2V55B

Mechanism of multi-site phosphorylation from a rock-i:rhoe complex structure
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
181
structure length
181
Chain Sequence
b'QNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO-ASSOCIATED PROTEIN KINASE 1
publication title Mechanism of Multi-Site Phosphorylation from a Rock-I:Rhoe Complex Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 45
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2v55B00
2FH5B 5JEDA 3THWA 2KI5A 3X2SA 1SVSA 2N1BA 4I1OA 1E9RA 4ASUA 3U2QA 3HPQA 5K8TA 2EU8A 1TF7A 3X1XA 2Z43A 4IOKA 1Z06A 5E7MA 2H1LA 3CX7A 2OLKA 4UJ5A 2WIBA 1NJFA 1MABA 2PMDA 1KDOA 3ZZTA 3RYTC 5HR5A 1NSTA 3H86A 3G82C 1KSJA 1BO6A 3P20A 5C4GB 1RRGA 2Q3FA 3EC1A 3AVUA 3GLIB 1N6RA 3KQUA 2FSFA 5IK2A 5FOTA 4TMKA 3M4YA 3V9PA 1PV4A 1CJMA 3UKDA 5B58C 1B0UA 1KJZA 1XTIA 3C41J 4C0HA 1BMFA 3RC3A 3ZZUA 4DSNA 1X6VA 1Z0DA 1DOAA 2OBNA 3QBVA 2PCLA 4PANA 1OH5A 1JXMA 1RRFA 1XMSA 3AVPA 3SHFA 4D4LA 1EFRA 2H18A 2NO0A 3LH5A 3AM1A 2OXCA 1W5TA 4V0LA 1IN4A 5HE8A 4TN1A 2A5DA 4BFSA 3N70A 3B8HA 1KDTA 1MT0A 1M7HA 5J5CA 2QENA 2DFKB 4C7OB 3QE0A 2IXGA 4TLCA 4LK2A 1EFTA 1XEXB 2GRJA 2W2VA 1DO2A 1ZUIA 3THYA 1E9SA 1U8AA 1E9AA 2ZSBA 4G5GA 3WNDA 2QBYA 1Y3AA 3KX2A 4Q19A 4RD3A 3GFTA 2PEYA 2H57A 2QP3A 4LJ6A 3MAAC 3L8YA 1W48A 3B9PA 3VQTA 1MH1A 2FGKA 3L0IB 3WP1B 4CZ2A 4TL6A 2QP9X 3U4QB 1FPMA 4FCVA 2NO6A 4Q7MB 1NIPA 1NG1A 1R8QA 5BWMA 1XD8A 3CRQA 2BJVA 4NYJR 4TL7A 1NP6A 1VIAA 1XEFA 3LBNA 5EE1A 2OBMA 3AKEA 5C1BA 5KPJA 4D0GA 4LHXA 4MKGA 1MO6A 1WMSA 2ZAOA 1Q57A 1FFHA 1AS3A 5L3SB 3K0FA 4C30A 1II9A 2YINC 1H8ED 3GJ8A 4GI7A 2WKPA 2HF8A 3TRFA 4OQFA 4OL0A 5BXQC 4X8LA 4F91B 1WQ1R 3KKPA 2ZI4A 2XX3A 3LFUA 1AQUA 4KI0A 4P32A 4URVR 2QAGC 1U9IC 2QUZA 4LYHA 4CVNA 1KI4A 1U99A 2ZYTX 1KSGA 2UVQA 2DPXA 3P1JA 4M22A 1M7GA 4AD8A 5SZKB 4B74A 1QHNA 2ERYA 2EFDB 4BWYA 4OI0A 3TQCA 4MRSA 5DI3B 3KKQA 3BH0A 1RE0A 4Q4HA 3BD9A 2FGJA 2ZR0A 4TMTA 5J40A 2NZ8A 2NO1A 1F6BA 2J1LA 4NCJA 1FP7A 5TB5A 3R9IA 3P26A 1GAJA 3SI7A 4TSFD 1P6XA 3U7FB 3SN6A 3CUEF 2F1RA 2WKQA 1US8A 3CNLA 1MOZA 1NBME 121PA 1Q3HA 5BN3A 5FPTA 2QMUA 5DYGA 2IYZA 4RY2A 3BWDD 4FCWA 2ORWA 3GJ3A 3GLFB 2VP6A 4Q02A 1E2JA 3OF5A 2JASA 2ZJBA 5DHFA 3D7MA 4GNKA 2QAGB 4ZI3A 2BMJA 3GEHA 3NBYC 1E2DA 1Y63A 2VSXA 1KO1A 5DISB 2D74A 1JNYA 3AQ4A 3OEHA 1YZTA 4RD6A 4DEYA 3G0HA 1QHHA 4BLRA 4GL2A 2QNRA 2X2EA 2XSZA 5BW8A 2J0UA 3HPRA 1ZNZA 3KQNA 1OKKD 2FFQA 2FWRA 3DL0A 3K8YA 4DT1B 4KITB 4DHEA 2DFLA 1XRJA 2GILA 4QRHA 1JPNA 1ZM4A 3GCGA 2ANCA 1KZ7B 4TQUS 1E69A 4EKDA 3L0SA 3K0AA 3RDPA 5GJBA 3OZXA 4JYCA 4A15A 1IJFA 2CMKA 2IW3A 4TMXA 3LQQA 2CK3D 3CBQA 1NMYA 2XJ4A 2IK8A 4LV8B 1VHTA 4M9ZA 1SHZA 1YRBA 4Q9HA 2NOAA 4NP6A 5EXXA 3TMKA 4N0DA 1CR0A 2OAQ1 3ZVLA 3IDQA 2A78A 4PAOA 4JT2A 5J4HA 1SVWA 1II8B 4KFRA 1DAGA 1T4GA 5HZKA 3SYNA 3KDSE 1W4RA 3UMFA 1K5GA 1CP2A 2FJUA 2EYUA 1IJEA 2I4IA 2YWFA 3BIFA 5IDVA 1XMVA 3SJZA 4BZXA 4UKDA 2G1KA 1AKEA 1QG2A 1XB2A 1GNPA 1Z08A 3ASYA 3B1WA 3T1VA 3BFVA 2G83A 1RJ9A 4LX0A 1FNNA 2NQ2C 5D3MB 3O8RA 1KI6A 1NN5A 2KBEA 4V03A 4WIAA 2WWIA 2H5EA 3U3KA 4CRWB 1JI0A 4X8OA 3KUDA 3OIUA 4TZ0A 4O3MA 1AJEA 1WCV1 4MYCA 1TEVA 2ONJA 3MUFA 4Q1DA 3ZDQA 4ESHA 5GVRA 3OEED 2ZI3A 1V5WA 4IOMA 2DWPA 3O8BA 3SJAA 4HLDA 4NHOA 1M2OB 3ZJYA 1DO0A 5M04A 3IBYA 4HB4A 5FFMA 1LFDB 4R98A 4AG5A 4A36A 2RGXA 4LHVA 1G20E 1VIYA 2XTZA 1AS2A 1YZKA 2GTPA 2QI9C 1R10A 2PZFA 2H8KA 2QT1A 2GJAA 3FFBA 4B3XA 4I1SA 2UZIR 2FEOA 4X8MA 2JJ1A 4EUNA 2ANBA 4V0OA 4P0TA 4BECA 4DDVA 1Z07A 4WOPA 2GNOA 4MH0R 1DE0A 2BBOA 2XEXA 3B9QA 4JLBA 4L9WA 1LS6A 1Z29A 1GG2A 4H1UA 2HUPA 5EZ6B 4KSBA 3SYLA 1GUAA 4A82A 1KY2A 4NL4H 1ZIPA 1ZNXA 4TWZA 3WRYC 4DJTA 5G3YA 4KVGA 3F3YA 3T15A 3EPKA 2OLJA 1XDBA 3EX7C 3NEYA 3NKVA 1W1WA 3QOFA 5LB4A 2GVDC 1FL9A 3FMOB 1KSFX 1W0KD 1ZC3A 1LF5A 3IEUA 2J41A 3BS4A 2IHBA 2C9OA 2JLUA 4ZKEA 1BYIA 4A0GA 3IHWA 5FUYA 5F2EA 4CT4B 4L4UA 2ZE8A 1D6JA 4MRNA 5B30A 4B2LA 4Q1FA 1CR4A 3QSYA 1XZQA 3FHOA 2PLFA 2VP2A 2J87A 1DVRA 3MFYA 2VYFA 1S2MA 3OE7A 3OIWA 5FOVA 3R8FA 4DDTA 3JZAA 2QPAA 2WIAA 2ZRNA 1G8PA 2OM2A 1H65A 5J4KA 4BGDA 3GJ6A 2R9VA 2O8BA 4GBMA 1RVDA 2WSSA 1G18A 4A2QA 1N3BA 4POAA 1OV4A 4A0FA 4HAZA 1II0A 5JSZA 2C77A 1F48A 1R0YA 2DY1A 3MMPA 3KTAB 4KAXA 1XFAA 2UZ3A 3TBKA 1LVGA 2RB4A 2FU5C 1UBEA 5FBVB 3B5JA 1IXSB 4DCUA 1KKLA 2VIIA 3FFAA 2HV8A 1Z6YA 5LB2A 1VKJA 3HJNA 4C0LA 3U44B 4RZXA 3UMRA 2YYZA 2O8DB 2BKUA 3SFZA 2O0KA 3FDIA 4DLWA 3U3JA 3E1SA 3BB3A 4BZPA 1P73A 1F2TA 2ZRBA 1GKUB 4GOJA 1T0JB 3QIAA 3W6PA 4AK9A 4ZI2A 4L8GA 3HU1A 2MSEB 3KFVA 1EFRD 4B48A 3L43A 2GJ9A 3IKJA 821PA 2QRZA 3AVYA 2J0SA 3FMIA 1P7CA 1SZPA 4TTRA 4URUR 4LYAA 1KO4A 1OYWA 2AN9A 2QTHA 2WJGA 4LRWA 4DLYA 3GP8A 2D2FA 3FVQA 3MGCA 1LTQA 1SXJD 2KWIA 2CDNA 4GT1A 5JCZA 2WWYA 1E98A 4CEIA 1G21E 4RFVA 2R6GA 1NKTA 1KI1A 2WJHA 2QT0A 2OBLA 3ETLA 4Q9IA 4IVRA 2GEVA 4FIDA 4G0NA 4PPNA 3AVOA 3T12A 4DB4A 2E9SA 1HA3A 4ARZA 4II7A 2D62A 3KXLA 3IPYA 4B35A 1QVAA 1J2JA 4K81B 3CIOA 1HQCA 2J45A 3L82B 4E07A 1HYQA 1VECA 3FGNA 2IXEA 1WDTA 2ZUCA 1GL7A 4IXNA 4PZLA 5EP3A 4C2UA 2GA8A 3KXKA 3NWJA 4HEJA 3HR8A 1KK0A 1NVVR 4TTPA 2IYWA 1JPJA 4Q7KA 4DEXA 1HT1E 3C5HA 5LD2C 2WJJA 4JSYA 3X1WA 3TQFA 2HEIA 1GKIA 2XAUA 1NG9A 2QBYB 1SVIA 4M9QA 1IY0A 1HE1C 1P61B 2CLCX 2IYQA 3I5XA 3P32A 4EPWA 5AWFC 4I81A 4XTCS 3QKRA 1CJTC 5BN5A 1KI9A 2HYDA 4AKEA 4C0SA 5HKKA 3TR0A 4R7ZA 4FI3C 3U61B 1T3LA 3AEZA 1N6KA 1U2RA 5JS8A 3IIMA 1Z6TA 1P75A 5C2JB 4KLNA 4CEJB 4R2HA 2CJWB 5IRCD 3AF1A 1KGDA 5CK5A 2I3BA 1QF9A 1Z6GA 4ZO4A 4MYTA 1WP9A 4G5QA 4IOLA 4NYJQ 3MCAA 3VHLB 4B2PA 5LD2B 3TVTA 4PC3A 1KDRA 3KB1A 2ZJAA 2X1VA 4LBYA 1SVKA 2IX3A 3W90A 3VNVA 2AWNA 3WY9A 3IEVA 1YHNA 3IO5A 1Q0UA 1GFIA 1HUQA 3SS8A 2W0SA 1D5CA 1YR8A 4KXFB 2CL0X 4OI1A 2CL7X 1H8EA 1U0LA 1UEIA 2RH5A 3K70C 4W5JA 4Q18A 1IQPA 3RS2A 3A36A 2WZQA 2ZJZA 2HF9A 1IHUA 2VHQA 4PSVA 1Z0FA 5CIQA 1HE8B 4BLTA 5J4VA 5DN6D 1Q1EA 2GXAA 2IL1A 4JLAA 4F7WA 1OB5A 4DSOA 3LRPA 3U3OA 3MLEA 5FTNA 1US8B 2BBWA 4EDHA 5GADl 2GBLA 1N0VC 5BYKA 2I1VB 2ZJ2A 3I92A 2P67A 3PUXA 4LOAA 2V3CC 2Q6TA 3PUWA 4Q47A 1PJRA 1BH2A 1GRNA 3ICEA 1OIVA 4AG6A 2ZRIA 4GMXA 4E03A 3LW7A 3TLXA 1YKSA 4HZIA 4TSFA 1P3JA 3BJIC 1R5BA 4CDGA 2IEYA 4LV5B 1HH4A 3B2EA 5JJKA 4N3NA 1QRAA 5FPHA 1J8MF 4DCTA 1BS1A 3K0CA 3NH9A 4LGMA 4WAUA 3C7KA 1AM4D 2GCOA 3AP3A 2PT7A 4IFEA 4I4LA 1ZM3A 2JLYA 4EIWA 1W2GA 1SHKA 2OZEA 1J8YF 3C15C 4XSGA 3UIEA 4F93B 3DHWC 4FW9A 1CEEA 2P65A 5H70A 2QZ4A 3I72A 1ZU4A 3B1VA 5DI9A 1G7SA 1Q21A 1GNQA 2F9MA 3CH4B 1OKKA 4A8JA 2XGJA 1ZC4A 3ZIAD 4JL8A 3RAPR 1W36C 2D4HA 2BC9A 3T1OA 1AKYA 5UKDA 2HXYA 2GF9A 2O8FA 3UATA 3IILA 4LJ8A 1D2MA 2AXNA 4IEIA 2ZRDA 5KPDA 2TMKA 5AJYA 3S1AA 2CK3A 4F92B 3RNLA 2MMCA 2FA9A 3HDTA 2ORVA 5FUWA 5FUXA 1ZBDA 2YHSA 4PC6A 2GK7A 3GMTA 3TAHA 3K0SA 1G5RA 3B1XA 1G9XA 4FMDB 4IJMA 1KI6B 2IHYA 3CPJB 2D3WA 4F4IA 5CB8A 1TU3A 1X86B 1NN1A 2BMEA 3AH8A 3LXXA 4G5RA 4LHWA 4XWKA 1XD2B 1GNRA 3F8TA 5B64A 1UDWA 1CXZA 2NIPA 1A82A 1IONA 1OF1A 3B6EA 1G6OA 2FX3A 4Y0AA 4Y0VA 5EQTA 4IOJA 1A4RA 3NEJA 2WBLC 2EVWX 3WBKA 2F43A 2XITA 4TLBA 2IYVA 5EXPA 3DMDA 2Z4SA 3Q7QA 3DVLA 2XOKD 4XVUA 1OXUA 3W8NA 4MGYR 4JVMA 3T06B 2GHIA 4OYHA 4BLOA 4JBYA 3CX8A 3TH5A 3ZS8A 3BFXA 4AY2A 4BUJA 2ZJYA 4UNRA 3GJ5A 2AR7A 3BAFA 3WHKA 4YQFA 5F3WB 4P33A 2ASEA 4PZZA 1DAEA 3CR7A 4HUQA 2Z0MA 1IN7A 4QL3A 1C4OA 2ZI7A 4KV9A 2FSGA 4D6PA 3OE7D 2Q9CA 4TTQA 2IS6A 2WKRA 1R5NA 2ERXA 3MWLA 5JHHB 2GEUA 3E5HA 1GM5A 2C98A 4DB2A 1XNJA 2G77B 4LV6A 2AFHE 1UPTA 2ZRAA 5JRJA 3H1TA 2ZXUA 1OHHD 1VMAA 2QMEA 3TJZA 4ZCLA 1WBDA 4UXHA 4JLPA 1GRQA 2R6FA 4JJZA 1T6NA 1Z2CA 4JVNA 5FL7D 1XTSA 1YU9A 3A1SA 2HYIC 4M9SA 1E2KA 1TEXA 2RHDA 3KJGA 3PEVA 4PXAA 4KJZA 3AKYA 3H4MA 2XZLA 4Z54A 1E2FA 1I4LD 1VCOA 3PUVA 1MRSA 1W0KA 2IYLD 1T9HA 4EPVA 3EPLA 2RKOA 1AIPA 1NJGA 2E87A 2W2TA 5TMPA 3CRVA 1AS0A 1P5ZB 3CNNA 3AVXA 2GEDA 4TYQA 3TSWA 4S2EA 4DDWA 4JIMA 1ZM9A 1G3UA 4HB0A 4E22A 2BIFA 5KNDA 4M1OA 2GESA 1MKYA 1P4SA 4EFLA 2GJ8A 2FOLA 3G5UA 3EPHA 4QBIA 4MUAA 1E0SA 5TY0A 3SFVA 2REXB 2ZRCA 2ZTSA 4MGZR 5FTKA 3R7WA 4OQXA 3EC2A 1ZNWA 1KY3A 4JLDA 2XTNA 5EP4A 2WJVA 2H7VA 1F2TB 2J7PA 2NO7A 2P0EA 1GOTA 1P62B 1SVMA 4L5BA 3AVVA 1WF3A 2FPKA 4C0AC 4D25A 1IBRA 1TQ4A 4LCBA 3SQWA 2CHGA 1VYTA 3MD0A 3AV0B 2W83A 4PX9A 1U94A 1CIPA 1UADA 4HLUA 4TQAA 1JXOA 3TE6A 3QXCA 1T0HB 2J9RA 4ACAA 3CRW1 621PA 1PVOA 2ZRKA 4KSCA 1WXQA 3NHAA 4P4TA 4QFMA 2IA5A 1GITA 5FR2A 4UNQA 1F3OA 1CR1A 4HZUA 1LY1A 1T3SA 4HAYA 5KO2A 2YC4C 4DKXA 2J5XA 5DE3A 5HCNA 2Z4RA 1SXJA 5CDFA 4EPXA 4AYWA 4A0HA 3ADBA 1DAFA 3T1TA 3IO3A 2NO9A 3QF7A 1FQJA 5HKKD 1XTRA 4GSYA 4CF7A 1FX0B 4RFSA 4ERNA 1ESNA 3R8CA 1G19A 3QXJA 1IN8A 2WJIA 3BGWA 2GXSA 1NMZA 1Z28A 5EUQB 5HE9A 4B3FX 4C9BA 2B92A 3SQXA 4C0QC 1UKVY 4CEHA 2ZSDA 4XD7D 4TZ6A 1KO5A 4QGFA 3AGQA 3QPVA 3FWYA 3VHXA 3DKPA 5CB6A 3Q9LA 2ZRGA 2QQEA 1DG3A 1NVVQ 4Q1EA 1E94E 3P4XA 3QKSB 4QNMA 1RFLA 2PL3A 2VSFA 2ZJOA 4JLMA 3ZS9A 1E0AA 3SOPA 2ODEA 1G4AE 1XXHA 1SVLA 3B13B 3MG9A 3OAAA 4Q03A 3T5DA 4FXPA 4DC9A 2B8TA 4F38A 4ZDIA 1TQ2A 5B2ZA 1YRAA 4A2PA 3W6NA 2PX3A 3MJHA 4BQSA 3GPLA 5KSYA 3K9LA 4YMSA 5EJEA 1OH7A 4ZCMA 3VKHA 3I4LA 3ADKA 2Y8EA 4V0MA 3IQWA 3SBDA 3QPWA 1SKYE 5SZHB 4FCTA 2QP4A 2GBLC 2VF7A 1W44A 3SBEA 2A3RA 1NSFA 2JA1A 3LBHA 1PZNA 3ND9A 3LLMA 4RCZA 3O8CA 2PJRA 5GJVC 1OYYA 2BOVA 2QU8A 4ZIRB 1UJ2A 4Q4AA 2PX0A 1MV5A 3EA5A 2VHUA 3VX3A 3REGA 3JVUA 1ZNYA 4PQRA 1Z63A 1A1VA 1X3SA 2RGEA 1KNQA 1E32A 1XCGB 2IUSA 4EJSA 5FOUA 3BE4A 1XEWY 4L16A 5DH9A 3K0CC 4EQ6B 1DEKA 5JZVA 5KDDA 4C2TA 3U3RA 4URYR 4M0LA 3WNCA 1XP8A 1G7TA 2AKAB 2RGNA 2WJYA 3HP1A 4HDCA 4PC7A 3GLHA 2DR3A 3WHLA 4MITA 1E9FA 2VTKA 2J3EA 1GKYA 3ZGXA 2IS1A 1N6LA 4PTLA 5CLLA 1N6HA 5BYJA 4W5HA 2REOA 1S96A 1OFIA 2BM0A 1TTTA 1D2NA 4A8JC 4HLQB 4XJXA 1EFUA 3EZ7A 4JLJA 1OXXK 4G1UC 1N6OA 2Z5FA 2HXSA 4MDFA 5DN6A 1LF0A 2RGAA 4LJ4A 3I8SA 1RRPA 1OH8A 3E70C 3GQBA 2F1JA 1ZW6A 5CLQA 2YC2C 2ZE5A 4AYXA 1J70A 2GCOB 2V1XA 4QKQA 3HWSA 1CRPA 1UM8A 2RCNA 1DADA 2WICA 2YOGA 3OIYA 3CR8A 3QY0A 4LWZA 3GFOA 2BCGY 4OHWA 4K8OA 4PR0A 4IDHA 2PZGA 3B82A 2WWHA 3IIJA 2IYXA 1M34E 1QHGA 1SKYB 2G6BA 1Z22A 3QF4A 5P21A 5JCPA 1JALA 2ZEJA 5EUMA 2VRWA 4GMDA 2ODBA 4HAXA 4TLEA 2BV3A 5KTYA 3MWJA 5J4LA 3RWMB 1A2KC 2BEKA 1TX4B 3QPUA 3PJRA 4UJ3A 4KYIB 2O8EA 3NHBA 1G3RA 1DAIA 4Q5IA 4D81A 4PFSA 3CWQA 2HDNB 2QPOA 5FOWA 4Z1MD 2HJGA 5H8WA 3PITA 2ZETA 3L0OA 4XOIA 1ONBA 1VTKA 1ZJ6A 3GLGE 3VR5A 1ZRHA 1KOFA 1P9RA 3K0EA 2YWHA 3GJ0A 4TYWA 4U02A 4DCVA 1E9DA 3RABA 2LCFA 4RZUA 5IT5A 3ZIAA 3VU9A 2JLQA 5HPYB 1MO4A 1G1MA 2V55B 5ELXA 1UBFA 3NDPA 1NF3A 2H92A 2B7CA 3NC0C 4LY6A 1E3MA 2LKCA 1EESA 4M1YA 5HZHA 3LDAA 3DOFA 3R9WA 4DSUA 1R5OA 4ACBA 4URZR 2CCKA 1XX6A 2CHVA 2JGNA 2QL6A 4B44A 2ZS7A 2JAQA 3PQCA 3TNFA 2ZVQX 1G8HA 2KE5A 1S0UA 2CCJA 4ESVA 1BIFA 1HTWA 1R4AA 4Q4JA 4PPGA 3UWOA 1P2VA 1CR2A 3WP0A 3HR7A 1ZM7A 3TVDA 5CITA 4P4UA 2V4ZA 2O8CB 2PJZA 3BK7A 2XXAA 2A9KA 2JCSA 4PC2A 4U5XA 1ZUHA 5DYIA 2O0HA 3KXIA 3MSXA 5J47A 1H8HA 1U8ZA 5IF9A 3D6TB 3QEOA 2GAAA 3LWNA 2ATVA 4Q1CA 4ON9A 3KQLA 3GEEA 2ZYUX 3KZ1E 3RSLA 4JYBA 2OHFA 1SGWA 3EA0A 4DLZA 1FUUA 3N2EA 2XOKA 3CB4A 2G88A 2HJVA 4G5OA 1Z6XA 4BLPA 5CM9C 3UK6A 4QBHA 1G3MA 5G53C 4B32A 1UAAA 4DCSA 1HURA 1COWA 3RVBA 4A92A 3M6AA 2J7KA 3IQXA 5D3QA 1DAHA 3K9GA 1GZSA 2EFGA 1XD9A 4P4SB 1YZGA 3SE0A 3X1YA 4DLVA 2EYQA 4Q1BA 3GLGB 3WMEA 1QHXA 1U0JA 1S8FA 3CW2A 1SKQA 5ANRB 1Q1QA 1UBCA 3SZRA 5EXSA 4FMCB 4CW7A 3QEJA 4MKIA 2FZ4A 4US0R 1W49A 3KJEA 1XBTA 4Q7LA 3LLUA 1SXJE 3KL4A 5CDFE 3B60A 1G41A 1E1RD 1OHHA 4HYYA 4YDHB 1D2EA 2VSOA 1E4YA 3KJHA 4B3BA 2JLRA 1W4AA 2N46A 4OK5A 4RJLA 2X19A 1ODFA 3CPEA 2PZEA 4XH9B 5FL7A 2J7PD 1OXTA 4CT5A 1KAGA 4YMVA 3M1IA 4KODA 1MO5A 4R71A 3A1UA 1F2UB 3FPAA 3LX8A 1NIJA 4NKRA 3PXGA 5AJVB 1Z0IA 2WVJA 1NRJB 1NVXQ 4B43A 2IS4A 2QA5A 2AXPA 1CKEA 1E4VA 3FYHA 4G3XA 5B57C 3FHCB 4HDOB 3THWB 4PQYA 1T3HA 1DPFA 3K09A 4JLNA 2XZPA 2ZU6A 3R20A 3EG5A 4N1AA 1EFHA 1KMHA 2ORIA 1XJQA 3W8RA 1SXJC 2Z83A 3CRMA 4LYFA 1U98A 2RGCA 3R9XA 2YOFA 3LVQE 3NVAA 1MABB 4UQOA 4LI0A 5A4JA 4EAQA 1QHYA 4G5SA 4ZCIA 3THXA 1VCIA 2Q9BA 3FE2A 4EPYA 2BEJA 4V0ME 2ZROA 4KVAA 4NZYA 2Q0HA 4C0KA 1S4QA 4QM7A 3UG6A 2VQSA 1E9CA 4AKHA 4MKHA 4QBFA 4JBWA 2V6JA 3GLIA 2JLSA 1G16A 2ZE7A 4E09A 2O5VA 3W6OA 1XMJA 1Z0AA 3SNHA 4PSKA 2FN4A 3NBXX 4DVGA 5CYOA 3RC8A 3EIHA 3U3MA 2EW1A 3TSZA 2JLVA 4KBFA 1FMLA 3TW8B 4FWTA 2REBA 3IBGA 5KOYA 4YLGA 1KDPA 1I2MA 5EE9A 3FTQA 4BRUA 2KB0A 4NYMR 4W5WA 4ZV4A 2ZRFA 4QGHA 5HCIA 1ZU5A 3VR6A 4B3DA 2AD5A 3K1JA 3OAAD 2FPLA 3PUZA 1X8LA 4BASA 4TMWA 2OCBA 2PMKA 4IEEA 4B3CA 1N0WA 1G3IA 3CF2A 3PUYA 4MYHA 2BMFA 3BFKA 3GLHE 4HLCA 5EZ5A 5AUOB 3THYB 3EIEA 1SVOA 2C9CA 5AUPB 4IFBA 2OESA 4HAWA 3QJYA 3VKGA 2V9PA 5FPKA 1L4UA 1F60A 2IUTA 1MRNA 4C7OA 3CLVA 1TNDA 5JEEA 1OH6A 1K6MA 1VYUA 2DHRA 5DLQC 2IYRA 1WRBA 4YDSA 4DLXA 3SC3A 2Q21A 1X8KA 4PPFA 2NMVA 1G6HA 2B8WA 4D0LB 2A5JA 1IN5A 3C16C 1E99A 2BJWA 2YZ2A 4BFYA 5JWRA 1KNXA 4LBVA 4M1KA 4FWIB 4PHTA 2OT3B 3CZQA 5JFGA 1DS6A 4EJSC 5KSZA 1IOZA 2ZI6A 3KFXA 4QJ4A 1R0ZA 1CJVC 5AJWA 2JLZA 2EFEB 1Z0JA 1Z2AA 1JR3D 3CF6R 1NN3A 4XD7A 3ZH9B 1BKDR 2QPTA 1GTVA 2QTFA 1LB1B 2RGNC 5BN4A 4TL8A 2P6NA 3K0FB 3QXHA 2FG5A 3LAWA 4NMMA 2AHOA 1O3YA 2OEPA 1U0HC 2IYUA 2O52A 5L3SA 2NPFA 2ZJ5A 1G4UR 3TK1A 3X1ZA 4NYIR 1Q12A 5GJCA 4URWR 3ZLJA 4LC0A 5A5GA 3Q5DA 4M1MA 4Q4AB 4FINA 4M1TA 3AVWA 1GIAA 1DARA 4CIDA 5TV2A 1DTSA 4QOSA 2GETA 3HYTA 2FMXA 4A4DA 4Q4HB 4LJAA 1AQYA 4OI2A 1AK2A 2VP4A 1E2QA 2XNSA 2QROA 1LW7A 2CNWD 3PR1A 5DI3A 3PEWA 4D82A 4JSTA 2CXXA 1UEJA 4WZAE 2XB2A 3RS7A 3FHTA 2QGNA 4LJ5A 3LBIA 1G5TA 4H1VA 1Q1BA 3AVTA 1RZ3A 3C5CA 1HV8A 5FOSA 2F3RA 3RHFA 5LPNA 1JAIA 1EFCA 2WM9B 1DBSA 1Z3IX 2J59A 2R2AA 2OFXA 3L2OB 4MYUA 4US2R 1NNEA 2ZIAA 4PAQA 2R44A 4GOXA 1A2BA 4AYTA 2VBCA 1ZCAA 3ZZ0A 1YVDA 3UWKA 1IY1A 4JLOA 1UKZA 4A2WA 3ICQB 2VLIA 4TYPA 3GLFA 1QHHB 2V6IA 5AJZA 4O25A 5FI1B 3BB4A 2MMGA 1ZD8A 2ATXA 2QAGA 1U9IA 4WZ6A 3K70B 1IN6A 2J0UB 2JEOA 3TKLA 4QXAA 5TXGA 2QE7A 1CLUA 2QORA 3PEUA 5CJPA 4W9MC 1E79D 3K0AB 2K5UA 1RRCA 3CPHA 1GRRA 3DEFA 4DT1A 5L8VA 1IAQA 5DSZA 2YJTD 3EZ2A 4U00A 1DAKA 3BBPA 5JLJA 3ZD6A 3CNOA 1QDEA 4JL6A 2F6RA 3QF4B 4HI0E 1WBBA 4OJQA 3F5FA 1L4YA 3D31A 3EASA 2DWOA 2IYYA 3TW4A 1TF5A 1K8RA 1XF9A 2GDJA 3KKOA 1CRQA 1YE8A 1ZYUA 4IDPA 2O8EB 2GAOA 2W6IA 1J99A 3MWKA 1K5DA 4OQMA 2GCPA 1NLFA 3P4YA 4OBEA 4XIGS 4GDFA 1E1QD 4JVLA 1JECA 3JVVA 4BRWA 2D2EA 2WOOA 3FMPB 4BEBA 4RKFA 2RHMA 1RJ9B 2DBYA 2W58A 4PZYA 1GVNB 1KTVA 1Q3TA 2NZJA 4HAVA 1Q22A 3LQRA 4D26A 1ZINA 2RGGA 3BORA 1CTQA 3AF4A 2BCJQ 4UXIA 3DDCA 2A7QA 1I4DD 1N25A 4Q9LA 4C0JA 4YXWA 5H68A 1H8HD 4Z1MA 1W47A 2V54A 3RRMA 3RS0A 2ZYVX 1W4CA 3LV8A 5FL3A 5TDHA 3KKNA 1M8PA 2JJ8A 2ZITA 5H1YA 1W36B 1KK1A 1KSHA 1EGAA 4JZKA 3A1WA 1UKYA 1T5IA 1TUEA 2XNDD 3EARA 2Q9AA 3QQ5A 1P2SA 2H16A 2C03A 5LDDC 3IUYA 2ZUBA 1PLKA 2H17A 4K46A 4D2IA 4D4KA 1GILA 2FE4A 4IRUB 4G01B 1J90A 4MRRA 5JWHA 5L3QA 1COWD 2G1JA 4M1SA 3WYAA 1IM2A 6Q21A 3E2IA 2OCAA 3QI2A 4Q66C 1YZUA 3PENA 1KI8A 4CYMA 2AD1A 1E0JA 4UNSA 1VHLA 2NTYC 3QUSA 1KIMA 4XTRA 1R0WA 2W6JD 1ZM2A 3LNCA 5FOXA 2IWHA 4A6XA 1OFUX 5LBIA 3WRXC 1AZTA 1KI7A 2F1HA 3H84A 5E7IA 1RW4A 2WV9A 5CYPA 4B3GA 2DFNA 2PT5A 1NY6A 3CX6A 4L15A 3K9NA 2ZAMA 2C99A 1M74A 1Q1ZA 2CVHA 3LD9A 3SHWA 5AUNB 1SQ5A 2IF0A 5F98A 2KJQA 2GZHA 1Q20A 3UG7A 3GLIE 3WYGA 2A2ZA 1R6BX 4ZDWA 4MUBA 4HATA 3DM5A 1NLYA 1KYIA 2ZRHA 2DWQA 3EW9A 4ZKDA 1KKMA 3GJXC 3K09C 1W0JD 2QG6A 3GEIA 1EX7A 1NLZA 2GCNA 3EWSA 4O2RA 1NKSA 2BHRA 2IUUA 2FFHA 2F55A 2O8BB 1G8GA 5TVKA 3W5IA 3DPUA 1W4BA 5JJLA 5AK0A 4LZZA 4JVSB 1KZGB 3GJ4A 2OCYC 2GXQA 3L8ZA 5JI3E 4BFZA 5JSZB 3KQHA 1NN0A 4FMBB 2WAXA 3FKSD 1XCMA 4KU4A 2V8OA 4LJ9A 4LBWA 3W9YA 4D4MA 2B21A 2QMHA 2ZRMA 4M4SA 4HAUA 1L2TA 1LNZA 4OJKA 4NCHA 2W2XA 3CO5A 3AUYA 3KTAA 3VX4A 2F7SA 4B76A 3OHMA 1E1RA 4EPRA 2FZLA 4QNRA 5AR1A 5FBQB 1PLJA 4US1R 2QSYA 3FMFA 3A4NA 1IY2A 2D7DA 1E2PA 3FB4A 2V7QD 3H0KA 2X77A 4PO8A 2O8DA 3GD7A 1V43A 2SHKA 3T61A 2A5FA 4Q9KA 4IW3B 5C46F 1ZUNB 4DCNA 4V0NA 1MO3A 5AJXA 1ZAKA 4RSGA 4HB3A 4PC1A 1ZVQA 1TU4A 3ZVNA 2CBZA 1TUIA 3THXB 2WOJA 4B33A 3AVQA 4CEIB 1HT2E 2G3YA 2HLDD 4MDEA 2VHTA 1S1CA 4GP7A 4WW0A 2RGBA 5CJ2A 1FTNA 3B85A 2ECKA 1S3SA 3A8TA 3NIBA 2OG2A 1S1MA 5JMTA 4QHSA 2MSCB 2P6UA 3ECCA 2DFTA 2FPMA 4A0RA 4R2IA 1UF9A 5EE0A 1E2EA 3D8BA 3T1QA 4LHYA 4ARZB 2DB3A 1ZIOA 3U5ZB 3HU3A 4PO9A 1N6IA 3KQKA 4DDUA 2RGDA 1Z0KA 3ZVRA 4WA7A 1CJUC 3C4JA 3KKMA 4ILEA 3UMSA 5KUTA 421PA 4M21A 4OHYA 3SU8A 4Q9JA 3EAQA 1JJVA 1OIWA 4XSHA 1YZQA 4JL5A 2J0VA 3IPXA 1ZD9A 2Z6VA 1NI3A 3AGPA 4NYMQ 1E2HA 1FUKA 4S35A 5G40A 4GFDA 2ZR7A 1UKEA 4PO1A 5KNCA 2HT1A 1QHSA 1XMIA 3RWOA 5F9HA 3BH6A 4F4JA 5FBRB 3BH7A 3I3SR 4PHFA 1KK2A 2QM7A 4TYNA 1E2MA 3TUZC 3AKCA 2MSDB 3QKRB 2C9YA 3GLFE 5F9FA 2JDID 1KK3A 3WNBA 1JQLB 3NBFA 3QNUA 3REFA 3TR5A 4FD2A 3VR4A 2ZE6A 3U6BA 3SEAA 2IBMA 1NL3A 4KFSA 4QJ3A 2VA8A 3MRSA 3QENA 4DUGD 1OW3B 4RZ3A 4AURA 2GWHA 4BEJA 1ZD1A 4YMWA 1J7KA 4UNNA 1S3GA 521PA 3TGPA 1WB9A 2WSMA 3U7HB 4CEJA 2FDCA 1I2DA 2CJWA 3FKQA 1Z83A 4Q21A 2G9NA 4JLVA 3TUIC 3VAAA 1TAGA 1ZMXA 2FFBA 4GP6A 3OFND 4OQNA 4Q7JB 1JR3A 3W5JA 2BWJA 2F9LA 4E5UA 5L3RA 2XB4A 3I32A 1VCMA 4KCGA 4LPSA 3W3ZB 2P2LA 1R8SA 4KHZA 2A5GA 2CLDX 2ZR9A 4NH0A 1LV7A 2CCGA 1HY3A 1GL6A 4OQLA 4NYIQ 4BFVA 4IHQA 4C0BA 2C04A 3AP1A 3ZD7A 1E96A 4FMDF 5FH9A 2GK6A 5JJIA 4BE7B 1RC8A 4M2LA 3I62A 1OXVA 2QE7D 1N5LA 2GVZC 2V1UA 2AKYA 2WWGA 1PUJA 4RVCA 2Q3MA 2YVUA 4L9SA 5E3HA 4F4CA 5K8IA 3ZVMA 3I1FA 1AN0A 2OV2A 3QKTA 1WA5A 4DIEA 2JLWA 4LBZA 4Q1AA 5C4MA 2QRNA 3B1ZA 1G8FA 2X8AA 4KFTA 4XWOA 2GXUA 2GJKA 3A4MA 4D4JA 2CNWA 3B7GA 4MA4A 4M1WA 3THOA 4DWJA 1LS1A 2O0JA 3LX5A 1CS4C 4JKIA 4YONB 3AF0A 2YNMA 2W6ID 1JAHA 4Q00A 3BB1A 3SDZA 2OUKA 1Z6AA 3KUCA 2R6AA 3ADDA 1XWIA 5FI0B 1N6NA 1Z47A 4IVQA 5FBWB 1AA9A 1GWNA 4TT3D 5KYKA 2GF0A 3RRNA 1D8TA 1E2LA 3ZQ6A 1EWQA 4A8JB 3OESA 3QG5A 3U60B 1M1YE 2BM1A 4WZBE 1IXRC 4KLZA 4ZDJA 2OCPA 3NTUA 4YXWD 5CK4A 2O8FB 1G7RA 2QSZA 1E79A 3V00A 1KHTA 2RAPA 4YC7A 1NBMD 5DGXA 1GP2A 2ZQ5A 3S1AB 4B6EA 4BFTA 3T34A 3PVSA 3JZMA 4ZPXA 1XPOA 1YJ5A 4BPBA 1S9HA 1TMKA 2Q3HA 4MRPA 3LO5A 2OE2A 1JEEA 5E7JA 2VF8A 1G8YA 3L0PA 4OK6A 2VH5R 2R65A 3RRYA 2ODNA 4B75A 3HYRA 2OILA 4B34A 3RS3A 1Z8FA 2DCUA 4MQBA 4AWXA 4D80A 1X1RA 5CIWA 1OLOA 2ZPTX 1HQYE 2G0TA 3M0EA 3T5GA 4ZDKA 1E1QA 1EWRA 1ZP6A 3VKWA 3VNUA 1XD2A 4QC2A 3RSOA 2C2HA 2E1RA 4TLDA 1PLLA 3NH6A 2WTUA 2JIZA 2GZDA 2BBSA 1RYHA 2F43B 2ZSFA 3BRWD 3PEYA 4QBGB 4RD1A 2IF2A 721PA 4BFWA 2QEQA 2IEZA 1NY5A 1N6PA 4JMPA 5DHAA 4RZ2A 3RRZA 4Z8XA 2ZVPX 4IXMA 4GZLA 4V02A 3VTKA 3CM0A 3DZ8A 3A37A 1E0KA 1EK0A 3B78A 3ADCA 5L3QB 1N0UA 3QXSA 3CF0A 3KJIA 2ZUDA 2WMNB 2P5SA 4RD0A 4HUQB 2XNDA 4TLAA 4NCNA 5KDOA 4A6PA 1M7BA 4EFNA 1AZSC 1N5JA 4TMVA 3VR1A 2AX4A 1P2TA 2YWEA 3IGFA 1JEDA 1W5SA 2IT1A 1VYVA 3VMFA 2ZI5A 8OHMA 4QJ5A 4MGKR 1GL9B 1ESMA 1KI3A 2D7CA 3A1TA 1WE2A 4ITRC 4TQ9A 2PH1A 4KYUA 3T35A 2FF7A 4IDNA 3QXXA 2EWVA 2W6JA 3PCRB 3BC1A 1VCNA 3A1VA 2WHXA 4JS0A 3W34A 5JHGB 1VG9B 2PBRA 4DLRA 3N2IA 2JJ2A 2QM8A 3I61A 2C78A 2VP9A 2IYTA 2KBFA 4QM6A 5A0FA 4GZMA 5L3VA 3QVUA 4LSGA 4PHHA 3RS4A 3UXMA 2A30A 4KBGA 1G3QA 4RKEA 4GPTA 2VL7A 2BBTA 1P60A 1JBKA 2QGZA 4NPHA 2P6RA 2QN6A 4DRZA 3CZPA 1OIXA 3A4LA 1W7AA 2WPDA 3DZDA 3PV0A 4DLUA 2ZM5A 4HLUC 4OHXA 1Q44A 4B73A 2GZAA 4LC1A 1E6CA 1G291 2R6CA 4KO8A 1KJYA 4OI4A 4QGGA 1W46A 4ASUD 1Z5ZA 1D9XA 2C96A 4O0MA 1QVRA 1JJ7A 1W0JA 2CEAA 3U6KA 3MWYW 3SYKA 3UPUA 1X1SA 4B6FA 1OFTA 4URXR 2FNAA 2D06A 1XXHE 1E2NA 2IS2A 3WBJA 1FTSA 1T91A 3R7WB 2QTVB 2EWWA 4YMTA 2ZSAA 2PCJA 5IK2D 3FKSA 2P5TB 2FFAA 2PLRA 2ZS8A 4JKYA 4DLSA 5IHPA 2ZU0C 1RYFA 3AP2A 5E4FA 1XZPA 1BMFD 4UXJA 1OXSC 1CBUA 5EXTA 1FW6A 2N42A 2R6DA 5GJWC 2ZS9A 2L0XA 3BERA 1C9KA 2ZRPA 2FV8A 2CVFA 3PFIA 1DG1G 1ELOA 1OSNA 2V7QA 1N5KA 4TL9A 2LWIA 3DO6A 1RPZA 3TSOA 4HZUB 1VG0B 4CGZA 1JR3E 2C5LA 1P72A 2ZREA 5K8LA 1E9EA 5G3ZA 4Q48A 2OXRA 3K9HA 1SXJB 4KFUA 5G41A 2OFOA 4PHGA 3ZYCA 2CLSA 2W00A 4LUCA 3A6PC 2HLDA 4XWAA 1KO8A 4FN5A 1UFQA 4DLTA 2HCJB 2VP0A 2P3SA 3SJBA 2YKGA 3PG5A 4RFSB 1OPXA 3TAUA 1TQ6A 1KJWA 4TMZA 1JQJC 2ONKA 4Q01A 3VFDA 1XEXA 4DXAA 3DKVA 1A5TA 2JATA 1R7RA 4EPTA 1FX0A 4CEHB 3F0TA 1E9BA 1GDDA 2WAYA 1QHIA 5EE5B 2AWOA 1U8YA 4QHTA 1ANKA 4JJKA 5HTKA 1CF4A 5AUQA 4HSEA 4IVPA 1YR9A 2VHJA 2QAJA 5JI2E 1XXHB 1NVWQ 1NMXA 3A58B 2WWWA 2C8VA 1G7CA 1EXMA 4LJYA 4NONA 3U4QA 4U7DA 5JECA 4M53A 3QKSA 3CRRA 3RANA 1U90A 4LJ7A 4JT4A 1T8UA 2BDTA 5JS7A 5KDLA 1CULC 2BVNA 5KSOA 1KI2A 2VP5A 2WWXA 1X8JA 3VR3A 1FOEB 1JR6A 1XEWX 5SZIA 3WXMA 2FSIA 1R2QA 1N5IA 2KSQA 3ASZA 1KMQA 2VHCA 2YV5A 4BZQA 2JDIA 2G0NA 1B23P 1OE0A 4LHZA 2A5YB 2WWFA 3U7GA 1XTQA 5DIFA 4QG7A 4HUTA 4DIDA 1E2GA 1T5LA 3BOSA 4IDQA 3BXZA 1XTKA 1OB2A 3VR2A 4DUGA 3EXAA 4RD2A 5KSPA 4ZIRA 1EG7A 1DAMA 4EJSB 4RD4A 3LVRE 1FP6A 5CM8B 5KHOC 2VO1A 1OFHA 5K8UA 4DSTA 2B6HA 2GJSA 3CONA 4AI6A 1FMJA 1CJKC 3WMFA 1M6NA 3B1YA 4BLQA 3ONWA 3AF3A 3GLHB 1I4TD 4PAMA 5DNYB 2ZRLA 3ND8A 4EQ6A 1PUIA 2ODWA 3OFNA 1N2CE 3DOEA 3NG1A 3EIQA 2F1IA 2R8RA 4WVFA 3OEHD 3H2YA 1F5NA 4OHVA 1QG4A 2AFIE 2XZOA 3EZFA 3Q5EA 1YR7A 5E95A 3NBZC 4P3YA 3NDBB 3O8DA 221PA 2UKDA 2XSZD 4H9GA 3K70D 1G5PA 3SJCA 1U81A 4O2LA 5EE3A 3N5CA 1YR6A 3LY5A 3I8XA 2LKDA 5TARA 2ZI9A 4BFXA 3DMNA 3LA6A 1CU1A 2IYSA 5FR1A 2OSBA 5SZJA 2JLXA 5GVSA 3V4RA 4A1FA 1NVUQ 2IWRA 2AK2A 4QHYA 1TPZA 4JLKA 5JRZA 3Q7PA 5JWOA 4IKEA 2XJ9A 3AF2A 4PSAA 1G17A 2CE2X 3J81k 2HCBA 1KO7A 2B7BA 2J0QA 3OIVA 4HB2A 3SR0A 4EFMA 4LPKA 5EP2A 4DZZA 1YZLA 3WYFA 4NCKA 4OHZA 1GSIA 1OJLA 1XPUA 5FUVA 4W7SA 5EP1A 3QKUA 1XPRA 4I1VA 1RKBA 4QGAA 2ZJ8A 3TIFA 1JB1A 4BLSA 5J4YA 2NGRA 2EQBA 4P31A 2CE7A 3D3QA 1QBKC 1R0XA 4LYJA 3CWZA 4OK3A 4Z8YA 3TUJC 1II8A 5JBQA 5KNBA 4ABYA 3GJ7A 3RS5A 5FTJA 1VPLA 2FSHA 1UDXA 2FEMA 2C95A 2RMKA 3EWAA 3PIRA 2JIZD 4FMCF 2CL6X 4TT3A 3MJRA 1IXZA 1OT3A 4GOKA 3IHLA 1S9DA 3ZQJA 4IDOA 2GKSA 1W36D 3VU9B 1P2UA 5D3MA 4PPQA 3RLFA 1G64A 1XU4A 4C4PA 1EX6A 1C1YA 1T8TA 4AC9A 2NPIA 3U7EB 2AK3A 1NBMA 1DELA 2BMDA 5FBLB 3NC1C 5FTLA 4B2IA 4WXPA 4WXRA 4N0EA 4B47A 1TQDA 1VG1A 2JJ1D 1XCPA 3AUXA 4C3ZA 3LXRA 4MRVA 2NG1A 4J0QA 3Q3JB 4Q4JB 4R9UC 4B71A 1D9ZA 2HT6A 4MKFA 4GRAA 1E2IA 4RCYA 3EPJA 2F3TA 3QG1A 3CKLA 1UBGA 3WMGA 1BYUA 1RIFA 4NTZA 2XXAB 2ZANA 1YQTA 5C18A 4WBSA 3C8UA 4M8NE 3O47A 2XTMA 4YMUA 1P9WA 2O8CA 1BOFA 4XVRA 2OFWA 3KB2A 1P9NA 4M9XA 3OEEA 2ZSEA 3CH5A 2JJ2D 4TYYA 3I5YA 4NE2A 1ETUA 3LW8A 3NXSA 3K53A 1HEIA 2IXFA 1A7JA 4A9AA 2QY9A 3C14C 3EZ6A 5FTMA 2VEDA 1FQKA 5FPYA 2OAP1 3V4FA 1O87A 3GFPA 4HDQB 2WPDD 2ZYWX 1QZXA 2CHQA 4XVQA 1VG8A 3P27A 1XJCA 1VDZA 4X8HA 4AKGA 4OKSA 3X1DA 2IC5A 1FNMA 4I1UA 2X2FA 4DBLC 2WSSD 4Z51A 3FOZA 5FPSA 4NBSA 4P4SA 1XJ0A 2J46A 4V0KA 4D0NA 3GLGA 3HU2A 4LDJA 5DO9A 4BFUA 3QVVA 3QBTA 2EFHB 2ZRJA 2QMOA 3AB3A 1AGRA 2I1QA 2R62A 2VPPA 4AKIA 2YWGA 1SULA 2WMOB 1FZQA 1YZNA 3Q85A 2QQ0A 1KAOA 1TADA 4NCIA 2DYKA 4NU0A 2YOHA 4UNPA 1XTJA 3I73A 3W3AA 1ZCBA 4I99A 5BQ5A 1W2HA 3DM9B 3UANA 2EFCB 2PEZA 3Q72A 4NDZA 4Q4LA 1F2UA 2BKEA 3Q8XB 4MGIR 2AL7A 3EZ9A 5KU1A 1AGPA 4PQFA 3U44A 1L8QA 3AKDA 4JBXA 1L7VC 1TL7C 2W0MA 3IIKA 1KMHB 4AIIA 1TF2A 1MR3F 2OO7A
chains in the Genus database with same CATH superfamily
3MD9A 1KMNA 4GR5A 3X2SA 2HNAA 3K4HA 3ZWCA 4I1OA 3EVNA 1H2XA 3SYTA 4IOKA 1Z06A 4KREA 1HZJA 4KAAA 2OBFA 3NJRA 3WWPA 2H1LA 5HZMA 2PPLA 4ZCRA 3F90A 2PU7A 1VE5A 4BQQA 1P45A 4JJAA 2AJ8A 2HK6A 3H86A 3PA8A 1Y8QB 1KSJA 3GCDA 1BO6A 4EGJA 2GSDA 2I7TA 1J5EB 1N6RA 3NOQA 4IXTA 3RI3A 4DWWA 1JWAB 1L5LA 3V9PA 4NZPA 2DWUA 2OBBA 3M9LA 4MV6A 3UKDA 9ABPA 5DBEX 1KJZA 3JR3A 3N07A 4BN4A 5DSXA 2XF8A 4GMHA 4R0VA 2ET6A 4QDJA 5IJAA 1G2OA 4DSNA 5EJFA 3H1FA 2PCLA 2R4UA 3DBLA 1JXMA 5LUBA 4KP7A 2F3SA 5SYAA 2HCFA 2TYSB 4G0YA 1DI0A 1U11A 2NV6A 1WB5A 1JBEA 4D4LA 3WDKA 1YL6A 5LDGA 4P36A 1XLUA 2AI2A 4UMVA 2Z6UA 2FN9A 3P45A 4QYXA 1A77A 1IN4A 3FSGA 4UPDA 5I9NA 2AUMA 2EG5A 2J6HA 3M6FA 4IJ5A 1DKMA 3B8HA 5D51S 1N4AA 3R7NA 1MIHA 1CEQA 1KDTA 1EPUA 2C3UA 1CFJA 2DFKB 2FFJA 3QE0A 3SKXA 3ESAA 4ZU6X 4F11A 5GTDA 1EFTA 1XEXB 2O2JA 3TDKA 3AEYA 1A7AA 3HGQA 4B6GA 1E9SA 3THYA 2DPGA 4C7JA 1E9AA 3FUCA 5K0NA 3T7KA 4A6EA 4QUIA 5JPIA 1VOTA 4BKPA 2QBYA 1JT9A 1Y6JA 3ENNA 2PEYA 3G2LA 3OT5A 4JA0A 5KVCA 5CVDA 5JNSA 1C14A 1CV2A 3IVAA 4FGLA 4BNXA 5CBPB 1ZL0A 2RH8A 1XUOA 2ZBDA 5FA6A 4FDLA 1MH1A 2Q4OA 4I4NA 3ED1A 3QITA 4AO6A 3WP1B 4KIUA 4CZ2A 3ZHVA 2XQJA 1I80A 1MO2A 1RYEA 4ETNA 4FHFA 4Q7MB 3RTDA 2O0LA 5BRNA 4KG7A 1LBEA 1ZN7A 1NG1A 3KU1A 4GSLA 3WL5A 4DY6A 1LI7A 2NN3C 2H9AA 4QUAA 3BGOS 2FPRA 4TL7A 5DV9A 3RBVA 1C7QA 1JDBC 1NP6A 1Z34A 3GXBA 3O83A 5EE1A 5G4KA 3T95A 2YQZA 1Y6QA 4KRGA 5KYUB 3RK0A 4MLZA 4QPCA 3VYWA 2GM3A 5DYYA 4CUZA 4TM8A 4MKGA 1M76A 3IQIX 5DEOA 1MO6A 4BVFA 3FVRA 3PNOA 4U2GA 1XNRB 1KQ3A 3KLPX 4C30A 2YINC 3TQSA 4LOLA 3TYXA 2DSNA 4GPZA 4HYTA 4OL0A 3H87A 2WFMA 3ST7A 5BXQC 2OORC 4RKYA 1MNQA 1WQ1R 2P11A 1SCAA 3C3BA 3LFUA 2DLCX 5GM2A 2OYCA 5DULA 1NVFA 4LYDA 2O3UA 4RIFA 4X1YB 4LYHA 1IMOA 1KSGA 1OTHA 5I7HA 5E6SB 2I8AA 2UVQA 4ARAA 3KBBA 1KQPA 5E9WA 4RTOA 1IDOA 1M7GA 2BYTA 2R8ZA 5EOVA 1BDHA 2ERYA 3U26A 1DRJA 3ELWA 3AUSA 2JA2A 3TQCA 3OZUA 1X1AA 3KKQA 3ILXA 4Q4HA 3BD9A 2ZR0A 1ND5A 2FW6A 1ZSNA 2WV7A 4L76A 2NO1A 1F6BA 2BFCB 4NCJA 1D2AA 1GAJA 1UWVA 1BTOA 3K8QA 3NIWA 3SI7A 1OZAA 1E6WA 3SN6A 5JDCA 3CUEF 4GM0A 4ZT7A 5D86A 3E2PA 1PJ8A 2R6HA 2B2NA 3HCEA 3O5AA 1C9JA 4DLBA 1ZS9A 5HCUA 3HSKA 2RH9B 4FZ3A 5TPWA 5AVWA 5AOBA 5FPTA 1BKSB 1VE1A 1CT9A 1NM5A 3A1NA 4LKOA 2BSAA 4KR7A 1NULA 4FYWA 3BWDD 3EMDA 4HG2A 4DKJA 3KXPA 4P4GA 2XKJE 2IHNA 2REQB 2VF4X 2JASA 5DHFA 1RBQA 3VOSA 4L1KA 3NBYC 1E2DA 4PWYA 5ECGC 2VSXA 3EGVA 5DISB 2C4WA 1LPBB 1I2CA 5EPUA 1HT3A 1V8OA 4CM9D 5JNRA 2B83A 4JK3A 4K9QA 1QH0A 3LI2A 4PLWA 4R31A 4GL2A 1GGKA 2CY0A 4JJIA 1IG0A 2J0UA 3L6BA 2FWRA 2P3QA 3EA4A 1YJQA 3K8YA 3N0RA 4K7JA 4DHEA 4QRHA 1GZHB 3OE1A 4LOJA 4UMEA 4BNZA 1Y8ZA 2X40A 2IVFA 4Z9BA 2PZAA 2BY4A 3GIWA 4JASB 3K0AA 3RDPA 1XK6A 5K8CA 1I7SB 5FI3A 2Q2WA 2Q4TA 1EA5A 2X42A 4J6FA 4WLEA 1BDBA 3S8EA 1VHTA 4M9ZA 1YRBA 3GNTA 4Q9HA 3NR2A 3DLIA 3SPXA 4N0DA 1A4XA 2Q3EA 4H1HA 4QVGA 1XTBA 3ZVLA 4BGEA 1LSSA 5JY1A 2NVUB 3TZ6A 1TIPA 3ZE2B 3HRIA 1DAGA 3Q98A 3GVXA 2DPLA 3D7LA 1ECPA 2IUEA 1K5GA 1CP2A 1OFVA 2MYNA 4UKDA 1AKEA 1QG2A 3K5PA 3VPCA 3ASYA 3DS8A 4TYMA 2HK8A 4QDXA 4J0KA 4Y30A 3QKWA 4KWCA 2PLWA 2AE1A 2XGOA 3KVRA 3C8MA 4P5EA 1ZSYA 4LOHA 5AW9A 3D8TA 1M67A 3I6MA 4FDUA 2H6EA 4O4HF 1DZ3A 1Y8RB 4A6DA 1KI6A 3H7AA 4ND7A 2OCLA 4UAVA 2H5EA 5CX1B 3GRYA 3IAM1 1J7JA 2FXVA 4LCEA 1XZCA 4NI5A 1PV2A 1JVNA 1LU9A 3E7DA 1C4XA 3IOMA 3ILHA 3R8XA 4YLYA 3NHFA 2KPOA 2FN7A 4PZUA 4NX2A 3SJAA 5BR8B 4RPHA 2AEFA 2XVYA 4EYGA 1DO0A 4ZGGA 5M04A 3IBYA 3ZVKA 4HB4A 3WFJA 1Z12A 3H2JA 3WDSA 1AKRA 2RGXA 4QOGA 3WLTA 4RVDA 4JEUA 2GTPA 4C0WA 2QI9C 4P4NA 4P0PB 2CLIB 5REQB 3WYCA 2ILTA 2O50A 4IWNA 3LUBA 3OX4A 4RHCA 2IHTA 4TMFA 2XDWA 5E3JA 3ZWYA 1KEVA 2CSUA 1KXZA 2QT1A 4BQPA 3QELB 3BEOA 4G8DA 4HGZA 2JJ1A 4U5QA 5L9AA 4COKA 5B1YA 4FYXA 1Z07A 4YYEA 1TPYA 5B7PA 1DE0A 4JLBA 1WPQA 1X7HA 9MHTA 1TU0A 1WB4A 4INZA 1DP4A 2C5GA 3EQ6A 2WU0A 3KHTA 4N7BA 3F97A 3OZRA 3UVEA 4A82A 2MYUA 1M0SA 1ZIPA 4TWZA 5KJ1A 4UUBA 4F3NA 3T15A 4G1MB 1ADBA 2VG8A 3UXYA 3LP6A 3PD0A 1YC2A 4AZSA 5HYVA 1G8KA 2X5JO 4FTWA 1SUIA 1W1WA 2GCIA 4Z99A 2X7XA 4UUMA 1INLA 2BLLA 1FL9A 1TM4E 3OQIB 4Q3NA 2XR1A 3LIIA 1H1DA 2O59A 3HLTA 1TZBA 1V3TA 5C34B 3BIJA 4YRRA 4F04A 1WCYA 2WUVA 1G0OA 3LC0A 1TFUA 4BP9A 2JLUA 2WWRA 1BYIA 2AG1A 3DHNA 3FOWA 2WA1A 3DEHA 3RVPA 4J0JA 4KE8A 2J07A 4U0KA 5HW0A 4FOOA 4B2LA 3WLQA 2DU8A 2GN9A 2PXCA 4YJ3F 4UTNA 3V4LA 4C88A 2PGIA 3RC9A 3MFYA 1EGQA 1C50A 3VJMA 4CKBA 5FKJA 4JV5B 1V6CA 2QPAA 5LXTA 5IVPA 2RHCA 3QWAA 1IHOA 4EW6A 4BGDA 3T1HB 1RCTE 4GIBA 4OYYA 3ZW9A 4OLFA 4IQ4A 4OXIA 2YZMA 3KLNA 4G8BA 2NU8A 5LC1A 5F7JA 2ZBFA 1P74A 2Y1DA 1XZJA 3DGFC 5BSTA 1SG9A 3OD1A 2A9JA 2PUHA 4G8JA 4A0FA 5GV7A 3MTJA 4HAZA 1II0A 5JSZA 4HEA6 1ZRMA 4LA4A 5AI0A 5IWAB 1YJ8A 4KAXA 1XFAA 3TBKA 4QDKA 3KD3A 1QFXA 3Q8KA 1NASA 1UBEA 3I5AA 3B5JA 2H5JA 3NIDB 3WIBA 4DCUA 2Z5GA 1SZDA 1PNRA 3HJNA 5DT9A 4A73A 2JHGA 4QVKA 3KELA 1NUUA 4RZXA 4ZQGA 3UMRA 4P7FA 4YLEA 4XYLA 2ETVA 2DVMA 2O0KA 1QGED 3RG8A 5ETJA 3QV2A 3NUZA 4ZODA 3R5SA 2X4IA 4TVBA 3PJGA 3DZKA 3EDQA 3FPCA 3ZHBA 1T4CB 4BZPA 2EXXA 2ZRBA 4M1ZA 5KCMA 1GKUB 3BXFA 1T0JB 2EGHA 4GOJA 2AG8A 3WYBA 2B1GA 3D7KA 3GROA 3AHDA 3L7MA 3ZBUA 2JGEA 4AK9A 3ADPA 2XYQA 1Y80A 1SPXA 1Y7TA 1Z5UA 1JEAA 1EXNA 3HU1A 3KFVA 4MWTA 2GJ9A 2O6HA 1LV8A 5DZSA 1Z33A 2EERA 1SZPA 2IZ7A 1A9XA 2HNKA 1X7WA 2AN9A 3FSGD 4KJXA 4LRWA 1PTJC 3IIIA 3NALA 4G24A 4U3JA 1U7XA 4EFKA 4KXUA 1R0LA 3BVPA 3PIDA 1BC5A 3D0RA 4FFMA 5JQGF 4RFVA 4CLOA 1T43A 2EX1A 4OUKX 3FPKA 2J48A 2JAUA 4MVXA 5DYNA 2W2NA 2W2KA 2XA2A 4IDCA 4Q9IA 4AZ3B 5TGZA 4D8YA 3F73A 2B4YA 4D9FA 1GFWA 3QWIA 3P97A 4MVJF 4UOEA 1QBGA 2GEVA 4PPNA 3AVOA 2E5WA 5EIWA 3T12A 5HHTA 4DB4A 2UXBB 3BE8A 1XMPA 4UVDA 1P1FA 1I10A 2W6MA 1RD4A 3M6VA 5TNXA 1RM0A 4LMRA 3IPYA 1L7OA 4GRDA 4B9EA 1BDIA 1Z7YA 1N57A 1QCDA 1CNEA 1HYQA 3JD4A 4YWJA 2EOAA 1VECA 4NBVA 2VDKB 3I6BA 3M81A 2DUWA 1L0BA 1ZJJA 2ESRA 2OP0A 4IXNA 4PZLA 3ZGVA 4EUSA 3U4GA 3B2QA 3P5SA 2DGDA 3EVFA 3LC7O 3FRHA 3N9IA 1KK0A 1M6VA 2H7YA 2K2WA 5A6VA 1R6XA 2Y05A 2YN4A 4I5EA 2JARA 3C5HA 3BJMA 1BROA 2QNBA 5BQ3A 2FR1A 2WJJA 1F8YA 3WYEA 1L9XA 1RRMA 1TA0A 1OQAA 3QUAA 5CNJA 1KJ9A 3TQFA 2HEIA 1NG9A 4IILA 4FNMA 4I4TF 4XCXA 1I01A 1Y9ZA 2G80A 1P1IA 3JARB 4B3SB 4ZYTA 5FLEX 3PJDA 5AVKA 4EPWA 3UAGA 3NX4A 3NHYA 2P75A 4DYDA 4LEIA 4JAVC 4DARA 1OAOC 1DTWA 1QPGA 2FYTA 1TO2E 5E3IA 1KTIA 2PUTA 4XTCS 4F2WA 3LMKA 1KI9A 2OD2A 4AKEA 1KVQA 3DE0X 2G8NA 2P79A 2EV9A 4FI3C 3NU1A 1GUZA 4WNYA 4D79A 1VP9A 4RV4A 2PKQP 3S2IA 5C35A 5JS8A 1L5RA 2BI7A 3E81A 2OG1A 3CH7A 3EVAA 3G17A 1P75A 3WWZA 4GXNA 4KLNA 4RSMA 1HNXB 1FU7A 2GRUA 3KPJA 3L8HA 2EHJA 1IWBB 4R2HA 3AIOA 1DKNA 2I3DA 5BUZA 2ZCUA 3GGOA 4FIZA 3WGKA 3ZV6A 2COEA 5CAEB 4ZO4A 1MB4A 4D9KA 4LOKA 4G5QA 2WHQA 4NK4A 5FWXA 2FW9A 3VBCA 1QYRA 3BL5A 3NOOA 3JZDA 5AT1A 4KQHA 3TVTA 3JSAA 3CZ5A 3RU3A 1KDRA 4HQ6A 3ZTYA 1MB2A 2X1VA 2CF5A 5KOHA 1KRWA 4MJ7A 3EHEA 2GZRA 5ALSA 3WY9A 2DP4E 3IEVA 1NUHA 1YHNA 3IO5A 5JROA 1XTZA 3BXGA 1RRKA 3MJSA 5D6OA 4Z9FA 3CVXA 4KXFB 4M9UA 5I9LA 5G1NA 1EHYA 4R1UA 3BWVA 4C7VA 1H8EA 1U0LA 3PC8A 4HEQA 2RH5A 2X0RA 2Z57A 2JI9A 3K31A 1KDYA 3BREA 1BS2A 1CPYA 2L82A 2Q49A 3KSMA 5ITWA 3C4VA 4PLYA 4D5EA 2UYCA 1Q0LA 2NUTB 4I2NA 4JITA 2Q29A 2VAMA 5DYTA 4NEQA 5A62A 5HM6A 3T9BA 2I0FA 2IL1A 3N2GB 4F7WA 1OB5A 1EFDN 3MLEA 5BYBA 4J1TC 4ALLA 2HPZA 5GADl 4D42A 1TVEA 5SYMA 5BYKA 3I92A 4WFJA 3UT6A 3EDRA 4GP9A 2QD2A 4H4EA 3VSEA 3TFOA 3HZRA 3OKFA 1CUHA 1NW8A 3UO8B 3GAFA 4GNRA 4Q47A 1JTEA 1E7MA 2I4OA 4EJ0A 3O0DA 3ICEA 4B80A 1OIVA 3ENKA 3L0YA 4QD3A 3ZDAA 3LW7A 2XYPA 5C5EA 3GJSA 3I12A 2EZ8A 2IEYA 3GL9A 1CERA 1GPDG 3DO5A 2C4MA 2QWXA 1AB5A 3GLRA 3INGA 4LV5B 5JJKA 1EM8B 1QRAA 3BE5A 5BVHB 3LUKA 2PKRA 1J8MF 3SXJA 3GDOA 4NCAA 1BS1A 5CDSA 1FXUA 3L4KA 4EI7A 3BGVA 3KLBA 1X80B 2H4YA 2H07A 5IARA 5JO9A 5BOVA 3AP3A 7ABPA 3K3PA 2FZCA 2FUG6 3A28A 4B3RB 2OENG 4LXTA 2DBQA 1HMYA 2BGMA 3O9VA 1JE1A 4PINA 3H97A 1SHKA 2OZEA 2WYUA 1GGMA 4EIWA 5F1PA 1TLTA 2W6OA 2NAPA 3UIEA 3LUCA 2Z2KA 4FW9A 3R4CA 1H0SA 1Q50A 2OMEA 1EJ0A 2C4HA 2QZ4A 4GXQA 3ROXA 4CIAA 2CVQA 1KVTA 1PR5A 1Q21A 2OCIA 2QZJA 4PSDA 1R3UA 4NMXB 5IKOA 3R7SA 1ONPA 1XAHA 3PFFA 1P2FA 1PGNA 1W36C 3E8MA 3F5QA 1CQPA 1EQ2A 1QS0A 2O8FA 1KZ6A 3O03A 3SFTA 2XUFA 2AXNA 5GZ1A 2TMKA 2RIPA 3QK7A 4WECA 1FS5A 2EP5A 4F92B 5I4KA 1HF3A 4PU0A 1M33A 3HDTA 3TGLA 2VJYA 3GX1A 5FUWA 1ABBA 1LQTA 2Y0DA 3RTAA 2AFIB 1SURA 2ZG6A 2ZPUA 1ZBDA 1C9NA 1J24A 4WN9A 2GK7A 1L5KA 1DT5A 2RB5A 2HIHA 2YHIA 3N8HA 1S01A 1ISPA 1I13A 3L9XA 4FMDB 3QVMA 2D3WA 1BMQA 2AQHA 1DQZA 4R3UC 1NN1A 3AH8A 2PZJA 3C6YA 3L1JA 3N3BC 4LHWA 4XWKA 1XD2B 4Q39A 4PZEA 1UDWA 2QVLA 2OGTA 3JWGA 4AX4A 2ZUVA 4NS1A 2UDPA 4BV2A 3BEDA 3ZE0B 1YAJA 2CMHA 3HN7A 4PZCA 1XCLA 3WLKX 1VA4A 4Y0VA 1ARZA 1QV7A 3NEJA 3K8ZA 2QRGA 1KYXA 2WBLC 1GQFA 3HB4X 3JRNA 3WBKA 5BMVF 2RG7A 3HKDB 2X7JA 4GC5A 4TLBA 4QXOA 2VT2A 5DBIA 4M87A 1BXKA 2R7LA 2G04A 3ZHXA 3AOGA 3WJAA 1RHUA 2KM1A 2Q45A 3NOXA 5AIAA 2XKBA 3T5PA 4JWTA 1U04A 2R6R1 5LQNA 1JHPA 1TKBA 4AY2A 1JHMA 2ALJA 2FN8A 3AFIA 1I2BA 3BAFA 3ESQA 3GJ5A 4ND4A 3WHKA 1FYDA 4YQFA 5F3WB 2X5OA 4LGVA 4M0MA 4C6HA 4RESA 3GDFA 1KQOA 1O95C 3DDHA 4RTJA 1FIUA 4KGZA 1G63A 1PX2A 1IN7A 2Z0MA 4TT8A 1M34A 4YK7A 3VZSA 2FSGA 5ECDA 4D6PA 2YJNA 3BZBA 3L18A 2Q9CA 5AM5A 4EMBA 3LT0A 3PCXA 4KXMA 2QRVA 4HNAA 1XNJA 3IP7A 2GLTA 2G77B 4FXOA 2D54A 4ZXFA 4WZBA 2AFHE 4GKBA 3L7BA 2ZRAA 1Q2UA 3W04A 3TQQA 2IVZA 4HLNA 4S1WA 3E9EA 5EWLB 1VMAA 2PQ2A 3TLYA 1FFCA 3IKLA 2VNIA 4UXHA 5ALMA 3FX2A 1WBDA 1GRQA 2R6FA 4JH0A 4NBKA 3LPNA 2QLBA 5I7UA 4CLHA 4B84A 1QUFA 2YYAA 3UTDA 3D5QA 2ZDHA 4NH4A 1ULBA 4BZZA 1E2KA 2C7GA 1TEXA 2CLHB 4BO0A 5IH7A 3PEVA 3B89A 1TJ3A 4Z4EA 2EJTA 3IPRA 3AKYA 4GI2A 1P9LA 2XZLA 4Z54A 2A1UA 1A95A 2VATA 4HCJA 2JD1A 3UICA 3OCWA 1NT2A 3FTDA 3KR0A 3IEXA 2I4LA 1R66A 1U3UA 1KAHA 1YL7A 1P2GA 3L0ZA 3CNNA 4O5OA 2OVFA 4F2DA 5BSWA 1MHTA 2ZKLA 1H5QA 1JQDA 4YJGB 2Y6VA 4Z3DA 2O7RA 4AP9A 2BGIA 5FBHA 1RI3A 3DAPA 3ZU5A 3ABOB 5KYGA 4JNKA 5FHRA 1RBYA 2WTMA 3C3PA 2JLCA 3U7RA 4YY3B 4WSOA 5AM2A 1O94A 3RKSA 4A0SA 2GESA 1XE3A 2GJ8A 2JGDA 4ZVMA 2FOLA 2FQWA 3PDWA 4WXMA 3ZKWA 2DETA 4C6SA 3G5UA 4B4VA 2X9VA 3EPHA 3ZY5A 1U2SA 1YNOA 1CJBA 3GH1A 1YT5A 1M66A 3HBJA 3QW4B 2ZRCA 4Y6OA 1GU0A 3T99A 3K6SA 3R7WA 4OQXA 1W8DA 3WAKA 1KY3A 1YB4A 4JI3B 3DWGA 5EP4A 3WK5A 4CLRA 5LLDA 2H7VA 1HZZA 1F2TB 2WDPA 2WHYA 2VS1A 4RDIA 1BVUA 5F1KA 3VGJA 4DA8A 2C54A 3LOQA 4GQBA 2UYYA 1GN8A 5CG2A 1IB0A 1QGYA 2FPKA 4KL8S 2PUJA 2E6UX 3MTEA 3ZDYB 1DV2A 1X8XA 3F7MA 2CHGA 4ZQCB 4JOQA 5A06A 2LNDA 2W83A 3AY7A 3BFJA 4PX9A 1HE5A 1U94A 5K8JB 4DIOA 1CIPA 1Y1RA 3KQQA 5AK6A 1U1EA 4TQAA 4B40A 1FDWA 1ISMA 1SY7A 1T0HB 2J3HA 2AFHB 2J9RA 3QXCA 5AI6A 5EKUA 4BNUA 3HCFA 3EB9A 4MR9A 2YWDA 2ZRKA 1ST3A 3EVGA 3NW9A 5ICCA 1KRHA 3T3HA 2BD0A 4U63A 5B36A 1T0IA 3JQ7B 1F3OA 3LYLA 4EABA 5J1SB 4CKXA 4HZUA 5KWSA 1D5WA 1SC6A 3O3CA 1LY1A 4HAYA 4C06A 2BHLA 1Z7GA 4YPFA 1T5SA 4A3SA 1CEXA 2ZKIA 3ECSA 3JPYA 1EAYA 1F0NA 2P2DA 1B2LA 3KAKA 4O2AB 1SXJA 4LZAA 4MUFA 3LKZA 4LG1A 4QRIA 4AYWA 4EPXA 2ZB7A 2W2QA 4A0HA 4X9XA 3ADBA 5JU6A 1ZD2P 3TTTA 3T1TA 2NO9A 1FQJA 3ZUPA 1XTUA 3DDSA 2WF5A 4W5RA 4MUIA 2OOKA 3WA6A 5EJ4A 2P78A 3GRUA 1JSZA 1NLUA 4N7RA 3ZCRA 4AICA 1JKMA 5CFLA 3QXJA 1K7CA 3FBGA 4H2DA 3BGWA 3EJ6A 5HE9A 4J2TA 2BFBA 1MGPA 1OR8A 2B92A 3VO2A 1KBOA 2J3JA 1X3LA 1RTKA 2FWAA 3DEIA 3LPLA 4RPCA 4CEHA 3D3NA 2JIDA 4AMZA 3QPVA 4XUCA 3FWYA 1L5NA 3DKPA 5CB6A 3Q9LA 2WABA 4ZI7B 1VRWA 1DG3A 1DRWA 1PK9A 3H5VA 1E94E 3IBTA 3K7EA 3NT4A 1RFLA 2ZJOA 3OTGA 3DE5X 3P4XA 3QE4A 3QKSB 1CUFA 4JCCA 4M6WA 1XZAA 4LECA 1E0AA 4YNBA 1G4AE 3B13B 3ZDRA 3MG9A 1GTMA 4Q03A 1GQYA 3MQ4A 4PNPA 2B8TA 3C5WP 3DV2A 4PYKA 3UAOA 2ONYA 3BMCB 1UZMA 4GOOD 3MJHA 1NA5A 1T8YA 3TCNA 1PFVA 3L6OO 5KI6A 4YALA 4R8VA 3R76A 4UBOA 3UFBA 2GPWA 5JY6A 4RELA 1TMGE 1YU6A 3VKHA 4TRMA 3I4LA 1MVNA 2Y8EA 4V0MA 2VQ3A 3N86A 2X86A 3E1KA 3IQWA 1AMUA 4UFNA 1F5SA 4GC9A 4FCTA 1TQ8A 3SBEA 2A3RA 1NSFA 2JA1A 1PZNA 1T8WA 2PQMA 4M0EA 5J63A 5CA0A 1KERA 1R8JA 1W5AA 1ZMBA 4RCZA 4W1RA 2FWNA 5DF1A 2XOEA 4M3NA 3DV0B 5GJVC 1SUSA 2BOVA 1UJ2A 1SJ9A 4NJMB 3R7DA 3TNDA 1SK9A 2ZT8A 2PX0A 2Q9UA 2RC6A 3I5UA 4IDGA 4HPWA 4XIYA 3WRWA 3IEMA 3VX3A 1NVBA 2EF1A 3JVUA 4PQRA 1CIJA 1RJDA 2NU9A 3FSEA 3O2NA 3RS9A 3U80A 4DBVO 1YULA 3SE7A 3QX3A 1QQAA 1KNQA 1YONA 2WNIA 4EJSA 3DE6X 5FOUA 1PNQA 2YFYA 3URMA 5EHNA 2FWMX 1WVMA 3K0CC 3OCCA 4EQ6B 5H8WA 5AKZA 4GX2A 4LXIA 5C32A 5KDDA 4M88A 2UXCB 2C9DA 3PPWA 4URYR 1BG6A 3U3RA 1E1MA 3PPYA 1AXEA 3DBRB 2PKEA 2QRLA 4IJQA 4QPPA 4Y2QA 3E9YA 2MSLA 1AE1A 3Q41A 4ZRMA 1XC7A 1I7LA 3WHLA 1FLVA 4RK5A 4AKSA 4ZCQA 1AKMA 4GBJA 5I7SA 4NY1A 5E6UA 1T6YA 2J3EA 4WGFA 3ZGXA 2Q7DA 1UJBA 4U7WA 1OCEA 2B7LA 2ZB2A 3AMVA 3ILYA 4UHFA 1J1IA 2G76A 2IE0A 1X87A 3O6VA 5EQDA 5TGTA 1EDBA 4D02A 2CJXA 1HM5A 3FUUA 4D98A 3AK4A 4NNPA 2VCEA 2VJOA 4YDRA 3T5TA 3NHSA 4I46A 4XJXA 3T7DA 4ID3A 4CF5A 1VBMA 3EZ7A 1CYDA 2H4WA 4W5NA 2Z5FA 3OLQA 4DPKA 3HA3A 4LJSA 5FJJA 2YJGA 1LF0A 2JFWA 5JD5A 3S68A 4DG9A 2OHGA 3CVYA 3DTTA 4R2JA 1K89A 4K8RB 4KFCA 1QCZA 2G25A 2I3GA 2PTGA 5KSYA 2DHDA 2C3YA 3IOYA 3QE9Y 4P54A 5GGYA 4EA8A 3M6LA 5B4UA 1IUOA 3BA6A 5DK6A 1XRLA 4JB8A 1J70A 1M2WA 1D4OA 3F7TA 3HWSA 4G0PA 3P19A 5F77A 4IHJF 1N1GA 2YOGA 3WLOA 1Y1TA 4LWZA 3V1MA 2N3ZA 1BOOA 1ZI8A 2O1SA 3BF8A 3GFOA 3QMWA 4K9OA 3JSXA 4XI9A 2PZGA 1NI4A 1Q6YA 1Z25A 2IYXA 3WGMA 2DOKA 1WZCA 1E5TA 1UZAA 4D57A 5C51B 5IS2A 1NUTA 1O9HA 1YQDA 3DXXA 4BAZA 2IZ0A 2XGSA 4ZYVA 4EG0A 4TKMA 3MWJA 3O8OA 3JRXA 4KMRA 3RWMB 1A2KC 2RE8A 3QPUA 4YIKA 2Q6KA 1G3RA 4Q5IA 3KEQA 2X8BA 3ORRA 4PXSA 4D81A 2ZB3A 1FP4A 2HDNB 5FOWA 5I8ZA 3AI1A 4BCBA 1ID8A 5BURA 1PSDA 1SUFA 2ZETA 3L0OA 3PITA 1ZJ6A 1OLSA 4GOMD 3VR5A 1FNSA 4CL8A 5ILQA 1KOFA 2V5UA 3K0EA 1NSYA 2YWHA 3HFSA 1BN6A 3QHAA 4NFLA 3V7YA 5JFOA 4ZU1X 4DCVA 2C9MA 4G81A 3KYDA 1LJUA 4Y1RB 1RADA 3IR6A 1KY4A 2VI5A 3A70A 4DWOA 4RZUA 5A03A 4INAA 3ZIAA 1C7IA 2ID8A 1G1MA 4TV9B 1RHRA 1EGMB 2G08A 4BEVA 2V55B 4MHOA 1NF3A 1YRQA 1VIDA 2B7CA 4N7MA 4O2BB 2GEKA 2B5OA 1HE4A 5LQMA 4XARA 1GZ5A 4RIIA 5DBFA 4REOA 5DHQA 4URZR 3MGKA 2JGNA 5HIIA 2WWVD 4B44A 2ZS7A 3D7RA 2IPXA 3GAZA 3PQCA 1UOQA 1Y48E 1C3LA 3KD2A 1W85B 3RVLA 3TNFA 3BIXA 5K3DA 2JAPA 4AIRA 1BA3A 1H0HA 1S0UA 4Z0TA 1BIFA 1R4AA 5ES4B 1BMDA 1EK1A 2I7CA 3E23A 1WHTA 4I55A 5AQEA 3NZEA 1DXHA 4HNRA 1HQDA 4P4UA 4BBPA 4LF5B 2EATA 2CUNA 4AP6A 5CLIA 1P5HA 2O54A 2A9KA 2JCSA 1TZJA 1ZEJA 4PC2A 4U5XA 1ZUHA 1K8ZB 2QVXX 3KEOA 3MT7A 5DYIA 5FPPA 4F6RA 5JVDA 2IXAA 5HP4A 1J1UA 3C24A 5AKYA 3D6TB 3QEOA 1JBQA 4H1TA 2HHAA 4X6LA 3KQLA 3OIDA 4YREA 1O4WA 4ZT4A 4CIWA 4MOWA 4MV3A 3AHCA 3PNVA 4RKQA 5I8PA 3RSLA 4JYBA 5I3CA 2OHFA 3FOEC 4INOA 2ZT7A 3CH6A 3L7IA 1AHPA 2FEXA 5L4LA 1FUUA 1OILA 2WKWA 4ZGWA 2G88A 3A6FA 4RVSA 3BULA 5TMEA 4DMUB 1PFGA 3R3VA 2OTCA 3UK6A 1UPXA 1GAWA 1QNLA 1G3MA 2DPYA 3ABQB 3LK6A 4QBHA 3TLJA 4ETIA 2HDHA 3VOAA 5A3JA 1Q17A 2Z1NA 3GLQA 1HURA 4A92A 2EJCA 4MQMA 4XYBA 3M6AA 2WVHA 5LMZA 2OVBA 2EFGA 3QLEA 1VP3A 3JR7A 4RTQA 3SE0A 2WD7B 3X1YA 4FSDA 2EYQA 1XZKA 4WLUA 5IDYA 3WMEA 4E15A 3ZDDA 1LPSA 1WTAA 3FXAA 1QHXA 1T2NA 1ZA1A 1U0JA 3CW2A 1H4TA 4RF4A 5ANRB 1UBCA 4PGGA 2FHPA 5EXSA 1TMOA 3DMYA 3L4SO 3NIFB 4Y67A 3JQ9C 2FZ4A 2NUAB 3NT2A 3KJEA 2ES4A 3C3AA 4XB2A 5GP1A 4G5FA 3FCEA 5FEMA 1XBTA 3DZHA 3LLUA 2X13A 4O4JA 1SCDA 1U0NA 1OX4B 3GG2A 4FC7A 3P2KA 1ZR4A 3B60A 1G41A 1ORIA 3FWNA 3HJHA 3KJZA 4MVJH 1L3CA 1FCJA 2HHCA 4H3VA 4NBWA 4YDHB 2IOHA 3U7JA 2VSOA 1L5FA 1RQ2A 1O54A 1W4AA 1CUIA 2DTXA 1N2ZA 3CPEA 4K26A 1OXTA 2AZTA 1PJQA 4FUTA 1OD6A 4XGQA 3JALB 4JVOA 2HQSA 1MO5A 4WEOA 1F2UB 4CQLA 4NKRA 4IWYA 1NIJA 3DZIA 4PLVA 4RX1A 5AJVB 4HGYA 3OIFA 3KWMA 1NNI1 1X7XA 2QRKA 3EFOA 4OU4A 2IS4A 2AXPA 1ADFA 3AEQA 4E6PA 4F5ZA 2WYVA 5AHKA 1E4VA 1O89A 3FHCB 3O3OB 4WI1A 3OJFA 1DPFA 2H4XA 1BVRA 1C5KA 1E3SA 2XZPA 3NVMB 3R20A 3EG5A 5KKAA 3UJBA 4RLSA 1XQ1A 1LFAA 4JA2A 1D1TA 4NDAA 2XMCA 1KFCB 4MQ4A 5TVGA 3W8RA 1K3TA 3CRMA 4XQ0A 1ZZEA 1JFVA 2RGCA 3R9XA 2RK6A 1MABB 2QLNA 3P7MA 3ZJVA 1QHYA 1UJ4A 5FWYA 5JAZA 4ZCIA 2HRDA 1VM6A 2O1XA 4PGMA 4ZPJA 4EPYA 4C04A 2ZROA 3BL8A 1S4QA 1K6JA 4QM7A 3R40A 2VQSA 2P4UA 4QBFA 1PJCA 5F3RA 4PG4A 2V6JA 3GLIA 3EPPA 1G16A 4L7QA 2PKCA 4YMHA 2ZE7A 1VI6A 3GFQA 2CYBA 2EKLA 2WHEA 2O5VA 3SLGA 1CB7A 3DOOA 1TZCA 2FN4A 3DHYA 4FDTA 4HR7A 3BMNB 5CT5A 3H9JA 2VJCA 2EW1A 5EYPB 5CEJA 2JLVA 2UZ1A 1TZKA 4XX0A 3E0XA 2REBA 4JQOA 4DIUA 1U0FA 3C3WA 3Q7IA 2W90A 5NULA 3WA7A 3ANYB 3BHJA 5EE9A 4F4HA 3FTQA 4ZV4A 1NR7A 1SHTX 2KB0A 4NYMR 1U63A 4YUVA 5NLLA 1IC6A 4BVJA 1JIXA 3QTBA 2H2IA 4E3ZA 1X8LA 1MC8A 2PMKA 3R5KA 2DQSA 5B3JC 2P0YA 2R00C 2C7OA 3CF2A 4HNGA 1KRXA 1U7OA 2AF4C 5AUOB 3E22B 3E3LA 1HX7A 3EIEA 1SVOA 1EINA 2C9CA 4YJ2F 4P4LA 2ODAA 4QT0A 3ZY3A 2PVPA 3PKIA 5KVAA 1JSRA 3VKGA 1Z6QA 1F60A 2IUTA 4FLFA 1Q7TA 3LSTA 3JD2A 4FDMA 4FT2A 3ZOKA 1QZ3A 5KU7A 2CLEB 3HABA 4Z53A 3SR4A 5CDTA 2C3PA 2QUBA 2Q21A 1X8KA 4I9FA 2NSDA 1G6HA 4NG5A 1ZVVA 2GD0A 4F21A 4JI7B 3Q40A 4DQKA 3C16C 4BFYA 4UE3S 4EEZA 4E51A 5IDWA 2MHCA 1PT8A 1PJLA 2C2BA 4M1KA 4PHTA 4EECA 2N47A 3NDIA 1AQ6A 1NBHA 3Q0EA 4N0MA 3KFXA 1R0ZA 1D0VA 5LYJF 3JATB 2JLZA 2YVAA 1PD0A 1Z0JA 1Z2AA 2EFEB 4AS2A 3MB5A 4XD7A 2QTFA 1MA3A 2GTIA 3ZGYA 1J09A 2FZVA 4TL8A 2Z30A 2O14A 5B7NA 5LU9A 4GAEA 3K0FB 4KK4A 2I4RA 1R8XA 1TQHA 2FG5A 2X9GA 1G21B 2RG1A 3FFXA 4Z9XA 5IJWA 3U4CA 2CUZA 1GGNA 2PX2A 1LRKA 3RRFA 3FAZA 3ZWOA 1T8PA 4PYLA 1H4VB 2NPFA 4GYWA 1G4UR 2A84A 3X1ZA 4I36A 2NP6A 4F5YA 2AR0A 5A3QA 5D2CA 5GOTA 1Q12A 2YWRA 3CA8A 3GT0A 4I14A 4YCNA 2VNAA 3LO8A 3V4SA 3AVWA 2BGJA 4M1MA 4Q4AB 3EZXA 3TS1A 3JASA 4BWVA 3O1HB 5HJ2A 2J3LA 3ED5A 5TV2A 1DTSA 4OB8A 3LCMA 3WICA 1KYTA 4R5MA 2GNAA 2OHIA 1H05A 2H06A 4Q93A 1Z3CA 4OI2A 2XNSA 2VP4A 3B38A 3GWZA 4QU9A 5FADA 5CW2A 1PBTA 2CN1A 3DKKA 4G84A 2NYRA 2OC9A 5DI3A 5A3VA 4D82A 2CXXA 1UEJA 1ZGGA 4KQ1A 1XHLA 4JBNA 1Y89A 4WZAE 4O02B 4QNNA 5AP9A 3VTZA 3K2IA 2PXAA 1GZ3A 3R0XA 5BN3B 3ZJTA 1ATZA 1N7IA 1CZHA 1Q1BA 3ZQ4A 1J2YA 1QFZA 3AVTA 1O6BA 1TVKB 4GKAA 4UBKA 5FOSA 1E7WA 2F3RA 2GZMA 2PGXA 1NV9A 3PQ6A 5C3MA 4MLCA 4N82A 2WM9B 3IUSA 4LXXA