2IEYA

Crystal structure of mouse rab27b bound to gdp in hexagonal space group
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
164
Chain Sequence
GDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDFKVHLQLWDTSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
total genus 37
structure length 164
sequence length 182
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ieyA00
2ANBA 2QBYB 2W0SA 5AK0A 1LF5A 4IDHA 5FOXA 4MDEA 4HAZA 2GXUA 4PPQA 4FMBB 5FI0B 3P32A 3A58B 3X2SA 1XXHB 4LJYA 3ZZUA 3E1SA 1W0JA 2NZJA 4V03A 2IF2A 2W6ID 4HI0E 2YC4C 2XTNA 1FX0B 3W6OA 4MUBA 1J8YF 4NYMR 1ZJ6A 1UJ2A 2BBWA 2NMVA 1SVOA 1YVDA 1MV5A 4LBYA 3R9IA 4Q4HA 3HU1A 5CDFE 4IVQA 1UFQA 3SYKA 1CKEA 3CX8A 4B2IA 4MRPA 4BLPA 4CT4B 4CIDA 3HYRA 1HURA 3AVTA 4RD2A 3JZMA 5LB2A 3B60A 3MWLA 4QRHA 3EZ9A 2VQSA 4DDTA 5K8TA 3CR8A 3THXB 3SJZA 4BECA 4Q03A 2JLQA 3A1UA 3QQ5A 5DYGA 2AWNA 4CW7A 2FV8A 1Z83A 2VA8A 4Q1AA 5TARA 4BFUA 1XWIA 1KKLA 3EX7C 3PJRA 3GLFA 4OL0A 2VO1A 3A37A 1X8KA 3DPUA 2CVHA 2BVNA 4BZQA 4KYUA 4DC9A 4D26A 2G77B 2GCNA 2XNDD 1E99A 1G1MA 1G6HA 4GMDA 4IEEA 4PPNA 1OHHD 1GTVA 5B30A 3GJ5A 1TU4A 4HDCA 4M1OA 4B3DA 3AVVA 2WWGA 4BEBA 5J4VA 2J3EA 3Q5DA 3KKMA 3LLUA 4LV6A 3GFOA 3ASYA 4LJAA 2ZE6A 1S3SA 5EUMA 1SHKA 4HDOB 2HLDA 4KYIB 3CH5A 4Q5IA 5FFMA 2KB0A 4ARZA 5IRCD 3CF0A 4ASUD 5JMTA 2FH5B 1KJYA 4DSTA 2C78A 4ZCMA 3NDBB 1OIWA 2QAGB 2DHRA 1GILA 2IS2A 3ADKA 2VTKA 3KFVA 2BJWA 4HLCA 1S0UA 5H68A 1OKKD 3B9PA 2D3WA 4G3XA 3OHMA 3CRQA 4F92B 3RHFA 4RFVA 1G17A 2JAQA 1R0WA 5B2ZA 3W6PA 3OFND 5L3RA 1E1RD 2F1RA 1GRRA 3B85A 3K0CC 2OEPA 1SQ5A 5C18A 1OB5A 1KZ7B 1W4BA 1XFAA 1XTIA 2ZITA 4OYHA 3R7WB 3U3OA 4D4LA 2ZI3A 3HPQA 2E9SA 3AF0A 2HT6A 3AB3A 2ZJ2A 3IHWA 2J0VA 5BN5A 4Q47A 1E2GA 4JMPA 5TMPA 2CXXA 2OO7A 5KDDA 3AKYA 5KU1A 5SZHB 3TAHA 3TJZA 4GOXA 1AGPA 1J8MF 2X77A 1IHUA 1E6CA 1JXOA 2PZFA 2Q21A 3U61B 2VHTA 1P2VA 1E9CA 1SVLA 4LHWA 2J0UB 4RCZA 2ATXA 1QHHB 4IOLA 1E2LA 1P3JA 3ONWA 3NVAA 1XF9A 3A36A 4BASA 4G5RA 3PEVA 1ZU4A 4TQ9A 1D2EA 3ZVLA 2B7BA 4MKIA 5AJVB 3BERA 3T5GA 3VKGA 1PLKA 4JYCA 2QTHA 1R6BX 3DM5A 4IVPA 4Q18A 4LJ7A 1MRSA 3QE0A 4OKSA 1JXMA 5CYOA 5KUTA 5CYPA 3K09C 3DDCA 1UAAA 4XSGA 2QENA 4TTQA 1CR4A 3UXMA 4EJSC 4F4JA 1JR3A 4O2RA 2QP9X 2W6IA 1ETUA 3GLGE 3WMFA 3RRZA 4DLVA 2CCKA 3EA5A 1XTRA 2EFDB 3T61A 2KE5A 5FR1A 2REOA 4TLBA 1YE8A 2CBZA 2VIIA 4WZAE 2IT1A 3DMNA 4MGYR 1A5TA 1E9RA 3KTAB 2ZQ5A 1KDOA 2KWIA 3A1WA 3IPYA 3ZH9B 2QMUA 1OB2A 2K5UA 4N1AA 3BGWA 1ZCBA 1OFTA 3UWOA 3GJ7A 3ETLA 1VYTA 1F5NA 2FGKA 2ZSFA 4QJ5A 5GVRA 2ODWA 4WBSA 2FA9A 1IN6A 1NN5A 2PCLA 4ARZB 4JJKA 1XJQA 1SHZA 3W5IA 4YMUA 3UWKA 4TQAA 4M1WA 3U7EB 5FPKA 4L5BA 4ZDKA 3I3SR 3ADDA 1JR3E 2ZE7A 4HYYA 2HYIC 4PC7A 4PC3A 2IBMA 4KAXA 1FOEB 2WICA 3NEYA 1KAGA 1G64A 2V55B 5AJZA 1Z8FA 1PUIA 5KOYA 2H16A 1KI4A 3K9NA 2OLJA 5AUNB 1MO3A 1D9ZA 4UXIA 4B3GA 4BWYA 4BLTA 4AKHA 2WAYA 1Z07A 2W0MA 1T3LA 2XJ9A 3AP3A 2RHDA 1EXMA 2OBMA 3CKLA 1COWA 4Q00A 4LBZA 4PR0A 4RD3A 3KJIA 5L8VA 4RKEA 3HYTA 2WWHA 5CK4A 4PC1A 3U6BA 1U9IA 1XMIA 3M4YA 2VPPA 3BH7A 1EFHA 4P32A 2BV3A 1OKKA 3BXZA 1U0LA 2OBNA 3SZRA 4NL4H 4FCTA 4GOKA 1F2TB 3A4LA 3ZD6A 3GP8A 4YMTA 2ZR0A 1C1YA 5JJKA 3SJBA 2FZ4A 1CJMA 1IY2A 1NMXA 1FL9A 3EIQA 2CLSA 3UPUA 1MRNA 3AF2A 2IUUA 2UKDA 1Z3IX 4US0R 3OIUA 3GLFB 3CWZA 1XPOA 2ZRAA 2ZM5A 4F93B 2V1UA 2MMCA 4C0SA 2RCNA 2REBA 3GJ6A 4LBWA 4OK3A 2GBLC 5JWRA 5DI9A 5EQTA 3MJHA 1KNXA 2VH5R 4JT4A 1E0KA 2GK7A 1YZUA 3K53A 4TLEA 4JLMA 3LLMA 4TT3A 4NYMQ 2IS6A 1SVWA 3FMPB 3LVRE 1XRJA 1PLLA 2PJRA 2YNMA 3NG1A 2W6JD 1ZUHA 4B71A 1T8UA 4Q1FA 3MUFA 2G1JA 4HZIA 2QT0A 3CF6R 4WXRA 2PH1A 2ZYWX 4LV5B 2QRZA 3WNBA 3RC8A 2G6BA 1E2HA 3DOEA 2B8TA 2REXB 4PSAA 1PVOA 4TYPA 2QAGA 1Z22A 2VSOA 4QHTA 3I5YA 1OYWA 1W5SA 1E2KA 4M9QA 2BMDA 4FMCF 2RGXA 3WNDA 4MKHA 1Z2CA 4PQRA 4B73A 3KXIA 3IBYA 4O3MA 2O52A 4JJZA 5IT5A 3TQCA 2MSDB 5GVSA 3QKRB 4NBSA 1D6JA 1RZ3A 1NJGA 1HQCA 1NI3A 2W2VA 3IEVA 1CR1A 4PAOA 2NO6A 4XTRA 4P31A 5G3ZA 4ZCLA 5TV2A 3AVUA 3PEYA 3AH8A 2FN4A 5GJWC 1CJTC 4EJSB 1E2JA 2ZSAA 3L43A 4D2IA 4DLWA 5FTNA 2BDTA 1VYUA 1KI8A 3NXSA 3C5CA 4JL6A 2XX3A 1WP9A 1XZPA 1XPUA 4FD2A 2D74A 1JEDA 1DG3A 1JNYA 2QI9C 2ZJAA 2JLXA 5EE1A 2QQ0A 2X1VA 3B78A 1KSJA 2DY1A 3B8HA 3IO5A 3DZDA 1T3SA 5EXPA 3H0KA 3FTQA 1Z6XA 1LVGA 1FFHA 4UNNA 1FUUA 5KDOA 4DLUA 1E2MA 4RD0A 2F1HA 4TLDA 2C9OA 3W9YA 3CNOA 5JS7A 1IN4A 1KSHA 4WOPA 3REGA 2VLIA 4JBXA 4NCKA 1G41A 3MWJA 1E2IA 3KZ1E 3OIVA 4V02A 4XVRA 2A9KA 4UNRA 3VKWA 3DZ8A 2IYTA 1F2TA 2QSYA 3UMFA 4URUR 5KYKA 4V0LA 1BOFA 1U8ZA 2FU5C 2RAPA 1U94A 4PFSA 2H8KA 2ODBA 3RS2A 1ESMA 3K0FB 3MRSA 3CB4A 4Q1CA 2NPIA 2FNAA 1G21E 3NBXX 4D0GA 3GLHE 4DLTA 1QVRA 4NP6A 4QJ3A 1L8QA 1XMSA 1RRCA 5FOUA 2ZJYA 3C15C 3KFXA 1YZGA 2P2LA 2VBCA 4JYBA 1XX6A 2ZR9A 2CK3D 2FOLA 2H5EA 5BN3A 3OEED 1A4RA 4M22A 3WBKA 4EPRA 5EZ5A 1T4GA 4RZXA 4NDZA 1CEEA 1L4UA 3L2OB 1TAGA 3CNLA 4RD4A 1X3SA 1FNNA 1CBUA 3DOFA 4EPWA 1OFHA 1WXQA 4KLNA 5J4YA 1U2RA 1OIXA 3VR5A 1JB1A 1S9DA 1ELOA 5HE8A 1SKYB 1UDXA 2WJHA 3ZLJA 3E70C 2O0JA 1YR7A 3GFTA 4QJ4A 3U6KA 5J4LA 5FOTA 4Z1MA 4C0JA 3K9GA 5F9FA 1Z5ZA 4PAQA 1G5RA 3KKPA 5FTLA 3EPLA 1K5DA 2WKPA 3QY0A 2GJKA 4JLBA 1TF2A 4A36A 2BOVA 2VSXA 2A5FA 3PEWA 1RPZA 4CEIB 3BFXA 5LD2C 3THYA 4KODA 3DL0A 5HZKA 4QNRA 2BKUA 4FINA 1G6OA 1MOZA 2ZRHA 2FWRA 2ZS9A 4IDPA 4DVGA 2PX3A 1JEEA 4TWZA 2ZYUX 1H8ED 2AN9A 4BLOA 2C96A 4KBFA 3ASZA 4DCVA 1KDRA 2CCGA 3OFNA 4Q4JA 5E4FA 3NC0C 1HY3A 3B5JA 1AS0A 1DAIA 1KK0A 4M21A 3FFAA 4K81B 2ZRPA 4GZMA 4NHOA 4YDHB 3MGCA 4B47A 3SEAA 4TL6A 4JKYA 5M04A 4Q7MB 4O0MA 1OW3B 1T91A 4HSEA 3VFDA 1VG9B 2H17A 3IGFA 3U4QB 2QE7D 1FMLA 2OXRA 5EP4A 2EVWX 3OEHD 2GCOA 2WKQA 4KXFB 2W58A 4Q9JA 2ZAOA 3QOFA 4DB4A 1DAGA 2O8CA 1GP2A 5GJVC 1NLYA 3HWSA 2O8FB 2FFHA 1LNZA 4FMDB 4YLGA 1LB1B 1QF9A 2J5XA 1HE8B 4F4CA 2V3CC 1Z63A 1PLJA 1W2GA 1W36B 1ZU5A 2QE7A 1CLUA 1BS1A 1U8YA 1RYFA 1N6PA 4C0QC 3L8ZA 1HYQA 1XEWY 3IIJA 3NKVA 2BJVA 2CLDX 1IAQA 1ZM7A 4WIAA 4Q9KA 3AVPA 2Z5FA 4IW3B 3ZIAD 4CEHB 1AQUA 3Q8XB 4RD6A 3WYGA 4LHYA 4HB3A 1S1CA 5D3QA 4B2PA 2DYKA 3SE0A 1II0A 3B7GA 3QNUA 3R9XA 1XPRA 3SBDA 2F9MA 2FPLA 3P1JA 1Z06A 3LVQE 1IN7A 1FZQA 1XEXA 3EWSA 4LPKA 1I4LD 4LZZA 4Q1DA 5FUXA 4QBGB 2XXAA 4DCNA 1GITA 4PO9A 5JJLA 1GKIA 2CK3A 1NBMD 4HUQB 3AGQA 3I32A 4QGHA 1Z0IA 3GJ8A 1NLZA 4F38A 1XXHE 2GXSA 1S3GA 3PVSA 3ZYCA 2ZPTX 1I2DA 4AYTA 1NSFA 3D3QA 4LCBA 4EJSA 1T0HB 2GDJA 3AV0B 3IBGA 5LD2B 3K09A 1NKTA 1X6VA 5JJIA 3RRYA 2HJGA 3LA6A 5CM8B 2EFCB 4R7ZA 2BBSA 1OE0A 4TL7A 2CEAA 3EZ7A 3KQLA 3CPJB 1P2TA 2V6IA 1G20E 1GVNB 1N5IA 1NIJA 1S1MA 2JLUA 4PHHA 2PLRA 2VHUA 5KHOC 2UZ3A 2Z43A 4DHEA 2IYZA 3EPJA 2IXGA 3W90A 3U7HB 3X1YA 2QEQA 2I4IA 1GIAA 4D6PA 3RLFA 2XZOA 1KO7A 1RVDA 4RY2A 4JL5A 1KMQA 4N0EA 4YXWD 2ZJ8A 2DR3A 3B82A 1G7SA 3MCAA 4QXAA 5F3WB 2XGJA 4RVCA 721PA 1H8HD 4BRUA 1P61B 4II7A 2Q9CA 1T6NA 3W34A 2L0XA 3Q72A 3VQTA 1P7CA 1G4AE 2QM7A 3TQFA 3KXKA 3SC3A 2PEYA 3Q85A 5FBRB 5IDVA 2CLCX 1YR9A 1XD2B 3LW8A 1OH8A 4NCJA 2P67A 3TUJC 2CHGA 2PX0A 2VP9A 2QN6A 3IHLA 2VHJA 4A92A 1M7GA 4M1YA 4A82A 3K0CA 4TMZA 4AI6A 2AR7A 4NH0A 3ICEA 4DDVA 4D4KA 4L8GA 2CCJA 2WVJA 4CYMA 4ERNA 3FPAA 5B57C 1P9WA 1KDTA 5JEDA 3KX2A 4IRUB 1F60A 5BXQC 1E2QA 4KFSA 1W44A 4HAYA 1IY1A 4XIGS 621PA 1NF3A 1N3BA 4LJ6A 1HEIA 2WHXA 2JJ2D 2JEOA 4DWJA 3RWOA 4TMKA 4K46A 4B2LA 1NVXQ 3W3ZB 2BMEA 4G5QA 3SJAA 4EPXA 1M2OB 2FE4A 3BD9A 3N2EA 1KY2A 5KSZA 4DEXA 4WAUA 5EE5B 3QKUA 1NMZA 4JBYA 1ZIPA 3ZVMA 2QAJA 4G01B 3QPVA 2O8DA 2FX3A 1RJ9B 1NVVQ 5E7JA 3CONA 4A0FA 3KB2A 4CF7A 3UANA 5HKKD 3UKDA 4US2R 1GFIA 3A1VA 2VYFA 1FQKA 3WMGA 2ZI6A 2P6NA 4M1SA 3PUWA 1S96A 1ZD9A 3RS0A 2H92A 2Q3FA 2C04A 2ZSBA 4JLPA 2JLVA 1E2PA 2G0TA 1W49A 2A7QA 1F2UA 3EZFA 5EP3A 1M7BA 3AVYA 3LNCA 1KO5A 3KXLA 5FUVA 4PX9A 3WRXC 2NO0A 2GETA 1DAEA 4R9UC 2CE7A 2IXEA 3FMIA 1C4OA 1P2SA 4X8HA 2DFLA 1IN8A 1AKYA 2C9YA 3RDPA 4YMVA 3NHAA 2HDNB 4ZIRB 2C2HA 2IYRA 1KMHA 4FW9A 1GL9B 1JECA 1W2HA 2GCOB 4CT5A 3ADBA 4IFBA 2P6RA 1RRPA 1TX4B 3QVUA 4BFVA 2ZRIA 1SXJD 4ZKEA 1D2NA 1TQDA 1W46A 2EWVA 4L15A 3VR2A 1IOZA 2GAOA 1E2DA 3AVQA 3A1TA 1VCMA 4NPHA 3FWYA 1S9HA 2G3YA 4OHVA 2UVQA 1OH7A 2GA8A 2X19A 3JVVA 4BLRA 2Z4SA 1OXSC 5JZVA 1JQLB 1ZUIA 2QZ4A 4F91B 4BFWA 3A6PC 5KNCA 4MITA 3SFZA 1GRNA 2OCPA 2WBLC 4BEJA 1EESA 1UKEA 1V43A 2BKEA 3RWMB 3THWA 1DAKA 3PUVA 821PA 4YXWA 3TSWA 2IWHA 1BYUA 1COWD 3VR4A 3TKLA 4E5UA 1UF9A 1WDTA 2KBFA 3T06B 4PHGA 3HPRA 4KBGA 3H86A 3P4YA 3AUXA 3EZ2A 1N0WA 1US8B 3FMFA 2GRJA 4LHVA 5L3SB 2YWEA 1CULC 2EW1A 4HUQA 4M9XA 2GXAA 1W48A 2OCYC 3KJEA 3X1DA 4MYUA 2YWGA 1KK1A 4V0OA 1CRPA 1RJ9A 3QBTA 4GP7A 5G40A 3EC1A 2JJ2A 4V0ME 1X1RA 4PAMA 1ZC3A 1TQ6A 4TN1A 3SU8A 5TDHA 3O8RA 1E9BA 4WZBE 4MGZR 2JLRA 5E95A 2F3TA 5FI1B 1K5GA 1GZSA 2C77A 2EWWA 3EARA 4OHYA 2ZSEA 3T1VA 3I1FA 1E1RA 3SR0A 1BKDR 2A78A 1KK2A 2PMDA 1YZQA 1VMAA 1GUAA 1HTWA 3MWYW 1HT1E 2YKGA 1TQ4A 3BB1A 3BAFA 2R6DA 5FUYA 3I72A 4BLQA 4DJTA 2G1KA 2E87A 2LCFA 2VP4A 2F3RA 4QC2A 1AKEA 1LS6A 4TQUS 1KSFX 4D80A 3V4RA 1ZM3A 2GEVA 1N2CE 1E94E 1UBEA 3B2EA 1T8TA 4KHZA 3U7GA 3OF5A 2XEXA 1D2MA 4GPTA 1AA9A 2ASEA 4S2EA 4BFSA 2IHYA 2QGZA 2B21A 4HZUA 3AKEA 3ZS8A 5EJEA 1W36C 3RS7A 2ZETA 3G0HA 3V00A 4LHZA 1P62B 4TZ6A 1N6NA 5CM9C 2BMJA 3U2QA 2FMXA 2GESA 5FPTA 3GLIB 2EYUA 3TNFA 3F3YA 5DO9A 3WYFA 2RGBA 3TMKA 5CIQA 4UQOA 1HE1C 2CVFA 4GDFA 1YR6A 1ZINA 3MG9A 2O5VA 3SJCA 2XNSA 1Z0FA 2FJUA 4QM7A 4C2UA 2I1VB 4C4PA 2R62A 3I8XA 1LS1A 2C9CA 1Z08A 3VMFA 1CP2A 1G3QA 4B3XA 2A30A 1RC8A 4BFTA 2B92A 5BYKA 5L3SA 2J0SA 2PLFA 4MRNA 1HQYE 3FGNA 2UZIR 3BE4A 3E5HA 4TSFD 2IS4A 5JWHA 2CJWB 3QENA 5F9HA 2P0EA 3UG7A 4GRAA 3SYLA 5KSYA 4PZYA 4OI2A 1R0YA 1E0AA 2X8AA 2OM2A 3MJRA 4GZLA 4TTRA 4JLOA 4OHWA 3F0TA 2J7PD 2NOAA 3QPWA 3EIHA 1T5IA 2JJ1A 2X2EA 4UKDA 1W5TA 1J90A 1DO2A 3ADCA 4B75A 1VPLA 3QJYA 5CDFA 1SXJA 4GSYA 1VG8A 4NYJQ 3OIYA 3Q3JB 1II8A 3ZGXA 3TGPA 2QAGC 4AYXA 1OV4A 1VG1A 3UMRA 2ZUBA 3NBFA 5FL7A 3NBZC 1VCIA 2QPTA 4D25A 4LHXA 4A0RA 4DT1B 2ZROA 2IEYA 4UJ3A 1DVRA 1OHHA 3CR7A 4LX0A 5FTKA 1Q3TA 5AJYA 3M6AA 1WF3A 5GADl 3F5FA 3UATA 1CS4C 4LV8B 1J99A 4Q21A 2RHMA 1W0KD 2ANCA 2IEZA 5A0FA 4QM6A 1ZYUA 4Q4AB 1WRBA 3C14C 2NG1A 3V9PA 1AZTA 2ZVQX 1IXZA 3RS5A 4NYIR 2JDIA 1G8PA 2ZRKA 4QGFA 2DWPA 4JIMA 4D82A 1DE0A 2R6CA 4EFMA 4AG5A 1G7TA 1TNDA 3LQQA 4URVR 1OH6A 1W4RA 1ZIOA 2QQEA 2G0NA 5CLLA 1KHTA 1G3MA 2CL0X 4ZI2A 4A1FA 1MH1A 5C46F 2AK2A 1K6MA 4HLQB 2AXPA 1KI1A 4WA7A 1GL6A 1M1YE 3CRVA 3NDPA 3WHKA 5J4HA 5JLJA 4TLAA 2P65A 2OHFA 4W5WA 3THWB 1SULA 2IYQA 3A4MA 5CJ2A 2HJVA 4JSYA 1DARA 1TU3A 1YR8A 1XD9A 1W7AA 4LJ8A 4B35A 3GLIA 4FI3C 4M1KA 1XD8A 2FPMA 3IDQA 4X8MA 2AKYA 4BZXA 1IN5A 4XWOA 2H57A 2PT5A 4ZCIA 3PXGA 2F9LA 2TMKA 2QM8A 1E69A 1U9IC 2HT1A 2VEDA 4FWTA 1XTKA 1Z6TA 4C0AC 5BW8A 4OI0A 4MUAA 5HE9A 3L0OA 1R5OA 2IYXA 1NKSA 1Z0KA 1N5JA 2SHKA 2ZI5A 2W6JA 5BWMA 3D31A 2WZQA 3HR8A 2ZAMA 4HLUC 1N25A 2EFEB 4OQXA 2NO7A 3PENA 1U0HC 2IW3A 4ZV4A 3N5CA 5DSZA 2RGCA 4DLYA 2FPKA 1OJLA 1P9NA 1FTNA 4PXAA 4A6XA 1Z0AA 2IXFA 3PUYA 4XSHA 3SS8A 4E09A 1Q1BA 2HXSA 3KKNA 4JKIA 5DHAA 2OFWA 4IXMA 1KO4A 5BN4A 4N0DA 1QHSA 4MRVA 2FG5A 4DRZA 2HCBA 1KNQA 1QHHA 5KTYA 1A1VA 4H1UA 1GNRA 3OAAA 4QBFA 3WP1B 5CK5A 1YZKA 4B33A 1EK0A 2ZYTX 1VHLA 5IHPA 2C95A 2J1LA 3TSOA 3U44B 1E9FA 1FNMA 3K70B 1KSGA 3LY5A 4POAA 4Z8YA 1KIMA 3GEHA 3QF7A 3DVLA 4B43A 2P6UA 5FTJA 2OG2A 5A4JA 4EAQA 4QG7A 4A0HA 1QG4A 2IL1A 3EA0A 4QKQA 5FOSA 3ZZTA 2IUSA 2AXNA 1UKZA 5HTKA 1MO5A 5TVKA 3ECCA 3WY9A 3PG5A 5CITA 1OYYA 3EPHA 3QXSA 1FPMA 5JS8A 1N6RA 3C7KA 2Q3HA 4QNMA 2QL6A 4ZDJA 2J7PA 2BMFA 5FBQB 5AWFC 3TW8B 4G1UC 3K70C 3R8CA 3Q5EA 1W0KA 3MSXA 2RB4A 4LY6A 1Z29A 5KPJA 2FF7A 3FVQA 4M2LA 3SHWA 5JECA 3QBVA 2OFOA 5KNDA 3PV0A 3EC2A 3FB4A 1W4AA 4W7SA 5LBIA 1VIYA 2ZRMA 2ZUDA 1O3YA 1OH5A 3L0IB 4JBWA 3K9HA 2D4HA 1J70A 3DO6A 4JT2A 4PC2A 3P4XA 1SKQA 5FPSA 1V5WA 1XZQA 4IDNA 1EG7A 1ZCAA 3MAAC 4V0KA 4DLRA 2ZJZA 3B13B 3NH9A 4XH9B 4BGDA 2BC9A 3NEJA 1S4QA 1S2MA 1MO6A 4IKEA 1HA3A 2N46A 2I1QA 1HT2E 2WKRA 2HF8A 2PJZA 2F7SA 2YWHA 3CX6A 3GCGA 4Z51A 2F1IA 1UBCA 3X1ZA 4JLKA 4BUJA 3LW7A 4TT3D 4BLSA 2C98A 5FBLB 1DBSA 2PEZA 4DCTA 2IS1A 2J0UA 2QT1A 1BH2A 1DAHA 4PO8A 1TADA 4CEJA 5JCZA 1H8EA 5H8WA 4KFTA 1II8B 4U7DA 2XSZD 4JLJA 5DHFA 4W5HA 1E9SA 1KI3A 4IDOA 5G3YA 2RGEA 1EGAA 1UEJA 3AUYA 3WXMA 1P6XA 2GF0A 3IEUA 4YONB 1XTSA 2BIFA 3GJ4A 2YINC 4I99A 3SHFA 4EFLA 3LH5A 4UNSA 3C4JA 5CIWA 2YC2C 1Q1ZA 3SOPA 1DS6A 3WP0A 1XEWX 3BOSA 4XJXA 4P0TA 4Q1EA 5DIFA 1E2NA 1Y3AA 3EXAA 4EPVA 3B6EA 2EFHB 3QPUA 4M9SA 1WMSA 2MSCB 5FBWB 4NMMA 1ZBDA 5J4KA 2Q9BA 1CJVC 2AFHE 3LBIA 1UDWA 2ZYVX 2ZXUA 4Z54A 2ZJBA 4I81A 4UNPA 4M4SA 1U8AA 5DH9A 2Z4RA 5JI2E 4HDQB 1N5KA 5FOVA 2WMOB 4LC1A 4ZPXA 5FOWA 4AG6A 2VHCA 1VHTA 2P5SA 4DIEA 1DELA 2FSFA 3FKQA 1GSIA 3OAAD 1IXRC 4LYJA 5GJCA 4C9BA 3N2IA 1YU9A 4ZO4A 3Q9LA 1IXSB 4M53A 3GLIE 1IBRA 3SNHA 1JJVA 3SYNA 2R8RA 1P73A 1SGWA 4KFUA 3QXXA 4KV9A 3T35A 5P21A 1WE2A 4DCUA 3W6NA 4AC9A 2R6AA 3DHWC 4KI0A 3TR5A 2JLWA 2BEJA 2GHIA 4NCIA 1MABA 4A2WA 4CGZA 1G7RA 2OT3B 2XZLA 4C7OA 4R2IA 4MYHA 3QXJA 4UXHA 4TL9A 4OQLA 4G5SA 4FXPA 4DB2A 2NIPA 2WJVA 4QHYA 4TTPA 1EX6A 1NVUQ 5G41A 4C0KA 1IJEA 1E79D 4ABYA 2GEDA 5HPYB 4BZPA 4LI0A 2QBYA 1Q21A 1YHNA 2ZJ5A 3HJNA 4HLUA 5KDLA 4C0LA 2HCJB 2WIBA 1E0SA 2WV9A 3AF1A 4IFEA 4ON9A 4W5JA 4EKDA 3VU9B 1XP8A 2KBEA 3PUZA 1D5CA 2ZS7A 1J2JA 4P4TA 2OBLA 2ZUCA 3IQXA 1RFLA 2A5YB 2YWFA 2AHOA 3I8SA 1E79A 5UKDA 4PC6A 4MGIR 2IWRA 1ZD1A 4Q4HB 3SDZA 3AKCA 4Z8XA 2ERXA 2QA5A 1E2FA 1H8HA 2WJIA 4U00A 4JLAA 5HCNA 2GAAA 5C4MA 4C3ZA 1R7RA 4FMCB 4B48A 4PZZA 1NY5A 4QFMA 1UKVY 3UIEA 2HF9A 4A2QA 2R9VA 4LGMA 3RVBA 2CDNA 1MKYA 2QTVB 2XTZA 2AWOA 3K0FA 3K0EA 3WBJA 4HLDA 1ZMXA 1P60A 1OLOA 4HAXA 4LJ5A 3V4FA 2VF7A 3GQBA 5DI3B 3KB1A 4DSNA 2C99A 4GBMA 4ILEA 1VKJA 4R98A 1OIVA 1ZD8A 2RGGA 4NCHA 3CIOA 4G5OA 2BCGY 3O47A 1XB2A 2FSGA 2QPOA 2J87A 5FH9A 3IIMA 3QUSA 4DLSA 3L8YA 1FMJA 2GKSA 3GJXC 3CLVA 5DN6A 2ATVA 2J59A 5CB6A 2J0QA 4RZUA 2XSZA 1CXZA 5DE3A 2VF8A 2EYQA 4A8JC 2ERYA 1NL3A 4I1SA 2GVDC 1MR3F 2XB2A 3M0EA 2GZAA 3R8FA 3UK6A 4Y0AA 2RGNA 4QBIA 3RS3A 4DSOA 1G4UR 1VCOA 1OSNA 4B44A 4EUNA 2LKDA 2A3RA 2DFKB 5TY0A 3REFA 2ZRJA 5SZKB 1FQJA 4JLDA 1NY6A 1PUJA 1BMFD 5JSZB 5FL3A 3K8YA 1NRJB 3GLGA 5EE3A 3R7WA 3H84A 4MKFA 5IF9A 2ZREA 4AKIA 1AM4D 2BEKA 1R10A 1G5TA 1N6KA 2IK8A 3L0PA 3OEHA 4ESHA 2G9NA 3KDSE 3I4LA 1S8FA 1XEFA 1RW4A 1W0JD 4XWAA 4IXNA 4NONA 2AK3A 2AD5A 3OE7D 3G82C 3FFBA 2J46A 1NN1A 2LWIA 1KO8A 2G83A 4DKXA 2ZRNA 1E9EA 2R65A 5TXGA 3U3MA 4AWXA 1M74A 2I3BA 2NQ2C 1I2MA 4O2LA 3TUIC 4F7WA 3ZD7A 3FMOB 3GEEA 3EASA 2OSBA 1EFRA 4IHQA 5FBVB 5J47A 3I61A 4HEJA 4I4LA 1UPTA 1OXVA 1HV8A 3IUYA 2YHSA 421PA 3K1JA 1OXXK 2E1RA 5EE0A 1BYIA 3PIRA 1G3IA 5FTMA 1E1QA 4BFXA 2VRWA 3DEFA 1TEXA 3NTUA 2WJYA 4JVSB 3BORA 2RMKA 1GKUB 3U3KA 4OJQA 5L3QB 5LDDC 4AKEA 5E3HA 3LD9A 3VAAA 5KO2A 4LDJA 4XVQA 2OE2A 1E4VA 4MYCA 4TMVA 4B3CA 3TUZC 2PT7A 4KFRA 3CX7A 1Z0DA 1TEVA 1P4SA 1ZM9A 4CEHA 1ESNA 1XBTA 2EQBA 1QG2A 2IF0A 3EG5A 4OQFA 1IY0A 5IK2A 1N6HA 3OESA 4A8JB 5A5GA 4Q7JB 1NJFA 2JJ1D 4PPFA 2H7VA 1U0JA 4KU4A 3PR1A 1TUIA 1L2TA 5CLQA 4FMDF 3FYHA 5JFGA 4NKRA 1RRGA 1SVMA 2NO9A 3CO5A 1VDZA 4DLZA 2XXAB 2WSMA 1FW6A 3BK7A 4E07A 1L7VC 1YZNA 2HUPA 1IM2A 2F55A 1MABB 2WPDA 4URWR 4HB4A 4CEIA 2AKAB 4FCWA 3H1TA 3IQWA 4DSUA 2BHRA 4B34A 1N5LA 4TLCA 121PA 2D7DA 3Q7PA 4MKGA 2GBLA 2QTFA 3TW4A 4B6FA 2WSSA 4L9WA 3B1YA 2OILA 4GNKA 1I4DD 4ZDIA 4DCSA 1YZLA 3GLGB 2QP3A 3LX8A 4U5XA 1SXJE 4ASUA 4OQNA 1TF5A 5EP2A 1YQTA 3VU9A 4Z1MD 2J45A 4AK9A 4FCVA 5C2JB 3FE2A 4BRWA 3K0SA 1VG0B 4A6PA 1AZSC 2ZI9A 1Z2AA 4LSGA 4UJ5A 1FTSA 4HB0A 2ZU0C 2PZEA 3T5DA 2J9RA 3AEZA 1R5NA 4QL3A 3U60B 1KI2A 1PZNA 3LAWA 4RZ3A 2GCPA 4DEYA 2XITA 3C41J 1OT3A 3LWNA 5K8LA 1TF7A 1IONA 1DO0A 3A8TA 1QVAA 5K8IA 3RSOA 2QMEA 2IYSA 2JIZD 2HXYA 1ZM4A 3KUCA 3LBNA 1XU4A 4I1VA 1Q12A 3I5XA 1X8JA 4Q4LA 3RS4A 4LWZA 4Q1BA 4TL8A 4KITB 2OV2A 3O8BA 3QG1A 1EFRD 3JZAA 3VR1A 4AURA 3DMDA 3NC1C 5FUWA 1Z28A 4MH0R 1NIPA 5LPNA 1CTQA 2OUKA 2J41A 3KTAA 4YC7A 2OXCA 1AJEA 1W1WA 3HDTA 3W3AA 4BQSA 2WWFA 3L82B 4LYFA 1N0VC 3TBKA 3MLEA 3DM9B 3LX5A 1XEXB 4TZ0A 1TTTA 1ZNWA 1X8LA 3QVVA 4B74A 1TQ2A 4EQ6B 2DWQA 1ZNYA 3HR7A 1P5ZB 1DOAA 5HZHA 1E1QD 1E4YA 4PSVA 4D4MA 2DPXA 4D0NA 1SZPA 1XMJA 4U02A 1JR3D 4D0LB 2WMNB 4LJ4A 1KI6A 2RGDA 4GMXA 4RD1A 2IYYA 4DLXA 3SQXA 1T9HA 4TYYA 5L3QA 2JLSA 2IYLD 4WXPA 3BIFA 1VIAA 4KSBA 3T1QA 3I73A 1FP6A 3PCRB 2BBTA 1WB9A 3KQKA 5J5CA 5JSZA 3RAPR 4TYWA 3QEOA 1ZW6A 2O0HA 5JWOA 1EFUA 4W9MC 5ELXA 4XWKA 1KDPA 2PCJA 3C16C 5D3MB 2ZJOA 1XCGB 1QDEA 5FR2A 1TMKA 1WA5A 5JHGB 3VR6A 1XCPA 2YOGA 4IEIA 4WW0A 4US1R 5ANRB 1E9DA 2ORVA 5C4GB 1Q57A 2D7CA 2FGJA 4YMSA 2ORWA 2ZRCA 2R6FA 1ZUNB 1X1SA 2JLYA 1JPNA 1G8YA 2GF9A 2YV5A 4NYIQ 4RCYA 1W36D 3AP2A 1YRAA 4GFDA 3L0SA 3LRPA 1TUEA 1H65A 2A5DA 3VR3A 4RFSA 2BWJA 3PQCA 3THOA 3MMPA 4PZLA 5CJPA 2GNOA 2ECKA 3LXRA 1R0ZA 1I4TD 2HLDD 3WMEA 4ACBA 4Q9LA 3RANA 2RH5A 1XD2A 4FWIB 3WNCA 3LFUA 1NMYA 1EWQA 3CRMA 1F3OA 1O87A 4B6EA 5FL7D 2YJTD 1UM8A 3TSZA 1GDDA 1Y63A 1DEKA 4PHFA 4C0BA 4HB2A 1KK3A 5KPDA 3NHBA 1LW7A 5AJWA 3CBQA 2QPAA 1RE0A 1E3MA 3FOZA 1P2UA 1SVIA 2JCSA 2WAXA 3PITA 2BCJQ 4PANA 4A0GA 4ESVA 5F2EA 3AM1A 3KQUA 2RGNC 3BFKA 4XOIA 5DISB 1YJ5A 5SZIA 4M9ZA 3TR0A 2D06A 3QKTA 1NN3A 1Q0UA 1QZXA 4DDUA 2WSSD 1SVSA 2Z6VA 4PPGA 4A8JA 3T12A 2XZPA 3ZS9A 1DPFA 1QHYA 3CRRA 3AF3A 3SFVA 4DDWA 3X1XA 1E9AA 1PV4A 3BBPA 2X2FA 4EQ6A 4QGGA 4Q9HA 1G7CA 1US8A 1Q22A 3CPHA 4C0HA 4CRWB 2XOKD 3ND9A 1UKYA 2JGNA 2AX4A 3QKRA 2D2FA 5GJBA 2GK6A 3FHCB 3W8NA 2VP2A 3FHTA 1Q20A 2WOOA 4DIDA 1KI6B 1AQYA 2ZE5A 5DNYB 4KO8A 3AVWA 1LTQA 2Q0HA 2CNWD 1JR6A 5EXXA 2ONJA 4MGKR 2Z83A 4Q66C 1N6IA 2B7CA 3OE7A 5JHHB 3THYB 2ZRDA 4S35A 1UEIA 3U7FB 2IYUA 4DUGA 4J0QA 1WQ1R 2CL6X 4X8OA 1R2QA 1T0JB 4OQMA 1U90A 4LYHA 2GVZC 3LO5A 2O8EA 5E7MA 1E32A 2DCUA 5EXTA 3K9LA 4B3FX 4CZ2A 3QEJA 3HP1A 3C5HA 2HV8A 2D62A 5H70A 3K70D 3IIKA 2KJQA 2V4ZA 2ZSDA 3CNNA 4OJKA 3GEIA 3TK1A 4BE7B 1D8TA 1GNQA 5DLQC 4OI1A 1R5BA 1XTQA 4QOSA 2OAP1 1KOFA 1VECA 3CW2A 1NBME 1OXUA 1Q1EA 3DKPA 1L4YA 3CM0A 2ZRLA 2GJAA 2HYDA 2QORA 4DZZA 1Z6YA 3IPXA 1CIPA 1G16A 5KSPA 2GZHA 2HEIA 3SQWA 2ORIA 1N0UA 5BQ5A 4OI4A 1RRFA 1IJFA 1CJUC 3G5UA 4KCGA 4LBVA 2ODEA 3CPEA 4HZUB 2ZE8A 4KVAA 1ZNZA 3H4MA 3WYAA 2QG6A 1JJ7A 1GAJA 2FDCA 1AS2A 2A5GA 2V8OA 3FKSD 1KI7A 4XTCS 3AGPA 5E7IA 4MRRA 4L16A 2MMGA 2WWIA 3BB3A 1G5PA 1CR2A 3CWQA 1XJCA 3TLXA 2N1BA 2OFXA 3TVDA 1M6NA 1VTKA 1XMVA 1J7KA 2PBRA 2OLKA 2AL7A 5EZ6B 2A2ZA 3D8BA 4QBHA 4OK6A 1M7HA 2PL3A 1VYVA 3HU2A 1NG1A 4M1MA 5HR5A 4DXAA 1U81A 2YYZA 2AFIE 4P4SA 2ODNA 2W83A 2ZRGA 1BO6A 4OHZA 3WHLA 4B32A 3Q7QA 3VX3A 2W2XA 3BC1A 3CZQA 4KJZA 1GWNA 2WIAA 2WTUA 1MO4A 2ZRFA 4IOMA 1EX7A 4XD7D 1AS3A 2WPDD 1Z6GA 1ZAKA 1AK2A 4YQFA 3OEEA 4C2TA 1A2BA 2QRNA 2KI5A 3ZVRA 4GT1A 3S1AA 4RZ2A 4URYR 3QKSB 2BM1A 4I1UA 1CF4A 2ONKA 3AKDA 5D3MA 5FPYA 4MRSA 4NTZA 2Y8EA 1HUQA 4A9AA 4EPTA 1R0XA 2GJSA 4EIWA 3P20A 2B8WA 4Q4JB 3GFPA 1SXJB 4HAUA 5G53C 4QGAA 1NVWQ 3T34A 4ZDWA 2ZU6A 3I62A 1E0JA 4ACAA 2DBYA 1ZRHA 2DFNA 2NO1A 4OBEA 3VX4A 1KTVA 1NLFA 5C1BA 2ZEJA 2Q3MA 2CE2X 3VNVA 3U4QA 4D4JA 4RFSB 2CHVA 1R4AA 2CMKA 3EPKA 4AKGA 2AD1A 1U99A 3U3JA 4H9GA 2FFAA 4ZKDA 1AGRA 4IOKA 4WVFA 2O8CB 2CNWA 3MD0A 3CRW1 2O8FA 1FUKA 5JI3E 4GL2A 3JVUA 1Q44A 3C8UA 4JVNA 2V54A 1CJKC 1QHIA 1R8SA 1TL7C 2V1XA 3KUDA 4HAVA 4F4IA 1QHGA 2WJJA 2VP6A 3E2IA 4WZ6A 1XJ0A 3CF2A 1AN0A 3TH5A 1LY1A 1KO1A 2QSZA 2WOJA 2F1JA 3LV8A 3RRNA 4L9SA 4JLNA 2WWYA 4JSTA 1KYIA 4IOJA 4JS0A 3HU3A 4P33A 4PQYA 5B64A 3W5JA 3B1ZA 1A7JA 5SZJA 2EFGA 2ZS8A 1G19A 3GMTA 2ZR7A 2LKCA 1DAFA 3IKJA 1NVVR 4G5GA 4L4UA 4LOAA 5EE9A 1UADA 1B0UA 3B1XA 3QIAA 3VTKA 2ZANA 3OIWA 4LYAA 2O8BB 2R6GA 1ZM2A 4XVUA 3KJHA 2GZDA 5JCPA 1XCMA 2FFBA 2OZEA 1QHXA 2NGRA 2KSQA 2R44A 2CJWA 2GILA 4RJLA 3VKHA 4E03A 3BRWD 3EAQA 4IDQA 1P72A 4HUTA 1T5LA 3WRYC 4TSFA 2IUTA 3U5ZB 3AQ4A 2J7KA 2W00A 2C5LA 1X86B 4Q9IA 3K0AB 1G3RA 2IC5A 3NWJA 5EUQB 1NSTA 3QXHA 1JPJA 4PSKA 4N3NA 3GD7A 3QKSA 1GM5A 1F6BA 1G291 2QMHA 3ICQB 4GI7A 1GRQA 1KJWA 3FKSA 3RC3A 1SVKA 4CDGA 2QUZA 2F43B 3KL4A 1NN0A 3BJIC 1RIFA 1CR0A 1Z6AA 2GTPA 2IYWA 2YOFA 2Z0MA 2Q9AA 4TYQA 2O8EB 1JBKA 4NYJR 3ZVNA 4B3BA 2R2AA 1B23P 2G88A 1XTJA 1ODFA 1DADA 3UMSA 4H1VA 3U44A 2VHQA 2H18A 4O25A 1KMHB 3I92A 3RSLA 4RKFA 4NZYA 3ZQ6A 4RSGA 1KZGB 3ZQJA 5EXSA 3KJGA 3A4NA 3B1WA 1QBKC 2ZIAA 2ZI4A 3EW9A 2A5JA 2V7QA 3LDAA 4V0MA 1JQJC 3M1IA 2CHQA 4JVMA 4A4DA 1OF1A 5BYJA 2FSIA 2YZ2A 3IILA 2F6RA 3PUXA 3UG6A 3GLFE 4XD7A 4URZR 521PA 3VHLB 3KQNA 5JBQA 1WBBA 2C03A 3KKOA 3OZXA 5DYIA 3TVTA 1Q1QA 4ZI3A 3R20A 5KSOA 4LC0A 3QF4A 3CZPA 4AYWA 4Y0VA 4AIIA 3LXXA 1SKYE 4FN5A 1GL7A 2JDID 1XDBA 1DG1G 3X1WA 4PHTA 2ZTSA 1NG9A 4P4SB 2DFTA 5DGXA 4BFYA 1OPXA 4JLVA 3ZJYA 1YKSA 1N6LA 4YDSA 1GNPA 6Q21A 5DN6D 2VL7A 2O8DB 1KY3A 1JALA 2NTYC 3SBEA 2O8BA 4BPBA 5H1YA 3F8TA 3LBHA 1E2EA 4EDHA 1G8FA 4DUGD 1EWRA 2JJ8A 2P3SA 4PQFA 3T1OA 1OXTA 3D6TB 3S1AB 1A82A 2QMOA 1LV7A 5AJXA 1YRBA 3GLHB 4OHXA 5TB5A 1F2UB 4A2PA 1G9XA 1BMFA 2GEUA 3CH4B 4TMWA 1IQPA 1FX0A 4MQBA 1C9KA 2GXQA 2WM9B 4TMXA 4MDFA 1YZTA 4G0NA 4CEJB 2EU8A 4MYTA 2FFQA 2MSEB 1CRQA 2V9PA 2F43A 2OAQ1 2QNRA 3SN6A 2B6HA 3VHXA 4ZIRA 3KKQA 8OHMA 5JRJA 4IJMA 1SXJC 4CVNA 2QU8A 2IA5A 3T15A 3FHOA 3T1TA 5JEEA 1U98A 3THXA 5J40A 1Z47A 2FEOA 3LQRA 4DBLC 3MFYA 1EFTA 1HH4A 5AUPB 2VSFA 1W47A 4A15A 3BWDD 4TYNA 2QROA 3ZIAA 5EP1A 4Q7KA 2Q6TA 3AF4A 3EZ6A 2PZGA 2W2TA 2QY9A 4PTLA 1K8RA 4V0NA 1ANKA 1M8PA 3P27A 1GOTA 1PJRA 1Z0JA 1ZNXA 3TAUA 1N6OA 1ONBA 4R2HA 1Q3HA 4ITRC 3O8CA 1FP7A 4JL8A 3KQHA 4UXJA 3DKVA 4LRWA 4NCNA 1RKBA 4KVGA 3TRFA 2DB3A 3RNLA 1ZVQA 4M1TA 1P75A 4TMTA 2YOHA 3IO3A 4HAWA 1UBGA 3TE6A 1JAHA 1GKYA 4MA4A 5JRZA 3CUEF 2YVUA 1UBFA 2IX3A 4YMWA 3AVXA 2VP0A 4M0LA 2WWXA 5LB4A 1MT0A 5K8UA 3ZDQA 3NH6A 5B58C 3NBYC 3TIFA 1LF0A 1G3UA 3J81k 1VCNA 1CU1A 2OCBA 3SI7A 3N70A 3QG5A 2RGAA 3B9QA 1W4CA 4R71A 4B76A 5IK2D 4Q02A 2XAUA 4C7OB 1RYHA 4D81A 1NBMA 3H2YA 4K8OA 1GG2A 3R9WA 2WJGA 5L3VA 4QHSA 3FDIA 1OFIA 1XXHA 1LFDB 1M34E 2N42A 3U3RA 3NIBA 3K0AA 1P9RA 3A1SA 4JVLA 4NE2A 1ZC4A 4Q01A 3MWKA 2XNDA 2FEMA 3GLHA 3BS4A 2CL7X 2V7QD 2XTMA 3D7MA 5FPHA 5AUOB 3VNUA 2NPFA 1II9A 5AR1A 1DTSA 1OFUX 2WWWA 2GWHA 3O8DA 2QP4A 2O0KA 1TPZA 4PO1A 4X8LA 3PFIA 2JLZA 1QHNA 3RABA 1KGDA 1NNEA 2RKOA 4KSCA 4EFNA 4LPSA 2PMKA 3BH0A 4I1OA 4DT1A 4Q7LA 4AD8A 1R8QA 1WCV1 4OK5A 2OCAA 2JASA 4E22A 5CB8A 4M8NE 221PA 3GJ3A 4GOJA 1NP6A 1G18A 1ZP6A 4GP6A 3B1VA 3BH6A 3RRMA 2XOKA 3ZZ0A 4Q4AA 1E96A 2QGNA 1G8GA 3GJ0A 3QXCA 4IVRA 1KAOA 3AVOA 4LJ9A 5DI3A 3P26A 1KKMA 1BIFA 4BFZA 3QSYA 3GPLA 3BB4A 1G8HA 2JIZA 1AIPA 1A2KC 4AY2A 4LUCA 2NZ8A 2OESA 3EIEA 2IYVA 4Q48A 2ZI7A 2XB4A 1T3HA 2FSHA 2GJ9A 2H1LA 1KI9A 3QF4B 4Q19A 1EFCA 4KLZA 2BM0A 2VP5A 2V6JA 3RYTC 4P4UA 4UNQA 3BFVA 2IHBA 1JI0A 3EWAA 2GJ8A 5HKKA 2FZLA 4C30A 2D2EA 1F48A 2P5TB 5F98A 1XNJA 2DWOA 4FIDA 5AUQA 1KJZA 1WBDA 1E98A 1QRAA 2JA1A 2XJ4A 3AP1A 3ND8A 2C8VA 1D9XA 2BBOA 4NU0A 3QI2A 4P3YA 1DAMA 4JZKA 3PEUA 4LK2A 2ZVPX 4URXR 4HATA 4EPYA 3W8RA 2JATA 5KNBA 1JAIA 5HCIA 2ZRBA
chains in the Genus database with same CATH superfamily
3WWYA 2QBYB 2W0SA 5AK0A 1I01A 4BXOA 4ZOLF 2NT4A 2O59A 4UM5A 1RXEA 1TK9A 2BTQB 4MDEA 1NZDA 4QU8A 5FUMA 4JI4B 3A58B 4KXWA 4LJYA 4RHFA 4WNCA 4YJHA 3O1JC 1W0JA 4XEUA 3ZY2A 4YUYA 1XELA 2IF2A 3W2TA 1MZPA 4G36A 1PS9A 2XTNA 3T3MB 4AJ9A 3QRWA 1R4ZA 4Z1OA 1XNQB 2HA2A 1ZOPA 2R25B 1JN0A 3U4DA 4LYDA 3R9IA 3C39A 4RMJA 5FPPA 4Q4HA 2FMKA 3HU1A 2QN8A 3W1WA 1KVRA 2AN4A 3MOGA 4JA0A 4RK4A 1ECGA 1IBMB 1UFQA 3VAZA 3H8VA 4JXKA 4C05A 2R6HA 1HURA 3HYRA 4CIDA 2Q4EA 1BROA 3CLHA 1RJFA 3E3OA 3KPYA 5K45A 1OFUA 3D3JA 3JZMA 5LB2A 1A27A 4FOLA 4BV2A 2VJAA 1R8JA 3EG9B 3HN2A 2C4UA 5TNXA 4DW8A 1T9GS 2YMMA 5IARA 4PX5A 3THXB 3SJZA 4PZAA 1CNMA 3OTHA 3SSOA 2AWNA 5JALA 1E8NA 1TMYA 4CW7A 2X0RA 4EHDA 2FV8A 1PR1A 1Z83A 4JBGA 4RAQA 4U2CA 5TARA 3P52A 3EX7C 1QHFA 3PJRA 4P4LA 2C5BA 4AWAA 1SA0A 5CXXA 3LDFA 3A37A 4PV7A 2RDMA 4H7FA 1OLSB 2B4TO 2BVNA 3HE3A 1YRQA 1ZLXA 3H6GA 4KYUA 1F06A 3S1SA 2G77B 2GCNA 3BXOA 4FQ8A 4JIGA 1NKVA 2XY4A 1OHHD 3L8CA 4PPNA 1WUYA 3T7TA 5JYDA 3I6YA 2IPNA 5CVDA 5DHRA 2UZ4A 2G67A 1CE8B 1U8CB 2VHWA 5KCMA 3MMNA 1MDBA 5J4VA 1HPLA 3HHEA 4YRQA 4KRXA 2J3EA 1M5TA 1SHJA 3IV6A 5DHAA 3Q5DA 2RBEA 3LLUA 4AX8A 1X1AA 3TZEA 2AFVA 2ZE6A 1R12A 3EMVA 2GVNA 1UJ6A 5I7AA 4JLWA 1CY0A 3FCAA 4HDOB 1SU4A 4REQA 4ARZA 4DWVA 4GUDA 1KF0A 4A91A 4H4EA 5JMTA 2FH5B 4ZI5A 2C78A 4ZCMA 1OIWA 2VYVD 2DHRA 1O95D 3ADKA 2VTKA 3KFVA 4KYTA 2BJWA 3DBHB 5CM2Z 2EJCA 1S0UA 1KFEB 1OKKD 1UAYA 2RHOA 3B9PA 2IU0A 3TB6A 4G3XA 3WZ2A 4GM0A 2IXTA 1MC1A 4IZ6A 2PYIA 4ZAYA 5B2ZA 1JT9A 3AUAA 1YB4A 2F1RA 1MVLA 1AQNA 2LW7A 2OEPA 3PWZA 4BO8A 2YYSA 4GYWA 4UUQA 1U7TA 1WJGA 1XFAA 1XTIA 2GM9A 1BQ4A 2ZITA 4D4LA 3MTEA 3HPQA 2E9SA 1PRYA 2HT6A 4ZO8A 1SQSA 2ZJ2A 1MENA 3LYLA 4WVLA 2P79A 2V6FA 1QMPA 1U5CA 3CINA 3HSKA 5B1YA 4FLFA 3GV0A 4M8SA 4GMFA 3SDBA 3T5TA 5F7XA 4IAOA 4P5DA 5TMPA 2D8MA 1YNSA 2BZGA 3AKYA 4YMLA 5KU1A 2IP1A 3TQSA 4IJVA 1HLPA 1VBNA 1M2FA 4GOXA 1AGPA 4I9UA 1V16A 3G59A 1V6SA 3NIDB 3GLTA 1JXOA 3MA0A 4QTXA 4ESOA 2A4MA 2FSUA 2VHTA 4RJKA 1AHPA 1QYRA 4LHWA 1Y9JA 1QHHB 3UA3A 3SVTA 1S89A 1HFJA 4BNWA 3P9QA 3ONWA 3F9CA 4BASA 4G5RA 3WAKA 4HXYA 3PEVA 3RUIA 4V0QA 4QGBA 4Z9FA 2Z98A 4YJ2A 3ZVLA 3T5GA 4MKIA 2FEAA 5AJVB 5IH3A 1MHTA 2MSWA 3BZUA 1ILWA 2I7TA 3DMPA 1GYQA 2ZJ0A 3M6VA 3FF1A 4IVPA 3QBJA 4LJ7A 2B9EA 1E61A 1JEJA 3QE0A 1JXMA 3O4FA 5CYOA 1JHUA 4C6RA 3QVMA 3K09C 5IT4A 4XSGA 1CR4A 2GBIA 4EJSC 1QFSA 3FAZA 4Z7QB 1I1QB 4NPAA 4P7JA 1L7MA 2KYRA 3UUEA 3V8PA 3OT1A 4UW9A 5H4GA 1IBKB 3KL2A 3WMFA 2RAUA 3GBSA 3EA5A 3TI7A 4A0SA 2EFDB 3P0IA 1JWAB 3VR4H 4B87A 2OV1A 2KE5A 1P17A 3AWIA 5FR1A 1ZJ4A 1KTIA 4O0LA 1YE8A 4GICA 2VIIA 3BE8A 4I4TF 1MNQA 3RH0A 2P77A 2D4AA 1A5TA 1JV2B 4I3HA 2ZQ5A 3A1WA 1OYOA 1TT5B 2Q5JA 2QMUA 3DTYA 2CMGA 2I2WA 2K5UA 4N1AA 2NSJA 4FYWA 3IUMA 1P77A 2XTJA 1GUZA 2VDJA 2VXBA 3GJ7A 4HXGA 4JC0A 3ETLA 3S68A 3UWOA 3H9BA 5AVKA 3WLOA 4DIKA 3A2KA 2JLWA 3PL1A 3OM0A 4WBSA 2J4FA 2FA9A 4G25A 1OPRA 1R9JA 1YB5A 3I2HA 4JJKA 4PBSA 1XJQA 5CLJA 2OHVA 2QTMA 2HSJA 4FNMA 1NXQA 1XKLA 2GT1A 2YY5A 3OPQA 3RTBA 1PUXA 5EHIA 5C5EA 1QLWA 3N59A 5FPKA 4N76A 4Q05A 1EDOA 1KU6A 1JR3E 2ZE7A 1CCWA 2W90A 1A88A 1SCKA 1VPEA 4BCBA 3NEYA 2BGTA 3K1TA 1XZEA 2V55B 5CDUA 3DEZA 4DBZA 4IDDA 4E12A 4PM4A 4A27A 5KX5B 5HS6A 3WJ7A 5AUNB 1D9ZA 1VIDA 2X14A 2QF7A 3MRVA 4UXIA 2HWWA 5ERGB 4B3GA 2RHTA 2A0KA 4M1ZA 3X3HA 4BLTA 1XR3A 2O3QA 3REQB 2DJ5A 3VZCA 1D1QA 2Q3LA 2RHDA 4II3A 4RD3A 3MBIA 3ENVA 3L18A 4LBZA 2IXDA 3KAQA 1F7UA 1P18A 3FPEA 4IH1A 2WWHA 1BW9B 3MS2A 3UJ7A 2RAVA 4BNYA 2HQSA 3HTXA 4HNAA 4TTSA 2I33A 4KAJA 4MCAA 2WQ7A 1Q0ZA 3C6MA 1EFHA 1ETHA 2RC5A 3IMKA 3HKEA 4M83A 1OKKA 2C7BA 3OJOA 3BXZA 2LVBA 1DQZA 2P62A 2BDUA 1X1DA 4GL4A 5HUHA 2ZT7A 1F2TB 4UUBA 4BB6A 2X4DA 3KYIB 3ZD6A 3GP8A 4YCLA 2ZR0A 1C1YA 3MINB 4L8FA 4DWWA 4BMXA 3IAS6 5CR9A 1CD5A 3R5JA 5J5VA 3SJBA 1PQYA 5HFAA 1UQTA 3O74A 2G7MC 4J43A 2PZMA 3JRXA 2C31A 1MRNA 5B3JC 2RI0A 1K88A 2BR4A 2COEA 4DKJA 2CDRA 1EWYA 4GWKA 1V4BA 1T4CA 3FDZA 4ZANA 2REBA 3GJ6A 3L7DA 1J33A 4AVYA 2GBLC 5DI9A 1KNXA 1O8CA 4KVFA 1N2CB 4JT4A 2JCYA 3NNSA 1YZUA 1C29B 1CE8A 2XYHA 3K53A 4O4JA 4TLEA 4NYMQ 3TIVA 2IS6A 1LPBB 1XRJA 4GI1A 4RVGA 1PKXA 3GD5A 4KB5A 2W6JD 1ZUHA 4A8PA 1XAGA 5DYTA 4B71A 1T8UA 4Q1FA 4DOMA 3GNTA 1RNLA 2G1JA 3I9OA 4ZV9A 2W6MA 2HNBA 4L0QA 1K4KA 2C4WA 1QYXA 2BFWA 3WNBA 5A2GA 2CNKA 3OQMA 3INNA 4KUHA 2VSOA 1NUPA 4OV6B 3VZPA 2UXDB 1NTRA 3I5YA 1W5SA 4BMPB 4FMCF 4MKHA 1Z2CA 1QIIA 1LBSA 3EPRA 1XV5A 4UMVA 3BQMB 3QV2A 4KR7A 1FB5A 2V45A 5LP6F 2ZUFA 3QKRB 2C4TA 1K98A 4NBSA 1YJXA 2XI4A 1D6JA 1PKEA 1UXKA 1HQCA 2JAHA 1JEOA 2NO6A 3Q3VA 4MGEA 4R8LA 5G3ZA 5TV2A 4RPLA 5K6AA 3AVUA 3ZZMA 2O5EA 2BFOA 3NBQA 1E2JA 2OFPA 1ONSA 1NDQA 5EVJA 3DDNA 4M46A 5D3KA 3TAXA 4RORA 1QF6A 2XX3A 3S29A 3VH4A 3ED5A 3KT8A 4NENA 3INYA 1T3ZA 1GT6A 1JEDA 3H8JA 2H4WA 2DR2A 2JLXA 2ZJAA 2IXAA 3WGLA 1FQWA 5EE1A 4MVJF 4N0MA 1H1LB 4LE2A 2DY1A 1FP1D 3DZDA 1FMTA 1MVOA 3QVTA 1A77A 2HUNA 3FTQA 3WBBA 4ZAFA 1G38A 3DL7A 3B6ZA 3GRVA 2VAWA 4JCOA 1A9XA 1DZIA 4DLUA 1CUGA 1VI5A 4J90A 1GKKA 2C9OA 4TLDA 5FIUA 3CNOA 1TVCA 4PZ0A 1JDSA 3REGA 3UC5A 4E2ZA 2VLIA 4F04A 5BUCA 4LOLA 2BMVA 4JXJA 1UCFA 3KZ1E 3MXOA 4WKBA 1T9AA 1CUCA 4XVRA 3FPGA 2A9KA 2H4YA 1YOVA 2DTXA 5ELMA 2GBCA 1QJCA 2NVUB 3E8SA 5ULLA 2FWNA 2XGSA 5HQTA 4E14A 4B6JA 1JDVA 3HP4A 3ORSA 3VYWA 4V0LA 2FU5C 3F7NA 1NATA 1U94A 1RR6A 2FQWA 2RAPA 4PFSA 2C0PA 5ETJA 3UFXB 1RYMA 1HE3A 5L4SA 1QTNA 5B7QA 3JQFA 4NG5A 3DPSA 1Z35A 5KWIA 2XIJA 1FVXA 2NPIA 4JDUA 3KOYA 4QIHA 1QVRA 5D7NA 4PGMA 2IE0A 3FY4A 2XMCA 2COKA 5C3MA 4MPTA 5D86A 2XOXA 1XX6A 1M9NA 2CK3D 3V32A 1T34A 2H5EA 1M67A 1R5JA 4K6KA 1A4RA 2NYUA 3ES9A 5ES4B 4YYZA 3WBKA 2OC9A 3D5QA 4U39A 1RAFA 9LDBA 5CTAA 3CNLA 4RD4A 5DBEX 2Z9DA 3PWTA 1SOAA 3DOFA 4DARA 2VJLA 4KLNA 5CBPB 5J4YA 3HJUA 1NJ5A 3WGKA 4AF6A 3VR5A 4BAUA 5LQSA 1ELOA 1M2GA 1VE5A 1CFJA 1SKYB 3WKCA 3ZLJA 3UAVA 2TECE 3CC8A 3OO1A 4I9NA 2HO5A 4GW3A 4NQZA 4KC0A 4XARA 3RYCB 1Z75A 1WEHA 2BR3A 2EP7A 4YNBA 4EUKA 3ERCA 1H93A 5C3UA 3L07A 4PAQA 3SS9X 4N5MA 1NQXA 3S81A 3UMMA 5FTLA 3RSQA 4NG4A 3GAFA 4JQZA 3PZBA 1GGKA 1L3IA 3QY0A 2GJKA 3PTZA 1QFZA 4BN0A 3HABA 2XD9A 1CUAA 3AHCA 3ELYA 1GQYA 3VSEA 3QWHA 3PGA1 5CU7A 3JWEA 3DL0A 1OR8A 5JQGA 5KBYA 1NT2A 1T8YA 3OURA 4FINA 4MPPA 2A9OA 3THSA 1HGXA 2GZ2A 5K99A 3I04M 4ND1A 1VL0A 2IGTA 2CVQA 1GUYA 2I54A 1JEEA 1QO7A 4TWZA 3G9UA 4G2NA 5AK5A 1EWVA 1YBMA 4U0JA 3GDWA 4A23A 3ASZA 4QA9A 5JMWA 2GAFA 4MJ7A 3FSRA 3B5JA 5ALGA 3F49S 3V3KA 2H5LA 3GEBA 3FFAA 4K81B 4M21A 3ZKWB 5AVSA 3SFTA 3MGCA 1SBNE 3H6HA 1V3TA 2VJPA 1VMKA 2Y4NA 3I39X 2VPZA 3DXZA 4FOOA 4O0MA 3LCVB 1JBQA 1U63A 4HSEA 4P82A 4X84A 1FRVA 3KEGA 2PO7A 3KCQA 2FWAA 2HL6A 3MINA 2EVWX 3UB2A 2GCOA 1Q50A 4TRJA 2IUFA 4UE2A 2W58A 3H0CA 1GCIA 1K0FA 4Q9JA 2GD1O 4EHIA 3EEBA 3QOFA 4J3NA 4DR7B 4OFXA 1DAGA 3TS1A 1NLYA 3DULA 2ACKA 1ZAYA 1BSVA 2J5XA 2OXTA 1BHSA 3LHFA 4H77A 3ETGA 1XU7A 3L8ZA 1HYQA 1XEWY 3NKVA 4KMRA 2BJVA 3RGWS 1YZHA 3L8HA 2CLDX 1S4MA 5EXDA 2UVDA 3RKUA 4DABA 1YJBA 4G4GA 4NOMA 5LP6C 3WNQA 4WIAA 4Q9KA 5A06A 1I24A 5ARCA 2VUSA 2Z5FA 4KR3A 1VA5A 3MGAA 2X5OA 3H1GA 1SVNA 1UDRA 1AGYA 1YI1A 3QHAA 5ERYA 4FT4A 4E30A 5C7YA 2CF6A 1YFLA 2EGUA 4H08A 1Z36A 1VJ5A 1X77A 2W5UA 1J06A 4ZVNA 3SE0A 3ISVA 3QNUA 2J3IA 4UQPA 1ZUD1 2F9MA 2ZYIA 2FPLA 1E8DA 1NWHA 4BNZA 3ITEA 5DDIP 3TZQA 3EWSA 3HK2A 4N5NA 1HTBA 2C42A 5SYMA 3VR0A 5BOVA 5KTRA 4RZQA 4CHTA 1SUWA 3P8ZA 4INPA 1TKBA 2R7AA 3LKBA 4W6QA 1FJXA 1PGJA 5JJLA 1EX1A 1HKUA 4QGHA 1C1DB 1S7GA 1TEZA 1F4PA 5KC9A 1NLZA 2R2GA 1LRLA 1ZN7A 2OORA 2GXSA 1SCQA 1OUMA 2D0PB 2OBBA 3P0JA 1X80B 3R2JA 3WLNA 5C8YB 3EVZA 1NSFA 2IQIA 4LCBA 3RRBA 1Z5NA 1E6KA 2GDJA 3O92A 3RNOA 4W1SA 4A8HA 2KM1A 3FFWA 1YDGA 3G5LA 5CAEB 3K8QA 4EW6A 5IPFA 4QYXA 1K4MA 3LA6A 5CM8B 3H7IA 5CNKA 2FZWA 3CJRA 2DKOA 4POOA 1VMDA 2BBSA 2BUCA 3IUEA 1C9DB 4P7GA 1Z38A 2CEAA 3BWEA 3KQLA 2QOEA 2DT5A 1S1MA 3QEBZ 3IALA 2VHUA 3WIDA 3EAFA 5BMVF 3L46A 2Z43A 3D59A 1T2FA 2IYZA 3OPYB 5K0CA 3X1YA 2ZUEA 1ZVVA 4E32A 2I4IA 2OYCA 4C4AA 3TO5A 4CQNA 1NBOA 3TQIA 3RLFA 3DMTA 3H2ZA 2C1EA 2XE8A 1CQWA 4KIJA 1VB5A 2DR3A 2D5LA 3B82A 4CU5A 5DM2A 4YLYA 3CURA 4RVCA 4GG1A 2G08A 1CQIB 2NVUA 4N7BA 3FNFA 4RF2A 4EHFA 4O4HB 3W34A 1T4MA 1KA9H 4JYPA 5J63A 3QHPA 4AJOA 5MF6A 3C97A 2PAFA 3HYSA 3S28A 1SIBE 4UEJA 1SPBS 3L04A 4WINA 2QZJA 2CLCX 3IX7A 3A11A 3EQZA 1XQVA 1O95C 2UAGA 3KUXA 2QN6A 1QGAA 2VHJA 5D7BA 4PU0A 4M1YA 3PC2A 4H60A 5CPBA 4XWYA 3WNZA 3TZKA 2EX4A 1JHQA 3F2VA 1MRZA 2WU3A 1JIKA 4V0RA 1E6MA 1YS1X 1OTYA 3NO4A 1P0FA 1GNVA 4L8GA 4DDVA 2WVJA 3A3YA 1LSJA 3FPAA 3Q7RA 3ZV6A 5HWSA 4Y3UA 5IJ9A 4MK4A 4QUGA 4YRLA 3OQBA 1AXRA 4J0CA 4Y9SA 1DBQA 4HNUA 1LLCA 2GN6A 1VSQA 1ISRA 1W44A 2YJ5A 5I51A 1QP8A 3BPSA 4XIGS 4LJ6A 2JJ2D 2O2EA 1NONA 1W29A 4PSUA 3ZY4A 4OP2A 4DWJA 1JIQA 2W4IA 3C3BA 4RLFA 3G0DA 5I5GA 3A6KA 1PQPA 2C3PA 1QLHA 2HPZA 2BZ0A 1EFLA 2NUAB 5KYXA 1WOMA 3JWGA 1NMZA 3K6KA 2FCAA 2QAJA 3I2IA 4RGBA 3V2GA 5AKIA 3B2QA 2DM6A 3SX4A 1NVVQ 1SIUA 3M4XA 3R3YA 5HKKD 5AO9A 2WFZA 3RPEA 3U7JA 3WWOA 4Y6RA 5F73A 5BQPA 1PNTA 4MVCA 2ZAIA 1AZLA 3PUWA 3HUDA 5JZMA 2C04A 1H4QA 1QG6A 3L1HA 2JLVA 4ED9A 1GTRA 1E2PA 4CF6A 3OFKA 3QUBA 3ONNA 5CVCA 1QQAA 3OA0A 4AJHA 4BEWA 1RPNA 2PA3A 3KXLA 2NO0A 4UFOA 4P1ZA 4MVJE 3EZGA 1DAEA 3HL4A 4RVSA 1QK4A 3K94A 2CE7A 5EHZA 4HO1X 3ZHYA 1G2IA 3UHPA 2HIAA 5TMDA 4O2AF 4QXMA 1WZIA 1H2XA 1L5SA 1ORHA 1U2PA 4IHJA 4NH4A 1AKYA 1V3QE 2C9YA 2C3OA 2RI6A 2X9LA 3ZKWA 4DQVA 1NVBA 3NHAA 2FQXA 3ZCRA 4RABA 3BMNB 1EE9A 1TD1A 1ZH6A 4IGAA 4JI5B 1KPGA 2F64A 4XQ0A 1J0EA 1DWPA 3UGJA 4DJAA 3GGPA 4L0DA 1NMEA 4MV5A 4CQMB 2G28A 4NU8X 10MHA 2X7HA 1LWOA 3VSCA 1IZZA 1QAMA 1RM5A 1W2HA 2REQA 2GCOB 4LDQA 3VKVA 4CT5A 1ZONA 3R3HA 2P6RA 2Y9MB 4ND7A 4ADSG 1TC2A 3K8ZA 3QVUA 4KQXA 2QR5A 4C29A 4TUYF 4RK7A 2FEPA 2DZDA 1G20B 1SXJD 1BMQA 1D2NA 1TQDA 1W46A 2WJ6A 3H3XA 3HNOA 3PGXA 4ZKEA 3RGGA 3ZCVA 4UBNA 1IK6A 1QYVA 4FGZA 5KNCD 1ZH2A 1X0XA 4NPHA 4XGRA 2UVQA 2ISSD 1DPGA 1LVUA 5WRFA 2ZSKA 2GLUA 3JVVA 3DZIA 4M55A 4Z5XA 1ZUIA 4FE7A 3O91A 4ZQFA 5H02A 3ZI7A 4G56A 1FW8A 4ZRDA 5IYZA 3A6PC 4EELA 2OFFA 3SFZA 2BM9A 3PQEA 2BFEB 2WTNA 3TVYA 1BJTA 1VIVA 1G6Q1 3WRXA 821PA 3TSWA 4MCJA 4R83A 1GT91 1C3JA 1BYUA 2PV7A 3CG4A 3F6CA 2IWHA 3TKLA 1SB9A 4D3ZA 3FHJA 1XTTA 1YQGA 1E6EA 3U81A 3ZW7A 2A9RA 4CTNA 3HEBA 3VR6H 4RDIA 5EESA 4TTJA 4GPZA 2QW1A 4FFSA 2ACWA 2JD2A 4MAMA 2IFTA 2X0FA 1O0CA 3EZ2A 4G1EB 1J6UA 3P9YA 3WK8A 2IJGX 4G97A 2PUBA 1VXRA 1JQDA 4C4SA 1YHZA 4E5NA 4O59O 2HU7A 5AFSA 2EW1A 2IPOA 3PFFA 4M9XA 4KAFA 5KCZA 1VLZA 2EARA 1YB6A 3OKCA 3VPXA 3X1DA 1KK1A 4I4TB 4QD3A 3RUCA 5C8YA 4EGCB 4HVLA 4P53A 3QBTA 5G40A 6PFKA 1ZQ9A 2C5FA 1X1RA 5IZ4A 1Q17A 2Z2ZA 2WKSA 1JMYA 3EVDA 3VAYA 3ADOA 2GQ0A 1L5NA 4PZ9A 4TLLB 1TQ6A 3ZWVA 3CB2A 4MYRA 2X8WA 1FX1A 3S55A 4FYIA 3ZHQA 1E9BA 3BSSA 3RYIA 3LT4A 3O8RA 1X9GA 4OXNA 2QY6A 5JCJA 3QEMA 1GZSA 1D4ZA 1ODSA 4UMEA 4YAGA 4G23A 3FIUA 5IZCA 1U3GA 1HZZA 1PEKE 4PZPA 4Y9DA 5AKZA 3U1VA 3NHLA 1SD1A 3DV2A 3P9KA 4NXNB 3A9WA 4G24A 1G5HA 4LMBA 1C0KA 3Q2OA 1VMAA 5F64A 4D74A 1HTWA 1U7HA 5A4IS 3OOSA 2FOXA 3BKWA 5JIBA 4N12A 2EKPA 3BAFA 1Y80A 2AFRA 2R6DA 3AONB 5FUYA 3UHOA 4BLQA 3O26A 3PICA 3BZBA 1N9ZA 1GU7A 5HVNA 5BYAA 3UOWA 2IOHA 1KS2A 2ZW9A 1XEAA 3JQBC 3QWAA 4QC2A 5JVDB 5AW9A 1PN3A 3AETB 4MI6A 1ZOOA 1SCUA 1IZ9A 5JZSA 1KSFX 1LBTA 1SG0A 3VR5H 1E62A 1K1EA 4B3IA 3RJTA 3V4RA 4BUCA 1C9MA 3TOXA 2XODA 1C4WA 3F47A 3L6EA 3L7BA 4R1MA 2Y05A 3U7GA 1QGUA 4OUKX 5A0TA 4J7AA 5JD6A 1IHOA 3OF5A 1IRIA 1D2MA 1JYFA 7AT1A 3FOCA 4S2EA 1N2JA 2N0SA 4ARIA 1BDJA 1E5DA 5CDGA 2QTNA 1H0SA 2I6FA 5BSKA 7YASA 2IOQA 3L84A 1WKVA 2H7YA 2Q4TA 4JSRA 1KU0A 3NX4A 1PJ3A 1W36C 2A0UA 4G0OA 5BWLA 1VOTA 5C5IA 2YZKA 3FMGA 1N2XA 1T10A 3SF8A 1O08A 1GPWB 2VP3A 4R9VA 4RF3A 1R1DA 3AEUB 5FPTA 2O2SA 3IA7A 3EUEA 1QIMA 4G8DA 4ZGWA 2RGBA 4MVJH 3GRCA 2X2PA 3G89A 3NNDA 1JMKC 2GK4A 2B83A 1PZMA 3QU5A 1D2GA 2CVFA 1NVTA 2R6ZA 1CJSA 1YR6A 1ORRA 3KZOA 1RZRA 3VPCA 4C2UA 2I1VB 5KYXB 4C7MA 3I8XA 2C9CA 1GRVA 2ZTHA 1Z08A 3QMVA 1JL3A 2FW1A 2VTEA 4LDPA 3JAWA 4FGSA 5JCOA 4B3XA 1MB9A 2I62A 3SXPA 1Z37A 2A30A 1TK2A 2O1SA 4FFMA 4OH7A 1L5RA 1B7GO 3RAJA 3JQQA 5BYKA 5L3SA 2RJNA 3KOXA 1TYZA 4ZGGA 2C2WA 2UZIR 3FGNA 4KQKA 4Y2RA 2OV6A 4NBWA 2IS4A 5F9HA 1QC5B 2XBUA 5ER6A 4GC9A 1T5DX 5TT1A 4I0WB 5B2EA 3W5SA 4L5IA 1OZ0A 1DMSA 4MQFB 3LUBA 1JEAA 4L5CA 1NZJA 1FFGA 1FPQA 4GR5A 4N8DA 2GYUA 3AESA 3AI2A 4TTRA 5JSHA 2ZYAA 1W52X 1ZSYA 2FRDA 2AG1A 4JLOA 4OHWA 5D6OA 5E0OA 3EF3A 1DJOA 5MGBA 3SXUB 2ZTUA 1W5TA 1J90A 3TJMA 5BSEA 4I1PA 1UWKA 2AV6A 3ADCA 3B7PA 4B75A 3R44A 1N9GA 1VPLA 4DRYA 1KWKA 1SXJA 4GSYA 4DE5A 1JIXA 2QVLA 2ST1A 1TFUA 4HXEB 5HG0A 3F1LA 3BMNA 4D25A 5FL7A 3NBFA 1Y34E 4A0RA 3OZSA 3ANXA 2WD7B 1RHJA 4DNQA 4D8XA 5FTKA 3GZJA 1E7MA 3G7SA 4UBJA 4Y9RA 2A57A 2QX8A 2GGSA 3NATA 3TB4A 1EUDB 3N6VA 4NEQA 4UCWA 3K20A 3ABSB 5ALYA 4C4RA 1J99A 2XVAA 4TLMB 1MMFB 3AG5A 2IEZA 4RNDB 2VQ6A 1HZZC 2P2NA 1G20A 2G9UA 1ZYUA 2YS7A 1P7YA 3PYMA 4H1HA 4NFYA 2NG1A 5MHTA 3UT6A 2V3WA 2ZVQX 4F1WA 2ZRKA 3NJRA 4JIMA 3ZDYB 3IVRA 2R6CA 3GJQA 4BQEA 2TMDA 4EFMA 1TNDA 3GUCA 4N9WA 3H3FA 1TVMA 2BGMA 2PXXA 1W4RA 1ZIOA 1Z6ZA 4H0CA 3D54D 2G0NA 4IKPA 4E70A 2OAEA 1KHTA 4QREA 4BC1A 2B9VA 1PL6A 4BO5A 1XROA 4ZI2A 2XKKA 1Q7EA 5JYEA 3WADA 4HLQB 3GLUA 1MQ9A 1YRYE 5B36A 1KFCB 1M1YE 2XT9A 2XWSA 3AEKB 2OSVA 4HH4A 4M49A 4TLAA 3LVFO 5DXJA 2SECE 3WC4A 3IE1A 5EJ2A 1QRDA 2E5WA 2IYQA 2V58A 3A4MA 2Y9PB 2HJVA 2NO5A 3EGVA 3HBLA 4Y2JA 5F77A 3UK7A 1YR8A 2IIVA 3GLIA 1JG7A 4ZTUB 3UB3A 3VGJA 4PBRA 4ENQA 1C2YA 4WBNA 2NVOA 4QBKA 4XWOA 2Y0PA 4X5OA 3N8DA 3L4SO 4LIPD 1DCFA 3Q3IA 1WPRA 4X91A 3LCUA 4QLBA 1XTKA 3AYXB 4JT8A 1GQ2A 2HF7A 3EGXA 4C0AC 4QECA 4MUAA 1R9GA 3L0OA 4ZI7B 3FCSB 1B43A 3VPHA 1RT9A 4RC9A 2D1QA 4A5OA 1CV2A 1DC3A 1N5JA 2YXEA 2ZK7A 2F8SA 1WUHS 5IEBA 3SVLA 2I3AA 3EEFA 1NR1A 1S02A 1DEOA 1OAOA 1JF8A 3RU7A 3G8AA 1NWCA 5TF0A 2ZAMA 1ONPA 1N25A 3TNLA 4ZAWA 3EXEB 2FMIA 3IAAA 3IQGX 4OQXA 3JVIA 3N5CA 4Y2GA 5DSZA 2XYRA 1VJGA 3OWXA 2FPKA 2HBQA 4DLYA 3SLRA 3DFIA 1MAWA 3JQRA 4UVIA 2EAUA 4F6RA 5BR1A 2QTZA 4IXMA 5A9TA 5C51B 4U8GA 3KSDO 1KO4A 2IYAA 4B31A 4YRGA 2PNFA 3N9IA 2UYYA 3DBIA 3DUWA 3PXAA 5AXCA 3IHKA 1I1HA 4INJA 4NPCA 1G6KA 2EW8A 1C0IA 2ZBPA 1OAKA 2PUVA 1GPLA 4FHEA 4MOWA 1YE3A 4QBFA 1YZKA 4DR5B 5E8RA 3AILA 3VHXB 4K9MA 1OXMA 1ZGBA 2FVYA 3AFGA 4RYLA 1IEQA 4JDPA 4B7AA 3EMKA 4OXQA 4DL9A 3L1KA 3FYDA 2VBGA 4G4SO 3DGEC 3QF7A 2YV2A 8ABPA 2C4HA 1WCIB 2UVPA 3BVPA 3WB2A 5FWDA 3KKLA 1I5RA 5A4JA 1X8XA 3RHZA 4QG7A 1EE1A 1XVAA 3GXOA 3EA0A 3SBXA 1JG1A 3LTEA 4UUOA 3NPAA 4L95C 4AXBA 4GX2A 1FDRA 4OGFA 1UKZA 3D6JA 4DA7A 1TIPA 1ADJA 2CXNA 1MO5A 2FQYA 1DTEA 3B1KA 4RACA 1P1JA 3ECCA 3JX9A 4CWAA 5CITA 1OLUA 3EFHA 3JZIA 5JS8A 1EJ2A 2MIIA 2QLJA 3OX2A 3FCOA 1L7OA 4M0CA 2G9VA 4QNMA 4ZN6A 3GLKA 4YDQA 3KCNA 2NUTB 2J7PA 2BMFA 4HDKA 5FBQB 4ZRNA 3ZGYA 2VSQA 1JT2A 4G1UC 1QPBA 1SWVA 3PF9A 3Q5EA 1AE1A 1V8DA 4D6XA 1L4MA 2RB4A 3JQ9C 2QNBA 3LC7O 2ZYRA 2VDOB 3QVGB 1A2OA 4XPZA 1J2TA 5JECA 2IZZA 3QBVA 1GPNA 2OFOA 3PJDA 1Y6JA 3NM6B 4IUBS 3T9DA 5FEUA 3FB4A 1I3KA 2B35A 2DLNA 3Q4GA 2PSJA 1YAHA 1XIVA 3JQPA 4P36A 3H1FA 4ZOQI 5IWAB 1O3YA 4KR2A 1MA0A 2JAPA 2AX3A 2F1KA 2D4HA 2R85A 4EFDA 5IDWA 1FVFA 3EGCA 4YV2A 3R76A 2G4VA 2NACA 2VJOA 3P4XA 1SKQA 2P27A 3NTVA 4JN6B 1V5WA 3WV5A 3OOYA 2C83A 1EG7A 2XUGA 1ZCAA 1BXKA 3T4PA 4CDMA 1QTRA 3NH9A 4P92A 4CJXA 3OCZA 3TFOA 2BGWA 3X44A 4B40A 2X3YA 1R27A 3WAGA 1QU3A 3WX0A 5KOHB 5JAPA 5FPQA 1I94B 2PJZA 2F7SA 1Y6GA 4HYEA 1UBCA 2WFLB 3CCCA 2XW6A 2ZSHA 4FONA 3VKUA 4YHHB 1FFXA 3V4SA 2HJHA 4LXGA 1GY8A 3BA1A 3JQAB 3T5PA 4RKWA 3D8HA 3S99A 3SXUA 4BLSA 3E82A 4FUQA 2LTAA 2ZIWB 2BE9A 1HOXA 3AHJA 1QO9A 2J0UA 1DAHA 1HLDA 3O9VA 2DFDA 4LYGA 4RIFA 5JCZA 1H8EA 1RBQA 1SCBA 2QG9A 1B6TA 2DHEA 5DHFA 5AKJA 4W5HA 2CL5A 1E9SA 1KI3A 4IDOA 5G3YA 5HF5A 1UZNA 2CVOA 1J7JA 1EGAA 5C7IO 3DMTC 4XA8A 3BRSA 3WXMA 2GF0A 1YO6A 3IEUA 4FEAA 1RAAA 4YRKA 2BJHA 3SHFA 2H6EA 3DWFA 1EUDA 2OO5C 4EFLA 3LH5A 2HIHA 1YC2A 5LFAA 2O3SA 2YC2C 1HT3A 4WK2B 3SOPA 3WWEA 2YL2A 3E8XA 4CMCA 3QE9Y 4NJMB 4FQ5A 3O2QB 3AF5A 1J5XA 1E5QA 1E2NA 1Y3AA 4GOOD 1UT8A 2H2AA 2XA1A 4DGSA 3RVLA 3G23A 5CT9A 1YASA 4WOJA 2WY2D 2WF5A 5IW8A 2EBHX 2MSCB 2ZKLA 4F2HA 1GPBA 4I9HA 3KT3A 1CJVC 4G65A 1XVTA 4KPUA 4XM0A 1H2WA 3SZUA 2ZXUA 1N2ZA 2PX8A 3UJ6A 2ZQZA 4I81A 3PUKA 4RVDA 4R8RA 2Q6LA 1N5KA 4GWGA 1J00A 2DUWA 5FOWA 4L4YA 5I7EA 5A02A 4RTSA 2OM6A 2VHEA 1DELA 3AEKA 3OO0A 4PFQA 4MHOA 4XX0B 5IJXA 3WRWA 5HTOA 3PZRA 2C7QA 1X7ZA 5DBOA 4ZPJA 1CDZA 2D1TA 2ZCVA 2ZUWA 4ZO4A 5EHGA 3KT6A 4F6CA 1IY8A 2JH8A 1JQBA 1E20A 1PW5A 4WN3A 2Y66A 3QYPA 1XTVA 1EB8A 2JGAA 4H7PA 3SNHA 1JJVA 2IDZA 1JU4A 3FI9A 3OZ7A 3ST7A 4HGPA 3V7WA 4KV9A 5L9AA 3VXKA 2X76A 3FZQA 4DCUA 1ADFA 2XWQA 5E6UB 3W6NA 2R6AA 3WWDA 3TR5A 3WWZA 2BEJA 2A14A 1JJFA 1DC6A 4ZI7A 3HGQA 2XMPA 2C88A 2NN3C 2H1WA 3QXJA 4C6HA 3VSBA 4DB2A 3JD2A 2WJVA 5KTPA 3K2QA 1MAUA 1DV1A 1QYDA 5G41A 1HSOA 4JJAA 3MFQA 4BV9A 1L5FA 5F1YA 1YHNA 2B1RA 3O8LA 3W5DA 1UBHS 2ZBGA 4FJ1A 3T9EA 1BC5A 2QYSA 5KDLA 4F5WA 1SEPA 1JDPA 3E5NA 4ON9A 1PDWA 3AF1A 3K96A 4QFBA 2BUBA 4R2XA 4RLHA 7REQB 2P5UA 1XP8A 2YW9A 3PUZA 4A03A 3ICWA 3N74A 4FGJA 4CKEB 1V95A 3IH5A 4GLJA 2B3DA 1RFLA 2H52A 2A5YB 2XKJE 2YWFA 1E79A 4FU0A 5LXTB 4PC6A 2D1FA 2OG1A 3CNQS 3U9TA 3I4FA 2IWRA 3SDZA 3UV6A 3AKCA 3WMXA 2AMYA 5B58T 2ERXA 3M6UA 4FHZA 1ZMBA 3KAPA 3L05A 2MT9A 4JLAA 5ADWA 5AKHA 1OTHA 1TEHA 1WMAA 4IMIB 4C3ZA 1R7RA 3LUFA 2HLPA 4MR8A 4Z7NB 4TVOA 2ID4A 1C2TA 3Q0EA 1NY5A 2PD6A 2HBYA 2HF9A 3UAGA 1H4VB 1LX7A 1ST2A 2O06A 4BVGA 1V37A 3N0TA 2CDNA 2I67A 4DM3A 1MKYA 3EEIA 2FHSA 3P96A 2IKQA 2JBAA 4HMQA 1NRXA 3K0FA 2E4XA 3OBIA 4OHMA 3UXHA 1T36B 4L3WA 4AXXA 4UUPA 4L3VA 2PMBA 1REQA 4PW0A 1OLOA 4LJ5A 4RY0A 2VF7A 4H7DA 4F97A 5E3JA 4Z2YA 1SXHA 3BILA 2E6KA 1NOKA 2ZXFA 4B7ZA 3QW2A 4ILEA 5KYWB 5JNLA 2OKGA 1ZD8A 3P45A 2R5NA 4BO0A 4NCHA 1TIBA 3MS4A 1PR0A 1V1RB 2Z09A 3K1AB 1AQJA 3WGTA 5JU6A 2EL7A 1UBUS 2JF0A 3IIMA 3ILVA 4HYTA 4RH1A 3V1TC 2VUHB 1P5RA 2P3LA 5I6DA 2GKSA 3CLVA 4WV3A 3F6BX 4J94A 1TJ3A 2NV6A 2JHFA 3U4CA