2IEYA

Crystal structure of mouse rab27b bound to gdp in hexagonal space group
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
164
Chain Sequence
GDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDFKVHLQLWDTSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
total genus 37
structure length 164
sequence length 182
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ieyA00
1ZMXA 1SGWA 4LGMA 1ZNXA 3QXSA 1GWNA 4Q18A 4CGZA 2JASA 4YONB 1HV8A 4HUQB 1P2TA 3EIEA 1GVNB 3WYGA 2GEDA 2QTVB 2W2TA 1M7HA 3HU2A 1GNQA 4OQXA 1ESNA 2QMEA 5DNYB 5JS7A 2IK8A 3CNNA 3GCGA 2RGGA 2ZYVX 3HPQA 1QDEA 1J8YF 3NBXX 3EPKA 2F43A 3RWMB 2FX3A 1AM4D 2FFAA 1GP2A 1SKYE 4XVQA 2ZRIA 1XXHE 3DO6A 5KSZA 5HPYB 4A2PA 1JR3D 3WXMA 2R2AA 3PENA 3TMKA 2CNWA 2IHBA 3QXXA 2DB3A 2YV5A 4PHTA 2OEPA 3LA6A 1OB2A 1E1QD 2RGEA 1YZTA 3TSOA 5KYKA 2OCAA 2VP6A 4MGYR 2PBRA 3BB3A 4OHXA 3GLGB 2XNDA 3D31A 5FL3A 2JLXA 1YR6A 3U7HB 4OHVA 4EIWA 3TK1A 2WAXA 4RD6A 3TLXA 3BRWD 5G53C 1FTNA 4DLTA 2EFGA 4IXMA 4Q1FA 2CK3D 3HJNA 4HDOB 1KSFX 1T3SA 1WE2A 4DXAA 1H65A 3A8TA 2RHMA 4NCIA 5KDOA 3S1AB 1A2BA 5JI3E 1NVUQ 1CJVC 2I1VB 2IT1A 4NYIR 1CF4A 2AKYA 2HJVA 4OKSA 2XXAB 2V6JA 3BAFA 1L8QA 3QKRA 4XVUA 3MGCA 4JL5A 4CT4B 3ZH9B 2D2FA 3SQWA 2Q6TA 1IN8A 2IS2A 4M9QA 3CBQA 1MV5A 1P3JA 2EYQA 1ZBDA 2ZI6A 1ESMA 1HYQA 2CCKA 1SHKA 3RNLA 4M8NE 4MQBA 2FSIA 2ZRJA 4H1VA 1KK3A 2XGJA 2ZUCA 4P4UA 1OHHD 3C8UA 5TDHA 1LF5A 2ZE6A 4DVGA 3P1JA 2PZGA 4MA4A 4BFYA 3GJ5A 1G17A 5TXGA 4M22A 3ZZTA 1AQYA 3DDCA 1XD2B 1S1MA 1GKUB 1OHHA 2CVHA 4BRUA 4QC2A 4WOPA 4Z1MD 4YMWA 4NZYA 1TPZA 3MWLA 4OHZA 1FTSA 4KYUA 1OIXA 4LC0A 4D4MA 1NIJA 1E2KA 2GZHA 2QTFA 2Z5FA 3DOEA 5FOXA 5HCIA 4DCNA 4Q1CA 1KO1A 1V5WA 1R0ZA 3UANA 1Q44A 3VKWA 2ANCA 1N2CE 1TUEA 3EZFA 3GFOA 2ZRCA 4CEHB 2F1HA 2A3RA 4ZCMA 2GK6A 1QHIA 2NOAA 3FMFA 2P6UA 2N1BA 2C77A 4B3BA 4MRVA 3QEOA 5L8VA 5TMPA 3X1WA 2VPPA 3R8CA 1N0WA 3B60A 1NG9A 2DWQA 3MWJA 2GZDA 1FNNA 4WW0A 3U61B 1OFHA 2H17A 4Q47A 4URWR 4JL6A 5KSPA 5KSOA 3OE7A 1SVMA 1ZM3A 2G77B 2O8DB 3SHFA 1NN1A 1YJ5A 2BIFA 1RJ9B 2OXCA 2DWPA 4HUQA 3ETLA 1E96A 4UKDA 4Q7KA 1OXUA 3T15A 3WMGA 1IQPA 2XTNA 4CT5A 4FINA 1H8HA 1OH7A 1E9CA 1LTQA 1JJVA 4Q9KA 421PA 5IK2A 4PPQA 2QM8A 1A5TA 5JS8A 3IIJA 3TSZA 3BFKA 3BK7A 3FMOB 5SZIA 2JDID 4X8OA 1W5TA 1JR3A 1EX6A 5GJWC 4A1FA 2KBEA 4B6FA 1T8UA 4FCWA 1GAJA 1JPJA 1W0JA 2HEIA 1OXTA 4E09A 3NDPA 3BGWA 4TSFA 1FL9A 1W47A 5LDDC 1CR2A 3WHLA 1L2TA 3EARA 4B33A 3GLHE 4Q00A 2OFOA 5C4GB 4ESVA 1XNJA 2IYZA 3VR5A 3ZVNA 3UMFA 3QXHA 3K70C 4RY2A 5CB6A 4D4JA 5DHFA 4KVAA 2NTYC 4YMSA 2VIIA 3O8RA 3AGPA 3A58B 3G5UA 5JCZA 2ZRDA 2R8RA 1AJEA 4G01B 3K9LA 5AUQA 1GRRA 1DG3A 4Q7JB 3FFBA 2VH5R 4F4CA 5J4HA 2HF9A 3DL0A 3I5XA 4V0MA 4MDFA 1S3GA 1NSFA 1I4LD 1YVDA 1E0SA 4KV9A 2KBFA 2RGNC 1B23P 1F6BA 5BN5A 3P4XA 2GZAA 2Q3FA 3W6PA 4NMMA 3VHXA 4A0GA 3THYA 1YZNA 1KSGA 3VNUA 2OBMA 3A1WA 3EZ7A 5G3YA 3EIQA 3RDPA 3X1YA 1R5BA 2QMOA 3AQ4A 4PHFA 2J7PD 3IQXA 2QQEA 1QHNA 1GL6A 2RAPA 3R8FA 1GNRA 3AVVA 3GJ8A 1HH4A 1NN5A 3ZIAD 5EXTA 1FZQA 4LPSA 4PC1A 2R6DA 2JIZD 5K8TA 1F2UA 1W4CA 2C2HA 4P3YA 3H4MA 4DSNA 5F2EA 1E2MA 2ZSAA 3CB4A 3ND9A 4ZI3A 2SHKA 2MSDB 1HE1C 2IYVA 1Z2AA 4M4SA 4QHSA 2ZJ8A 3U4QB 2QROA 2W6JA 3OFNA 2GF9A 4URZR 2QE7A 1GOTA 4BLTA 4JYBA 2OUKA 4EPRA 1XU4A 2QQ0A 1RW4A 5FBRB 4YLGA 1Z6GA 2XOKA 4KFUA 3B6EA 3X2SA 3B78A 3Q3JB 5FTNA 1WP9A 2C78A 4KODA 3R7WA 1R7RA 1G7TA 2OE2A 5F9FA 5JWRA 3ONWA 2RHDA 2V9PA 1U99A 1VG1A 2BJWA 2WWWA 3LQRA 1N6KA 3KJIA 1NBMD 4NPHA 4TTRA 3RABA 4QKQA 3T1TA 4LY6A 1DTSA 1DS6A 3TR0A 4ACBA 4D0NA 5BW8A 1GSIA 1W44A 2FN4A 4MYUA 4JVNA 4A2WA 2F1IA 1NJFA 1SXJA 2O8CB 1CLUA 3GQBA 5EJEA 5LB2A 2ODNA 3B13B 4US2R 1FMLA 5CDFA 5KOYA 4JLVA 2JCSA 1M2OB 4A0RA 5C46F 4IFBA 3RRMA 1XD2A 4TSFD 3T06B 2GXQA 4Q4AB 1HE8B 3I5YA 3U3OA 1E9SA 5CITA 1VCNA 3PFIA 1WDTA 1G7RA 3QKSA 1Z0AA 3RRZA 1ZM2A 2ORIA 1KIMA 3TBKA 5E95A 2B21A 3MCAA 2P0EA 1W4AA 3A1VA 3ECCA 2JLRA 4AC9A 3W5IA 3FWYA 2WJJA 4XIGS 3WNDA 4LPKA 4WAUA 3TVDA 2IXFA 4WZ6A 3K0AA 3L0PA 3QBVA 2ZI7A 1CXZA 3ZD6A 3QUSA 1K8RA 3W34A 4B2PA 4EPWA 5BYKA 4P33A 2DR3A 4TL9A 3FVQA 1UJ2A 4PQYA 1E4VA 4CEIB 3VX3A 2IUTA 1CR4A 1NI3A 1U81A 3H2YA 4LBWA 3RRYA 2O8EB 4B34A 1FOEB 2O0KA 3LY5A 1NIPA 1K5GA 4YDHB 1GRQA 4QRHA 2J1LA 3NH6A 3TRFA 4DIEA 4DJTA 4R7ZA 4HZIA 4DBLC 5FOVA 4I1UA 1F60A 1Z83A 2WPDD 4QGFA 1UM8A 4TMWA 3A4NA 1OW3B 2ZRNA 2YOGA 1E2PA 2BMJA 3CUEF 3OAAD 4TLDA 1CP2A 4JVLA 4A8JB 4GL2A 2A5YB 5EP3A 5KNCA 2QRNA 2JLUA 1G8YA 3ADCA 4U5XA 5JRZA 3IGFA 3LBHA 2ZIAA 3QI2A 1J70A 4L9WA 2O8EA 1M1YE 3L2OB 3R7WB 2VP4A 2IYTA 3GLGE 1C9KA 1QBKC 2Q9CA 3UG6A 3TUJC 1EFUA 1ZW6A 5JJLA 2CE7A 3BE4A 4TTQA 3ZZ0A 1EESA 2JATA 3QPUA 2YYZA 4HZUB 4JLMA 4JVSB 3ASYA 3BXZA 3LAWA 4NCNA 3DVLA 2VHCA 3RRNA 3NH9A 1U98A 1RPZA 2ZRLA 5CJPA 1XTQA 1E3MA 1PVOA 5GVSA 1A4RA 1OFUX 3EZ9A 5DH9A 2QZ4A 3N5CA 1ZM7A 2A2ZA 3NC0C 4L8GA 3GLIE 4PR0A 1VHLA 2AD5A 3LW7A 1PZNA 4B2IA 3TSWA 4C0KA 1II8A 1AS3A 1LB1B 2EYUA 2GJSA 3KDSE 4NYJQ 4V0KA 5TV2A 4QJ3A 3C4JA 2V55B 1M74A 1YKSA 1ZU4A 5LB4A 1N5IA 2J41A 4QGHA 1EK0A 3CPHA 3AVTA 1LV7A 4KYIB 2FNAA 3EX7C 1HUQA 3KKPA 3U44A 2OESA 4CEJA 1H8HD 2WTUA 2RGDA 4JBXA 3V9PA 4HYYA 2GXAA 1QHSA 3PEWA 5A0FA 3QY0A 4GP7A 1MRSA 2BHRA 2ZEJA 1DPFA 3ZZUA 4PC6A 1Z0DA 3Q5EA 4HAVA 1ZM9A 4IVQA 4PXAA 4QBIA 4NL4H 4DDUA 3VTKA 2IUSA 2V4ZA 1XMSA 1Z28A 2OILA 1JQJC 2BEKA 1MT0A 2XZPA 1YRBA 4LBVA 5DLQC 4DDVA 3A4LA 3AVXA 4G5QA 1QHGA 4DCUA 4RD2A 1SXJD 1S1CA 2GRJA 1R10A 1X1RA 5HCNA 1E0JA 1CJTC 2GJ9A 3EA0A 1XX6A 5GVRA 4HAYA 2YHSA 2YWEA 3C5CA 1RRGA 4H9GA 1GILA 4B44A 2JJ1D 2MSCB 2J7PA 3GLFA 3HU1A 5P21A 1NJGA 3AKCA 4PANA 3SOPA 1BMFD 1G41A 5FL7D 5FL7A 2AFIE 4E5UA 1WF3A 4LC1A 1Q12A 2OO7A 3DKVA 1Z3IX 4BLPA 1JEEA 3ND8A 5CIQA 1OJLA 3VQTA 1Z6XA 5FUYA 1S2MA 2V54A 1ZUNB 5JFGA 3WP0A 4JLKA 3FTQA 4B2LA 4NE2A 1XJ0A 1GL7A 1SKQA 1G21E 1HTWA 1Q1QA 2JLYA 4PFSA 1VYVA 1P7CA 2HCBA 3K9GA 1CR0A 4MYHA 4X8MA 2WSMA 1BS1A 2IYSA 4ACAA 2XJ4A 3QPVA 1KJWA 5EXXA 1MO6A 2ODWA 3CR8A 4CEJB 2ZRPA 4DUGD 3RYTC 4URXR 3N2IA 2CVFA 1KZ7B 3O8BA 1E9FA 3GLHB 4L16A 5L3QB 1M8PA 3D3QA 4QNRA 3KXIA 4OHWA 4URYR 2CCJA 4ASUD 1KDRA 3IIMA 2VHJA 2QT1A 2WAYA 5HTKA 4AWXA 1XXHB 2O8FB 2Z83A 1SVOA 1E79A 2ZRKA 2ZSDA 3SBEA 5HR5A 1KMHB 3VU9A 2OLKA 3ZD7A 2WM9B 1VYUA 4G3XA 1G6HA 4V0LA 1JBKA 1GKYA 4RD4A 3LVRE 3THXB 1P9WA 4PSAA 4IEIA 1G3QA 3W8RA 4B3CA 4M1SA 2OAQ1 3E5HA 3W3ZB 2BMEA 5EP4A 2ASEA 3IO3A 4CEHA 5L3SA 1S9DA 4URVR 3PQCA 4XH9B 1DAHA 4JT4A 4AKEA 5D3MB 2NO7A 1WBDA 4NDZA 2XSZD 4KBFA 3QEJA 2GBLA 4GRAA 4TT3A 1DADA 4MKFA 8OHMA 1IOZA 1G4AE 5CJ2A 4QL3A 4M21A 4PC3A 4D4LA 1XRJA 1NMZA 4LHVA 4US1R 4ZDJA 3ZVMA 2ZI9A 1RJ9A 1WB9A 4UXHA 3KKQA 1AS0A 3VR1A 4EPVA 1Z0IA 3MAAC 4YMUA 1ZD1A 1KKLA 4RFVA 2AD1A 2BWJA 3GLGA 2MMCA 1F2TA 4LV6A 1XTIA 4A82A 3X1XA 2OCPA 1NMYA 4EPYA 5JCPA 4C7OB 4CZ2A 2ZAOA 2E9SA 3I3SR 2BVNA 4DLYA 5IK2D 4OI0A 1XWIA 4DT1B 3CRMA 1TU3A 4DSUA 1LNZA 3CNLA 1XBTA 221PA 4GMDA 1XEFA 1TQ6A 1DG1G 3AF2A 2HYIC 4NYIQ 1TAGA 4TQUS 5AUPB 4ZI2A 5DIFA 4K46A 5EUQB 4PPGA 4NYMQ 1O3YA 4HSEA 1C1YA 4POAA 4BFTA 1XDBA 3KJHA 1E0AA 2B92A 4KO8A 1OE0A 4B35A 2QSYA 3V4RA 2VA8A 2DY1A 2ZVPX 1XXHA 3PR1A 4M53A 1DEKA 4NTZA 4OK3A 3B9QA 2XZLA 1Z5ZA 4IJMA 4Q4JB 3QNUA 2ZI3A 4KFTA 2IHYA 4Q9HA 4DRZA 2QAGA 4EJSC 4EUNA 3Q85A 4XOIA 2JLWA 1T8TA 4Q21A 2GF0A 4C30A 5SZHB 2IEYA 1YR7A 1K6MA 2RKOA 3WYFA 4EPTA 2F9MA 4YQFA 4OK6A 521PA 3GEIA 2ODBA 3RS4A 3FHCB 3VKGA 2W00A 2WOJA 5IHPA 2BM0A 1AK2A 2F6RA 4N0EA 4M2LA 1IY2A 4FMCF 3SJAA 5B30A 5JI2E 2GESA 1VPLA 3CIOA 2J9RA 2P6RA 4TYQA 2GCOA 2W83A 1CTQA 4HAUA 3U3RA 2CLSA 5KHOC 3PEYA 3SBDA 5KU1A 4Q9JA 2IEZA 1IM2A 2BBOA 3IDQA 4Q4HA 4A0FA 3THWB 5DE3A 1KI3A 1JEDA 4AYXA 5EP1A 1W0KD 1MR3F 5BQ5A 1YR8A 5FOSA 1Z08A 1ZNZA 4LYHA 3EPHA 2Q21A 1X8LA 1FQKA 2NZ8A 1ZCAA 1XTSA 3TJZA 1DOAA 1RC8A 2WJVA 1KDOA 2WMNB 1AS2A 3BC1A 3P32A 1I2DA 4E07A 1W36B 1UKZA 1ZNYA 3EPLA 1P9RA 2D06A 1KI1A 2C99A 3QXCA 4FMCB 3EZ6A 4HLDA 3IBGA 1IHUA 3ASZA 2GJKA 4TN1A 2B8WA 4UNRA 1P2UA 1YZKA 3FYHA 3U7FB 4F4IA 3RC8A 3B85A 1XP8A 3UMSA 2Q9BA 1AGPA 1KYIA 1RRCA 1P5ZB 3DPUA 1TX4B 1Q1EA 4B71A 2HCJB 1Q21A 2QAGC 2V3CC 2C04A 1E2JA 3BH6A 1G5TA 4Q4JA 2CK3A 2IXEA 5FTLA 1E32A 3EASA 5JSZB 3NEYA 2YJTD 3NBYC 3ZS9A 4IHQA 3SJBA 4QXAA 3FKQA 3WBKA 1XD9A 5JHHB 1OYYA 4GI7A 2NO9A 3MD0A 1E1RD 2YVUA 4KAXA 1WRBA 4DSOA 3CH5A 2JLSA 4Q7LA 1F2UB 3QBTA 4TMVA 3AM1A 1IN7A 2AR7A 1QVRA 2OHFA 3NKVA 1E2LA 5HZKA 3TW8B 2WJIA 2UVQA 3R9WA 1XZQA 1ZM4A 2C8VA 4NCJA 3RANA 4N3NA 2GXSA 4TZ6A 3HR8A 3QKTA 1KGDA 3OFND 3TGPA 4Q03A 3PIRA 3U2QA 4DB4A 5FI0B 3MSXA 1MRNA 3E1SA 1UFQA 4YDSA 2PMDA 2PJZA 1GL9B 5CB8A 2EW1A 1AZSC 2A7QA 2G0TA 1B0UA 4DLWA 5B57C 3HU3A 1OF1A 1MABB 3U7GA 1TQ2A 2FSHA 1COWA 2AL7A 3TUZC 1AZTA 5IRCD 2F9LA 2WKQA 4B3FX 4F93B 2Z43A 4PO8A 2XB2A 1PJRA 2QL6A 5JRJA 2LCFA 2XAUA 3UATA 4YXWD 3U4QA 5H8WA 4PO9A 1DO2A 1U90A 2VL7A 3GD7A 3ZDQA 2H92A 1FP6A 3TQCA 3THXA 2QU8A 2O52A 4OI2A 2IYUA 2IS4A 3R9XA 2HXSA 5AJYA 2FPMA 3LBNA 1LS6A 4GP6A 1WQ1R 4M9XA 4HAWA 4IXNA 5AJVB 3K0FB 2X2FA 4LX0A 4P4SA 3K9HA 5DI3A 3IEUA 2YWFA 5FR1A 3PJRA 2J46A 3O8DA 1CU1A 5ANRB 2GCOB 2AK3A 1D2MA 3VHLB 4O2LA 3FHOA 3RWOA 1E2FA 2XX3A 4LWZA 2NO0A 3I8XA 2CLCX 1II0A 1OXVA 1US8A 2O0JA 2PT7A 1KO5A 4XWKA 1KI9A 4MGKR 4WXPA 4BLRA 3QJYA 1KDPA 4Q9LA 2W6ID 1J8MF 1UBGA 2VP9A 5FOTA 2MSEB 4AG5A 4V0OA 1NMXA 4QG7A 4LUCA 5FBVB 4BRWA 1D9ZA 3GLIA 3L8ZA 2IC5A 2FSFA 2DBYA 1ZC4A 4L4UA 1XTKA 5FPKA 1II9A 2K5UA 3DOFA 2REBA 2VHUA 2P5TB 2R6AA 5C18A 1P62B 4GPTA 4R71A 1EFCA 2F3TA 3AVOA 2AWNA 5CLQA 2RGCA 4QBFA 3AV0B 2QPAA 2A9KA 3PUVA 1UDWA 2FFHA 2DFTA 1P60A 2REOA 1GUAA 2PLRA 2Q9AA 5JEEA 2VF8A 3CRRA 3EC2A 3LXRA 4B47A 2WJGA 3B82A 5EE3A 2AFHE 3CZPA 2KSQA 2W0MA 4D25A 1LF0A 2ZS8A 3CLVA 3QPWA 3SS8A 1SXJE 1FPMA 4U02A 1OH5A 2QA5A 4JKYA 4GBMA 3UXMA 3ZIAA 4R98A 3AUYA 3OIVA 3GLHA 4KJZA 3LX8A 4QHTA 3RS0A 3W6NA 1Z6AA 2QE7D 4E03A 1NBME 4UQOA 2V6IA 2EFEB 2VP5A 1OYWA 1OFTA 3LH5A 2IUUA 4A92A 3GLFE 1IBRA 3TE6A 4AIIA 4Q02A 1XCMA 3LQQA 1XMIA 4JT2A 4PC7A 1ODFA 3AP1A 3FDIA 1VHTA 2C9OA 1TF7A 1XZPA 4BUJA 2AWOA 3O8CA 2O0HA 3KB2A 1UADA 1S9HA 3TUIC 4D4KA 4CVNA 2PH1A 2W2VA 1F2TB 1KDTA 5JJIA 2AHOA 3VNVA 5GJCA 3U6KA 3QSYA 3I92A 4AURA 1M7BA 2VEDA 4JJZA 3NIBA 1NVXQ 2ZJ2A 3FKSD 3P4YA 4JVMA 3LNCA 4Q7MB 1HT1E 4X8HA 4XTRA 5DSZA 1W2HA 3GFPA 1J2JA 1SULA 3QQ5A 5TARA 2VYFA 1KO8A 4Q4HB 4JMPA 3UK6A 4DC9A 3D8BA 2NQ2C 1IXSB 2JIZA 2BCGY 721PA 2ZRGA 3RVBA 4PTLA 2VHTA 3VKHA 1KI6B 3NEJA 3P20A 1UPTA 3CWQA 4OQNA 4JZKA 1GDDA 4TL7A 2IWHA 1FFHA 1HURA 3ZJYA 3SJZA 3LVQE 3FOZA 4LBYA 1W0JD 3E70C 4HAXA 3ADBA 4MUBA 2ONKA 3EG5A 1ZIOA 4C9BA 1OSNA 1KMHA 1ZUHA 3NBFA 4LV5B 1TF5A 4Z8YA 4Q48A 1ZCBA 3BD9A 3VU9B 4ZKDA 2W58A 2ERYA 1A1VA 5F9HA 1XJQA 2FJUA 1N6NA 3CW2A 5AJWA 2OAP1 3RSLA 2I1QA 1XMJA 4D82A 3GLIB 1CEEA 2DYKA 3B1YA 4LJ4A 4KLNA 3U3KA 2BKUA 3FGNA 4JSTA 5B2ZA 4EJSA 3LX5A 4NYJR 1VIAA 1I2MA 4AYTA 3CRQA 2EWWA 4D2IA 5HE8A 4L9SA 4GZMA 5J4KA 5K8LA 2ZR0A 3AVPA 3A1SA 4V03A 3ZLJA 1RYFA 3Q7PA 3SEAA 4Q66C 2GJAA 2QUZA 4WXRA 1Z63A 2YINC 4W5WA 1N3BA 2FEMA 2J0UA 4IOLA 4A8JA 3K0EA 1QG2A 1KSJA 3RS2A 1W0KA 1YZGA 4WZAE 3I62A 2ZANA 3LLMA 1E9DA 1F48A 2OT3B 2HV8A 3PVSA 4DLUA 1QVAA 2H5EA 1CR1A 3CWZA 1J99A 1FP7A 1QHHB 1SVLA 2WIAA 3OE7D 5LD2B 4HAZA 1MO5A 3QE0A 3LBIA 1HQYE 3OEHD 4Z54A 2JLZA 1VCOA 4Q19A 4MGIR 1NKTA 1Z0KA 4EQ6B 2I4IA 1D8TA 1T0HB 2DCUA 4I81A 4D0LB 2BJVA 4MGZR 1OT3A 1KI4A 3Q7QA 3PUZA 5DN6A 4AI6A 621PA 1A7JA 1DAKA 3L0SA 3T1VA 1S3SA 3JZMA 1X3SA 1UKYA 4EFLA 5D3MA 3DZDA 4PX9A 4D80A 2H7VA 4OJKA 4V0NA 2A30A 2A5JA 5FBQB 4C2TA 4A0HA 2C9CA 3T35A 4OK5A 1NLZA 4I1SA 2VF7A 2ORWA 2GCNA 5FTMA 1TF2A 4LBZA 4LJ5A 4BLQA 3W3AA 3R9IA 4ERNA 1ZJ6A 2P5SA 1YZUA 1G1MA 2RGAA 1YU9A 1DO0A 2ZETA 3CRW1 1UBEA 1COWD 2QEQA 1QHXA 5FH9A 3K0CC 1XEXB 2XTZA 4MYCA 4TQ9A 5E3HA 2G1JA 5K8UA 1W4BA 2CE2X 4XSGA 4F91B 1N0UA 4ZIRB 1P6XA 4KFSA 1WA5A 2IYRA 4OHYA 2I3BA 3PITA 2IF0A 4B3DA 1WCV1 4ARZA 5FTKA 1W36C 2P6NA 2TMKA 4B43A 4MH0R 4TLAA 2ZYUX 1AA9A 5JSZA 1K5DA 4AG6A 3EXAA 3HPRA 2RB4A 2C03A 5E7MA 3A1TA 2G3YA 3S1AA 1EG7A 3TKLA 4LI0A 4EJSB 5EE1A 1KI2A 1JXOA 2ZJZA 2DHRA 1DAFA 2EWVA 2WBLC 1R0XA 5EP2A 2X8AA 4F4JA 4EQ6A 4BPBA 5FTJA 3SQXA 4GMXA 4L5BA 3IPYA 1A82A 1E99A 1OFIA 4PZZA 3P27A 5DHAA 5EXPA 1RZ3A 5A5GA 3G82C 4HLUC 4LSGA 2G1KA 5L3RA 2YOFA 3QVUA 3IKJA 4B75A 2QPTA 4UNPA 3PEUA 4YMVA 2B8TA 1BH2A 3B5JA 2RGXA 2PT5A 3T61A 2R65A 4FCVA 3UWOA 4WZBE 2R62A 1PLLA 2BMFA 3ICQB 1UDXA 4PZLA 4IDQA 2AX4A 5FR2A 1N25A 3E2IA 1NNEA 2BKEA 1AGRA 1KNXA 4TMXA 3KQHA 1QG4A 2DFLA 3IIKA 4DSTA 1E2EA 1UBFA 4V0ME 3B1VA 1E1QA 3AF4A 3D7MA 1XTJA 1ONBA 2V8OA 3SNHA 4B3XA 2GJ8A 2HYDA 4NCKA 4C0HA 4OI4A 4LJ6A 3W8NA 1R5NA 3K53A 3AF0A 4WIAA 4TYYA 1CULC 2J0QA 3VAAA 2V7QD 4LYFA 3ZQ6A 1D5CA 3IO5A 1KK0A 1TADA 2FG5A 4TLBA 2IS1A 1W1WA 2O8FA 1QHHA 2LWIA 3LO5A 4UNQA 1P2VA 1P72A 5C2JB 2DFNA 5SZKB 1X1SA 1ZD8A 2QN6A 1G16A 1NVVR 2FSGA 4KLZA 1EFRD 5BN4A 2ZRFA 2P67A 2FE4A 5IT5A 1TEXA 4XTCS 1KJYA 2F3RA 2AKAB 2QRZA 1MH1A 4HLUA 3N2EA 5HKKA 2IL1A 3SYKA 2D4HA 2OFWA 3UG7A 3KB1A 1OXXK 1AKEA 1Z6YA 2EU8A 1GFIA 4C0JA 1G18A 5H68A 1JECA 2HT1A 4NKRA 1QHYA 3SFVA 3L0IB 3HWSA 1E94E 1G8GA 4G5RA 1IJFA 5F98A 1DARA 4FWIB 1G64A 4G5OA 1ZIPA 2A78A 3T34A 1IY0A 2GVZC 2NG1A 2ZYWX 2A5DA 3AP2A 4B73A 3THOA 2IYYA 2QY9A 1XEWY 5B64A 1EX7A 3OEEA 4TMTA 4II7A 4ARZB 4RCYA 1E9BA 1H8ED 1RE0A 4FWTA 2HLDA 2GAOA 2ZJYA 1FX0A 5CDFE 1G7SA 3GJ3A 3QF4A 2HF8A 2RGNA 4LYJA 2QENA 1KKMA 5CM8B 3F8TA 3I72A 2ATVA 1HY3A 4NU0A 4ZV4A 5DI3B 1MO4A 1VIYA 3LFUA 1U8YA 5D3QA 4LHYA 4BFVA 3FHTA 3SR0A 4CDGA 5AK0A 2NPIA 4P31A 3X1DA 1G5RA 1II8B 1P4SA 2KE5A 2ONJA 4LHZA 3AF3A 2GEVA 1LY1A 5FUVA 2FPLA 4DEYA 1G6OA 2CMKA 4FMBB 4PPFA 3Q9LA 3OEHA 3FFAA 3QKUA 4KXFB 2H16A 4LHWA 4M0LA 3QF7A 1U8AA 5G40A 3EPJA 1U2RA 1UF9A 2R9VA 1J90A 4G5GA 2G9NA 1NN0A 1R0WA 2C98A 2VP2A 3CONA 5DGXA 3T1OA 4EKDA 3KJEA 2ZRAA 2XTMA 4E22A 2FFBA 4W7SA 1V43A 4MYTA 1YR9A 3Q8XB 4BECA 2X1VA 2Z6VA 2QSZA 1KI7A 5E4FA 4FW9A 3DMDA 4HI0E 5L3SB 1OH6A 4TMZA 3WYAA 4O3MA 4PQRA 3I8SA 1TU4A 5J4VA 1WBBA 2XZOA 5LPNA 1XF9A 3D6TB 4C4PA 4M1WA 3MJHA 4DLVA 2ZSEA 4JLNA 3CR7A 4HEJA 1G8HA 3HYRA 2QG6A 1BOFA 2DWOA 4RKFA 4BZXA 4LK2A 3U3MA 3FMPB 3CF2A 5E7IA 4BFZA 2FF7A 5AUNB 4TTPA 1W7AA 3ICEA 4MDEA 4M1KA 3AKYA 1DE0A 3BFXA 1XEXA 3K70D 4BZQA 1P73A 4QBGB 2O5VA 4NCHA 1KY3A 2QMUA 2VSXA 4BLSA 1UAAA 2YKGA 1JAIA 2YWHA 4DT1A 2IS6A 4R9UC 1R2QA 4EPXA 2CL0X 4EDHA 3I32A 2AXNA 4A15A 1M6NA 5F3WB 5DN6D 1OKKA 5EE5B 1IAQA 2Z4SA 4QGGA 1RVDA 1NP6A 5GJBA 1ZVQA 2FGKA 5KSYA 3TQFA 3GPLA 4C2UA 1SZPA 1W46A 3MWYW 4HB0A 4S2EA 1TQDA 2GBLC 3W90A 3OAAA 1DBSA 3B8HA 3QXJA 4UXJA 2C5LA 2WWGA 2QTHA 1HQCA 1G3UA 1G20E 4IEEA 3CF0A 4I1VA 4Z51A 1FX0B 3U5ZB 3IILA 3SN6A 4RFSA 1O87A 4GFDA 1W49A 3AKEA 2VBCA 2R6GA 1RFLA 1SVSA 1T5IA 1FUUA 3LWNA 1E98A 3O47A 4NH0A 2CCGA 4OQFA 1S4QA 2QMHA 3REFA 4BLOA 1YRAA 2D3WA 5G3ZA 3K70B 4BFWA 1E1RA 3H86A 4P0TA 3MFYA 3ZQJA 4G5SA 5DI9A 2ZI5A 5CLLA 4PSVA 1VKJA 4I99A 2LKCA 5JZVA 1D9XA 4CEIA 1N5JA 5UKDA 5J5CA 4J0QA 1CBUA 2HLDD 1GRNA 1N6OA 3IHWA 4JS0A 3B1ZA 4Q4AA 2EVWX 3KQUA 1SVWA 2VRWA 1S96A 4LJYA 3DM5A 1WXQA 1DAEA 3UIEA 4W5JA 4WBSA 1AIPA 1IN5A 5G41A 2QP9X 1G4UR 2ZRMA 3BJIC 3GFTA 4MITA 1U9IA 1OH8A 5JMTA 1ZUIA 4RZUA 1ETUA 1Z29A 4O25A 2CHQA 2KB0A 2OFXA 3CM0A 3H0KA 4URUR 1MABA 2J59A 4RZ2A 3RS3A 5JLJA 4MRNA 2VTKA 3KQNA 3U60B 3GJ6A 3GEEA 1G8PA 1VCIA 4AKGA 1T6NA 2LKDA 2F1JA 3K0CA 5E7JA 4F92B 3T5DA 4TYWA 1C4OA 2J45A 1XB2A 5KTYA 3PEVA 1UBCA 1HA3A 2ZITA 4HZUA 4BFUA 1JB1A 2ZREA 2YOHA 1JQLB 1KAOA 3ZYCA 1YHNA 1FUKA 3CPEA 2GKSA 1E2IA 4JSYA 3QIAA 4IOKA 4K8OA 1SVKA 1T4GA 1XEWX 2RGBA 5KPDA 2QORA 4NP6A 4CF7A 2WSSD 4LRWA 3K9NA 1LVGA 2WKRA 2QP3A 1JR3E 1D2NA 2CBZA 3PUYA 2B6HA 3PV0A 1Z06A 5KPJA 1AKYA 5JWHA 3WMEA 2OZEA 3AP3A 2VP0A 1SXJB 3SDZA 4BFXA 3AGQA 4IOJA 2NO1A 2C9YA 4RZXA 1VDZA 4US0R 4F38A 3LDAA 2V1XA 4JLBA 4BEJA 5B58C 4MKIA 2C95A 1YZLA 1KSHA 4IVPA 4Q1BA 2D62A 1CIPA 4HB2A 1RRFA 1XJCA 1OLOA 5GJVC 3V4FA 3AVWA 3SFZA 2WJHA 2J5XA 3KTAB 5CYOA 5FUXA 2QBYB 1ZP6A 2NO6A 2FA9A 1R5OA 1Y3AA 1U9IC 4QOSA 1E2NA 3BS4A 1G9XA 1NL3A 2X2EA 4XJXA 3QKSB 4YXWA 3PCRB 4DEXA 2XOKD 4H1UA 3FKSA 2GA8A 5DO9A 1N0VC 2IYWA 3DEFA 1N6PA 2G88A 4GOXA 4AKHA 4F7WA 4DB2A 1RIFA 2B7CA 2JDIA 2ORVA 2ZXUA 4IKEA 3K0FA 2X19A 3VFDA 3QF4B 1E9EA 5L3VA 1Z0FA 2A5FA 4X8LA 1MKYA 4B3GA 3EWSA 4M1YA 3ZVRA 2PMKA 2ZUDA 1Q1ZA 4LJAA 3UWKA 4KU4A 4V02A 3J81k 4RD3A 1UKVY 5TVKA 2KWIA 2F55A 2NMVA 2JLVA 2FV8A 1NKSA 2IYLD 4QNMA 2RMKA 4Q1DA 4RSGA 3PG5A 4LOAA 1JALA 3PXGA 3HDTA 1Z0JA 1OIWA 1N6LA 3OEED 2CLDX 1EGAA 1ZD9A 4ZPXA 1JPNA 1W4RA 2J0UB 4B6EA 2D2EA 3RAPR 3NVAA 2WWXA 2AXPA 1Q20A 2BV3A 1NN3A 1E2DA 4N1AA 4DLXA 4Q1AA 1Q3HA 1XCGB 2F1RA 1Z47A 4ESHA 5FI1B 2HT6A 2YZ2A 1KHTA 5FPHA 4XWAA 5HKKD 1H8EA 4BGDA 2CNWD 3NHBA 3WNCA 1CJMA 2N42A 5CYPA 3OHMA 3C16C 1E79D 1ZYUA 5JHGB 5AUOB 2CDNA 3K09C 1E6CA 5FUWA 4A6XA 4D6PA 1DELA 3KJGA 4Q4LA 4XVRA 5AWFC 2RCNA 3BH7A 4PC2A 4K81B 1L7VC 3GJ0A 4DHEA 1TMKA 2FFQA 4D26A 4PO1A 5AJXA 4CIDA 2UZIR 4IFEA 2ZE8A 2W6JD 2VSFA 1BKDR 1GG2A 2ZSFA 4FCTA 1TEVA 4GSYA 3SJCA 4BASA 2ZM5A 3C15C 1RRPA 3ADDA 5DYIA 1T0JB 2VO1A 5ELXA 1P9NA 1XD8A 5EUMA 4DDTA 2OM2A 5JBQA 2OCYC 2PX3A 2R6CA 3DZ8A 2JJ2D 4NBSA 4GT1A 2FZLA 4ZO4A 2ZROA 1VYTA 4KI0A 1A2KC 5FBWB 4B48A 1NSTA 4B32A 4JLOA 2FWRA 2ZS9A 4XSHA 3WP1B 1DAGA 3TVTA 1IJEA 2IA5A 1U94A 2RH5A 2A5GA 1OXSC 3U7EB 1G5PA 4FXPA 4P4SB 3SZRA 1N6IA 2HJGA 3CO5A 5FPYA 3H1TA 4PAQA 1R6BX 1LS1A 3K0SA 4C0QC 2OXRA 3K09A 821PA 4Q5IA 4C7OA 1TNDA 2F43B 2PL3A 4LJ7A 2X77A 1KY2A 3SYLA 2WICA 2BBTA 3OF5A 4PPNA 1W5SA 1D2EA 2O8BB 4JYCA 2XSZA 5J4YA 4TLEA 3EWAA 4KHZA 4JLDA 4AYWA 4NONA 3G0HA 3CX6A 4JKIA 5K8IA 4QM7A 1NY5A 3BFVA 3KKMA 3B1XA 1US8B 2GNOA 3I4LA 3VR3A 4LDJA 1KTVA 5J40A 4AY2A 1ZAKA 1FNMA 4OQLA 5BYJA 3VR4A 1EWRA 2WJYA 3A36A 4NHOA 3KFXA 5HE9A 5A4JA 3NWJA 3DM9B 2GILA 2QPOA 3M0EA 3OIUA 4FN5A 2Q3HA 4JLJA 3RS5A 3NHAA 3W6OA 3BERA 3FB4A 3T1QA 1CS4C 1X8JA 2ZUBA 4G0NA 3WNBA 3NG1A 3BBPA 1Q3TA 2NIPA 5H70A 4AK9A 3PUWA 4DCVA 2YNMA 2IW3A 5J47A 1JNYA 1JI0A 1CJUC 4QBHA 2KJQA 3K1JA 4PZYA 3GP8A 1TQ4A 3AVUA 3AF1A 2IYXA 4QFMA 3SI7A 5FFMA 3UMRA 4I4LA 5C1BA 2NZJA 1KJZA 2XXAA 2G6BA 4I1OA 3MRSA 3VR2A 1G3MA 2FEOA 2JEOA 2G0NA 1EFTA 3M4YA 1HEIA 1BMFA 2H57A 2HXYA 1QRAA 1T9HA 5KDLA 3KL4A 1JAHA 3CKLA 4CRWB 3BH0A 3AEZA 4ASUA 5AR1A 1P2SA 2JJ1A 2VHQA 4N0DA 1SXJC 1ELOA 4GZLA 4PHGA 4R2IA 2WMOB 3KUCA 5FPSA 3WRXC 2XNDD 2GDJA 2GHIA 1CKEA 4ABYA 2E1RA 4Q1EA 4BWYA 1NVWQ 1N6RA 3DMNA 4DKXA 1NRJB 1LW7A 2B7BA 4A36A 3BB4A 1IN4A 2IWRA 4MKHA 3LXXA 2WSSA 1U0JA 1JJ7A 1JR6A 3DHWC 1Z22A 2YC2C 5FOWA 2QP4A 2GXUA 1U0HC 4L15A 1EFRA 3NTUA 2ODEA 4DLRA 3JZAA 4GDFA 2CHVA 4MRSA 5C4MA 2VSOA 2WPDA 1FMJA 3A37A 1Z6TA 3QKRB 5CK5A 2JLQA 4EAQA 4KITB 1EFHA 2CJWB 2FMXA 1KK1A 1GNPA 2JJ2A 2GWHA 4TYNA 1ZINA 3H84A 4CW7A 1IY1A 3THYB 2OLJA 4O0MA 3U44B 3CX7A 4HLCA 3X1ZA 2AN9A 4TLCA 3B2EA 2GEUA 4AKIA 4MRPA 4YMTA 1Q57A 1OPXA 4MKGA 2UZ3A 3SHWA 4UJ3A 3V00A 1P61B 3L82B 4ZDIA 4QJ5A 2O8DA 5H1YA 3N70A 2Z4RA 1PLKA 2OSBA 2FGJA 2OBNA 1SQ5A 1XMVA 3AH8A 4IRUB 3GJ4A 2QI9C 3MJRA 1VG0B 4KCGA 3U6BA 4ZDKA 2J0VA 1D6JA 2BM1A 2ATXA 1NF3A 3C41J 1VMAA 4QGAA 6Q21A 1T5LA 5KNDA 4BZPA 3IBYA 5LD2C 5TY0A 3W5JA 1IXZA 3K8YA 2P3SA 5JJKA 1KK2A 2BCJQ 2EQBA 4YC7A 3VMFA 2GCPA 4A8JC 3BOSA 2QNRA 3FE2A 4BEBA 2ANBA 1BIFA 4D0GA 3B7GA 2VLIA 1R8SA 5CIWA 4HLQB 2BC9A 4TWZA 3THWA 1ZC3A 2G83A 3MG9A 3C7KA 3CNOA 2KI5A 2MMGA 2UKDA 1ANKA 4DLSA 2FH5B 3KXKA 1Q1BA 2N46A 4CYMA 1G8FA 2ZR7A 1BYUA 2ZS7A 4Q01A 4UJ5A 5DYGA 2W6IA 4M9ZA 3LD9A 5IF9A 2ZJOA 4RCZA 2O8CA 2PX0A 2JGNA 3SC3A 4C0BA 2BBSA 2XJ9A 2ZJAA 3KZ1E 2QGNA 4OL0A 4HUTA 3OZXA 2BDTA 1SKYB 4HATA 1NG1A 4LCBA 2WWFA 2ZPTX 4KFRA 2PEZA 1F5NA 3C14C 1FQJA 2QAGB 2W2XA 2WV9A 2ZE5A 1UEIA 4EFMA 1JXMA 3QOFA 3R20A 1ZRHA 2GAAA 1E2GA 2GTPA 2ZU0C 2IBMA 1NLYA 4RZ3A 2YC4C 5EQTA 3LW8A 2WIBA 1XCPA 4ZCLA 2AK2A 2REXB 1KZGB 1CJKC 1F3OA 4HB3A 1NBMA 1IN6A 3VX4A 1GITA 3L8YA 2WOOA 3QENA 5GADl 3T5GA 4BFSA 2L0XA 1Q0UA 2CHGA 1W48A 3JVVA 4OYHA 4NYMR 1L4UA 4IDPA 4QJ4A 2BEJA 2ECKA 3KXLA 3RHFA 5HZHA 3GJXC 2OG2A 5LBIA 1I4TD 2R44A 3IPXA 3I73A 2J0SA 1I4DD 3QVVA 4UXIA 1KI6A 2GK7A 2WZQA 3NBZC 2P65A 2J3EA 4HB4A 1E69A 2ZU6A 4DUGA 2PZFA 1R8QA 2O8BA 1XTRA 2CL7X 1XPOA 4G1UC 1S8FA 2OV2A 4DDWA 4RJLA 4U7DA 4QHYA 5KUTA 3A4MA 2IXGA 5FPTA 3F0TA 3F3YA 2EFHB 2QAJA 4W5HA 1Z2CA 2P2LA 5KO2A 4M9SA 2D7DA 1J7KA 3C5HA 3L0OA 4FIDA 4DCTA 3CF6R 1SVIA 3RC3A 1CRQA 3FPAA 2IF2A 3I1FA 4TYPA 3NXSA 4GNKA 3KQLA 2XB4A 3MUFA 3HP1A 3LV8A 4KVGA 1EXMA 5FBLB 3WY9A 2OBLA 1W36D 4XWOA 4JL8A 1X6VA 1KI8A 2JJ8A 5AJZA 3A6PC 4P4TA 4PAMA 5CM9C 4PAOA 4BE7B 4ZCIA 3KTAA 4HDCA 2HUPA 4O2RA 2QBYA 4S35A 4Y0VA 4IW3B 4W9MC 5KDDA 1YQTA 2D7CA 3CRVA 3TH5A 4XD7A 2CXXA 3QG1A 4LZZA 1TTTA 4JBYA 4A4DA 1R4AA 4RFSB 4U00A 3U3JA 1E2HA 1GIAA 2CEAA 3HR7A 4HDQB 2ZJ5A 2W0SA 2WWIA 2Y8EA 3BWDD 4OJQA 5L3QA 1KNQA 1HT2E 4ZDWA 4TZ0A 1BYIA 4IDNA 1BO6A 4TQAA 3CH4B 1VCMA 1KAGA 2FOLA 1QF9A 2WHXA 2Q3MA 3RS7A 3WBJA 2PJRA 3ZS8A 4TL8A 4JBWA 2E87A 2D74A 2V1UA 4LHXA 1OKKD 1ZU5A 1DAMA 4KBGA 4A9AA 2ZQ5A 3AKDA 3GEHA 4R2HA 2CJWA 2QT0A 2R6FA 2ZYTX 3AVQA 2BOVA 4C0AC 2ZRBA 1XFAA 3B1WA 4B74A 1G3RA 1N5LA 1T3HA 4ILEA 4C0SA 3EC1A 5BXQC 1YZQA 2NGRA 5JEDA 4MUAA 3IHLA 1W2GA 4DCSA 5M04A 3AVYA 2XNSA 1PUJA 1UKEA 4XD7D 2NPFA 3SE0A 1OV4A 1KMQA 1Z07A 4FMDF 4FMDB 3OIYA 2GVDC 2VQSA 2J87A 3M1IA 2PZEA 3OESA 2CL6X 2JA1A 121PA 3EZ2A 4IDOA 3WMFA 3M6AA 3MWKA 4M1MA 3IEVA 1KOFA 1SHZA 2YWGA 4DIDA 2ZI4A 4TL6A 2H18A 2EFCB 1IXRC 4GOJA 4KSBA 2ZR9A 5EE0A 2ZTSA 2ERXA 4ITRC 1Q22A 2PCLA 1UEJA 3EA5A 4OBEA 3NC1C 1GKIA 2PCJA 4WA7A 1S0UA 4A6PA 1VECA 4RD1A 1KO7A 1NVVQ 4JJKA 1T3LA 1AN0A 5TB5A 3EIHA 3IQWA 4IVRA 2IX3A 5BWMA 2Z0MA 2F7SA 2OCBA 4OI1A 4M1TA 4JLPA 5IDVA 4UNSA 4DZZA 2PLFA 5FOUA 3ADKA 3KUDA 1IONA 5DISB 2IYQA 5CK4A 1X86B 3EAQA 5EXSA 3TW4A 3KX2A 2ZSBA 3P26A 3PUXA 4P32A 2WKPA 4FD2A 1DAIA 3KKNA 1P75A 2H1LA 3UKDA 5KNBA 1MOZA 1Y63A 3GJ7A 4D81A 3MLEA 4QM6A 3JVUA 4IOMA 3W9YA 4C3ZA 5EZ6B 4LJ9A 4LJ8A 3TAUA 2QGZA 1XPUA 3TNFA 1G3IA 1OIVA 2GETA 1VTKA 4PHHA 1PUIA 1GM5A 1R0YA 2ZJBA 1RKBA 1TL7C 2ZAMA 4Y0AA 1G291 3BORA 3HYTA 3K0AB 4JIMA 1YE8A 5SZJA 2FPKA 3CZQA 4RD0A 1KO4A 2JAQA 3AUXA 3ZGXA 3EW9A 3DKPA 2ZE7A 4KSCA 3Q72A 1G19A 1NY6A 1VG8A 3I61A 3LRPA 2FZ4A 3A1UA 2XEXA 4DWJA 1OB5A 5EE9A 3Q5DA 4LYAA 1G7CA 4RKEA 2EFDB 4Z1MA 3IUYA 4BQSA 2QM7A 1ZNWA 4ON9A 4Z8XA 2XITA 1DVRA 1T91A 2DPXA 2Q0HA 1X8KA 3MMPA 1NLFA 1U0LA 4RVCA 2H8KA 3F5FA 4EFNA 1N6HA 4ZIRA 3KFVA 2C96A 3WRYC 3QG5A 2ZVQX 1E4YA 3LLUA 3BB1A 3RSOA 4A2QA 1PV4A 1FW6A 5EZ5A 3KKOA 2WWYA 4C0LA 4LV8B 2WVJA 2V7QA 3SU8A 4AD8A 1EWQA 1RYHA 1WMSA 4OQMA 1GTVA 4Q9IA 3CPJB 2FDCA 1E9RA 5J4LA 3CX8A 1E9AA 1E2QA 4ZKEA 2J7KA 2BBWA 1VG9B 3VR6A 3GLFB 5BN3A 5JECA 4PQFA 1N5KA 3BIFA 1U8ZA 3ZVLA 3TAHA 4JLAA 1TUIA 1CRPA 4M1OA 4TMKA 2BMDA 3NDBB 1GZSA 3L43A 3T12A 3WHKA 3AB3A 1MO3A 1E0KA 5JWOA 2FU5C 1PLJA 3REGA 3KQKA 2WWHA 1M34E 3FMIA 1M7GA 2DFKB 4TT3D 1XPRA 2PEYA 3OIWA 4DLZA 3TR5A 3B9PA 1L4YA 1Z8FA 3SYNA 1AQUA 3TIFA 1QZXA 2HDNB 3UPUA 4MRRA 4FI3C 4GOKA 2ZRHA 4PSKA 4B76A 4IDHA 4WVFA 4UNNA 3GMTA 1LFDB 3RLFA
chains in the Genus database with same CATH superfamily
1UOQA 3WNQA 4MVJG 1SGWA 3ZUGA 1ZNXA 5EHGA 3Q8LA 1BHO1 1XHEA 1P2TA 4FB5A 2V7BA 2QTVB 2QN8A 3HU2A 1AMNA 4ZVKA 5TS2A 4RPHA 1BW9A 1ZESA 2XT6A 4O1MA 3IOCA 2C9DA 1JEQB 1HG0A 3GCGA 2RGGA 3HPQA 1P0MA 3NBXX 4D3YA 5J1TB 5FTWA 4CTKA 3F3MA 3DO8A 2FDRA 1D6NA 1AM4D 3PHHA 5EJGA 1QJCA 2ZRIA 1XXHE 2X4IA 3QRWA 1WZCA 5IAKA 1AQNA 1C3XA 2CMFA 1GJRA 1ZXBA 1C80A 4ZOLF 1V7PC 1ISFA 5HPYB 2HSEA 2EP5A 1ZVMA 2R2AA 2JFGA 4L1KA 5CH5A 2EZ9A 2CNWA 3TMKA 2G09A 2Q28A 2WKSA 1NW7A 2OEPA 3LA6A 1DDIA 1LPSA 3EXHB 1ID8A 1NRWA 1E1QD 2WK1A 3FDZA 4HDNB 5KYKA 1JDZA 4AI6A 5FL3A 9ATCA 4WOKA 2R751 1ECCA 3TFQA 3KXDA 5ALQA 4AF7A 3TK1A 3CEJA 1Q77A 1RWBA 4QDTA 3U7HB 3PGMA 3ZCRA 3QKWA 1QIMA 2FQQA 5D7BA 4NJMB 2EFGA 2ZDHA 1U0GA 4RV5A 5K4AA 4IXMA 4Q1FA 3SYMA 3S3TA 1L7PA 3DOIA 1UANA 4DXAA 1U9JA 2RHMA 3A8TA 2JFNA 3I1JA 4I2VA 2QIOA 1K06A 1M8KA 2B7LA 1CJVC 4FYJA 4D99A 1PZFA 4MWDA 2JFYA 3DUFA 4DMHA 1Z15A 4E2YA 1CF4A 1HOXA 4NZNA 3MEQA 1TMYA 1CG6A 1QR2A 1JEJA 1ODIA 3NYRA 1G6Q1 1ULAA 1HFJA 4D9EA 4HNAB 4CT4B 2PSFA 1HKHA 4FGKA 5IKOA 3STHA 3ZH9B 3SQWA 1CUJA 4M3NA 5GOZA 1IN8A 1B0PA 1MW8X 3CBQA 1MV5A 3MCZA 3HTXA 3Q88A 2ZVJA 2AJCA 2Y77A 4KTTE 1V7QA 2X9NA 5E3JA 3WGGA 1OAOC 1C2YA 2ID9A 4K87A 4M8NE 4HPJB 4H3VA 2ILTA 3HGMA 1T4CA 2QLJA 3GT7A 2ZRJA 3FFXA 4EO7A 4CKBA 5CCBA 2ZUCA 3GARA 3OZRA 3UT0A 5IDXA 1LF5A 1LLFA 3LQ1A 3E22B 4HGNA 4LVNA 2E4VA 4UM5A 1Y89A 3R24A 1H1DA 3R5FA 4HC4A 3AQIA 4OHPA 5TXGA 3GFSA 1W59A 3KBOA 4M22A 5FRDA 4PYJA 2YZ7A 1R8JA 1XROA 4M83A 1EZ4A 3P97A 4FFWA 1XD2B 1E5XA 4X60A 3AR6A 1GKUB 1OHHA 2CVHA 2Q4BA 2VPTA 4PBTA 1R12A 3TGLA 4WOPA 3ONVA 1U7WA 2HU8A 3ZWCA 4AL4A 1ONOA 4Z1MD 5FWYA 5D5HA 1QE3A 2WY2D 2AG8A 5AKJA 4D4MA 4WTOA 3RUDA 5EJ5A 4H7EA 4DCNA 4OXKA 4BGVA 1KO1A 2G6TA 4P6VF 3VPXA 1V5WA 1R0ZA 4EG8A 5MGNA 1E3DA 1S5PA 3BTUA 1Q6YA 2L17A 3D64A 4UAVA 2ZRCA 3SLKA 2F1HA 3E81A 2I8LA 1KYXA 2JEZA 4OA8A 3DFIA 1JFTA 3WLPA 1FFEA 1YBVA 3OM8A 2E89A 3PJDA 4ZC8A 2BSAA 4L0MA 4B3BA 1L5NA 5L8VA 4JY7A 1NG9A 3AHEA 1G38A 4ND3A 1ZOLA 2J5QA 1FNNA 3CLTC 2Q46A 3HWRA 5TJHA 2H17A 5BRAA 5I7VA 2B8EA 3HA5A 4KH0A 4JL6A 5KSPA 4Y6QA 1QE0A 2G77B 1Y4SA 2YFKA 3L5OA 3ILXA 1RAEA 2VT3A 3NTXA 4IDFA 2WHQA 5I9NA 5IYZA 4HFMA 2QL9A 4HUQA 1QH8B 5DBEX 1NXOA 1I3KA 4R40A 4AY3A 3WDMA 4G8DA 4Q7KA 4RULA 3MT7A 4GOMD 4DUYB 3H9GA 2XTNA 1OH7A 4NZPA 2H4ZA 5AIBA 4OD0A 3DDWA 1R8YA 2KLHA 4MUYA 4DCJA 2AFVA 3AEQA 4TGLA 1ST2A 5IK2A 4M1EA 4RGBA 4PPQA 2QM8A 3LT5A 1XZCA 4RKYA 4DIMA 1JBQA 5SZIA 1K1EA 4ZT2A 1WU8A 2XA2A 4QPCA 1AXEA 5BSFA 1EX6A 2IHUA 4UTXA 4FCWA 1GAJA 1X7WB 1T0UA 1X77A 2HA2A 2HEIA 1E2UA 3WGMA 3QI7A 3HJCA 4NMHA 1FL9A 1FDWA 3N8KA 4OAOA 3V7WA 3EGXA 2X14A 4Q00A 4ESVA 2YV3A 4X63A 5CNKA 4FI3F 5T41A 2DERA 2IYZA 1IY8A 3ZE1B 1SY7A 2XY4A 4O8ZA 3TCXB 4R5MA 1EDBA 3MBIA 3P94A 1KP2A 3N2GA 4RY2A 5DHFA 3S70A 4D4JA 1CE8A 4TWRA 2WIFA 5EKSA 1U2PA 3G5UA 5JCZA 2ZRDA 4FS3A 4G41A 4TV8F 3TSYA 2H0RA 2AOUB 3DD1A 2E5WA 1TYAE 4Y98A 5GM1A 1GRRA 4EABA 5JASA 1HEUA 1JU4A 2HIGA 3LT1A 5KQPA 3I5XA 2HF9A 4G63A 1XA0A 2ZWVA 2OV1A 1NSFA 3CPSA 2ACKA 4QEZA 3REOA 4PLGA 4CM8A 3KOWA 1DFIA 3QEKA 2OGZA 3QWIA 1DU4A 2RGNC 4MXDA 5H16A 2X0KA 1F6BA 2PX8A 2WG2A 3D3WB 1B23P 4DWOA 3PDCA 2GZAA 1EUCA 4I19A 2NUAA 4JP5A 4BZZA 4A0GA 5KMGA 3THYA 4GPIB 4PW0A 4YP7A 3MF4A 4BO8A 3L8MA 1K6IA 3X1YA 3IA7A 3WLFA 1R5BA 3ITKA 3VKFA 4J1TA 1WETA 3AQ4A 1AKMA 2J7PD 3MTBA 4R1QA 5JZOA 3PQFA 2G72A 4NEHB 1QU2A 1QHNA 1GL6A 3C3MA 1KEEB 5D01A 5LXTB 4CLEA 2IXTA 5IMSA 3R8FA 4ZVVA 1GNRA 1HH4A 4BRZA 3ZIAD 4C6TB 1FZQA 3IDSA 4LPSA 1VHWA 1T13A 2R6DA 3H2HA 3EQ2A 1F2UA 3FGOA 3G2NA 2W93A 2YWCA 2VYNA 3H4MA 1EUCB 4KQKA 2B78A 5F7OA 3SJ7A 2FJPA 2P4HX 2HWUA 3F2IA 3GDWA 1NVAA 5F2EA 2EV9A 2SHKA 3G0GA 3UOWA 4ZI3A 7MDHA 5I45A 2ZJ8A 2QROA 2Q50A 4DXDA 1L6RA 3OFNA 1XZ8A 2GF9A 1RJFA 1CUXA 2Q0XA 3FBTA 3E7PA 1DIRA 2HPVA 4JYBA 2OUKA 2RC5A 2QQ0A 5FA5A 3TMYA 3P9XA 4F84A 2Q6KA 3B6EA 3X2SA 3NHJA 4AF6A 3HZOA 2EFYA 1SFRA 5FTNA 3ZG6A 3H7AA 3QV2A 3VYSB 4KODA 1AH2A 1D4FA 2FF5A 1R7RA 1G7TA 1BKYA 2OE2A 3Q2IA 1YA8A 3ONWA 2VAPA 2OV8A 1QFJA 2RHDA 1HDIA 1U99A 2BJWA 3AR4A 3I9V1 1N6KA 4YYEA 4LRXA 2MOKA 4RLQA 1X7DA 3GEBA 4TTRA 1ULHA 3RABA 4DLAA 1FLDA 1Q16A 2QZZA 2Z2ZA 3TR0A 3VR4H 1VDMA 1O5IA 2FPIB 3ZUPA 1XQ1A 1YQXA 2Y1FA 3MINA 2PRJA 4D0NA 1AKRA 1D0SA 2GT1A 2VCEA 5CT9A 5BQXA 2CUZA 1WLYA 4A2WA 1G55A 4HLNA 4KK4A 2PWYA 1W96A 2YJZA 3LI2A 4MZDA 4KLRA 1EUZA 1RRVA 3K9BA 4BQIA 4QO8A 3I9FA 4UBIA 3JSAA 2CDCA 4RANA 4L08A 3IPRA 2M6KA 3AHCA 1UODA 3RU2A 1EK5A 2YUTA 3OFSA 4PSUA 2QY6A 5LB2A 3B38A 3IP3A 1RNLA 2W2OA 1R74A 1LK0A 5KOHB 4ADSG 4TSFD 1JQAA 2GXQA 5BV0A 2C07A 5JNLA 1JG7A 4U2DA 3Q7SA 2JAUA 4WY5A 5H81A 2V58A 1EUYA 2CZCA 3V8NA 1C3JA 4AF8A 3PDIB 1XK6A 3NPMA 3PFIA 3WGTA 1G7RA 4KGXA 3WISA 3EH2A 3L6OO 3OTOB 2WAMA 1YULA 3KTDA 4F72A 5A0VA 3RRZA 4IWYA 3KIPA 2NSYA 2FMUA 4GX1A 4IGKA 4KWCA 3RLIA 1TA4A 2P1ZA 5E95A 1KMMA 2B21A 1I2BA 1WU7A 1HTBA 5TQJA 2P0EA 3NBQA 4N3AA 4F3KA 1W4AA 7GPBA 1WZ2A 3L9XA 1VA4A 3OQIA 1U2GA 1A7KA 2WIDA 2SECE 2AEFA 4PRKA 3GGPA 4CV1A 5CCEA 2G9UA 1DC3A 4QSMA 1IIRA 2ACEA 4LPKA 3FJOA 3EF3A 1L1QA 1NF8A 3G7UA 5HF8A 2IXFA 2HCFA 2N3ZA 3K0AA 1H2BA 1V8OA 1Z73A 4RXTA 3RT9A 3QBVA 3W05A 1CXZA 3ZD6A 3QUSA 4UOQA 4WXYB 1H5UA 3L7CA 3K9WA 5FA8A 4P33A 4TL9A 4PQYA 1JYSA 3EGEA 3U7QB 1AUVA 3D5QA 1T6XA 3C74A 3QVKA 1U7OA 5JQGF 3A9RA 3HN7A 3TQQA 2DUNA 3ROZA 1U81A 1JLSA 3H2YA 4ZI7B 4FSXA 2O8EB 4E11A 4ETNA 1XTVA 3ZGNA 2VA9A 3QWAA 4CODB 3HVKA 3LY5A 3T9FA 1ZXXA 4YDHB 1GRQA 3I04M 4QRHA 4KZPA 4PLZA 4PVDA 1DZ3A 3TRFA 4DJTA 4W5RA 3GL9A 2BGKA 2WT9A 2XYGA 3CX3A 3LPLA 2WPDD 1T2CA 1UM8A 1IYZA 2C2GA 3HDVA 3TJMA 1O6ZA 3L4SO 2J9ZB 5BV8A 1UBHS 2ZRNA 2BYTA 2VZLA 3CUEF 3KR9A 4GL2A 3F9CA 3A4VA 2WT4A 1P0FA 2QRNA 2BI7A 1G8YA 1NBIA 2RBEA 3C8ZA 2ZIAA 2O8EA 1W581 4Y2XA 4CNBA 1BXGA 1C9KA 2HNBA 2G9RA 2AOVA 3BUSA 3UBMA 3KZNA 2FOIA 3M6IA 3KB6A 1ZW6A 2G07A 5A4DA 3H2BA 3IKMB 1N1MA 3OLYA 3BQ9A 5FFFA 3W2IA 4H7JA 3GA5A 1T2VA 2JATA 4WZBA 2MIIA 2AOTA 5JO0A 3BXEA 3LAWA 5BYBA 3BWYA 5F9MA 3OQPA 3FB1A 4FP9A 1J06A 2VHCA 3RRNA 2DRIA 1MDBA 1ULSA 3NETA 4C43A 1QYDA 1DIAA 3BE5A 3E9ZA 2WAAA 1IC6A 2YZMA 1P8AA 3UPTA 1ODCA 4R6XA 4LVCA 1U8EA 1PVOA 1ZGGA 4V0QA 1OFUX 3ISTA 3N5CA 1E3WA 1O5OA 2A2ZA 4CF6A 1VHLA 2AD5A 1PZNA 4HPXB 4L95C 4B2IA 4QUAA 4YALA 2JK1A 4U7GA 3TSWA 4PNEA 1VMEA 1AS3A 3B20A 4NYJQ 3HKBB 2AUNA 1JKJB 1T36A 2BF7A 1JIVA 2CFRA 1FC0A 2JFOA 2QZ9A 4H0FA 5CX4A 1YKSA 3COVA 2ZIFA 2O0MA 3OCJA 4BKOA 4ECEA 4EI8A 1ZU4A 4PZ9A 5REQB 3C70A 3H75A 1EK0A 2H4XA 2V7PA 3D81A 3KZOA 3WFJA 2I1WA 3EFOA 1PDVA 4KYIB 1ENPA 3T3PB 2W7TA 4EO9A 1QF6A 1OREA 1PV1A 2P2SA 4IGIA 4JI1B 3U44A 2GARA 2AB0A 5E2IA 1H8HD 2WG1A 4TS9A 2WTUA 1PL7A 4ESOA 1RLMA 1NI5A 3M6VA 3QY0A 2BGWA 4YDRA 1C3OB 5EEGA 1MRSA 1Q2UA 2P77A 2EZTA 5CAEB 4ARCA 1OASA 1J8DA 4D8TA 2LNDA 1TM4E 1USUA 1ZM9A 1ZBQA 4HAVA 3COZA 4QBIA 5AI9A 3T4EA 2W2KA 2OOKA 4ZJZA 4IWNA 1VLLA 3OTGA 4Y9DA 5AM4A 2OILA 3WDKA 3CB2A 5CX1B 3A10A 5IJAA 2BGIA 3GLUA 5ALVA 4ZOEA 4LI3X 3HCPA 3PQ5A 4IEFB 4G5QA 4W1PA 2FW7A 1WXHA 2QHXA 3ZKAA 2R6HA 2QTAA 1R10A 5C5EA 1KERA 4UTVA 2X3FA 1CJTC 2GJ9A 4WHMA 3M34A 4OUDB 1YCDA 4ZQEA 5GVRA 2M32A 2YFYA 3C5CA 5F7XA 1JA9A 3MCVA 4RF4A 3TLZA 1MORA 2OFFA 1IUNA 1K27A 1U28C 2MSCB 4LSWA 4BMVA 2J7PA 4A3SA 4V1CI 2V6GA 5P21A 4PANA 3UK2A 5JNRA 3AJ9A 4YLEA 2K6GA 3JD3A 1MO2A 4YGYA 1NLMA 1JAXA 2ISCA 1WF3A 2Q7OE 1PEYA 3VJKA 5C7LO 1EAYA 1JEEA 1SU4A 5CIQA 3RK1A 3BT7A 4RPLA 2H2AA 3NHZA 5AVXA 2OGSA 1OJLA 5CLGA 5EIFA 3VQTA 4ZYWA 3EAGA 4QODA 3N5KA 1UFRA 3T4XA 2I2DA 3HXMA 1LA2A 3JCZA 3EZYA 3FTQA 4B2LA 4QECA 3OJ0A 3R4VA 3OZCA 1RAAA 2VK8A 3HYNA 3C45A 3PI7A 4PFSA 5EXDA 3RC7A 5IW8A 4OLFA 4AJPA 2FP4A 3LPCA 1BA3A 1O94D 2H9YA 1EK6A 4UC0A 1BS1A 2B98A 5F2KA 3VH1A 1KJWA 3ENNA 3DFMA 5CVDA 5EXXA 1Y1RA 5IP5A 3RTBA 2ZRPA 1PZHA 4D5EA 4RLSA 4DUGD 3BPSA 4C06A 5EWJA 3OZAA 3RYTC 1RMYA 3CU5A 4R2XA 3O8BA 3GLHB 1NT2A 3T3GA 1E1KA 1M8PA 3AJAA 1UUFA 3KXIA 3ZDEA 1QH8A 2VR1A 4B17A 3BL5A 3JQ9A 4RDIA 1X1DA 2WAYA 4L9RA 4MI3A 1L5WA 2O8FB 3LSYA 5I8WA 3Q2KA 2GN9A 3GUCA 4HBGA 5EZSA 3GRUA 3ZD7A 2IDKA 4TV9A 1YDGA 1E63A 4D5GA 4G3XA 3RH0A 1XCOA 2TSYB 1JBKA 5HUHA 5HVNA 1GKYA 3RK4A 1LBIA 4HQFA 1F0KA 3AINA 3OWXA 3RHSA 4BB5A 1C1XB 3BRWA 3LVRE 4AJOA 4YJ2A 1Y5IA 5KSWB 4B3CA 3W3ZB 2BMEA 5EP4A 3PC8C 4CEHA 1CY8A 5L3SA 3T5TA 5LLTA 4UREA 3K5PA 3A11A 1EBBA 4LYEA 4ZAVA 5D3MB 1PJQA 1TT5B 3H3XA 2NO7A 2Y1WA 3Q12A 4NDNE 4D45A 5C8YF 1WBDA 2XSZD 1QYCA 1SKAA 4MUXA 1JDBB 3WKAA 3HU5A 3NT5A 4KBFA 2IBTA 1IUKA 8ATCA 1DADA 1YIDA 3NW9A 8OHMA 4MIEA 4MVJM 2H7CA 3IHKA 1NOKA 3LOUA 5G02A 2OLEA 4BNDB 4JHXA 2NXWA 1NF2A 3BXOA 3HCDA 4M7PA 5FV7A 4FDTA 4RTJA 5ETJA 2C7RA 1FNBA 2IEIA 5F76A 3GVCA 4ZWNA 2GX6A 4IHJA 3MAAC 1ZZGA 4YR7A 4YMUA 3FWPA 3VYUB 1WPXA 1F8UA 4OJTA 2VJOA 4JI6B 1WHTA 2AD1A 3GLRA 3HCOA 4EVIA 4AQDA 3EVBA 4HMOA 4LDNA 1E3TA 5JCPA 1NMYA 2B36A 2HO4A 3O1IC 4GPAA 4J6EA 5DWVA 4CZ2A 3A1FA 1BGXT 1U5AA 2E9SA 2XR1A 2BVNA 2YWBA 7REQA 2EZ8A 2NTEA 4MW2A 4XYBA 2I71A 4XKJA 4IQGA 4O2AF 4FYYA 1LNZA 3DBLA 1HFWA 1XBTA 1PFVA 2P9ZA 1XJWA 4GMDA 2BM8A 1NJ6A 1DG1G 2R8YA 1DRUA 4BLVA 5DB4A 4AJLA 2D2XA 4YCDA 2R2GA 1XZNA 4L02A 3IURA 1KJJA 5DIFA 2VJPA 5AUPB 4PPGA 5F3DA 2IY9A 1H3EA 3SDBA 1T8YA 1ZOIA 2Q1YA 1BS9A 3HBFA 4POAA 1GGEA 4AN4A 5LP6A 1E0AA 3Q0IA 4QULA 1EI9A 1WCYA 4GGMX 4QDKA 3NKFA 3OG9A 4GVXA 4M53A 4OK3A 1XXHA 5CA0B 3V4RA 5HX7A 1IOVA 3BIOA 2SNIE 5HKOA 1NV9A 4JX8A 1RJGA 4R9SA 3UAGA 3IVRA 4Q4JB 4EJSC 3DLTA 4Q9HA 3EOAI 3N86A 4EUNA 2F17A 4ETIA 3G5MA 1KE2A 2AG0A 4JC0A 4LXHA 5I9MA 3PU6A 4DSAA 3KETA 2LW7A 3ILYA 1JHDA 2ZYIA 5A3QA 3PGA1 1U2GC 1YACA 1CEQA 4NV1A 4QO7A 3H8VA 2GBPA 3MLAA 3A26A 4WXHA 3P0HA 4YQFA 1QONA 1TM3E 2PS0A 3FNEA 2ODBA 5IJ0B 1LVHA 1CLEA 1JWBB 4X7MA 3DE4X 1AK2A 4M2LA 1Q11A 3KQWA 4FNOA 5JI2E 2BGGA 3QVSA 4BNIA 1QK3A 3UYLA 2PO7A 4TYQA 3HGTA 4IX9A 5B3JC 4HAUA 3QOWA 2TMDA 4UEKA 1F8FA 3GRAA 3FHJA 4K2AA 4KV7A 4M38A 3I2YX 5HXAA 3PEYA 4GPEA 2D7DA 1IM2A 2BBOA 3ZDYB 5AW9A 4CMCA 4BMDA 2KW5A 3QVWA 5K20A 1QQ6A 2CLKB 4WDQA 2NUTA 2NT4A 1YR8A 1IWOA 2LIVA 3GGJA 3PFKA 4HGZA 3VMMA 3D2LA 2BGJA 3P0FA 1K6XA 2BL4A 4ZMBA 1GT6A 2NZ8A 2I6XA 3ESXA 4YT8A 3CS3A 4XEHA 2C1EA 1GZDA 2FMTA 2QRVB 1CEYA 3CVUA 1PR2A 1OVMA 2HQSA 1W36B 3QW2A 1KMNA 2AE2A 4B6FA 4ER0A 2OKCA 4ENPA 2F4VB 5GY7A 1U31A 2A4KA 3L8HA 4FMCB 3TYXA 1IZ7A 1R88A 2NU9B 3BXHA 4AROA 2WNIA 4PTYA 3IBGA 3ASZA 2GJKA 5BSGA 2XDWA 1P2UA 2QRLA 3FYHA 4J07A 2LZ0A 2HFKA 3B85A 3TOSA 4C01A 4ICIA 3B8EA 4ITVA 8LDHA 2IOFK 3AO0B 4PLFA 1ZSVA 1KYIA 1XSEA 3HKDB 2UYHA 1RRCA 1KVUA 3EXIB 3GK3A 4QLBA 4J0DA 2Z98A 1P4AA 3DONA 1Q1EA 2H4JA 3ZWPA 4B71A 5ITSA 3AY6A 3WK6A 4BX3A 1AD2A 3JYHA 3PQ7A 3T7IA 2V5AA 5T5QA 4AW9A 1Y1PA 2I6TA 3BH6A 1L6IA 2QRVA 1TA9A 1YB7A 1L7NA 5I9SA 1K7XB 3EASA 5JSZB 1I0LA 4JFRA 1F51E 3ZS9A 2YHIB 2C4WA 1VB5A 5EIWA 2WVGA 5F2OA 3SS7X 3WBKA 4CKEA 1HYGA 1DC7A 1IEVA 1XD9A 1U2TA 2BFAA 2A3NA 3VZQA 1E1RD 3WLKX 3SF0A 1U2DC 1YZVA 2XTJA 3CBGA 4Q9AA 3CH5A 1XO1A 2JLSA 1VSVA 4XM0A 3AM1A 1ECFA 4ZQCB 2OHFA 4Y9SA 5H3CA 4P54A 2WJIA 3T9DA 5CHEA 2CXRA 3EIUA 3TQIA 1EFPB 5ALWA 1L4BA 4HYQA 3HA2A 1YL7A 2KYRA 3RANA 1K6JA 3KDAA 1GZUA 2GXSA 1CUCA 2YY5A 1KGDA 3HR8A 3GCDA 2Y93A 1TZKA 4DB4A 4RTLA 1FU8A 2QVLA 3DFFA 4QDZA 4MWEA 4GPZA 5LWQA 4H35A 4IY1A 2AKEA 2JFQA 5LNK6 1T6YA 4EARA 1PR6A 1UFQA 1NW9B 2A9OA 3LM8A 3MVEA 1V9LA 4MW6A 4YDSA 1ISHA 3FTCA 1GL9B 1XAJA 3RVMA 2EW1A 4EG4A 2G0TA 2BFWA 2C5SA 1B0UA 4MMXB 3KHTA 5B57C 1KQPA 1OF1A 3HU3A 5CDUA 4O4JF 4EGJA 3AM3A 3HUFA 2FSHA 1COWA 2CLEB 4GD3Q 1JJAA 4I08A 1SUIA 3ME5A 4P3NA 2XMBA 4U1RA 3S5UA 4NOMA 3NM6B 4E7PA 4DMGA 1Z36A 1K3TA 2QL6A 1FU7A 5H8WA 3U4QA 2JH8A 3KAPA 1DO2A 4DJFC 1TGYA 2PKRA 4IQ8A 2W2MA 2WVHA 3MWEA 5JXGA 3THXA 3W5AA 2G36A 2O52A 3ETHA 4JEHA 4OI2A 3U4GA 3PX7A 1RFGE 1RI2A 4R8SA 1HBJA 1XQXA 2IS4A 4G1MB 3PVZA 2AN4A 2C1ZA 3A6FA 1P33A 2HJRA 1AUXA 4M9XA 2FMKA 4KK3A 2OXTA 4F5WA 4HAWA 4TZKA 5AJVB 5BUCA 4C5BA 4KGDA 1W4ZA 3KZVA 3OJXA 5LQCA 3K9HA 3COJA 4MMYB 5KC9A 1G8SA 1WDMA 3SXUB 3L84A 2EJVA 2YWFA 5EHIA 2B3TA 4FHDA 1T6BY 2BEUA 2E85A 2JFHA 3HVIA 4RMJA 5HJ2A 4BNLA 3EIXA 1MZVA 3RWOA 1E2FA 1JFLA 4WRRA 4LWZA 2NO0A 5HM6A 2UUAB 2HIHA 5U1PA 4Y2JA 4LFCB 5AKZA 1CZUA 3UHFA 1V8FA 3V8PA 1EGMB 4M36A 1IZ8A 1LJLA 2DTEA 2H0AA 2UVPB 5BSWA 4DR7B 2L2QA 2OB1A 2A8YA 3QJYA 4M8LA 4W5OA 2P6MA 1KDPA 5LLDA 1OWMA 5DPMA 1T2DA 4R1OA 5E7QA 4A16A 2JHGA 3CF4G 3DWFA 3EW7A 3PLRA 1B8UA 4LUCA 3HUTA 1D9ZA 3GLIA 3OKPA 1VJTA 3L8ZA 2JCVA 5TS3A 2CL5A 3PYLA 3KZCA 3IQGX 1ZC4A 3RHTA 1QPZA 4IH1A 3VHQA 3ZDDA 1R6UA 3SBOA 5C18A 1P62B 2VZ0A 2FG7C 4DQ0A 1PD1A 2F3TA 2WV7A 2Z9CA 1IB6A 2NVUB 3HMKA 1IMOA 4LVOA 1JHOA 2FFHA 2VUIB 2REOA 2W9XA 3D1VA 4QPJC 2IPMA 4HV4A 5FNVA 5LOVF 1WDLA 5DNCA 2C7QA 4V1CA 5ALNA 4EZEA 4L8WB 1U0OC 2GD6A 4YRKA 2AFHE 4GU5A 2KSQA 4BO7A 2W0MA 4OLBA 1KPGA 2ZS8A 4ZA2A 3WSWA 3QPWA 1JGTA 2Q6VA 2QX9A 4E5YA 1OH5A 4KIGA 3EQ6A 5LJIA 2NZ2A 4JKYA 1ADBA 4BOYA 4HFNA 1XRQA 1ZWLA 3OIVA 5JADA 1YRYE 3W6NA 5CFOA 3P9KA 3NHYA 2V6IA 3E05A 4CCWA 5LM3A 1IBRA 2O2XA 3TE6A 4Q02A 1KIAA 1XMIA 2QJOA 3OZFA 4N76A 1T24A 2CZQA 1VHTA 2Z5GA 4KOAA 3UGQA 2H7XA 1O89A 5AJUA 1MIOA 6ABPA 4BUJA 1ZPDA 1A7AA 5IX8A 2UYGA 2AWOA 5CM2Z 2O0HA 5TQ0A 1A9SA 3K4QA 1ZI8A 1UADA 4D57A 3TUIC 2FZGA 4UHFA 4M60A 4B4VA 4DMFA 2JHAA 1SUFA 2ZJ7A 4RKQA 3ND7A 4ZAFA 4MS1B 1KDTA 3RKSA 5JJIA 2AHOA 5TJ9A 1YAHA 3QSYA 2Q4EA 1HK7A 4OHRA 5TMBA 1KOLA 5A5DA 2ZJ4A 3EB9A 4KI7A 4CLXA 3NIBA 2P2CA 2CYBA 1N1GA 3ORRA 3M6MD 4UU1A 1HT1E 1TUBA 4D8UA 3WI7A 4HDKB 1J2JA 1U4SA 1SULA 5I7FA 4Y2RA 2VYFA 2UXCB 1KO8A 4L6AA 4Q4HB 3ER9A 3AI1A 2XBLA 3UK6A 1F1BA 3GR6A 4MPRA 5FWYB 5TT1A 1M1YB 2UZ1B 3NYIA 2IPNA 721PA 2EZUA 2FPXA 2ZRGA 1EGVB 3RVBA 1XE3A 3IFSA 1I7DA 2G5CA 4PTLA 1M2JA 1KI6B 3THSA 1UPTA 2ZVDA 2YHUA 2WTNA 1JTVA 1EK2A 1GDDA 4JZKA 4TL7A 1JFFB 3P4UA 4MA0A 1A77A 4O3FA 3NEAA 5JG7A 3SJZA 2VDLB 4C0XA 3HFSA 6REQB 3E70C 4HAXA 4ZVNA 1YKGA 2K2QB 1O03A 2ONKA 2CUKA 2SKDA 1ZIOA 3EG5A 1USWA 4W7HA 4RAQA 4Z8YA 2R86A 2YVLA 3BD9A 3E7DA 3LC1O 4L73A 2W58A 3FPKA 3CGGA 4KPUA 5AJWA 2Q5JA 3RSLA 4YIHA 1CEEA 1YS4A 1UM9A 1W94A 4D82A 3JWGA 3HYLA 2H65A 1IG0A 3B1YA 3QFRA 3FA2A 4LJ4A 3S40A 4PYRA 3TD6A 4YT4A 1D0IA 3LX5A 5G0UA 1I2MA 2I6UA 1HL3A 1OBCA 5BPFA 2QMZA 3E0QA 5K03A 3FPHA 1QNFA 5HE8A 2HHJA 4GZMA 4EJFA 3LIIA 5J5AA 1G42A 5CDTA 2EW8A 3MOGA 2P41A 3ZLJA 4EO4A 5KKAA 2GJAA 3HB1A 2BLNA 1KFJB 4WXRA 3RIHA 2JCYA 2QYTA 4IOLA 5EC8A 4YRPA 3AFMA 4DRXB 3K0EA 3GUHA 4I9UA 4DSZA 4EG5A 2DETA 2D5LA 4DW8A 5TE9A 2HA4A 4I5EA 2FK7A 3LLMA 3ZE9A 3ZCQA 1E9DA 4M8KA 4DY6A 4S3MA 1F48A 5ENZA 3WWOA 3BK1A 2NLOA 2HV8A 3PVSA 5DSTA 4DLUA 4W9NC 1PJAA 2QSJA 1KEUA 4M0FA 1WHTB 1D03A 2WIAA 3D2AA 3B1FA 4LXGA 4HAZA 4MROA 4W82A 3QE0A 2KLBA 3GPCA 3LBIA 3M9LA 4KNWA 5EWMB 4Q19A 4KSYA 2W6QA 1U63A 4EQ6B 2I4IA 1CFJA 5C8YA 1JL3A 3RTEA 5ALEA 2N75A 4INAA 1OT3A 1X7XA 2YV4A 5DN6A 5IKMA 1QVVA 2J0EA 4ILKA 2Q99A 2QTZA 3QEAZ 1Y1LA 4CCYA 4CIXA 1UKYA 3MC1A 1YQQA 2VDKB 5FBKA 4EFLA 1U2EA 4PX9A 1BFKA 2VNIA 1J97A 5BW4A 4OJKA 3UMGA 4Y1GA 1JYFA 1BQEA 4CMAA 3LX6A 1M3SA 1HDEA 3RIXA 4C2TA 3SCZA 4H7IA 5K51A 4OK5A 4QWWA 3RR2A 3T35A 4BHTA 4EA8A 2VF7A 2ORWA 4QQ8A 3CR3C 1QF7A 4YCAA 2EGUA 4N5IX 5FTMA 3RVPA 4ERNA 4BLQA 3LHSA 4DR1B 2FWMX 4GX5A 4ND8A 3TQHA 2P6OA 4JU9A 1WR8A 1DO0A 1PG5A 1LRJA 1Y3HA 2LXNA 1LPBB 5KTOA 4IGEA 5I7HA 5JFOA 3RS9A 1CZOA 2ETXA 3D54D 1QHXA 1NAIA 5E3HA 1HEYA 2CE2X 4MV1A 3WFZA 3F2VA 1E1CA 1I6LA 1H3NA 1E7MA 2PWZA 1GFWA 3TZLA 5ICMA 1D2RA 1PN3A 1HRKA 4MQ6A 1N36B 4HMPA 2YWJA 3B6IA 2CWWA 3DZIA 1WCV1 4JB2A 4JEMA 4AULA 4EUHA 1I9GA 1PHPA 2Z1MA 3RC9A 1DCFA 3EDYA 5AT1A 4JXJA 1LPNA 2ZYUX 4L0QA 1IBMB 3R5KA 3LCRA 3EXAA 2GM4A 1GPMA 3TTWA 1J1IA 4UDXX 2QXTA 4U39A 1L7RA 1C8LA 4ENRA 2RB4A 3ZWOA 5CXUA 2G06A 3S1AA 5JC1A 3TKLA 2HDOA 4OGWA 2QUKA 3MFQA 4ZOLB 4LI0A 1VL0A 3ETGA 2C2XA 4P8RA 3ABIA 3RFTA 1WVMA 4JR2A 3V97A 4MQ4A 4D4IA 2ZB4A 3LCJA 2WBLC 1R0XA 4EJ0A 4Z6KA 4EHNA 4F4JA 1JB9A 4JJIA 2QUAA 4GMXA 1YGYA 4L5BA 2BGLA 2TYSB 3WQSB 1R5JA 1LLDA 5A5GA 3IJ5A 3ENZA 1FBTA 4FQ5A 1PE0A 2FPIA 1WNFA 4LSGA 1CW2B 1JG1A 3OKCA 2YOFA 3H1PA 4UBNA 1TM2A 1NXPA 3GNTA 3O8NA 2SKEA 5EESA 4YJDA 3FVVA 1EUQA 5KOJB 4NBRA 1JSRA 3OLQA 5TSDA 2CZGA 1XMPA 2EKZA 3WLNA 4AS3A 3IUQA 4MAMA 3S2GA 2A0KA 3Q15C 3JZFA 4P53A 3GJYA 5CPBA 3SE7A 1A1SA 1LX7A 2R62A 3GOQA 1MEEA 1X1AA 1HMYA 3E23A 3A2LA 4RA6B 1CUZA 2GD0A 1YRWA 3L1UA 3R0XA 3ICQB 4TKUB 3WKEA 3H17A 1T15A 2AX4A 2D13A 5FR2A 5EIEA 3E48A 2Q5HA 3OPQA 2ZZMA 1VJDA 3BD6A 1NNEA 1IVSA 1AGRA 1VJRA 5CT5A 1L4NA 3OI7A 4WXMA 2C4TA 2RHJA 3S2YA 3IIKA 4DSTA 4JJ7A 2WP0A 4UAUA 4HDMA 3B1VA 3OX1A 3L4BC 3AF4A 2D1TA 3HN2A 3QVTA 1WD5A 1SCUB 2HYDA 1G21A 4S1NA 3W8NA 3AF0A 1E7WA 2J0QA 3VAYA 2AT1A 1SAYA 4A10A 4FFMA 1N0IA 4N18A 3IO5A 1KK0A 3GELA 3NUQA 4NMLA 2DPGA 1XPJA 1ZJ4A 3F8SA 1H0SA 2AMVA 1EHYA 2ZWIA 3DZGA 3LO5A 4ZT4A 4TV8B 5C2JB 1VKHA 4OSPA 4D9NA 2X0EA 1ZD8A 2MINB 1QH0A 2XNJA 4LTDA 1CQIA 2AS0A 1BC5A 3FAZA 1XZBA 1FMFA 2XMDA 2I2BA 1U7ZA 3HBAA 2J5RA 3L8DA 4G4JA 4LG1A 3UMVA 2P9CA 1LX6A 1OXBB 4LZJA 2C3MA 5IT5A 2F3RA 4M9RA 1BRMA 3A7EA 2PA0A 1MH1A 3KSDO 5LKAA 1YS1X 3T5PA 4HLUA 4P86A 4HNUA 3M5CA 5JSFA 5IM5A 3IKTA 2OFWA 3C39A 1OXXK 1AKEA 4C08A 3BSSA 2EU8A 2GBFA 5CB4F 3OU2A 4C0JA 3OICA 3M4XA 2HT1A 1JECA 4G8JA 3MTGA 3CXRA 5F73A 1XN1A 2OMEA 1RKQA 1W88B 1M1NB 2PQ6A 4RLFA 2CLLB 2QRMA 4RTQA 5F98A 1XC7A 3ZTYA 3P0RA 2NG1A 1Q2XA 2A5DA 3AP2A 4LXTA 4MW4A 4P93A 3A70A 5ALSA 5BSVA 2D3TA 4B73A 2QY9A 2WQZA 3OZEA 3ZWQA 2A84A 3ONDA 4WZAA 1EX7A 1ST3A 4ARZB 1SC3A 3TRKA 1CQJB 1TZJA 3ON5A 5ALHA 3R8XA 3GRPA 4N5LA 1D6MA 1FX0A 4WLUA 3GJ3A 4RENA 1DBIA 2E48A 1N3YA 4ZOCA 1YNSA 3IVGA 4LYJA 1EGQA 3EH1A 1KKMA 4DNOA 4LOIA 4D4HA 3BXGA 4JMLA 1Z4LA 3T54A 2HNAA 1SUWA 4MOWA 3IB6A 5CGQB 4ZV4A 4MVJH 4ZZ3A 5AK0A 2FPPA 2GN1A 5KNBH 4CM7A 2WF6A 3NASA 5IPFA 1AXRA 1P4SA 1QV7A 1E8MA 1GCAA 4G65A 1ABEA 4I4IA 3WBFA 1RBQA 2YMLA 1CUIA 2CMKA 3Q9LA 4BC1A 1BU5A 1SOMA 3AU8A 3DEJA 3NT4A 1UK8A 2V4MA 4COKA 3GCZA 4LHWA 4EUKA 4EB3A 1VI6A 1ZD5A 2A9RA 2VJCA 2AXEA 4G5GA 5JAHA 3VTAA 2G9NA 3EPJA 1BVYF 3DQPA 4BJHB 4EKDA 3IUPA 5A2GA 5NLLA 4ZTUB 3JD1A 4QYSA 3K15A