA 2RIRA 4PG7A 2AEFA 1OOEA 2DC1A 2P5UA 3ZW9A 4QO8A 3U49A 1TT5A 3RUHA 2VCYA 4WCFB 2JFFA 5JY1A 2JJYA 4HXYA 4B4VA 4W4TA 2VHWA 3JQFA 2XAAA 1GYPA 1MGOA 2QRKA 3H6KA 4G81A 3G1UA 4XB1A 1ADGA 2JD1A 3VH3A 2YW9A 3ZNNA 1QRRA 3E18A 5IJZA 3RIHA 2J5QA 3R0IA 3GUYA 3TFOA 4D45A 2F00A 3WIDA 3DAFA 1SOWA 5EINA 3L4BC 3ABIA 4CM4B 1K3TA 4IZIA 1ONNA 3ZNPA 4BGEA 1D3AA 4CLOA 4NPCA 2O7SA 3HDJA 3PHIA 3H9JA 4IBOA 5IXSA 3GNTA 1ADCA 1EE9A 4ZU3A 3KVOA 3MJCA 1I2CA 1OBFO 2X7HA 3BTOA 4JBIA 1HF3A 1LTHR 1U4SA 1NBOA 4E2ZA 2XF8A 1UDCA 2DAPA 1P44A 3SJUA 4AJ4A 1DHRA 4CQMD 2A94A 2JFHA 2IZZA 1H0KA 3TN7A 1I10A 1JVSA 5ER6A 5IN5A 1HEUA 4NG5A 1QV7A 1X14A 1O0SA 2FWMX 3DONA 4FJ1A 4KTTE 4YJHA 3OH8A 2CDCA 4CM5A 3KEOA 4KMSA 2Y0CA 5JE8A 1Z74A 3PJFA 1K2WA 5DN9A 4WUVA 5B4UA 3SVTA 3QV1A 4MVJE 1E6WA 5BSEA 3TDKA 1TI7A 3PTZA 3UW3A 2CVOA 3FCOA 3O4RA 3I3OA 4LCJA 1U28A 4AJHA 2D59A 4D3DA 3GVXA 3LT1A 4E0BA 2VNSA 1YH3A 2OXIA 4YXFA 1H2HA 5KOIA 3BMQB 4Y67A 1CDOA 3K96A 4A0SA 1I3NA 5HM8A 3ZWWA 5A5FA 1DFHA 3GT0A 3O8QA 2NU6A 5IN4A 4ND2A 4GVXA 3L77A 3WQRA 1PQPA 3KV3O 3ZV4A 1MLDA 3JD1A 3NJ8A 1IPEA 4R69A 3INGA 2E49A 3FD8A 5CFZA 1DDOA 1QG6A 4IGEA 1E1NA 3MTGA 1C0LA 4LVCA 4A10A 3UCEA 4URFA 4HFNA 3RFXA 1VM6A 2Y1OA 3AI2A 1NHWA 3HQ4O 4QUKA 4LGVA 2J5KA 2BFPA 4Q3EA 3K73O 1IYZA 1E1LA 1Q0HA 2B35A 2J8ZA 2Q4BA 4Q3BA 4XYBA 1GEGA 3KETA 3C85A 4DWVA 5IZCA 4AL4A 4FOSA 4EYEA 4H16A 5JCJA 3ZCXA 5JDIA 1JWAB 3H2SA 3LU1A 4IDAA 3MWEB 4W9NA 1IL0A 5DBIA 4RVGA 3IOYA 1M6WA 3E8XA 5J23A 3GVPA 1VJ0A 1VPDA 2QQ5A 3GF4A 4RPLA 4CMIB 2X9NA 1E7RA 4OM8A 3RJ5A 3FR8A 1B14A 3MZ0A 3HE3A 5ITWA 5DDIP 5KTKA 1ZJYA 4D42A 4CLRB 2GUGA 1LNQA 3KYDB 1PL8A 3GVIA 3W8EA 4BO3A 3FRJA 3KOUA 1EVIA 1LUAA 1P77A 1UXJA 3F4LA 2AEJA 2Q2QA 1Z7EA 3GQVA 4JROA 3FNFA 1GADO 3DB2A 3DC2A 3UFXA 4K6FA 5CEEA 4XGKA 1JA9A 1T2FA 1J5PA 2HK8A 2RH4A 3STHA 4A7PA 5HS4A 1MG0A 3UF0A 2WYWA 4Z0HO 4B7CA 5DCYA 4LRSB 5TIIA 1LQUA 3K2EA 4IJKA 5C7LO 4D41A 1A71A 3LC1O 2UV8A 4K6CA 4TZTA 1SAYA 1KEUA 3VVCA 3SBOA 1PU2A 1HLDA 1E0DA 4TMFA 5TT1A 1J6UA 2X0NA 3QVOA 5F1PA 4DYDA 3K30A 1EVZA 1T26A 3B70A 4Z0PA 1I33A 4JCOA 3JCZA 2R00A 4CV0A 4S3MA 3ICPA 4J49A 4MP6A 1LDYA 3DZFA 3U4IA 1GUZA 5GMOA 4DC1A 2YFQA 2Y1EA 4RQTA 1NWCA 4UAGA 1ORRA 2GSDA 3C1AA 2Y1GA 4CMEA 2NV6A 3ZU4A 4ZN6A 1CETA 1HWYA 1X1EA 1YBMA 2RHRA 3NAQA 3EUWA 3M1AA 5F3RA 1Z82A 4H7PA 4G2NA 3RI3A 5AOVA 3RUAA 5ES3A 1R4NB 3BZUA 1MV8A 1AE1A 5I8ZA 4CR7A 4YA6A 5IG2A 4MKRA 1N8KA 1XLTA 4S1VA 3VZQA 3DQPA 3WG9A 1IHYA 4XQCA 1NFFA 4RVSA 2Q4EA 5GY7A 4P4NA 4IINA 4EUFA 3DAGA 2DKNA 1DC5A 2GDZA 4FFNA 3OIFA 4D7AA 4ZICA 2PV7A 5DT9A 4EI2A 3I4FA 3OJEA 4D0RA 5KKAA 5C3MA 2QIOA 1A5ZA 3RC1A 3RCBA 2YHIA 1P1IA 2DBVO 2HMVA 2ZTVA 2HJRA 4UEJA 3WR5A 3I9LA 4CMKA 5BNIA 1I30A 4HY3A 3HZZA 3ZWBA 2BI8A 2BD0A 1E3WA 4OXKA 4JX8A 4KZPA 3F5QA 4MIYA 3JV7A 3PJEA 3H9UA 5L7YA 4YAGA 2BELA 1YKFA 2Q3EA 4G65A 6ADHA 1SBYA 4Q39A 5ILGA 2RBEA 3LC2O 3G17A 3C1TA 4RGBA 3RVDA 3HNPA 3T4XA 1DJNA 4BGIA 3UKOA 3P7MA 2Z95A 3TWOA 3ITDA 3U4CA 3W1VA 2GD1O 3WLFA 2VT2A 4E5KA 4N54A 1YO6A 1BWSA 4YQZA 2AA3A 1VRWA 2XPCA 5T8KC 2GRAA 4B79A 3LVFO 4Z3DA 4NQZA 4GVLA 4NZ9A 2NACA 3AOEC 5EESA 3D7LA 3FWNA 4IJVA 5CDSA 1BXGA 2E37A 2A9FA 2OUIA 5JY6A 3RKUA 3GAFA 3EHEA 1ZJZA 1KVUA 1IZ0A 2JHFA 5JAIA 3EC7A 4OAQA 5ADHA 4YJFA 2FY8A 2C82A 3WGZA 3ZWMA 3GC6A 5A3JA 3WXBA 3I9JA 2C07A 4R16A 1ARZA 2NU7A 4AJ1A 3PYXA 3S55A 1T2DA 4U7WA 1LDNA 2HLPA 4I5GA 3ORFA 1T4DA 1ZZEA 4HUJA 2Q1UA 3FPLA 3RFVA 3SLGA 2CVZA 5KWEA 3KUXA 4U5QA 2Y0EA 3I9NA 1CF2O 1LC0A 4GX2A 3RU7A 1ISIA 3ZV3A 3ADOA 3HN7A 4BNYA 1A7AA 1Y8RA 2YJZA 5U1PA 3O26A 1BXZA 2I9PA 4XEHA 4EITA 5AQ1A 2GLXA 5GZ1A 4BB5A 3BMOA 1EVJA 5TJHA 3E5RA 2EJWA 4IQGA 4QFDA 1DC3A 2HUNA 2FPIA 1ZH8A 2O3QA 4JGBA 3OBBA 5T5QA 4BNVA 4YPOA 3WWZA 4D46A 2DTDA 4FR5A 2PKQO 2Q1SA 4XIJA 4Y8VA 2W4QA 4QEDA 4YACA 1ISGA 4ZQHA 4M8SA 4EUHA 1BDBA 4FFLA 4BO8A 1NR1A 1FDTA 4ZQFA 1SMKA 1YONA 2I76A 3FBGA 3AW9A 3ROKA 1P74A 3QP9A 3RUDA 2IXAA 1HRDA 5B12A 1BMDA 3KSDO 4BKUA 1F12A 3I6QA 1X7HA 5JPIA 1RM4A 3RJ9A 5A04A 3V1UA 4YAIA 1NQ5A 1QYDA 4R3WA 1DHTA 4L4RA 2VT3A 2YYYA 3U9LA 1SZJG 4QXMA 5CDYA 3ZWPA 4DLLA 4CM8A 4XJTA 1MXFA 1P31A 4MP3A 4CMJA 1CWUA 1L1FA 3GRPA 4IDDA 2AQIA 4F6LA 1O95A 1PTJA 4XJSA 1JN0A 2EV9A 2TMDA 5I8WA 1M75A 3DOOA 4HBGA 4RVDA 2X0RA 4AFNA 4BOYA 4QECA 1NPYA 3LT2A 1G1AA 1H93A 1P45A 4CM9A 3HG7A 5A02A 4L76A 5I7FA 4ALIA 1SEVA 4KUEA 3RSHA 1VC2A 1MB4A 4UUPA 3B20A 3G3EA 1W8DA 3OA0A 4UUOA 4BNTA 1V8BA 2NTJA 2DBZA 1EK6A 3PWKA 2OP1A 2Q50A 3PRJA 3WSVA 1XU7A 2J3IA 3NKLA 1I3LA 4Q3AA 3WICA 4IMRA 2B69A 3D3EA 2DFVA 2JFGA 5LC1A 3DBRB 4EUEA 4ROSA 2X5OA 3RC2A 1I32A 5EL0A 4DREA 2LDXA 3WIEA 4FCCA 3A28A 1BGVA 1P9LA 4L4SA 3GVCA 4CQMB 1FF9A 5JO0A 3V1YA 2Q1TA 1LLQA 2BGKA 4W6ZA 1DC6A 4JLWA 1CEQA 1RPNA 4ALJA 5L95A 2J5RA 3QWAA 4XYEA 4Y6RA 4CUZA 1NVMB 3GGPA 3N58A 1JAYA 2EJVA 8ADHA 2HK9A 3H5NA 3L4SO 3UCFA 1GZ6A 1I2ZA 4R9RA 4RPGA 4GPD1 4NBVA 1ZSVA 2X9VA 1PJLA 4TSKA 3K92A 4I5FA 1I2BA 2PFGA 4JJIA 3O38A 4AJJA 1Y1PA 2WM3A 1NQOA 1U5CA 1WZIA 3D3WB 1F8FA 4O6VA 2VHZA 1HDGO 2P68A 1HE3A 3INRA 1Y5MA 1NAIA 4BKOA 4GKBA 2P9GA 1XWFA 4BQRA 1JVBA 4J9UE 2ZTUA 3KBOA 2HDHA 3OMLA 2EERA 3AU8A 3VTZA 2QYSA 3JQ8A 1WNTA 3K8ZA 4RPHA 2OHXA 4XRRA 1ZUD1 3DBLA 3V1TC 2V6FA 4WPGA 1KVSA 4GX0A 3HDHA 3JD2A 2UDPA 1X0VA 4INAA 4B3HA 2AE1A 5CHEA 2NSDA 4FBGA 4N7RA 4PLVA 3R1IA 3DZKA 2DM6A 1YBAA 2AQKA 4W7HA 2OMEA 2LDBA 3DHYA 1B8VA 2ZB7A 4RZIA 2QX7A 3SX2A 3M2TA 4XYMA 3HSKA 5EQFA 1ISFA 1P0CA 1SCUA 4JJGA 4DA9A 1HXHA 3FNHA 1BW9A 2PD4A 1BDMA 3KSZO 4JN6B 4JP2A 1YRLA 2C5AA 3UUWA 1MFZA 5CDTA 2VUSA 4BMVA 4D79A 3EDMA 2ET6A 1Y81A 2WSBA 3BYZA 4WECA 1Q7CA 4H3VA 3LT0A 2GF2A 1RM3A 1IPFA 1PS8A 5G0UA 5JCJD 5A9SA 2X4GA 3E6AA 3V5NA 1KVRA 4EEXA 3F1LA 1ENYA 2AEMA 2PTGA 4CLHA 1R0KA 1R4MB 1ZBQA 2HMSA 3GZNA 4J7CA 3UN1A 3EAGA 4K9DA 3ZHYA 4L0QA 1ZFNA 2HK7A 3GPDG 1E6UA 3HB4X 1PJCA 3RROA 2CDAA 4BO7A 4MOWA 1GYRA 3JQEA 5IAAA 4XX0A 2UYYA 4DIFA 3NT2A 4TRRA 1MX3A 5MGBA 1H6BA 1PX0A 1KY5A 1EDOA 3JYPA 4LRTB 5FYDA 2JL1A 3WGQA 3DEYX 4OIMA 1I24A 1LDGA 1H2BA 4FJ0A 1DPGA 3AUSA 3EZYA 4U0JA 2ZQYA 1TEHA 3EMKA 3WMXA 3ZNQA 4CM1A 4DPLA 1ISHA 5BR7A 2FMUA 2NM0A 5KJ6A 2UAGA 3OQ6A 1YVEI 1FDUA 1DIBA 1AN9A 2X86A 1UXHA 1DSSG 1YXMA 5DNAA 5L53A 1PWXA 1KY4A 3GFBA 3TNLA 2OBNA 4IMPA 1QR6A 3FWZA 4CLEA 5KJFA 3CSDA 1ZKMA 2AHRA 3Q0EA 3FTNA 5EJ2A 3NGLA 4YAEA 3FHLA 4RVHA 1R0SA 4L9RA 4P4LA 1YJQA 2VUTA 4P4GA 1PS9A 2PH3A 4MKZA 2BFOA 2O2YA 3RBXA 3ZDFA 5CDGA 3ST7A 4E33A 1N7GA 4IJUA 4EJ0A 4FGSA 1YQDA 4RF5A 3NT4A 1XGKA 2YV2A 1B16A 3A14A 3F5SA 2EKQA 4TVBA 5FI3A 2Y05A 2JAHA 4UEOA 5CEJA 4BNIA 2EGGA 4PLFA 2Q2VA 5FWNA 4PVCA 2B4TO 3C7AA 4HFMA 4UVIA 4NU6A 5JLAA 2VWGA 4GGPA 4RJTA 3IJRA 5A05A 4IDFA 1FJHA 2NU9A 3W6ZA 4BNKA 3GHYA 4KWHA 1HDRA 2NTNA 3QSGA 3TRIA 1YWGO 4BKRA 1N1GA 2Y0DA 4BV8A 3A06A 1ENPA 4FDAA 3NGXA 4RZHA 2QRLA 2Y66A 1YE3A 4ZQBA 2CSUA 2XOXA 4ZHSA 5HWSA 3W4JA 4DQXA 1E1MA 4NFYA 4CMIA 3MOGA 1A7KA 2DT5A 3LLSA 5A3VA 1HSZA 3D5QA 1GUFA 3GG2A 1I3MA 2BFAA 2O3JA 4NBWA 2CNBA 4XR9A 1D4FA 3DAPA 4YDRA 3VOSA 2P9CA 3B1KA 3H9EO 4PRLA 2ZKLA 2HU2A 4HP8A 4MVJM 3WGHA 4OL9A 4OGWA 3LSYA 5COAA 1RYDA 3JQ9A 2PZLA 1OAAA 1WAMA 4B3JA 3DBHA 3IP1A 4CQLB 2I67A 5EMHA 2ZB8A 1E1KA 3CE6A 3JQ7B 4BGUA 4RCVA 1ZMTA 3GY0A 3QW2A 2EG9A 3COSA 1GR0A 3ZWXA 5DP1A 3GAZA 4EW6A 4WNCA 3GN1A 3PLNA 1X13A 1Q0QA 3DBVO 4WLNA 1V6AA 3OIGA 4HNHA 4HX5A 1CYDA 1DJQA 5IZCC 3VZRA 4BNHA 3L9WA 2EIHA 2VN8A 3DZJA 4DRYA 4LK3A 2Q45A 2V6BA 4J4HA 3K31A 4GH5A 1DC4A 4CPDA 4E3ZA 5JDIC 2POQX 4OOFA 2E6UX 3GFGA 4QT0A 2G76A 3GR6A 4FC7A 3I1JA 3PEFA 4HFRA 2IYOA 1IY8A 3KZVA 2PY6A 1ENOA 2YFHA 3ZI0A 4PVDA 4CMAA 2PZJA 1T2CA 5TSDA 3RFTA 3WJAA 3TZ6A 4E21A 3E9QA 3LT4A 2E48A 1R4NA 1EQUA 3TF5A 3D4PA 4PLHA 4II2A 4FN4A 3PP8A 1PZHA 1C3VA 2XXBA 4BNLA 1E3EA 3U09A 4DVJA 2RCYA 2GNAA 4TZKA 2NVUA 1IOLA 3AOGA 5TRTA 1V0JA 1FMCA 2PGLA 1IB6A 2ZCUA 2ZCVA 3GEMA 1I3KA 4CM3A 3IKTA 4RDHA 3RD5A 4XDZA 2G17A 3IQDB 3OQ1A 3HUDA 4CUJA 1KBZA 2EKLA 2IE0A 3GEGA 3WGYA 5JDCA 5KVSA 5L45A 2H5LA 1U4OA 1NASA 1DRVA 4UVEA 1H94A 2BFMA 2I99A 4C4OA 1YGYA 4PIVA 2HMUA 3CMCO 3L4BA 3EYWA 4F46A 4XQEA 4ZQGA 4O0LA 3C3XA 3KTDA 1N9GA 4YQYA 4DUPA 3CIFA 3X2EA 1XCBA 4B4UA 3QQPA 4J0FA 2X5JO 3IJPA 1LA2A 4E13A 1O9BA 4B3IA 1YS4A 1EMDA 1FDVA 2VUUA 4XYLA 1LC3A 4BNUA 2JHGA 2D4AA 1DIHA 2NTVA 3UHAA 3E9MA 1HE4A 3PJDA 4KDFA 4AJPA 1BG6A 1ZSNA 1EBFA 2Q2WA 3DR3A 1W73A 1B3BA 4MIOA 1ULUA 3LK7A 2JD0A 4RDIA 3HJAA 4KQXA 3AUUA 3CPSA 2PZKA 1VL8A 4E2XA 3JQ6A 3GK3A 1X1TA 4XCVA 2YY7A 3W4KA 4II3A 3IKVA 1E5QA 1D1SA 5G0TA 2QRJA 1KC3A 4RF4A 2C7VA 2OGUA 3PIIA 2X0JA 3ONEA 3GMSA 1JKIA 2G0TA 3LF2A 1TT5B 2NVWA 2C20A 2OL4A 1T1SA 4OMUA 3PFWO 2NLOA 2PD6A 4ND5A 4CLXA 1Q7GA 3IP3A 2X58A 3WSWA 2D3TA 1JU9A 4CV1A 4E5MA 5DP2A 2PD3A 4UREA 4CM9D 4CM7A 2WWRA 4J9VA 3M6IA 3WX0A 3A9WA 3AUTA 1K0UA 3BMCA 1N1EA 3INTA 5EN4A 3Q1LA 4AJNA 3ZWOA 2ZYAA 1UDAA 4ALLA 5CP8A 4Y98A 5I9LA 2WD7A 2O50A 1LDEA 1GY8A 1QYXA 3O03A 4CLOB 4BNZA 2CZCA 3QE3A 3NV9A 5EERA 2PGDA 3TSCA 4Z6KA 3WDSA 3OJ0A 3PZBA 3OJFA 3ZWNA 1FK8A 1MC5A 3DTYA 4R1TA 2CDBA 3KYCA 2JCYA 2P4HX 2AXQA 3QWFA 3QVXA 3GUCA 1OI7A 3ASUA 2HO5A 1CQJA 3WFIA 3H8VA 1ZK1A 2BKAA 3GHHA 3ZU5A 2V6GA 5JYEA 5FEUA 5IF3A 1A4UA 1Q2XA 3H3FA 4IGFA 4BNJA 1YL7A 2WE7A 1U7HA 2GR9A 4N5LA 3KM0A 3ZN2A 3QA9A 1NNUA 2WD8A 2X0IA 4NNJA 3SJ7A 1DIRA 3S2GA 3WTCA 1HDXA 4FJ2A 2O3TA 4OYRA 3R6DA 2GASA 4ID9A 4TRMA 4YJHB 4YT2A 3WJ7A 3RUCA 4I5DA 3PI7A 1C1XA 3DOJA 2HKIA 3DFZA 1UH5A 2V7PA 1X7GA 1UXIA 2CY0A 2GZ1A 4CR6A 3TOZA 1Y9AA 5H81A 1HLPA 1V9LA 2SCUA 4WOJA 5AXAA 2D5AA 1ENZA 2PK3A 3NDIA 3S2EA 4ZVVA 3HDQA 3RC7A 2FZWA 3FI9A 4I8XA 4NBUA 4ZGWA 4IDBA 1DBVO 1YL5A 4MKXA 3NJ4A 2G5CA 3O8QB 3VPXA 3JQDA 3JYNA 8LDHA 2YDXA 5EIOA 3T7CA 1WP4A 1ISMA 3TFQA 2X5KO 3NT5A 1PJBA 2VYVA 1M76A 2D8AA 4FW8A 4NU5A 4PLPA 4IIVA 4WK6A 4B7UA 3OA2A 5IDYA 3KO8A 5K6AA 1XIVA 2CD9A 2J6IA 4IY1A 5DZSA 4PCVA 1WXDA 3MJTA 4XGIA 1HL3A 2I5PO 3ONDA 4E30A 4NH4A 2PLAA 4N18A 4ILKA 3V2GA 1C1DB 2VRBA 1DB3A 5C37A 3L6OO 1ZIDA 3AY6A 3JQAB 3ROPA 2AG5A 4FFMA 3ETGA 5G4LA 5TGDA 2EHDA 3CXRA 1F17A 2OP0A 4J1TA 3L0DA 3E03A 4MVJA 2WEKA 4JBHA 4CUKA 4I9UA 5LDHA 2A92A 1NVGA 1E5LA 4WKGA 3MEQA 1ZK2A 1P1RA 2X8LA 5LDGA 1JKJA 3HB5X 1UXGA 2X6TA 1HETA 1VJ1A 5JC8A 3HFGA 1B0AA 1XG5A 4Q9NA 1AHIA 1OC2A 2O23A 3EZLA 1V35A 3MJSA 4IUYA 4AJOA 1I5RA 5L4NA 1RJWA 3MJEA 1QMGA 3T7EA 1LRLA 4LVUA 1LBEA 2HAEA 1WLYA 1JKFA 4GWGA 4PZCA 5I7EA 4GX1A 5TLSA 3VHRA 1KEWA 1SO8A 4F3YA 1QP8A 3F3SA 4NJMB 1W4ZA 4YJGA 1PJ4A 4CR8A 3H9QA 3D3WA 3KYBA 4YT8A 1A9YA 5COQA 2C5EA 4EBFA 3ZU3A 5KVCA 1NYTA 2FOIA 1SNYA 3Q9NA 2IODA 3DHEA 1R15A 2DVMA 2FPPA 1P3DA 3RAJA 4BO4A 4M54A 1B8UA 3RASA 4BL5A 2I3GA 2ZYGA 2PA3A 2PR2A 3RU9A 1TXGA 1E7MA 5DBFA 7ADHA 3P2YA 3PPIA 5K9ZA 1RYEA 1ZK3A 3BHIA 3IL2A 4U6SA 2P9EA 1PJSA 3JD4A 4HKTA 4PLGA 2W8ZA 2DFDA 4CMCA 2XXJA 3V2UA 3WQQA 3EW7A 2C2XA 1GUYA 2B4QA 3GZ4A 1LU9A 3QVSA 1NFRA 3FF4A 4R1SA 5JSFA 2IDZA 4FC6A 3U5TA 4BNMA 1J4AA 3BMNB 4U8GA 1SEPA 3BXXA 2YQ4A 3DZIA 1K5HA 2GCGA 2UUPA 3L6DA 1IHXA 3ZWYA 1EFLA 4LISA 4DTIA 1DAOA 2B0JA 2GGSA 3B6ZA 3UOGA 5THKA 1KIFA 4JBGA 4BMNA 4KTVE 1H5QA 1QORA 3ETEA 4YVFA 4GX5A 4CJXA 3WOHA 3R3JA 3DXFA 5BSFA 4HNGA 3ZHZA 4OOEA 2HSDA 1NAHA
chains in the Genus database with same CATH superfamily
3EVAA 3WK5A 1O97C 2FSVA 3OTIA 4I14A 3PC3A 2VP6A 2AC4A 2QQGA 3AF1A 5IARA 5JTUA 1JSCA 3KSAC 3A11A 2SKEA 1Z5VA 4K9NA 3U60B 4FFSA 1GTZA 4XB2A 3SJCA 1XHFA 5K0TA 3QPAA 1G6KA 1Z2CA 4KSCA 5EUCA 1C0IA 3UPUA 4L8VA 2B1GA 2QA5A 4H27A 2FUCA 1MOZA 2X8BA 4INJA 2WVAA 4KIUA 221PA 4LW8A 4DABA 2HCTA 4LZPA 4HNSA 4TQGA 3OKPA 5LWHA 4FNAA 4R7ZA 1T5LA 1K88A 3FPJA 1GQOA 4OJMX 4GEKA 5JNWA 3QY0A 4LRYA 2V65A 2WT4A 2Y0BA 1GTMA 4YJ2A 2AMYA 1HT2E 4OSOA 4YRAA 2Q27A 2IFTA 3Q1KA 4KQ1A 2XNCA 4MEJA 2B6HA 5HPYB 1D2RA 3NETA 3V4RA 3SQLA 1E2PA 1FSZA 2ZIXB 4OJTA 3ZQJA 1RU3A 1IQRA 4L72A 4NATA 4DAOA 3LC0A 4K2HA 4HQNA 2WWHA 2EX1A 2QRGA 3H2YA 3WLQA 3C7KA 4BNFA 3BIWA 1E1YA 5DBHX 4WZBA 1UM9B 2ZAYA 5JSUA 1VSBA 3MWDB 2CUNA 4I9HA 2DEUA 1P7YA 1B93A 1BRMA 1BS1A 1C30A 2I3BA 3E27A 3PGMA 1NM5C 4G5XA 2W11A 4MJ7A 3PHLA 3PVSA 4E12A 1I7SB 1ZNZA 1EDBA 2VBIA 4AY3A 3S81A 1YMUA 4BVBA 4WKPA 2HWXA 1BWPA 4KMRA 3V1KA 1GPLA 1OFGA 1YI1A 1OXUA 1YRWA 3R09A 4E03A 4IM7A 2DLDA 4MDHA 2O54A 5DX1A 1LRKA 1YDHA 2C3YA 3JZMA 4TLDA 2BTQA 3TI9A 1UBJS 2GFHA 1H2WA 3PTAA 5KC8A 3P9SA 1FNBA 1P7VA 1VHLA 4JSRA 4C6RA 2VH2A 4KE8A 4NHEA 1OZGA 3PQEA 2BN4A 3SYMA 4Z3KA 3I64A 1P4SA 2BEJA 5B1IA 4QTUB 1Z0JA 3IH5A 2H52A 5IVIA 2VJBA 3MIZA 1PQWA 4RV4A 5BMVA 1H4SA 3NH9A 5HG0A 3QX8A 4RK1A 4E08A 2BR4A 2QHXA 2V96A 3JQGA 3AI3A 3G85A 1QOZA 3LZDA 3Q2KA 4IXNA 3LHFA 4HAYA 1XJQA 3L07A 4LV6A 5EE3A 2ZXEA 3FYSA 5BW4A 1R6VA 3ML1A 1W2GA 3PBKA 4MS1B 4WXMA 2O3SA 3HCBA 3LUAA 5F12A 3ZWDA 1GCOA 4R40A 4RA9B 4AJIA 1YMQA 3LTEA 1U7TA 2ZSBA 2AT1A 3PXBA 4FHDA 3BBPA 1DBPA 1NXWA 1TLLA 4D96A 3R23A 1A82A 5KTTA 2VZLA 4WCFA 1CFJA 2I1QA 1YB5A 3AVPA 4YCJA 2OORA 2QIPA 3EX7C 1EFVA 3EZ9A 1X7ZA 5TDHA 3WGNA 3ME5A 1FFEA 4PRYA 4G0OA 3MM4A 3CPJB 3LGXA 4YI5A 3QF4B 3A6JA 3AUKA 3EARA 4URYR 5E6RA 1CK4A 3BXGA 4GPTA 5TPWB 4DBZA 2NYAA 3O3NB 1WF3A 2VQ6A 4EHFA 4C29A 4JL6A 1C3LA 1W44A 1V3TA 4DQVA 1V1RA 2EFJA 3BIFA 2HV9A 3LH5A 4MP8A 1H65A 3DZHA 1Z18A 1DRJA 2FPIB 1O5OA 2V98A 3Q41A 4L0MA 2VDUE 2X6QA 3EMVA 4WKNA 2Q29A 4G41A 4ZC1A 3WGLA 4BRZA 3RSLA 4JSYA 1FJ2A 1A27A 4TV9B 3S8MA 3NXSA 4YDSA 4ZZ0A 3JAWB 1TF2A 3DGEC 3HO6A 2ST1A 1F6DA 4C08A 3AJDA 4Y2RA 1U9IC 5IPFA 3PXAA 5C31A 1H42A 2GJ4A 3K1AA 1B7GO 4HGOA 4ZT6A 1LQTA 3UJ7A 1KWGA 5JI3E 3WA6A 2IIPA 5DYGA 3RU3A 2GXSA 4LCEA 2WJWA 1DIGA 1W9HA 4Q4JA 3HU1A 4QLAA 5DHFA 4LJ9A 3SHQA 3LLCA 4QARA 3PDIB 1D2CA 2YC4C 1FXUA 1UEJA 3A4VA 4W9MC 4PLWA 1JFRA 2B20A 1CUJA 1VLJA 2C54A 3H8SA 2DUMA 4CNQA 3AM1A 1DWUA 5TF0A 2QN8A 2H4FA 3EOAI 1L7AA 2NVBA 2CNNA 4FR0A 4IUDS 2G1AA 2NV0A 4JBLA 4QFCA 1LSUA 1NF8A 2PKCA 5AW5A 2HCFA 5NULA 1NNLA 1F48A 1T2EA 3TJZA 4E5VA 2IYLD 5K3OA 1Z75A 5F2EA 4R01A 2CFTA 1MA0A 2WPDD 1GKYA 4KKVA 2VR1A 5DXAA 5KHOC 3ZGOA 3NNNA 2KX7A 2HNBA 4CM8B 5A4JA 5J4KA 5T67A 5GM1A 3PEUA 4X1IB 3C6BA 5AVUA 1ISJA 4D80A 4UQLA 2JLSA 4EDFA 2PKYX 2FWIA 3GLHE 4MUEA 3SM3A 1M1YE 3LRTA 2C4VA 2GPYA 3CVXA 3E58A 2GBPA 5G2OA 2B3TA 1VMKA 4G26A 4PZ9A 5TQ2A 4OI1A 4DLBA 5DSTA 3JQFC 2H57A 2UVDA 5AJUA 1NUUA 1MQ9A 5JOQA 1JYEA 3KXDA 5F3WB 5M3BA 2Y8EA 3A3OA 3NYWA 1PKEA 2QW0X 3VV3A 2DWCA 3FGNA 4YRBA 1ZOOA 2AMVA 5DOVA 3T1NA 4E4TA 3DHNA 3KSUA 3TO5A 5I47A 2OHVA 2QTGA 3ZVRA 4QJIA 4W8OA 3KLBA 2CF5A 5JATA 1JFFA 4BYMA 1XNRB 1QYWA 3KR1A 4GSKA 3T5CA 3IQHX 4KFSA 1U98A 1M66A 1WWKA 1VI6A 3W9UA 4EPXA 1JLLB 2Q46A 3BMQA 3IO3A 1CULC 4PQEA 2WWGA 4B7XA 2NTYC 1G5PA 4EBBA 1G291 3L43A 3ORRA 1QSGA 2IIVA 2H6EA 3PGKA 1JXQA 3M81A 4DILA 1E1DA 3OKAA 4GLLA 4Q4AA 2J0UA 1M2NA 3SLKA 4LDQA 3N39C 2GT1A 3NHAA 1RQLA 1ONOA 1S8AA 1KOFA 2EFGA 3DV9A 3PLRA 3ZIAD 5DYNA 3R8CA 1ZLYA 5CVCA 1RPTA 2OD2A 4FSHA 4GYYA 4O33A 3Q5EA 3THOA 1KI6A 2FN4A 3CH7A 5HK9A 3HI6A 5E1OA 1E5DA 2H31A 4GLOA 2DPHA 3Q3VA 1GCIA 4PQFA 2YCLA 1P6QA 1CVLA 1GV0A 1Q3TA 5HM6A 2XMGA 3GJZA 5KSZA 1HOXA 4HS4A 4FP9A 3BA1A 4JVNA 3WYEA 4UTRA 1UPCA 2A7XA 5DK4A 2I78A 4A2WA 3GNQA 1OSNA 4A23A 2XNKA 3KKLA 1K3UB 1U9JA 1JVNA 5J5VA 3VDQA 1H69A 1HMPA 3FPHA 3CE9A 4GLFA 4UHFA 4B4WA 1WDKA 3FYHA 3X1XA 4DQUA 1FYXA 2VDWB 2ZROA 4GNRA 4CN9A 3FGPA 1PDWA 2GLTA 5K3DA 3ETDA 4F60A 4U9HS 4YRSA 4UM9B 1OZFA 3WQHA 4FEEA 2VQEB 3C3WA 1QTRA 1WHSA 1WV1A 3A31A 2DBRA 3VOAA 2HXSA 1K3FA 3BK2A 2NYVA 4BEBA 4EYQA 5BPFA 2J4FA 3F78A 2YOHA 4LN1A 4MVCA 3RVMA 3T9FA 2J6CA 2YWDA 4JH0A 4B7AA 1VIVA 1RWOA 4ZCSA 1GZ4A 1L4GA 4WUTA 2YV3A 4KYVA 4YWJA 5B57C 1M72A 2O8VA 3EAQA 2GZDA 3RABA 5MN6A 2V45A 1CQIA 1DEHA 3DBLB 3IP9A 3V3KA 1YVUA 2IYWA 2OTCA 3AKZA 3DWIA 3ISTA 3BWXA 1RABA 5H3LA 4AF7A 4EHIA 4WV3A 3HKBA 1ECCA 2FLKA 4NE9A 1NKSA 5AK4A 3AKEA 5JZMA 4ALMA 1B1AA 3SC6A 3RIGA 1YDEA 3TYXA 2VWQA 4AT1A 5EJ9A 2IBTA 1UDBA 3LBAA 1EVYA 2IZ6A 3M4ZA 3KXPA 4C4ZA 4E09A 4EL5A 4H7HA 1SD5A 2PG3A 1S3FA 5ALHA 5C4MA 2E7ZA 3G7SA 3JVVA 4KJXA 3C3KA 3HVIA 4O8ZA 4JFAA 1JHQA 1YL6A 3FETA 3QENA 3TVYA 1XZPA 5E7MA 1E7SA 1LSJA 4FFRA 4V0KA 2D7JA 2QYHA 4JC8A 1X3SA 3GRUA 4RQAA 3KOYA 3U0BA 2EL9A 1R37A 3GH1A 5CVVA 3SSAA 3AY7A 5F77A 3NDBB 1BC5A 3F47A 3ZJTA 4MR7B 3CZRA 4CFSA 3W2GA 1U63A 1DOAA 1LVGA 5C8DA 4AY2A 1GG8A 1UKAA 4PWZA 2JCXA 2XR1A 4P4SA 1UM8A 2QVCA 5ALVA 1GKLA 1FMLA 4YDQA 1VDZA 2BONA 3ZDDA 1QHHA 1AXEA 2P3LA 2PSEA 1OGJA 3OTGA 3HJCA 1SXJA 3HN2A 4RKWA 2WFLA 1KMNA 2ZWOA 5ILQA 3TL2A 4M8IA 3RAEC 3W34A 3DD5A 4RORA 1UAYA 1LY1A 3PNOA 1XRNA 2IYYA 3NHJA 3H2ZA 2C8VA 2WZCA 1B2LA 4US2R 1OAOA 3VUEA 3FG9A 3K4PA 4W9NC 3KPVA 2MMGA 4C5AA 3T7AA 3SMVA 5K2OA 4BATA 1H1LB 2JCSA 2WVGA 1SA0A 1R0ZA 1LJ8A 3TINA 3WO0A 2GN9A 1XEXB 4MA5A 1GO2A 3DMGA 1ESEA 1UUFA 2EF1A 4A9AA 1RC0A 4DIEA 5I7WA 3K70D 2UXCB 4EP1A 2BUAA 2PH5A 3U6BA 1LNZA 4BPBA 2GPAA 4ZI5A 8AT1A 4C2UA 2GJSA 4YY3B 1XN4A 2CJPA 2EWMA 5DSZA 3BK7A 3G8DA 2C7PA 5JSZA 2I34A 1MQAA 5TQVA 4B3CA 1PZGA 1A2KC 4JT9A 4QBFA 3CQ9A 1K6JA 4RXTA 1HQDA 4WDRA 5EIWA 4LGMA 5FOVA 2GFQA 4ENRA 2H2FA 1QYRA 2VTDA 4OHUA 1XDGA 5C2JB 3JR7A 2Z4SA 1PJ2A 4G37A 1XLUA 1Y9EA 4GZLA 4E2YA 4F1JA 3M0EA 1QV6A 2HSGA 1DBIA 3TRKA 4QPPA 1KDVA 3ZBTA 3EIFA 3K8OE 3L1KA 2BBOA 1Q22A 3N2LA 1SVSA 1YHYA 1FXWA 2EG5A 3I5UA 4P6VF 3STVA 4YR7A 1E0SA 2W00A 4HDRA 4HEQA 3OECA 3FZQA 4CMGA 2EZUA 4PAGA 3ABZA 1JZTA 4ZKDA 3WAGA 1U5AA 2YWBA 4KQWA 3V32A 2SECE 1T25A 1HE5A 3DXZA 4YRJA 3TTSA 3TQIA 3IALA 1E32A 4RUKA 5HF6A 2WYVA 4HMOA 3EIEA 1N2CE 4HXEB 1C0KA 1KU6A 3WISA 3ZPXA 3D4OA 4J2OA 1T6XA 5K7SA 1P4HA 3FROA 3FBTA 3ZZ0A 3ZHUA 1E9DA 5KNDH 3G79A 3GV0A 5CNKA 3B7PA 4UBLA 3KRTA 3EF1A 5I7SA 1O5IA 1P9OA 4TLEA 4TLCA 1TLTA 4DJFC 5J5AA 3TGLA 2Z5LA 1OVGA 2GBFA 1XUOA 1K4YA 1K7FB 3VTKA 4G1MB 3ANYB 4GEGA 3A1CA 5A4KA 4E32A 1Y3AA 3E53A 2JFUA 3ACCA 4L8YA 5DPMA 3WB9A 4H6PA 4N01A 1E6EA 1O1YA 3O4GA 3OT1B 4Q66C 1DOHA 4YJDA 1QYCA 4TTJA 4NABA 2HCBA 2YC2C 2PZMA 2NU9B 5AKLA 1XD2B 2G80A 2OG1A 2DKFA 1SQGA 2B21A 3EISA 2IBMA 2UZ0A 2WU0A 3OZDA 4Q21A 4BIMA 4BEWA 4DC0A 2ZPUA 3GDFA 4EZEA 3PQ3A 1LI4A 4UHJA 2HMAA 1J22A 2ILVA 2HU5A 3MJFA 3LTNC 1H8HD 1RYBA 2ID8A 2Q3BA 2ZSAA 4JOCA 1PGQA 4BV9A 3RC8A 3T41A 4JYMA 2I6SA 3AHCA 3QPUA 4XJVA 1E77A 2I3ZA 5JZSA 1C7EA 4IH4A 4GF5A 4B3SB 4GSLA 4TVSA 2DUWA 3CLUC 3E15A 5FTNA 4UTNA 4GZMA 4UFOA 4U0KA 3JYOA 4QDOA 2OKCA 3HSYA 2QPLA 3PNQA 4BWVA 1JWLA 3VH2A 3WVNA 3OP4A 4FBMA 3GROA 1UJ2A 3E5MA 3MRVA 4HN2A 4MW2A 3U80A 4DXAA 1JIJA 3WZMA 3TE7A 3GRZA 1VG0B 4R9NA 3RT7A 1JFVA 4N03A 3NYRA 2HMYB 5BQPA 4HWKA 1WBJB 2JS7A 4O1MA 2P2DA 5A7HA 5A1JA 1S2LA 5K0GA 3BWYA 4ZREA 5K0NA 1KARA 1HPLA 2G7MC 3BQ9A 3R4CA 1BE1A 2VTEA 1GDHA 4YRGA 1YIDA 1Z2NX 1LPAB 1VFNA 4N8DA 4DJDC 4EA9A 3T6KA 4ZAYA 4JNKA 1QNLA 4K26A 4NFHA 1K92A 2GCOB 4QPCA 3GLVA 4WJZA 3NATA 3QEBZ 3LHIA 2BJWA 5ELXA 1J21A 4EY5A 3R0VA 1QMPA 3LCVB 1DP4A 4KH1A 3NIWA 1QB7A 4WNYA 1SM4A 5GAJA 4CG1A 3FWYA 1VIYA 4BQOA 2ZUTA 1E6LA 3GEPA 4MH0R 1WUHS 4N49A 5AVWA 1W6UA 1YJ8A 4QPNA 3ZH2A 3PGJA 4P34A 1TAQA 3KK0A 2G5GX 3MBOA 1ZR4A 1HYEA 2P69A 4ITUA 1HNXB 3GVHA 2HSZA 5EPOA 1CJVC 4O4IB 5FUVA 3QLUA 2DLCX 2P11A 2DU8A 4XAQA 1NFQA 2FFRA 3BEOA 4J75A 3CURA 2JZOA 5J2TA 1QCCA 3EVNA 3D3QA 3HRKA 2M1ZA 5KYKA 2YL2A 3R5JA 3RTAA 2R1TB 1A76A 3KZOA 1DV1A 1XDZA 2YUTA 4OXNA 3VDMA 3VNSA 5B2EA 1KMCA 2J6HA 3F98A 3LT5A 4DCGA 2H1RA 3MUEA 1MIOA 5KYXB 1NOJA 2VSYA 4YONB 3CKMA 2FVYA 1U7OA 5BN4A 5I7AA 2EATA 2FSFA 1U94A 2JFQA 3KE8A 5CPBA 4EF5A 5I5GA 3SOPA 1A9XA 1SVWA 2REBA 5JALA 4GE3A 2ZRHA 3G0CA 4RETA 1M6NA 2P30A 3UT6A 2IS6A 2R7LA 4O0MA 4LBVA 1RXYA 2ZSHA 3CUKA 1W25A 2RB5A 3Q87B 1T4GA 3OMXA 4J1QA 4MW4A 3TBHA 4ER6A 4XDHA 4TTSA 1L5RA 5EXTA 1E63A 3NTQA 4QYSA 1YZ3A 2B7BA 2C9DA 1R9MA 2GYUA 1HDOA 1N9GB 2VDPB 1P0IA 2FA9A 2R1VA 3VKUA 4PG4A 4PYJA 1V7PC 1QTQA 2WG0A 3GLHB 5AXCA 3X1ZA 1M1YB 3JU3A 3O1HB 2ZM6B 2X7JA 2P5SA 3VR2A 2PZ8A 4FHFA 3B60A 2PU5A 2BDUA 3U81A 1TW3A 3H17A 2C2GA 2IYTA 2FW1A 4HV4A 1U0EA 3FVTA 3NDJA 2EGHA 2XUKA 2FSHA 2FXVA 4UUMA 2PUVA 4G1EB 4IDQA 4FCWA 3PDUA 2WOOA 1VBMA 3PDJA 4IHJB 3VPGA 1Z8FA 4C6SA 3CTMA 4LFCB 3F73A 1KH3A 1KETA 1ZA1A 2ABWA 2IHBA 1F0KA 3NEYA 1AHHA 1SGWA 3ORQA 3C2QA 4R68A 4RSGA 4KUHA 3L6EA 2RG1A 3PD7A 2IHVA 4ZAWA 3LL4A 5DHTA 1IG3A 1V4NA 1P61B 3H65A 4NZOA 4U9IS 4YRCA 1TUBB 4CKYA 3WRXA 1YIOA 3H7AA 3C7CB 1KDYA 2EDAA 3B36A 5C1PA 1NU8A 4CL8A 3K5WA 4DG8A 4L6IA 5L3VA 2D2IA 5B3KA 1BAPA 2C3OA 2KBFA 1PTJC 3OSUA 3Q8WA 4UNIA 4D9GA 4KXVA 4Q9AA 4ZHQB 3QK7A 5CLGA 4DIOA 1AZLA 3NNSA 2GPTA 4FQ8A 4LMBA 4QC2A 5CX1A 4FFPA 3O73A 3DUFA 5F5LA 3AZPA 4Z7OB 2AJCA 3QYJA 5C5CA 5AVXA 2AWNA 3GOHA 1PUXA 1QAMA 4HC4A 4LTNA 1CNFA 3K7EA 2OBYA 3R3VA 3GFRA 5B64A 3JQPA 3A9RA 1BYIA 3LIPA 4YO7A 2F1JA 3JVUA 4KITB 1ZPDA 4M1MA 2OCBA 2QD5A 2EL7A 3CH5A 1OX6A 1T1RA 1JHRA 1EB8A 4F2PA 1BTOA 1JG7A 4KI0A 3HVHA 3ZBPA 4QGBA 5GGYA 5CFOA 1XYGA 2AK3A 2Y1WA 1M74A 2F17A 2VDLB 3QBJA 4M83A 4TLMB 5EUMA 1IZ9A 3I2FA 3E8SA 1DIAA 4AKIA 3IDFA 1E2DA 5DN6D 3A36A 1PSWA 1XU9A 1Z36A 2RJ3A 4WOPA 3TEJA 2TYSB 3LSTA 4Y3UA 4HWGA 4AO6A 2W2NA 3C8MA 3JRXA 3AVOA 4B32A 3QU7A 4MRVA 1TNDA 4A36A 5E9WA 4NR0A 3NWPA 5D5PA 5FPSA 2X9QA 3WA7A 4EQ6B 1AGNA 2OHHA 2QU7A 5HP4A 1P2FA 1RW4A 2O2IA 4IWXA 4Y9RA 1VQ1A 3TKAA 1HX7A 4UEKA 2Y93A 1XI2A 3DM9B 5JXWA 2X2EA 3EA0A 4EG4A 5HOQA 2FWJA 3QFCA 4M87A 3ZNOA 4YGXB 3FPBA 1QHFA 1OWNA 5B5SA 1A4IA 4ETMA 3RBZA 2Z2ZA 1LX7A 1Y1KE 1U7PA 1U0FA 3A25A 2OSVA 2BLLA 3AJRA 3B5EA 3F6BX 3LG2A 1JDSA 3LP5A 4MVXA 4V24A 4ZO6A 3I01M 1PNVA 2ZBVA 2O4UX 1MPTA 4FMCF 3IT0A 4X64B 3NHFA 3WGIA 1M2WA 2V8OA 1OLXA 4Q48A 2YV5A 4U63A 3C1OA 3D54D 3M9WA 3PR1A 3HYCA 5EZSA 3RHSA 1C0EA 3QVGA 1XELA 4RMHA 1IXZA 2Q5LA 3G5AA 5CGQB 4WADA 1M0EA 1SPBS 3QJYA 5IJXA 5H3CA 3G2PA 2PRIA 2P78A 4MVJI 1U2DA 3OICA 2FGKA 2ZUSA 1LK5A 4J3JA 3ZE7A 4RH3A 1NPDA 1ZS9A 1JHAA 4L7VA 4MUKA 5ED4A 1W5SA 2ZRNA 4HK4A 1RKUA 4OGLA 4GZ5A 4R1UA 4RGQA 4XM2A 5CW1A 2O7QA 2G77B 3TZKA 3VTFA 3WYCA 1S1MA 3LLUA 3PZRA 3T4EA 1J2EA 4DEYA 1JIIA 2ZBEA 3SE7A 1KJJA 5ALSA 3TSOA 3T5BA 3HXKA 2Y27A 4E5PA 4K2AA 1ZM7A 3QVWA 1M83A 2IZ0A 5KYVA 1WO8A 3I9KA 3Q9SA 4F9GA 3JQQA 4PV7A 4WEOA 5IAEA 3LFHA 3TSAA 1US8B 2Q3LA 1EFRA 4OKNA 3TFWA 1DLIA 1EGHA 1XAJA 1VL0A 2ZJ7A 1X1AA 2VYCA 3EGDA 4IIJF 4DGSA 1NR7A 3F5DA 1RWWA 3H1EA 2OO5A 2ZJ1A 4LXQA 3HWRA 1HURA 5FUWA 1WDLA 1E7YA 1QLJA 2Q4DA 4PC2A 3F46A 1H2XA 2KSQA 1C7IA 4Q12A 2HXGA 1FDWA 3L8DA 4CQNA 1KMIY 2W2TA 1DS6A 2XNDD 4I3HA 4JYPA 3IUQA 1P4AA 3Q6MA 3HDYA 4MYSA 2JVIA 1BH2A 4C0BA 3K5PA 3G8CA 4GRIA 4OD0A 2IKQA 2I6FA 4PNZA 3O8CA 2CJWA 2GBIA 2HI0A 2B8NA 2P5YA 4GWLA 2P67A 2QTAA 4JP8A 1YB4A 3FTEA 3HS3A 1U8ZA 1XEWY 2GVZC 2ODBA 4LMPA 4YAJA 1F0YA 2I66A 3D6UA 3LPCA 4IO1A 5DK6A 4ZQCB 3U7RA 3DFUA 5DMHA 5E6SB 4D6YA 3K94A 1HDZA 2IS1A 2N3ZA 2VNAA 3P8ZA 3UC5A 3QU4A 2PS1A 3TEMA 3NIBA 2Q3DA 1CD5A 2PSHA 3K70B 2HMTA 5IDVA 2I7CA 1C9KA 2ZWVA 1JTFA 3IUMA 4Z4FA 4D0LB 1UR5A 2R25B 2V9ZA 4DSTA 3I83A 1CR0A 3U4DA 2OBMA 1N2CB 2HNKA 2QU8A 1LBSA 2OV8A 1E59A 4HXFB 5C1OA 4QYIB 4JBNA 1GEEA 2RGXA 3HMQA 3TI7A 5JIBA 3V6MA 3NEJA 4NYIQ 1T2AA 3AW8A 2GNOA 2X41A 4HGYA 4EF4A 1C4XA 4YJGB 5DYIA 3P2OA 4IIHA 4J7UA 1IJBA 4WOKA 3WL6A 1WEHA 3DG9A 2H1LA 1LTKA 5EKDA 3KLPX 2AFIA 1IC6A 3L0PA 2ZXFA 2POCA 4ENTA 5AK0A 1KKLA 1NBAA 3IDOA 1U8XX 5INTA 4Y30A 5KOHB 1YVPA 2ATIA 1LFAA 3EIWA 1UBTS 1BMFA 3DEIA 3FMOB 4LKRA 1G2PA 3UH1A 4X8MA 1F2TA 4K81B 1F8XA 4LNUA 4M89A 2R2GA 2YXDA 3FMPB 3O1LA 4J91A 2LKDA 4NAVA 4BNXA 3FF1A 2IYVA 2OR3A 3A04A 1AXGA 3GAMA 2OVFA 4RCYA 2EWWA 4MKFA 4AG3A 2XQVA 2QP4A 1PKXA 1IHOA 5F64A 2IRWA 3WAKA 4DCSA 5AVSA 3MUFA 1T0IA 4TTTS 4QAJA 4B44A 4D56A 4R51A 4L5CA 2B6NA 3WYAA 4KBFA 4I50A 4ZKEA 1XDWA 1OXVA 3CNNA 3RUIA 5J2TF 1T36A 3FMGA 2BZ1A 2I7XA 2IUEA 3A6ZA 4QBGB 2Q2NA 4CRWB 4LZLA 4IS3A 3GEBA 3B89A 3VH1A 1CUZA 3JQAD 2QN2A 3GEDA 1G8MA 2P2CA 3BN3A 2G40A 1VE5A 2HQBA 1QIEA 2G63A 4EMBA 4R1NA 1WBDA 1JSRA 4IVPA 3SZUA 3E9CA 1QZTA 5C5IA 2PLRA 2CVFA 2Y2UA 4EGJA 5FTMA 1COWD 4I4NA 1I94B 9MHTA 1DZ3A 1ORVA 3GDGA 3HM2A 4URXR 1KY2A 3OFSA 4FGWA 3CLTC 5CFMA 2GBCA 4S1TA 4Q1EA 3D6NB 3N2ZB 1EUCA 1UOPA 4P36A 3BZWA 4IG4A 2FMFA 2FQWA 1H23A 2JFOA 2VZ8A 1KO4A 4MO2A 2A57A 3K0CC 1S4MA 4R2MA 4K9OA 1CRWG 3VC2A 3KDSE 3FUXA 3KT3A 3MCUA 3OIUA 3OZSA 1LDMA 1UC8A 2RHWA 3ZWCA 1IXRC 1YK1A 1PFVA 1X15A 1CRZA 5L4LA 1VZ2A 2CXNA 1GTL1 1OX5A 4KHZA 2XTJA 4LHZA 2W2LD 1F06A 3FB1A 1AQNA 2VRCD 3NPAA 4M6WB 3MSXA 3H3JA 2B37A 4NCJA 4ENQA 1NONA 2FW8A 4DCUA 4BJ5A 1M2OA 2VP3A 4R41A 3D1LA 3BIOA 1DQSA 1TW2A 5AXDA 1E9SA 2C4WA 1BN7A 2PO7A 3GGDA 3UMCA 2BFWA 2DLNA 5F35A 1CUUA 1USGA 3DDHA 1ISSA 3VPSA 1MAWA 4DCTA 4DN6A 2OCPA 3SR0A 1J8DA 3E0XA 3FWHA 3F7NA 3JATB 1SCQA 3S2IA 4AX4A 5EKUA 3B6IA 4UE2A 5HGJA 1LDBA 2Q7OE 3AM3A 4PGFA 2G08A 4N39A 2VEDA 2QAGB 3IAHA 1MABA 1Q3KA 3FFTA 4AJEA 3PPXA 3E82A 6ADHA 4RF2A 1PV4A 2W6JD 3H83A 3WGOA 4DR3B 3DZ8A 4F9EA 4DXHA 2D1FA 2H1SA 3VV2A 4L3WA 2Q4RA 4P54A 2L2QA 4AZWA 4HLNA 1T2UA 2QRUA 5G1NA 3VX4A 3ZE2B 1D2EA 1CSEE 3GIWA 4X62B 3WMGA 4Q3OA 5IZ4A 2GH1A 2HUPA 3TW8B 5FPPA 3I9V6 1U2PA 3FSGA 1U2RA 2W6ZA 5K3FB 3V4FA 3VRHA 5C32A 4DSOA 3RC3A 1H6DA 1LFDB 1T3ZA 1ZD1A 3HBNA 1WRBA 2PANA 2AE2A 2Z3VA 3S28A 4WQMA 4OBEA 4N0MA 4XSHA 3UKJA 2SNIE 1DT3A 3OPQA 5FD8A 3ZD9A 4BFTA 3UAGA 1MC4A 1VJTA 2QL7A 4RZ2A 3QBDA 4PX2A 4BFSA 3DMTC 4BLSA 1IAQA 1ZVKA 3JS5A 4X85A 4KAFA 2AVNA 3X1WA 5LSAA 2RKWA 2WM8A 3P5SA 3ZZNA 4YUXA 5LQAA 1NQTA 4NCIA 5ILOA 1LVUA 2CCJA 3M3DA 1C3OA 1YOVB 5KVVA 2HPVA 5TY0A 4ZOAA 1EA7A 2BHRA 1CJCA 4KVAA 3HWWA 1SQ6A 4XQ9A 1IY2A 1FNDA 2C2KA 3N6VA 4NOKA 4EEKA 3K6SB 1Z37A 2P5UA 4IDNA 3R7LA 3FUTA 3VVMA 1YQTA 1M1XB 3ELBA 3KE9A 2J41A 3V9PA 5JPDA 5FHRA 1J9EA 2J08A 4D4LA 2JJYA 2FPUA 2Q3CA 4L8LA 4YFVA 5AOCA 4KNVA 4AY4A 2XAAA 2VF2A 1GYPA 1SCNE 2QRKA 3H6KA 2ES4A 2HFKA 4LHXA 4NEGA 4XB1A 4EGQA 1ADGA 2QM3A 3UK0A 4C4XA 5D6NA 1WMDA 3IODA 3RIHA 1UFQA 3QIAA 1B0PA 2J5QA 1WCIB 3Q40A 4DDKA 3R0IA 4D3YA 2XD9A 4MULA 3I6ZA 4KQHA 2J33A 3A1SA 4X91A 3BSSA 3IPRA 1Q6ZA 2ZETA 1J8YF 1NF9A 1UPTA 1V4BA 4CM4B 1QRTA 3LKZA 3EFHA 4IZIA 3CRMA 1KKMA 3GUVA 2XGMA 4UD2A 3LQYA 4DUYB 4Q93A 4QELA 4XLLA 1IN8A 3H9JA 3UOAB 4PYRA 5K4GA 3GNTA 4JLPA 1ADCA 2A5JA 2EP8A 4KWTA 5EPUA 1SJ9A 1EE9A 3R41A 5JJIA 2CNKA 4Z7NB 1CE8A 4KGXA 3RYFA 3BRSA 5KINB 2UYCA 1JPJA 3KVOA 4HH3C 5BWCA 1I2CA 1OBFO 3LNTA 3TNDA 4HB3A 3REQB 4LOLA 4F4DA 1LTHR 3N2KB 4O08A 2IPMA 5D3MB 4ZZIA 2WUGA 3Q0TA 5CNMA 3VNBA 2F9FA 3PEEA 1TQ2A 4OFBA 4AJ4A 3KKZA 1BJTA 1XTZA 3D4LA 3FKSA 4HDAA 3CY6A 2A94A 2JFHA 5B36A 1J8VA 1JVSA 5IN5A 3WL8A 1DXHA 1Z7WA 2FH5B 1BCSA 4MMZB 4JLOA 4R71A 2Y1KA 1O0SA 4M21A 3SU8A 2ZG6A 2ETXA 2AJLI 3MWJA 4QKQA 1QTIA 1IHDA 3VSEA 4MYUA 2DXIA 1WOMA 2W0MA 3KG2A 2ZUWA 2NN3C 5DN9A 5LA6B 1S2GA 4HWSA 4WUVA 4A0HA 3ZTWA 2J9YB 5JMTA 4AS2A 4BB9A 4MVJE 3IPLA 1E6WA 3VHXB 1NN0A 3G0BA 3H9BA 4F7DA 3TD2A 4P08A 3GLKA 4M1YA 4RHCA 3UHPA 3UW3A 3FCOA 5ARDA 5EIBD 3O4RA 1U28A 5CT4A 2D59A 1E6MA 3CGGA 4B84A 4D3DA 4DV3B 2F1RA 4NOJA 1ZX1A 4NMLA 4YXFA 1U8AA 1FYEA 3PQ5A 1YZNA 4Y67A 3QTLA 1CDOA 2G36A 4K86A 4F2HA 5HRCA 1I3NA 5HM8A 3IUYA 1FIUA 2HRDA 2N9UA 2PBZA 3DLIA 5BSVA 4BX2A 5DM70 3D43A 4WN3A 5DXFA 3L77A 1RYNA 3KV3O 4X20A 2QG9A 4Q15A 2ZIVB 1LPPA 2E3JA 2XKJE 4GUDA 3U3KA 3NJ8A 2ZUDA 1IPEA 2XXAB 5CFZA 1FTQA 4NYMQ 5CVUA 3WQBA 5BV0A 3SXUB 1Z6QA 2HHJA 4URFA 1VM6A 4N1AA 3TLKA 4EKGA 2WJ3A 4R2WA 3HQ4O 3AVVA 5ALWA 1NZJA 2J5BA 1W35A 1FUYB 1TJ4A 1TMGE 2VXBA 4FD2A 4HLCA 2J5KA 4Q7LA 4YO8A 4XLTA 5AI5A 5AKJA 4ZVNA 4GOMD 4PNHA 1Z2EA 4Q3EA 4WI1A 1PWYE 2QG6A 1QIMA 4RTJA 4NOMA 2LIVA 2Q4BA 2B4KA 3C39A 3QMVA 4XYBA 1GEGA 2Q7DA 1O94C 5J47A 1P3JA 2C9YA 4DWVA 2C42A 2FX5A 1HEYA 4ARZB 4F85A 2BGGA 2XBMA 4BNDA 3E3OA 5DJ5A 4GKKB 1NLMA 1MTOA 1JJAA 4FSDA 2Q5IA 3SG0A 1K27A 3EYAA 3LU1A 3OCZA 4OQEA 3X1KA 3AR6A 4K6GA 2NXNA 1QX3A 1FFXA 1C29B 3CM0A 2DJ5A 4CKEB 4D4MA 3V80A 5KMGB 1OWPA 2PZGA 1DCFA 1IY0A 2ZCJA 3DVSX 3CRZA 3GVPA 2CD7A 4JGIA 4S1PA 1JDUA 5FYQA 2QQ5A 2Z83A 3QE4A 3NTUA 1YB7A 5KX5B 3KOMA 4Z4QA 3DL7A 1CB7A 2PBLA 5KNCH 1B8OA 3FHTA 1XP8A 1WQ4A 4E5SA 1RLIA 1QJCA 4O4HB 2ID9A 4FIDA 1ZJYA 4OHZA 2ATEA 4JOQA 4D42A 5IJ0A 2BI4A 3EG9A 2GUGA 1VL1A 7REQA 1NUAA 3KYDB 3W9SA 3GQBB 4NCAA 2J1LA 4YXWA 5I9IA 4BO3A 3CO5A 1RZUA 5EZYA 3WLJA 4WBNA 2XZOA 3DYVA 4CKWB 3NM5A 1EVIA 1U0RA 4KQIA 2VCEA 2DR0A 2A86A 3I5YA 1UXJA 3BX1A 5AK6A 5E4TA 2XZLA 2I6QA 3GQVA 4GBMA 4OFWA 3CUWA 4IV5A 1GADO 3I42A 3NEAA 4JUFA 5C7YA 2BLNA 2ZRAA 1NVWQ 3IT3A 4UW9A 621PA 4KR2A 4WIAA 2NP6A 1E79A 1J5PA 2BM1A 4KQ9A 4MWOA 3IAXA 4ES6A 5HS4A 3UF0A 4C43A 3O9VA 4OYLA 5DHPA 4DCJA 4Z0HO 2HWKA 2J7PA 3CZAA 3FHCB 3NM6B 4LRSB 3EWSA 1KE1A 4ZYUA 2VBGA 3ZTTA 4BJ1A 5TIIA 4DNFA 3RAFC 2ZU6A 2UV8A 2XZPA 3NPMA 1CVRA 4K6CA 3U26A 2R79A 1N0WA 1PJ8A 3SF0A 3VVCA 5HQTA 2W37A 3PX2A 3P9RA 3SBOA 1QGOA 2XMQA 1HLDA 4P5PA 5TT1A 4DYDA 4J1TC 2PUWA 3DV0A 3PIRA 3FNIA 4LBZA 5FBHA 5ICEA 4ZTZB 4ND8A 2R00A 1NF3A 4MP6A 3FOWA 3KT6A 3UY4A 3K1YA 1A97A 1JPVA 1JR2A 2QE6A 2W8BB 3HH8A 4FYPA 4RQTA 4Q9HA 4C7VA 2YZMA 2X9LA 3GP3A 4MW5A 4PZ0A 5KSPA 2Y1GA 3ZGVA 2NV6A 1IN7A 1XVIA 3NAQA 2RHRA 1KP9A 4NXNB 2CB0A 1H4TA 1FFBA 2ZBPA 1ZCBA 3EUWA 3O2JA 5BYAA 4CEIB 4NZMA 1AKYA 4H7PA 2ZR7A 4G2NA 2D1SA 5AOVA 4IUCS 3RUAA 3OESA 1ODJA 2P5TB 1NA5A 4BMCA 1Y4SA 2HU7A 3RVKA 1DC8A 1J70A 1T0HB 4BFWA 5DRTA 3ROEA 1PR4A 1W75A 3KZMA 4UTZA 3VNAA 4QWMA 2ODWA 5KSWB 2N75A 4WY5A 1V1MB 3F49S 3PNLA 3MWYW 2GKSA 2JATA 4RKQA 3O9MA 4Y2UA 2MTBA 4XQCA 1VOTA 2R6ZA 2FZCA 1DMRA 1BIFA 1OXXK 2Q4EA 3IQGX 4IINA 4P4NA 4RVSA 1GNLA 4TPKA 4EUFA 3UGTA 2JLAA 2W6QA 3DAGA 3MT8A 1DC5A 2Z5VA 3RYIB 1QDLB 2CK3A 1VCHA 4W8HA 3FAZA 4AIIA 3I4FA 1A8IA 2LCQA 4EPWA 1ESZA 1CR4A 3KKQA 1A5ZA 1KDTA 3RCBA 2DBVO 1T5SA 1TZ2A 5J59A 1MO5A 3GD5A 4UEJA 4PX3A 4CMKA 3IFSA 2VJYA 1T5BA 2ERXA 4KZPA 1MOQA 4F86A 3F5QA 4IVRA 1YDFA 2PQ6A 3HP1A 3PJEA 3H9UA 3TPFA 4NOLA 4NG4A 4URWR 1F6BA 5IWCA 1RYFA 1E98A 1WTAA 2ZIXA 1SBYA 4B6EA 1NVDA 3KPJA 1J0DA 2H5IA 1AKUA 4IRMA 1FLDA 1JFLA 3G17A 3OF3A 5GM2A 1PYDA 3RVDA 4CG3A 2J0SA 4FXOA 2CJFA 1E4EB 3UH0A 2RGRA 1UM9A 3H5IA 1JAZA 5ADVA 2PCLA 3LUDA 3MWDA 3TWOA 4TWIA 3ITDA 4C0WA 3CNQS 4LSZA 4C07A 3HLTA 2OT3B 4I4TB 4NL4H 4N54A 4N6OA 4YCSA 3K35A 4LYYA 3COZA 1T10A 2AA3A 3CCBA 3V8QA 2BFEB 2C5BA 3OAAD 1N78A 4B79A 2NT4A 3LVFO 2B4AA 1JB9A 5TMDA 1NSYA 2I33A 2D00A 1E1CB 4HQOA 5FUXA 3E1SA 3OOJA 4LDAA 4B09A 3D7LA 5EHZA 4LVNA 3IAAA 3LQRA 2W6NA 3H6HA 1MX9A 2OUIA 3R7DA 3GO4A 3RKUA 5JY6A 5ALNA 4LK2A 3C6ZA 2R60A 4AKGA 1O5TA 3EHEA 1ZJZA 1IZ0A 2FSVC 3KSRA 4JUBA 4LXYA 3EC7A 4MIKA 4MW7A 4O25A 4YRFA 5HMMA 4ENUA 5ADHA 2FY8A 1U3GA 2O7VA 3WE7A 1ECGA 3GC6A 1YZHA 2XODA 2HK6A 3PF9A 4HVAA 4JFRA 4ZTBA 1B0ZA 2C07A 3T8YA 2ZYVX 3HXTA 4PYIA 3KUDA 5EE5B 1VE3A 2IPLA 2UXDB 1J2YA 4FCVA 1HGXA 3C3YA 4ZEXA 1XMSA 1CIPA 4HLQB 5B55A 3MFYA 4MS1A 4TZ6A 2CXXA 1KRHA 2GYWA 3ZU6A 3F96A 2BFCA 3AEQB 4MQFB 4I5GA 2DR3A 1AUVA 1B6TA 1RBZA 2D13A 2V97A 1RVDA 4KXWA 4IO0A 4IJQA 1ZC4A 1EAMA 2EX0A 4FYIA 2Q1UA 1PEAA