2IEYA

Crystal structure of mouse rab27b bound to gdp in hexagonal space group
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
164
Chain Sequence
GDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDFKVHLQLWDTSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 164
sequence length 182
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ieyA00
5FI1B 2FF7A 2WHXA 3GJ4A 1JI0A 4A82A 3LBIA 1YR6A 2A2ZA 1NN1A 2DWQA 3QSYA 4O3MA 1ZNZA 3BAFA 1AKEA 1PZNA 2D2EA 3U4QB 4XIGS 1ZP6A 3L0PA 4MDFA 3CRW1 3M0EA 1EX7A 3TBKA 1KYIA 4Q47A 2ZUCA 3C5CA 1E99A 3EC2A 4LJ7A 4KCGA 4GFDA 4DCSA 1KK3A 3U44B 4DCUA 3GLFA 2JLQA 3AEZA 3SBDA 3TJZA 2ZJZA 4Q4LA 4HDOB 1XCPA 4EAQA 2O0KA 4IDOA 5UKDA 2Q3MA 4E03A 1PUIA 2VIIA 3T1OA 4Q1AA 2JLRA 4B34A 4CGZA 1XD8A 3DZ8A 4O0MA 4TZ6A 1MABB 1VCOA 1LF0A 1SKYB 1SULA 4BLPA 3CRQA 5JFGA 1E4VA 3CR8A 5BW8A 4CDGA 1AQUA 2FJUA 2MSEB 3QF4A 4LWZA 3W8RA 1RZ3A 1TX4B 4QHTA 2K5UA 2YOFA 3C5HA 1KI7A 1W4RA 3ZDQA 3QXHA 3RWOA 2IK8A 4LCBA 3OEHD 1S9DA 1ZMXA 2GCOA 2CE7A 3C4JA 1R0YA 3BERA 5TY0A 4DLYA 4NHOA 4ACBA 1YZNA 3GD7A 1ZM9A 4TMTA 2XTNA 2NG1A 3OEHA 4A9AA 3A1VA 3VR5A 3Q8XB 4Q4AA 1LW7A 4PC2A 3MJRA 4RZUA 2WJIA 4XWAA 2ZS7A 2KE5A 2DFNA 5AUQA 1XCMA 4JLPA 5KSOA 5E7IA 4KFRA 1U9IA 2O8FB 2PEYA 4FWTA 1GRQA 5LPNA 4TYYA 2R2AA 4FW9A 5FBWB 1X8LA 2REOA 3LBNA 3D7MA 2P0EA 4Q21A 1EFRD 1YHNA 4CVNA 3E5HA 4HB0A 4FI3C 3RANA 1XZPA 4LI0A 5K8TA 1E0KA 4AK9A 2KI5A 4URWR 4HEJA 1MOZA 3EPHA 5G3ZA 2ZJAA 2KSQA 3AKEA 1IBRA 1S4QA 5HKKD 1EFRA 5JZVA 1Z28A 1E2HA 1QHSA 2J59A 3I92A 1WBDA 5HE9A 3LWNA 4B75A 2BC9A 2CNWD 3GJ0A 3UK6A 5HKKA 2E1RA 2DHRA 4ZIRA 4PO8A 1DG1G 1OFTA 1FX0A 2WOJA 2CHQA 1XTJA 4IOLA 4MYUA 2ZSBA 3AVQA 1P5ZB 4HLQB 3IDQA 5JSZB 2Z4RA 2PH1A 2CNWA 4PPGA 1KNQA 3Q5EA 3LLUA 3QKSA 1ONBA 1S96A 3A4NA 2KJQA 3RHFA 1FMLA 1KO5A 1MR3F 1E2EA 2CJWB 5G41A 2QRNA 3O8DA 2XNDD 3W6PA 2NMVA 1ZJ6A 2NZJA 2VHJA 3QEOA 4DXAA 2RKOA 2HT1A 3CPHA 2NPIA 2QM8A 3MFYA 2GF0A 1CRQA 3BWDD 5H1YA 2WWFA 1SVWA 2WPDD 5EE3A 2XNDA 1G6HA 1P60A 1VG1A 2CCGA 4GRAA 1XEXA 2QRZA 1GTVA 4RFSA 2LKCA 5BQ5A 1E0AA 1SHZA 1U90A 1AS3A 2IYZA 3DEFA 2WPDA 2AKAB 4R98A 3ZZ0A 5F3WB 3OF5A 4LBYA 5KU1A 2GZDA 1N3BA 4XTCS 5ELXA 3EXAA 4ZDWA 4M4SA 1ZD9A 5JEDA 5CK5A 5JWRA 1GKIA 2GEDA 2AFHE 3N5CA 4AKGA 2WMNB 5G53C 2V4ZA 4XJXA 1OV4A 2A5FA 2OZEA 2QROA 3UANA 1G41A 3T15A 3I32A 3LX5A 1E2FA 4KFSA 4F4IA 2O5VA 4HUQB 2KB0A 5B58C 1TF7A 4H9GA 3C41J 2YOGA 3NH9A 1WRBA 5KOYA 1TL7C 1P3JA 5J4LA 4C2UA 1AN0A 1X6VA 1S3SA 2FFAA 2A78A 2GJKA 1ETUA 2A5DA 4QGHA 1O3YA 2PMKA 3RDPA 3CW2A 3LQRA 4JYBA 3ICQB 1XTIA 3FKSD 1VYUA 4P0TA 2AXPA 4CEIB 2IEZA 2QG6A 5L3QB 4BWYA 2OCPA 4LC0A 1IAQA 1OPXA 3FKSA 2WWYA 5AUOB 2R9VA 4AC9A 3CNNA 5C2JB 3A36A 5A5GA 1EWQA 3JZAA 3LXRA 2QY9A 2ZRJA 3BH6A 4B73A 5IRCD 2QTHA 3N2EA 2VHTA 1KI6A 4MUBA 1G7RA 5SZIA 3CR7A 3ONWA 4NYMR 1VCMA 4M0LA 4OK6A 4B43A 1SXJD 1M74A 1G7CA 1II8B 2CL0X 3DMDA 3NWJA 1A2BA 2IYLD 1OXTA 3AP3A 3ADDA 1XP8A 4Q1FA 1JR6A 1A5TA 1D6JA 3D8BA 4WAUA 5JCPA 1DADA 1KI9A 1SXJA 2QMHA 2IYXA 1G19A 4C0KA 1WBBA 4RFVA 3SZRA 1BS1A 2EFHB 1GIAA 1XWIA 4LBWA 4BEJA 2J0UB 2V7QD 3IUYA 1BOFA 4KU4A 3P32A 4KO8A 2BV3A 4PFSA 3SYKA 4F4CA 1KZGB 3A1TA 4AKIA 4H1UA 2ZRPA 2GCNA 1T3LA 2WSSD 4JVMA 4HSEA 4Q19A 2V7QA 1F2UB 2GXUA 2RHMA 4HATA 4DKXA 1VIAA 1T4GA 1BO6A 3IO3A 3KXKA 521PA 3DDCA 2N46A 1A1VA 3L82B 1S9HA 3KXLA 5DO9A 4MUAA 4AURA 1YZGA 1NJFA 2A5YB 2WSSA 1XX6A 3OESA 1ZC3A 2ZU0C 4TQ9A 3TQFA 4NCNA 2Z4SA 2GNOA 3K9LA 3SI7A 2NO7A 3TK1A 3B1VA 4P4SA 2QZ4A 1WE2A 3SE0A 3UG6A 4BGDA 3LXXA 4YDHB 3SHFA 2IS1A 4LPKA 2QENA 4Q18A 4LDJA 1OYWA 2UZ3A 1N6RA 2DFKB 1G5TA 4BE7B 4FMCB 3ECCA 2IYYA 2RGXA 1OH5A 2KBEA 2KBFA 3THYB 1NY5A 5HZKA 5KSZA 3MWKA 4IW3B 2P6UA 1C9KA 2ZI6A 4OI0A 2O8CA 2ODWA 3KJGA 1TAGA 1N6NA 3T12A 1E2NA 2C9YA 1VHTA 2WZQA 4DEXA 4ZDKA 2QQ0A 2RH5A 4DLWA 1P4SA 4TL9A 4D4MA 3T1TA 4D0GA 2HF8A 3UXMA 3FMPB 1IN8A 2F6RA 2YC2C 3K0FB 3UMRA 3W3ZB 2G1KA 2J45A 2JLXA 1ZIOA 3KFXA 2ZAMA 4HDCA 3W3AA 2QAGC 3X1ZA 1CS4C 1KI3A 2J46A 4CF7A 2F7SA 1P9WA 1QZXA 1MV5A 4JLJA 5FL3A 4HLUA 3FOZA 2F9MA 4Q1BA 4AY2A 3WHLA 2B8WA 1XPUA 2REXB 4BASA 4Z1MD 3VFDA 4DCNA 5CLQA 3UWOA 5GADl 1XD2B 3NBXX 4Z1MA 1TPZA 4MKHA 4MITA 3SJCA 3PXGA 5DYIA 5CYOA 1R0XA 2VEDA 2HV8A 3P4YA 3EG5A 4CEHB 3M6AA 1G8GA 2ZI3A 1T0HB 2RGCA 4LJ9A 4OHVA 3RC3A 1YJ5A 2BBOA 2QEQA 1NVUQ 5E95A 1XTRA 3EZ9A 1N6IA 4HI0E 5E7JA 2ZUBA 2ZITA 2HXYA 2VA8A 4ESVA 4LHVA 2P5TB 2DB3A 3ZZTA 3EIHA 4OKSA 1AS2A 1KAOA 5CJ2A 4U7DA 2OHFA 3K0AB 2ODEA 1KO8A 3WYAA 4UNPA 5L8VA 2WAXA 4N0DA 4FCTA 2PZEA 4ARZB 4LJ5A 2IWHA 2P6RA 4LC1A 1NF3A 1HURA 1MT0A 3NIBA 4KODA 1ZBDA 3MLEA 3Q5DA 3V9PA 1L2TA 2P6NA 4BFXA 3IO5A 3ASZA 4LHWA 4YQFA 2X2EA 4TLEA 5J4YA 2DR3A 2RB4A 1Z2AA 5IDVA 5LBIA 2ZE7A 2GCPA 4PZLA 1N2CE 1YR9A 2XSZD 5DI3A 1JXMA 3QEJA 3FE2A 2GF9A 2J41A 3U60B 3KB1A 2VRWA 4FMCF 3GLGB 4UXJA 4NKRA 2OXCA 4JLMA 4UXHA 2XSZA 2BDTA 1U9IC 2PL3A 2J3EA 3OE7D 5L3VA 2QI9C 1RE0A 4KYUA 4N3NA 4MKIA 3EC1A 4XVRA 5HE8A 421PA 3KKNA 4UNRA 1I2DA 2DFLA 4GDFA 4TSFD 4MGZR 3B1XA 2GK7A 3OE7A 3CNLA 2E87A 2WJHA 2R62A 1F2TA 4UXIA 3VMFA 3EIQA 3EPLA 1Q1BA 1ZC4A 3QOFA 4PZYA 3RLFA 4TL8A 3X1WA 4HLDA 1W36D 2ZI4A 2VTKA 2VP5A 4JLKA 3H86A 4TSFA 4Z8XA 2V1XA 1GFIA 3WNCA 1T5LA 1ZU5A 2A30A 3L0IB 4EIWA 1MRNA 1TF5A 3CF6R 2PCLA 3S1AB 1SZPA 5IT5A 1QHNA 2YNMA 3AF2A 1WA5A 4DUGD 4Y0AA 1VHLA 2HDNB 1WDTA 4NDZA 1BMFD 3CUEF 1KI2A 1GP2A 4X8MA 3D31A 4C30A 1RPZA 1GWNA 2O8DB 3L0SA 3GEIA 5DE3A 2OCAA 4V0KA 1U81A 1UJ2A 2LWIA 1T0JB 3C15C 3I73A 3KTAA 2BMJA 3QBTA 1T3HA 3U3OA 4WVFA 2AD1A 4DUGA 3EX7C 1GUAA 1BMFA 1E1QD 4XVUA 1W0JD 2QMEA 1ZD8A 3ZIAD 1KJYA 4PPQA 1KMHA 1XMSA 4JLBA 1GRRA 4M2LA 1E1QA 4I1VA 3FHOA 3U6KA 3KQHA 1W0JA 1WF3A 2MSDB 1FMJA 3CRRA 2I1QA 3GMTA 4RKEA 2N1BA 3ZIAA 2DBYA 4Y0VA 1G21E 4LJAA 3HR7A 1G3QA 2H7VA 2R44A 4A2WA 1JALA 1XTQA 1LB1B 2IHYA 4GI7A 2ZI9A 2O8BB 4Q4HB 3QPVA 2ZROA 2X77A 2QP3A 4D2IA 1ZNYA 1YZQA 2C03A 2FZLA 5FPTA 1TU4A 4YLGA 1OIWA 2C04A 5FTMA 1ZINA 4CT4B 4JKYA 5EXTA 2ZM5A 3GJ5A 2G77B 4QBGB 1XJ0A 4HB3A 2GK6A 2ZYVX 3CKLA 2W00A 1I4LD 4QNMA 4IDPA 2VHCA 4BFUA 3X1DA 2VP2A 1UDXA 3AF4A 2QL6A 2ZYWX 5DYGA 5TVKA 4ZI3A 2ZJ5A 5AUNB 1DELA 5JMTA 2XZPA 5KYKA 4JIMA 2PX3A 1DE0A 2ZVQX 1JNYA 5FTLA 1F3OA 1XMIA 5CJPA 4N1AA 2V9PA 1TTTA 2Z43A 1P2SA 1QHHA 3B9PA 1OB5A 3QXCA 3TSOA 1Z3IX 3BK7A 1QHYA 1Q1EA 1OSNA 1ZAKA 2VF8A 2WWGA 2HLDD 2Q3FA 5FPHA 3C8UA 1TQ6A 2QNRA 5JHGB 5GVSA 4HZIA 5KTYA 3H4MA 4O2LA 4B47A 5JCZA 5KNBA 1EK0A 1GL7A 3WYGA 3ZVMA 2Q9AA 4TLBA 5KPDA 4RD4A 1N6PA 1W4CA 2HLDA 2P65A 4UQOA 1AIPA 3U3MA 4A15A 1J2JA 5DGXA 6Q21A 1RYHA 5FR1A 1IOZA 2VBCA 1KKLA 4URVR 2QT1A 1P9NA 1UFQA 3TH5A 1CBUA 5AJZA 4D82A 1E0JA 5H8WA 3U5ZB 1SQ5A 5AJXA 4GSYA 2RGDA 1KJZA 2R6DA 4E22A 4FCWA 1NN5A 4CW7A 3TUZC 1SXJC 2JEOA 2PLFA 2ZRAA 5LD2C 2FA9A 2GJSA 2H5EA 2IYWA 2YVUA 1RRPA 2HYDA 1E0SA 4ZO4A 4DT1A 2D06A 3AVYA 4QJ4A 4OI4A 4IRUB 3IEVA 1QBKC 4DIDA 2WKRA 1XMVA 3K70B 4C7OA 3HU3A 4LYHA 4B2PA 2PZFA 3D6TB 3RC8A 5FBVB 1Q21A 1OIXA 4KYIB 4ESHA 1Q3HA 3HPRA 1G20E 1Q1ZA 4H1VA 5KHOC 2CK3D 3GLIE 2X2FA 5EXPA 4EUNA 1GL6A 1SVKA 3L0OA 2QM7A 3PVSA 4TZ0A 4X8HA 2AK2A 1T8UA 2CHVA 1C4OA 1NBME 3MUFA 3PITA 2CK3A 3GLHB 5TARA 1RRFA 3WBKA 1S1MA 1Q1QA 4O25A 1WP9A 2V1UA 2J9RA 3IHWA 4TMZA 2BEJA 2OLKA 2NTYC 2B21A 1NY6A 3PEVA 1NMXA 1Y63A 3JVVA 3K09A 1KMQA 2HJVA 1XBTA 4RD2A 1FQKA 4EFLA 3AM1A 4CT5A 3IBYA 2XTZA 4KLNA 2CVHA 1J90A 1OT3A 1ZUNB 1VG0B 2ZJ2A 3PUZA 1DS6A 4P4TA 2AWNA 4EJSB 1FPMA 2ODNA 3CX7A 2PJRA 5J4KA 4D25A 5H70A 3CWQA 1KO4A 5EXSA 1CJVC 2W83A 2EYQA 4DB4A 2JJ8A 1Q3TA 1Z07A 1GILA 4ITRC 4JL6A 3B60A 2FZ4A 4G01B 4Q9IA 4FIDA 1XTSA 4F38A 1MRSA 2QN6A 4TL7A 5EE1A 1Q20A 4JLAA 2ZRHA 1W5SA 2KWIA 3A4LA 1FW6A 1IN5A 2FNAA 3W5IA 1JQLB 2BJVA 3ZQJA 1YZTA 2YHSA 4D4JA 2DWPA 4X8OA 4C0JA 5D3QA 1CF4A 4NCHA 4QOSA 2IF0A 3AKDA 3BXZA 5EUQB 4QM7A 2J0SA 2XXAB 4P33A 1CR1A 2ODBA 3U7GA 5DHFA 3W6NA 3DOEA 1E2KA 1R4AA 2A5GA 1P73A 1HE8B 4RD6A 2GBLA 3N2IA 2ZXUA 5JEEA 1DAIA 1YVDA 5LDDC 4HB2A 2VQSA 3BFXA 5EE9A 1GAJA 1YRAA 1GL9B 2FDCA 3FMFA 4FMDB 3PUYA 1G3UA 2XITA 2CXXA 3IGFA 3P4XA 5HCNA 3CPJB 2JLYA 1SKYE 1FNMA 3EA0A 5BN3A 1EG7A 1L4YA 2AX4A 2VH5R 3EAQA 4DWJA 4Z8YA 4Q48A 4FINA 2ZRFA 4JVLA 1EFCA 1XF9A 221PA 2BMFA 5BN5A 1NP6A 1NKTA 1V5WA 4MKFA 1NLYA 3BS4A 3DM5A 4HAVA 4M53A 5JRZA 2AHOA 4KHZA 4TLCA 3P20A 4F93B 1DPFA 1VECA 3TSZA 1FZQA 4TMXA 4YMVA 2H18A 1IY1A 1RVDA 3NC1C 1HQCA 3BIFA 2QPTA 4LHZA 4MRRA 3B1WA 4IVQA 1TUIA 4LBVA 5E4FA 2JLVA 3FVQA 2O8EB 4PAMA 2XB2A 3BORA 4B35A 2D4HA 4A0HA 3TLXA 5FBQB 2B8TA 4TYWA 1R8SA 4RKFA 2IXGA 2RMKA 4HDQB 3U3JA 5FOTA 1KZ7B 4DDUA 5EXXA 1G18A 3WY9A 3GJ6A 3Q3JB 4NYIR 5E7MA 1X3SA 5AUPB 1QHIA 3M4YA 2V3CC 1OFUX 4UNSA 2VHQA 2GRJA 1TNDA 4M21A 2YYZA 4QFMA 4D80A 1ZCAA 2RGAA 3F3YA 1J8YF 2JCSA 5HTKA 2H17A 4K46A 1HA3A 1UKVY 3VR2A 2A5JA 4TMWA 4D0LB 3CPEA 1ZNXA 2J87A 4URYR 5KDLA 5HPYB 2PCJA 3BFKA 3AV0B 3QE0A 4Q03A 2RGNA 5ANRB 3AVWA 4V0OA 3L8YA 2I1VB 1LS6A 3BFVA 1QVRA 2VYFA 1HY3A 1PLKA 4OJKA 3VQTA 2DWOA 5CB8A 1VG9B 2OBNA 2REBA 4A8JA 3HDTA 3CB4A 4NTZA 2JGNA 1AKYA 2Q6TA 1ZUIA 5CB6A 3BH0A 1W36C 3TAUA 1E9RA 3X1XA 1BH2A 3H1TA 4IKEA 4MRVA 2OEPA 5FTNA 1B0UA 3SU8A 4OHYA 4Q7KA 4C0BA 4NYMQ 1RC8A 1GM5A 1XEWY 3VAAA 1U0JA 2W6ID 1CJTC 2ZYTX 4JLVA 2ZJOA 2BOVA 4FMDF 3EPKA 3B78A 3OAAD 3ZH9B 2O8DA 2CEAA 1XD9A 3QNUA 5JLJA 1NIPA 4GNKA 2AXNA 2W6IA 5C1BA 5CLLA 4LZZA 5M04A 3PEWA 1XPRA 3T35A 4A92A 3OAAA 1Z0KA 2YINC 4FWIB 2CCKA 5F2EA 4HAXA 4JZKA 2P2LA 3NG1A 2C5LA 2YWHA 4NP6A 1N6HA 4Q9HA 1UKZA 1FOEB 4KITB 2ERYA 2ZRGA 3GQBA 1TQ2A 4KI0A 3TKLA 5FOVA 4JLOA 1E2QA 2F43B 1FFHA 4EQ6B 4LYAA 3QKRA 1J7KA 1TEXA 2VO1A 3A4MA 1WCV1 1GVNB 3LLMA 5J47A 1G3MA 1P62B 1LTQA 4US2R 1CR4A 5DH9A 2G83A 2GXQA 1HE1C 4OQXA 1SVIA 5G3YA 3B1ZA 3U7HB 1OKKD 3LQQA 4QJ5A 2EFEB 2D62A 3RVBA 1N5KA 5L3SA 2CHGA 3THWA 5FFMA 3R8CA 2NO6A 4OBEA 1E9AA 5JRJA 3AVVA 2FG5A 2ZREA 4U00A 2ZRBA 1OKKA 1Z6YA 2PMDA 1S3GA 1JPNA 1U0HC 3BOSA 3T5GA 2RGBA 1IN6A 1OB2A 1T3SA 1W2GA 2ONJA 4Q4JA 1XMJA 2C2HA 4GZMA 4U5XA 3SDZA 3W34A 4A6PA 2DPXA 621PA 5FOSA 1CULC 3WXMA 2B6HA 2CL6X 3Q9LA 2HJGA 3B7GA 1HUQA 3KJHA 3QVUA 4LSGA 2X19A 1Q57A 4DB2A 2PX0A 1IN7A 2JLSA 4GPTA 4M1TA 2HXSA 4ZCLA 1Z0FA 1BYUA 1G1MA 5JI2E 3RRYA 1JBKA 1U2RA 4DLXA 1LV7A 2A7QA 4TTPA 3GJXC 4M1KA 3I8XA 1T8TA 4PC1A 3ICEA 2AD5A 2C9CA 2IUTA 3D3QA 5SZKB 3LRPA 4W9MC 4I1OA 4EPYA 3VU9A 2G1JA 4EPWA 3QG1A 4L4UA 1E79D 3K9NA 3U3RA 3FB4A 1IXSB 4XSHA 1IXRC 3AVPA 3KKPA 1NJGA 1LF5A 3PFIA 1HH4A 3NBFA 1RW4A 4G5QA 1ELOA 4HZUA 1E79A 1FQJA 3OHMA 4BQSA 4PO1A 3AF1A 1UEJA 2CDNA 3BH7A 4DJTA 3CRMA 1F6BA 3DKVA 3K0EA 1BYIA 1CLUA 1CR2A 1NVXQ 1YR8A 2C96A 2GKSA 3CONA 3QG5A 2J0QA 4PHFA 2JDID 4Q7JB 4QGAA 1UF9A 1MO6A 1ZM7A 2WMOB 2GZAA 5FOUA 3H2YA 1KKMA 1R7RA 2VSOA 4V0NA 2AWOA 1Z83A 1VYVA 2CLDX 2W58A 3THXB 2IF2A 2JDIA 5FH9A 2J7KA 4IFBA 2AL7A 2BWJA 1AK2A 2IBMA 1A2KC 3GFPA 3O8CA 4GP7A 3TRFA 5GJBA 1Z0AA 1DAMA 2G9NA 1X86B 2CBZA 4CEJA 2QBYA 1MKYA 3DPUA 1KDOA 4Q9LA 3K09C 2FGKA 3IIKA 3TQCA 5KDDA 4V0ME 1RJ9A 4AYXA 1X8KA 1E1RD 4HAUA 1NL3A 4TMKA 1NBMD 4EDHA 1G4AE 3PIRA 4JBYA 5D3MB 2FV8A 2VSXA 3GLIA 1FP6A 2ZEJA 3E1SA 1YQTA 3TR0A 3R7WB 2CL7X 3UKDA 1UEIA 3T06B 5KUTA 4B3BA 1E1RA 3GJ8A 3EPJA 1M7GA 5TMPA 1NBMA 1N0VC 3R8FA 1DAEA 2JIZD 2QT0A 3HWSA 3DKPA 1E6CA 3I8SA 1Q12A 3PV0A 1PLJA 5F9HA 3ZGXA 1E9FA 3WMFA 2WIBA 1I2MA 3SS8A 1G7TA 2OESA 3AVUA 3NDBB 2WIAA 2WWIA 1Z08A 3CZPA 4Q01A 4HLCA 1US8A 1OFIA 5DISB 1E4YA 2JIZA 3AQ4A 3QY0A 2FSGA 3G5UA 4W7SA 2ZAOA 2ATXA 1SKQA 3O8RA 4FN5A 1CRPA 5DLQC 4TLDA 2QAGB 1J70A 1YE8A 4M9QA 4OQFA 3RAPR 3GFOA 1GRNA 3LO5A 4TMVA 3FKQA 3C14C 1OXXK 3IKJA 4W5WA 4A2PA 1DO2A 4UKDA 4WZBE 2ZU6A 4LPSA 4NZYA 2W2VA 4WW0A 2DCUA 2GBLC 1AZSC 3K0SA 3PR1A 4QGFA 3ZS9A 1AGPA 4KFTA 2XXAA 1DBSA 1KNXA 5A0FA 3U4QA 1YZUA 1COWD 4OI1A 4G5RA 3GLFB 1UADA 5AR1A 2BHRA 1QG4A 5AJWA 2JLZA 2GILA 1II9A 4LX0A 4LOAA 1DTSA 3OEED 3UWKA 3WMEA 1D8TA 3RYTC 1SVSA 1XJCA 3B82A 1CJKC 2ZETA 4KAXA 1COWA 3RS0A 3U44A 4HAYA 4S35A 4IOMA 3OEEA 1N5IA 3LDAA 1CU1A 1M34E 3IHLA 4TTQA 4DCVA 2ZTSA 3QF4B 3TSWA 4EFMA 3FWYA 5F9FA 1MABA 4B76A 2YWGA 4US0R 3UG7A 1KDPA 2W2TA 1GITA 2E9SA 2XAUA 4XWOA 2OXRA 3BJIC 4PX9A 1NRJB 4FXPA 3AB3A 4HYYA 4A1FA 3WP1B 2MMCA 3GLGE 1IY2A 4WXPA 5AWFC 4PXAA 2IYRA 2ORWA 3K9GA 3WHKA 2GCOB 4F4JA 4GMXA 1GZSA 3RNLA 2QPOA 5A4JA 4OL0A 4C0LA 3NKVA 4LHXA 3AP1A 4Q4AB 4BUJA 1R8QA 3IPXA 2FPLA 2WM9B 2H1LA 3R20A 5JS7A 4OJQA 2OG2A 4BFYA 1AS0A 1M6NA 2RGEA 2VP6A 4RD0A 2XZLA 1AJEA 5DN6D 4C2TA 3AF0A 5DSZA 2QSZA 3VX4A 1AM4D 4MA4A 1A82A 2ASEA 4LK2A 4Q02A 5EP4A 1FL9A 3SQWA 3TR5A 4ZKDA 1Z63A 1JXOA 1P2VA 1X1RA 3QXXA 4G5OA 5DN6A 1QF9A 4RJLA 2RGNC 4NCIA 2O8FA 1JAHA 2CE2X 2CLSA 3GEEA 3PUXA 4M9ZA 3RS2A 2QGNA 5IK2D 4L15A 3KQNA 5F98A 4P31A 4Q1DA 3KQUA 1CJUC 3H84A 3SJBA 3KB2A 3SR0A 2ZS8A 2Z0MA 4A8JC 4QGGA 5IK2A 2IYUA 3EIEA 1OYYA 5KDOA 2HEIA 2EQBA 3QKTA 1FUKA 3TAHA 4MRSA 4BZQA 2FMXA 2LKDA 4ZIRB 4DSNA 2ZQ5A 4PSVA 1FX0B 2NPFA 2WV9A 3B5JA 3MJHA 1ESMA 1BKDR 1KIMA 2WWWA 1N0WA 2G6BA 2VF7A 4JBXA 3E70C 5GVRA 1R10A 3QKSB 3QIAA 4MGKR 4E5UA 1JEEA 4C9BA 2D3WA 3LBHA 3V4FA 3G82C 4IHQA 3QJYA 1DAKA 1D9ZA 2OFWA 3KDSE 4OI2A 3PEUA 3SOPA 5FTKA 5JSZA 2JJ2D 4JVSB 3PEYA 3A6PC 4D26A 1IQPA 5CYPA 3PG5A 1II0A 5KO2A 2CJWA 2YWFA 3VR6A 1DG3A 4MGYR 1E2DA 1HTWA 1Q44A 2GESA 2GJ8A 3QQ5A 1XEXB 5JECA 4PC7A 2ZSAA 2JJ2A 1E32A 1JEDA 1N5JA 4RFSB 3EASA 4OQMA 1KI4A 2BM0A 3FPAA 4P32A 2EWWA 4ABYA 3TW8B 4MRNA 3WBJA 1PV4A 1N5LA 4GOKA 1J99A 3VR4A 1NSFA 3EZ6A 3AUYA 4Z51A 1KAGA 4AG6A 1OW3B 4I81A 4JMPA 1E2LA 1LVGA 2GETA 3U3KA 3X1YA 1ZYUA 2IWRA 2I3BA 2FSIA 4LV8B 2O0HA 4BLOA 2CMKA 3SQXA 2GAOA 4PZZA 5K8UA 1XRJA 1Z8FA 2I4IA 1IJFA 4PTLA 3MG9A 1VYTA 3QF7A 4MGIR 4G5GA 2FFBA 4BFWA 5B57C 5K8LA 3ETLA 2GWHA 5EUMA 1CXZA 4GL2A 1TEVA 1R6BX 1GNPA 2D7DA 4HUQA 1NIJA 4DLTA 3R9WA 2GXSA 4CRWB 3BBPA 3B6EA 3AVXA 4NBSA 1R2QA 1Z47A 3IEUA 3W9YA 2GAAA 3RS3A 2Q3HA 4RD1A 3MMPA 1KO1A 2V54A 4ASUD 4DCTA 2GZHA 4B6EA 1DAHA 2F1HA 3R9IA 1H8ED 4R9UC 2BCJQ 1K8RA 3AP2A 1VKJA 1UBCA 3UMSA 4B33A 2WJJA 4ASUA 2X1VA 4CEIA 1Y3AA 1E94E 5L3QA 2ZE8A 2N42A 2ZI5A 2W0MA 1PUJA 1KI6B 1H8EA 2FN4A 3OFND 2WICA 4KSBA 4QJ3A 4F91B 5JWHA 1W1WA 4Z54A 1W44A 2F3TA 4PSAA 3BB1A 3AVOA 3RS4A 4K8OA 1N6OA 1MO5A 1P72A 2YWEA 3OFNA 1ESNA 2ORIA 3OIVA 3B2EA 5FUWA 4NCJA 1UM8A 2Q21A 5CK4A 1UKYA 2NO9A 1SXJB 3GEHA 5LD2B 2XZOA 1II8A 4C4PA 3RRZA 4PR0A 1ZW6A 1G6OA 1Z6GA 2GDJA 2ZRDA 1G16A 3KKMA 3HU1A 1D2EA 3DMNA 1JECA 4OYHA 3GJ7A 5IF9A 2XJ4A 3MWLA 3VTKA 3GLHE 5CM8B 3LNCA 4US1R 3NHBA 4B32A 2ZPTX 5C4MA 1OH6A 2C98A 4PHGA 4PQYA 4G1UC 1TUEA 4DEYA 2J0UA 1EFUA 1WB9A 1SHKA 1E9BA 2WVJA 2Z6VA 3NVAA 1F5NA 1N6KA 5BN4A 3U61B 1PJRA 4GOXA 1Z6AA 4IDQA 3ZD7A 1EGAA 4JKIA 3CO5A 1H65A 4KXFB 4PC6A 4DDTA 2GVZC 2FPMA 1P9RA 1R5NA 1F2UA 1YZLA 2OBMA 1MO3A 3HJNA 3SHWA 4F7WA 2YKGA 5JJLA 3FGNA 1YR7A 3SEAA 2IT1A 1DARA 2UZIR 4LY6A 4P4SB 2D7CA 2VPPA 1RYFA 3E2IA 1G5PA 1Z29A 4TYPA 1CP2A 3QXJA 4QL3A 4LBZA 4ZDIA 4AD8A 3ZVRA 1ODFA 1GNRA 4TT3D 1KY2A 5CIWA 3F8TA 1TQDA 1O87A 2XB4A 2P5SA 5FOXA 3L8ZA 4LV5B 1E2PA 3F0TA 2IUUA 3EA5A 2ZIAA 5HR5A 4TT3A 5B64A 2O8CB 2F3RA 2QU8A 4LJ8A 1IJEA 1NMZA 3THYA 1SVLA 4YC7A 3BB4A 1YU9A 5FPYA 4BFVA 3O47A 2DYKA 4WZ6A 5EE0A 2PT7A 1JJ7A 4NYIQ 4P3YA 2QPAA 2EWVA 1NVVQ 1QG2A 4L9SA 2QA5A 3SFVA 3TW4A 1NG9A 5B2ZA 4EKDA 2QAJA 4V0MA 1G64A 1KDRA 2NZ8A 4L8GA 2V55B 2F9LA 2H16A 1KSFX 1G17A 2ZR7A 2WWHA 3QPWA 3RWMB 2ZVPX 1H8HD 3CLVA 4KLZA 2FSHA 2XNSA 3OIWA 3FMIA 4HLUC 1KSGA 5J4VA 3U6BA 3K0FA 4RZXA 5FUYA 2XX3A 3FYHA 3MAAC 1LFDB 5E3HA 1KY3A 1KJWA 1T5IA 4B3GA 1W49A 3IIJA 1DO0A 1FTNA 1H8HA 1GOTA 1TMKA 3AF3A 1XTKA 2QSYA 3EWSA 2QAGA 3EARA 2V8OA 1GG2A 2X8AA 1M8PA 3B8HA 4HAWA 3DHWC 4TWZA 4ACAA 1KSHA 1XEFA 4DC9A 1Z6TA 4F92B 2Q0HA 2FEMA 2W6JD 3GJ3A 1VDZA 4PSKA 1XXHB 3AGPA 2QMOA 3UMFA 2OILA 2P67A 3HYTA 1ZM3A 3SBEA 1U0LA 3U7EB 3WNBA 4DVGA 3HPQA 4B3XA 5HZHA 1GKYA 2BBTA 1E2MA 2TMKA 4D4LA 4LUCA 2W6JA 3IPYA 4NYJQ 1FP7A 2EYUA 1XD2A 2ORVA 4BLSA 2R6GA 3FTQA 5KSPA 2V6JA 3NHAA 3LW7A 5DNYB 1GDDA 2WWXA 3NH6A 2WKQA 1X8JA 2BMDA 4PHTA 1IN4A 2WKPA 2H92A 3ND9A 4IXNA 2BBWA 4XH9B 4DSOA 4CEHA 1KO7A 4E09A 4QBHA 2HCJB 2JJ1D 4TQAA 2YZ2A 3UATA 4R2IA 2IEYA 1IONA 2OT3B 2R6FA 2AN9A 1L7VC 1CIPA 2R8RA 2P3SA 2W2XA 2VP0A 2ZUDA 4IEEA 1P7CA 4C0SA 1R5OA 4KFUA 4DSUA 1E2JA 2JJ1A 2R6AA 1CTQA 2NO1A 4JL5A 1G5RA 2NO0A 4A36A 1JB1A 1IM2A 1NVWQ 1Z0IA 4NONA 3N70A 3THOA 4ZDJA 3K0AA 1ZM4A 5DHAA 5L3RA 3B9QA 1VIYA 4NPHA 4ARZA 3T61A 1UAAA 2HCBA 3LD9A 5K8IA 2C9OA 2WJYA 3I5XA 4DDVA 5DI3B 1NVVR 3CIOA 5KNCA 4GZLA 2ANBA 4I99A 3MSXA 4JJKA 4OHXA 1TF2A 4LYFA 1VTKA 3ZYCA 1VG8A 4W5HA 4AKHA 4C0AC 4B71A 1EESA 2IS6A 2BKUA 4A6XA 4QKQA 3KUCA 2QORA 3VR1A 5JHHB 2FX3A 3GLGA 3VKWA 1KSJA 3K9HA 2AFIE 1OIVA 4MYTA 5G40A 2F55A 2IW3A 1G7SA 3SN6A 4RD3A 2EFCB 4MYHA 5BXQC 1F2TB 2GHIA 4TYQA 2IXEA 1EFHA 2NOAA 2ZRIA 1G8YA 5EP2A 1JAIA 4PHHA 3LY5A 1KDTA 1VPLA 3ZS8A 1UBFA 2NGRA 4MQBA 2D2FA 3EWAA 1W36B 3A1SA 4NYJR 2BJWA 1G8FA 5EZ5A 2RCNA 3TE6A 2FU5C 4DBLC 2ZE6A 3K8YA 4PQRA 3SJAA 2YC4C 3S1AA 2BEKA 1RIFA 1C1YA 1PLLA 3KTAB 1G8HA 3LX8A 1IXZA 4RY2A 1UBGA 4FMBB 2GTPA 2Y8EA 1UDWA 1N0UA 1XCGB 1T9HA 2FSFA 3K0CA 4A0GA 721PA 4FCVA 3TUIC 3ADBA 2GEUA 2AKYA 1AQYA 1KMHB 3NBYC 1MH1A 1ZVQA 3RS5A 3LVRE 2OBLA 2SHKA 3AKCA 4D0NA 3V4RA 2W0SA 3EZ7A 4LJYA 5EP1A 1DAGA 3LA6A 3P27A 4NL4H 2Q9CA 1I4TD 1YZKA 3OIYA 2FFHA 5EZ6B 3RABA 1Z2CA 3NDPA 3B13B 2DY1A 5FPSA 2D74A 1D5CA 1EFTA 1KI1A 1KGDA 3HYRA 5C46F 4DDWA 2J5XA 3DVLA 4TL6A 4IXMA 1HV8A 2ZSEA 1NLFA 4WZAE 3WRYC 3CF0A 4ZKEA 4EPRA 3CX8A 2CLCX 2OUKA 2O8BA 4Q1EA 4Q4HA 1E9SA 3RSLA 2ZJYA 4G5SA 4B6FA 1F48A 4B2LA 4WBSA 3TIFA 4AI6A 4JVNA 5IHPA 1S2MA 4A0FA 4BFSA 1TU3A 4HAZA 1OXVA 4CZ2A 4QM6A 1XFAA 2ZSFA 3KQLA 1Z0DA 3ZVLA 1FTSA 2PEZA 1GKUB 2IX3A 1G3RA 1U8ZA 1XB2A 4KBFA 5SZHB 2ZJ8A 4PQFA 3I62A 1QHHB 3VHXA 3FHTA 2UKDA 1T91A 2BM1A 1U98A 3L2OB 4JL8A 3A58B 2G0TA 2VLIA 3G0HA 2GJ9A 4Q5IA 4QG7A 4XWKA 2C8VA 4ERNA 1VMAA 4V02A 1OH8A 2FWRA 1P2UA 3W90A 4URXR 3JZMA 3MWYW 4POAA 4Q66C 1KOFA 2VP4A 2QQEA 4I1SA 3RSOA 1N25A 1P6XA 3K1JA 4FD2A 2ZRKA 4QXAA 3MWJA 4DIEA 3WRXC 1ZUHA 4Q9KA 4JSYA 4ZV4A 4NU0A 3QVVA 4M1WA 2FOLA 1RFLA 1EXMA 4IOKA 1IY0A 5C4GB 1G8PA 3GP8A 2OCYC 2IYTA 3KL4A 4C3ZA 1Z0JA 1MO4A 4R2HA 5FUXA 2J0VA 1BIFA 2IYSA 3I61A 4WIAA 1NKSA 1HT2E 4I4LA 5P21A 4AWXA 3A1UA 2O0JA 4N0EA 3KFVA 2QMUA 3NBZC 4M9SA 4GT1A 4D81A 4IOJA 3LV8A 4DT1B 4BLRA 3HR8A 1CJMA 5CDFE 1ZCBA 2GA8A 2FGJA 4C7OB 3K70D 1DOAA 5HCIA 3Q7QA 1GNQA 1ZU4A 4QBIA 3DZDA 1Q22A 2C77A 1CEEA 2ZANA 1A7JA 3FFAA 3LFUA 1KI8A 3P26A 3SNHA 4AIIA 4RZ2A 1OXUA 1YKSA 1ANKA 2H8KA 5GJCA 2BVNA 1KK1A 3GPLA 1LY1A 1FNNA 3REGA 4KJZA 1E9CA 5FUVA 4QNRA 3BB3A 3OIUA 1GSIA 4PAOA 2WJVA 5BWMA 2VSFA 1D9XA 3IILA 3EZ2A 4OHWA 5AJVB 5B30A 2FH5B 4K81B 3LW8A 1JR3D 4I1UA 3GLHA 4QRHA 4ZI2A 4ON9A 4MRPA 1SVOA 3BD9A 1D2MA 4KSCA 2GXAA 1Z6XA 5JWOA 3CF2A 2A3RA 4U02A 4TN1A 3T34A 4DSTA 1X1SA 1JR3A 1DAFA 2PJZA 4TTRA 2L0XA 2GJAA 5EP3A 3U7FB 3QPUA 1E69A 1XDBA 3T1QA 1KHTA 3C16C 4URUR 1RKBA 3BC1A 1S1CA 4EJSA 4B3DA 1W4AA 1WMSA 4DZZA 3NXSA 2FEOA 4PPFA 3ZVNA 1OFHA 4R71A 1LS1A 2OV2A 4JSTA 4NCKA 2C78A 1P61B 2ANCA 3MD0A 4PANA 4IFEA 1QHGA 3I1FA 4DLSA 1L8QA 3ZZUA 1NN3A 2OO7A 5J5CA 4AYWA 1DEKA 4XTRA 4LYJA 5J4HA 4KVGA 2ZRMA 3J81k 3QENA 1F60A 2BKEA 2CCJA 1NLZA 4PC3A 3L43A 5LB2A 1G4UR 1NG1A 1U94A 2ZRCA 4M9XA 3GLFE 3QBVA 1CR0A 2ERXA 3P1JA 1HYQA 1S0UA 2JATA 1XNJA 1ZD1A 2EFGA 2ZJBA 4TQUS 3GFTA 1E2IA 1KK0A 3SC3A 3F5FA 1RRCA 3UIEA 3CZQA 4L9WA 3T5DA 4O2RA 3TGPA 3Q85A 2V6IA 2MSCB 1S8FA 4BLQA 3FFBA 5AJYA 2UVQA 2BMEA 4URZR 2WBLC 2JASA 4DLZA 4C0QC 2F1IA 2IYQA 4CYMA 3PJRA 5TXGA 4RCYA 2FE4A 4II7A 4YONB 5FI0B 2JLWA 3VHLB 2PBRA 3JVUA 1RRGA 3I3SR 4L5BA 5FL7D 3SJZA 4BLTA 4EPVA 821PA 1XXHA 4OQNA 2J1LA 1K5DA 3REFA 4HUTA 4LJ4A 1J8MF 1W48A 1L4UA 2ZI7A 4BRUA 2EU8A 1XU4A 2G88A 3OZXA 4NH0A 3DL0A 5TV2A 4Q00A 2QP9X 5FL7A 1U8AA 3I4LA 1NNEA 3MRSA 2ZRNA 4IDNA 5KSYA 4HB4A 4AG5A 3NC0C 1W4BA 2G3YA 3IQXA 1PVOA 1XEWX 3EZFA 2YJTD 3BRWD 2B7CA 4IEIA 1NSTA 4WA7A 3X2SA 5JBQA 4KV9A 5H68A 1HEIA 2QE7D 1JJVA 1VCNA 1W2HA 4ZCIA 2OM2A 5CITA 2XGJA 1YRBA 2IUSA 3CX6A 4R7ZA 3TMKA 3HU2A 3NTUA 3A37A 3GCGA 2IHBA 4PPNA 2O8EA 5DIFA 1JQJC 2ZR0A 1AGRA 2QE7A 2PZGA 3QUSA 4JT4A 4UJ5A 2YOHA 4B3FX 4RCZA 2BBSA 1XPOA 3ZD6A 4ZPXA 2QGZA 3QXSA 4BECA 3KQKA 1EWRA 2F1JA 3A8TA 3V00A 1R0WA 3DM9B 3O8BA 4KBGA 4A0RA 3VNVA 2O52A 2QTFA 2YV5A 4YXWD 3KKQA 3RS7A 2RAPA 2WJGA 2WAYA 4D4KA 3ADKA 3ZLJA 3FDIA 4XOIA 2ECKA 4M1OA 3TVTA 4JT2A 2OAQ1 4YXWA 1M1YE 2HT6A 4LRWA 1D2NA 3TUJC 4Q1CA 2FPKA 4A8JB 4RZ3A 3ZQ6A 1W47A 4BEBA 4GP6A 5KNDA 3DO6A 3W6OA 1OF1A 1LNZA 2EFDB 3K53A 5FTJA 1E2GA 1B23P 4MKGA 1JPJA 3IIMA 4JBWA 3NEJA 4LHYA 3MCAA 2WSMA 1W46A 5DI9A 3KJEA 4LV6A 5JJIA 4B44A 1EX6A 4JJZA 5GJVC 3K0CC 2OFXA 1E9EA 1E9DA 2XEXA 3IBGA 1XJQA 2C99A 4M1SA 4RSGA 4Q7MB 2HUPA 8OHMA 1M2OB 1K5GA 2F1RA 2OCBA 1TADA 1QVAA 5TB5A 1QHXA 5TDHA 2VP9A 4W5JA 2DFTA 1NN0A 4V03A 4ZCMA 1P2TA 3VR3A 4JYCA 4DLUA 4Q7LA 3H0KA 3AH8A 2VL7A 4OK5A 2IS4A 2QP4A 1W5TA 2QTVB 4BZPA 1TQ4A 4B48A 1P75A 3C7KA 5BYKA 4TLAA 4WXRA 1M7HA 1UPTA 3R9XA 3QKRB 1Z22A 2GEVA 3BGWA 4GBMA 2LCFA 4LJ6A 4D6PA 4EPXA 5JJKA 2EW1A 4QHSA 1SVMA 2IXFA 3ND8A 4P4UA 3SFZA 4BZXA 3SYNA 2F43A 2Q9BA 4EQ6A 3CRVA 3CH5A 5CM9C 2OFOA 1OH7A 1E3MA 3BE4A 5L3SB 4A2QA 3THWB 1HT1E 3ADCA 3W8NA 3FHCB 2ATVA 3VNUA 2IS2A 5EQTA 3RRMA 1HQYE 1WQ1R 2G0NA 2JA1A 2Z83A 2EVWX 4YMSA 5BYJA 5J40A 3MGCA 1ZRHA 1Q0UA 4JLNA 4DHEA 1R5BA 1V43A 4Q4JB 4M8NE 4XD7D 5SZJA 3W5JA 4BRWA 3QKUA 4MYCA 2B92A 1SGWA 1IHUA 3PUVA 5JI3E 3A1WA 4YMTA 4A4DA 4MH0R 3EW9A 3PQCA 3CWZA 5GJWC 4XD7A 3HP1A 1T6NA 3AUXA 2JAQA 3KKOA 1G9XA 2NIPA 4M1MA 1NMYA 4LGMA 1SXJE 1E98A 2IA5A 4UNNA 3QI2A 4YDSA 4B3CA 1KTVA 2B7BA 2ZRLA 2WTUA 2ZYUX 1CKEA 5C18A 3PENA 3PCRB 3KZ1E 2A9KA 3VU9B 1W0KD 1Z5ZA 1VCIA 2OLJA 3VKGA 2JLUA 2MMGA 4C0HA 5FPKA 4M1YA 4B74A 2C95A 121PA 2FFQA 2OAP1 5AK0A 5FBRB 4WOPA 5JS8A 4UNQA 1W0KA 2XJ9A 4DRZA 4BPBA 4OHZA 1U99A 4HZUB 1DVRA 4IVPA 5LB4A 2IC5A 2ZR9A 2QUZA 1XZQA 1OE0A 2OSBA 4QC2A 4M22A 2J7PD 1M7BA 4X8LA 3Q72A 3U2QA 4NE2A 3SYLA 3WYFA 3TNFA 1QDEA 2PLRA 4OK3A 1JR3E 3CBQA 2H57A 1N6LA 4ILEA 3WMGA 2AR7A 3K70C 2J7PA 3NEYA 3B85A 3I72A 3KJIA 3VKHA 1OHHD 3RRNA 3DOFA 4RVCA 4V0LA 3VX3A 4BFTA 3CH4B 3IQWA 4PAQA 2BCGY 3WNDA 3CM0A 3TVDA 2AK3A 4GOJA 2XTMA 3KUDA 3T1VA 1OHHA 5CDFA 3KXIA 2HF9A 4L16A 1R0ZA 4QHYA 4G0NA 4CEJB 2Z5FA 3THXA 2QBYB 1E96A 1OXSC 2R6CA 4J0QA 4AKEA 2ZS9A 2HYIC 4S2EA 4DLVA 3AKYA 1RJ9B 1G3IA 4DLRA 5CIQA 2CVFA 2ZSDA 5FOWA 2IL1A 3FMOB 3PUWA 1AA9A 2GVDC 4PO9A 4G3XA 5FBLB 5FR2A 4JLDA 3WP0A 4AYTA 2BIFA 3GLIB 4MDEA 3LVQE 1OJLA 2IYVA 4XVQA 1U8YA 3M1IA 2WOOA 5EE5B 4EJSC 4KVAA 4QBFA 5D3MA 4GMDA 1W7AA 1ZNWA 3I5YA 3UPUA 3KX2A 4XSGA 3R7WA 1ZM2A 1G291 1US8B 4JS0A 3B1YA 1QRAA 2RHDA 2ZE5A 3AVTA 2R65A 4NMMA 1UKEA 4Q9JA 4EFNA 3LAWA 1A4RA 4BFZA 4EPTA 1UBEA 1Z06A 3ASYA 2XOKD 2OE2A 1OLOA 3Q7PA 5EJEA 2PT5A 4IVRA 2NQ2C 3LH5A 4CIDA 4TYNA 4YMUA 1WXQA 1XXHE 2VHUA 1I4DD 1KK2A 1ZIPA 1FUUA 4OQLA 4YMWA 1AZTA 2ONKA 3ZJYA 2XOKA 3CNOA 4IDHA 5KPJA 4B2IA 2RGGA 4IJMA 4UJ3A 4E07A 3AGQA 1NI3A 1K6MA
chains in the Genus database with same CATH superfamily
4J94A 1UXKA 5LYJB 4AN1A 4IWYA 1GUFA 4PGMA 3GJ4A 1JI0A 4OHKA 2VDNB 2HH9A 3RIGA 4GM1A 4A82A 3QSYA 2I2WA 4IIHA 2R7MA 4WA8A 1I3MA 4WT7A 2WYHA 3GT4A 3SR4A 1YONA 4LXIA 3PVCA 3U4QB 2NM0A 3CRW1 5J5AA 3T7IA 5CNIA 1SUCA 4CMBA 1U0SY 3H3JA 1Q0PA 2ZUCA 3C5CA 1E99A 4F8JA 2YWCA 1HDXA 5G4KB 4TM7A 4GNRA 4YX9A 1NI4A 2AI2A 4PICA 1IUPA 3AT1A 3KEMA 3NM5A 5AI0A 4DCUA 1AMUA 2BGUA 3LLSA 3KBOA 3O74A 2XA9A 1I4OA 2D7JA 1CDDA 1LJLA 4FFDA 5J1SB 2VHYA 1SB9A 4IDOA 1RJWA 1S4MA 1TOAA 1TMGE 3DVAB 1VC2A 5CA1A 2YN0A 4HVTA 2H4XA 4Q1AA 3FNHA 2JBWA 4ETMA 3Q98A 4B81A 4PGFA 1OROA 3EIXA 2Z2ZA 5CFOA 5JVDB 2XCTB 2A9PA 2XHZA 3PGKA 4KKVA 1LEHA 1CJSA 1SULA 2AOTA 2XVMA 4U9IS 4ZZ1A 5JFGA 4MNTA 5CP8A 2XYHA 2FMFA 1AQUA 5FO0A 4L50A 5MGNA 3QF4A 4LWZA 1VJCA 2QL5A 4QG3A 4I1YA 1AUPA 3OOJA 2ZBQA 1BJRE 3DBHB 4L2IA 1AMNA 5BPFA 2YOFA 3BA6A 2FUNB 1A50B 1IOLA 1C8BA 1Z75A 2O7RA 3EJ6A 4FGLA 4Y6QA 2C9BA 3EGXB 3ZDQA 4LCBA 1ADGA 3OEHD 2I4LA 3AR7A 5E4TA 4BWGA 2JGKA 4R1MA 5DM70 4MV1A 2PBZA 1JBQA 2BEVB 3VR5D 2JIPA 2GCOA 3CLTC 3OKAA 3C4JA 4IHJA 1J2UA 4QPCA 5DEIA 3ROQA 2JFPA 4H6VA 4D9BA 4C0WA 4ACBA 1VKHA 4R0MA 2R79A 3W5CA 1RI2A 4LF9B 1JHYA 4BX2A 2JKZA 2FETA 2N0SA 1T34A 3K8QA 1VRVA 3OPXA 1WKVA 3LIPA 3N58A 4HWRA 5U4XA 3RRBA 3ZGYA 5EWMB 3Q8XB 1OWLA 3KE9A 4NJEA 1LW7A 1XGKA 3PCXA 3JQ9C 5AM1A 4DQDA 4CKXA 5LQRA 1N7HA 4TROA 3ZY6A 2PWPA 4XWAA 4FOPA 5AUQA 2DFNA 1FDIA 1XCMA 3ANYB 5E7IA 4KFRA 5SY6A 5A4MS 1U9IA 3EISA 3FGOA 2FN3A 2VJNA 3CURA 1P33A 5BV0A 4CIAA 4MIEA 4JGIA 5IDWA 2R2AA 4TYYA 1G60A 4U9HS 2D00A 3EG9A 3S7TA 1YVUA 2PSEA 1EFRD 3IVCA 4CVNA 4LQLA 3RANA 1GPMA 1XZPA 3ZWVA 4WSOA 2QW0X 5HP4A 2YV2A 2UZ0A 3PD1A 5KTOA 5ECGC 3R5FA 3RSCA 1L9XA 3WMXA 5HRUA 1IBRA 1R9GA 1S4QA 3HP7A 4YWHA 5JZVA 3RUHA 4CJXA 1P39A 4L08A 4B40A 2ODPA 3QLVC 5HE9A 3I5AA 3LVFO 2FMKA 1XV5A 1ZK2A 2CNWD 4AN4A 2RBEA 4LCEA 3UK6A 2UUCB 4B4UA 1THGA 2E1RA 5K01A 4TUYB 1FYFA 5KX5B 2VJKA 4IH1A 3PFBA 5IZCC 4ZZIA 1EQUA 3DEKA 1P5ZB 2EKZA 3WWEA 3R7NA 4RO0A 1BCRA 1AD2A 3FA2A 3LLUA 5LUBA 1ONBA 3I9V6 1S96A 2VSNA 1X1TA 3A4NA 2KJQA 3D0RA 2JD1A 3S44A 4DHWA 4REQB 4YCCA 4RAQA 2Y1XA 2XNDD 2NMVA 3LGSA 3QEOA 2RKOA 5F76A 1A9OA 2IDJA 3CPHA 4W82A 2WSIA 3IT0A 3JQPA 4X3PA 4DLBA 1KRXA 1T13A 4J6FA 4KMSA 3H7IA 4MAFA 4MJLA 3ZZNA 1MOQA 2VK1A 3BWDD 4LF7B 5H1YA 4O4LB 2OD2A 1G6HA 1DKPA 1VG1A 2CCGA 2J3IA 5ILGA 4YT4A 2E4UA 4CPDA 1OC4A 2QRZA 4XYEA 1EIWA 3ODPA 1RTTA 4KMRA 3AK4A 4Z4QA 3CGGA 3KTOA 1SHZA 1LLCA 2E7ZA 2IYZA 2WJPA 2XMPA 3FN4A 3QITA 4R98A 4TSRA 4KR2A 5ELXA 4HQKA 4TS3A 5DSTA 2HSWA 5AHKA 4J4HA 2QTVA 4XQCA 2GZMA 2I3AA 4ZDWA 4YRAA 1YA6A 3FGPA 1JA0A 3BMQB 3EULA 4B80A 2EQ5A 3V2GA 3WICA 4EUKA 3R1IA 2AFHE 1TT5A 3CQ9A 3QWBA 2WMNB 4XQGA 5P8WA 4ES6A 5LL6P 2VHVA 2VJAA 3REQA 4AMZA 2OZEA 3T15A 1WUYA 3I32A 3LX5A 2G80A 2VT3A 4LTDA 1HORA 2WZBA 1A5BB 1EFPA 1NLMA 2A58A 3KD3A 2O57A 5JCOA 2F8SA 2I7DA 2J9YB 3ZKAA 2Q3LA 5D86A 3BXGA 3GJRA 3KPJA 4J7XA 4E1AA 2ZUUA 3C7AA 3TSAA 3VU3A 4LWOA 4X1IB 4E2WA 2WTNA 3AY6A 1AXRA 2QKYA 3P9RA 2MT9A 3G2HA 3DEHA 4QGHA 1O3YA 2ZLBA 2HA5A 5DZSA 1A5AB 3C3BA 4RMIA 2C4KA 2XB8A 3PEFA 3DQZA 4RPCA 4TLLB 1RU3A 1VYUA 5FIUA 5EZYB 3U40A 2Q8NA 5ALFA 3CEHA 4GHWA 3OLXA 1CS0B 3JVIA 5L3QB 3R7SA 2UDPA 1QIEA 1U0BB 4TVSA 5JEEA 1P74A 2WWYA 4FLMA 4Z7NB 1CIVA 2R9VA 3W5VA 4TVOA 4BMYA 3CNNA 3OZRA 4L85A 4HH1A 4N5DA 1I6MA 3LXRA 5IRCD 1HRDA 3N2EA 3RVOA 5KTMA 1SKUA 4PHCA 5ITWA 2ZJFA 2QXTA 3CR7A 1G8KA 4NYMR 1LNQA 4DJDC 4DV6B 1L4MA 1C9DB 1DRKA 3JXEA 4TVKA 4OK6A 4FBLA 1RXCA 1TUBA 1U2QA 4DMGA 5KS2A 1WSWA 2CL0X 5IG2A 2W6MA 3V1UA 3JZFA 4P86A 1QS0B 2ZBPA 3L1UA 4BO9A 2EF0A 1JR6A 3LX6A 4WAUA 5JCPA 3N87A 2JK1A 1KI9A 1SXJA 1WBBA 5FD8A 4C0KA 4IDBA 3CR3C 3MHPA 3ESXA 4I5FA 4RFVA 3BYZA 1BS1A 4RMHA 3K6SA 1GIAA 3FTFA 5FV7A 3JWJA 3K8ZA 3TDMA 1WEKA 5EN4A 1UBRS 3HFJA 4BGEA 4TV8B 3T8YA 1QAOA 3TNDA 3B48A 3ZDFA 3PJEA 1ZG3A 2BV3A 2HREA 3F7NA 3PHJA 4X44A 1KZGB 3DKKA 3S70A 3PC7A 1GPKA 1PS8A 3P2IA 4IZ6A 3IIEA 2Q6OA 1DB3A 4X5OA 2V7QA 5JD3A 1MTZA 2GPJA 3UUEA 1BO6A 4J16A 4DA4A 3HWX1 3DDCA 1A1VA 5DK4A 1S9HA 2QOEA 5DO9A 5CXQA 2J07A 1XLTC 1ZSYA 1D4FA 2EEZA 1NJFA 4FOLA 1IXYA 4BRSA 2WSSA 3ZN2A 1Q3KA 3NJRA 4NAUA 4AXXA 1ZC3A 2JFHA 2QLLA 2R8EA 2Z4SA 4YCBA 5LIPA 4ARVA 2YZNA 1RI4A 3SE0A 2QZ4A 3ES9A 3UG6A 4A7PA 2V7TA 3E9QA 4E13A 4YDHB 2GZ1A 1O0SA 2PUBA 1UAYA 2DPMA 1FVFA 2I8AA 3TQIA 4HX2A 1E8MA 3DL4A 1M67A 5K4AA 5HIJA 5KAMA 4DMUB 2FK7A 4D0SA 1OYWA 3DXZA 2UZ3A 1N6RA 2YXLA 2DFKB 3H9BA 4W8HA 4DOMA 4N39A 4B3TB 3GDHA 3TKAA 4AMYA 2OKGA 2ZT8A 4GU5A 2IITA 2Z3VA 2BN4A 2CFOA 3A04A 4WKCA 1OH5A 3EGCA 2G07A 1NY5A 4ZOCA 3BCUA 2CFRA 1NUSA 2R87A 1V8BA 3BMCB 3M5WA 3PUIA 1SQFA 2Y6VA 3B9BA 2ZI6A 2OGSA 3EGDB 3HUEA 1FLDA 4L78A 1PFQA 3AWIA 3KJGA 4V1CI 2BH2A 3LX4A 4YS6A 4M7OA 2C9YA 1M2FA 1C7QA 1VHTA 2WZQA 1H6DA 2VDPB 4H4EA 3QEAZ 3KE8A 4G8BA 3DXFA 4YJ3F 5HMMA 1Z5GA 2DT8A 1CRZA 4Z0TA 1QPZA 3HO1A 2H7CA 2RH5A 1L5HB 3EXIA 2EF1A 4Q3KA 3W3AD 4DLWA 1I7DA 2XCQA 1XDSA 3OTWA 2YICA 1QFSA 2YC2C 3UMRA 3W3ZB 1K9SA 2AYYA 2BF7A 2XGOA 3ETJA 4RYDA 3KFXA 4Y1GA 2ZAMA 2HJ9A 4P53A 2QX7A 4C03A 3LHDA 4C89A 2G17A 4CV0A 2VBGA 3L8CA 3X1ZA 4BDTA 2MYUA 3CVYA 4BP9A 3TB4A 2XDQA 3ZV5A 1D2RA 2F7SA 1GRVA 3COYA 2C4VA 3P5SA 2BEWB 5F5XA 1MV5A 3IVMA 1F6WA 3LC1O 4JLJA 4N8EA 1M73E 4Q1BA 3S2EA 4BC0A 4HT3B 5FT9A 1DCMA 2ZWVA 3WHLA 5KSYA 2HMUA 3CA8A 5KQSA 2HFKA 4BASA 3DXYA 4PM4A 4Z1MD 2G9QA 1ZGZA 3HYCA 1MB4A 3K05A 3X1MA 4NENB 5HIAA 1CQJB 3H97A 3VFDA 3FY4A 3VR4H 4DCNA 1J8VA 1ORHA 2ZFUA 1IHYA 3T9FA 1VQ1A 4G9GA 4TV9B 4KVFA 1KEUA 3UK7A 4RS4A 1T5OA 5CPBA 4CMHA 1U4OA 1OBFO 3B7WA 4F96A 5GADl 5DX0A 3TMAA 3HNPA 2H1VA 1QLJA 1RKQA 2DPHA 5EWJA 3DE2X 3OSZA 4IV8A 4WZBB 3RK0A 4YR9A 1KZ9A 3SJCA 3ACBA 2JH8A 3F6RA 2HV8A 2QMYA 3LQFA 1G8GA 3PHIA 2V3VA 4RTJA 4WXHA 5ALKA 3PQ7A 4LJ9A 3RC3A 3STYA 1NV8A 5JZBA 2I6QA 2QEQA 5BV1A 3EZ9A 2GSWA 2EJCA 2VPXA 5IAGA 2V96A 2ZUBA 2ZITA 1HYEA 4R5MA 1U2PA 2VA8A 4PTZA 4RK0A 2YVKA 3LSYA 4EGJA 1UAGA 4LHVA 1W5BA 2GPBA 2VS1A 3HVUA 2KLHA 3RVJA 3VI3B 1PZFA 2W8ZA 2J09A 3EIHA 2DB3A 2OHFA 2HMTA 3O9ZA 5ETJA 1YR3A 5F1YA 1QTIA 4UNPA 1SCUB 1SCIA 3UT5B 2IWHA 1N7GA 2GKOA 6CHYA 1M34B 1HDOA 3ZZ1A 4IJ5A 4LI3X 4X6LA 2GMWA 3DZKA 4TSKA 5F7OA 4BFXA 1NM5C 4MUFA 1M2JA 1E2UA 1D7OA 1TCUA 3AO0B 3R0ZA 4HXFB 5IDVA 2Z98A 1VJRA 4M0UA 1KZHA 3OM9A 4YAOA 3LUBA 1KDZA 5HQTA 1OBHA 1V7CA 4U0KA 4F9GA 3FE2A 4PGHA 3ZXIA 3ETCA 3UMCA 5BUCA 4LXYA 4CKBA 1YRYE 3JQEA 3QJGA 1XHLA 3GT3A 3U62A 4CT0A 5K3EA 3AHEA 1RYNA 2WQZA 5EIXA 5EIWA 2VRCD 5ADVA 4ZVOA 3HBNA 4AAYA 1O94C 2Y27A 1UZAA 1LSSA 3FETA 4MKIA 4N3NA 4Q24A 1E3WA 2WNIA 2PNFA 2XXBA 3JSXA 3KKNA 5E4YA 4YUVA 3X2FA 3NOOA 4WFQA 4GSLA 4DE5A 2PV0A 2ZBGA 4UE6A 4E5NA 1TMYA 5BP7A 2WJHA 2R62A 5EJ2A 3FPFA 1IRXA 4FSDA 1B6SA 2BZSA 2SICE 4JKOA 4F86A 5AM2A 1Q1BA 2HA6A 3RLFA 3X1WA 5BQXA 4TL8A 1FRQA 4AJ2A 3D7LA 5BWOA 1KQNA 1MUUA 4TSFA 4R01A 2BEUA 1L4HA 1YB2A 2IXAA 4F5ZA 1G2IA 1T5LA 1ZU5A 1L3CA 4EIWA 1MRNA 2FE1A 3ZW7A 3OCJA 4UCWA 4L6CA 3CF6R 3UJBA 1SZPA 3OJCA 1JRLA 4MVJI 4MVJH 2HA4A 1Z6PA 2HDNB 3SX0A 1YL5A 2EZTA 1Z5OA 1BMFD 2B99A 1TTPB 2XGMA 3TRDA 3D31A 3NV9A 1GWNA 3CNBA 3L0SA 2Y1FA 4ZYVA 4V0KA 1KJNA 3OPYA 3ZYZA 1U81A 2LWIA 3I73A 5BMVA 3U3OA 4DUGA 3EX7C 1T3HA 4E5YA 3N74A 4L8YA 5K6RA 1I5OA 3HJBA 1UPFA 1W0JD 1MQAA 3O3OB 2WT4A 5IVIA 3T5CA 2WHYA 1NBWB 3IPRA 1SD1A 4ZOLF 3ZY4A 2AN1A 2FVXA 1JU9A 3VPGA 4WCFA 2PK3A 4LRSB 2I2FA 1WXIA 3GNTA 2HWKA 2MSDB 1FMJA 2EKQA 3Q41A 5JH7F 4RABA 4MW9A 4LJAA 4N3BA 1P81A 4J76A 4UQPA 1CFZA 4OA5A 1LBIA 4Y0NA 3IKLA 3OQIB 1DKNA 1XTQA 3SZLA 2P6OA 1IJKA 4GI7A 1Z4LA 2ZI9A 1ZIDA 2V03A 3MC1A 4J1TC 4L6AA 1R12A 2X77A 5M2QA 3DHYA 2JANA 2D1SA 3R2JA 2XV1A 4ZYZA 5KC9A 1J2TA 5EXTA 3LUAA 2HF7A 1R50A 3EXEB 2G77B 1OOEA 3I2GA 3PWKA 4QBGB 4QDZA 3RTAA 3FPLA 5K0GA 4HB3A 3NAMA 1UZMA 4NU6A 4KR0A 1T9GS 1I4LD 3RK1A 5J2UA 1JDTA 1I7LA 3PX7A 3LNTA 1TEZA 2VP2A 1J56A 1UDXA 2ZYWX 1GTJ1 4WI1A 5DYGA 5JMTA 4RTOA 3VHXB 1VIVA 2ZWMA 5A6VA 1N2SA 1Q92A 2CL5A 2R6R1 2OV4A 3BCRA 3X0DA 4CR7A 3GVXA 4XDGA 1YACA 3LG2A 4YCAA 2ZVQX 4N3GA 4XYLA 5TGTA 2XOEA 3KVVA 4V2IA 3WZLA 3PFNA 1J1ZA 4QYIB 5G0WA 1TTTA 1BHO1 1G8AA 1IMOA 1QHHA 3GGJA 1OB5A 3QXCA 4PYLA 5KNBD 4AJHA 2PWYA 1MMFB 1T3TA 1S01A 1KMIY 1QHYA 3SF8A 1GTRA 3LY9A 3JASA 2HLDD 5LQDA 3E0XA 5HDBB 3VC3A 4EHBA 3OF3A 3EFOB 5KTYA 3H4MA 4OFXA 4B47A 5JCZA 1FYWA 3JD2A 4CU5A 2FEKA 1IAVA 4I08A 3WNZA 3ZVMA 1MF7A 2IGBA 5CFLA 1N6PA 1W4CA 3F3SA 4II3A 3QUAA 4R9SA 1Z15A 3MRTA 2Q4EA 1IU9A 1ENZA 1J2JA 1CHDA 2IY7A 3U81A 4LJSA 2V8BA 2QX9A 3BRCA 3VNAA 4BPRA 1Z4QA 2JVJA 2QT1A 2AIRA 2JK0A 3C3EA 3I0ZA 1RAEA 4PYQA 2HOQA 3PYXA 4D42A 3EB9A 5H8WA 1LDMA 3SR3A 4GSYA 1NVAA 1E8NA 3PP8A 2GN0A 4IM7A 2NTNA 3DCNA 1KOJA 1JR4A 2FJ0A 2PS0A 2WA1A 3FBWA 3G89A 4FCWA 4MAAA 5H3HA 4RSHA 5KVSA 2J67A 1JAXA 2IUFA 4CW7A 3LT1A 4IWNA 5J58A 3B2NA 5LD2C 3V80A 1QGAA 1GNSA 2FA9A 2GJSA 1JA9A 3VTFA 4LG1A 4DT1A 1E0SA 1PCXA 4EB6B 4INZA 4RGBA 4X90A 4OI4A 3IEVA 4YYEA 1QBKC 2ZBRA 2VQDA 3SKYA 3WGYA 4DIDA 2YWRA 4C7OA 3I2YX 4FYHA 3M4ZA 1GAXA 2B2NA 2NXEA 2A4KA 3A1DA 3WOHA 2R8PA 4G0UA 1FUIA 1T4CA 2DKOA 2PAFA 3OBIA 1RAGA 4ZZ2A 3HSSA 4Z1OA 5BV2P 5E9WA 5IFLA 5KVCA 1Q3HA 3JRNA 3HPRA 1G20E 1TGVA 1XFDA 3UQYS 3EVNA 1O7JA 4JH0A 2QV0A 2VJBA 3E22B 3KR1A 1A8PA 2Z8ZA 2F8LA 4EUNA 1NWHA 3EQ9A 3K5WA 3L0OA 3PVSA 5K1ZA 5M34A 3OQ1A 3PBKA 1T4DA 1T8UA 1OR8A 1T9DA 1I14A 1KU0A 1OI2A 1EK2A 1W5FA 3HE3A 3PITA 1UP7A 4GKBA 3WAKA 5TARA 2I2DA 1YR2A 5CW2A 4O25A 5A0TA 1WP9A 4TWBA 3AI2A 5HW0A 2NTYC 2B21A 2QUBA 3PEVA 1NMXA 3JVVA 4EZBA 2GK4A 4EFLA 1L7RA 2HJVA 3GDOA 3ZE6A 1DOHA 4KXWA 4RVSA 4KK4A 5BO5A 2ZJ2A 1J90A 1VG0B 1ZUNB 2XQGA 3JYNA 3KT8A 1DS6A 3PUZA 4FJ1A 4IZHA 4C29A 1FYXA 2Z1MA 2F00A 2AWNA 2XQKA 1IZ8A 3B6MA 3CX7A 4HNRA 4X41A 4EJSB 1AZLA 4D25A 3CWQA 1KO4A 1XLVA 1CJVC 1EQ2A 5AOCA 3OUUA 1Z07A 2JAUA 1GILA 2AC2A 5JFTA 3LOQA 3G2NA 3MVEA 5AKZA 2FPRA 3SHQA 3JTEA 3WK4A 1U1GA 2B4QA 4FIDA 1LWNA 4MWTA 3W2IA 1WB4A 1PT5A 2RC5A 5I9IA 1L5ZA 4QDKA 1D0SA 1U0NA 4JLAA 3JRXA 3SYTA 3CN7A 3TPCA 5C9ZA 2R2GA 1QZ3A 1WKCA 2KWIA 3A4LA 3CLSD 2ICAA 1IN5A 3NM4A 3W5IA 5HS4A 4GW3A 2PPVA 1Y7PA 1U1EA 4D4JA 4ZJYA 1DFGA 4B1FA 3U4AA 3VYSB 3FJYA 2J5KA 2XNHA 5D3QA 5FBZA 4Q05A 3UOGA 3VC1A 3ZWBA 4DXDA 1SUIA 1BHSA 3K2EA 2W22A 1GPYA 4GICA 1JKJB 5G0VA 3AKDA 3BXZA 5EUQB 4QM7A 3NZEA 2XMCA 1V8FA 3T9DA 2J0SA 2XXAB 3HP4A 1M2KA 2C2KA 5CTAA 2I91A 3K20A 5DHFA 2JFYA 2XDYA 5FQOA 3D64A 3OFJA 4DR6B 2AQKA 4RD6A 3PF9A 4BB5A 3WL6A 1KYZA 1DAIA 3KLBA 3BFXA 5EE9A 4QLBA 2VHXA 4DA6A 4WN9A 5KJ1A 1JQ5A 4FMDB 4GVLA 3PUYA 1G3UA 1YZVA 4KQIA 5EPEA 4CM1A 3EVFA 1PU2A 3IGFA 3OCWA 1FNMA 5BN3A 1E4OA 1USKA 2AX4A 2VH5R 1XU9A 4FLFA 2P7HA 1BMDA 4Z8YA 3H9EO 1LBQA 4FINA 4JVLA 5BNTA 1YQXA 5CM2Z 3DT6A 2X1LA 7GPBA 1SBQA 4XGIA 5A4FS 5C52B 4HRYA 2PTHA 1ZKDA 3QA9A 4GGPA 4F46A 1V5WA 3R77A 2Z58A 4MKFA 3DEZA 3GPDG 1SELA 3H13A 5JRZA 2BFMA 4HADA 5HVNA 4KHZA 1FYEA 4F93B 3W4IA 1DPFA 5A04A 1TFUA 2AF3C 3C8MA 4YMVA 3BDAA 4IRMA 3RTBA 4C4XA 4L3VA 2DRIA 2CHUA 1RAAA 4RTQA 2O3RA 3BIFA 4UBJA 2B1JA 4B85A 4EW6A 2NSJA 1JQKA 4IVQA 1OBOA 5E4FA 2FSVC 2JFXA 3FVQA 4GX2A 3UGTA 4B5LA 2JLVA 1OLSB 2O8EB 4JQZA 1FUEA 4PAMA 1AOXA 1WW2A 2UXBB 4C05A 4PO3X 2HY7A 1UM9B 4YRBA 4MEBA 3AEYA 4QECA 2DFPA 2NXCA 1Z4IA 4F84A 2KMLA 1PJ2A 3T7TA 3FDFA 1R8SA 3BMNA 4HVLA 5ARBA 4NPAA 2IXGA 4RPIA 3RVNA 2J9FB 1XJ5A 1MBZA 5EXXA 1G18A 4YHHB 2PKYX 3Q3JB 3TLBA 5AUPB 3FTDA 3ZU2A 4MMYB 1Y81A 4S0XA 2CXRA 3UCEA 4M21A 3VR2D 1OA0A 1ZCAA 3WDMA 4KJXA 2PH3A 3F3YA 1YDHA 4D9KA 2IEAA 1O77A 5HTKA 3I9JA 5CYGA 2EDCA 4H18A 1FEZA 3RC1A 4N5HX 4HC4A 1ZKMA 4DBLE 1UKVY 1HOTA 4XFDA 4OMCA 5ITZA 1LSUA 4TMWA 2BGIA 1L5FA 3BXXA 3CPEA 5G4LA 3UO8B 3ZHUA 1F8GA 1K92A 5KDLA 5ER9A 3HRHA 3UA3A 3V1MA 3ZZMA 6ADHA 1IC6A 3COJA 2XDAA 3QE0A 2FMHA 2Q4OA 2RGNA 2E4WA 3DMFA 3FPGA 5DHPA 4F06A 5LLDA 4BMCA 4C4OA 1NRXA 5FNVB 3L8YA 4R2MA 4V1CB 2C2ZA 1ONPA 2C8JA 3KWJA 4L8WB 4FMPA 4RK7A 1LS6A 3KLNA 4X24A 4W5OA 2W5UA 3DTVA 2VDQB 1HY3A 2F8MA 1ENOA 1FPQA 1ZBQA 2O6HA 3KS9A 1V3QE 2DWOA 5TGZA 5CB8A 3TLZA 1XDGA 2KQUA 4FP9A 1FVOA 1EUZA 1ARZA 2REBA 1XZIA 3CZ9A 3CB4A 3HDTA 2JGNA 3IOCA 4GEKA 2HQ1A 4K8RB 4NTZA 4OYYA 4FVTA 1VZ2A 1WCXA 4J0CA 4EVRA 2YNMC 4F1KA 2XF2A 1TA9A 1X1QA 1E9RA 1DC6A 5EJ8A 1HYGA 1CZHA 3PYLA 4IKEA 4MUYA 5FTNA 3K5PA 1B0UA 3LQ2A 1PR1A 5LCXA 3V34A 4HGYA 1BE6A 4TYMA 3C7CB 2R5WA 3ILSA 3KU4A 3HBFA 2W6QA 2C2GA 1XEWY 3C8ZA 3M6FA 2C84A 1E6LA 4RH3A 1M2HA 2IZ1A 4INJA 4QAQA 2HAEA 3IAM1 4E5MA 1YK0A 3FR8A 2I2AA 1YI0A 5AESA 4G41A 2WF5A 1GTZA 4D43A 1RXWA 1SEPA 3ZH9B 5MN4A 1RDFA 2DQ4A 1T1RA 1JYEA 3PNSA 4OB8A 1PV2A 1M2OA 3MWDB 2O1SA 1MQ9A 2CJPA 4LZZA 3UFXA 1RZUA 1FLAA 4PR3A 3AJDA 3PEWA 2B4TO 4YRJA 3OAAA 3KOOA 3LCCA 1V41E 3LPNA 4JZKA 4LRYA 3KQTA 3QTLA 2OHXA 3GAZA 3RR2A 4CLDA 3TIXB 3COVA 2E5FA 3NG1A 1N6HA 2HDWA 2HA7A 3KT0A 3KPWA 5F9FA 1FTYA 3W2FA 4AZWA 2ERYA 3GQBA 4KI0A 4PCAA 1N78A 4WHMA 2IE0A 3DB1A 1X39A 1NUTA 1E2QA 4FW8A 4LYAA 3JYOA 1UJ4A 1J7KA 1NF9A 2VO1A 1WV1A 4YWJA 1WCV1 2JFFA 4HGPA 1VL6A 3EJWA 1P62B 3EZXA 2P3LA 1CR4A 1NT4A 3ECAA 1XKXA 1ADCA 2D5CA 1HE1C 2WI8A 2X2PA 3M5PA 3NTLA 1M2VA 1R88A 1REQA 1SVIA 2X9LA 3ZE8A 3B1ZA 1RP1A 1OKKD 1CYEA 3BIJA 3DD1A 2D62A 1XZFA 4QYXA 3RVBA 3ZGLA 2GD0A 4BCDA 3L92A 4CM7A 4ETNA 1EMDA 1E9AA 5FORA 3NIWA 2Z3WA 1G21A 2FG5A 3P52A 3ND5A 2ZREA 3GBSA 2W2KA 3LUDA 3PNLA 4LNUB 1NFRA 3G0OA 4U00A 4B6QA 3E1KA 1JPNA 4KR3A 1WU7A 2PKXA 2RGBA 4NK5A 3A10A 3D5EA 1C9MA 2CXTA 3IAHA 4MHOA 3WO0A 4Q4JA 3ZE1B 4DMKA 5BSEA 4GZMA 3F1LA 3W34A 4A6PA 3GUCA 2ZBVA 3NOXA 5FQNA 1N75A 1I0IA 3WXMA 1UFRA 2B6HA 2CL6X 4UBNA 5SICE 1A2QA 3QVUA 1H2ZA 2QIOA 1X7HA 2PX0A 4M3NA 2ZZNA 3DD5A 4D1YA 3SIWA 2BZGA 4NY1A 4E30A 1GGKA 1ZITA 2WG2A 1YDGA 4FI3F 4QDOA 1P17A 4R6XA 3N9IA 3ZI0A 2PRSA 5FWNA 3RRYA 5A05A 2WJZB 1LV7A 3AFIA 4CG2A 4GR5A 5M7EA 5AW0A 3GPBA 4PC1A 3ICEA 1ZONA 3L1IA 2AD5A 2C9CA 2XQJA 4R9RA 4ERXA 3OOYA 4XGNA 3D3QA 1J7JA 3EUWA 1UH5A 4I1OA 2VNHA 2O2IA 1AKQA 1F12A 4CIXA 3A06A 2P9HA 5DM4A 4LF5B 4EDFA 3FHLA 4IQGA 5EPUA 3W04A 5B53A 4QVIA 4FLEA 3WGTA 3VU8A 2JAPA 3DFFA 1WABA 2R60A 2ZKIA 3F90A 1JPUA 1IXRC 3UV7A 3QUCA 2Y92A 3C5EA 3ZWPA 5L7TA 3KKPA 2MSNA 1JE1A 3MYYA 4Y9DA 5F33A 3D8SA 1HDYA 3EPPA 4HZUA 4LRXA 3OJ0A 4CCYA 4Q12A 1GZVA 1DBWA 1PG2A 1LRKA 1EA5A 1JG1A 4BQQA 3BH7A 4GMHA 3F4KA 3RJ5A 2UUAB 4KLRA 2ODQA 1P4GA 3WIBA 1CR2A 2HKIA 1WWKA 1ZUD1 2C96A 2HZBA 4BNMA 3SIRA 1Q7RA 1UF9A 1TJYA 4R6WA 3ZDAA 5HIIA 2WMOB 2W6CX 1C29B 5FOUA 2C1ZA 1KKMA 1RQPA 1J2EA 4G5HA 2ADFA 3SPXA 2AWOA 1NX6A 2CLDX 3AHGA 2PUDA 1VE5A 2P91A 4G56A 4ZXFA 2R7KA 2IF2A 2JDIA 1G9TA 1AKUA 1HDZA 1NW5A 3QMMA 4UEQA 4E31A 3GFPA 3FNFA 5L4SA 3O8CA 1UJNA 5KQGA 4QX6A 1EDDA 4AJ9A 4HOYA 2J6CA 3P2OA 1GQ2A 4K9NA 5GJBA 1ZPDA 3RYCA 3RSSA 1XNHA 1Z26A 2HTFA 4GPAA 3K09C 5J23A 3AJ9A 5DCWA 4INOA 2GAFA 2PLWA 4V0ME 1E1MA 2I6TA 3HN6A 5AKLA 1HZZA 4J7UA 1G5QA 1NBMD 1UQTA 3KOYA 5U1PA 4EDHA 1I10A 5EFOA 3MCUA 5D3MB 1X15A 2VSXA 1FP6A 1DUVG 2OK8A 2XUZA 2ZEJA 3E1SA 3PICA 4NC9A 3MTDA 4GYYA 1LK5A 3UENA 4A5SA 1E1RA 1GU0A 3GJ8A 3GZNA 4ZFNA 4C3OB 3EPJA 1M7GA 3R8FA 2VPYA 2JIZD 1ML4A 2XECA 4WL0A 5C0OE 3RFUA 4DYHA 1QKKA 1SCAA 2RAVA 4QT0A 3WMFA 2I34A 2HHCA 2WIBA 3OO0A 1I2MA 3CSUA 4GR9A 2P4EA 3OP4A 3U48A 2RI0A 4E2ZA 4EL5A 4QTUB 1XRRA 3OJLA 4HLCA 1LKZA 1JVSA 3FM9A 4PLGA 4N48A 2ZYAA 3PQEA 2PLNA 3F3MA 4KGDA 2ZAOA 2ATXA 3G0CA 2XMGA 2QR3A 4G0QA 2ZBFA 3WTBA 2DUJA 3ROGA 1QM5A 4J29A 5I8WA 1YE8A 3PNQA 2Q3JA 4KGVA 5G0UA 5KHAA 1QVZA 3RAPR 3LO5A 4I55A 1WX1A 5I9BA 3E84A 1DV1A 2F17A 3FKQA 4C6HA 4QU8A 2BT4A 2V7PA 2YFKA 1GSAA 2YN2A 3HM2A 3UMJA 2PIDA 2WRZA 1JIQA 4PW0A 1ZGBA 5ESDA 4UKDA 1SVNA 1P8JA 4CTKA 1RCTE 1AUVA 2ZU6A 1EZ1A 2ZWAA 4LPSA 4LVOA 4RHXA 4NATA 5LYJA 3P9SA 3K0SA 2PYDA 5EYPB 3GRPA 1JDJA 2C5HA 3NBUA 4AUNA 3L02A 3WLQA 5F4ZA 2XUFA 1GPH1 4FFNA 5A0FA 3U4QA 2VK8A 5KTNA 1OI3A 2ARKA 5AR1A 5HRAA 3ER8A 3W5BA 4P9NA 5B3JA 3UWKA 2JLZA 4I19A 4LOAA 3OEED 5E2IA 1D8TA 3W7AA 1SVSA 5G4KA 1E3TA 2OBBA 4AX4A 1D1PA 2C2XA 2ZETA 3B82A 3NDIA 1DCKA 4R8MA 1GPAA 2CYCA 3E7WA 4J49A 1L5WA 1XAIA 4HEA1 3UM9A 5JR3A 2FMTA 2OB1A 3LDAA 4AWAA 1PYGA 6PFKA 1F7UA 1WM1A 3CVOA 4JJEA 3DVAA 1XWWA 3ZCPA 3MT8A 2XAAA 4TTQA 1CUUA 1O5IA 4PWYA 5FPPA 2XBLA 4EHJA 4DCVA 1G63A 4MLDA 4BKPA 3IAM6 3CXRA 2HJHA 3FWYA 4M9RA 1BU8A 2AG1A 4A03A 1BGVA 3PNKA 2YRFA 2YWGA 4KGZA 5AVUA 5JVDA 1YR1A 3UG7A 1KDPA 3JZDA 1S2IA 4LECA 3BJIC 2CC2A 3GJZA 3OLVA 1LQ2A 1QCCA 1INLA 2MMCA 1ULZA 5DNUA 1I2ZA 3GLGE 3FCYA 3DBHA 4HK4A 3WHKA 2IYRA 5IX8A 3H2HA 3TINA 3D2BA 1T15A 1DBIA 4YLEA 4X7MA 5DXFA 2C3PA 4OIFA 5SYMA 3SKVA 4C21A 4AY6A 1GPUA 1GZSA 1A9TA 3RNLA 2QPOA 1NXXA 3EGXA 4OL0A 2CMGA 2AG5A 1SQSA 4B0PA 2P6PA 4P7FA 4Z4FA 3FNIA 3MJTA 2VTBB 2BEVA 3NKVA 2IHUA 4Q4AB 1R8QA 2PD6A 1J0DA 1NJ8A 2H1LA 3FWNA 5KEIA 1ZCFA 1RYYA 3R20A 3RGWS 4Z7QB 5IVHA 2XPCA 4BFYA 1AS0A 1KMMA 3KTDA 2PGNA 1M6NA 4HRAA 3SYMA 3A2KA 1K7YA 5EWMA 4C2TA 1KP9A 1QIJA 3AF0A 4JWTA 2CB0A 4UM8B 2YDXA 3I37X 1Y9EA 3JQDA 1Z7GA 4Q02A 1DFHA 3SQWA 1G0NA 4ZCQA 2CHFA 2PUVA 3KKKA 3S4YA 4IP0A 1JFFB 3SQOA 2AMVA 1X1RA 3QXXA 2WDZA 3AL2A 4L9RA 3HC7A 3EVCA 4XAQA 3RS9A 2EW2A 3MILA 3OD5A 2F67A 1GZ4A 2CE2X 2CGEA 3PUXA 3EIUA 1RHKA 3R4VA 4B7ZA 3RS2A 4CR6A 1UFKA 4Y2TA 5CBPB 4MV8A 4BLWA 2XRFA 3KQNA 1TU0A 2JBAB 5JD5A 2VXYA 5LVAA 1CJUC 3H84A 4HLNA 4ZO8A 3WMWA 4IBOA 2Z0MA 4A8JC 4QGGA 5IK2A 2IYUA 4FR5A 5D1NA 1LSJA 4R8KA 3FDJA 1SQ6A 1ZD3A 4MRSA 3N07A 2FMXA 3RIMA 4ZIRB 2Z8XA 4HNSA 2ZQ5A 2NPFA 2H3HA 3L6EA 4CG1A 5JFOA 1GZHB 1GKKA 3ZLVA 3UB3A 4L5JA 4TTVA 4DQVA 5AM3A 5HOEA 5HWSA 2HIGA 1NJSA 2I7XA 1JA1A 3LI2A 1H0KA 1N0WA 1FU8A 2G6BA 5LBTA 4AZTA 4CR8A 4CLRB 1IHXA 4EA6A 4HY3A 2XZDA 5KX5A 2PO5A 4MGKR 4TUYA 4YMIA 1JEEA 5GGYA 3NUQA 1BDHA 3GUYA 4OHCA 3VR6D 4R0VA 2B2CA 3JWPA 5E38A 2F3UA 2XDWA 1YS6A 2OFWA 3EGWA 1NVBA 1TMOA 1Y7LA 3KDSE 3PEUA 5FTKA 3VTAA 4WTOA 2PUAA 3PEYA 1UC4B 1ISPA 2H1CA 1OT5A 2QVBA 3PZBA 3JU3A 2JI6A 4RXUA 4F3NA 1W93A 2WUEA 5FDFA 3LHFA 2L2QA 3OZEA 4HD8A 1M83A 3LT0A 4REQA 4BNJA 1WUKS 1JYFA 1UOQA 1Q44A 4B7AA 4BBAA 1T6XA 2H7XA 3WKEA 4WINA 5CA1F 1Z37A 2ZUVA 1Q0LA 4GXNA 4XX1A 5ADWA 1KI4A 3GBPA 4P32A 2DERA 1IN1A 3QWIA 3TM4A