2V55B

Mechanism of multi-site phosphorylation from a rock-i:rhoe complex structure
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
181
structure length
181
Chain Sequence
QNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RHO-ASSOCIATED PROTEIN KINASE 1
publication title Mechanism of Multi-Site Phosphorylation from a Rock-I:Rhoe Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2v55B00
1VECA 4NKRA 1XB2A 4G1UC 4KYIB 5EXPA 1WRBA 3RDPA 3A8TA 4DUGD 4RD0A 5FTKA 4A0GA 2GCPA 3EZ6A 1WB9A 3AV0B 2ORWA 3Q5EA 4V0OA 4AD8A 1XMVA 1U0HC 2DFNA 4PC7A 1UM8A 4BUJA 1G1MA 1GTVA 1OH6A 1YRBA 3MLEA 4TMZA 4U00A 3CO5A 2BJVA 3AP1A 4IOLA 4N1AA 3RC3A 4B3CA 4KFTA 2OHFA 5IT5A 4MRVA 4JLBA 2AL7A 3I8SA 5H8WA 4FIDA 1SVMA 2G88A 2W0MA 3RVBA 2C04A 3DOEA 2KSQA 2IYZA 5FR2A 2QAGB 2ZJBA 2AX4A 1G16A 4TLAA 2A5DA 4QGGA 2FFQA 4ON9A 1CXZA 2NO9A 5BN5A 3P1JA 4US1R 5LBIA 3GLHB 2ONJA 2VIIA 2G1KA 1E1QD 2IS6A 4TQ9A 1NN5A 3Q8XB 3BB4A 3FOZA 3R9WA 2RGAA 1Z07A 1RE0A 2BBSA 3AUYA 4JLKA 1W0JA 5B64A 1BYIA 2FOLA 2WZQA 2FG5A 2IEYA 3OEEA 5M04A 2FJUA 3LA6A 3NIBA 3PUWA 4GRAA 2JJ1D 4RCZA 4DSUA 2XOKA 2QMOA 4LY6A 5EJEA 3OEHD 1R4AA 4JL5A 3W5IA 4DB2A 1Q57A 2CEAA 2R9VA 1SHKA 5IF9A 3TE6A 4B33A 4B74A 2WKPA 1ZCBA 3N2IA 2IS1A 4MA4A 1S96A 2C2HA 2AD1A 3LBHA 4OJQA 4PHTA 2ATVA 1GVNB 5BN3A 4HB4A 2BBTA 5JMTA 3DKVA 3QXCA 4LJ4A 3SJAA 3W90A 3CONA 3U2QA 3HU3A 3K70B 1VHTA 4DLVA 1OYYA 3X1DA 1CR2A 2O5VA 3DZDA 2QUZA 3G0HA 5J4YA 3ADCA 1NVVQ 4PANA 1PUIA 2PBRA 1MABB 4LYFA 1KDRA 1P75A 5EZ6B 2C95A 2EWVA 3THYA 1IN5A 2ZRGA 3CPHA 3MGCA 1QDEA 2XNDD 3MWKA 1P7CA 1OFHA 4IJMA 4WBSA 2J45A 3NHAA 5TVKA 1KYIA 3TRFA 1NJGA 5FOTA 1G4UR 3CUEF 3GLHE 1DBSA 1RJ9A 3A6PC 3THXA 1E2FA 3HU1A 5FH9A 4K8OA 2QPOA 1JR3A 2PX3A 2H57A 3DMNA 2XTNA 2OG2A 3LVRE 1RVDA 2QENA 1H8HD 2WIAA 3U7FB 1M2OB 3B1ZA 1FW6A 4BASA 4MITA 4XTCS 4QL3A 4YMWA 3LBNA 3FHTA 5CIQA 2VHQA 1XD2A 2UVQA 2VEDA 3VHLB 3UMFA 3NBYC 3W9YA 2F1JA 2PZGA 2VP0A 3FKQA 5KO2A 1BS1A 2ASEA 5FL7A 4HAVA 1Z5ZA 2OAP1 1G20E 4GBMA 4S2EA 1GL7A 2GF0A 2O8DB 3BK7A 4HEJA 1G7CA 4WXRA 4B3GA 3BC1A 1W4RA 4HZUB 4TYYA 1AS0A 3V00A 5JJLA 1N6NA 3QKRA 3GLIB 4B76A 1R5BA 3SN6A 2J0VA 2JASA 1E79A 3DPUA 3F0TA 3TSZA 4OI2A 5KNDA 3Q3JB 3SS8A 4E5UA 5TB5A 1TADA 2ECKA 2HXSA 4LHXA 1OHHD 2Z43A 1WA5A 1RRPA 1Z6AA 2FA9A 3LVQE 3FKSD 4YMSA 1XZQA 521PA 3BRWD 3CM0A 4PPFA 5AJXA 2O8CA 2OZEA 1N5KA 2VPPA 4KSBA 5H1YA 2IX3A 4X8HA 1U8ZA 3MSXA 1YZTA 2C78A 3L0IB 1B23P 1JECA 3V4FA 1G9XA 2PJRA 1KNXA 3G82C 2PJZA 4Q7JB 4D4JA 2EFCB 1G41A 4F4CA 5DNYB 1OKKD 3Q72A 4IVPA 1SXJA 1GWNA 2A5JA 1V43A 1XBTA 4DSOA 2JLWA 2VF7A 3C41J 2V4ZA 2Q3MA 2FSHA 2VHTA 1E0SA 2FF7A 1XX6A 4DXAA 4Q01A 3W3ZB 3SZRA 4XWAA 5L8VA 4BPBA 2RGCA 1ZBDA 4KAXA 5CK4A 1ZM2A 2NO7A 5C46F 1Z0KA 4US2R 1TTTA 1TAGA 2GJAA 4LC1A 3B78A 4A1FA 3AEZA 2X19A 2KE5A 3AB3A 3KB2A 3H84A 2E87A 2FFAA 2F7SA 1LW7A 4R2HA 3NBZC 2IL1A 2P6UA 2J87A 2JLRA 1IN8A 1U99A 2RGNA 2ZJZA 1NKSA 3Q9LA 3U7EB 4L9SA 3QPVA 4NE2A 3QSYA 4MQBA 5IHPA 3CB4A 3GLIE 4BE7B 2WWYA 3V9PA 4Q9LA 4DVGA 2X1VA 2O0JA 4EPXA 1A1VA 4TL8A 4GOKA 2QQ0A 3HPRA 2XSZD 5CYPA 1P2UA 3IPXA 2REXB 1VPLA 4OYHA 121PA 1TU4A 1TQDA 1RRCA 4H1VA 5LD2B 3SDZA 5JBQA 3BWDD 2JJ2A 1KO1A 1KAOA 4ACAA 5JHHB 2JLSA 2NZ8A 1XZPA 4HLUC 2ZRPA 4JKIA 3LX5A 4UNPA 4KLZA 1D2MA 5FPKA 1MO4A 3B60A 1KZGB 3ZQJA 3RS5A 2D7CA 2QE7A 1IN7A 3AKDA 4RD3A 4X8MA 4N0EA 3RRZA 2NO1A 1T8UA 3IPYA 4MUAA 4PX9A 2GBLC 3ZZTA 3BERA 1N5JA 3BD9A 1Q1ZA 4DUGA 1MOZA 1XCMA 1ESNA 1OSNA 1YQTA 1KK3A 3RAPR 4Z8XA 1LVGA 3KUDA 2G9NA 4QM6A 3PEWA 1E2PA 2W6JD 4LC0A 1L4YA 4D26A 1TQ6A 3QOFA 2C96A 1EFTA 2FNAA 3PEUA 2NOAA 1UAAA 4MKFA 1OIVA 3ZVNA 4Z8YA 4Q7MB 1GSIA 3GFPA 4C9BA 4XSGA 4C2UA 2XTZA 3OF5A 2GAOA 3OIUA 2C77A 4DHEA 2RH5A 2B21A 2RGXA 4LPKA 2BIFA 2WPDD 3VR5A 3EWSA 4ZIRB 3LFUA 2BCGY 2F9LA 1R7RA 1PZNA 3AKYA 4M9SA 4QGHA 2ERYA 4PFSA 1CS4C 5A0FA 1S1CA 4DRZA 5FOXA 1JR3E 2QP4A 4YXWA 1W36B 3K0CA 4A0HA 2EW1A 5FBRB 2ZR7A 1PLJA 4CZ2A 3QKUA 4LJ7A 4G3XA 1X8KA 1PUJA 2KWIA 2ZANA 4HDCA 4TSFD 3T1OA 1J8YF 2UKDA 4P32A 4TMXA 3H0KA 1EWRA 2WOOA 4XVQA 1GZSA 4LJ5A 1UPTA 3FVQA 3T06B 4BLPA 2JLYA 1XPOA 1NKTA 3KFVA 3AGQA 1ZU4A 2QMUA 3VNVA 1KI9A 1HQYE 3K53A 2K5UA 2WICA 1LFDB 5JFGA 2IK8A 1XTJA 3OEHA 3BH7A 1RYFA 3ECCA 4LYJA 4MRSA 5BN4A 2CHQA 2P3SA 3BGWA 5BWMA 2CL6X 4HI0E 1R0WA 4AKGA 4PC6A 1KI8A 4QBGB 2J0SA 4ZV4A 1KY3A 2V55B 1E1RD 1G19A 3LW7A 4UXJA 2IYLD 4AG6A 4A15A 4DLYA 1G8FA 3F3YA 3SI7A 2P65A 1K5GA 2Q0HA 4AYXA 2BMJA 1YZQA 5L3SA 3A37A 4CGZA 1MO6A 4JIMA 4PSKA 3TSOA 4JJZA 5CIWA 2P5TB 4TMVA 3CKLA 4R7ZA 1JAIA 2JDIA 3BS4A 1AGPA 1F2TB 4XWKA 3HJNA 3B5JA 4NH0A 5KYKA 4P4SB 4CEIA 3OE7D 4KO8A 2IYUA 5KUTA 5HCIA 1ELOA 2OFOA 2BKEA 1HUQA 4ILEA 3KJHA 5SZJA 2XNDA 4QRHA 3CF2A 3OIWA 4ESVA 1QHSA 4PTLA 3FE2A 1X1SA 2EWWA 1RRGA 3MMPA 2VHJA 3EIQA 1IN4A 1K5DA 4HLDA 5TXGA 3UPUA 2F1HA 3MWJA 4POAA 3THOA 1FX0A 3BH0A 1A4RA 3LDAA 4ACBA 1H8HA 2AKAB 2BVNA 3ZIAD 1M1YE 1UEJA 5KDLA 1FMLA 1Z06A 4MGKR 1Z63A 2QMHA 3K70D 1E2HA 3QXJA 2BM1A 1DAKA 1LY1A 3R9XA 2P5SA 1E94E 1N0VC 4BZPA 3CF0A 4L8GA 2BBOA 4IDOA 4LPSA 3K9GA 4RZUA 4D0NA 1N6PA 2R6AA 3T1QA 1YKSA 4TLBA 5FUYA 4DSNA 1NBMA 2CHGA 2DPXA 2OCBA 4E22A 1UEIA 3UK6A 3O8RA 4MRPA 3PG5A 3LY5A 1CKEA 4OKSA 5C4GB 4OK6A 1GG2A 1YR9A 4Q1DA 4HAUA 1BMFA 3KQHA 3AKCA 4OI1A 4AURA 3CWZA 1OHHA 3I72A 4KU4A 1KK1A 4GOXA 1M6NA 3FKSA 2AR7A 4RKFA 4DB4A 3K0FA 3RS0A 5L3QB 1CF4A 2ZUBA 1W5TA 2MMCA 4ERNA 1GP2A 1U98A 1QHHB 2CK3A 5JRJA 4Q9HA 2JJ8A 4OHZA 4X8OA 4D4LA 2CJWA 2ZI9A 2C03A 2Q6TA 3I32A 5EXTA 5C2JB 2HF9A 3X1XA 5KPJA 3DL0A 3MD0A 1CJTC 3VR6A 1W48A 1J70A 2XB2A 4QGAA 4LBWA 1P72A 2GJKA 1G7RA 3QPWA 4Q18A 4EQ6B 1E96A 1ZUNB 3EPLA 1ZNZA 1VKJA 3KL4A 4TMTA 2J0UA 1P6XA 5AJWA 1DTSA 2PEZA 2FE4A 4ZI3A 2HT1A 5EP4A 3ZJYA 4QBFA 1W0JD 4M1KA 2CCKA 1E2QA 3OEED 1HT1E 8OHMA 4URUR 2BDTA 2HT6A 5JS8A 1KTVA 3TJZA 3TQFA 4EFMA 4PAMA 4HSEA 1FQKA 3NWJA 4Q1CA 1DG3A 2A2ZA 1XFAA 4HUQA 2NIPA 5KDDA 3LRPA 4P0TA 3ZH9B 1IOZA 2X77A 1P60A 2GZHA 1P73A 4GPTA 4PR0A 4BFVA 2CCJA 4TMKA 3VU9B 1MT0A 1W47A 4NU0A 2XSZA 4JT2A 4OQLA 2YWEA 2EFHB 3RS4A 3IEUA 2ZVQX 4KV9A 4LZZA 4FXPA 4IDHA 1FTSA 2FSGA 5FPHA 3KKOA 3FYHA 4GMXA 3OFNA 3CX8A 4YONB 2VBCA 4KVGA 4AIIA 4QHSA 1GAJA 1NLZA 3BJIC 2ODEA 2R2AA 3FMIA 4TYPA 4D0LB 4E09A 2ZROA 3AM1A 3HP1A 3KKPA 3X2SA 3DEFA 2ZYUX 2F43B 4JL8A 2DFTA 5EQTA 1WBDA 4HB0A 3TIFA 4LJ8A 4DCUA 4P4UA 3JZAA 4QJ5A 5P21A 3THWB 1U2RA 1U9IA 1X8LA 2WWGA 4XH9B 2VP6A 1SVIA 4EJSC 1KY2A 2OO7A 2RB4A 3QG5A 2A9KA 4XVRA 3TVDA 4LJ6A 1E2LA 3ZZ0A 4A8JA 3OIYA 2ERXA 4AWXA 2OCAA 3B2EA 2VH5R 1JR3D 2O0HA 1HURA 4A9AA 1NNEA 2GNOA 1OB5A 3BXZA 5DI9A 4NCNA 4PZLA 1KNQA 4JSYA 3T61A 1CP2A 4RCYA 1XXHB 5B57C 4Q21A 3WXMA 4AYWA 5JWRA 1TNDA 4TT3D 4QFMA 4Z54A 4LV8B 4C7OA 3G5UA 4PHFA 1Q1BA 1VMAA 2NQ2C 3CNOA 5FL7D 4B34A 2QPAA 5KOYA 2JLZA 1E9DA 4CF7A 1JALA 1YU9A 3TW8B 2HEIA 4D80A 4M1TA 4Q4JB 2QTHA 3W8NA 2QBYB 3K8YA 2XXAA 4TL6A 1IJFA 1AM4D 1S3GA 3EASA 5G41A 3CX7A 5J40A 3BB3A 1E2GA 2EQBA 2GA8A 2D2EA 3FPAA 3GJ6A 3NDPA 4FMDF 4TSFA 3SFVA 1E79D 2OV2A 1KMHB 1PLLA 2NO6A 4LX0A 4D2IA 3KJGA 4PZYA 4A92A 3CRW1 3GJ4A 1P3JA 2NTYC 4XSHA 1R10A 4DCTA 2ZYWX 1UBCA 2GAAA 4KI0A 4YDHB 1Q3HA 4QBHA 3A4NA 3FMOB 1JEDA 2IEZA 2YINC 3OIVA 5A5GA 3AVWA 3D6TB 1ZM3A 1NBME 1HYQA 1ZMXA 4A2QA 3RSOA 4HDQB 5K8LA 3V4RA 2V1UA 3CIOA 4O2LA 2QM7A 2GWHA 2OLJA 4Y0VA 4V0KA 3NBFA 4ZKDA 2J0QA 2D4HA 3JZMA 1XD8A 4YDSA 1X6VA 4B35A 2QRNA 4G5GA 1F48A 4PO9A 4V03A 5AWFC 1F5NA 2QAGA 1XEFA 1FUUA 2ZI6A 4RZ3A 1J2JA 2QTVB 1RW4A 1UDXA 2Q9CA 1Q44A 3QVVA 1W36D 4B43A 2IYWA 4IXNA 2D06A 2X8AA 4JLDA 4JVSB 4AC9A 1SVLA 2PCJA 1KI4A 2AK2A 3NKVA 3GLHA 1AQYA 4MGIR 3VNUA 4FCTA 3U3JA 1XXHE 2O8EB 1VG1A 3T15A 4HAYA 1T5LA 2BHRA 4ITRC 4DBLC 1D2EA 1I4LD 4TLDA 4KJZA 3LLUA 2QSZA 3RC8A 3GJ0A 3ZGXA 2I3BA 3QEOA 2HF8A 4MYHA 3T34A 1SGWA 4OK5A 3IHLA 1XWIA 4RY2A 1U8AA 2FEOA 2GCOB 2ZIAA 4EPWA 3CF6R 1WBBA 1R5NA 2Z4RA 1VG0B 2CLCX 4KITB 2O8BB 1L8QA 1Z8FA 2IF2A 1XCPA 2ZAOA 2CE7A 2PL3A 1ZM9A 2IUSA 4Q4LA 4ABYA 2GXAA 3B1XA 5FOWA 2HLDD 3HR8A 3TKLA 1OXSC 2WKQA 2ZRNA 3RABA 3R9IA 2JJ2D 1II8B 1W44A 2PT7A 4NYMQ 4W9MC 2BOVA 3QUSA 3ZLJA 3FFBA 4CYMA 2J9RA 1OFUX 2GCNA 5FTJA 2IS2A 4W5WA 1DO0A 5UKDA 2QE7D 1AZSC 2WSMA 2QGNA 4DIEA 2OAQ1 1MABA 3LXRA 2FDCA 3SEAA 1KO7A 2KJQA 4KCGA 1S9HA 3EX7C 3W3AA 4WW0A 3I5XA 1OH8A 2HDNB 2GF9A 3LV8A 3I8XA 2ZI3A 2W83A 3U3RA 1T6NA 4RD2A 2ZRKA 1XJCA 1CBUA 4M22A 3NG1A 2FPKA 4II7A 4G5OA 2A5YB 2RGDA 4XVUA 2ZE7A 4BZQA 4C0BA 3M1IA 3Q7PA 3PITA 4BLSA 2AXNA 3GEIA 4UXHA 5DE3A 4D4KA 5CB8A 1AQUA 4QBIA 1FP6A 2PEYA 3B82A 4IOJA 1KAGA 2GHIA 4Y0AA 2CE2X 2WKRA 1EG7A 1DAHA 1AJEA 4RZ2A 4OHVA 4XWOA 2ZU0C 1IN6A 4KFUA 3GPLA 3C15C 2CHVA 4YXWD 4Z51A 2YWHA 3TUIC 1AS3A 3CRMA 3I73A 2O8DA 4DJTA 4FMCF 2HV8A 4EAQA 4HZUA 3QJYA 2E1RA 3SYLA 2H5EA 4JBWA 2YOHA 3GLIA 4HDOB 4O2RA 4H1UA 3ADBA 4TYWA 3ASZA 3D7MA 3MG9A 1ZUIA 5KHOC 1VG9B 1QF9A 1GNPA 1YHNA 3B9PA 5EE5B 1T5IA 4DCSA 1KO5A 4MYCA 4YMTA 1IXSB 1GL6A 1HE1C 3TH5A 4BLRA 1OLOA 1KI7A 4A2WA 1KZ7B 1BOFA 2FEMA 3S1AB 5FPYA 2ATXA 3A4MA 5EP1A 2QRZA 3BE4A 5LB2A 2EU8A 4LGMA 3ZZUA 1RKBA 2R6FA 4FN5A 2EYUA 3ADKA 1T0HB 2D7DA 1NMXA 4C0JA 3WHKA 4BFSA 4F38A 4QOSA 4ZKEA 3U3KA 1UBEA 1VYVA 4U02A 1TMKA 3D3QA 2KB0A 4DDWA 5K8TA 4TTRA 2GK7A 1FZQA 1XDBA 3RRMA 2JDID 3UWKA 1AIPA 4D82A 2Q21A 4OHWA 2BKUA 1NN3A 4UJ5A 3LW8A 4EPTA 3QBVA 4L16A 3KJEA 4WIAA 5EZ5A 3SOPA 1OV4A 2IWRA 1I4TD 2DWQA 2UZ3A 2R44A 2ZRFA 3D8BA 4FMBB 2YOGA 2WAXA 5DYIA 1EX6A 1FQJA 2CDNA 1D5CA 2OE2A 4Q1AA 3CNLA 1G18A 1TF2A 3UMSA 3RS7A 5FOUA 3WYAA 2EFEB 2GTPA 4GT1A 1YR8A 2ZRDA 4IVRA 5JCZA 2ZRCA 4Q7LA 1S0UA 2ZUCA 2FZ4A 3CR8A 4V02A 4B2IA 1TF7A 1E9EA 3UATA 1PVOA 3TAUA 2EVWX 4BZXA 5JSZB 1XPRA 3AVOA 4NONA 4DLZA 4DLWA 4HUTA 1QVRA 4TT3A 3IIJA 5CM8B 4KBGA 2V1XA 1XU4A 2VSXA 3AVVA 3KXLA 1QG2A 1ZVQA 1KHTA 4F91B 1XMIA 4PQYA 1ZCAA 1IXRC 3U44B 1NBMD 2Y8EA 3GLGB 1VCMA 3DMDA 3NH6A 1N6RA 4DCNA 1K6MA 4UQOA 3U61B 5KSZA 2IA5A 3BFXA 3SJZA 1KDTA 3RS3A 3SJCA 2W6IA 3GEEA 1G3QA 4OHXA 1BMFD 2IXGA 5TMPA 5EE3A 3X1ZA 3U7HB 1ZM4A 3WY9A 2VQSA 1NRJB 1AA9A 3QY0A 1CR4A 4CRWB 5JHGB 3GFTA 2G83A 4JT4A 3KDSE 3VR1A 2CK3D 3IGFA 3B1VA 5GVRA 1Z6XA 4ZIRA 1G8PA 2D62A 5F98A 1Z2CA 3MWYW 3C7KA 1JR6A 3QI2A 4RFSB 4Q48A 3B1YA 3LAWA 1G17A 1M7HA 4IHQA 3EA5A 3UMRA 3ZVLA 1US8B 2WOJA 1E0KA 1OW3B 1G3MA 1WXQA 2B92A 2HCBA 2OFWA 5DN6A 4AI6A 1TUEA 3R7WB 421PA 4BGDA 1SZPA 5KNBA 3T35A 2J41A 3GJ8A 2ZS9A 4QHTA 4V0LA 5CB6A 4TZ6A 2C99A 2YOFA 4GOJA 3TQCA 3NEJA 1XNJA 4BECA 3LBIA 3BOSA 3IEVA 4M9XA 3PUVA 3GQBA 2ZYVX 2GBLA 4IOMA 3FB4A 3PR1A 4BEBA 4A6XA 1XD9A 1C1YA 3SJBA 2WTUA 1GKYA 3VX4A 2O8FB 2VHCA 4F4IA 2LKDA 5FL3A 4HATA 2A3RA 2FH5B 1T91A 4PSAA 2GILA 3K09A 1EWQA 3H86A 2C9OA 1X8JA 3I1FA 4KSCA 1E0AA 3AF0A 1ANKA 5CLQA 1CULC 1OXTA 3VKWA 1R0ZA 2P0EA 2HLDA 1IY2A 3CRQA 1GNQA 3OFND 5KSYA 3QXSA 2OUKA 2WJHA 3T12A 2ZJ2A 4Q00A 4N0DA 4Q4AB 4HAZA 3IUYA 4HZIA 5JZVA 2R62A 1VCNA 5JLJA 1F2TA 3UG7A 2QP3A 1MO5A 1W2GA 3EC1A 4P4SA 2I4IA 4ZDIA 3OHMA 3RRYA 1KDOA 1SXJC 4AY2A 4P33A 2IUUA 1E69A 5CJPA 2OCPA 3TUZC 4GSYA 2ZRHA 1S9DA 1V5WA 4IEIA 1D6JA 4NBSA 1TQ4A 3TGPA 1G7SA 2NGRA 3Q85A 1NSFA 2BMEA 2C9CA 1W4BA 1WCV1 1D9XA 3U4QB 2YKGA 2H1LA 4GZMA 2OXCA 4TN1A 2ZXUA 2C8VA 2NZJA 2OSBA 1T3LA 1P2SA 2D3WA 2DFLA 1KOFA 3MAAC 2BJWA 1NN1A 4OQNA 3AKEA 3ZQ6A 4D4MA 1T4GA 3SE0A 1XJ0A 1TL7C 4B6EA 3CRVA 2B8WA 1HY3A 2CBZA 2RGNC 2OM2A 3TLXA 2ZJYA 3IO3A 4JVNA 3L82B 1YZNA 3OZXA 4IDPA 2GEVA 5FTNA 5K8UA 1KI2A 2A30A 4OK3A 4LV5B 1YRAA 2P2LA 3PUZA 1IY1A 1YR7A 3VR2A 1P4SA 5GJWC 3CWQA 4JYCA 2H16A 3EC2A 3VTKA 4LHWA 4FCWA 2QPTA 1ZYUA 2N42A 4V0NA 3REGA 3W34A 2IF0A 3L0PA 4IDQA 3TBKA 4F7WA 4NYJR 3K9LA 4QHYA 5EE1A 3W6OA 5CITA 4LBZA 4BRUA 1YZKA 5E4FA 2BCJQ 3ZD6A 2ZAMA 2MSCB 3RWMB 1X86B 2YWFA 4QXAA 5CJ2A 4U5XA 1ZNYA 2P6RA 4W5HA 3ND9A 5KSOA 1J90A 1CJVC 3P32A 2RAPA 5DHAA 1M74A 5KDOA 3WYFA 3EIEA 1GIAA 3A58B 2NG1A 2PT5A 1JI0A 2R8RA 5L3QA 3GLFB 2IYYA 3K0EA 2G77B 4MGYR 4MGZR 5DLQC 3KQLA 1QHHA 3W8RA 3ZD7A 2GVZC 1ESMA 2D74A 2A5GA 4CVNA 2CVHA 1HE8B 2VP2A 1R8SA 2ZEJA 1GRNA 1NIJA 2ZM5A 6Q21A 3EA0A 2ZRIA 3GJXC 3CR7A 2ZYTX 1P5ZB 4X8LA 2AFHE 2Z4SA 3DM9B 4ARZB 4M53A 5E7JA 1NLYA 4EQ6A 2DWOA 3LO5A 4C0KA 2OXRA 5J5CA 5BQ5A 1PV4A 3EPHA 1OFIA 3KKMA 4XJXA 1IY0A 4RSGA 4URZR 1LF5A 2G0NA 1ZD8A 4R2IA 5TV2A 2JLXA 3UIEA 4JYBA 3AQ4A 3C4JA 1CLUA 1N6LA 3K0CC 4PQRA 5F9FA 3HDTA 2GEDA 4M8NE 5AJVB 3E5HA 4DZZA 5B30A 1DOAA 3MJHA 3BORA 4GI7A 1JEEA 4LJ9A 2ZS7A 1DELA 4WZAE 1IM2A 2JGNA 3AGPA 2IHBA 3KQNA 3EARA 5EP3A 3VU9A 3U6KA 4IDNA 4JVLA 1I2DA 3ADDA 2B8TA 5FBQB 2QORA 1T9HA 1NY5A 1ZJ6A 5GJCA 5FPSA 1OF1A 4DIDA 5FTMA 1W1WA 2WHXA 1FUKA 1UF9A 5KPDA 1YZUA 4KVAA 1G3IA 4R98A 2IS4A 3C16C 1M7GA 3UWOA 4OL0A 3IIMA 2F43A 1DEKA 4XTRA 5IK2A 1ZNXA 3HYRA 3PUXA 1SKYB 4LYAA 4CW7A 4FD2A 3THWA 2RGGA 1IBRA 2FPMA 1QHYA 4W7SA 1LS6A 1FP7A 1GDDA 1MKYA 2JAQA 1UADA 4Q9KA 2FN4A 5JI2E 5L3VA 2VLIA 1N6KA 3VAAA 4TL9A 3A1UA 3WRXC 3P4YA 4FCVA 2WIBA 2QL6A 1R5OA 2BBWA 2WWWA 2F1RA 3KKQA 4F93B 3ZDQA 4LHYA 5JI3E 2VF8A 1I4DD 3QVUA 2H18A 4EUNA 1GFIA 5JECA 1YZLA 2FV8A 3IQXA 1XXHA 2IXEA 3WP1B 2A78A 1U81A 3N2EA 2DFKB 2AD5A 1BIFA 1KMQA 3QKSB 4NYJQ 4Q4JA 2QBYA 1HT2E 1N6OA 3IIKA 4HLQB 4EFNA 1EESA 4DDVA 3KTAB 2BM0A 2ODBA 1G21E 4GMDA 4B3XA 4FINA 3BBPA 3QEJA 2E9SA 4OQMA 4PO8A 5J47A 2ANBA 1KMHA 4MKIA 3PV0A 1E2KA 1ZD1A 1DAMA 2IYQA 2V6IA 3OESA 2XTMA 4XD7A 3T5GA 5GJVC 3T1VA 1A7JA 2IXFA 3H2YA 2VHUA 4RD1A 4P3YA 1QG4A 4DLTA 4L9WA 2B7CA 4BFUA 2FGJA 2YC4C 4F92B 5DHFA 2DB3A 2WJJA 3CRRA 2RGBA 2X2FA 4FMDB 4C4PA 2CLDX 3K0AB 4ASUD 3AF3A 1T3SA 2IYTA 5BXQC 1WP9A 5HE8A 1COWD 1D8TA 3Q5DA 2WJIA 4L5BA 1E0JA 1SVWA 3BAFA 1Z6TA 1H8ED 1Q1EA 2ZSBA 3TSWA 2VSFA 3SC3A 1CJUC 1YR6A 4URWR 3BB1A 1G7TA 2BC9A 2O0KA 4QGFA 3EZ7A 3FMPB 2PX0A 2HUPA 4D0GA 3DDCA 1WMSA 1RIFA 3IBGA 1SVKA 2BV3A 2XITA 3QF4B 4M9ZA 3QQ5A 5EXSA 1Z0DA 2O8EA 1ZC3A 4NYMR 2C5LA 2G1JA 5AJYA 3K0SA 4ZDKA 2QI9C 3SHWA 5FUWA 1G3UA 2IC5A 1UKEA 4JS0A 4DEXA 3AF1A 1UKYA 3NBXX 1AS2A 5DI3B 4B44A 3TAHA 1E2MA 2GKSA 3VHXA 5FBVB 4D25A 1SHZA 4DLUA 4LBYA 1D2NA 2J5XA 1HA3A 3IO5A 2ZR9A 3P20A 3KZ1E 2AWNA 2OBLA 1ZD9A 2GCOA 2PH1A 1NMYA 2ZSFA 1VCOA 1Z28A 3FTQA 3JVUA 4HB2A 4JLAA 4CIDA 4OI0A 1NJFA 2AFIE 1KI6B 2AK3A 4QNMA 2O8BA 4IKEA 2DY1A 1GKUB 2IW3A 4TYNA 2RGEA 4MUBA 4Q4HB 2JATA 5D3MB 2ZPTX 3I5YA 1FFHA 5DGXA 1N3BA 1LB1B 2LCFA 1KDPA 4GDFA 1II8A 3GJ3A 5HR5A 4RD4A 2CCGA 5EE9A 4CEHB 2WSSD 1Q0UA 1LV7A 3ASYA 1QHNA 4K46A 3ICEA 3L8ZA 4AYTA 2HCJB 4GP6A 1PLKA 3EZ2A 4N3NA 4JLVA 1E32A 1E2DA 2FZLA 2V54A 4RZXA 2BEJA 5SZKB 1LTQA 2W6ID 4EFLA 3SQXA 4PC3A 2QTFA 4UNRA 1G6HA 3FHOA 2ZJ8A 4RVCA 3SFZA 1S1MA 5TDHA 1KI1A 4EKDA 3CPEA 2CLSA 2IYRA 3BIFA 5IRCD 2QSYA 2CNWA 2Q9AA 2PZEA 1DVRA 3L0SA 4Q19A 1JNYA 2F3RA 2FFBA 4EJSB 1U9IC 2CL7X 2B7BA 3A1SA 2DYKA 3U5ZB 1KJZA 3I3SR 2QAJA 2AKYA 1EFUA 3QIAA 3AUXA 4M2LA 2ZI5A 4MRNA 3RWOA 3B85A 3WNDA 4JLOA 3W6PA 1E9FA 3GD7A 1J99A 1OIWA 4I99A 4CDGA 5AJZA 1A2BA 4P31A 2FSFA 4JLPA 3UG6A 1UBFA 1E3MA 1NN0A 1UFQA 1Z0AA 4UXIA 3VFDA 3H4MA 2VSOA 2ZJOA 3N5CA 2GJ9A 3LNCA 5DN6D 3CLVA 4J0QA 1HV8A 2QQEA 3WNBA 1CRQA 4ESHA 1RFLA 2FWRA 2GZAA 5L3RA 1TU3A 5SZIA 4JLMA 5FBWB 3WMGA 2ODWA 3IQWA 2GESA 1FMJA 3VKHA 4TLCA 2IYSA 4FMCB 2JEOA 2LKCA 2OEPA 4WXPA 1AZTA 4P4TA 2ZRLA 1NSTA 3S1AA 2XZPA 4MYUA 3ZS8A 1CRPA 4RFVA 2H8KA 4G5RA 1G8HA 3WMFA 4BFYA 3ZVRA 2OFXA 1Z6GA 1VDZA 3TVTA 2RHMA 2VTKA 4LSGA 4UJ3A 4KLNA 3RANA 1ZAKA 3GJ5A 4H9GA 1P61B 5JS7A 4AKEA 1NIPA 1Z22A 1MH1A 3IBYA 3DO6A 1P9WA 5HZKA 1RPZA 4LJYA 1XTQA 1CR0A 2IT1A 2VA8A 3HU2A 4FW9A 1OFTA 4M21A 3TMKA 1RC8A 2C9YA 2W0SA 1RZ3A 3F5FA 1JBKA 1LF0A 1E9RA 1KK2A 2J7PA 1OPXA 4Q7KA 1FTNA 2JLVA 1F2UB 1UBGA 3NC0C 5E7IA 2ZSAA 3EPJA 4LHZA 3U7GA 5AR1A 4G5QA 2REBA 4B3FX 2XZOA 1BH2A 1VIAA 1N5IA 1OXUA 3SR0A 2ANCA 3O8DA 2ZITA 4I1UA 1F60A 1N0UA 2PCLA 1AK2A 1NG1A 4BEJA 1R6BX 5B58C 5KTYA 1TEXA 1TX4B 4RD6A 2AN9A 1IQPA 3PJRA 4XIGS 1W4CA 5JSZA 2NMVA 5F9HA 3M6AA 4I81A 3AF4A 3AH8A 1H65A 3C14C 4FI3C 2GXQA 5H70A 4RJLA 3IHWA 3CZQA 1ZINA 1JXMA 2XGJA 4A2PA 1BYUA 4BLTA 3U60B 4EPVA 2D2FA 1G6OA 4LCBA 4CT4B 1E9CA 4XOIA 5J4HA 1R0YA 2OBNA 3U44A 3EIHA 2MSDB 2V3CC 5TY0A 5CDFA 3GLGA 2HYDA 3W5JA 1UKVY 3UKDA 4NTZA 4QNRA 2RHDA 5EUQB 2C98A 1KIMA 2ZVPX 4B6FA 4IFBA 4O3MA 1G64A 5JEEA 2PMKA 3K70C 1XMJA 2QY9A 2XJ4A 5D3QA 1E4VA 2V7QA 3PCRB 1KJWA 4B2PA 2WBLC 3RHFA 2BWJA 1U90A 4Z1MD 3B7GA 2HJGA 1PJRA 4MH0R 4US0R 5DO9A 1XEXB 3HR7A 1NVXQ 2KBFA 4M1WA 2GK6A 1XPUA 3NVAA 4KODA 3WMEA 4TQUS 4ASUA 3B8HA 3C8UA 2G6BA 3P4XA 1COWA 4U7DA 3FHCB 3ZVMA 3NTUA 2HJVA 3LXXA 1H8EA 4DLSA 2FX3A 4C0HA 1YZGA 4HYYA 5FR1A 4GL2A 4RFSA 1XTSA 2QT1A 4HB3A 1EFRA 1US8A 1WQ1R 2ONKA 4YQFA 3DM5A 3U6BA 1Y63A 4CEJB 1ZNWA 2XAUA 4C3ZA 1IAQA 4V0MA 3A1WA 3R7WA 5E3HA 1X1RA 2PLFA 1ZIPA 5IDVA 2ZR0A 3JVVA 3GJ7A 5AUQA 5FUXA 1SULA 1M8PA 1MV5A 3GCGA 4LV6A 3KX2A 4B75A 5CLLA 4DKXA 3A4LA 4NCHA 4LK2A 4MDEA 4MRRA 1DE0A 2L0XA 1RRFA 4A4DA 4DT1B 4I1SA 2O8FA 5G3ZA 5F3WB 2IHYA 1NVWQ 5EP2A 2Q9BA 5HTKA 1IJEA 5FI1B 2REOA 3KUCA 2WWXA 4Q9JA 4G0NA 3QXHA 4UNNA 4GNKA 1FPMA 1Q20A 1EXMA 4Q4AA 3X1YA 4ZDWA 2BEKA 4LHVA 3RS2A 3SYNA 2WSSA 2V9PA 5B2ZA 4KXFB 2PZFA 5DIFA 3ND8A 5IK2D 2GZDA 4LYHA 3QNUA 1Y3AA 4OBEA 1CJMA 4Q47A 2WWIA 3VX3A 1E2EA 2QA5A 1L4UA 2P67A 3QG1A 4TL7A 4BLOA 2QN6A 4JSTA 3VKGA 1J7KA 4C30A 4A0RA 1YJ5A 4M1OA 3SU8A 1OJLA 3U4QA 1AGRA 1S3SA 4WOPA 3EXAA 4S35A 4O25A 1W0KA 1JQLB 2IYXA 4Q9IA 2G0TA 5TARA 5HKKA 2ZU6A 3PIRA 4FWIB 1NP6A 3KJIA 2JLQA 3F8TA 4B3DA 3CH5A 1KSJA 1QVAA 2F55A 1JB1A 1FOEB 3FFAA 1Z83A 3P26A 1HTWA 1CEEA 1Z3IX 4MKHA 1G5TA 4Q03A 4OHYA 4NZYA 4YMVA 4OQFA 2ZTSA 4NMMA 1N2CE 4LOAA 4HLUA 5LD2C 3RSLA 5JEDA 4OQXA 4XD7D 4IXMA 1CJKC 3GFOA 3UXMA 3K1JA 4AG5A 1BKDR 1MRNA 2WMOB 4C0SA 4NHOA 1EFCA 1R0XA 4GFDA 3AVTA 2KBEA 4WZBE 2SHKA 4TLEA 2NO0A 3KQKA 4PHHA 5CK5A 2F6RA 5CDFE 4PQFA 3GLGE 3WBKA 2Z83A 1B0UA 4Q5IA 3GLFA 3O47A 3SQWA 5HZHA 4RKEA 4YC7A 4BRWA 1XEWY 1HEIA 5FFMA 1DAEA 4NL4H 4BWYA 4I4LA 5EXXA 3B9QA 3THYB 2IUTA 2YC2C 2WV9A 4G5SA 1XCGB 2DHRA 1ETUA 3VQTA 4MYTA 4URYR 4TYQA 5LB4A 4ARZA 2AWOA 2GDJA 5FUVA 3I92A 1RJ9B 4JMPA 3THXB 4B48A 1C4OA 2WJYA 1R2QA 4Q66C 1VYUA 3OAAA 2N46A 5AUPB 2I1VB 4URVR 1G5RA 3NXSA 4LBVA 1KK0A 4B3BA 3VR3A 1DARA 2FGKA 4EPRA 1W36C 3KFXA 4D6PA 4LWZA 1XD2B 4ZO4A 2EFDB 4IRUB 2MSEB 3AP2A 4DLXA 2WWHA 1Q12A 721PA 3AVPA 1TUIA 2NPIA 5BW8A 2B6HA 4BLQA 5EE0A 1ONBA 4O0MA 4V0ME 3CZPA 5KNCA 2YNMA 1KSHA 3C5CA 1CIPA 1E6CA 2QROA 5AUOB 4M1MA 3QKTA 1II0A 1QZXA 2ZJ5A 1SKQA 5BYJA 2WVJA 5SZHB 1VIYA 4C2TA 1GM5A 3QKRB 1Z29A 2ZRMA 4AKIA 2JIZD 2IYVA 4JZKA 621PA 2O52A 1ZM7A 2AHOA 4GP7A 1VTKA 4YLGA 1XP8A 1Z6YA 2Q3FA 3RYTC 1N6IA 2R6DA 3LQQA 3PUYA 1WE2A 3K09C 4JJKA 1WDTA 2GXSA 2EFGA 3W6NA 2ZUDA 2O8CB 2W00A 3ICQB 4L4UA 3L0OA 3L8YA 5DSZA 1HQCA 4TMWA 1IXZA 3QXXA 3U3OA 2RCNA 4W5JA 3CH4B 5DH9A 2OESA 3N70A 1SXJB 1ZRHA 2FU5C 2TMKA 1L2TA 4BFZA 4DSTA 5EUMA 2CNWD 4M4SA 5HCNA 5JJIA 3ONWA 4Z1MA 2Q3HA 1Q21A 4Q02A 3X1WA 3U3MA 5J4LA 1G3RA 4NCIA 1SQ5A 2PLRA 5E7MA 2OILA 1E1QA 4KBFA 1DPFA 3RRNA 2QP9X 3K9NA 2J1LA 1XMSA 3B1WA 1UJ2A 1EK0A 4C0QC 2XNSA 1QHIA 2DBYA 4PZZA 5AUNB 3WHLA 4ZCMA 4DDUA 2VP9A 3MRSA 5ELXA 4TTPA 1JAHA 2JJ1A 3KKNA 3QKSA 5CYOA 4PC2A 1X3SA 3NH9A 2WJVA 1GKIA 2EYQA 2YVUA 3B6EA 2CL0X 3H1TA 3KTAA 4JBYA 5G40A 5C4MA 4AKHA 2QU8A 1KSFX 3HPQA 1NL3A 2VP4A 3QE0A 3M0EA 4PAQA 1FL9A 2ODNA 2Z0MA 5C18A 1E9AA 2GRJA 3HYTA 1J8MF 1KO8A 3CBQA 1GRQA 1KGDA 5JJKA 1II9A 1P9NA 1G5PA 5GJBA 3IKJA 2RMKA 2V8OA 1U0LA 1HH4A 3L2OB 4G01B 4PO1A 4A0FA 4E07A 2ZQ5A 3NDBB 2GVDC 3A36A 3K0AA 3LQRA 4UKDA 2ZI7A 4DDTA 3AVXA 2OBMA 3WP0A 5K8IA 1IHUA 2GJSA 1SXJE 2F9MA 2DWPA 2ZRAA 3O8CA 1DAIA 1Z0IA 1SVOA 1U8YA 4DC9A 4BFXA 4JVMA 5FOSA 1JJ7A 3GLFE 1JQJC 2ZRBA 1Z0FA 2ZE5A 1OT3A 3QF4A 1GOTA 3Q7QA 3EPKA 3PEVA 4KYUA 4LRWA 1N6HA 4IFEA 1T3HA 5DI3A 1UKZA 1YVDA 2J3EA 2J7PD 2OCYC 1NMZA 3TK1A 5JWOA 1GITA 1N0WA 1JPJA 4B73A 4DEYA 2VYFA 4A6PA 3EG5A 4NCJA 221PA 2DR3A 3FMFA 3HWSA 2G3YA 5JWHA 3NHBA 1G8GA 1XTKA 3O8BA 1E98A 2Z5FA 3IILA 3TNFA 3TR5A 5J4KA 2VP5A 3SBEA 4DWJA 5A4JA 2CXXA 2WAYA 2GETA 1KI6A 1TQ2A 2ZJAA 1GRRA 3TW4A 4ZCIA 4D81A 4Q4HA 5CM9C 5D3MA 2HYIC 4EDHA 5FPTA 1BO6A 2W2XA 2XB4A 3B13B 4MKGA 1M7BA 4WAUA 1EFHA 4F4JA 1P62B 1TF5A 1DG1G 3BFVA 3RNLA 4MDFA 1G8YA 1OE0A 3PENA 4URXR 1KJYA 1YE8A 1ZIOA 5KSPA 4R71A 3J81k 4NDZA 3C5HA 3ZS9A 5LPNA 1NI3A 3ETLA 3QPUA 4CEHA 1NG9A 3CPJB 1GNRA 3EW9A 1O3YA 1JPNA 2WJGA 2OT3B 2Z6VA 2YYZA 3FGNA 5DYGA 5JRZA 1P2TA 1JJVA 3MWLA 2JA1A 2W2TA 4ZI2A 2DCUA 2YHSA 1P2VA 1MO3A 2YZ2A 1W4AA 3KB1A 2V7QD 4NCKA 4EIWA 4LI0A 1QHGA 1OKKA 1FNMA 1OYWA 3GMTA 1ZUHA 4PPQA 1U94A 5L3SB 1E2IA 2FMXA 2A7QA 1O87A 5DISB 4OJKA 5E95A 5H68A 1SKYE 2ZE6A 4HLCA 4EJSA 1CU1A 2ZI4A 3LLMA 4IVQA 3SBDA 2W2VA 3CNNA 1W7AA 3EAQA 5J4VA 2YWGA 1E4YA 2ZREA 4CEIB 5ANRB 4NYIR 4TZ0A 4KFRA 4ZPXA 4DLRA 3P27A 1T0JB 3BFKA 1MRSA 4KFSA 4BFWA 2AXPA 3R8CA 2HXYA 1W2HA 1DADA 3VR4A 2BMFA 2ORIA 1E2JA 1G291 1FNNA 2XOKD 1Z0JA 2WWFA 2X2EA 1EFRD 2LWIA 3A1VA 2MMGA 3KXKA 1EX7A 3T5DA 2V6JA 3DVLA 4QG7A 5C1BA 4K81B 1L7VC 2IBMA 1XJQA 2R6GA 1E99A 3K9HA 4TQAA 3PXGA 1CR1A 2J7KA 4IEEA 1OH7A 1Z47A 1DS6A 1FX0B 2F1IA 3MJRA 1VCIA 1KSGA 3AVYA 3LX8A 2WM9B 3AVQA 4M1YA 4BQSA 3MUFA 1P9RA 1G4AE 3EZFA 4PSVA 3WYGA 1UDWA 5F2EA 3A1TA 1AKYA 4QM7A 3I4LA 1TEVA 3AP3A 3CW2A 4B71A 1ZW6A 4BFTA 1W5SA 5G53C 5JCPA 5LDDC 3SHFA 4A82A 1NY6A 1OB2A 4EPYA 3M4YA 3PEYA 1DAFA 3WBJA 4LJAA 2XJ9A 3AVUA 1S2MA 3QF7A 2IWHA 1GUAA 3QENA 3MFYA 1IONA 1Z2AA 3QBTA 1S4QA 4JKYA 2JIZA 1AN0A 2NPFA 4LUCA 1I2MA 3I62A 4WVFA 1CTQA 1KKLA 3NEYA 1GL9B 1W49A 3LD9A 3TR0A 3R8FA 5KU1A 2I1QA 3WRYC 2W6JA 2YJTD 1S8FA 1C9KA 4HAWA 1OXXK 2QG6A 2KI5A 2N1BA 2WMNB 1ZU5A 4JBXA 3GEHA 4LDJA 2H7VA 3K0FB 4Q1EA 4PXAA 4PHGA 3VMFA 1Q3TA 3KQUA 4WZ6A 2ZE8A 3RLFA 4TWZA 1ODFA 3I61A 3SNHA 5FI0B 2CJWB 3PVSA 3UANA 4PAOA 1A82A 2J59A 2WPDA 1F2UA 2JLUA 4NPHA 1XTRA 1ZC4A 3EWAA 2CMKA 2QEQA 4ZCLA 4M1SA 1QBKC 2QM8A 2UZIR 2GJ8A 2VL7A 3IDQA 3CX6A 5FOVA 4ZDJA 2A5FA 1W0KD 4WA7A 4B47A 1WF3A 2J0UB 1E9SA 3WNCA 4HAXA 3SYKA 5HKKD 5AK0A 3KXIA 2R6CA 4A36A 3D31A 1D9ZA 2ZETA 4A8JC 2FFHA 4JLNA 1GILA 1R8QA 1W46A 1LS1A 4I1OA 2P6NA 4KHZA 4C0LA 1E9BA 1OH5A 1EGAA 2ZS8A 4B2LA 4C0AC 3DZ8A 4CT5A 1M34E 4FWTA 4IW3B 4HUQB 1K8RA 4QKQA 3NC1C 4QJ3A 2ORVA 4R9UC 4M0LA 1KO4A 5FBLB 1Q22A 1VHLA 1QHXA 821PA 4UNSA 5FTLA 4Q1BA 1XRJA 5HPYB 2QGZA 3LH5A 1E1RA 1JXOA 1SXJD 1OXVA 2BMDA 3E1SA 1XEWX 1AKEA 1NLFA 4PPGA 4M9QA 3REFA 3TUJC 1E2NA 4NP6A 4UNQA 4JL6A 1QRAA 2QT0A 3E2IA 4NYIQ 1ZP6A 2QNRA 3ZYCA 2GXUA 1XEXA 1TPZA 1KI3A 4L15A 2CVFA 3PQCA 2J46A 4B32A 2FSIA 4Q1FA 2H17A 2W58A 2QMEA 3LWNA 3OE7A 3PFIA 2F3TA 4JLJA 5GVSA 1A2KC 1VG8A 2PMDA 2YV5A 5GADl 2QZ4A 2XX3A 1MR3F 1A5TA 1NVVR 3FWYA 4OI4A 3EZ9A 2ZRJA 4PC1A 3DOFA 4QC2A 1T8TA 2FPLA 3T1TA 3GP8A 3BH6A 4DCVA 2RKOA 3DHWC 1NF3A 4A8JB 1RYHA 2R65A 1OIXA 3DKPA 1SVSA 2GEUA 3OAAD 2VO1A 4CEJA 3E70C 1XTIA 3FDIA 1U0JA 2QAGC 1F3OA 4PPNA 5BYKA 1Z08A 4E03A 1XF9A 5HE9A 1N5LA 2OLKA 1DAGA 2VRWA 2JCSA 5G3YA 3ZIAA 1N25A 4GZLA 3L43A 4AK9A 4TTQA 4C7OB 1VYTA 4QJ4A 1KKMA 3AF2A 1Q1QA 2ZSDA 1NVUQ 2XEXA 1LNZA 2ZSEA 3R20A 3MCAA 4DT1A 4YMUA 2XZLA 2XXAB 2H92A 1F6BA 4IOKA 4I1VA 1DO2A
chains in the Genus database with same CATH superfamily
4LMRA 4CKBB 3BJMA 3IVGA 2Z6AA 5JCOC 4QXMA 5I47A 3ZY3A 1WRBA 3RAGA 4LA4A 4L27A 5C81A 4DUGD 8LDHA 4AQ7A 1RLOA 1G8AA 2X15A 3EB9A 1WPQA 2D8AA 1KH1A 3PQ7A 3IP9A 4RD0A 4D7AA 3ZQKA 3LUPA 2ORWA 4YCMA 3Q5EA 4FHEA 2E5LB 1RAHA 1G38A 1PFVA 4HAIA 4LYYA 1SXHA 1UM8A 4C88A 2PO7A 2H7YA 2WUDA 5FV7A 2VR1A 5C8YA 2RE8A 3CO5A 3AP1A 4I6EA 5EN4A 5GGXA 3H6GA 3CUVA 3GEGA 4MRVA 2NW6A 1QQAA 4JLBA 4TUYB 5KYUB 1P19A 1U2TA 2AL7A 3I1YA 4IY1A 1QF6A 3RH0A 2W0MA 1OFVA 3MTAA 1DC7A 3F6YA 4DR7B 1NW9B 1XZMA 1MAAA 2ZJBA 2PQ0A 1T1EA 4GE0A 5KOHA 1CUWA 2GUWA 3FUWA 4BJ1A 4CHGA 3LKBA 5CAEB 4HPWA 3VNSA 5FWDA 4JT8A 1A4XA 3VU1A 4K2HA 4LWOA 4N03A 4O4JB 4QGGA 4ZC1A 5HJ7A 4L0MA 2AH5A 3E7XA 1NTOA 2NO9A 4UHEA 4LYGA 4YCSA 1W2WB 3P1JA 1T0PA 3R3ZA 2OHIA 2XBMA 4AO8A 3HY3A 4BQEA 1BXGA 2VIIA 2G1KA 3R3YA 2IITA 2XT6A 4YCNA 3Q8XB 4CV1A 2C7PA 2I3ZA 4DIKA 3RARA 3BB4A 3S29A 4BB5A 4FC6A 4CL0A 4PBRA 5AK4A 1I0LA 5F1YA 2JHFA 3QFTA 5DXJA 1RE0A 2E6UX 1MHPA 3F2IA 3OOHA 6YASA 5HMMA 1B1CA 1EP9A 2FG5A 4NCXA 1XDWA 2IEYA 3BRCA 4J16A 3TSAA 3LA6A 4B2YA 4AQYB 3PUWA 1DZIA 1LRLA 2HA0A 2PX5A 4HVCA 3N7TA 2C0QA 2VSQA 4NICA 1WEKA 1G5QA 4EYOA 4LFAB 1SCIA 1IUKA 2IKSA 4JJ7A 4MROA 2R9VA 1M6VA 3L04A 3UWDA 3I05A 4AY5A 5AVVA 1PW7A 2O2ZA 3JXEA 2E55A 5E3JA 1A7UA 2PSJA 3DBRB 3DR5A 3N2IA 1Q0PA 4KXMA 3DB1A 1S96A 2XADA 2C2HA 3VU8A 1E5TA 2VAMA 5A62A 1SUPA 2AD1A 4BVGA 4O5OA 2I7TA 1GVNB 3NJ4A 4HB4A 2X8LA 3MILA 2QR5A 4KK3A 4UW9A 4BGVA 2B83A 4LJ4A 5JMTA 5KX5B 1YJBA 4BIMA 4RJIA 3CONA 3E82A 3U2QA 3I6IA 2CGEA 4RF3A 4IXTA 3R0QA 4M0EA 1VHTA 2B20A 1GZ7A 3AFOA 1F1BA 1TXGA 4NQRA 3DZDA 4OCZA 2NAPA 1W1IA 1PUXA 2EJTA 1TO2E 3A31A 3FNRA 2H9YA 3KS9A 4UAGA 1CUJA 1NVVQ 3ADCA 4ZOEA 3V33A 2YDYA 3LQ4A 1I7LA 1MABB 3CVOA 2NNWB 4LYFA 3AFIA 3RO7A 1V4VA 1M2FA 3CPHA 1FFGA 3CEAA 1F14A 3TQTA 4BPRA 1YOBA 2QY6A 3HGMA 1R0SA 2GHTA 2G17A 2GJ4A 3EJWA 3NHAA 4IM7A 5HGXA 2WDZA 4DADA 1KFKB 1EUDA 2L69A 3TRFA 1KJIA 2P6PA 1YRLA 1WSBA 5JVDF 3QVGA 1JJFA 4BNJA 1RJ9A 5B4TA 1J20A 1NW7A 4G4SP 3HU1A 4QIHA 4P08A 2GEKA 1Z4MA 3DMNA 1T43A 2OG2A 3PT5A 4PPYA 1POWA 1H8HD 1MX5A 1RSZA 1JA1A 4HH4A 3HY6A 1T6ZA 3B1ZA 4PLWA 4BASA 2OCGA 3U7FB 4HR7A 1PJCA 4B3MB 4YMWA 4F5WA 2R84A 1U3UA 1YMUA 4B3DA 2V6BA 1TZ2A 3X43A 1SELA 5BWBA 4KWEA 4E2FA 3WA7A 5J2TB 3ZJTA 3VHLB 1I3NA 2Y0EA 3A4IA 5AKXA 1XA0A 2F1JA 5C0OE 2XMQA 3NAGA 5KO2A 1BS1A 3FNBA 1WZIA 2EZ4A 1QIIA 3C3EA 3L8EA 4MDHA 1GEGA 3U4HA 4G26A 7AT1A 4QDZA 3PCTA 1V48A 1L1QA 1BCRB 3E9ZA 3I9LA 4KYTA 1ZMBA 3R7LA 4KR7A 2QMZA 1G7CA 1QV6A 1RWKA 2ZULA 3BC1A 2C42A 2IU3A 2JF0A 4TYYA 3JTMA 3P45A 1H4VB 2Y0PA 4YHHB 1R5BA 3UXYA 4BHTA 1ZUWA 3ZU2A 1JVNA 3DH0A 1D2GA 2Q1UA 3Q3JB 4LE2A 4PINA 5DLYA 5IASA 1YNOA 1U4OA 4YR9A 3PF9A 2R00C 5IZCC 2FKAA 4WZAE 1TADA 5KNCH 1OHHD 2WILA 3I6QA 1RPJA 1Z6AA 3SX4A 5HZMA 1DUIA 4K6HA 1OFGA 521PA 2VWQA 3CM0A 3CN9A 5AJXA 2OZEA 1I9CA 4F72A 3D7LA 3IL2A 1I3KA 1JQAA 3JAKA 3G2PA 3OOJA 4K9RA 4L4YA 4YJGB 1CSEE 3MSXA 4MRMA 5HNKA 1XZFA 2DP4E 1NUUA 1G9XA 2ZTHA 1BMTA 3L6EA 4NV3A 1PEAA 3G82C 4O2BF 1QVZA 3KT3A 2PX2A 4IVPA 4OUDA 3VR6D 3Q8LA 2IOHA 3LTEA 4BB6A 4M8IA 1RKXA 1M1UA 4FZVA 2IPLA 2Q3MA 1X7WB 5LZ2A 5KVQA 3WMXA 2H00A 3B6ZA 3KEMA 1XX6A 3GDOA 4Q6BA 5HWSA 3CV3A 1ZM2A 4PTZA 4RSHA 5C46F 1Z0KA 3OTOB 1L8LA 3O84A 4GC9A 5AKHA 2GJAA 1T2EA 1Z34A 2GN8A 3HA7A 3OCJA 5BNWA 1D8AA 1BMQA 2A9VA 4O08A 1W8IA 3AUSA 3AEZA 4LQLA 2X19A 3JCZA 4OAPA 4DGQA 5ARBA 3AB3A 3G2HA 5JYCA 3IAM1 2FFAA 3LCVB 1LW7A 1KC1A 1LI5A 3FYCA 3LIIA 4PGFA 4YQZA 1LJUA 3WLIA 2J87A 2QN7A 2RGNA 3KJNA 2QJFA 1B76A 2OV1A 2WSYB 5EMNA 4BAGA 3TGWA 4QPZA 3H2ZA 1PFGA 3SPXA 4DC1A 5IHPA 1WF6A 2P5YA 2ZYIA 4YJDA 3GLIE 4BE7B 2BFDA 3V9PA 1OZAA 1Y0BA 3TLYA 2O0JA 2QTAA 4EPXA 2PUAA 4GOKA 2QQ0A 3HPRA 3CG0A 3CHYA 4MV1A 4PNHA 1P2UA 2GZSA 4RLFA 1YRHA 3GJSA 4KEAA 2XOEA 4OYHA 1TQDA 4OSOA 4WFJA 3Q6IA 1RRCA 1BHSA 2I99A 3AUKA 3C45A 4WBNA 4CU2A 4Q37A 2VXBA 3BWDD 1RQRA 4J3JA 3SQLA 4MHSA 1KAOA 1M10A 4NFYA 3ZDAA 3ABRB 4JKIA 4HLUC 5CLIA 2NUTA 2G1AA 4S0XA 4UNPA 2X4LA 3HB9A 2OD7A 2VT6A 4MS1A 1UJBA 3B60A 4MRAA 4C6HA 3K6SA 1UZMA 4J76A 2D7CA 5HFNA 1CVRA 5IWAB 3WWOA 3AKDA 3JYOA 4N0EA 4PZ9A 1F38A 2NO1A 2A88A 5DYNA 4W5OA 2AQHA 3O8OA 4EHHA 1YGPA 3AI7A 2BF7A 3BD9A 1UINA 4Q3EA 3THSA 2E1PA 1U9CA 1Y1PA 1MOZA 5K03A 1XCMA 3RAPR 2UZ0A 1H9BA 3UN1A 3SK0A 1J1UA 1E2PA 2ZB3A 1ZEMA 1GRVA 2ZBEA 2JH8A 3BWXA 2GAIA 3EH1A 1SZCA 1SQGA 1GSIA 9GPBA 4YIKA 3N75A 3ZCPA 4DN6A 3TCXB 1HETA 3OF5A 3D7RA 2QZSA 2C77A 1NI5A 3D2LA 1BWRA 4IMIB 3TLGB 4HWKA 1KZ1A 5FULA 2OK8A 3QMPA 4OFWA 4PO3X 2BIFA 3DDNA 4RAOA 4ZHQB 4L50A 1I6MA 3BSYA 1BFDA 1I36A 4ZIRB 5A7GA 3AYZB 2I7XA 1KOLA 4EYSA 3L07A 5CT9A 1ZH6A 1PZNA 4QGHA 2A9QA 4M9SA 3ZE0B 1EVEA 1CS4C 5A0FA 4DRZA 1KR5A 4OREX 4RVGA 5IAEA 1W36B 1FLAA 4L5IA 2B9VA 4P2BA 1U7DA 1PLJA 2F4NA 1HO3A 2ZR7A 4G4JA 2ZWPA 2SCUB 2E5WA 2YJ6A 4G3XA 2KWIA 2GZ1A 4LJ7A 4TSFD 3IEIA 4GGPA 1J8YF 2UKDA 4P32A 4RGBA 1KZHA 4RSMA 3SP1A 3T0IA 3HRHA 4L28A 1EWRA 3NONA 4YT4A 2B5WA 2WOOA 2O8VA 1GZSA 1P1FA 3HNOA 4LJ5A 4U7WA 1WB5A 1UPTA 2C5EA 2RAVA 4EYGA 3PFNA 1MJ5A 3MJVA 3O6VA 3BL5A 4I5IA 4L5JA 4TS9A 3RHTA 3D6AA 3RVPA 1ZU4A 1G5HA 1RYBA 2NQTA 2OUIA 2QMUA 4LNUA 5KREA 3GQBB 2FPPA 3M6WA 3KIPA 4I3HA 3AR9A 2DPLA 3DQQA 3G79A 1ZL2A 1LFDB 5ED0A 1JN0A 3VV3A 4TKVA 4Z7OB 1OWNA 3DKKA 2C3YA 4C21A 3BH7A 4Z4CA 2JJMA 3CVXA 1RYFA 2CHQA 3BGWA 4AKGA 1R0WA 4OFBA 4PC6A 1KI8A 4CR6A 3E0XA 4C3UA 4Y1EA 4JB3A 1GNLA 3QE3A 1KY3A 3OQHA 2FSVC 2KYRA 4KW7A 2P75A 3A10A 4UXJA 2IYLD 1T6YA 1NUAA 1YVUA 3GWZA 1NPTO 2BMJA 2XI4A 1Y3BE 3LKDA 5L3SA 4H59A 3UOAB 3WX0A 4CGZA 3T3PB 1WU8A 1BDMA 2IZ0A 4FYWA 4JIMA 4N3CA 4XXHA 4XE5A 4DE5A 2FPGA 3AKZA 2EXXA 3ECAA 1UDCA 4TMVA 1DEOA 1JKFA 5K7SA 1VBNA 1JAIA 1JHYA 4MI9A 4R7ZA 1Q2UA 4YAJA 1Z45A 3TZBA 3WRXA 3BS4A 3HH8A 2IPXA 5JAIA 5KYKA 1QIDA 4P4SB 3EVNA 2QR3A 2V6GA 3QLVC 2SICE 2VWPA 5JH7B 1O94A 1ELOA 2Z3WA 3H17A 1NVDA 1VLVA 1IYZA 1R50A 4CCYA 2LDXA 3SXPA 3KPUA 3KT6A 1PR2A 4ESVA 1QHSA 1ODLA 1X1SA 1RRGA 1M3SA 3KXDA 3QWIA 1PEYA 2DC1A 4JCOA 3C3AA 1K5DA 2NTVA 1IAVA 2F1HA 4QT4A 4RELA 1JDBC 3RUDA 5AW6A 1DINA 1MA3A 2B8NA 4P7JA 3DWFA 3BK1A 3L8CA 4X84A 3WMWA 4ZMRA 2QN8A 2QLFA 2W8BA 1M2HA 3H7IA 2Y4NA 4HAOA 3IP5A 4K6MA 2HMUA 4OM7A 3VRHA 1U2DC 1MJGA 3NDBB 2HIHA 4X63A 1T5SA 3DXXA 4NAUA 3ZIAD 3NMUF 1UEJA 4G84A 5KDLA 2OFPA 1O6FA 2ODQA 2RK4A 3EDOA 4JP8A 4V3CA 3BFJA 2QN9A 3SHOA 5D85A 3LUAA 1JNXX 2QMHA 3DB2A 1BXZA 5EKDA 4CMEA 1YULA 3R9XA 1JVSA 1HZJA 1GGJA 1DKMA 2CD7A 2ZUSA 4L02A 4BZPA 4L8GA 4WN3A 4X45A 4D0NA 4LJRA 2J6IA 2FW9A 1UMDB 2XNHA 3AOEC 3EVDA 1O4WA 1YKSA 2MIIA 4TLBA 4MGEA 5E9JA 2OCBA 4INPA 2O2XA 3W2IA 3UK6A 1AUPA 1S4MA 2RHWA 5EL0A 3W4KA 1Y1RA 3PG5A 4NENB 4NZNA 1FP4A 1GG2A 3QX3A 2RC6A 4YAEA 4HAUA 3EG9B 4BB9A 3KQHA 3N8NA 3CWZA 1DZ3A 2PAAA 3DBLB 3T41A 1OJ7A 4QRDA 1GAEO 2EHDA 3FKSA 4Q16A 2J3KA 2MYPA 2RHBA 4IYJA 2GZMA 5DGIA 1WW8A 4F2WA 2Z5GA 5L3QB 5LLDA 1K2VN 8ATCA 1GP2A 2G07A 4DCGA 4H3SA 1USIA 4ZZ0A 2DLDA 2BGIA 4B7ZA 4OHZA 2BGJA 4X8OA 2ADOA 5FFNA 3W9UA 2ZI9A 2Q6TA 3I32A 4EX7A 4Z4QA 2HF9A 2Y1FA 5EPOA 1CDZA 4N54A 3ZY2A 3MRTA 4E1BA 5E2BA 1CJTC 3WV5A 1X7DA 3INYA 4I9UA 1JKIA 4GE3A 4MTCA 4EW1A 2QUBA 2P40A 3CVJA 4LBWA 1P72A 1YZFA 2GJKA 3IAS6 1ZUNB 5ALGA 3EPLA 3RYIA 4LZLA 5AKEA 1UOOA 3GRYA 3JS5A 4RL4A 3LY9A 3MIIA 5AJWA 5TS2A 2QRMA 2PEZA 3QUBA 2AF4C 4ENSA 2HT1A 2AFIB 1W0JD 2EG5A 2CCKA 1W6RA 1I4EB 3CPSA 3OEED 5TPZA 2B35A 1HT1E 1GZUA 3L8HA 5D3KA 8OHMA 3UT5A 1EIWA 2ZUWA 1I0ZA 4URUR 3WWZA 5YASA 4ABTA 4HGZA 1N2HA 3ELWA 1NC3A 1U0RA 2WAMA 4JVOA 5DSXA 1O7JA 1ZDMA 4PAMA 1RLTA 4GKAA 2WHPA 2ORYA 3LRPA 2OZPA 5AT1A 1U1GA 5CNJA 4GPTA 3EGVA 4EHFA 4KGVA 1Z2DA 2I2FA 2ZFUA 3VC7A 2ETVA 2VK4A 3IAXA 1OWMA 1C7ZA 2J9YB 2WF5A 4XM1A 2XSZA 3IEMA 3EZGA 3U4MA 1VBKA 2FP4B 2FPIB 2JZOA 3TXYA 3O82A 3FWKA 4GQIA 4KV9A 4LZZA 4GX2A 1ABEA 5IZCA 2FSGA 3KKOA 5FWXB 2F2TA 2Y9MB 2CNOA 2ZB8A 2P4SA 3BPSA 3FYHA 3NBMA 2HREA 3NRBA 2VBCA 3OFNA 4RABA 4WLFA 1YJCA 3RV4A 1GAJA 1LRJA 1RQXA 3BJIC 1E3EA 3H04A 3I58A 1IEWA 3JWPA 1RKUA 2GYWA 3FMIA 4TYPA 3WK7A 4D0LB 3WLTA 3LUJA 5EGNA 5K8CA 3GN1A 4FS8A 5C8VA 3KKPA 4IHKA 1DKNA 1GNTA 3DEFA 2F43B 1VBFA 5G1PA 1WBDA 3TOXA 1STOA 4CQMA 3PZBA 2FRVA 4LJ8A 1C3OA 3THWB 1TVEA 4P34A 4CFZA 1J56A 4K0RA 2QYOA 3KEGA 3GF4A 3IP3A 2CXQA 4XH9B 4B84A 2UV8A 3M49A 4FNAA 1YA4A 1KY2A 2OO7A 2RB4A 3QG5A 2GDZA 2A9KA 5LUAA 1HNWB 5CP8A 4DBVO 4R3UC 2VQDA 4A8JA 4BMPB 5DTJA 1B93A 1QQ7A 4AT1A 3D4PA 4RV4A 4DNPA 4YYZA 1QCCA 4R1OA 2M6SA 2ACEA 2EARA 1NNEA 3DL7A 1J06A 3W8EA 2I7CA 3OTHA 1N5OX 2POCA 1D1PA 4FBGA 4PZLA 1KNQA 3K96A 4MDYA 5DI9A 3T61A 3I5AA 1CP2A 4CI0B 1UKAA 1X2EA 4RCYA 1Q84A 2XVYA 3A6GA 2BMVA 5HZGA 3IH5A 2EQAA 3DYIA 1UJMA 4AYWA 4REQB 3SXUB 2V7PA 4F6LA 5JWRA 2NU7A 2COUA 3B36A 2K6GA 3D8NA 3Q9UA 3I28A 4TT3D 4Z54A 3G5UA 3WK8A 4C7OA 1VMAA 1WXXA 3OF2A 5EAIA 5FL7D 3RI3A 1G6Q1 2GWRA 5KOYA 2JLZA 2VPTA 1KKUA 1RE1A 2GN4A 4CMIB 4GXTA 4TXNA 3N58A 3ANLA 3GARA 1JYFA 3K9CA 4U3JA 1Y1SA 2QTHA 3GAAA 3UJNA 2QBYB 2C2GA 1I13A 3BT7A 2VBIA 3W5BA 1AM4D 2IVZA 2YWRA 4JYAB 4YX9A 3OZRA 4OH7A 5G41A 1QPGA 2GA8A 2D2EA 2OO5C 3FPAA 1CZLA 4FMDF 1EB8A 4R1PA 5DNEA 3OKAA 4AZ3A 5A3QA 2OV2A 3Q7RA 3IBSA 4D2IA 1JB9A 1P0QA 4HTAA 4AUKA 3LCCA 3PC8A 1OBFO 3ER9A 1QCZA 3GJ4A 1P3JA 2W93A 5F7JA 2MINA 1GDHA 2ZYWX 4KI7A 4M38A 1DEAA 2GAAA 4KI0A 1R6UA 4QLOA 2AN3A 1BWQA 3Q11A 4KR9A 3KQVA 2OP1A 1LCIA 4FSDA 3EDMA 4KO3S 1OXKB 4G9BA 1JEDA 1Y9AA 2OKCA 4P4GA 1YRWA 1JXAA 3DE0X 1V5GA 3SC2A 2C9BA 1HYQA 2PL5A 5K8LA 2V1UA 3CIOA 2QM7A 3EEFA 2PVPA 2CLMB 2GWHA 2OK7A 2HJRA 1NNLA 1Y1QA 4L3WA 1P7VA 4M9UA 4PGMA 3ZHXA 4C29A 5F23A 2J0QA 1LX6A 2D4HA 2E4UA 4ZXFA 3IJ5A 2FW7A 5BW6B 1RWPA 2QRNA 1RYDA 2O7SA 5AWFC 2VWGA 4CF5A 4AJIA 3TB4A 2QRQA 2X7JA 1XEFA 3N0TA 3RIGA 3KELA 3TCKA 1XZCA 1RW4A 1Q44A 3NB0A 3CYFA 2ZTVA 4KWHA 1W36D 1RAIA 2IYWA 2BZ1A 2D06A 3DTVD 3R3HA 2OHJA 4JLDA 4OHFA 5DSTA 4R40A 3CZ9A 1ZLYA 1ZCFA 4ALNA 1PI3A 1AQYA 1BRTA 4FCTA 2ZAIA 1NP7A 3X1JA 2QW0X 5SV2A 3T15A 4HAYA 4Q3DA 3JTEA 2DULA 4ITRC 4DBLC 1D2EA 4TLDA 4UPVA 3VDXA 1E64A 5BNTA 5U4QA 4KJZA 2QDKA 3LLUA 1LEHA 1Z4IA 2WJ3A 3W9SA 5T6BA 1WY5A 2QN1A 3SEZA 1DBIA 3GJ0A 4IHJA 2B4QA 4HRVA 3ZGXA 4MYHA 2JFBA 1MMFB 4HRAA 5AVKA 4EO7A 4X62B 4PYRA 2DM6A 3H9QA 4OK5A 1TYCA 3E81A 4XLTA 4A7PA 3STYA 1H1TA 1OZ0A 4M83A 1N0IA 3EAGA 1ZUD1 3CZ5A 3NZEA 3Q7EA 2PUHA 5HKBA 2YJ4A 3TBFA 3RYCA 1E8DA 2Z4RA 2CLCX 2XCIA 2F3PA 3NJRA 4CMBA 2IF2A 1ZHOA 1T9BA 4ND5A 2OHGA 1GFSA 1XCPA 1UR5A 1QU2A 4Q4CA 2HW8A 5EESA 1FTWA 1MVOA 2OL4A 5FOWA 4F4HA 1YS6A 9LDTA 3HR8A 3ABZA 2WKQA 3O4RA 2C3PA 1QWOA 4CM8A 2JFVA 2G1UA 4LZJA 1XR3A 4C07A 1CQJA 3FNHA 1WU7A 1OV6A 3C3CA 1YB1A 3QUSA 4W9MC 1QRUA 4C4SA 2IIVA 1OFUX 1W93A 5FTJA 1Y6JA 4BE9A 3ZCSA 4W5WA 1DO0A 1XHLA 5JNVA 3LE8A 4BQPA 2XQKA 2QE7D 4LZPA 3GA0A 1VPVA 4F5EA 4DIEA 1LGYA 4TZTA 5TQ2B 1B14A 2I6UA 3AEXA 4UM5A 2FDCA 3EX7C 3L9XA 5DLEA 1ND5A 5IU6A 3LG2A 4F4FA 1KAQA 1L7RA 1MJGM 2W83A 3ZHZA 3GA5A 3U3RA 1T6NA 1K97A 1MAVA 4RD2A 2WWTA 4JX9A 2QUIA 4M22A 3NG1A 1NWHA 4II7A 1D6NA 1J49A 2AW3A 2BUAA 2GKOA 2PGIA 2FCRA 4L76A 4Q3KA 2VQFB 2ZE7A 1OI3A 3B6MA 3DP7A 4TLLB 3M1IA 3VYRB 3PITA 1PGPA 3IDAA 1JZTA 4JI3B 3GEIA 3GUUA 2V7XA 4J9VA 2OMKA 5BT9A 3ZW7A 1AQUA 2O48X 4HGRA 1DIHA 2VK8A 1T8PA 4LOLA 4IOJA 4M37A 2AJCA 4TV9A 4PLVA 2GHIA 3QUTA 2X3FA 1FRZA 2CE2X 2PYIA 2H8GA 3BEOA 1N7HA 1AJEA 7MDHA 3L6OO 4J29A 3EIFA 2XUAA 3KUKA 4F1KA 4XWOA 4M0UA 2NU8B 1HDOA 2WINI 3FWNA 3P9XA 4OXKA 4RK5A 4UFOA 4ZZ1A 4CLOA 1XELA 4Z51A 1VPDA 3PKIA 3DO8A 1DUVG 4WLUA 3WYNA 3TNYA 5LP6A 3H16A 1IFXA 4I4TA 4IDDA 2X0RA 2D5AA 2HV8A 3NQ41 4EAQA 5IDXA 1GU1A 2I62A 4W63A 3ZXXA 4DMMA 1KERA 2GPWA 4QICA 4AS2A 3GLIA 1JLSA 4ZCTA 3HC7A 1GCOA 3HP4A 3ASZA 3D7MA 3MG9A 1ZUIA 1LQ2A 1VG9B 2VT2A 3E3NA 3WK6A 5JARA 1YHNA 2EQ5A 3CNBA 4HTFB 4K6OA 3NNNA 5EE5B 5A9RA 2X1HA 4GG1A 4OXYA 1KO5A 2DHQA 3RTAA 1SU8A 1IXSB 5F2OA 1HE1C 1GGEA 1T2VA 4TVBA 1NJ6A 4JQZA 1OLOA 1X42A 3CKMA 1GGFA 5AM4A 3U4AA 3MINA 1CJBA 4A2WA 3A7DA 1XZHA 5CG2A 1T10A 2WJWA 1F8YA 3RC9A 4WLEA 3S1AB 1DP4A 5FPYA 2ATXA 1FQOA 2QRZA 3M5PA 3W2HA 1N92A 2Q6VA 3JD3A 2EU8A 3LP8A 4R83A 3JARA 5F4ZA 3ZZUA 2WYIA 1EM8A 1P91A 2X5NA 2XEDA 1I1HA 3AERB 2R6FA 3P9NA 2EYUA 3L02A 2GERA 4FHDA 1U31A 4FN5A 3TPFA 3ZEAA 4C0JA 4V1CB 1I94B 4BFSA 4XW2A 4F38A 2D7DA 3O7MA 4QOSA 4BMZA 1CRWG 4U02A 4BKMA 3D3QA 5K8TA 1SB8A 1SIWA 2GK7A 1XDBA 3HB4X 4ZVMA 4DQXA 1ZONA 1AIPA 2MSKA 2BKUA 1HRKA 1P77A 1R9MA 3GEDA 1JA9A 4J3NA 1L4GA 4MARA 4UJ5A 5C7YA 1NQTA 1NBWB 4EPTA 2YZKA 3QBVA 4CM4B 4L16A 1AMNA 4D8VA 2H07A 4ED9A 3N7UA 4RY0A 2WMDA 4M60A 2R44A 2Q62A 4G63A 3D8BA 4RMGA 3AEUB 2YOGA 4WESA 1FQJA 1N5DA 3FPKA 2OE2A 3ECSA 4Q1AA 4QXRA 1ZXBA 3HS3A 4IGEA 4Y8VA 2X0FA 2PUJA 3CF4A 3EXHC 5FOUA 3RSSA 2FFRA 4UUNA 4GT1A 1Z35A 3W77A 2EATA 2H52A 4ID3A 1D4ZA 3A6HA 4RXMA 3MIZA 4CUKA 1F0KA 5HJ5A 2ZRCA 3NR2A 1S0UA 2ZUCA 2YY7A 3NAMA 4LY3A 4B2IA 1TF7A 3GVIA 4GSKA 1XQVA 3UATA 3FI0A 1FMCA 2EVWX 2PWAA 1P4HA 1PVOA 1EHCA 2A1UB 5BYBA 1YS2X 2VNJA 4BVKA 2LV8A 4NONA 1HLDA 5T6MA 4DLWA 4ZRMA 1QVRA 4DR4B 1ODCA 4JUDX 5K0ZA 2V1XA 5ELLA 1M8KA 1QSGA 2BRUA 4FM9A 3LBAA 4NG5A 3ZWCA 1NE2A 2PUWA 3I53A 4YV7A 1KZ6A 5C5CA 4NNOA 3RU7A 1YA6A 1BD3A 4PYLA 3WDMA 3DMDA 2X5OA 4ZJYA 3T9FA 4OOFA 2AYXA 4DCNA 4U7HA 2OXEA 5KSZA 3BFXA 3UFBA 1R4NA 4QEDA 3OP1A 2Z5VA 4QEKA 2YS7A 1JIVA 5CNKA 3M9XA 3GEEA 5FAXA 3EVZA 3H2SA 4OHXA 3K4QA 1BMFD 3I1JA 3WO0A 1J00A 2BW0A 3MWGA 3OUUA 3E23A 3X1ZA 3GGGA 5KMGA 5ES4B 2EGUA 3O31A 2B8EA 3AR6A 4HD8A 1Y6GA 3HCFA 4XYBA 1PR0A 4OLJA 4Y9SA 2G83A 4BN0A 3OQIB 3VR1A 1MQAA 2YXEA 3DPSA 4CLRA 3IGFA 5JDIC 3IJPA 3KB6A 5LWQA 1NC1A 2F90A 1QKJA 4IGAA 1PR9A 2DKNA 5DW3A 4C3VA 3GGSA 3I9NA 3SSMA 3N76A 3KOMA 3LYAA 4RLSA 1L7DA 4F7DA 5U1PA 1FPQA 1E7RA 1WUKS 2CDBA 3C7KA 5HCUA 1H5QA 5F9MA 1JR6A 1M0TA 1XV5A 2QTBA 4Q48A 4N01A 3ZVLA 4GR4A 1Y5NA 5BT8A 2I29A 5BRJA 1DWUA 2BI8A 4RH1A 1BU5A 1OW3B 1G3MA 1I8TA 4F84A 2BFAA 1AV7A 1C2TA 2HCBA 3OCWA 4XJTA 4AU1A 2MSLA 5BUCA 3O8LA 4KQXA 4EY3A 1SEPA 3ROXA 1R37A 4BGDA 1ULHA 2CBXA 1P2GA 2J41A 2ZS9A 3GJ8A 4XIIA 4E2XA 5KNBA 2C99A 2Z2KA 2YOFA 4AL4A 2FLVA 2L42A 3ZE9A 3IEVA 2XIQA 3NOOA 1KOGA 4E5MA 2ZYVX 2QRUA 1ZXLA 5DOZA 1XD9A 2VRBA 3PTAA 2WTUA 4H08A 2ZZNA 5FL3A 3N2KB 2IODA 4HATA 4UBNA 4DY4A 4GBJA 3ETJA 1T91A 5KDOA 4BJ5A 3DWGA 2GILA 2X5XA 3OVMA 4P7BA 2FPOA 5IKPA 4MS3A 1MT3A 2QR2A 1NXPA 3NETA 1EWQA 1WNFA 2C9ZA 1Q2XA 4EKNB 4Q3LA 1CULC 1FLDA 3HADA 3V55A 1JKMA 1KVUA 1R0ZA 4DLNA 2FR1A 2HLDA 3OKFA 2PKQO 3QXSA 4M0MA 3M34A 1TECE 3O9MA 4PG6A 5KHLB 1H3NA 3EF1A 3GP5A 1NUHA 4Q00A 4GWGA 1N33B 1E7QA 3ADOA 4OATA 3PQ3A 1B15A 2VHVA 3EUAA 2X58A 1SPBS 2R62A 5IT9A 4BO5A 3JQ6A 4V2IA 1W2GA 2V9ZA 4RK1A 3HVHA 4D9HA 5JDCA 3H5RA 4AY2A 4P33A 4KRGA 3HA5A 1L7XA 3GYGA 3L0YA 1P1RA 1ZOSA 1ZD4A 5EWJA 3G1WA 3NWBA 3P9PA 2Y71A 3HEBA 3LZCA 3DE1X 2HI0A 2XECA 4WACA 5CJPA 2AI3A 2P30A 3KAJA 2FUEA 3QTLA 3ZU5A 3L77A 1D6JA 4NBSA 1CLEA 2EC5A 4OAOA 2NGRA 2PV0A 2ZSHA 4R16A 2IXBA 4XLZA 4ZVPA 5AXDA 5G2OA 1NSFA 1AKRA 4QOIA 3UH1A 1WCV1 1E9VA 3U4QB 3PNYA 4IQ8A 4TN1A 4BN4A 4Q9AA 4JC5A 1Q91A 5IYZF 4AJ9A 2C8VA 2XTJA 4BKOA 4EGJA 3QU4A 1CFZA 2JD1A 4XFDA 2BJWA 4OQNA 3V1KA 2O06A 3NDIA 3EEIA 4KZKA 4D97A 1Y3CE 3CTMA 4Q3CA 1SVUA 1XJ0A 4I08A 3AQIA 4YECA 1KQGA 2O5CA 3IUMA 1VC2A 2OM2A 4K9SA 5AO9A 1YZNA 3OZXA 2X76A 2GEVA 2ZVDA 4IDPA 1KI2A 3NBAA 1SIBE 5FTNA 1LBIA 3IR7A 2HFKA 2QVLA 1AKWA 4JP2A 5IDYA 2VH1A 4D98A 5CA0F 3PUZA 1IY1A 1I6WA 5JD3A 2OXTA 4AJ1A 4JJGA 3KZNA 5COAA 3T9DA 4LK3A 3CWQA 4DQLA 2V7UA 1Y1KE 2OBYA 2JGLA 3F78A 1CEXA 1JBQA 1VPTA 4MVJG 3VTKA 2QPTA 1MAWA 1XKQA 4CLXA 3HCEA 2WFLB 4P4NA 5JNWA 3W34A 3HI4A 6GPBA 1QCDA 3TBKA 4F7WA 1UQUA 5CVCA 4AJJA 2AYZA 5EE1A 3GLSA 1V2GA 4WZAB 5FB3A 3VPDA 1JSLA 3EQ6A 3GJZA 3E9MA 1PVDA 5JJCA 4ITVA 1ZG3A 2FUCA 1FA9A 1Z8DA 2RHJA 4U5XA 2YXBA 2Q6KA 4IFTA 4N7JA 1OGJA 4W5HA 3PFKA 2AX3A 1ENPA 3O8NA 1FYFA 4QREA 4G4IA 4LSMA 3P32A 2EWMA 2WU8A 4M46A 3S2IA 3SIXA 1M74A 1EIZA 3EIEA 3EFBA 2NG1A 2PT5A 1JI0A 2PKCA 2YZNA 4K6GA 2CNBA 4RF5A 1UC8A 3EWNA 3LBYA 4MGYR 4MGZR 5DLQC 5JZBA 1QHHA 3KQLA 1S2LA 3OC6A 4YACA 4IICA 1B3RA 1ESMA 2A5GA 2D74A 4WY2A 2I8AA 3R2JA 1HE8B 3E9CA 4HVTA 5FLEX 1NXOA 3U16A 2PBLA 1G63A 3VH2A 4GI5A 5FQOA 6Q21A 4LZWA 1ZK1A 2EP8A 3UAVA 5K0BA 3OZTA 3UKOA 1AHPA 3GJXC 4NWIA 5EJMA 3I9OA 3DM9B 3I9V1 4ARZB 2X6TA 4EQ6A 5IVDA 1OD6A 4NBWA 5BMVA 4R2WA 1OUMA 1SUBA 4YQYA 5J5CA 5BQ5A 3D6MA 3O21A 3S55A 4UVGA 1QP8A 2JGDB 4XJXA 3M6LA 4URZR 4RSGA 3KDAA 3UUWA 3H1EA 3UIEA 4CKEB 5HYVA 1RU3A 4WNYA 1JLMA 3WV4A 3NP9A 3AQ4A 3MK31 3O2SB 1B4DA 4B8ZA 2GYYA 1CLUA 2H1SA 5IUKC 3GPBA 1N6LA 3EFEA 2WSIA 4WEQA 5JAMA 2NT4A 3E15A 2ETXA 2RH4A 2AOVA 4EUHA 1SNYA 4M89A 3DE3X 5IVIA 3TL3A 2I67A 1UBOS 1U0EA 4I19A 1V6SA 2AA3A 2D0IA 2VJKA 1GCUA 4ZMSA 1ODKA 3MJHA 3QVLA 2M6LA 2C31A 2VJYA 3IALA 3A2NA 3R23A 3UT0A 1K4MA 1JEEA 3KWFA 3MJEA 3BREA 2VDKB 4E4RA 2E89A 4FYIA 4E5KA 5EP3A 2AN1A 3DZIA 3NORA 5BSWA 4H6WA 1R3DA 4JVLA 1RRMA 3IX7A 3OPYA 3ADDA 1XTBA 4YPOA 5FBQB 3CC8A 1WETA 3O26A 4BDSA 2YBEA 1V16B 1Q7EA 3SEQA 5JAPA 4H0FA 1OF1A 3OCZA 4YP9A 3FNIA 5FTMA 1WZ2A 1V6CA 2WHXA 3IUBA 1YZUA 3MOIA 3D6JA 1P17A 3UWOA 3IHKA 4QFDA 3I9KA 4OL0A 4EMBA 3KWMA 4HHEA 1DEKA 5BWCA 2AJDA 1A69A 3AB7A 2DH5A 2JBAA 3HYRA 2C5GA 1NULA 4IDEA 4B6QA 2QXYA 1WZEA 1ENZA 2XCOA 2GARA 1QHYA 2W98A 3LQ2A 1SD1A 4GUDA 1LS6A 2ZYDA 4LRYA 4W7SA 4ND8A 2J9ZB 5BPFA 2JAQA 1UADA 4Q9KA 4O4IA 1R1DA 1FJGB 3CZRA 3A1UA 2NSYA 2WUGA 5BQFA 5DGHA 4P36A 4MV8A 5GM1A 5A71A 5A7FA 1JKXA 1Y7TA 2E7ZA 3FLAA 2WIBA 1D4FA 3FSGD 1RXEA 2QL6A 2ZIGA 2BBWA 1DOHA 2WWWA 4F2GA 1M2JA 1RT9A 4ZHSA 2F1RA 2ST1A 2XVMA 3KKQA 1PQYA 4MVCA 1BE1A 4LHYA 1W0CA 2J5BA 2P5UA 3ANYB 3FFWA 5DHRA 3WYDA 3ZBPA 1ZWLA 1T9KA 3QVUA 1XGKA 2YMMA 1YZLA 4F97A 3VISA 1Y1TA 2INGX 3HVUA 3IQXA 4X94A 2NXJA 4BB0A 3WP1B 1L1RA 4EHLA 4NECA 2A78A 2P62A 5BUSA 3DHEA 3P9SA 5AKIA 3F9CA 1OX4A 4XGRA 1PNOA 2O3JA 4YP0A 1PD1A 2J4FA 2G9QA 3A6DA 3HCAA 2AD5A 1ODTC 1BIFA 3N2GB 1QVWA 2A4KA 1ZN7A 4FOSA 5AKZA 2G70A 1OAOA 3IEKA 1T5OA 2DPMA 3R77A 2BM0A 2EBFX 1VA4A 1ZOIA 3QITA 4OQMA 3SS9X 3E35A 3UBMA 3T9BA 1TMGE 3DOJA 4Q7EA 4C7XA 1KMHA 4X6LA 3MELA 3PV0A 4Z99A 3VVBA