2V55B

Mechanism of multi-site phosphorylation from a rock-i:rhoe complex structure
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
181
structure length
181
Chain Sequence
b'QNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO-ASSOCIATED PROTEIN KINASE 1
molecule tags Transferase
source organism Homo sapiens
publication title Mechanism of Multi-Site Phosphorylation from a Rock-I:Rhoe Complex Structure.
pubmed doi rcsb
total genus 45
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2v55B00
2QPOA 2DHRA 4ZO4A 1N5KA 5HKKD 1ZNYA 5EUQB 2WKRA 3W6NA 2E1RA 2X19A 3MCAA 1CEEA 1HE8B 3EPJA 2WWHA 5EP3A 3TSZA 2PZEA 4B3XA 4Q4AB 4M1YA 5CDFE 2GETA 1XTJA 2FU5C 3WYFA 2PLRA 3T12A 2GJKA 3BGWA 4GBMA 1G8GA 2OAQ1 1IOZA 1VKJA 3J81k 3OZXA 4OQLA 1TUEA 1ZRHA 5F9FA 3I3SR 1KJZA 5JFGA 3VHLB 2LKCA 2HJVA 4IVQA 4RFVA 2L0XA 1AS2A 4ABYA 1A4RA 1XJQA 2DYKA 5EE3A 5B57C 2BCGY 4RD4A 1SKYB 2IS2A 2NO6A 5H70A 1US8B 4TLDA 2CMKA 2FSFA 4HAYA 1PLLA 2HF8A 2IT1A 1Q3TA 3ONWA 4GRAA 2FDCA 5AWFC 1CJMA 2HYDA 4EIWA 1NSFA 1VYUA 3V9PA 4E22A 2J45A 3EA0A 4LBZA 4Q4AA 2YKGA 5GJBA 3FKSD 3RRYA 5L3SA 2IYYA 5JJLA 2WKPA 4QHTA 1G18A 2CVHA 5C2JB 3SYKA 3LLUA 1DVRA 4OHVA 4ASUD 4JL6A 1HEIA 2ONJA 1W5SA 2XEXA 3H0KA 3FHOA 2GTPA 4AURA 3FMOB 2PLFA 4O3MA 3PCRB 4PHTA 4JLJA 1GL7A 4BASA 4A0GA 2ECKA 2OHFA 4WXPA 4HAWA 4I1UA 3HR7A 2OBMA 1F6BA 3H4MA 2OUKA 3K0SA 1KO1A 2BM1A 2IUSA 2YWGA 4PZLA 4P3YA 4RZXA 1R8SA 4HAZA 1GKYA 4DLYA 1ZC3A 2O8FA 2AKYA 4RFSA 1T3SA 2ZRAA 4UJ5A 2ZE7A 1ZBDA 2KE5A 4CGZA 2OFOA 5LD2C 3B1YA 2J1LA 1LF5A 3PEVA 1VG8A 1W1WA 3EG5A 5M04A 4XD7A 1QVRA 2QROA 5AUNB 4M53A 2ZYVX 2RGBA 2RKOA 2XNSA 4DLXA 2Q9CA 1AQYA 2Y8EA 1EFRD 1S0UA 5L3RA 5KDDA 2WIAA 4UXHA 4UNSA 2BKEA 3NH6A 2EFHB 2BWJA 2QM8A 3QKRA 3EW9A 4LYHA 2AR7A 1Z2CA 1UPTA 6Q21A 2VF7A 3I8XA 4C4PA 4GOJA 2QAJA 1JEDA 1T5LA 3ZVNA 1HH4A 1T8TA 3LLMA 1MR3F 1CJVC 1QZXA 4Q01A 2XSZD 5CM9C 3UWKA 4ERNA 3GLHB 3K70C 4LJYA 3NDPA 2OXCA 3DPUA 3LQRA 2IYRA 2ZYUX 2ZI5A 3QEOA 2JCSA 4OKSA 4DDUA 1XTRA 3B9QA 1YU9A 1NN3A 4QXAA 1M74A 5AK0A 1KIMA 3CONA 4JSTA 2J3EA 2O0JA 4AI6A 1NBME 1M8PA 4F38A 1YE8A 5JS8A 1JEEA 1YRBA 2QGNA 4QNRA 4OI1A 3EX7C 1KY2A 3K70D 1KDOA 1E2PA 1YZKA 2R9VA 2ZXUA 5TV2A 2D4HA 4O2LA 2ZAMA 1D9XA 5AJWA 3TJZA 5CB8A 621PA 4EAQA 3MFYA 4QOSA 1RYHA 4JLPA 2G3YA 1DG1G 2CVFA 3NTUA 2JLXA 2OZEA 3CF6R 3A1SA 3ADBA 4KBGA 2ORVA 3N2IA 1RRCA 3AVXA 4RZUA 2QEQA 1WRBA 2QL6A 4R2HA 3X1ZA 1XF9A 2A5DA 3RWMB 2VHJA 4ZKEA 3FDIA 1SXJD 3RS3A 3U7HB 1YZUA 2WJHA 4B76A 1E2IA 4P4TA 2WTUA 3AUYA 1J99A 1E1RA 1XX6A 1P9NA 1ELOA 3HU3A 4KODA 2GILA 1NVVQ 3CX8A 2IX3A 3CRW1 4WZ6A 3IUYA 2W0SA 4OHXA 3M1IA 1QVAA 1GNPA 2EWVA 4KI0A 4ZPXA 3IQXA 1SVMA 1K5GA 2IC5A 2IWRA 2W0MA 4QBHA 4KYIB 3Q7QA 2FSIA 4DC9A 1SVWA 4MKGA 2W58A 3A4LA 4TL9A 4LOAA 1GIAA 3Q85A 4PC7A 5DGXA 4FI3C 3FOZA 3R9XA 1OIVA 1FNNA 2HUPA 3RAPR 5TVKA 2W6IA 1JECA 1KTVA 1Z08A 2AHOA 2GXUA 2YWHA 3ICQB 5A5GA 3DKVA 3OFND 2YV5A 5JCZA 1IONA 2H5EA 1ZNWA 4WBSA 4C0QC 1P2UA 3QVVA 2VHTA 4AYXA 3GLGE 3QIAA 4OQNA 1TF7A 3VNVA 1G1MA 4GP7A 1H8ED 1W4BA 4KSCA 4KVGA 4UJ3A 2BM0A 1E2GA 1IJFA 4XWKA 1D6JA 2CLSA 4R9UC 2VLIA 2XXAA 4IDHA 3ZLJA 1G8PA 3WYAA 2EFDB 1IN5A 1KAOA 1T5IA 3NIBA 5EZ6B 2BVNA 1KI2A 3U5ZB 5E7IA 4PPFA 4MGKR 2ZVQX 1OPXA 4HDCA 2IYTA 4V0OA 1XEXA 1F60A 1JQJC 3CIOA 1OYYA 2WJYA 1R0YA 3TUZC 1M7GA 1KO8A 4K8OA 1J8YF 2MSCB 5H8WA 2BOVA 2ZRHA 2F7SA 1NLZA 3LV8A 2ODNA 4PQYA 1MOZA 3W8NA 1G6HA 1GL9B 5DO9A 2OCBA 3DL0A 3RS7A 3LW7A 5BN5A 2JLSA 4DB2A 3LWNA 1XD9A 1KO5A 4HDOB 2IXGA 3R9IA 4ARZA 1E3MA 1LNZA 4NYMR 1UKVY 1KI1A 5D3MB 4NU0A 4LJ9A 1AK2A 3I5XA 1CR4A 1IAQA 2IEYA 1N0VC 4TTPA 4MH0R 1OH7A 3WY9A 1YR7A 3VR2A 2P2LA 4UQOA 2G1JA 4NBSA 2JJ1D 1EFCA 1R4AA 5BW8A 1BIFA 2VTKA 3M4YA 3BFVA 1PUIA 4V0NA 3B1XA 3SFVA 4TSFA 1YHNA 5HTKA 3KJGA 4EPRA 3B78A 2AXNA 2WSSA 1KO4A 1NMZA 4MGZR 3SU8A 2GWHA 3TRFA 3B2EA 1BMFA 4LK2A 4ARZB 5KO2A 4GP6A 5IK2D 1E9FA 2P6RA 3I62A 2CLCX 2ZM5A 2I1VB 1TEXA 3RS2A 3T5DA 5FL3A 1U99A 4X8LA 1X1RA 4NCKA 1E0SA 1Q12A 3FHCB 2XB4A 3PXGA 1U0HC 2W6ID 2D3WA 4A82A 4EPTA 3BB4A 1SVKA 2C03A 1JPJA 1OH5A 3CPHA 1GZSA 4V0LA 1DAMA 1MO3A 2AFIE 4RKEA 2AFHE 4P4SA 4NONA 1OHHA 2RGDA 2W83A 3HU2A 1KSHA 3AVVA 4WVFA 3BAFA 2WOOA 2QGZA 3EXAA 5K8IA 4CEJA 2NO9A 3CNOA 4IW3B 3A4NA 4TQAA 2GESA 3F0TA 4M4SA 5CJPA 3SN6A 4YMUA 3TIFA 5J4LA 5FTNA 5FBWB 4QBIA 2XJ9A 3KQUA 1RZ3A 3C41J 1PUJA 5AJXA 2ODBA 3OHMA 4NYIQ 4AKHA 121PA 1E0KA 3RRNA 4C3ZA 1AGPA 5JECA 5FOTA 2BHRA 3PV0A 2R8RA 3U4QB 3FGNA 2WZQA 4AKIA 4NPHA 3GLHA 2QAGA 4D25A 1W46A 1XMJA 1W0KD 3FMFA 3QF4A 2VRWA 1YQTA 3EAQA 3T1TA 4CRWB 3NXSA 1ODFA 4KFRA 1VIAA 5DE3A 3GFPA 1PJRA 4B74A 4B3CA 4A8JB 1FOEB 4KJZA 3N70A 4URZR 2NPIA 3SFZA 4EJSC 1JR3D 2WWFA 2ANCA 3MUFA 2VPPA 3OIUA 4F4IA 1E4VA 2VIIA 3L0SA 4TQUS 2NQ2C 3G5UA 4MRPA 3CNNA 1KJYA 4YMTA 3KUCA 1ZM7A 4B6FA 4PC3A 1M7HA 5FL7D 2F3RA 4PAMA 2AKAB 4XTCS 3E5HA 3B85A 2OV2A 2QP3A 4DT1B 1NIJA 2G88A 2G0TA 4QNMA 4K81B 4LV6A 5G3ZA 3LFUA 5FBVB 4BZQA 821PA 4EKDA 5HPYB 1XPUA 4L8GA 4JJKA 1BH2A 3LX5A 2CE7A 4EUNA 1DPFA 1DS6A 3IIKA 1KO7A 1R0WA 1U81A 3K0FA 2HLDA 1Z47A 4LYAA 2QTVB 3AVYA 5J4HA 2QT1A 2ZR7A 2AWOA 3DVLA 1Z3IX 3E1SA 3K0EA 4IDQA 1OB5A 2ZSAA 3GJ4A 3CRVA 1DAKA 1RRGA 3U4QA 2UZIR 1TQ2A 4IOLA 2P6UA 3RS4A 3CZQA 3OEEA 5K8TA 2W6JA 1KKLA 4IDPA 1ZIOA 4H9GA 1RJ9A 4Q1AA 1U8ZA 3CWZA 4PANA 3OE7A 5JHHB 2CL6X 5BXQC 3TK1A 2GAAA 1UBFA 4JLDA 4C2TA 2R6CA 3I73A 5HZKA 3GCGA 5C4GB 4M1OA 1DOAA 1NVXQ 4YMWA 3UIEA 3AVUA 1B23P 3VU9A 2PX0A 4FMCF 5L3SB 4DKXA 2HXYA 1DEKA 4URXR 4XWOA 1KOFA 2OT3B 1U98A 4DDTA 1G7SA 2DFNA 2C95A 2GXQA 5FOSA 3LAWA 4Q48A 5FPYA 4H1VA 1RKBA 5AJVB 5JJKA 1X3SA 2GF0A 3NVAA 4IOMA 1D5CA 3CX6A 1P61B 1YJ5A 1NBMA 5SZJA 4AC9A 1P9WA 4XJXA 1V43A 2JASA 3EIEA 4QFMA 3OF5A 2FSGA 2DFLA 3P27A 3O8RA 3GLFB 2GK7A 2X2FA 4OI4A 3OIWA 4M1KA 2C8VA 2Z43A 4XSHA 2F1HA 3BK7A 2GF9A 4M9XA 1FUUA 2OXRA 1KDRA 1KSJA 2OBNA 2CL0X 3BD9A 3NBFA 4HI0E 5KTYA 2FGJA 5DI9A 2PT7A 4B34A 2V55B 3HDTA 3Q72A 1KI6A 1LS1A 2ZROA 3SNHA 2PMDA 4Q4JB 1IN4A 3SYLA 2YC2C 4B75A 3CX7A 2VP2A 5FI0B 1Y3AA 1FL9A 3ZYCA 4KFSA 2C04A 1EFRA 2HT6A 2WIBA 1W4RA 1RVDA 2BEKA 1WE2A 4LBYA 4A9AA 4MUAA 3SJAA 1WQ1R 4XD7D 3IHLA 4QBFA 1I2DA 1FUKA 5D3MA 1OE0A 2V6IA 1G4UR 1AZTA 3U44A 1TADA 1MABB 3LVQE 3T34A 1WB9A 1CXZA 3TVDA 4KLNA 1GFIA 4WXRA 2B8TA 2IWHA 4C9BA 2DWQA 4DCSA 2QQEA 4UNRA 1DADA 1S9DA 3SBEA 4EFLA 4JMPA 4NYJQ 1F48A 1F2TB 1AN0A 1XD2B 1EX7A 2RAPA 2EW1A 1ANKA 3VR3A 1X8LA 2RGGA 2NO7A 3QE0A 2ZU6A 2IS4A 4D80A 1Q21A 1W5TA 4FCWA 4EFNA 1S9HA 5J4VA 5EQTA 5A0FA 4ASUA 1KI9A 2JJ2A 4HLDA 4OK3A 2CLDX 2ERYA 4DLRA 2GCOB 2ZRJA 3OIYA 3U3RA 3KXIA 2IA5A 3THYB 2J0SA 4C0BA 3DHWC 4FWIB 1U9IA 4JYBA 3AF3A 2XZPA 2GJ9A 1KJWA 3K0AA 1XEWX 1AA9A 3H86A 4JBYA 5B2ZA 1U94A 4OBEA 3U3KA 3THXB 1QG4A 4LUCA 1CR0A 1U9IC 3KKOA 3CUEF 4D4JA 4TT3A 5FOVA 2VSXA 4Q4HA 3W3AA 4P4UA 4Q7JB 1A2BA 3KQLA 3LA6A 2QT0A 2PBRA 2J87A 2AD5A 4PQRA 4CEJB 1BYIA 3FMIA 2C99A 5EP1A 2CK3D 4QJ4A 4DDWA 4YQFA 3U6KA 3GLFE 2QRNA 4FMCB 4FMBB 3CR8A 4YDHB 4PQFA 4KXFB 4PC2A 1G20E 3GD7A 4G1UC 1XRJA 1KK1A 4Q9IA 1NP6A 3BH7A 4D4LA 2BMJA 3EZ9A 1N6LA 1FFHA 1W4AA 4U7DA 3MMPA 1AIPA 1HA3A 3T1VA 3QBTA 2WJIA 4BZPA 2Q9AA 3VR4A 4HLUC 5K8LA 3DDCA 1NI3A 2ZI3A 3BXZA 1Z2AA 4YLGA 5LB4A 2CXXA 1YRAA 2ZU0C 4X8MA 2EFEB 4B44A 2N42A 1R8QA 3AB3A 1OYWA 3N5CA 4LJ8A 2GVDC 1G5RA 2WKQA 2YWFA 3EARA 1J8MF 3B82A 4IOKA 4MA4A 2O8CA 4BFYA 2ZRDA 5FBLB 1VYTA 2O8BB 1Z0KA 3K9LA 2PZGA 4NCNA 2GJ8A 4N0DA 4DLWA 3VR1A 2EFCB 2GRJA 2NO0A 3HWSA 4Z8XA 3WP1B 3WMEA 3Q7PA 1WF3A 5GVRA 3BORA 5B64A 3ZH9B 1QRAA 2FMXA 2X77A 4PSVA 4LGMA 2CDNA 2D2EA 2IYXA 3IDQA 3QENA 5CB6A 2KSQA 4LJAA 4B3DA 4JSYA 1UBEA 5GJVC 1CU1A 5JI2E 3WNBA 5TMPA 3WBJA 1OXUA 2Z6VA 1UBGA 4OI0A 5C1BA 3Q8XB 4DSUA 1LB1B 2AK3A 3NC1C 2F55A 1ZD1A 4F93B 1OH8A 4D0LB 1D2MA 4BFTA 1N25A 1ZNXA 3U7GA 5C4MA 2NZ8A 2VO1A 2PCJA 3C5CA 2KI5A 4DVGA 1MO4A 2QUZA 2ZJ8A 1SHZA 2OM2A 5L8VA 2X8AA 1OFIA 4HEJA 2QTHA 3O47A 5E7MA 1TU3A 1RRFA 1AS0A 2H18A 1XTQA 4II7A 1XZQA 4IJMA 4A8JC 4X8HA 4URYR 4A92A 2AD1A 3FWYA 3QG5A 3SE0A 4HUTA 1Z6YA 4EPWA 2E9SA 4P32A 4OHYA 3A1UA 1CP2A 3RC8A 4AWXA 1AKYA 3K09C 2J41A 5HE9A 5BN4A 3KQNA 2Q6TA 4TMKA 1WDTA 2OILA 2O8BA 4RD2A 1OXXK 1T3HA 3F5FA 1EXMA 1UFQA 3LD9A 4O0MA 3U3MA 4RJLA 2VHUA 1FQJA 4DEYA 3MRSA 4M8NE 2ZIAA 1UAAA 3BS4A 3EZ7A 3QXXA 1DAHA 2YZ2A 2OBLA 3OIVA 3GJ5A 2NMVA 1DAGA 5AUPB 3L2OB 1M7BA 4A0HA 3W5JA 1E0JA 1Q1BA 1J2JA 4OYHA 1A2KC 1D2EA 4I1VA 2CEAA 5DYGA 2QRZA 3LXXA 5KYKA 3IBGA 5G53C 2WSSD 2F1JA 5FBRB 1COWD 3HPRA 2BC9A 4HB4A 3WBKA 1G4AE 1GP2A 2G83A 2R6DA 2OCPA 3H1TA 3VMFA 1FNMA 4B71A 2YOGA 1KI7A 4LPSA 3LBNA 5DISB 3SJBA 2D62A 4NCJA 2GAOA 3VHXA 1Q1EA 5DI3B 3RLFA 1NBMD 2H8KA 3R7WB 3SR0A 1BOFA 1OIXA 2GJAA 1E2NA 1SZPA 1NN0A 4EDHA 1U8AA 4BZXA 2O8FB 3MJRA 4HB0A 3QBVA 1NF3A 1JR3A 3TUJC 3NHAA 1KI6B 1W47A 1W49A 3R9WA 2FFQA 4Q4JA 1TQDA 2FFBA 3WNCA 3A1WA 4CZ2A 2FE4A 3UG7A 3R8FA 2ASEA 4C0HA 1Q1QA 1Z63A 1SKQA 3SZRA 4G5SA 4XOIA 3CPEA 3KQHA 3KB2A 1XJ0A 3QKTA 4JLVA 2GEDA 1C4OA 5LDDC 1F2TA 1M34E 1MO5A 4KU4A 4GOKA 8OHMA 1Q20A 5FUVA 1G41A 1JAIA 4LDJA 4PXAA 2DPXA 2BMDA 4BLTA 3SQXA 2IUTA 2QAGB 3OESA 2Q3MA 2PX3A 5L3QB 4A4DA 5FUWA 2WICA 1G7TA 2H7VA 2W2VA 5G40A 3UKDA 2JJ8A 2ZRPA 4LV8B 2LCFA 2P6NA 4TYQA 1MV5A 1HQYE 1II9A 1P4SA 2DB3A 2R6AA 2NIPA 4LHYA 4ESVA 3GLIA 1G9XA 1QHGA 2QP9X 4OHWA 3ZZUA 3ZD7A 4NE2A 1G8FA 2QNRA 4JLOA 1II0A 4BEBA 1Y63A 4IDNA 5EE9A 3AEZA 2P5SA 3EZ6A 4JLAA 1E79D 2ZYWX 4KVAA 1FW6A 1EK0A 1NL3A 3FYHA 5FUYA 1GNRA 3NBZC 2QM7A 2P67A 3SDZA 5ANRB 1SXJB 5CM8B 1JPNA 4B32A 1G7CA 4PPQA 4ZV4A 5DH9A 2ZI6A 3PEUA 2QN6A 4QGHA 1GG2A 3B13B 4TMWA 4JVMA 4R7ZA 3IIMA 3TUIC 3ZVRA 2GJSA 2C98A 4HUQA 3I4LA 4L9WA 2VP6A 4LX0A 3PEYA 4HB3A 1NVVR 3QEJA 4US2R 3TR0A 4PPGA 4AIIA 1VIYA 4DEXA 5SZHB 3PEWA 1ZU4A 2O0HA 2HLDD 3CZPA 4F91B 2OCYC 1P5ZB 4DSNA 1WMSA 3HR8A 3BB3A 5B58C 1E9SA 2JIZD 1JXMA 1JBKA 2JJ1A 2VHCA 3GEHA 3L0PA 2QMUA 3QKSB 2R44A 4NYIR 1K8RA 1KY3A 2I3BA 1CJUC 2ZSEA 5UKDA 5GADl 3P4XA 2IYLD 3SBDA 2C78A 1HY3A 2V1UA 4O2RA 4CEIB 3AM1A 4TYNA 4AKGA 2F1RA 1P73A 3LX8A 4UXIA 3HYRA 1SULA 4Y0AA 5CK4A 2ZRCA 1S4QA 3B9PA 1QDEA 3DMDA 2XGJA 1IJEA 4O25A 3NEYA 3AP2A 2XITA 4Q66C 4N0EA 4A1FA 4DSTA 1Z0IA 2A5FA 2FZ4A 5CIWA 4V0KA 3CF2A 5FR2A 2LWIA 1EGAA 5J4YA 2PEZA 4NMMA 1TL7C 1VTKA 4P33A 4XVQA 4P31A 2OFXA 3EWAA 2B7BA 3U3OA 1LVGA 1OH6A 2X2EA 3K0CA 4PC6A 3BE4A 3GLGB 1OFHA 1XU4A 2CCGA 4Q1BA 1VG1A 1KDPA 1I2MA 4B48A 2RGAA 1MT0A 2G77B 3NBYC 1J90A 3NHBA 1NKTA 1TAGA 4H1UA 4HLCA 1TF5A 1VMAA 3WHKA 4YXWA 1A7JA 4QL3A 2DFTA 5E4FA 3WXMA 1CF4A 2V7QD 1P3JA 3BRWD 2XTMA 2CCKA 2F9MA 4C0JA 1SVSA 1ZM9A 3PG5A 3Q3JB 4JJZA 1G8YA 4M1TA 3DKPA 5DHAA 4BE7B 1H8HD 1L7VC 1OV4A 3AF0A 2PL3A 5KPDA 4BRUA 4L5BA 4RY2A 3BOSA 1Q57A 2IK8A 1OSNA 5HCNA 2FEMA 4RZ3A 3S1AB 1N3BA 3BIFA 2WOJA 4DHEA 2HYIC 3WP0A 3U7FB 2WAYA 1X8JA 1I4DD 3KTAA 4LY6A 3BERA 3IKJA 2CHGA 4B73A 4TL8A 2REXB 4JL8A 1GKUB 4QGGA 4L15A 2ZVPX 4G5QA 4XIGS 4A0FA 4Q4HB 1BMFD 3OAAA 1PLKA 2GZDA 3U3JA 4CDGA 3W5IA 2A5GA 4PO1A 1E2EA 2ZI9A 3UG6A 1XBTA 2ZRFA 4EPYA 4ZDJA 2EYQA 4FN5A 2UZ3A 3THYA 2IHBA 2ZSDA 2GCPA 2OLJA 3C4JA 4C0AC 1DE0A 4W9MC 1MO6A 4GOXA 1OXVA 1TMKA 2V8OA 4Q03A 1N5JA 4PC1A 3DM9B 2VSFA 1KMHA 1G64A 3SEAA 1Q22A 4HZUB 3G0HA 3BH6A 2IXFA 3W6PA 1AKEA 2HDNB 1J7KA 4PAQA 1FP7A 1LY1A 1TQ4A 2XAUA 2FPLA 4F4JA 2IUUA 1ESMA 5SZKB 3EIHA 2F43A 3BC1A 4HAUA 4HYYA 3GFOA 4LHZA 1IN7A 4CT5A 2WJGA 2PJRA 4NCIA 1N6IA 5KNCA 4URUR 2N46A 3PQCA 4RCYA 2HCBA 3TSWA 4PHGA 2P65A 3MGCA 1UBCA 2Q3FA 4ZI3A 2ZANA 4DLSA 4ZDWA 3DOFA 2OCAA 5HCIA 2ZE6A 5C46F 1H65A 1IQPA 3UPUA 4IOJA 2HV8A 3ADDA 4LBWA 5JJIA 1E69A 1E9CA 4MKHA 1O87A 1RRPA 4M9ZA 3ZVMA 3IIJA 3OEHD 1EWQA 3FE2A 1E2MA 1GDDA 2ATVA 1R6BX 3EPHA 1EFUA 2QQ0A 1NLYA 1HE1C 3E2IA 4NYJR 5C18A 2WVJA 2VBCA 2R6GA 3A1TA 2W00A 5G41A 3ZIAA 4JKYA 1E94E 1II8B 1NNEA 3TBKA 1E99A 1W36C 3QF7A 4ZDIA 5IF9A 3VTKA 4IKEA 5J40A 1P6XA 5JLJA 1R2QA 4GT1A 1T3LA 3KB1A 4EPXA 2GEVA 3SYNA 2BBOA 3BBPA 3QVUA 1QHSA 4CEHA 2GKSA 3DEFA 2OLKA 3GJ3A 1BYUA 4KYUA 3GLIE 4I99A 1CR1A 3QXSA 4IXMA 1ZUNB 4KCGA 3GEIA 4JZKA 1XPRA 4OJQA 2D74A 3PVSA 4XSGA 5BWMA 4OL0A 5J5CA 2QG6A 4FINA 2ZETA 2O8EB 4F92B 1AGRA 3BH0A 1P62B 1T91A 2JDIA 2NG1A 4POAA 2ZE8A 4GZLA 4Q7KA 2GVZC 1CRPA 2FPKA 2QI9C 3X2SA 1CBUA 4BWYA 1R5NA 1SVOA 3GEEA 4Q9KA 4TTRA 4TZ6A 1N0WA 3TGPA 4LRWA 1XFAA 2DR3A 2XSZA 5IHPA 1OW3B 3TMKA 1MRSA 2XZLA 2F6RA 3U6BA 4N3NA 2B8WA 3K8YA 4FMDF 2Q21A 1X1SA 2LKDA 2QAGC 1R0XA 2FH5B 4JLNA 3PR1A 1G5PA 1CRQA 4M22A 4TLEA 5KUTA 1NY5A 1OKKD 5JHGB 4NH0A 1QHHB 3EC1A 4DIDA 4GZMA 4AG6A 2CHVA 1XPOA 4NL4H 1GITA 1VPLA 1KSGA 2R65A 1E1QA 1E9AA 2D2FA 1P2TA 2C2HA 2C9OA 3LW8A 2H57A 2C77A 1W0KA 1RPZA 3P1JA 2WWXA 1L2TA 4S35A 1FMJA 1W36D 4JLBA 3TSOA 4B33A 2ZJYA 1XEWY 2RGNA 3EZ2A 1FMLA 1GOTA 2V3CC 1Z5ZA 2FV8A 2PJZA 3O8CA 4W7SA 1PVOA 2RCNA 1KK3A 1SXJC 3OAAD 3VAAA 4NCHA 1QHHA 4Q5IA 4WZAE 1IXZA 2ZTSA 2ERXA 1UKZA 2QPTA 4UNQA 2ZEJA 5FL7A 1WCV1 5DHFA 3LBIA 2ZITA 3KKQA 2KBFA 3D8BA 3MWJA 5SZIA 4PZYA 3AP1A 4EPVA 3TW8B 5KHOC 4RD0A 1S1MA 4KLZA 4Q9LA 4WAUA 1P2SA 2WJJA 1Q0UA 4MKFA 1UDWA 1N6OA 3FKSA 2FF7A 3REFA 4C2UA 4AD8A 2BJWA 1OB2A 1Z6XA 3TH5A 3B1ZA 4ZCIA 2MMCA 3TLXA 3F8TA 4ACAA 4BFZA 2IYQA 1WA5A 3SOPA 5BYKA 5TXGA 2EVWX 3ECCA 3K9NA 1KNXA 1S8FA 1HV8A 1SXJE 2HEIA 3PUZA 3CBQA 1JXOA 2VSOA 2FEOA 4MYHA 3OEED 2DWPA 2VH5R 5FTMA 5IK2A 2IYZA 3ZQ6A 5KNBA 1TTTA 4A36A 4DRZA 3PUYA 4YONB 2I1QA 2A5YB 1S3GA 4DWJA 3RNLA 1JJ7A 1OXSC 4FMDB 5JSZB 4Z54A 4MUBA 4BFSA 2QBYA 1YZQA 1N6HA 2ZJ5A 4KHZA 1JR6A 2Z4SA 3T1OA 3CW2A 1XD2A 2JLRA 1T8UA 1XNJA 1YKSA 2O8DB 1E79A 2A2ZA 1F3OA 5H68A 3JZMA 2ZJAA 3ZS9A 3FB4A 1FTSA 3LDAA 2ONKA 3K0FB 3KJHA 4WZBE 4JVNA 1OXTA 1Z83A 2ZI4A 3RWOA 3G82C 3DOEA 4LJ5A 4US0R 1Z06A 2YNMA 3I32A 4L16A 4M1SA 3ICEA 3W9YA 4BLQA 1G16A 4FW9A 4DUGD 2JLWA 1DAIA 3A1VA 1IHUA 4CF7A 5LPNA 3RRZA 4AYWA 5AUOB 3SS8A 2JAQA 1NJFA 4LWZA 4TL7A 2HCJB 4IRUB 3AKDA 2BDTA 1WBDA 1XMSA 2ZRLA 4TYWA 4TMXA 2REOA 3L82B 1LTQA 1Z0FA 3K1JA 3C16C 4IEIA 1XZPA 2O8DA 4JKIA 3ADCA 2BBTA 5FR1A 1ZM3A 2J7PA 5EP4A 4EQ6B 2A5JA 3WHLA 1NG9A 3GMTA 2ZJZA 1ZU5A 4GI7A 1VECA 4KV9A 2ZUBA 3NG1A 1TPZA 3EPKA 4PTLA 4BLSA 1VCIA 4D2IA 3QJYA 4DJTA 5JSZA 1PV4A 2KBEA 4PO8A 5FPTA 4QHSA 3VFDA 1G291 4FCTA 3RSOA 3LQQA 5E7JA 4C0LA 4QC2A 4U02A 2BEJA 2Z4RA 5HR5A 1E2QA 3KXKA 1X6VA 5HE8A 2ZREA 4IFEA 1E2LA 3KJEA 2WPDD 1OT3A 1NKSA 1NN5A 2VL7A 4LYFA 4XH9B 3UANA 1Q1ZA 2QMHA 4FCVA 421PA 4GFDA 4PPNA 4EFMA 3EA5A 1CULC 2FJUA 4US1R 4V03A 4DDVA 2FPMA 1WP9A 3PUVA 5F9HA 1X86B 4TLAA 3UK6A 2XNDD 2ZRBA 4KSBA 2DBYA 3AH8A 3ZVLA 2JEOA 3B6EA 3D31A 1NLFA 2OE2A 4HB2A 4IDOA 5FTKA 1NY6A 1ZW6A 5KOYA 4Z1MA 721PA 4R71A 4DCUA 2RGNC 1G3IA 3NBXX 4HLQB 3CLVA 221PA 5JWOA 2A78A 3B8HA 4PZZA 2N1BA 3X1WA 1XCGB 2B6HA 4KAXA 3C8UA 3KJIA 4QHYA 2ZUCA 2WSMA 3BFKA 1E2FA 3AF2A 1ZJ6A 4PR0A 5KDLA 4I81A 4Q00A 3CRMA 3IEUA 1P72A 1HURA 2IYWA 2BCJQ 3Q9LA 5K8UA 1PLJA 5FFMA 3HJNA 3QKRB 4FIDA 3PUWA 2XOKD 2XTNA 1LF0A 1NVUQ 2FZLA 2ZRIA 2X1VA 4MYUA 5JEEA 2ZSFA 4JS0A 1F2UA 3U7EB 4DCNA 1UJ2A 2IYVA 5ELXA 3WMGA 2QSZA 1M2OB 2KWIA 3A6PC 2J5XA 1GRNA 2TMKA 3NH9A 1XEXB 3AF1A 1MH1A 2VYFA 1CJTC 3LXRA 4RFSB 1XXHB 5FBQB 4BLOA 3AV0B 5BYJA 2J7PD 4BFXA 4ZIRB 2MSEB 4LHXA 4DLTA 2V6JA 2V54A 3I1FA 3UMFA 4K46A 5D3QA 3TE6A 2IW3A 2YC4C 4MITA 1QHIA 2BIFA 4IVPA 4B3GA 4DBLC 5GJCA 2CHQA 1E96A 3IO3A 4I1SA 4Q1CA 3VKWA 5JRZA 2IXEA 3THWB 3K0AB 3PENA 3V00A 1MKYA 4HZUA 5FPKA 4DIEA 4NYMQ 1IBRA 3CH5A 2JATA 3WRXC 2QZ4A 1K6MA 3ZZTA 2ZS8A 1QHNA 1IY0A 1SGWA 1VG0B 3NEJA 4LHVA 4UXJA 2QP4A 1XCMA 2IBMA 3A36A 3TW4A 1Z07A 2ZQ5A 2WMOB 4C7OB 3W34A 3RYTC 3TNFA 4OK6A 3ZDQA 4GMXA 3AP3A 4YMSA 4QM7A 3DZ8A 3N2EA 4MQBA 3GJ7A 2RH5A 1KDTA 4E5UA 4OHZA 3EASA 2CNWD 5AJZA 1HYQA 1VDZA 3THOA 3U2QA 1RJ9B 2F1IA 3EIQA 5IDVA 4M9SA 3VKGA 3A58B 2F3TA 4C30A 4DLUA 2CK3A 2WWIA 3PUXA 3VX3A 1K5DA 3IPXA 1KI4A 1XD8A 4JL5A 4PHHA 2F9LA 3IPYA 1ONBA 3DO6A 3RANA 3WMFA 4MDFA 4F7WA 4NDZA 3TKLA 4HAVA 2J7KA 2AX4A 4KITB 4BLRA 1FX0A 4XVUA 1SKYE 2ZI7A 2ZUDA 3U61B 1XP8A 2AK2A 1G3QA 1DAEA 4A0RA 4QGFA 4Z51A 5J47A 2MMGA 3CR7A 2QBYB 1Z28A 1P9RA 2J0UB 3K9HA 1SXJA 3KTAB 1IN8A 1QF9A 2J9RA 2QMOA 1U90A 5TY0A 1NMXA 5DIFA 4Q9JA 4ZI2A 3CRRA 1RC8A 2J46A 1ZD8A 3GLFA 2D06A 4URWR 4LV5B 1S96A 3P26A 1Z6GA 3FFAA 3GJ8A 1RFLA 2G9NA 1OIWA 4D26A 1KI3A 4C7OA 2BBSA 4LC0A 3KFXA 2WAXA 3IQWA 3JZAA 4I4LA 3QXCA 1D8TA 2JLQA 4CW7A 2XOKA 2IF0A 1N6RA 3CPJB 2VA8A 4JYCA 2Z0MA 1TX4B 4WW0A 5CDFA 1JAHA 3AGPA 4NKRA 1KNQA 2WWWA 2JLZA 5DN6D 1W2HA 4BUJA 2RHMA 2O0KA 3L43A 2VQSA 1RW4A 1FP6A 2NGRA 2NZJA 4OJKA 1G3MA 3V4RA 3U44B 2C9YA 1COWA 1CJKC 5F2EA 2ZE5A 3B7GA 3BB1A 2AWNA 5EE1A 3IBYA 3LY5A 1R7RA 3PFIA 4RCZA 5LD2B 3LBHA 1GAJA 2WV9A 1VYVA 1E98A 2AN9A 2DY1A 3C7KA 3VR5A 2B21A 3MWLA 3AQ4A 4DUGA 2IS6A 1JB1A 4A15A 1BKDR 1F5NA 1TUIA 1Z29A 2B92A 4D0GA 3QPVA 3SQWA 3RABA 5CLQA 3K9GA 4MYCA 2OFWA 3QPUA 4TQ9A 2CCJA 1G5TA 3ETLA 2ORWA 4B3BA 2ZAOA 4BEJA 1Z0JA 4XWAA 2KJQA 1E9DA 2GXAA 1RIFA 2QENA 4KFTA 2AXPA 2EU8A 5AR1A 3NKVA 3UWOA 3ND9A 1G7RA 1I4LD 5GJWC 1II8A 2ZPTX 3D7MA 3HU1A 4RSGA 1Z8FA 2CE2X 4RVCA 2PMKA 1KKMA 1MRNA 4HSEA 3K0CC 3WRYC 3THXA 2IS1A 1KZGB 1N6KA 3MJHA 3H2YA 1EFTA 4G01B 3GFTA 4M21A 4Q47A 3SI7A 5B30A 3FPAA 1XTKA 1XB2A 1QG2A 1KMQA 2CBZA 1VCOA 3L0IB 4UNNA 3EWSA 4B2LA 1ZP6A 4A2WA 1UKEA 2YJTD 5FOUA 1IXRC 3DMNA 4JBWA 1G3UA 5CYOA 5LBIA 1DO2A 1LW7A 4FD2A 1JQLB 3CH4B 5EE0A 2W6JD 4B2PA 2FWRA 3LNCA 1GILA 2NTYC 4HAXA 1W2GA 1XTSA 4LPKA 3QNUA 4W5HA 2FNAA 3R7WA 1JI0A 3QPWA 1T9HA 5A4JA 2GZHA 4LC1A 1OKKA 3FMPB 3ZJYA 3RS5A 4BFUA 4AYTA 1T6NA 2DWOA 1F2UB 3C14C 4V02A 2SHKA 3MWKA 1ZUHA 1MABA 3B1WA 4JLMA 1UDXA 4DLZA 1RE0A 2ODWA 3M0EA 5KPJA 2EQBA 2CJWA 2IYSA 1ZUIA 3ADKA 4MYTA 5KSZA 5L3VA 1TU4A 2XZOA 4BECA 1G3RA 2J0VA 1E0AA 1B0UA 3D3QA 4TZ0A 1XXHA 1Z0DA 4AK9A 2W2XA 4PAOA 3Q5DA 3KFVA 1QBKC 3FKQA 3KDSE 2UKDA 2GEUA 1QHXA 3KL4A 4LBVA 1FQKA 3NC0C 3BFXA 3WNDA 3V4FA 5FPSA 1BS1A 3TQCA 2NO1A 2O5VA 2VP0A 3ND8A 5TARA 3W3ZB 4A2PA 4DB4A 1NMYA 4I1OA 3AVTA 1LS6A 5JS7A 3MLEA 5EXXA 3PIRA 2EFGA 5KNDA 3BJIC 2HJGA 1AS3A 2RB4A 4QJ5A 4AY2A 1HUQA 1YVDA 4UKDA 2XX3A 4BGDA 3RVBA 2ZRGA 2Q3HA 2ZS7A 4KO8A 1EX6A 3OE7D 4PHFA 4C0SA 3VKHA 3D6TB 1KSFX 4A6XA 2JLVA 1W48A 3AVWA 5CIQA 1OLOA 3C5HA 1M1YE 1XDBA 4G5OA 3RC3A 2ZJOA 3QKUA 3AKEA 3KXLA 4GNKA 3AKYA 3ZIAD 5KSYA 1W0JD 3CM0A 521PA 5IRCD 2B7CA 3O8DA 3L8YA 1ZC4A 2QE7A 1SVLA 1FX0B 3DM5A 5TB5A 2JJ2D 1YZGA 4Q21A 4LSGA 4ESHA 3ZQJA 1ZYUA 3ASZA 5AUQA 3UMSA 1YZTA 2FOLA 1FTNA 1VCNA 5EZ5A 2GHIA 4NTZA 4V0ME 4ZKDA 1NRJB 2E87A 3P20A 4R2IA 1S3SA 3C15C 2HT1A 1T0HB 1Z22A 3IILA 1NVWQ 1SQ5A 2ZR9A 3GJXC 1G19A 5BQ5A 2IL1A 4XTRA 1W36B 1YZNA 2QU8A 2C96A 4E09A 1ZM4A 2QA5A 1G6OA 2RMKA 1ZCAA 1JALA 2ODEA 3AVPA 3GLGA 2A9KA 1ZINA 4B2IA 5FPHA 5JMTA 5FI1B 1FPMA 4JIMA 1HQCA 2FGKA 1NIPA 2K5UA 1DTSA 2YVUA 4TTQA 4YXWD 1KHTA 2V4ZA 1ESNA 2ZRKA 1G8HA 3FTQA 1XEFA 1J70A 2GDJA 5JEDA 1OFTA 2OG2A 4WA7A 5H1YA 5JRJA 3EC2A 2O8EA 4CEIA 2AL7A 3IO5A 4HDQB 1VHTA 2GK6A 4TMTA 3LRPA 3X1DA 3KX2A 4GL2A 2FX3A 2ZS9A 5GVSA 2GBLA 1E4YA 3A37A 1IY2A 2ZR0A 3GPLA 5EJEA 2G6BA 1Z0AA 2ZRNA 3I8SA 1GUAA 1UADA 3CB4A 3T15A 2O8CB 3QXJA 5E95A 5HKKA 2YHSA 4G3XA 1WBBA 4J0QA 3A8TA 3BWDD 5JI3E 2BJVA 2PEYA 2QORA 4GSYA 2JDID 1L4UA 2WJVA 4B47A 1GTVA 4P4SB 1GRRA 4MRSA 3AKCA 1VCMA 1GRQA 2XTZA 1Z6AA 1YR6A 2J59A 4IXNA 4ON9A 4B43A 1E2JA 4ACBA 1IN6A 3U60B 3QUSA 4EQ6A 3GJ0A 3DZDA 3S1AA 4Q18A 5JZVA 1R5BA 1TF2A 4QKQA 1CTQA 5JCPA 3X1YA 3ZGXA 4URVR 3K53A 4G5RA 4DZZA 4F4CA 3ASYA 4GMDA 1OHHD 1G17A 3AGQA 2P0EA 4JT4A 4KFUA 4BFWA 5E3HA 4GDFA 1Q3HA 1T4GA 1DG3A 4OQMA 1KGDA 3GP8A 1EWRA 1NSTA 1P60A 2RHDA 4RZ2A 2I4IA 3A4MA 2V7QA 1JNYA 2PT5A 2P3SA 4PX9A 4X8OA 3PITA 4DLVA 3QQ5A 2KB0A 4XVRA 4MRNA 4S2EA 2H17A 5DSZA 4Q1DA 2ZSBA 1O3YA 3TQFA 2EYUA 4LZZA 4W5WA 4Q19A 3VR6A 3W6OA 4CVNA 1EESA 1GVNB 2BMEA 2QY9A 3TAHA 1E6CA 2QPAA 4G5GA 4TWZA 2YYZA 2O52A 2YOFA 2GCOA 3CO5A 2CJWB 1AZSC 2RGEA 3OEHA 1C9KA 1W44A 1R5OA 2VP9A 1RYFA 4ZCMA 1E9EA 1ZVQA 4AKEA 4AG5A 2NPFA 5DN6A 4QM6A 2ZJ2A 3JVUA 4MKIA 4EJSB 1BO6A 2J0QA 2H16A 2VP5A 4D6PA 2XXAB 2QMEA 2IHYA 1CIPA 3ZZ0A 3QF4B 4ITRC 1VG9B 3UXMA 2WPDA 2J0UA 3MSXA 5JBQA 1KYIA 4BRWA 3X1XA 1D2NA 2Q9BA 2FFHA 3AVQA 1TEVA 1NG1A 1Q44A 2OEPA 1E1RD 4HUQB 1NJGA 2GA8A 5IT5A 1X8KA 2V9PA 4NZYA 4NP6A 5FH9A 3GLHE 1Z6TA 2OO7A 2IEZA 1GWNA 5F3WB 1YR9A 1CS4C 1S2MA 4JT2A 4FWTA 1U0JA 1AQUA 2HF9A 3GJ6A 3REGA 3RRMA 3VNUA 3EPLA 4TSFD 2JLUA 1E2KA 4CEHB 4Z8YA 1GL6A 1HT1E 5CJ2A 1CLUA 1S1CA 4OQFA 4MGIR 3PJRA 1T0JB 3LH5A 4IFBA 5LB2A 3QKSA 1P75A 4HZIA 5CLLA 4JLKA 2RGXA 2ZYTX 4L9SA 1YZLA 5J4KA 4RD1A 1GSIA 1WXQA 3FHTA 1A1VA 3IEVA 3MD0A 3T35A 1H8EA 1EG7A 4OI2A 4D81A 2BBWA 5EP2A 1E9RA 4TLBA 4LJ7A 5JWHA 3QY0A 4D4KA 1E9BA 3R8CA 2FSHA 2C5LA 2IYUA 5FOXA 4M2LA 4GPTA 1IM2A 5EE5B 3OFNA 1LFDB 3W90A 3K70B 5F98A 4ILEA 2FFAA 2Q0HA 1YR8A 4LI0A 1AM4D 2PZFA 4TL6A 5BN3A 5L3QA 3MWYW 2YOHA 4Q1FA 4B6EA 4CT4B 3QXHA 2DFKB 3QOFA 4N1AA 4QGAA 4BFVA 3QSYA 2YINC 1ZMXA 1CKEA 2BMFA 3IGFA 1ZIPA 3T1QA 5DLQC 1H8HA 2JIZA 4U00A 3GLIB 4Q7MB 1DBSA 2OESA 4U5XA 4YMVA 2Z83A 4Q7LA 4B3FX 2WWYA 4NHOA 3SHFA 3HYTA 2CL7X 2P5TB 4WIAA 5KDOA 4Z1MD 4M0LA 1PZNA 3RS0A 3TAUA 5DNYB 4YDSA 4ZDKA 1XJCA 3ZD6A 3VQTA 4D0NA 1W7AA 3E70C 1KZ7B 4YC7A 3KKNA 1U8YA 3CNLA 4RKFA 3UATA 4M9QA 4Q1EA 1XMVA 5CYPA 3B5JA 2G0NA 2VHQA 4M1WA 3KKPA 3NWJA 2WBLC 2XJ4A 1SHKA 1ZNZA 4HATA 4Q4LA 3KQKA 3WYGA 1HTWA 2CNWA 4FXPA 2OAP1 4P0TA 5DYIA 2GZAA 4TN1A 1I4TD 1QHYA 2FG5A 2QSYA 4B35A 2VEDA 2PH1A 3RDPA 1OJLA 2A3RA 1AJEA 1XXHE 1DAFA 2ORIA 3B1VA 3CF0A 3QI2A 3SC3A 1TQ6A 2R62A 3LO5A 4MGYR 2ATXA 4CYMA 4WOPA 1SVIA 2R6FA 4DSOA 3I72A 1E2HA 3CKLA 2BV3A 4IEEA 1N6PA 1N2CE 1XCPA 2WM9B 3P32A 1LV7A 3SJCA 5KSOA 2IF2A 1FZQA 1DARA 3FFBA 5EXTA 2JLYA 4CIDA 5FOWA 1P2VA 4A8JA 1JR3E 1KAGA 1OF1A 4TMVA 1IXSB 2D7CA 2GNOA 4Y0VA 1GM5A 3I5YA 4PFSA 3TVTA 4JVSB 2C9CA 5P21A 3ZS8A 2QTFA 2A7QA 2A30A 2WWGA 4W5JA 4D82A 2F43B 3HPQA 1IY1A 1JJVA 2VP4A 4LHWA 3RHFA 1ZAKA 3MG9A 2WMNB 4OQXA 1N5LA 2H1LA 1EFHA 1XTIA 4DT1A 2MSDB 4LJ4A 2H92A 4MDEA 4DXAA 1R10A 5EXSA 2V1XA 4G0NA 4A6PA 2XB2A 3P4YA 3MAAC 3O8BA 1XWIA 4UNPA 4D4MA 1KMHB 4DCTA 2JGNA 1U0LA 1C1YA 1E1QD 4PO9A 1CR2A 4JVLA 4E07A 4TYYA 1L8QA 3AUXA 5FTLA 4QJ3A 2ZJBA 4E03A 2DCUA 2G1KA 5EXPA 2REBA 1N0UA 4QBGB 3TR5A 1L4YA 1UEIA 4MRVA 3VU9B 3T5GA 1VHLA 5CK5A 1D9ZA 5JWRA 5AJYA 4EJSA 3Q5EA 1N5IA 4LCBA 4TYPA 4V0MA 5G3YA 4LJ6A 3UMRA 1E32A 3GQBA 4M1MA 4QRHA 3VX4A 2GXSA 2YWEA 1GKIA 4L4UA 3L8ZA 1XMIA 4PSKA 3T61A 4BPBA 3AVOA 4TLCA 1U2RA 5HZHA 4DCVA 3F3YA 3THWA 2PCLA 3JVVA 3K09A 3RSLA 4QG7A 5EUMA 5DI3A 4A2QA 4RD6A 2UVQA 4OK5A 1KI8A 1A5TA 2R2AA 1ZD9A 2BKUA 2GCNA 2VF8A 1ETUA 2GBLC 3QG1A 4R98A 1ZM2A 2OSBA 3SJZA 4BLPA 4MRRA 1KK2A 2ANBA 3I61A 1TNDA 2EWWA 1GNQA 1DO0A 3EZFA 4HLUA 1M6NA 1DELA 3FVQA 4Q9HA 4BQSA 2ZRMA 4KBFA 4TT3D 1G21E 4TMZA 3SHWA 4JBXA 4ZIRA 4C0KA 4IHQA 2QE7D 3AF4A 1W4CA 1UF9A 2W2TA 5TDHA 3B60A 1W0JA 1A82A 1KK0A 2XNDA 2WHXA 3L0OA 4PSAA 1N6NA 2D7DA 1OFUX 2HXSA 3KZ1E 3KUDA 3HP1A 5FUXA 1NN1A 1UEJA 3T06B 3M6AA 1US8A 3LVRE 4IVRA 3KKMA 2FA9A 2RGCA 3W8RA 2JA1A 4ZCLA 1P7CA 5CITA 1HT2E 3I92A 5KU1A 4RD3A 3H84A 3IHWA 4LYJA 1UM8A 3R20A 1R0ZA 1ZCBA 1E2DA 2Z5FA 1V5WA 2NOAA 3NDBB 3CWQA 2FN4A 4Q02A 5KSPA 1UKYA 5FTJA 3CRQA
chains in the Genus database with same CATH superfamily
2QPOA 2OOKA 3G2OA 4K6GA 2RGYA 5HKKD 4YIHA 4EECA 4MQEB 1GNVA 4OGLA 2YZNA 2QVBA 4RFLA 4E4YA 2R8XA 1UBKS 2P9JA 2X19A 4IIVA 1CEEA 2HPAA 3IFSA 3PQFA 3V2UA 1RZUA 4OU5A 1RI5A 5B12A 5C5CA 1Z0SA 5LQKA 3L49A 5D51S 4HFMA 2PZEA 3U4DA 8LDHA 1RLMA 4MCAA 4Q4AB 1PJ2A 1OXMA 2HSGA 3C3JA 3BXGA 4B4VA 5CFNA 2JF0A 1PE0A 2V3VA 4ZQCB 1WMDA 2FETA 2GJKA 3G5LA 3T12A 4EHKA 4GBMA 4JCCA 1VKJA 3KYCB 3MERA 3OZXA 2HUNA 1ZESA 3D59A 5KWJA 2VDKB 2WYWA 3AY0A 3I3SR 2GLUA 4CM7A 3VHLB 3EFHA 2LKCA 2FW9A 2HJVA 3QA9A 4IVQA 3KSZO 3PX2A 1IL0A 2H52A 5FUMA 4OJYA 4PSCA 1FP4A 1XJQA 4ZU1X 5A05A 3RKRA 2NTNA 1SKYB 4YRFA 2IPNA 2JAWA 1G8KA 1E3EA 1CDEA 3OLYA 1O6FA 5G4KB 3RVLA 1ZN7A 3IQZA 1XRLA 2IIBA 4Y1GA 4Z0HO 3ONWA 1PHPA 4GRAA 1FRNA 1JW9B 2RE8A 4QT0A 2P0AA 5A3JA 3U09A 1CJMA 2GNAA 3NLLA 1LXCA 1QRDA 4DDKA 5K4AA 4ZI7A 2R5NA 5GJBA 2PAFA 2XB8A 5DGDA 3RRYA 3GCWA 4D8UA 4QT4A 3ROTA 3Q11A 3WIBA 2PSEA 3FBWA 1HEIA 1JV2B 2J3QA 5KHAA 3YASA 4G0YA 2I2DA 4MIKA 3STUA 3WGZA 4NEHB 3FHOA 4MW7A 1WJGA 1UOEA 2X58A 4JN6B 3AV3A 1NWHA 2WEKA 4MR7B 4PHTA 1YVEI 4Y6LA 1K06A 3SIRA 3EA4A 4AXBA 1DQRA 5HX7A 3ZLTA 2BT4A 2KS6A 4YASA 1OCEA 2OHFA 4I1UA 3K0SA 3HR7A 2OBMA 7MHTA 2OUKA 3DA8A 1X3LA 4PZLA 3AG6A 1XPOA 2REQB 3KO8A 1R8SA 3N7UA 4PLHA 4U0JA 4URHA 1RWXA 3RWBA 4AVYA 1G38A 1KA9H 2AKYA 4RFSA 4AO8A 1XHFA 4BN5A 4AJKA 4ZVSA 5IT9A 4YJHB 5EINA 2KE5A 2V74B 1Y3BE 3R0JA 1NF8A 4OHBA 3WKEA 5FWYA 1U2QA 2IBSA 4LVUA 1F0KA 1UL1X 1SCAA 1XNGA 4W4TA 2J1LA 4OAPA 6REQB 4P3KA 1LF5A 5IP5A 3PEVA 1WZUA 3SHOA 1HPLA 5M04A 4XD7A 4CL2A 5FBKA 2XNSA 4DLXA 5KREA 1MDBA 4NCAA 5IFKA 5DBEX 2V7PA 1S0UA 3E9YA 3NGLA 1Z2DA 1VGRA 4K9NA 4QSMA 1W87A 4UREA 3FHLA 5DLDA 1V37A 4UNSA 4F3YA 2XXJA 1Z5NA 3STWA 5MFZA 1NM5A 3EC7A 3P96A 1PJ3A 2JI7A 2XVXA 4BQNA 2GBIA 3T0GA 4C4PA 2O7QA 2OBYA 3FVTA 1M0SA 1ZY2A 4B2YA 1JEDA 3RYIB 1HH4A 1HLGA 2CNOA 4EELA 1MR3F 1CJVC 4ZC1A 3ESQA 1ORDA 4NNJA 3ZXUB 1MNAA 2PPLA 3IP9A 4EENA 4LJYA 1SRRA 3VVCA 4EGQA 1R4MA 1JWAB 1T6XA 3N39C 3P9CA 2GYVA 2IYRA 2ZI5A 1YMVA 2JI8A 3ZIDA 3QKWA 4DDUA 5JASA 1Z45A 2ZM6B 3B9QA 3MC1A 4N47A 1LRLA 1SOVA 4U9IS 1M74A 2B5WA 2XUQA 5I9TA 1N2CA 1M2NA 2MTBA 2ZIWB 4Y2XA 3SZOA 2J3EA 3MEQA 4MUJA 1YBMA 3NR2A 4FEYA 4F38A 1CZHA 4R4JA 2JFWA 4PZEA 1SR8A 3WL7A 3HXQA 2W4QA 4NY1A 4GGOA 3EX7C 3K70D 2VJLA 1OBFO 2HSDA 2ZAMA 3IQDB 3QFSA 3W2GA 2GD6A 4YN3A 1LPAB 4F2PA 1K4KA 2J3HA 4QOSA 4EAQA 621PA 3EY9A 2VI5A 3AXTA 1QWOA 3VPGA 1PX2A 5CA0F 3AETA 1YS9A 2GHQA 4EYSA 2OZEA 2WUVA 2JLXA 3G0OA 3WBFA 3ADBA 1DWQA 5A6SB 2ORVA 3N2IA 1EWKA 1VIDA 5LWQA 3EZXA 2QZJA 1YA4A 3OPMA 5EHQA 3PGMA 3UGJA 1XG5A 1QNLA 1C30B 4AJPA 5AI0A 4ZVPA 2A5DA 5F2KA 1JKJB 1VKOA 2Q1XA 2GKOA 1V5FA 3PE6A 1M72A 3P9RA 3F1KA 5K0TA 1J97A 1QE0A 1E2IA 2JIMA 3B6ZA 3LU1A 1QZZA 4MS3B 3SXPA 2EJWA 1IATA 3AUYA 3TZQA 6ABPA 1E1RA 5IN5A 1ELOA 4JX8A 4DV6B 4ZMBA 2YHAA 1ID8A 2IX3A 1E3LA 1V16B 1CZKA 1NI4B 3BQNB 1I3KA 4F2HA 1ODLA 3CN7A 3CSDA 4V24A 1PQ4A 4FLFA 4GM4A 4RGYA 4C2BA 4F0JA 1GNPA 4I36A 4ZPXA 1VLMA 1V7QA 1W29A 5LZ4A 1X13A 1Y4UA 3N87A 4IFIA 4BGVA 3Q7QA 3R3ZA 3T3IA 4DC9A 3OVMA 3GA5A 2C88A 1I9GA 2W58A 3EZNA 1GIAA 4JZYA 4P1ZA 5DGXA 3ROMA 1YQXA 1Z4QA 1FNNA 1LUAA 2HUPA 1MJGA 1ST3A 4AZ3A 2O0MA 4HGRA 1BVYF 1TI7A 1UT8A 1YRHA 4QXQA 1KTVA 4RDIA 5LA6F 2C7GA 4F11A 4YNBA 5A5GA 3AEKA 2YV5A 2CJFA 3E5NA 4OY3A 3W9BA 4JBIA 2H5EA 2YJ4A 1ZNWA 3C3AA 2VHTA 2AEFA 2WT9A 3UA4A 2IYFA 1SBTA 3AETB 1TF7A 4H0CA 3UWPA 1G1MA 3L07A 3TCNA 1P2BA 4KLAA 1VA4A 2BGTA 2QD2A 4X0EA 2P9TA 1GNSA 2P7HA 3G8CA 4JB3A 4Y7CA 1WCIA 1ARZA 2BM0A 3CLKA 1E2GA 3G17A 4GYYA 4LGCA 2CLSA 4R9UC 4BRZA 2HU5A 3M34A 1JG6A 3M2PA 1U3CA 3N75A 5GOTA 2XWQA 4DM4A 3ZLJA 1G8PA 4MEAA 4D3DA 2WB2A 1E59A 2IY9A 4N3CA 1QPGA 3NTXA 3OPVA 2R7NA 4G0MA 5FTJA 4PPFA 3RK0A 3AI2A 1NVGA 3HWRA 1OPXA 1QOPB 4YUVA 4YRGA 1UZMA 2EEZA 2IYTA 3OWOA 4JROA 3MJ4A 3UCFA 2DX7A 3BD6A 3LF1A 1WUKS 4K8OA 3ENQA 2R87A 3HUFA 2MSCB 2AV6A 4NMLA 2BOVA 4PLFA 2ZRHA 5CBPA 1NLZA 5K6AC 1KWGA 1MOZA 1GTMA 3K1AA 4EK9A 1F6WA 1P0QA 3W8NA 1GL9B 5DO9A 2OCBA 3OQ1A 1DJMA 5BN5A 3T0FA 2WQ7A 1KVUA 1OZFA 1KO5A 1XD9A 4C20A 1KORA 1UKVY 2WF7A 5HIAA 2DLCX 1KI1A 2FOIA 1HZZA 4LJ9A 2H4YA 1AK2A 4NU0A 4WQMA 5D3MB 1NVDA 1W94A 4LRXA 2GAJA 2Q3BA 1WSBA 2H51A 2D5CA 2B8EA 3RREA 1B2LA 3VR2A 2G1JA 2JJ1D 3C7TA 1R4AA 1BIFA 2OSVA 2W37A 3BFVA 3M4YA 4I50B 2GZSA 5IJ9B 3RUHA 4PQEA 3NBUA 4X20A 2W2LA 4KKXB 5ILQA 4DN6A 2BELA 4M55A 2ZOSA 4MA0A 3KJGA 4RS4A 1R8YA 4K8RB 5HTKA 2DQSA 2AXNA 3GLIA 1KO4A 2CC2A 3TRFA 3UJ7A 2GWHA 4QE3A 4FGWA 3RGGA 1H69A 3ZTWA 5JV5A 1CQIB 2PUWA 4UHBA 1OASA 5EJ9A 1EU1A 4CF3A 4RC9A 1TEHA 4UVHA 2JIQA 3BSWA 3AY7A 3NVMB 1PJAA 1U99A 4Q3OA 1N33B 1WZIA 2HBZA 2XQIA 4NCKA 3EGEA 1TCCA 3JQAA 1U3FA 5E4TA 5BP7A 1Y8QA 2G08A 4X41A 3SQOA 5CHYA 4AULA 3GLQA 3OF3A 3ESZA 3MXOA 3IEKA 4EPTA 1JPVA 3A9SA 5A7HA 4CI0B 3BZUA 4UPDA 1E2BA 4P4SA 2O2XA 3GY0A 3WLSA 1BA2A 3D7SA 1JHPA 4YRBA 2C2BA 4UMVA 3HU2A 5EMHA 3OOWA 3H1GA 5GV8A 3RJZA 3SYMA 3S8EA 3BAFA 5KOIA 4LQDA 4RGBA 4KVZA 1U0NA 1B73A 2JVKA 5CIYA 1OYOA 1LA2A 1UWCA 4U2BA 5DN9A 5K8IA 1A69A 2W8BB 3U3ZA 4OGKA 3W2IA 5I4IA 3BGDA 5B1EA 4QIHA 4TQAA 2YRFA 3UT0A 1A9ZA 1J0CA 1WSWA 2GESA 4GR9A 4WZBA 2WFZA 2O3RA 4WY5A 1PS0A 3JR7A 3MT8A 1RI4A 4B6GA 4YMUA 5J4LA 3FCSB 4XR9A 4RK0A 1B3RA 1YL7A 2E4ZA 4H27A 1LVUA 5GGYA 1TLFA 2N47A 4UBMA 3KQUA 4NBTA 3QNWA 4BQOA 4KQHA 3TTXA 3ITEA 4AKHA 1TC1A 4OCZA 1T24A 4FYVA 4IIJF 4ZGBA 2ZWPA 2POQX 4N3BA 3HA3A 5JECA 1CERA 3PV0A 4BB9A 4HNGA 1DBVO 3I2YX 3GLHA 2JGJA 2QAGA 4JT9A 4D25A 2C1XA 2YS7A 2J3KA 3DTNA 2JCYA 3PHHA 3QF4A 4GPAA 2K7FA 5A2QA 4H60A 2O2JA 3SXUA 5JXWA 1QFYA 3GFPA 4JCOA 1XRNA 3MUEA 5CH8A 4B3CA 4ZPJA 4A8JB 7AT1A 1ADFA 4BX3A 1AGXA 3N70A 5EZYA 4MQ4A 3HZZA 3AHIA 3PC7A 4O2AB 2MU1A 2GMWA 2ANCA 3UWSA 3R3VA 3OIUA 1L7QA 2VIIA 4ZEVA 3U17A 5KC8A 3ZLUA 1YMUA 4XWWA 1KJYA 4WPGA 5TT1A 2DT8A 4U7PB 4ZI5A 1UMDA 1ZM7A 3UK1A 3ZQUA 4E21A 1FQWA 2OC4A 1M7HA 1H85A 1PT8A 3QLVA 4QEDA 4RETA 1JFVA 4HS9A 4OLJA 2EQ5A 4NR0A 3WKBA 3AJRA 3EGOA 2G88A 3VC7A 2B6NA 5ITWA 3AOGA 1W85A 4GC9A 3OD5A 3LFUA 5FBVB 5HBGA 1RYNA 3BA1A 2YFHA 3NRCA 3AESB 5HPYB 1KOJA 3WL6A 2EZ9A 1UBMS 3QYAA 5FORA 4NE7A 3UT5A 4NS4A 3FGZA 3EGIA 1ZITA 3ETEA 4IZHA 3WGKA 5FNVA 1DS6A 2ISQA 3HKEA 3IIKA 5AVYA 3FMGA 1U81A 2J9GA 4E4TA 3OLWA 1CSEE 4HSGA 2LBPA 2NXNA 2QT1A 4JC4A 4JIGA 4QWWA 1EKXA 2AWOA 4UM7A 3CQ9A 3E1SA 1CNEA 3ETDA 4AP9A 2ZSAA 5LZ2A 3CRVA 2WT4A 1I0LA 3ZGNA 3FCOA 2UZIR 1XNHA 3QVWA 1TQ2A 4IOLA 3TB4A 4AN1A 3D54D 3RS4A 2IFTA 1M1XB 2GYYA 2Y1FA 5EJMA 5I3CA 3B7WA 5CD1A 1HMPA 1I0ZA 3OPXA 1RJ9A 3K5IA 4GX1A 2PUVA 5BUCA 1HORA 3DG9A 5EHGA 5HGXA 1PL6A 4EKGA 1PS9A 1IY9A 3H6GA 1H2AS 3KXDA 3GG9A 2D0IA 1UBFA 2EZTA 2J9FA 2VAMA 4GC5A 3TSCA 4C2TA 3G1WA 4GEKA 5L6MB 2W2KA 1FTGA 2WJZB 3LX4A 2XKKA 1MPXA 1DOAA 1NVXQ 1JEQA 4M1OA 5IYZB 2PQMA 1B23P 3VU9A 1DC3A 2PX0A 4FMCF 5L3SB 1XNQB 2R6R1 2C3PA 1HE5A 4DKXA 1OC2A 4F5YA 1B8NA 2H0AA 2Q49A 1EP2B 1XL1A 1J2TA 1MX5A 1G7SA 3PQDA 2DFNA 5K2MA 1PZFA 4K1XA 5BQPA 5FPYA 1ZN8A 5AJVB 5T5QA 3VA7A 1J0AA 3I0MA 5TF0A 1D5CA 5AI5A 2ERCA 2VBFA 1K8YB 1ONOA 1R3DA 2CHEA 3LMKA 4OBWA 2PRKA 3TQSA 4AC9A 1ZOSA 4AROA 2OCDA 1JIJA 1PJQA 4KE9A 2QZZA 2DFLA 3P27A 1GV0A 5JSUA 3O8RA 4L5IA 2WTNA 3Q40A 1RQGA 3GLFB 1BHJA 2XMPA 3H11B 2A58A 4RXMA 5ALOA 5DM0A 4P93A 2CFTA 1XU9A 2C8VA 1FCJA 3WIUA 3BK7A 2K2WA 4MJLA 2P2GA 2AKEA 1GZVA 4X6LA 4FJ0A 2CL0X 3BD9A 2Q6OA 1A5BB 1M54A 1HL7A 5EFZA 3KTFA 2D0OB 1XRRA 2PU7A 4ZOLA 1GZ4A 4UPEA 3BHJA 2JAUA 1JSCA 3OA0A 4NMWA 3ZHSA 1L8XA 1XKTA 3VKVA 2H1WA 3IERA 4N6NA 5TQ0B 1E18A 2YC2C 3KTOA 4Y9SA 4RZSA 2FR1A 3BT7A 1M1YB 4JX9A 2VP2A 1W1IA 2WF5A 3CNEA 4IIFA 1Y9EA 2YIJA 1O4VA 1S2IA 3NFYA 3NYIA 3QYFA 3FHJA 4MYDA 4QTTB 4RV4A 4E70A 4HDKB 2YDXA 4CIVA 3P9KA 3KQQA 4IQ8A 4LBYA 3FRIA 4KPEC 1NUHA 3V2IA 4MUAA 1JPUA 4KUHA 1JDVA 1C29B 1I2DA 4HX2A 2VQ6A 2X42A 1V7ZA 3T34A 2X76A 1XRPA 5AM3A 5ICFA 4NFSA 4WNAA 4XI9A 1LTKA 1QO0D 2WNSA 1NYTA 2HCRA 3TVDA 1GFIA 4NECA 3UKJA 1I7SB 4RTKA 3HSYA 2YX1A 3T94A 4NZOA 2BI4A 4UNRA 3CJTA 4W1PA 2VHXA 3SBEA 1E64A 3L5KA 2YYSA 5AI9A 2YR0A 2NUPB 1F12A 1DLIA 3SYRA 1AN0A 2RAPA 1EX7A 4IEFB 3UFBA 4CLEA 3VR3A 2RGGA 3QE0A 2FK8A 4GVXA 1MC1A 2C3MA 2YWDA 4AO7A 4D80A 3HB9A 2IS4A 3KZVA 1JGTA 4FCWA 3AEQA 1H2EA 3H5VA 3W1WA 4EFNA 3AZOA 3ON5A 2FG7C 2O2HA 1ECLA 1UXGA 2Q6LA 3GC6A 3OA2A 1GTJ1 4CUKA 4H18A 3GZNB 1JRLA 4PPYA 2JJ2A 2WWTA 2X1MA 3MWDA 4KW7A 2ERYA 1ZI6A 5ALRA 2BF7A 3T7TA 4DLRA 3AI3A 3U3RA 5HWSA 4ABYA 4GBJA 2IA5A 1BD4A 3DHWC 1S01A 1U9IA 6GPBA 2COUA 2OFFA 3P5BA 2Y3IA 3OQOA 2GJ9A 3OECA 2B4QA 4IUCS 3HHPA 3PNVA 4JBYA 1U94A 2CLKB 4K3VA 1YS2X 3D0RA 4ENQA 4Z4IA 1CR0A 3K35A 3QHQA 4TT3A 3HJUA 3TO5A 1R8JA 2VSXA 3DXZA 1WUIS 4N0PA 2YIVX 1L4LA 1BGVA 1A2BA 3KQLA 1EUQA 3GI1A 3FI9A 1HWYA 4RE6A 1TJ4A 4CEJB 1DPGA 3CE9A 1G8JA 1QB7A 2CK3D 3FMIA 4YV1A 4WY8A 1BEUB 2VDWA 3AOEC 4LSWA 2QRNA 4FMBB 3W4IA 2FLVA 5ICEA 5IHXA 3GD7A 3TQQA 3V4SA 1XRJA 2WM3A 4Q9IA 4YO7A 2NVUA 1NP6A 3D5TA 3WBBA 2QTCA 1FFHA 4GE0A 1YR1A 3UHPA 3QBTA 1KYZA 3RARA 3VR4A 1FX1A 1T4CB 2R4UA 3BF8A 4NV1A 3BXZA 1YFLA 2KYRA 1QJ4A 2GB4A 1N32B 2CXXA 3IURA 1CVIA 1WXGA 4DBLE 3MIIA 5FUBA 3GBPA 2HDHA 5CA1B 4FILA 1RYZA 3OUZA 1AE1A 2GVDC 3PSAA 4XM1A 1G5RA 5JYCA 2YWFA 5GONA 2JBWA 2XKBA 3B82A 4IOKA 2O8CA 5FBLB 3UK7A 3H1BA 1VYTA 2XYHA 1BWQA 3QOWA 1O57A 3A6ZA 4QXOA 2R1VB 1N78A 1Q3KA 2PZGA 2O8BB 2GJ8A 3PC8C 4N0DA 3E22B 1J0DA 1UBTS 4RKQA 2GRJA 4Z8XA 1Y1PA 1U1EA 2FP3A 2VWPA 2R6ZA 3PCTA 1KYXA 1WF3A 1QAMA 2RHCA 3QE4A 4BDTA 3DC2A 1QRAA 3HCAA 1T0PA 2FMXA 2X77A 1I7QB 4K6CA 4ALKA 4NF2A 5ALHA 2KSQA 3WOVA 4U63A 2AJLI 1HDXA 4B3DA 2AG5A 4JSYA 3UMBA 4QFDA 1NT2A 2GPAA 3WNBA 2ZYSA 1IEVA 2Z6VA 3CURA 4KXVA 4EHBA 3BEDA 3PC8A 4DSUA 4UHKA 1OA0A 4CI9A 3EK2A 2PGXA 1FUEA 1NXQA 1ZH2A 3GPBA 1ZD1A 3V7FA 3ZWVA 1UBOS 2OHVA 1GPDG 2Q8PA 3QPAA 3C5CA 5C4MA 5EIXA 4CM8A 3U13A 2B61A 3QVLA 3SR4A 4DVGA 4ZYLA 1DX9A 1SHZA 2RJ3A 2OM2A 1WEKA 1NVEA 3JR3A 2FPRA 4OV6B 1TFUA 4MVXA 3T7IA 5L8VA 1H5NA 2VDOB 4OFBA 4QUBA 5GOZA 2QIPA 1GADO 5BSMA 1RRFA 2ZJ1A 4OB6A 4JJ8A 6PFKA 4LZPA 2W6ZA 1F8UA 2H18A 1XTQA 2HRBA 4II7A 1XZQA 3LPAA 4LVOA 4URYR 4G5FA 3FWYA 1EXVA 3QG5A 5KZMB 4QDUA 5LSAA 2EOAA 3FUXA 4KE8A 3WI7A 4L0QA 4P32A 3H04A 4OHYA 1EBFA 2QYOA 2FVXA 1VGVA 3K09C 5HE9A 4B82A 3KQNA 5T4EA 3RIHA 1V48A 1WDTA 5CFQA 1T3HA 1JEYB 1C1DB 4ENUA 3O5AA 5FHQA 1FQJA 2BUAA 4M8NE 4DNPA 5IAEA 4KAJA 3EMKA 1QZUA 1GCIA 3V6MA 1UAAA 1JG7A 3EZ7A 1CUJA 5AHOA 5ALTA 1DAHA 4PZUA 3KKKA 3JAKB 1O4WA 2XUOA 3O73A 3P5SA 3MA0A 4UNIA 3AEUB 5L53A 4JYZA 3EDCA 4W8GA 1Q1BA 2Q7DA 1J2JA 1DJOA 2CEAA 3G79A 3AFNA 1NQWA 2RHTA 3CN9A 3NYWA 2N0SA 2GH1A 2XIQA 5KKNB 2XCSB 1FSSA 1LW6E 5CLFA 3ILHA 3BE6A 1C2TA 1Y80A 1Z5PA 2A88A 2PWAA 5LP6A 1RWVA 4PINA 1YV9A 2CXTA 2EBFX 1GFWA 2J6HA 5BUZA 2K4MA 3IBTA 3WBKA 4Y9DA 2BISA 1CY6A 2EW2A 1VJ0A 4EI8A 2R6DA 4C4TA 4E31A 4F12A 3H1TA 5K0JA 3Q0IA 2B5OA 2L82A 2NQTA 2OBBA 1FFXB 4LPSA 3LBNA 3SS7X 1KIFA 4EF6A 3RSHA 1AY0A 2JGEA 3H8VA 2BFPA 2C58A 1Q1EA 3AERA 3EGDA 4FKZA 3Q6MA 4GRIA 4YALA 4ZCSA 3VH4A 3R24A 3WDKA 4AMBA 1OIXA 1E2NA 3ETGA 3U48A 4AJJA 1NN0A 2R0QC 4BZXA 5REQB 3MJRA 4FKBA 3FPSA 3SDBA 3LQKA 1W49A 2CXUA 4Q4JA 3GP5A 4YAGA 3WNCA 1PG0A 3UUWA 1T2AA 3H4VA 4RZIA 4CZ2A 4CIBA 3OZVA 2EZ8A 3L40A 2MYNA 1GLGA 5K0BA 1HO3A 5DNWA 4K9QA 4WNYA 3QVJA 4JLVA 2Q5QA 3E05A 3MTDA 1NT4A 2HQBA 2K6GA 3T3EA 4O59O 5LDDC 1C14A 1PFGA 2P4UA 4Y8VA 4Z9FA 4TGLA 1G41A 4DM7A 1BHSA 1QRUA 1UJ6A 2HMSA 2DPXA 4NFHA 4CN9A 1U5CA 3N07A 2BMDA 5K3FA 3L46A 1UEXC 3PRJA 4QARA 3GQBB 4BLTA 4EVIA 3SQXA 2QAGB 2YFQA 3A3YA 4A4DA 5C1BA 4GEGA 4B87A 5HZMA 3W5VA 5DXAA 5FUWA 1RXIA 1ORVA 4FD3A 4CPDA 1YACA 2X41A 4S2UA 2I9KA 4G36A 5DWQA 3WSVA 5JJCA 3OCUA 2ID4A 2P6NA 4K1LA 1MV5A 3DTVB 5D85A 2OVFA 4BAZA 1XTUA 4O8ZA 4LTDA 3REOA 1TPYA 2M98A 2NIPA 4LHYA 2P9GA 4HH1A 4R41A 1QHGA 3BZBA 3NOQA 1OTYA 2YJ3A 4IIXA 5FJIA 2JW5A 4IG4A 3ZD7A 2GK3A 1G8FA 3KAQA 4NE2A 5ADWA 2WSBA 2JKZA 3V7WA 1RM4A 2LV8A 4BBZA 1IAVA 2DQZA 2VZLA 2CKMA 5TE9A 1EBBA 3LC1O 2ODAA 3P9PA 3NQ41 4H1HA 4S1OA 3IOBA 2AOTA 8GPBA 3G0GA 3R0IA 1K2WA 1FW6A 1EK0A 3FYHA 4KLRA 4I66A 4XZ3A 1ZJJA 2QM7A 3B3JA 3CCBA 3IAEA 3NBZC 4F3TA 4B7CA 4MVJM 5CM8B 3ZDRA 2GS9A 5DBHX 4EYOA 3S1SA 2W9XA 1HNZB 3DB2A 1G7CA 4FHZA 2H7XA 4PPQA 1P2DA 5LA6A 4WA8A 5DH9A 5EGSA 2X7HA 4DA9A 3PEUA 3ZZNA 2PS3A 3HXTA 2HA5A 4TMWA 3FTCA 2GJSA 2C98A 3BXXA 4HUQA 4L9WA 4RK1A 1IM5A 3H5LA 1RQXA 1FSGA 3I01M 1NVVR 3QLUA 1E7WA 1JT9A 4HB3A 4PBSA 1QIFA 3IKTA 4UEJA 4RA9A 1VIYA 1ZGCA 2NP7A 2M1ZA 3QEMA 4TWRA 3MLBA 3RU9A 1BX3A 1C8KA 2EJUA 3PC3A 1H2XA 4F85A 2AMVA 4PGGA 4U2KA 5BRJA 4CT0A 1WMSA 3V2GA 1T9ZA 2Y99A 1W6RA 4E6PA 4F8EA 2YXNA 3LS2A 3TE7A 3A9WA 4F86A 3NBQA 4MVJE 3V8VA 4EMUA 4AQ7A 4NYIR 1D07A 1NW9B 2I1WA 1GG9A 1UQRA 2ACEA 4U9UA 3E48A 1BG6A 1YRLA 4FHFA 2I3BA 1KEUA 2ZSEA 3LKVA 1GZDA 3DV0A 5GADl 4MEBA 1RR6A 2FSVC 4OXRA 1ISPA 1Q1GA 4AT1A 4JI4B 1MBZA 1HY3A 3TTUA 1GNLA 3LT0A 3AM1A 3HNRA 2YDYA 4PYRA 1T10A 1OFVA 1T9BA 3UJBA 3VHXA 1Q0PA 4BNZA 5L7WA 3FTPA 4AKGA 1VLJA 3LX8A 4I2VA 4OKNA 3BIJA 5J59A 1KF0A 2ZRCA 5A3VA 1XTVA 5B53A 2EATA 2XGJA 4WRRA 1DO8A 2W8BA 3FNHA 1RDFA 1KQNA 2I7VA 2GBFA 3JYLA 2FEXA 4Q66C 4RORA 3STTA 3T3MB 3GPCA 4A1FA 3PLAE 1KTIA 4LWQA 1OBHA 4RF4A 1WCXA 2FZ4A 4MQFB 1RAEA 1RYBA 2HI0A 2HMYB 4GQBA 4V0KA 5CIWA 4ZCPA 2RBEA 1EGAA 1IEXA 1YCFA 2H11A 1H3EA 1EVZA 3EXG1 4NMMA 4CQLB 1A97A 1L5WA 1ZN9A 1OH6A 5DHUA 4PNZA 3OOHA 2E3JA 4Z4FA 4OOFA 5SYMA 2YRWA 1H93A 1YWGO 2H2GA 4KPYA 3DZIA 1KE1A 2Q1YA 1AHNA 3F3KA 1OAOA 4GICA 4P4GA 1JU9A 3RIMA 3SQLA 3F6YA 4HH0A 1TAGA 2R8YA 3HCNA 3F49S 4H1UA 4BP9A 1Z88A 4RL4A 3WHKA 2DOKA 3HI6A 4FCCA 1FXUA 4IDGA 1LPNA 5LP6B 2V7QD 2WU1A 3OTQA 3H19A 1Z7EA 2CCKA 1VRCA 1EGHA 1SVSA 1ZM9A 3RAGA 4BE7B 4RPIA 1AUVA 1UZUA 2HOQA 3AF0A 1WDMA 1FFWA 4NU8X 1LC3A 3JZIA 3DLPX 3U4GA 4LQCA 4BRUA 2QN2A 3LBAA 1Q57A 4MAMA 2DPLA 2IGTA 3WGJA 5A4AA 2IK8A 1OSNA 4YCAA 4P5EA 1O0SA 1XJ5A 2WU4A 1BD3A 2PWZA 3HXLA 1Y7TA 1ZJWA 4DHEA 2WOJA 4LFAB 3WP0A 4JNCA 1A50B 1AKVA 4M9RA 1POWA 4R1QA 3O2NA 3UQYS 3VBCA 1R50A 3BERA 3U9LA 3JX9A 3AKZA 3FM9A 2CXSA 1GNTA 4G5XA 4B73A 1ZD2P 2V6BA 4FYHA 2Y76A 4IUBS 3WIVA 2REXB 1YRQA 3BJEA 2PVSA 4GMKA 4L15A 4X63A 3DE3X 4M7PA 4U6NA 4G5QA 4XIGS 1R3UA 4R81A 4C0WA 4Q4HB 1Q17A 4JXJA 1PLKA 3PR2B 4MI9A 2GZDA 5BRAA 3U3JA 5F7OA 3A0UA 4DF3A 5LKRA 2BFNA 1RHKA 4B3HA 2PBFA 2ZI9A 4NBNA 1XBTA 3K8OE 4QPDA 2EYQA 3P9YA 3SLGA 5L45A 3THYA 4JGIA 1NJ6A 3GMSA 4MIYA 3C4JA 3BL8A 4W9MC 1MO6A 1K97A 4UUPA 1IZ8A 1JHMA 3W7VA 2QM0A 3CY6A 3M5CA 4DADA 2VDMB 3LOPA 1WOMA 4TRMA 4EOGA 3VDMA 3FPHA 3WFIA 1PS8A 2CNLA 2CUZA 4WT7A 3KSMA 5J1TB 4JP1A 3WZ2A 5KWVA 4HZUB 3DZHA 3EYAA 5HF8A 4AJ2A 2B37A 2MT9A 3W6PA 4MRMB 3EOAI 4YRDA 4PAQA 3LKBA 4F1JA 5B5SA 1FP7A 1ZJ4A 1FJHA 4FNGA 4RYLA 4YJ2B 4F4JA 2LR0A 1BE1A 4AM8A 3I5UA 1H9AA 4I5DA 4AUKA 1O5OA 4ZAZA 3W8DA 3BC1A 4HAUA 3GFOA 4FBGA 4LHZA 1OROA 3D6AA 5IM4F 4I55B 2YNMD 1ZVVA 1HC7A 1N6IA 3GPDG 3IH5A 2KPOA 4NCIA 4ZK2A 1L5HB 5HQTA 3WV5A 4RCYA 3PQCA 1AKTA 1AGNA 2H63A 3HC7A 1DV1A 3R7AA 2P65A 3HUDA 1UBCA 1WB5A 5CPFA 4DLSA 1WZCA 2WFAA 1YJ8A 3HK2A 4BB5A 5HCIA 1LDBA 4H7PA 2ZE6A 3NIDB 4FB5A 2Z30A 3OE1A 4MMYB 2BFCB 1JHXA 3DFMA 4IOJA 1VFNA 1OY1A 4LBWA 1OYVA 1MAWA 3WLNA 3ERCA 1E69A 2UYCA 5JJIA 1O87A 4I9UA 2V7BA 1EE2A 1UK9A 4M9ZA 4F45A 5BWNA 3D4PA 5A3SA 5H3CA 4JFAA 4MVJD 5E3JA 3SD7A 3ZVMA 1UBRS 4Q3LA 1E2MA 5HIIA 4NH4A 3AIIA 2H4XA 3EPHA 3NJ4A 5KVVA 3LIPA 4FS8A 5I7WA 2IELA 4NYJR 4DZRA 2HA7A 2I55A 2WVJA 1UH5A 1B93A 4PXYA 5G41A 1Q95A 1QX4A 3V3TA 1GQ2A 1AHHA 1TA4A 1CVLA 2QUIA 3VISA 4ZT3A 3VTAA 4A6EA 3ORFA 4L85A 3ICCA 1R2QA 5AKEA 1YHYA 1T3LA 2GEVA 4KH1A 1YOBA 5IZ4A 2BBOA 3BBPA 3ZDDA 3QVUA 4L5CA 1CY8A 1MN6A 2RAVA 3MJDA 3INRA 3I2IA 2GKSA 3DEFA 4UASA 3PVCA 1ZMOA 5GV7A 3GA7A 2IHVA 3AHEA 2CFOA 1X1AA 1BYUA 3ML1A 4I99A 1MW8X 4KCGA 1ZMBA 3GEIA 4DNOA 1GAWA 4JZKA 1XMPA 2UXBB 1MB9A 4IO1A 3WGOA 3M2TA 5KVAA 3CU5A 1XL0A 4LMRA 2QMYA 5J5CA 4DIBA 4FINA 4YO8A 3N53A 4K6HA 1O77A 5B6IA 1X7HA 1MOPA 1Z5VA 4R0VA 5M3BA 2XUKA 5DTQA 1XRMA 4GZLA 4FGLA 2VZEA 4JUBA 3K2EA 2QI9C 1CJCA 2YFYA 5KEIA 1NAIA 1CBUA 3ENVA 4Y9RA 2PO5A 3MWEB 5K3OA 1ULUA 2PGDA 4LRWA 1DKMA 1M1UA 1HEUA 1MRSA 2OD9A 4V3BA 4L6CA 3U6BA 4QAJA 3OY2A 1VBFA 2VOEA 1E7QA 1F8FA 1X1SA 4PY2A 2LKDA 4C4XA 1I6KA 3BREA 4GWKA 1ENYA 3G02A 3NUGA 4O1IA 5TVGA 1NUUA 3EC1A 2AXEA 1JWBB 3UUFA 4GZMA 4AG6A 1Z33A 3AFMA 3OPQA 4OUDA 3ZJUA 5TEWA 1QVVA 1T3TA 3ROGA 2R65A 4D6XA 1YBAA 4NOMA 1PL0A 3QBEA 1CIJA 2GM5A 3EH2A 3GRKA 4OEHA 1YQEA 2MSLA 3ELDA 1GSHA 4RNCA 3DJFA 1WXDA 2HIGA 2C77A 4X9XA 2QVLA 3V80A 1RPZA 2WM2A 4X62B 3P1JA 4BNFA 5CD9A 3K6SA 1L2TA 1YRYE 1GTSA 2XBMA 2VJNA 3NGXA 1ZQ9A 2I3ZA 2YXEA 3FUCA 4U3JA 3TSOA 2ZJYA 1XEWY 3GYGA 2D5LA 3HZRA 4Y2PA 4DMKA 2RGNA 3L7JA 5DT9A 4DPMA 2NVUB 3J80A 2FV8A 1GZUA 2FSUA 2ZYIA 3BVPA 4QYMA 2O54A 2RCNA 1G2OA 1WVGA 5F64A 1JXQA 3II6X 3VAAA 4YROA 3BTOA 1ORHA 2JS7A 3KOZA 3BE8A 1DRKA 3FPGA 4GM0A 4JOQA 4G97A 2ZXFA 2I4TA 4C04A 3DFFA 1O96A 2W48A 2D5BA 2ZITA 5I7EA 5EHXA 3L6UA 3MWJA 2EJTA 5SZIA 3X44A 3OTIA 1C8LA 1BTOA 4NX2A 5A7GA 3DL2A 5L9AA 4IX1A 4CV3A 5COAA 4MXDA 4RD0A 1S1MA 4KLZA 3E6AA 2D2IA 4WAUA 3HDQA 4DCGA 5CA1F 3UJ8A 2IY7A 2OGTA 2ZYRA 4MKFA 3BAZA 4H59A 4DC1A 3OQPA 4NULA 5FKJA 1B4DA 3REFA 4ALNA 1WHTA 5TJHA 4D3ZA 2QE6A 4E5SA 1VC2A 4QU9A 1BGWA 3UGTA 2GYUA 5JQGF 3BRCA 3TH5A 4HGNA 1TVEA 4XQ0A 1IIRA 4M0EA 4ZCIA 4BFZA 1WA5A 2O23A 4MJXA 3QUAA 3AF6A 3RUAA 1CG6A 5HF6A 3A9VA 3RM3A 4IIYA 4OQZA 1W5AA 1CPYA 1WB6A 2HEIA 2W8ZA 3OBBA 4I3HA 3U3DA 5IS2A 4G0ZA 4S12A 4EABA 5ED4A 2MR6A 2VSOA 2AYYA 4MYHA 2DWPA 5KNBA 1EE9A 4RK4A 2JD2A 4E11A 1DDOA 3Q3GE 1JZQA 2ZR8A 4GZ5A 4XYBA 3NHMA 4YONB 3SC2B 2I1QA 2WINI 3EDYA 4Y18A 4ZU3A 3U4AA 2IE8A 1UXJA 5T3UA 4DILA 1WPRA 5F4ZA 2PWBA 5C7LO 1NQUA 5MHTA 3E9EA 2GF2A 4R1OA 5JAQA 4MUBA 2QBYA 1YZQA 1TJ3A 2ZUSA 4R9NA 4ZMSA 1L5MA 4WOKA 4BCDA 2VBGA 2AQ8A 4YMHA 2Z4SA 1IN1A 1GTL1 1KKUA 1PZXA 3DUFA 1XD2A 2JLRA 1XNJA 2O8DB 4HCJA 4BUZA 1CVRA 2CWWA 1XHLA 3OY7A 4HN9A 1JMKC 3O2QB 3V1KA 2AOTB 2VT7A 1XC7A 1UT5A 4ZAXA 3FB4A 3U4CA 3ET4A 4JVNA 3G82C 5KI6A 4LJ5A 4BVBA 1P17A 2C82A 2R60A 3TX6A 2DWCA 3I32A 4BO3A 4D92A 1QH9A