2IEYA

Crystal structure of mouse rab27b bound to gdp in hexagonal space group
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
164
Chain Sequence
b'GDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDFKVHLQLWDTSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-27B
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 37
structure length 164
sequence length 182
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ieyA00
4HB4A 5BXQC 2WPDD 1EESA 1DG3A 1YU9A 4C0QC 4CDGA 4NBSA 5D3MA 4QNRA 4YLGA 3ZQJA 2FPMA 4Q48A 3NVAA 4DLUA 1R7RA 3CWZA 1E9FA 1SKYE 721PA 1CLUA 4ABYA 4DIEA 4KV9A 4QGAA 1MO3A 4YXWA 2ZJAA 3T1VA 4CEHA 1XPUA 221PA 2QI9C 5BN5A 1P60A 2HLDA 1OH8A 1YRAA 1KMHB 2YVUA 4TYNA 1ZM4A 5BYJA 4LBZA 3TAUA 2OXRA 4HZUA 4Q9LA 2GBLA 4JLDA 3AF2A 3IO5A 4HDCA 5L3RA 4ZIRA 1E94E 1GRRA 3GLHB 3GJ5A 1L4YA 4CEJB 1KI7A 4KHZA 3KFXA 4RFSA 4QHTA 1U94A 4LBYA 4TLCA 1MV5A 1FX0B 1XTJA 5AR1A 1OFUX 2IYZA 3RYTC 4HAWA 1W47A 2BMEA 4D4MA 4EQ6B 1OXXK 3QEJA 1IJEA 5KSYA 3PJRA 2AWNA 4A82A 4D25A 1DO2A 3NC0C 2XXAA 2XX3A 3KJIA 3GJ0A 2ZI6A 3CONA 3TAHA 2PLFA 3PG5A 1IBRA 1KK3A 1CJKC 1KK1A 1NVWQ 4FMBB 4IEEA 4Q4HA 4V0OA 3PUXA 4GOJA 4NPHA 4Q4JA 4POAA 1G4AE 4CVNA 3FMPB 1CBUA 5KTYA 1G3MA 4MQBA 3QSYA 3EPLA 1WA5A 4TYWA 1W7AA 2Q9AA 4NONA 3QNUA 1W36D 2ZJ5A 4V0KA 4EPRA 3GEEA 3CRQA 5JWHA 2W0SA 3MMPA 1KI3A 1OFIA 3K0CA 2W2XA 1KI4A 1Q3HA 1XBTA 1KZ7B 3AQ4A 3KJGA 3UXMA 4RZ3A 1Q1ZA 4LV8B 2NO7A 2P65A 1IHUA 5JCPA 3EX7C 2QSZA 4LV5B 1E3MA 2KJQA 3R7WA 2C78A 4GOXA 3OIVA 2BBWA 3P26A 4X8LA 2XTMA 4URXR 1XXHB 5FL7A 3A58B 1AQUA 3VNUA 3ZZTA 1NN5A 1XD2A 4QOSA 5FUVA 2C9CA 3RHFA 3Q72A 1CRPA 1TQ4A 4FMCF 4TLBA 1JALA 1VG0B 2JLRA 3KUDA 1NSTA 1SXJD 3B1ZA 5FPKA 1EFUA 2H8KA 4LJAA 4PPGA 1W0KA 3OAAD 2QROA 2HYIC 3VKGA 5C4MA 2FFBA 3IPYA 3WNCA 4MGYR 2GTPA 3WYGA 3L43A 4CT4B 1YZTA 2VF7A 2GJKA 3B78A 3L0OA 3PXGA 4C7OB 4M8NE 2IYSA 1HTWA 4YQFA 1Q20A 1J70A 2BC9A 2QP9X 2B21A 2W2VA 4OHWA 5AUPB 2QENA 4IDOA 5FOVA 3KQNA 3GJ6A 3M6AA 1CKEA 1E79A 3F8TA 5B64A 1OH7A 3GD7A 1DE0A 2D2EA 4D2IA 3BFXA 3RWOA 2GHIA 2ANCA 5KNDA 1GVNB 3C41J 1H8HD 1LB1B 1US8B 1XTSA 1K5DA 3DZDA 4GZLA 2G9NA 4UNRA 3G0HA 2N46A 4LJ4A 2P3SA 1MOZA 3SN6A 2GEVA 2W6JA 3K0FA 1AK2A 3T61A 3R8CA 4XD7A 5FBVB 1E2JA 4JLKA 2VYFA 1IY2A 2O8DB 2AWOA 3KDSE 3P32A 4M9XA 3ZD6A 3C14C 3EIEA 4NHOA 1P73A 2ZE7A 3CPJB 4F4JA 621PA 3HJNA 1NVVR 1AS3A 4BQSA 4C0KA 3NDBB 1K8RA 1CU1A 3SFVA 3ZLJA 1HQCA 3DMDA 1XP8A 4K81B 1I4LD 2GDJA 4URWR 4BZPA 3ONWA 1YRBA 1T8UA 2QM8A 1RVDA 1UDWA 4LOAA 5DI3A 4PQFA 3RRMA 5K8UA 1CIPA 1NJGA 2J7PD 1F3OA 2CNWD 2J0VA 2J5XA 4C3ZA 4MRPA 5CIWA 1F2TB 2ZRIA 4MA4A 5KOYA 4CGZA 2EFHB 1RKBA 3LX8A 5DYGA 2PBRA 2F1HA 1KDPA 2ODBA 3RNLA 5GJCA 4E22A 5JJLA 2XOKA 1YZLA 4KCGA 3KQUA 2HXYA 4OQLA 4DCTA 2KI5A 4PSVA 1L7VC 2L0XA 3IPXA 5CYOA 3U7GA 3SYLA 5JWRA 4D80A 4JLBA 2H17A 4DLSA 3SJBA 1F2UB 2QM7A 3QKRA 4G1UC 2YYZA 3U7FB 1U0LA 1T6NA 2WKPA 1YZQA 3L8ZA 1G20E 1QG2A 4QKQA 4R9UC 3RS3A 1AJEA 1N2CE 1N5LA 1G64A 1P2VA 3CBQA 3MCAA 4LZZA 1WF3A 1ZUIA 3RC3A 3B85A 4ZI2A 1IQPA 4US2R 2QA5A 1O87A 5F2EA 1KDTA 4DLZA 1E2MA 3B6EA 1KI6B 3ZZUA 2W6ID 1ZUNB 3MWYW 4PAMA 1R0ZA 1Z3IX 2FWRA 2ZS7A 2KWIA 1LV7A 2ZREA 2RGAA 2J9RA 3MD0A 2FSGA 3KKMA 2IYRA 3THWB 121PA 2Z6VA 1Z63A 1DPFA 1NG1A 1GITA 2GZDA 2NO9A 4A8JC 2OCYC 3LQRA 4OHYA 3K09A 1TPZA 4IRUB 1NN0A 4LBVA 1P7CA 2HCJB 2WWHA 3JVVA 3GLGE 4C0BA 5J4LA 4PQRA 1T5IA 5ELXA 1FUKA 2BMFA 3P4YA 5DYIA 5JHGB 1NKSA 5KHOC 1KYIA 2AKAB 4OJKA 3PITA 3DOFA 2FFHA 4V0LA 1DELA 2ZVQX 4B48A 3IIKA 2FZLA 1IN5A 3W8NA 1A2KC 1W36B 2VSFA 2A3RA 3PUVA 3RRZA 2CJWA 4KSCA 3SI7A 3CX6A 3B60A 4HB3A 1U8YA 3MJHA 4HYYA 4RY2A 2QP4A 1QG4A 4B74A 2XTNA 1PJRA 4JT4A 1Z6GA 4U5XA 1W4RA 2PX0A 4KYUA 2QY9A 4DBLC 3KB1A 1A82A 1N3BA 4P3YA 3RC8A 2VSXA 4OQXA 3O8BA 1FW6A 4CEIB 4FWTA 1BKDR 1J8YF 3HR7A 4OHXA 1EX6A 1N6RA 4HAUA 4IJMA 2HT6A 4GMDA 2J3EA 3B8HA 2CL0X 1KSGA 3C16C 3EPKA 1R0YA 2WSSA 4JBXA 521PA 4RKEA 3T15A 1L2TA 3D6TB 3LD9A 3AVYA 5JCZA 4PPQA 2ZJBA 2BVNA 3M1IA 1IN6A 4GOKA 3HU1A 4M1MA 3T12A 1WQ1R 3THYB 4F4IA 2VHJA 2WAXA 2GEUA 2ONJA 1QHYA 1E6CA 1F48A 4GNKA 2PX3A 2WPDA 4IEIA 2QAGC 3ECCA 3TUJC 3WMFA 4QM7A 4YONB 4TQUS 3TGPA 4AYXA 4Q9IA 4TMVA 1AN0A 1FP6A 1VHTA 2AK3A 3U4QB 3LW8A 1FFHA 2WWXA 2R6GA 1VG9B 2REBA 2Q3MA 3UMSA 4IOKA 3N70A 2XB2A 4PPFA 1WCV1 4BZXA 3KKPA 4YDHB 2QGNA 4TSFD 4G5SA 1D9ZA 1W4AA 4EPXA 2ZROA 2P6NA 1U9IC 2OFXA 3VR6A 1KTVA 4UXHA 2J46A 4DDVA 2JGNA 4DB4A 5LPNA 5AUNB 2Z4SA 2J0QA 2DR3A 5BYKA 5SZKB 4PANA 4NP6A 4B3DA 4NZYA 2BCGY 4LYFA 3H0KA 3UWOA 2FOLA 3ADKA 4B2PA 1EFTA 3EZ2A 3H86A 3UG6A 1UJ2A 5HZKA 2X77A 3LY5A 1TADA 2ZS8A 2J0SA 1Z0FA 1E96A 1Q57A 4X8OA 1KSFX 3AF1A 4Q4AA 4KBGA 3W6OA 3T1OA 3THXA 2JLYA 4PTLA 3WHKA 5B30A 1RJ9A 2Y8EA 3X1DA 1MABB 3RSLA 1LS1A 1ANKA 1K5GA 4GP7A 5CJ2A 1NNEA 1G6OA 2VP0A 4Q01A 2ZSBA 5FBLB 1G7RA 1NMYA 2NQ2C 4IFBA 1Z0DA 5TXGA 1E2FA 2O8EB 1Q1BA 4AKIA 1B0UA 1JPNA 1MKYA 1DG1G 3N2EA 1T4GA 2YINC 3NHBA 1X8JA 3CH4B 3MGCA 4TTRA 4XWAA 4OQNA 2JCSA 1Z6TA 4Q03A 1D8TA 1G8YA 1S3GA 4UNPA 3TMKA 2IYXA 3ZS9A 1TU3A 421PA 1FMJA 5EE5B 4BUJA 4KI0A 4AD8A 5F3WB 4KODA 2OT3B 2FJUA 3OE7A 2VLIA 1TF5A 1U81A 3LRPA 3TLXA 4DDUA 3GLFA 1QRAA 2J1LA 3F5FA 3K0CC 4LC0A 4BFXA 1NIJA 5ANRB 2PMKA 2QU8A 3QKSA 4MRNA 4QC2A 4JLNA 1IOZA 3UANA 1SXJA 1HEIA 1S96A 3HWSA 1N25A 5K8IA 3UK6A 4JLJA 2C95A 2ZANA 3B9PA 1VG1A 4V02A 2B7CA 3QI2A 3MAAC 4OKSA 2JJ1D 3AUXA 1OYYA 4ARZA 5IK2D 3W8RA 4Z54A 2X19A 4HSEA 3DOEA 4MYTA 1IAQA 4M2LA 2FGJA 2SHKA 4RZXA 2YHSA 4CIDA 1OXSC 5C18A 2O8CA 4HB2A 1GIAA 5C46F 2J7KA 4N0EA 2JLUA 2ZE5A 1QHHA 5KSOA 4NYMQ 4DEYA 1H8HA 2PT7A 5CLLA 3A1VA 5FPSA 4RZ2A 2EYUA 3IIJA 2YWHA 3ZIAD 1ONBA 4NE2A 4TMWA 4A6PA 4QRHA 4AI6A 1P2UA 1ESMA 5G53C 2O8BB 2FA9A 2ZAMA 1XZPA 3L0PA 3PUWA 3WRYC 2HXSA 1ZUHA 3QPUA 3B1YA 3QXCA 1HH4A 1E2GA 2PL3A 4BWYA 5JWOA 4JYCA 1JQLB 3DO6A 1PLJA 1UKYA 2NPIA 4YMVA 1ODFA 1Z2AA 2DWOA 3JZAA 4B6EA 1N0UA 1IXRC 2AX4A 1NG9A 1ZAKA 5DN6D 3PUYA 2J7PA 1FMLA 2CNWA 1Z6AA 1I4TD 2WBLC 2ZRMA 2GAAA 4HUQA 1OT3A 3THOA 4A8JB 3R20A 4OQMA 5FOUA 1H65A 4NYJQ 1IY1A 1CF4A 4RD3A 3S1AB 5SZIA 2JASA 1NBME 1GP2A 1KNXA 3LAWA 1GWNA 1GRNA 4DC9A 5KU1A 1UBCA 3W9YA 4JVNA 2F9LA 3A1WA 3AB3A 1N6PA 2MSEB 3WY9A 1EFCA 4UJ5A 1XPOA 3SDZA 1IN8A 4QL3A 2REOA 5D3QA 5J4YA 3U60B 4B2LA 3KB2A 1KAOA 4AYTA 5F9FA 2B92A 3IEVA 1N6OA 2FEOA 2QBYB 5FOWA 4RD0A 4RVCA 3U6KA 1HA3A 1TEVA 1JR3A 1ETUA 2B7BA 1OYWA 3KL4A 5FUYA 1VG8A 4AYWA 1XZQA 4J0QA 3A4LA 4Q9JA 1N5JA 1X86B 4R98A 1J2JA 4BRWA 3W3AA 5CM8B 4QJ3A 1G16A 3CRRA 3J81k 1XJCA 4R7ZA 2JLQA 4H1UA 4EKDA 3AF0A 2BM0A 3NDPA 2O8FA 2AD1A 3QUSA 3U44B 3VR5A 3GJ4A 1PV4A 3P1JA 2H92A 3LA6A 1ZIPA 2W6IA 3HU2A 3TQFA 2RGXA 3QOFA 2F9MA 5KYKA 4KFTA 5GADl 3TVDA 3QVVA 4AKHA 2OESA 4G3XA 2ZRNA 2H7VA 3LDAA 4L4UA 4Y0VA 4DKXA 1NN3A 3ND9A 4FINA 2WHXA 4H9GA 2IBMA 1Z5ZA 1ZNZA 2RCNA 3OHMA 4M1SA 4MDFA 5LBIA 4IVQA 4JBYA 2QAGB 2AFIE 4G5GA 4I1SA 5IF9A 3TW8B 3FFAA 3P4XA 2B8TA 1D5CA 1ZC4A 1P6XA 1E32A 2JLSA 4DSNA 4PHTA 2GWHA 3F0TA 1QHIA 5JEEA 2QE7D 1AGRA 2NOAA 3K0EA 5L3QB 1YKSA 2OG2A 1JEDA 2R6DA 5JSZA 3K09C 2CMKA 4AG6A 4ILEA 2EQBA 4JLOA 1VIAA 2IHBA 4QHYA 2ZI4A 2C96A 2YV5A 1G21E 3TSWA 3PVSA 1GILA 2DBYA 3W5IA 1DARA 5KPDA 2YJTD 4F4CA 1WBBA 2PZFA 1LF5A 4N3NA 3IHWA 4XIGS 2VEDA 1OXVA 3DEFA 3A6PC 1LW7A 2QEQA 2K5UA 4HLUA 3CNOA 4Q1CA 4MYUA 1VYTA 4NYIR 3MUFA 1X1SA 2HYDA 5A4JA 3PR1A 4EIWA 1ZC3A 4DUGD 3I73A 3KTAB 4TLDA 821PA 2LKDA 1N0WA 1OHHD 1JR3E 4JYBA 4C0HA 3FKSD 4DCSA 4E03A 3BH0A 3RS0A 1E9AA 2FH5B 4BFUA 4DLWA 2ATVA 5BN4A 1YZKA 1Z08A 2D3WA 3K0AA 1C9KA 5FUXA 4BLOA 2ZYUX 1K6MA 1IXSB 3SHWA 4V0NA 3AGPA 2AXNA 1T8TA 5FFMA 3K70C 2G0NA 1JAIA 4FMDF 1XEFA 2XJ4A 5LD2C 2GXQA 4Q4LA 1KY3A 2QQ0A 4WXPA 2XXAB 2BEJA 5L3VA 1C1YA 3O8CA 3V9PA 3AKCA 3EG5A 3GQBA 4H1VA 4U02A 3DKVA 4LJ7A 2WJHA 4P4SA 1U0JA 2GILA 1WDTA 3I8SA 4MYHA 4Q47A 4XSHA 1DADA 4TSFA 1G6HA 4GZMA 1KNQA 1M34E 1S9DA 4DSOA 3VKHA 1MH1A 1E0SA 1KDRA 2D4HA 1Q22A 4S2EA 4D0GA 4DIDA 5TDHA 2ZQ5A 2HT1A 1X1RA 3BE4A 4HAZA 2C98A 3RS5A 1TMKA 2H57A 5FBWB 2QL6A 3AEZA 1KI8A 5EXXA 2FZ4A 2HV8A 5DNYB 4LYHA 2J0UB 2TMKA 2V6IA 1RYFA 3O47A 5FI0B 1Q1EA 3E70C 2IL1A 4BEBA 4XWKA 4C2TA 3AVOA 2BEKA 4DLXA 4B32A 2OCPA 3I8XA 4EPVA 8OHMA 3U7HB 1XD2B 2UZIR 4C30A 4URUR 4G5QA 4DXAA 3BRWD 4RD1A 3QE0A 1ZCAA 4GT1A 3BXZA 3N2IA 2P5TB 3CM0A 5IRCD 2E1RA 3K9GA 1CULC 1RRGA 4R2IA 2IYWA 3BFKA 3CNNA 3D31A 2X1VA 2VP9A 2ZYTX 4ASUA 3WBKA 2NO0A 4WIAA 5HTKA 4B75A 2GEDA 2JA1A 3NEYA 1ZD9A 2HUPA 4B2IA 2GCOA 3W34A 5FPTA 4LJ9A 5DO9A 5HPYB 4Y0AA 4BPBA 4JLPA 1T3LA 1V5WA 1YHNA 2C9YA 3GLIA 1E9RA 1N5IA 2Z4RA 2C8VA 2VHTA 2R62A 2WAYA 2ZRJA 4A2PA 3TK1A 1TQDA 2QMOA 4ZDKA 2GCPA 1JNYA 2QZ4A 1NVUQ 1ZNWA 2LWIA 3E1SA 3CKLA 1IONA 2GVDC 4HAVA 1E9DA 4XVRA 3RLFA 1EK0A 4YMUA 1VYVA 2JIZD 3QKUA 5CK5A 3T5DA 2PMDA 2QMHA 2I3BA 1E9EA 5HE9A 4P4TA 1HQYE 3GLGB 1QDEA 2VL7A 1S8FA 1E9BA 1T0JB 4ESVA 4F92B 3WRXC 2JJ1A 3ZD7A 2HF9A 4PZLA 2MSDB 5IK2A 1J8MF 3QF7A 4ZDIA 5HKKD 1Z0KA 2GJ8A 3TRFA 2BIFA 4FXPA 5CDFA 1JI0A 1U8ZA 4YMWA 3U7EB 1DAIA 3A37A 4B6FA 1Q12A 3FPAA 1KAGA 3AP3A 3EASA 4ZCIA 1FUUA 3CIOA 3AVQA 5JRZA 1CJVC 4LJ5A 4GBMA 4U00A 1SZPA 4O2LA 1L4UA 4Q1AA 2WJYA 1GDDA 4Z8YA 4HUTA 4MH0R 3SNHA 1IN7A 3VTKA 2CHVA 3CO5A 3E2IA 4LHVA 4QJ5A 4A9AA 4NCHA 5DI9A 1MRNA 3GEIA 3CR7A 3L0IB 4DEXA 2RB4A 3ZH9B 4PR0A 3QKRB 2KB0A 2QTVB 1KO7A 3A1SA 1E2HA 4LBWA 4Q02A 2GK6A 4YDSA 4QBFA 4LDJA 1CRQA 1BYUA 2BBOA 1NRJB 2AL7A 2ERYA 5JRJA 1HUQA 3I61A 1N6HA 1HURA 3CX7A 1S1MA 4EFNA 4FCWA 5CB6A 2V55B 3K9NA 5DN6A 4LJYA 5EXSA 1RW4A 3Q3JB 2P2LA 5GJVC 4FWIB 4D26A 2N1BA 1KMHA 2AFHE 2GAOA 4UXJA 3KXIA 3Q5DA 2F7SA 4DLRA 3AH8A 2P6UA 3VU9B 4IFEA 4OQFA 3Q5EA 4DDWA 4BFVA 3OEED 3GLHA 5CIQA 2ZUBA 4EJSC 4CEJA 4A6XA 1JJ7A 2EFCB 1W46A 4OJQA 5FOTA 3CPEA 3CW2A 3CB4A 2IYYA 1FX0A 2V3CC 3C8UA 1G3IA 3IEUA 1PUJA 4AURA 5GJBA 1KI9A 4PX9A 2WJVA 5FR2A 1P62B 2Q3HA 4JLAA 2JAQA 1EXMA 1R5OA 2DFTA 5TY0A 2OFWA 4BGDA 2RHMA 3EWAA 2HJGA 1N6NA 1P5ZB 1OLOA 2ZSFA 3DM5A 4KVGA 1E2IA 1SQ5A 3BD9A 4KFRA 2ORWA 2ZRCA 2QT0A 4LPSA 2G6BA 1G1MA 1P72A 4UJ3A 1UEJA 3ZGXA 4LC1A 3SYKA 2ZI7A 2P6RA 5M04A 3SEAA 1SVWA 4B43A 5CDFE 5JECA 3F3YA 3OESA 2ODWA 5LB4A 3GFPA 5AWFC 1MT0A 4CF7A 2NTYC 3I4LA 1GL9B 4IKEA 1S0UA 3D7MA 3WMEA 1G8FA 4LHWA 4IVRA 3NBYC 2V54A 3FYHA 4B76A 1G4UR 4ZKDA 4IOLA 5TB5A 2EWWA 1HV8A 3FMOB 5EE0A 1XCMA 2XZLA 2ZRFA 1M7GA 3OFNA 3SR0A 4XWOA 4E07A 3U61B 1UAAA 4NCKA 2QPAA 4XVUA 4PO8A 5EP1A 2VTKA 3NH6A 1UM8A 2FSIA 3QIAA 2W0MA 3EZFA 4YC7A 3CWQA 4F38A 4QNMA 4XVQA 4URYR 3K70B 2P5SA 3SJZA 3I72A 4MUAA 1OE0A 1TL7C 4V03A 1KKLA 2EW1A 2AXPA 4M1YA 4P32A 3T1QA 4TL9A 3TUZC 1XD8A 2IW3A 4P33A 1XXHA 1NMXA 2Q3FA 5JI3E 1DTSA 3CZQA 3QQ5A 2VBCA 2AD5A 3QBTA 1XEWX 2BCJQ 2G83A 3RDPA 2G1JA 4UNNA 2PH1A 2VO1A 3R9WA 3V4FA 3UMFA 5E4FA 4BZQA 3FOZA 4OL0A 1ZNYA 3QBVA 1X6VA 4I4LA 1XJQA 3UWKA 2A2ZA 1KO5A 2BMDA 1R8SA 4DRZA 1EGAA 4LPKA 1UBFA 1NVVQ 1KZGB 3WBJA 2NO1A 1E0JA 4LJ6A 4DLTA 3QXSA 1EFHA 1YR6A 2QPTA 4AIIA 5H8WA 3Q85A 3GLHE 3NBXX 3RWMB 1G3RA 2IXGA 5K8LA 2F1IA 4IOMA 5E95A 2XTZA 4ESHA 4C7OA 1VCMA 4DUGA 1DAKA 2Z5FA 2VIIA 3LH5A 1DVRA 4FMCB 4NMMA 1OHHA 1CR4A 1Z28A 3FKSA 1RPZA 1II8B 1TUEA 3ASYA 2ANBA 4GP6A 4DHEA 2GETA 3GJXC 1US8A 1G19A 2RGNC 4XTRA 1KIMA 3NIBA 4BLSA 1FZQA 3C15C 3EZ7A 1QF9A 2LCFA 2C2HA 1P75A 2YZ2A 4IXMA 4KLZA 4TMZA 2VHQA 1MO4A 1P4SA 4WVFA 5J4KA 4PO1A 1JXMA 2G77B 1KJZA 2E87A 5IHPA 3WYAA 1CR0A 3AUYA 1RJ9B 1GAJA 4A92A 3PEWA 5BWMA 2MMCA 1U8AA 1RIFA 1SVMA 1X8LA 2NZ8A 4A2WA 4LWZA 3BK7A 3HPQA 4Q1DA 1Z47A 1LY1A 1PLKA 3PIRA 1G7TA 4PHHA 2FFQA 2EU8A 1OIWA 4GMXA 2ZR9A 5KSZA 5CM9C 2GCNA 3PEUA 1P9NA 3U5ZB 1UF9A 1F2TA 3EIQA 1XTIA 1P61B 1XXHE 3VAAA 3KQKA 2RGBA 3NXSA 5DIFA 2I1VB 1EG7A 1UDXA 5KNBA 1G3QA 1ZCBA 1IN4A 4OHZA 1ESNA 1MR3F 4EPWA 3V00A 5KNCA 4PFSA 1Y3AA 2ZJOA 4IDNA 4UQOA 2FN4A 3G82C 2R44A 3EW9A 1H8ED 1F2UA 2G0TA 3TSOA 1GSIA 2XJ9A 4N0DA 1M2OB 2J41A 1Z2CA 1P2TA 5J4VA 2WMNB 1KOFA 4FIDA 2IK8A 2OO7A 1U2RA 2NG1A 4K8OA 1BH2A 4CZ2A 3EC1A 1VDZA 5P21A 3K1JA 2XNDD 1NVXQ 2HEIA 5GVRA 4B47A 3A36A 2IXFA 3D8BA 2VF8A 1J99A 4KLNA 2ORVA 4DCUA 1KI6A 3QF4A 2YWFA 5HCIA 1Z0AA 2ATXA 1G18A 1CR2A 1EWQA 2G3YA 1AKEA 2QT1A 4TMKA 4WW0A 5CYPA 3THWA 1KK0A 1E1RD 3EC2A 3VFDA 2GBLC 4CT5A 2RKOA 2QN6A 1GG2A 1TF2A 1G5TA 4A15A 4M1WA 3REFA 1ZNXA 2WWWA 1E2EA 3FHTA 2PEZA 4Q19A 2R6AA 3W5JA 1G8PA 2WOJA 1XTRA 4OK5A 3BJIC 1E1QD 4L8GA 1TUIA 2JIZA 4KITB 1ZD8A 2CK3D 3CLVA 3EPHA 4W7SA 2FPLA 2JLXA 2IYUA 1GNRA 4YMSA 4RCYA 1TTTA 4Q00A 1DAFA 2V6JA 5IT5A 2OCAA 1BO6A 2RMKA 2XSZD 3ICQB 2F1RA 3WYFA 1VKJA 2EFGA 3SE0A 4HATA 5B57C 4AKEA 1FTNA 2P67A 2GXAA 4EJSB 2BHRA 4IXNA 4ZDJA 3OIWA 1E4YA 1Y63A 3EAQA 1XTKA 4CEIA 2YOFA 5H1YA 4KJZA 2ZRLA 1ZU4A 2A9KA 4LRWA 1XMIA 4M53A 3ADDA 2CDNA 3KQLA 3W3ZB 2F43B 3WNBA 1U90A 3CF2A 3RRNA 4NYMR 1KI2A 4TL7A 4TZ0A 3RABA 6Q21A 2OBLA 4Q7JB 3THYA 5KSPA 3PV0A 2ZYVX 2D2FA 3IBGA 1G7SA 1XU4A 4WZ6A 1SVKA 5TV2A 3OAAA 1VIYA 2WJJA 1R4AA 4GPTA 2Q21A 5FTJA 5FBQB 2WWFA 4DZZA 2JLVA 3BWDD 1OF1A 2WTUA 2ZS9A 5IDVA 1G3UA 2ZSEA 2OCBA 1CTQA 3NTUA 2DWPA 3AVXA 5FBRB 3U4QA 1XMSA 4UNQA 3JVUA 3BB3A 2ZU0C 2R8RA 2XEXA 2D62A 2IEYA 1D2EA 3TVTA 3ND8A 2OSBA 2XNSA 5EXTA 1NIPA 4C9BA 3IIMA 4A4DA 1N6KA 1OIXA 1XTQA 2BJVA 3T5GA 3WNDA 5EP4A 4RFVA 5J4HA 2CHQA 4ZV4A 2W00A 2CXXA 3OEEA 3IILA 3LVQE 1RRPA 4GRAA 4NYJR 1G9XA 1M7BA 1P3JA 2WIAA 3P20A 2GZHA 2BBSA 2XITA 4DCVA 5KO2A 2UVQA 5JZVA 1W5TA 1Q0UA 4Z51A 1II0A 1ZINA 1AM4D 2AHOA 2FSFA 3NH9A 1T3SA 3QKTA 1R0XA 4UNSA 2ZRDA 1HY3A 4QGFA 2WWYA 2ZRKA 3QPWA 5H68A 4E09A 2F55A 3U6BA 4A36A 3VHXA 4LK2A 1FL9A 4NDZA 4NCNA 3ZVMA 5AJYA 2AKYA 1XPRA 4WBSA 3VR2A 1MABA 3TSZA 1E2QA 3KXKA 1FNMA 2FGKA 3A4NA 3LBNA 3A1TA 4JL5A 4N1AA 4Q1EA 2IS2A 1KSHA 1XEXB 3B1WA 2GVZC 2CVHA 4Q7LA 1IXZA 1IY0A 2C9OA 3IQWA 1SKYB 5JBQA 2O8EA 1CP2A 3GLFE 5CITA 4PZZA 5E7MA 4BRUA 3IUYA 4D0LB 4NU0A 4BE7B 5F9HA 2PZGA 4ZDWA 5CK4A 5AJZA 1NJFA 1XFAA 1SXJE 3U3KA 2H5EA 1XCPA 2JDID 1P9RA 2I4IA 3MWLA 4BASA 2UZ3A 2J45A 4KSBA 3U3RA 4NTZA 5G3ZA 3VR3A 4MRRA 1W0JD 4ZI3A 5FTLA 5JEDA 4AKGA 3CRMA 4RD4A 5DE3A 2C5LA 2FFAA 3OEHD 2FPKA 4DT1B 1QBKC 2DFKB 4PSAA 2OBMA 2QSYA 3IQXA 3RVBA 4UKDA 4XD7D 3SOPA 1QVRA 1ZIOA 2ZITA 2ZJ2A 5FOXA 1DAHA 4WAUA 3TR0A 2OILA 4LHYA 1GNQA 1ZM3A 2OEPA 3PCRB 3SBDA 4II7A 2WV9A 1T5LA 4ON9A 4R2HA 3KKQA 1GM5A 2X2EA 5FL3A 1XRJA 2ASEA 1U98A 1XMVA 4D4JA 3GJ3A 3LVRE 4I1UA 5L3SB 4LSGA 1AS0A 1OB2A 2DCUA 3KJEA 5FTMA 4D81A 2Z43A 5EP2A 3VHLB 2EFDB 4QM6A 1VMAA 1ZP6A 1TAGA 1M8PA 4G01B 4HDOB 4QGHA 2ERXA 4UXIA 3ZVRA 1S1CA 1YZNA 1R6BX 2D06A 3MG9A 2XAUA 5D3MB 3CRW1 4ZCMA 4HAXA 3IO3A 1A5TA 1G7CA 2C03A 3ZVNA 4PQYA 5BQ5A 2O8BA 4XSGA 3SQXA 1DEKA 1NY5A 4TYYA 4HB0A 4WZBE 4B3BA 4GL2A 5AUOB 4CEHB 3FB4A 3R9XA 2WM9B 1KI1A 3NWJA 3NBFA 4AG5A 1DOAA 5F98A 1EFRD 4DLYA 2EFEB 4QHSA 5HZHA 4AY2A 2QTHA 2ZRGA 2VP2A 1VCNA 1AKYA 3C5HA 4HZUB 3HR8A 1IM2A 1NSFA 3LWNA 3UG7A 4BLQA 4ZIRB 1JR6A 1EX7A 4A8JA 3RANA 2RGDA 3NG1A 1LF0A 1VTKA 1SVSA 1X8KA 4RFSB 3S1AA 4OI0A 3EARA 4I81A 2DWQA 4KU4A 1QHNA 2QMEA 3PQCA 1Z29A 4QBIA 3GPLA 1TU4A 2IYTA 1QHSA 3UATA 3FMFA 1NKTA 3HYTA 2YWGA 2NMVA 2PCLA 4HAYA 4JMPA 4PXAA 2QPOA 1CEEA 2XZOA 3AKYA 1A7JA 1H8EA 4DSUA 2VSOA 2ZAOA 2QNRA 4HLCA 1A1VA 2VP5A 1YZUA 4EUNA 3X2SA 3GFTA 1KJYA 1UEIA 2EVWX 2JJ8A 3DDCA 3LXRA 4I99A 3BS4A 4Q4HB 4Q4JB 1KY2A 1OW3B 1T0HB 2GZAA 3VX3A 5EXPA 3NEJA 2OHFA 5EE3A 5LB2A 3AP2A 3QPVA 5JI2E 3A8TA 2BDTA 3AVPA 5E3HA 3P27A 1LTQA 3U44A 1Z6YA 4B34A 3Q8XB 3VKWA 1OXUA 2JEOA 4JJZA 3B7GA 2OAP1 1D2MA 4NYIQ 2NIPA 4LY6A 3AVUA 2IEZA 2RH5A 4DVGA 1U99A 4XOIA 2GK7A 1CJMA 1FQKA 3KUCA 1ZYUA 3LLUA 4KVAA 4TQ9A 2HDNB 5FPHA 2D7CA 3MRSA 2EWVA 3R7WB 1W4CA 3SQWA 3AKDA 3QJYA 4M1TA 4O0MA 3IDQA 2ZR7A 2N42A 5JS8A 2QAGA 3U3MA 3K70D 3AVWA 5JMTA 3WP0A 4TN1A 1BOFA 2WSSD 2IYLD 4JT2A 2VQSA 4P0TA 4C2UA 2WKQA 5E7IA 4C0SA 1E1QA 2ZTSA 2BKUA 1E99A 2FEMA 1YR9A 2YOHA 2CK3A 4MGKR 3TBKA 5L3QA 3UPUA 5LDDC 1N5KA 3KKNA 1PUIA 4JZKA 5EQTA 3UMRA 4D0NA 5HCNA 1E69A 4K46A 1E9SA 1MO5A 2DYKA 2A5GA 2IYQA 2XSZA 5KPJA 3PENA 1BMFD 3X1ZA 1UPTA 2DB3A 2GA8A 2IX3A 3HP1A 1E0KA 1U9IA 3VR4A 2ZU6A 3SZRA 1I2MA 3Q9LA 1NI3A 3ZJYA 3DL0A 4RKFA 1G41A 5BW8A 1W36C 3HPRA 4M9SA 3EZ9A 2QMUA 2WZQA 3Q7PA 2IUUA 1J7KA 2FU5C 4QBGB 2VRWA 5HE8A 1QHXA 3TR5A 3GMTA 3KTAA 4O25A 4OYHA 3OF5A 1M6NA 3GJ8A 3FVQA 2I1QA 1GKIA 2VA8A 3QY0A 1HT1E 4PAOA 5CLQA 1S4QA 2O0JA 4EPTA 1Q1QA 4EPYA 3K0FB 1W2GA 2PT5A 1II9A 3QVUA 1Q3TA 4QBHA 2ECKA 4LX0A 2RHDA 1ZM9A 3M4YA 2D74A 4FCVA 4D82A 1Z6XA 2IA5A 2J87A 4U7DA 2GJ9A 4MRSA 1RFLA 3EA0A 3HU3A 1CJUC 4BFYA 3OIYA 1SXJC 2ODNA 4TMTA 5FOSA 3MJRA 1NP6A 1VPLA 4G5RA 1JAHA 2FV8A 5DI3B 2BM1A 4MGIR 3B9QA 4TLEA 1W44A 2OZEA 3SS8A 3BBPA 2O0KA 2CE7A 1YVDA 3A4MA 4LJ8A 1E2PA 2XB4A 2OLKA 3JZMA 4FMDB 4OI2A 5CB8A 4HZIA 2KBFA 1PLLA 3C7KA 3OZXA 3LW7A 4OI4A 2H16A 2OLJA 2OFOA 3BFVA 1JB1A 1GL7A 3H4MA 3ZIAA 1XEWY 2ZM5A 2ZVPX 4TT3D 1CR1A 2J0UA 1XCGB 3K9LA 1T9HA 4FCTA 4B3GA 2W2TA 4URZR 3MSXA 3O8RA 2UKDA 4EFLA 3PEYA 1OFTA 1SKQA 1Z83A 2ZJ8A 1V43A 3C4JA 2GJSA 3ICEA 3OE7D 1NBMD 4KYIB 3IKJA 1AS2A 4JVLA 2BOVA 1AZSC 1WP9A 5J40A 4I1OA 4JS0A 5JHHB 4JVMA 1HE1C 5TMPA 3GLIE 4ITRC 2P0EA 2YWEA 3TE6A 4LI0A 1T91A 1YR7A 2HCBA 3VX4A 2IS6A 1YZGA 3DMNA 1D2NA 1BIFA 3L8YA 2Z0MA 3LFUA 2YC4C 3BGWA 3FGNA 2Q0HA 3TIFA 3LLMA 2B8WA 1QHGA 2BKEA 2FMXA 1NLYA 1W48A 4XJXA 3AVTA 3CPHA 1S3SA 3ASZA 4OBEA 3BB1A 2WVJA 4RD2A 2JDIA 4EQ6A 1G8HA 1UKZA 2ZUCA 1SVLA 1E2DA 4AK9A 4RSGA 5AJWA 4Q9KA 2FF7A 4DB2A 1FPMA 1W0JA 3K8YA 2BV3A 4ZKEA 2ZE6A 3TQCA 2A78A 3QG5A 4DLVA 2GESA 2XZPA 4A0HA 3OEHA 5DHFA 2V9PA 2AN9A 2QTFA 1L8QA 4O3MA 3QEOA 5JFGA 2IF0A 4XTCS 1GNPA 2FG5A 2CJWB 3LXXA 1O3YA 1E2KA 2VP4A 1GTVA 4B35A 2PCJA 3BOSA 3IBYA 3GLGA 3WP1B 1EWRA 3CF0A 2Q6TA 3NC1C 4Q21A 4F7WA 4EAQA 2F3RA 3X1XA 3WHLA 3EZ6A 3SHFA 2IXEA 4QG7A 5J5CA 3ZVLA 4DDTA 1Z0JA 1G8GA 3AV0B 1SHKA 3VNVA 1R2QA 4Z1MD 1KJWA 1UBGA 3CNLA 3QXJA 2V1UA 4JL8A 1TQ2A 1LS6A 2IF2A 1B23P 3AF4A 3HYRA 5LD2B 1ZM7A 2RGCA 3FWYA 2JJ2D 3L82B 4TZ6A 1P9WA 2ZE8A 4OK6A 2QE7A 5GVSA 1Z07A 2QGZA 3LBIA 4JSTA 3W90A 1QVAA 2CHGA 4HLDA 3RS2A 5E7JA 1ZW6A 3LQQA 4KFUA 4L5BA 1WMSA 3MWJA 4A0FA 3CUEF 4AWXA 1R8QA 1NLZA 2VH5R 1OKKD 1S9HA 3G5UA 5DSZA 5H70A 5KDDA 2R9VA 1RZ3A 4M4SA 2NPFA 3BC1A 5B2ZA 2F3TA 1JR3D 4MDEA 2VP6A 4M21A 5BN3A 3K0SA 3TW4A 4S35A 1WE2A 1XF9A 1EFRA 1UKEA 3AKEA 2AK2A 4FI3C 3RS7A 2WSMA 4Q1BA 2EYQA 4WOPA 4NCJA 4Q1FA 2R65A 1XD9A 1OH6A 4L15A 1VYUA 4HDQB 4BEJA 5EJEA 3AF3A 3GCGA 3U2QA 3EIHA 2D7DA 1OXTA 1OH5A 4A2QA 3VU9A 2IC5A 3QF4B 4IVPA 4MITA 4HLUC 1CS4C 3GEHA 5DGXA 2QRNA 2A30A 1OPXA 5KDLA 1NN1A 3FHCB 2ZI9A 2H1LA 2VHCA 4X8MA 1SGWA 4X8HA 1JBKA 2CLSA 1RC8A 3IGFA 4M0LA 3X1YA 4Q4AB 4BFSA 3THXB 1X3SA 5K8TA 1UFQA 4ERNA 2V7QD 2RGGA 1E4VA 1JECA 4L16A 4QXAA 3ETLA 2O8DA 3AGQA 4LHZA 3TNFA 2FNAA 2ZRAA 4JKYA 1XDBA 4CYMA 4URVR 3B13B 1XJ0A 1FP7A 4M1KA 2NZJA 4W9MC 1XMJA 3TJZA 2YNMA 1FOEB 4WXRA 4E5UA 1ELOA 2R6CA 4KXFB 4V0MA 1E2LA 2QP3A 2GF0A 2WJIA 3A1UA 1YR8A 2ZR0A 4KBFA 4HEJA 4IDPA 1T3HA 2YC2C 4WZAE 3AP1A 2V1XA 1HE8B 4A0RA 3SYNA 4B3FX 1KO4A 1J90A 3SFZA 1HT2E 3GLFB 3FKQA 5JJIA 5FUWA 1KGDA 3LNCA 3GP8A 4G5OA 1TQ6A 2ONKA 3QKSB 2OM2A 1NY6A 1OFHA 1ZD1A 4BFTA 1SHZA 1SXJB 2Q9BA 2RGEA 5B58C 1F60A 2R6FA 3K53A 2Z83A 5SZHB 2FE4A 1G17A 2F1JA 3EA5A 3KX2A 2MSCB 4MKFA 1VHLA 1BMFA 3UIEA 2E9SA 1AA9A 1S2MA 5HR5A 2IUSA 4ARZB 4XH9B 2LKCA 1KDOA 3QXXA 2WMOB 4PPNA 2O52A 3L2OB 3MWKA 4NKRA 2IS1A 1GRQA 2GXSA 1E0AA 2O8CB 2Q9CA 5KUTA 2BMJA 1NF3A 3I92A 1QHHB 3Q7QA 3QG1A 4RCZA 3GFOA 2GXUA 3M0EA 4WA7A 3HDTA 4C4PA 1QZXA 2CCJA 3RRYA 1II8A 1FTSA 4CRWB 2JLWA 1OJLA 1VECA 1COWD 1JQJC 3TUIC 1AIPA 4G0NA 4EFMA 5FR1A 4A0GA 1ZBDA 1RYHA 5AK0A 1GOTA 3PEVA 4TMXA 2A5DA 5L8VA 1NMZA 2WKRA 1LNZA 2QRZA 1BYIA 2VPPA 2DHRA 4V0ME 2VHUA 4NL4H 4GDFA 4QGGA 2IUTA 4R71A 3RSOA 4NCIA 4IDQA 5HKKA 1UADA 1PVOA 1ZM2A 1ZRHA 2CLCX 4PAQA 4B71A 4YXWD 3QXHA 4M1OA 2ZI5A 5AJXA 1KMQA 1RE0A 1RRFA 3KFVA 5KDOA 2HLDD 2OXCA 3NKVA 4HUQB 4O2RA 4JBWA 3D3QA 4RZUA 4RJLA 4JJKA 1SVIA 4ZO4A 5DLQC 3RS4A 4IW3B 3MLEA 3H1TA 4D4LA 4D6PA 3ADBA 4MKHA 4ASUD 4DSTA 4PZYA 3L0SA 4TT3A 2ZXUA 4GSYA 2WWIA 3W6PA 2ZPTX 4B3CA 3U3JA 1GKYA 4TWZA 4JLMA 3LO5A 4YMTA 5C2JB 2PLRA 1ZJ6A 2WICA 1M74A 1FQJA 4PC2A 4FN5A 5DH9A 5UKDA 1E2NA 1NBMA 4QFMA 3REGA 4OI1A 3I1FA 2GNOA 1DBSA 4TLAA 3WXMA 1Z06A 2FDCA 4BLRA 2CCKA 4Q7MB 3BIFA 2O8FB 1D6JA 1WRBA 3FTQA 3SU8A 3KXLA 3BORA 4LV6A 4JSYA 1JXOA 3DKPA 3FE2A 2DY1A 2JLZA 1XWIA 1E9CA 4C0AC 2C77A 2OE2A 1YJ5A 4PC1A 2ZJYA 1KK2A 2GKSA 2IHYA 2BWJA 1YE8A 1GL6A 3BERA 1AQYA 3CR8A 1Z8FA 2AR7A 4Q5IA 4US0R 1G5PA 1W2HA 3DM9B 4PC6A 4NH0A 1KHTA 4FW9A 4Z8XA 4PC7A 2GRJA 4CW7A 3KKOA 2CL7X 2OAQ1 3R9IA 4I1VA 4M22A 3KZ1E 4HI0E 4RD6A 5GJWC 1GFIA 2WWGA 3B2EA 5FTKA 1HYQA 3O8DA 2G88A 2O0HA 5EUMA 2ZRPA 5FL7D 2IWHA 5JSZB 3BB4A 5EP3A 2V4ZA 2C04A 1R10A 1N6IA 2QUZA 2B6HA 3ZZ0A 3DPUA 2A5JA 4LYJA 4IDHA 4MUBA 3QENA 2KE5A 3SJAA 1Q44A 1W0KD 4W5JA 3T1TA 2ZIAA 2ZRHA 4C0LA 3DVLA 3T34A 4US1R 4EDHA 5A0FA 1JJVA 4TTQA 1DS6A 4PC3A 1XB2A 4B3XA 1MRSA 2JATA 1N6LA 2IT1A 4EJSA 1BS1A 1W49A 3LBHA 5AUQA 4Z1MA 2J59A 2WOOA 2PZEA 5JLJA 1GKUB 3CX8A 5FH9A 3KJHA 1E79D 3C5CA 5JS7A 2JJ2A 3I5YA 1E98A 3VMFA 1WB9A 3W6NA 2F43A 2KSQA 3LX5A 3KQHA 3K0AB 1F5NA 2C99A 2R2AA 2W83A 5EE9A 1RRCA 3N5CA 1OB5A 3H84A 4BLTA 2ZETA 2O5VA 3TKLA 1OIVA 2W6JD 3RAPR 3IHLA 5TARA 2ZSDA 1OKKA 2ZSAA 4W5WA 1I4DD 4IHQA 3V4RA 1LVGA 1U0HC 4TYPA 5FTNA 3ZYCA 2W58A 4DWJA 3BH6A 1DAMA 1KO8A 4L9SA 3TH5A 3FDIA 3WMGA 4F91B 1DO0A 1W1WA 4P4SB 1ZU5A 4GFDA 2NGRA 4M9QA 3I32A 5G40A 1A2BA 2CEAA 3I62A 4LCBA 2IYVA 5AJVB 1VCOA 5C4GB 4BECA 1W4BA 4P4UA 4Q7KA 4B33A 3AVVA 2NO6A 3H2YA 1M1YE 1G291 3DHWC 1P2SA 5C1BA 2QG6A 2X8AA 5G41A 1GUAA 4KFSA 2A5YB 3EWSA 4ACBA 2H18A 2HF8A 4PHGA 3FMIA 3K9HA 3MFYA 4ZCLA 4MYCA 1LFDB 1UBEA 1PZNA 4A1FA 3GJ7A 5EUQB 4ACAA 3T06B 3I3SR 1DAEA 3OFND 2XOKD 4JL6A 3I5XA 5FPYA 4B44A 4ZPXA 1XX6A 1MO6A 1SVOA 5DISB 1KKMA 1R5NA 2QAJA 1TNDA 2REXB 1NL3A 1Q21A 2V7QA 3FFBA 4OK3A 4TL6A 3U3OA 3X1WA 4JLVA 1GZSA 1AZTA 1TEXA 2HJVA 2ZEJA 1M7HA 3ZQ6A 3B82A 1DAGA 4Q9HA 2FX3A 4GI7A 4BLPA 2YOGA 4IOJA 4P31A 2DFNA 5EE1A 1W5SA 4DJTA 4JVSB 3OIUA 3CRVA 1F6BA 3VQTA 3EXAA 1G5RA 2BJWA 3BH7A 1XEXA 4JIMA 1Z22A 1A4RA 3B1VA 1I2DA 5JJKA 5TVKA 3NBZC 4FD2A 2DPXA 4Q18A 3SJCA 3VR1A 4MKGA 1TF7A 3CH5A 4BFWA 2ORIA 4L9WA 5A5GA 2RAPA 2GCOB 3T35A 1TX4B 1R5BA 4C0JA 2ODEA 1OSNA 1WXQA 1JEEA 1N0VC 2G1KA 1UKVY 2GF9A 4TTPA 1WBDA 4B73A 3GLIB 5EZ5A 3BAFA 3CZPA 2YKGA 1VCIA 2RGNA 4QJ4A 1C4OA 3DZ8A 2QBYA 4MGZR 4LGMA 2KBEA 3PUZA 4LYAA 4D4KA 3ADCA 5FI1B 1NLFA 3SBEA 4F93B 1YQTA 4AC9A 2OBNA 4PHFA 5J47A 2ZYWX 2XGJA 1ZVQA 3E5HA 5DHAA 3NHAA 3UKDA 2WJGA 4DT1A 1CXZA 1KSJA 1FNNA 2CE2X 4Q66C 2ZI3A 1CJTC 2OUKA 4TL8A 2XNDA 3FHOA 3SC3A 4OHVA 4KO8A 1SULA 4M9ZA 1XNJA 3ZS8A 2MMGA 4HLQB 1ZMXA 4BFZA 1IJFA 5G3YA 4JKIA 4KAXA 2QORA 1JPJA 1R0WA 2CLDX 1E1RA 4LUCA 5CJPA 2CCGA 2CL6X 1KO1A 2OV2A 1D9XA 4PSKA 4TQAA 3B5JA 4MRVA 2IWRA 4MKIA 4PO9A 2F6RA 2A5FA 5EZ6B 1Z0IA 3ZDQA 2PJRA 2FSHA 5L3SA 2GJAA 2A7QA 2BBTA 3AM1A 1OV4A 1AGPA 2IS4A 2DFLA 1COWA 2CBZA 2PEYA 3PFIA 4LHXA 3B1XA 2ZRBA 2ZJZA 2ZUDA 3EPJA 2CVFA 3CF6R 3R8FA 4W5HA 2QQEA 4TYQA 2X2FA 4DCNA 5SZJA 2WIBA 2V8OA 3LV8A 2PJZA
chains in the Genus database with same CATH superfamily
4FT2A 1DG3A 2BMVA 1LLUA 4G36A 5ULLA 1F2VA 4NBSA 4C0QC 3Q6MA 4DV3B 2JK0A 3HY4A 4DLUA 1E9FA 1SKYE 3EVBA 3HP7A 721PA 2JAWA 4DIEA 4ABYA 1AZLA 4RH0A 5AM5A 5AW8A 3WO1A 3M3PA 2IPAB 2Y76A 1MO3A 1IVSA 1PV1A 3T1VA 1Z8HA 3EG9A 4D9NA 5JZOA 4CEHA 1XPUA 2WZBA 5AKXA 1V9SA 1WZEA 2F59A 1QSGA 2QI9C 2HLDA 2N47A 3I9KA 2BW0A 3LQ2A 1KEEB 4KMMA 1KMHB 3VDRA 4DWVA 1ULZA 2L42A 5A7GA 1TEZA 5IJ9A 3PNKA 5HRAA 3TAUA 4ALIA 1YHYA 4H7KA 4HVTA 4Q9LA 2P3QA 2QUJA 4JQOA 4LHEA 4YNBA 3H18A 3GLQA 1O2DA 3IVRA 3VR6D 1QO7A 4W1SA 3GJ5A 1B1CA 2H4XA 5CHYA 4HCJA 4CEJB 4E21A 2CNDA 1UWKA 1U94A 2QHXA 3W06A 1XTJA 1ZGZA 2WIDA 2IYZA 2OWEA 2VYQA 3IRUA 4G0YA 5JSYA 3RYTC 4HAWA 1JEQA 2BMEA 4EQ6B 3PI7A 1OXXK 3QLVC 5CNKA 4BNUA 4DBLE 4EJ2A 1U9ZA 3FTCA 3CZ9A 3ZV3A 4IUDS 4J2HA 3UAOA 1GSOA 2QN1A 4TKLA 5BW5A 2IJGX 3PRHA 4HBZA 3UOAB 2XXAA 3LFTA 3GL9A 1VXOA 3DPSA 1DTWB 4AKSA 1EFKA 1ICIA 1QF7A 1SCBA 4YI5A 4EY7A 4QATA 2D13A 4R83A 3VPSA 3FYTA 3E1KA 3UVEA 3A1NA 4KIJA 4L4ZA 5TQ0A 1BHQ1 1KK1A 1CJKC 3NP7A 4FMBB 1CQIA 1V3UA 4IEEA 4Q4HA 1UXJA 3FBWA 3PUXA 4WBXC 1BCSB 4C4TA 1NW7A 4CVNA 2ERCA 2V7BA 1JPUA 3NEAA 4QJIA 3LWZA 5KTYA 3JASA 3EXFB 1U3FA 4MQBA 1WA5A 4TYWA 1I51A 1QH8B 1UPUA 3NALA 2VAMA 4U2DA 2NTEA 3STXA 5C5EA 5JXWA 1W7AA 3S81A 1T36A 3S1SA 1DKPA 5T57A 3CRQA 4NBKA 1T35A 3MMPA 4V24A 2YHIB 2OQRA 1GNSA 2Q5HA 3U4IA 3JD0A 5JCOA 4B7ZA 1GQSA 3LI2A 2BFCA 4C14A 1ILEA 3EXIA 3W1WA 1IMJA 1QH0A 3OSZA 5ED4A 3LUGA 1K75A 4X63A 3KJGA 5EAIA 4RZ3A 4QDOA 4LV8B 5EGSA 1EB9A 1ZGGA 2NO7A 4HAOA 1H23A 5FPQA 5HGXA 1WO8A 1GG9A 3LF2A 3R7WA 3QSGA 2HRQA 3P26A 1D7OA 2FUG6 3HLTA 1Z5UA 5DZSA 1IAVA 3RC1A 4E5PA 6NULA 4TMFA 1AQ6A 3FVWA 3I6YA 3LJKA 4Y2JA 2ZKIA 4Y2HA 5SYNA 3K20A 4DYHA 3HUTA 2ID8A 3OT1B 1Z56C 3QBDA 5DLPA 4F72A 4YP5A 3ZEAA 3ZWOA 4YFYA 2FX5A 1FSPA 2Q0SA 3X1JA 1NJSA 3RHFA 1TKRA 2BR5A 2R60A 2WQ7A 1QDUA 1UUFA 1ZSNA 2BHSA 1TQ4A 2Z56A 5AI9A 4BAGA 3LSYA 4TLBA 1UFOA 3FZGA 1SXJD 2ACEA 3KUDA 3DXZA 1Z34A 2EJCA 3VKGA 3SHOA 2PKQO 3IPYA 4FWBA 5DXAA 4MGYR 2ZYRA 1W6UA 4HQNA 1USGA 4Q3DA 5FWDA 2V45A 3KJFA 3PYXA 1O6ZA 1UPFA 2GJKA 5DFAA 2NP7A 1JQAA 3L0OA 3GEPA 1V4NA 4M8NE 1D2RA 1HTWA 1MQAA 2HA3A 5AESA 1J5PA 1J70A 1XZEA 1EVLA 3G79A 2QENA 4IDOA 3KQNA 2PS9A 3CR3C 4G8DA 4PBRA 3I3OA 1W1IA 4CF4A 5B64A 5IBCA 5BY2A 4D2IA 5BOSA 4XFJA 2DHCA 3N8IA 3DS8A 5ALTA 1RYBA 2GHIA 2RK3A 3C41J 4QDXA 1US8B 1LB1B 1Z62A 4UNRA 5KNDA 2X4DA 3DZDA 3E9QA 4MUIA 4DKJA 1PGPA 1T29A 5JMPA 3AR5A 1XGKA 1U0FA 2HI0A 2W6JA 4CNBA 1AK2A 4IDCA 1DZIA 4AJOA 1FTYA 2OXEA 4OL9A 1MENA 2VP3A 1EI9A 1XVUA 5T4EA 3TFOA 3DE6X 5LJIA 3IX7A 2LIVA 3DMGA 3EIEA 4NHOA 5A3SA 1ZZEA 3CPJB 1SNYA 1YBFA 5LMNB 2X0NA 3LA8A 1NVVR 4BQSA 2O07A 2ZG6A 4O8ZA 5A3RA 3X1KA 4URWR 3SDSA 2P1RA 5GZ6A 2IQIA 3ONWA 1P3Y1 4KYVA 3DOOA 1M2WA 3V7NA 2QM8A 3QNMA 4W5RA 1MAUA 4ZVQA 1AO3A 2E5WA 3GWZA 2OBYA 3RRMA 1JU3A 1NQWA 2CNWD 2J7PD 2PTGA 3U5TA 3B20A 4W8OA 2Q8PA 4MRPA 3L07A 1F2TB 2VUUA 2ZRIA 4RQAA 5KOYA 4N6GA 3PGJA 2XW6A 5AVXA 3NBQA 2C4KA 1RKBA 1MW9X 1WB6A 5IDWA 1YULA 2YIMA 2PBRA 2F1HA 5D1HA 3JPWA 2ODBA 4C5AA 1J2TA 5GJCA 4N0QA 2EKLA 2CLKB 2VDMB 1LU9A 2UUOA 1KH3A 2R8PA 5TF4A 3OUZA 1HEUA 2X6RA 1U2EA 3FLMA 3H97A 2HXYA 4OQLA 1B3BA 1QFZA 4XUGB 1KBZA 3RUEA 2FSSA 3RWBA 3HV0A 2L0XA 3QH4A 4RETA 4JLBA 2H17A 4DLSA 3QKRA 5E1DA 3RQSA 2VHWA 4TUYF 2JHFA 2D3TA 2Y92A 3EGDA 3L8ZA 2DPGA 4QKQA 4RZSA 4EEKA 3RS3A 2HJHA 1K6EA 2AYZA 2I7CA 1FVXA 3FI9A 1YD7A 4BX2A 2J08A 5TT1A 3FZNA 5FWYB 3WDMA 3MCAA 3T7DA 1A4XA 3OIGA 4P93A 5GONA 3IDOA 1LNQA 2JA2A 5IWCA 2BFAA 4GPBA 5F2EA 1E2MA 3B6EA 3DUFA 4PSUA 4EF6A 2W6ID 4PAMA 1JLMA 4W5QA 1ENZA 1KYYA 2YY7A 2ZS7A 2VLBA 1G63A 3U7RA 3FUUA 1YIAA 4PYIA 2RAFA 4FOPA 5CP8A 1PWEA 2PRSA 4RO0A 5ALXA 4TTJA 4IKOA 4BP8A 1NG1A 4S24A 1WOYA 2VZ8A 1GITA 5IVPA 1QP0A 2DCMA 2NO9A 4A8JC 1EVKA 1G2IA 2M6RA 3HBLA 3M4NA 3PDIB 1QK4A 1T8RA 3LQRA 4GI1A 1Q1GA 1TPZA 2IIVA 3H1BA 3HN7A 3HCOA 1NN0A 3O92A 4WD3A 4WSOA 3QYFA 5K8CA 1DL5A 2I8AA 1P7CA 1MPXA 2HCJB 2WWHA 2QL7A 3C70A 4C87A 1WPQA 1ZJJA 4XUEA 1FUKA 2BMFA 2XA2A 3GRFA 4OHKA 4U39A 1NKSA 2G25A 5IKMA 5BQFA 1GR1A 4BGIA 5KHOC 4OJKA 3GYGA 4BQNA 3C3BA 1U4SA 3OPYA 1JZSA 1CY7A 1FFBA 2II6A 2FFHA 3CCFA 3DOFA 3IBCA 1DELA 1OLUA 2BE9A 4D43A 1EFVB 1HMPA 4B9AA 4LYEA 3WLTA 3GZ4A 5BSKA 3PUVA 4OUKX 4BN5A 4DDMA 1RZUA 5DGIA 3AJ9A 3SI7A 2AZMA 3CX6A 3DKKA 3B60A 2XRFA 1JKJB 1T2EA 1U8YA 4HD8A 2G8LA 2FWJA 3JQ7A 4RPIA 2X2OA 2R7KA 2PSSA 4CE6A 4BEWA 4ER7A 2HNAA 2PANA 4YK7A 4AY6A 1A82A 1FTGA 2AUNA 3DFMA 3CUKA 4OQXA 1JSZA 5CT6A 4I7EA 1EK2A 1VOTA 3ZY2A 4FWTA 1CCWA 3HGTA 4OHXA 2BAGA 3NI2A 2ZM6B 3PFGA 2VXOA 2EG5A 3FDJA 1D0VA 3K94A 4GR9A 4AX8A 4NZZA 1PTJA 2HT6A 2J3EA 2EATA 1YL6A 2C3MA 2UVPA 1IWOA 3B8HA 3C16C 3SDBA 1R0YA 3AEQA 4J3JA 3SIXA 4CU2A 1K92A 4ETIA 5C7LO 4RKEA 5HVNA 3C39A 5ALUA 2FR0A 2BGTA 1KA9H 1UJMA 4ZT4A 5IC5A 4ESEA 1JEJA 3LD9A 4LDZA 2PVPA 5EEHA 4GL4A 1XZNA 3HU1A 1LPSA 2DUJA 4F4IA 1UBUS 4KH1A 2ONJA 3FTEA 2LDXA 3QLUC 3HB7A 3AQIA 4PF1A 3TJMA 5CNJA 4DJFC 3GP5A 4IEIA 2R1VA 4C76A 1CY4A 2IPOA 2QAGC 3ECCA 4BKQA 4OYLA 3TUJC 3ORYA 1P6QA 3QLJA 3WMFA 1W85A 5C5DA 4QM7A 3ERCA 4EYOA 1NVFA 3TGPA 1GO2A 3I9NA 4PYQA 1FP6A 1EIWA 1GHTA 2R6GA 3L7CA 1MIOA 5K9ZA 4IHKA 4BKMA 4B6PA 3UMSA 3PWZA 4P83A 4PPFA 2CXHA 2JZCA 4YUXA 3R6WA 2C4TA 1WV1A 1CX9B 2QGNA 3KKPA 4RK6A 4YDHB 5D01A 4AP5A 4BWVA 4QTYA 1NATA 5I7WA 4EPXA 3LL7A 1BW9B 3GCWA 4O02B 2JBAA 3T41A 1I3KA 3VR6A 4B3RB 4B6JA 4BNVA 2J46A 3GFGA 3NTXA 4Q3CA 4EKYA 1EWYA 3ITNA 3G1UA 4B09A 1QPZA 1CEYA 1DWPA 3TLGB 1XNRB 3O94A 4MUGA 1U7TA 4F11A 1RRVA 5BYKA 1KHHA 3A6LA 3UWOA 3ADKA 1JDPA 3DMTA 1PX0A 1EFTA 3DEIA 2OB2A 2SECE 4HDSA 3GB9A 3ZBTA 3VPBA 3ZJUA 2ZOSA 1O5OA 5HZKA 5F3DA 1HDOA 5LP6F 3LY5A 1TADA 1HOXA 1GLVA 5IKXA 4G6ZA 5B2FA 1PSDA 3CYFA 3AF1A 4YRTA 3NWOA 3KOOA 3LCCA 4JLSA 4WOKA 2ZYSA 5CH8A 1T8YA 5FKJA 5DGDA 1RJ9A 4P8RA 3UJHA 3X3HA 1Y37A 4R3NA 3RSLA 1E3DA 3A9TA 2OQVA 1KPHA 2J3IA 2XDQB 1ECPA 3LG2A 3OWOA 1JP7A 5CJ2A 3TLKA 5HIAA 1PR3A 2Q5QA 2G5PA 4RQTA 1KETA 1OC2A 3TG2A 2CWDA 1EXNA 2JRLA 3MT7A 4IFBA 1I4EB 3ZNPA 1VSQA 1MTZA 3C8MA 9LDTA 3AFOA 3MWEB 4ISBA 4ZAZA 3I30X 3VNRA 5L4SA 2BDUA 3C6KA 1GKKA 1ITZA 4G23A 4GUAA 1DG1G 3AJ8A 2HH9A 5JAZA 1T4GA 1SEVA 4CV1A 4E0BA 2J09A 4XWAA 1X13A 2JCSA 1Z6TA 4WBNA 3PKJA 4U3JB 1G8YA 4JXJA 1XZJA 2WFLB 2J5QA 2I2XB 3K7EA 4HQRA 4NICA 2ZSIA 5ALPA 5KWVA 4D3DA 2E21A 3RFXA 3ER8A 1ZL2A 1FMJA 3IB3A 4OSEA 5EE5B 4ZU1X 5M7EA 3NYIA 1LTHR 1P1KA 2OT3B 2OP1A 3MT0A 1U4OA 2XKJE 3CQ9A 1XRQA 1WXWA 3TLXA 4DDUA 3T4XA 1ZONA 3K0CC 4P58A 4X61A 2IV3A 4LC0A 4BFXA 3GLFA 3OH8A 4GOMD 3WLJA 2O2ZA 4U0JA 4DS3A 5E3JA 2R0QC 4DR4B 4KIGA 3NOXA 1FSFA 2QU8A 1LUAA 1IUKA 4RTLA 2PGOA 1SXJA 3D2BA 3DEHA 3U7JA 1N25A 5K8IA 2P9JA 4XW2A 3IERA 3USES 2QZJA 2BFNA 3B9PA 3NB0A 1ID8A 1VG1A 3ROQA 1T2FA 3QI2A 3G9QA 3TZHA 4B8ZA 1QG6A 5K7SA 1SBNE 1GUBA 3WRWA 1BEUB 1BEEA 5EEGA 4MEJA 2X19A 1MJ5A 3EWNA 4IAOA 4IIXA 4MVYA 1P4HA 1QPBA 4TLMB 4CN9A 4B3TB 1H1LA 3W2IA 5FUMA 2RBEA 3V3KA 3N76A 2YHSA 4YHHB 1ZA1A 1P5JA 4ZTUB 3IB6A 1CHDA 4N0EA 1CUJA 1PFKA 1UT8A 4KLAA 4RS3A 2UUBB 1QHHA 1JMVA 4WINA 3U17A 5KSOA 3AK4A 4NYMQ 1SKBA 1V7CA 2VRCD 4I36A 4QX6A 1L4FA 1XQWA 2WP8J 1Y6ZA 2PT7A 5CLLA 2H3EA 3B2NA 4LI3X 4LMAA 5DGTA 3ZUPA 3A1VA 3FCOA 4CMEC 4D4IA 1FYDA 2FUG1 2OORC 5FHRA 2YZKA 1Q84A 3ZIAD 1MNQA 4ZVTA 3VDMA 1U0BB 2B34A 2CXQA 4PSCA 2MSNA 1VRCA 1CUUA 3HVKA 2CLOB 4FHGA 4MJXA 4F6RA 5G53C 2PQ6A 2FA9A 4IDGA 3OOYA 1XZPA 3IUEA 4JDPA 4JITA 4MUJA 2PX2A 2P2YA 1BWSA 1MGOA 1QR2A 4GAEA 4P4NA 2FB9A 5LFAA 3ZE9A 3H2HA 2PLAA 7MHTA 1RXVA 5JVDB 5ETJA 4Z0NA 3V5NA 3GARA 2RI6A 4AZSA 4BWYA 1FP4A 3DO6A 4GKJB 3ZJ4A 1R6VA 1AXGA 2DWOA 3ONVA 1N0UA 1PUXA 2A94A 2AF4C 5M29A 1NG9A 2YRXA 4MTCA 1ZIDA 4TV8A 5DN6D 2J7PA 2CNWA 3KZNA 1I4TD 3JTMA 4II3A 1SD1A 4JJFA 1OT3A 5DGCA 5EXEA 1FDIA 4ZYVA 5CG1A 1IULA 3IT2A 1IY1A 1CF4A 3B70A 4RD3A 5H59A 4BV9A 1XRPA 2QZ9A 4C01A 1GP2A 4OGWA 1GRNA 5KU1A 1GDHA 2OCXA 1ZQ9A 4JVNA 5HKBA 1N6PA 3GXBA 2PFKA 3WY9A 5J4YA 2XT9A 4EA7A 3PGVA 3S5JA 1KAMA 3KB2A 2ATEA 1NF2A 3SBXA 3UWSA 1BS2A 3OHSX 5IJZA 2R8ZA 4O2BA 4RVCA 5E2IA 3U6KA 3KLNA 1ISJA 4KR6A 3V8EA 3T7AA 3ROEA 2B7BA 1F14A 1VG8A 4AYWA 4J0QA 3SZ3A 1EFLA 2W4IA 4F8YA 1NONA 3TBFA 3ND6A 4R98A 1J00A 2F3UA 3AHEA 4BRWA 1G16A 3QU9A 4NPCA 3CVOA 2PLNA 3TVYA 2AC4A 1P6UA 2OV3A 1NVBA 1S5PA 5I7RA 3J81k 1N4DA 1WUJS 5LZ7A 5B1EA 4WY2A 4G0ZA 3O1IC 2AD1A 3KQPA 4O8CA 1XL1A 3GJ4A 3WHPA 1PV4A 3I2KA 1ZIPA 3JQEA 4AXXA 2D5BA 1NXPA 2W6IA 5JYDA 1PYOA 5LUAA 4IIHA 5AHOA 5C53B 3K72B 3NGMA 2YCBA 4I5GA 5ITVA 2ONZA 5JY6A 4AKHA 4KDFA 2OESA 3V7WA 1PW7A 2BKLA 1WMFA 4KQIA 3TOVA 1P1FA 4FINA 1P19A 3KQVA 2ZUWA 3ND9A 3U4CA 3QV1A 3ZX4A 3GRUA 2PUAA 2ZT8A 1ZNZA 3ZXUB 5JAUA 2RCNA 1RLOA 3IUNA 2GZRA 3J7TA 2IHJA 1SBIA 5LBIA 2I03A 2QZSA 4NK4A 1FFWA 4C06A 4HWSA 3TW8B 3NHFA 1D5CA 1Z0ZA 3CSDA 2OZVA 2FYTA 5JE8A 1Y3FE 2GKOA 2GWHA 3NGLA 1C8BA 1ACLA 2RAVA 1C7QA 3JZDA 4M83A 1NP3A 2BF7A 3R0QA 1QYCA 1UT5A 2EERA 2I2WA 2OG2A 2ZWVA 3I34X 1Y1TA 2CMKA 3MMSA 3GLKA 4GS5A 3RJ5A 3UMJA 4ILEA 4POOA 3AIMA 4JLOA 4F7DA 1HDGO 3F67A 3NBKA 1UBRS 1YOBA 3PVSA 4L5AA 4RMGA 5GM1A 4F6CA 1MQ8B 2YJGA 2PZFA 2AKEA 5IJWA 1LF5A 1KQOA 4YBZA 2XRZA 1FIUA 4RENA 5A9TA 2QTTA 4J43A 3DEFA 3ZBUA 2P40A 3A6PC 1OASA 2QEQA 1GT6A 1CQPA 2HTFA 4FS3A 4HLUA 4ZYLA 4MK4A 1R64A 4GMGA 1E9VA 1N92A 4R1PA 3UA4A 2HYDA 4BMNA 3TX2A 4BX8A 1ZC3A 1H2WA 1L7DA 1CUAA 2I0FA 3DB1A 2BPOA 2P41A 3I73A 5F4BA 3VDXA 3I9OA 3VU3A 7GPBA 3HY3A 1IH8A 1AQLA 1JA0A 4ITVA 5BMVB 4CTNA 4C0HA 1KFBB 4DCSA 3BH0A 4ZEWA 2FH5B 4C4YA 1I2BA 3R7LA 3AHIA 3FH0A 3NONA 1RM3A 1Z08A 3G2LA 3NWEA 3RSGA 4G25A 5CDSA 4RMNA 1IXSB 2D5IA 3GQVA 3DWGA 2IP2A 5K0EA 3KTFA 4LY0A 4V0NA 2B2XA 4WOJA 3I58A 5BNFA 4RTOA 5ILOA 1FUEA 2R00A 2HC9A 4IJWA 2DTEA 2GXQA 2CXRA 2XXAB 2BEJA 4ICIA 2PS1A 1JYSA 4OCZA 2WWRA 3M34A 4U02A 5DTMA 3SZGA 2YXDA 3H4IA 1MN6A 3FROA 3IHKA 4P4SA 2GILA 4O1MA 1WDTA 4UEWA 1K08A 2VJYA 5F21A 3U4MA 1W94A 3JWGA 3HRHA 1WKVA 3JASB 3LY7A 1TVCA 3DMFA 4GZMA 4Y8VA 1KNQA 1S9DA 2H1HA 2BY4A 4RPLA 4C7OB 1MH1A 3CNBA 3I64A 4S2EA 3NHWA 4OP3A 2GPSA 2YIDA 5LQCA 2ZFUA 1T9ZA 1INLA 4LE0A 1RYNA 4K2HA 3PWSA 5KYNA 2ZT5A 2WU0A 1PF7E 1NKVA 5TGDA 3OZ7A 3O9VA 1KI8A 3MPOA 3NFRA 5DNYB 2TMKA 1A5BB 1Z18A 1QBGA 2Z5LA 3FW1A 1OLXB 3SSMA 3AM5A 4DJJA 2ECFA 3SQNA 3E70C 1KF0A 2C4HA 2IL1A 4BEBA 1JQEA 2O8NA 4YMIA 2FWBA 3F4LA 5KNCD 1I7LA 3GU3A 4G9GA 4ALNA 1OI2A 4B32A 3P9ZA 4UNIA 5K0JA 4EPVA 1BFDA 2J8ZA 3HB5X 5F2OA 5A5EA 3Q12A 4V3CA 5IXSA 1Z7WA 3U7HB 4FGJA 3WR5A 4DXAA 3BRWD 1OXBB 1UPXA 4J49A 3QE0A 1ZCAA 2QW0X 2ZJ7A 2QD3A 3BQ9A 3N05A 5ECDA 2P5TB 1JWAB 2A0WA 2E1RA 1KE2A 3K35A 4MAAA 4DG8A 2C3UA 3CNNA 3EVCA 1QYIA 4PGMA 1ZUD1 3T3MB 1CG6A 2VP9A 1OAAA 1CUCA 2VZEA 2JA1A 1F4VA 5EZYA 5CLFA 1R27A 5KCMA 4CMBA 2GCOA 1MAVA 1DC6A 2Y27A 3KSDO 1FSSA 4BE9A 2GLTA 5ALIA 1DXOA 3ZDYB 2ZDQA 3FLAA 4RNDB 1THGA 1DKOA 2X5JO 4BPBA 5DYNA 5CVEA 3DYIA 3MGKA 1ID1A 3HJCA 1CNFA 1RYDA 3OZSA 1CJBA 1GU7A 2VF2A 3N75A 2GEKA 4F71A 3QJGA 5EJ7A 2DX7A 2X5XA 3AY0A 4PNHA 1DJQA 5AH0A 4A2PA 2IY9A 2RHLA 5COAA 3TK1A 1FLVA 2YH2A 1TQDA 4F3RA 2GCPA 3SKYA 4JOBA 1DBRA 4RYLA 2SKCA 3DZGA 4MV9A 2BEVA 1YS6A 1X74A 1QVZA 2RHHA 1NASA 1AN9A 4HEHA 4WN9B 3PJDA 4JC8A 3RLFA 2ISCA 3ITKA 4WQMA 2NUTB 3QKUA 4X1YB 5H3LA 3BEDA 3E05A 4NEHB 3WLSA 4CIXA 2NNWB 1C0PA 1CR6A 3AILA 2VL7A 3WL7A 3LC1O 2BMWA 3DQQA 1U2SA 3UMVA 1ORWA 4HSGA 1FLNA 4FHDA 5HQTA 3RSZA 3T0IA 4ZHQA 4FNOA 5CB4F 5BXYA 1ZH0A 1J8MF 4WDQA 1ISHA 3L6EA 2NQTA 1BDJA 1GU0A 1RPTA 1VP9A 4HRVA 5ENDA 4ZRNA 3V4PB 3SAJA 4D79A 5KX5A 2C0PA 5CDFA 4Q6BA 3U7EB 3A37A 4ZCTA 4AJKA 5IKPA 4F6LA 4M7OA 4J0DA 4YGYA 3CUUA 2VRCA 5JS6A 1M0EA 2HNKA 1KIAA 1KXZA 3CIOA 3IALA 4JJ7A 3E48A 3AVQA 4WT7A 1IB0A 2X8JB 5FTWA 3U16A 4QQKA 3SWWA 4F45A 2NYVA 5CDTA 1APBA 5LC1A 1AQJA 5D00A 3MINB 1GCUA 2V5AA 4MH0R 2NZVG 4PYMA 4WZAB 2GEFA 3SNHA 2WIJA 4Y9UA 3SMQA 4DIKA 1IN7A 3M4XA 1LPAB 3E4CA 2VNKA 5B1YA 3ET5A 2Y1LA 5FO1A 5IFKA 4LHVA 1J42A 4ZHSA 4IY1A 2FMIA 3DXXA 1CNMA 4S3MA 4R0MA 2A4MA 1K0FA 4ZEXA 3SNKA 4BMOB 4HEQA 1GUDA 2RB4A 3ZH9B 3QKRB 5D8DA 1U8FO 1KO7A 4Q02A 1E2HA 4ZAYA 4YDSA 3WIDA 2QG9A 4PIPA 5BN3B 4QBFA 2QMZA 2BBOA 3F6RA 4YQYA 1X39A 2XLCA 1V25A 3DEZA 4FKMA 5JNUA 5JRJA 1N2EA 2ONYA 1HURA 5KHAA 3CX7A 2XHEA 1QCCA 1C3OA 3BDIA 3K9NA 5A4DA 5DN6A 3IP9A 2FOIA 2FW0A 1OFVA 2FX2A 3P2YA 4FWIB 2GAOA 2UYYA 3BHIA 3JTEA 2M6SA 1WW3A 3AH8A 4V2UA 4PE5B 3DT8A 3VU9B 1NPDA 3D1VA 5GOTA 1U3CA 5AO9A 4DDWA 3VYWA 4DZTA 3IE2A 3KL2A 5DF1A 4ZA2A 1YA8A 4BU1A 1ABFA 3T95A 4F9GA 3C6YA 2X4GA 3N6VA 4MQLA 1JJ7A 5D1NA 4FGUA 1PJZA 1V5GA 1UDRA 1YHZA 2QW8A 4OJQA 3CW2A 2CUTA 2G9QA 1FX0A 4EYKA 4F8EA 3L46A 4ZOLF 1KI9A 4EW1A 1ZY2A 2I9KA 1ZMBA 5FR2A 4ND4A 3GNLA 4K6OA 3C8ZA 5ALDA 3KCNA 1A9OA 3UAVA 4KO4S 3U39A 1TVMA 2RHMA 3EWAA 2MYPA 3IMGA 1YACA 1N6NA 1PZHA 3KOZA 3SLRA 2CUKA 3DBOB 3LBYA 1SQ5A 3OEYA 1FRFS 3LC2O 4KVGA 5DM1A 5B2EA 2B1IA 4PLTA 2BD0A 1W5BA 3K9QO 2QT0A 3NEPX 2VFAA 2G6BA 5CFQA 1PX2A 3P0JA 1G1MA 4P2BA 4UJ3A 5KVSA 1UEJA 3SYKA 5IH7A 2QUAA 3DNMA 2E89A 5M04A 3AR7A 5CDFE 2F90A 2ODWA 3FWNA 4ZCPA 1MT0A 1RLMA 1QIMA 3C45A 3ZGVA 5CCBA 5JAHA 4IG4A 1WXEA 3JQ7B 4HBGA 4L72A 4RK0A 2V9ZA 4K26A 3LQKA 4W9NC 3GUCA 5KTNA 4LFAB 3OU6A 2V54A 1Y6RA 4BC0A 4B76A 1G4UR 1PS0A 2I4LA 3W2TA 4FD3A 3ZDBA 3GAMA 3PHHA 2W98A 1HV8A 3BHNA 5EE0A 3UMYA 4ZT2A 3NAGA 2FK8A 3IAS1 3SR0A 1PR5A 4XWOA 1UAAA 4NCKA 1WLYA 1QV9A 4PO8A 2PUJA 4P4LA 5A4KA 4ID9A 4I8DA 5EP1A 1ECGA 4OIMA 5FLKA 3HXKA 2FSIA 2W0MA 3CWQA 1NUPA 3X43A 5FBKA 2Q6KA 4JBHA 2C5HA 3DC2A 3I72A 4JU9A 3LKDA 1XXLA 1KKLA 5E9JA 2Q50A 4M1YA 3F46A 4TL9A 4B4OA 3GN2A 3CWCA 1XXHA 3OKAA 3D8NA 4P33A 1WU7A 5JI3E 1DTSA 1O6FA 1T5TA 1WCIA 3HZOA 3J80A 1XEWX 2BCJQ 2G83A 4B6RA 4TVBA 4G0UA 2PH1A 2VO1A 1KORA 3KNZA 4GRDA 3FOBA 4AWAA 3EUEA 4QTXA 3V4FA 4C4ZA 5KNCA 2FHSA 4R9NA 3K2BA 5JD5A 2Q1UA 4I4LA 1QP4A 2QJOA 2EQAA 3HM2A 3MJ4A 2BMDA 2J67A 2P27A 1EE1A 2K87A 3EGOA 1P4AA 1U7OA 1UBFA 1NVVQ 2D54A 2HGSA 4L27A 1E0JA 1Z5WA 4Y7CA 5EI5A 4DLTA 3UJPA 1YR6A 2DFPA 2EQ5A 4CHTA 4NBVA 3CH6A 1CUIA 2VBFA 1QQTA 3FPEA 5K5EA 3O74A 2YDYA 2IXGA 3CLTD 3IQGX 3PJGA 4E6PA 5KWJA 1I30A 2XIQA 4ESHA 5LLDA 1IRIA 1KY5A 3C5WP 3MJTA 4HHEA 1JJAA 3WG9A 4C20A 4D98A 1M1ZA 2QVLA 4QECA 3LCUA 4ZOAA 3ZDZB 3EPLA 3OFJA 4NMMA 3MA0A 1AZWA 1CR4A 4PLVA 2YXPX 4CMCA 1RPZA 4CM8A 3AI1A 4BJ3A 1II8B 2VZ0A 3ASYA 4QWWA 4YRIA 2P9BA 2ZJFA 3IQZA 4BGVA 3E27A 3D3WA 3SHVA 3RVRA 1VE6A 1C0EA 3K9BA 3R3JA 1KIMA 3NIBA 3L1UA 3TI9A 3EZ7A 3HKBA 3KQWA 3MCWA 4R1UA 4Z7JA 1QMPA 4AKTA 2C2HA 3AB8A 2V7PA 4RMHA 3QVOA 4HWKA 3RUIA 3RYFA 5C7OO 5J4KA 1P8AA 4PO1A 3UB3A 3WHIA 2E87A 3FIJA 3WYAA 3SE7A 1UPBA 3RTDA 1MJHA 1RJ9B 1OAOA 3VC7A 3PEWA 1GTRA 4FDVA 2WQZA 4FGKA 1WUYA 2IIQA 4UUPA 4LWZA 1PGNA 5BOVA 3ZU3A 2HJSA 3GHHA 4MW1A 1WZCA 4C3VA 3AX6A 1T8PA 3HLKA 1X87A 5EWLA 4K1LA 2CSUA 1W96A 2PWZA 4WEQA 1OLSB 2ZR9A 3UK1A 3FWHA 3DCYA 4RHEA 5A3JA 2GCNA 4RJTA 5CDHA 4CIAA 1P9NA 3Q2OA 3T7RA 1SBZA 3UAWA 2QYTA 1G60A 1XXHE 3LM8A 3NYQA 4ZODA 4KPYA 3I05A 3K6KA 1UJNA 4G41A 1ZAYA 1XLTC 4RA6A 5I7VA 2IIBA 4H3SA 1UDXA 4R2LA 4AMUA 1G3QA 2VQFB 1PQPA 1IN4A 3HE3A 1E20A 4EKGA 3FNQA 3QMMA 3V00A 4EPWA 3K0HA 3L79A 1NXSA 1AUQA 1JG2A 1OZGA 1DLIA 3QOXA 4IDNA 4PFSA 2FN4A 4UQOA 3G82C 2W6MA 1NA5A 3ESBA 2R5FA 5BRNA 4BQFA 1F2UA 1U0GA 1ZESA 1P1CA 3LGXA 1NFFA 2G0TA 2PRZA 3AL0C 3FNRA 2XJ9A 1T1JA 1X77A 2H11A 3OPQA 3BRWA 1HYHA 3BD8A 5I7UA 3ZJVA 1FPQA 1M2OB 2J41A 2L18A 5IJAA 4EUEA 1QNLA 2WMNB 3QVKA 1PHRA 4FIDA 3QMVA 1T4MA 3SPXA 3FGPA 3U4HA 1SELA 5B6PA 2WWVD 3DL4A 2HJRA 3ICWA 3OZTA 3EC1A 4Z2YA 4CZ2A 3ZDCA 3K1JA 1NVXQ 4FLMA 3L5KA 3O6VA 4WFJA 3VYUB 1VA4A 2IXFA 2ORVA 4L74A 3NJRA 3ZVKA 4QARA 1ZUNA 2CHUA 4UBMA 5TR9A 2X41A 1CR2A 2HA5A 2H54A 4UVHA 4I1IA 4TUYB 4D9KA 5DHQA 3QITA 3U7QA 1YRHA 2QXTA 3FAZA 3GY0A 4W99A 1RBMA 3WIEA 2RKOA 4M36A 1MW8X 2B4AA 3IT3A 1ZNQO 4QU0A 5K0NA 1JTFA 1B6SA 2GFHA 4UVGA 2O5RA 4K05A 3E6AA 1U3TA 4F2DA 3GV0A 2DBQA 5FRDA 4J0JA 2W8BA 3WBFA 5IT4A 4C4RA 3DTVA 3WBBA 3W7AA 2EP5A 3W5JA 2WOJA 2YUIA 5F23A 4WNAB 4MA0A 4LVUA 5C8YF 4ZOQI 1HSOA 1TIKA 2WHPA 1TUIA 1V11B 2BTOA 2WTAA 3L7DA 3EIFA 2P91A 3G5MA 4F6RB 2FPLA 3EF3A 1L7RA 3QIVA 4H27A 4CLRA 3OZCA 3DOUA 1BKYA 3N8NA 1LSSA 5LQMA 1SHLA 1YRQA 3EE6A 4L0DA 2V6JA 1SU8A 2C4MA 2J30A 2XSZD 3ICQB 1DX9A 1V35A 3KYCB 3LCJA 1JPVA 1C9NA 4W1RA 5HCUA 1FQWA 1UMDB 1FTWA 1NOJA 2OGSA 3I23A 1MLDA 5B57C 1OD6A 2GXAA 4EJSB 2BHRA 3CT4A 4UUBA 3UAYA 1PT9A 2EJVA 3OIWA 5AW4A 2W2KB 3KXPA 5G0VA 3S3TA 3JR3A 3TS1A 3F74A 3V97A 4C6HA 3UKJA 3WAJA 4M53A 4F3YA 4FYYA 2O2DA 2F43B 1M2NA 4AY4A 3SJUA 4OFXA 1U90A 2VOJA 5HWSA 5JCOC 2G63A 3SGLA 4TZ0A 3T7JA 2QPLA 2E2WA 3RABA 3I2FA 3ECSA 3NWBA 4AMVA 1XVLA 4C05A 4DADA 6Q21A 3PF9A 3ZWAA 3THYA 2WYVA 2D2FA 4ESOA 4ALJA 1RQPA 3K5WA 4MQEA 1G7SA 4BRZA 1XU4A 4HNAA 4CU5A 4M8LA 2BJHA 5TV2A 1FYXA 1BE0A 5DMXA 5DK4A 1X7XA 3MQ4A 2Q21A 4DZZA 2JLVA 3GXOA 3H99A 1DUVG 2YCLA 2IHKA 1AMUA 2J6HA 1EM8B 2XYVA 5C51B 2Q4BA 5KWIA 2ZSEA 4AICA 5B58T 3TTXA 2WK1A 4EW2A 4HWOA 5FBRB 5BSVA 2QJRA 3U4QA 3AVXA 1DCMA 2V74B 3BB3A 1PV2A 4F4FA 4DXDA 4Y2YA 1U7HA 1KZ6A 3N0TA 1JTVA 3KP1A 4HEA6 3OX2A 3B51X 4ZC1A 2F62A 2XNSA 4UMFA 4IQ8A 2P2ZA 4A4DA 5DIZA 1VL2A 1N6KA 2FRDA 1DO8A 1FUYB 4J2OA 3TOZA 2BJVA 4WECA 3OA2A 3T5GA 4PTYA 3WNDA 5EP4A 1SIBE 1JG3A 4ZYXA 2XUQA 4EFKA 4ZV4A 1EYZA 2W00A 1EZZA 2CXXA 2QV7A 4NYJR 3RSCA 3G23A 5JS8A 1DV2A 3P20A 2WIAA 1CW2B 3FCAA 3IMKA 3ZLUA 2GZHA 5BVGA 2BBSA 2XITA 4CKWB 5KO2A 5JZVA 1ESCA 4PS0A 5E1MA 3CEPB 1KFJB 4JX9A 4X94A 2Q27A 1YUMA 1II0A 3Q4GA 2VJDA 1ZINA 4CCAA 3ZCRA 2ZTUA 5KJFA 1IQUA 3NH9A 5EKUA 4PV7A 2ZUFA 1M1YA 3O3MB 4Q3EA 4UNSA 1AHHA 5CPFA 3C85A 2RJOA 1VMEA 4E09A 5D7BA 2F55A 2X6TA 5DHSA 4BYGA 3G68A 4LVOA 4LK2A 1FL9A 3VHXA 4JQSA 3EXEB 4NCNA 3ZVMA 1XZIA 2PS0A 2O2JA 4KXUA 3FYDA 4MP8A 2NSJA 1OA0A 1XPRA 5DOZA 2CHEA 4G2TA 4QDZA 3TSZA 3ZK8A 3HL0A 3KXKA 3HUEA 4QA9A 1EP1B 4CUZA 4MO9A 5A03A 1EGQA 4O29A 3W77A 3ZKWB 2D6FA 4WLOA 4E2XA 2JARA 2L82A 3LUBA 4MV5A 4Q7LA 4QOJA 2HHHB 2C9OA 5JSFA 3SEZA 3BMNB 2PMFA 5LP6B 3L8EA 1UBTS 2DKNA 3G17A 2YYYA 3OU7A 2INGX 4KG7A 4KQHA 3ROMA 5F73A 3IKTA 3IMFA 3OQBA 3PX3A 5FB3A