1DWPA

Crystal structure of hydroxynitrile lyase from manihot esculenta at 2.2 angstrom resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Hydroxynitrile Lyase from Manihot Esculenta in Complex with Substrates Acetone and Chloroacetone: Implications for the Mechanism of Cyanogenesis
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Hydroxynitrile lyase
molecule keywords HYDROXYNITRILE LYASE
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dwpA00
1CRLA 2QMQA 3RKSA 2QT9A 1CUAA 4Y2PA 1CUEA 1F0NA 4MXDA 5AI5A 2HA7A 1PJAA 4Y2TA 5K3CA 1XZBA 4QNNA 3STTA 3WL5A 3H17A 2XMSA 3PFBA 1CUIA 3G9TA 3W9UA 4ZI5A 1WHTA 3I1YA 1FJ2A 5E4YA 1GPLA 2ZSHA 1P0QA 3EIOA 2WU3A 1XZGA 2GYUA 4ZXFA 2WUDA 3AIKA 2HA0A 2V98A 3G0CA 2WJ4A 4H77A 4DIUA 1TK3A 2WIJA 1CUDA 1JJFA 4K2AA 3I28A 2JGJA 5LZ5A 1LPAB 4JUIA 5ALEA 5SYNA 5K3FA 5AM2A 4LYEA 4X71A 3HZOA 2DQYA 2RHWA 3IURA 4LIPD 4BTLA 1LPPA 3WKAA 2RI6A 4A5SA 2PUJA 1ZIYA 5FPQA 1RYYA 3SX4A 1A8QA 4LKOA 1JT2A 3PDCA 5LZ2A 4FLFA 4H7EA 4OB6A 3IB3A 4NVRA 5AKKA 2WKWA 4HZGA 2QM0A 2VJBA 2HHAA 2OCLA 5T4EA 1HL7A 3BXPA 4L0CA 2GZSA 1XRQA 3WWOA 4Y2XA 1YB6A 3WK8A 3ILSA 2CBGA 1OXMA 4U2CA 1ZI8A 2E3JA 5C8VA 4XX1A 2XUKA 1CUYA 4H7JA 4B82A 3WLAA 4BDSA 4S0XA 3ZV7A 5ALMA 3HACA 2JGMA 3W05A 1H2XA 5LZ4A 3ZLVA 1CUWA 2WG0A 3QMMA 4QDOA 2C0QA 3C6XA 4AN0A 1CEXA 2H7YA 1ZD5A 3H18A 2VTVA 2GBFA 1CUSA 5KBYA 4BE9A 1XQWA 3H04A 1QTIA 3STXA 2OQIA 4FWBA 4BZZA 1BN7A 4CG2A 5AM4A 4B9EA 2ZYRA 1N5MA 5JAPA 2HFJA 2WQZA 5HZGA 3OG9A 5CH8A 5FUMA 3STUA 2CZQA 4HXFB 1R4ZA 2H1IA 4RPCA 4GI1A 2VJCA 4G1FA 3W06A 1QO9A 3QBJA 5F4ZA 5JAUA 3F98A 1E89A 1QIHA 3NUZA 1ZI9A 1XZLA 3FYUC 1G4HA 4B0OA 2V9ZA 4F60A 3C5WP 2HA2A 5LKAA 4B9AA 2GBGA 2VF2A 4O08A 5CBKA 1A88A 3ANTA 2RAUA 1CUZA 1QFMA 4AZ0A 4DGQA 3O4GA 5JYCA 2AJCA 4BBZA 4MEAA 3R3ZA 1EI9A 2JEZA 3DL4A 3V48A 1VA4A 1LLFA 1CR6A 1U8EA 4W1SA 4Q3OA 1SCQA 2WFLB 4NMWA 5AI4A 3C70A 3FSGD 2CMFA 2BUAA 1R3DA 2ZYHA 5HF6A 3WZMA 3WKEA 4ZWNA 5AOAA 5FXMA 2XMDA 4PSCA 4E15A 1KU6A 3VJLA 4EZIA 5EIHA 5KWIA 1Y7IA 3IIIA 4C01A 2XQFA 1BCRA 4AO8A 1QIEA 2XLBA 2CUTA 1P0MA 4AQDA 3O4IA 3FYUB 5AIAA 2OGTA 1WM1A 3QYJA 1WHSA 1JFRA 1QZ3A 4BZWA 4WDQA 3BF8A 4QDUA 3QITA 3G0IA 4KEAA 3H2HA 4U2EA 2Y6VA 5JD6A 4E46A 2XB6A 4X91A 5ALUA 4KAFA 4IH1A 2XMGA 3DDUA 1AQLA 1BRTA 3F96A 1J1IA 4BYMA 4G4IA 5A7FA 4M0EA 2BGNA 4UHFA 1WB6A 3WIOA 3I1IA 3G7NA 1R9NA 5A71A 3O9VA 1XZEA 4OPMA 4X93A 4EBBA 2WUEA 1BN6A 3VVLA 3AILA 1P0IA 2Z5GA 4BVLA 4EY7A 1AC5A 4LHEA 1VZ3A 3QZUA 4K6GA 4BCBA 3IUJA 3GELA 2ACKA 1YA8A 4MWSA 4FKBA 4JNCA 2HRQA 4J03A 2GYWA 4FNGA 3DKRA 4QDTA 4AMYA 2G5PA 2V97A 1EVQA 1GPKA 3WIBA 4C87A 3FOBA 3IUQA 1H2WA 4WDRA 2HU7A 1N8SA 3ZWQA 1E8NA 3FYUA 2OQVA 3D7RA 4MQMA 3LIPA 4JH0A 5CT4A 2HIHA 2VAXA 3R40A 3OURA 2XQGA 2ZVDA 1Q84A 2Y1KA 4OYYA 4HXEB 2Y6UA 2WTNA 4DMFA 2VA9A 2B4KA 3V1LA 4J0CA 1DQYA 2HA5A 1ACLA 5LZ9A 2O2IA 3DOIA 4W63A 5CH5A 3AIOA 4P08A 1SCKA 5BOVA 3WA6A 2XQJA 4MYSA 4QWWA 4LXIA 5A6VA 2QUBA 2DHCA 3R3VA 4B83A 1FFDA 1G66A 4MYDA 1XKTA 3H2KA 4L3WA 4H7KA 4X92A 1UK6A 2DQZA 3I2IA 1H23A 2BJHA 3M81A 1DWQA 3D4LA 4H35A 5CURA 3PUIA 5ALNA 4UUQA 1ZI6A 2JGLA 5IH7A 3VJKA 1QTRA 1H2ZA 1XLWA 1E8DA 5CH3A 3C8HA 4Q3KA 5CT8A 1G5FA 4Q3LA 3PF8A 3BE8A 1JJIA 4FNMA 5K3AA 1K8QA 2BAGA 4J3JA 2AXEA 4AXBA 4BAZA 1VLQA 3ICVA 4IO0A 4BRSA 5AH0A 2C7BA 4X00A 1MN6A 6YASA 1DX4A 1UKCA 3G0DA 5C8ZA 2G63A 1F8UA 4G5XA 2WIDA 3OOSA 4AN1A 1TCAA 1XRNA 2WJ6A 1VKHA 3FYTA 2DFPA 5DNVA 1EX9A 4QLAA 1W76A 1Q0ZA 3OC0A 1SOMA 2WUFA 2B61A 3QPAA 2EDAA 4P92A 1ODSA 1N5RA 4WCVA 5EGNA 1WPRA 5HFNA 1VJ5A 4DNOA 5E4JA 3DEAA 1YS1X 4EY6A 4A16A 2BFNA 1FSSA 2QS9A 3VKFA 5HF8A 4H7FA 3TEJA 5IKXA 1FFCA 1J07A 3O9MA 1EH5A 2O7RA 4Y2SA 2Z3ZA 3H0CA 2GBIA 1HDEA 2QKYA 4H7DA 3DKKA 1XZFA 3D2BA 4YASA 3FBWA 5CW2A 5LLSA 2PUHA 3DYIA 3H1BA 1ZD3A 4ZV7A 5JASA 5EFZA 4XVCA 1DWPA 2WFZA 4FBMA 3G02A 4ROTA 2WHQA 1BEZA 2Q0XA 2V96A 4FHZA 3AJAA 3AZOA 3IUNA 1X70A 1CUFA 3M3DA 3BDVA 3WK4A 2OGSA 4F0JA 3STYA 2ORYA 2HM7A 4OU5A 5LZ7A 5DJ5A 1QIGA 3MUNA 5ALWA 1JMKC 1CUHA 3HJUA 5ALDA 1VXRA 4DTCA 1QIKA 4B84A 4GXNA 1BU8A 1R9MA 5AM1A 2AJLI 3DS8A 4FOLA 5T4FA 5EHXA 2OCIA 4H18A 5JZ9A 2ACEA 2ZJ6A 3WL6A 3Q8WA 5FP0A 1PV1A 2XUGA 4EHBA 3DCNA 4Y2RA 3AFIA 4BAGA 3KXPA 3WWCA 4LYDA 3CCBA 1QIFA 7YASA 1Z68A 1UWCA 3FNBA 3ESDA 2VT7A 4UBOA 1XRMA 3G9XA 5EHZA 1K5PA 1TAHA 3S8YA 4U2FA 1EDDA 4BVKA 2LIPA 4GWLA 2ZYIA 2X8BA 5ALQA 1ZGBA 1ODCA 5EIEA 1XZCA 4HXGA 3WWEA 3FSGA 3U0VA 1Q0RA 3YASA 4WY5A 1ZOIA 4H0CA 5KREA 3E1GA 3AIMA 4UHDA 1HPLA 4AZ3A 2B20A 5AK4A 5AKLA 3F9CA 1XRLA 5A7GA 4LXGA 4BCDA 5ALGA 4J0JA 2PSJA 4B80A 1XRRA 5DLPA 4DMKA 5C7YA 2HA3A 2PU5A 3IA2A 2C5FA 3R3YA 3HRHA 3K2IA 1UZAA 3LCRA 2ROQA 3LS2A 1EDEA 1ZJ5A 4PW0A 4QE3A 1ACJA 4G8DA 5JANA 4PF1A 1TIBA 1BCSA 4D9JA 1EB8A 4Y2UA 3KOOA 2HU5A 4X95A 4B85A 5K5EA 1WPXA 2HA4A 4W1RA 3DYVA 4UFOA 5DWDA 1RWQA 2WG1A 4CCYB 1MAAA 3F97A 1MU0A 4DMHA 3V1KA 4HVTA 3G9ZA 1TKRA 5AI0A 2EEPA 1OILA 5FOQA 2JGIA 3HXKA 4EY8A 4QDZA 2GBCA 1GKKA 3BIXA 1RP1A 3W04A 4KR0A 1YSCA 3RK4A 3FAKA 3ESCA 1ZD2P 4XIIA 4AB1A 5AK3A 3PI6A 2WFMA 4V2IA 3EF3A 2PSFA 3QPDA 3ANSA 2VATA 2AJ8A 1WB5A 4UHHA 1QE3A 3C87A 2QTBA 1CQWA 2OAEA 4A23A 5HK8A 3D59A 1CV2A 1X2BA 4WJLA 1YR2A 3T52A 5K3BA 3A6ZA 1B6GA 3I2GA 1PFQA 5ALTA 4C88A 3E0XA 1MNAA 4W1PA 1VOTA 1XQXA 4WFIA 3UUFA 3EBLA 1C7JA 1D07A 1QFSA 3LP5A 4KYVA 5LP1A 1TCBA 4Q05A 1QO7A 2WU4A 5CT9A 3EQ8A 5JIBA 3EQ7A 3S2ZA 3BWXA 4M0FA 5DTJA 1CUGA 2QZPA 4XJVA 1HBJA 2WTMA 4OSEA 1NU6A 4DM7A 5ALJA 5DTIA 4QA9A 3VISA 3DJYA 1MX1A 3X3HA 1CUCA 5A7HA 5AO9A 4C89A 1LPSA 1SCIA 2I3DA 2WFLA 2C5GA 3D3NA 3HC7A 2CEKA 2XUDA 3C43A 3LIIA 4X97A 5JD5A 2QXTA 2WHRA 4JYMA 4QWMA 1XZMA 3MGAA 2RHTA 1DT5A 3I6ZA 3ESAA 5HF9A 3I6YA 3B3QA 5D7BA 3D0KA 1ORWA 1YASA 3GA7A 1T2NA 1XKLA 2PSHA 1EA5A 2XUOA 5H3HA 1A7UA 2QOEA 3H2JA 2WIGA 4GHWA 2JGFA 4K6KA 1JI3A 5ALFA 4ETWA 3W9BA 5BWBA 4L72A 1U4NA 5JADA 4UBMA 3C6BA 1R88A 4WY8A 2C58A 1DINA 3JYHA 3V1NA 4QZVA 4DNQA 3LLCA 1S8OA 4NS4A 2Y2UA 2X76A 2YH2A 3UUEA 3ZI7A 5CT5A 1B41A 1HKHA 1EK1A 3UMJA 4OU4A 1K63A 1ODTC 3AZPA 2K2QB 5ALHA 4N8DA 2ZJFA 1GGVA 4TVKA 4HAIA 5AP9A 4C4ZA 2OXEA 3VXKA 2YASA 2J3QA 4DLNA 3A2LA 5JAOA 4RGYA 4F21A 3BJMA 4PNZA 1XZDA 3VDXA 1MTZA 3CXUA 4OD0A 2B9VA 5FPPA 2XI4A 5K3DA 4OUKX 2QVBA 2DHEA 4G4JA 3WYNA 2PKYX 2XMZA 1L7RA 3WKCA 1UKAA 3G0BA 2HA6A 4H7HA 1AZWA 4Q1VA 3PUHA 3OPMA 3D2AA 4CIBA 1QGED 2OCGA 3TGLA 3W2TA 4CI9A 2XUFA 4OB7A 1VZ2A 1XZIA 3WK5A 4G9EA 4MJ3A 1Q83A 1CPYA 2PX6A 4OB8A 3QMVA 1JJBA 1R1DA 3DL7A 2G4LA 3M82A 5BWCA 3H2IA 5AICA 1THTA 3OTQA 4BDTA 5CT6A 3CCCA 5ALSA 3OM8A 4J7AA 2OG1A 4ITVA 4UBLA 2DR0A 2DCMA 2OCKA 4OCZA 4J0IA 2XUQA 4ZRDA 3WL7A 3FVRA 1UT6A 4EY5A 4HRXA 4NZZA 4X6XA 3WL8A 1A8SA 5HQ3A 5IVHA 3FLBA 4UHEA 2J3DA 4L9AA 4QDXA 1QLWA 2WUGA 3WJ1A 2HDWA 4BTVA 2PBLA 5AKZA 3MVEA 2Z3WA 4IHAA 1Y7HA 5I8PA 1YB7A 3IDAA 5DYYA 3GROA 2XUPA 1UFOA 5AK5A 3CN9A 2D0DA 4I3FA 4F5ZA 1L7QA 1XLUA 2WG2A 5ALXA 5EI5A 3SK0A 2I78A 3TRDA 3FLEA 2AJBA 1DQZA 3A2MA 1QIJA 4CG1A 1XQVA 1I6WA 4UHCA 4FMPA 5IVIA 5K3EA 1IMJA 3PICA 2H9YA 3DNMA 3BIWA 1MO2A 4W9RA 5AM0A 4E14A 1XRPA 5ESRA 5HKBA 3MUOA 2OAGA 5LIPA 1O6GA 4CCWA 1ETHA 1KEZA 3WWPA 3L1HA 3H2GA 3WK9A 4AO6A 1AGYA 3T4UA 3JW8A 3VVMA 3WI7A 3KSRA 2XMQA 3K9BA 2BKLA 3C45A 5AIBA 2ECFA 1MNQA 3ESBA 2DHDA 3O4HA 5J3JA 1XZKA 1THGA 2R11A 3FVTA 4BAUA 1IZ7A 3I6MA 1SFRA 3DD5A 5AI9A 1UXOA 5AOCA 2XMCA 3KDAA 5AKJA 4EA6A 3G0GA 2WJ3A 2G5TA 2W22A 3BJRA 5YASA 3F8SA 1QOZA 4B0PA 2HADA 2O2HA 3QM1A 4HS9A 2XUHA 3WQHA 5AKHA 5ALOA 3WWDA 2CJPA 2H7CA 5HFAA 3R0VA 1EVEA 4E11A 3P2MA 5CRIA 3WYDA 2QRUA 3WZLA 1P0PA 4J0GA 1JU4A 1W1IA 2WHPA 1QIIA 2ES4A 5AHXA 3EQ9A 4FTWA 3C6YA 1QIDA 5EIAA 4CIAA 4FBLA 4FLEA 1UK8A 3GZJA 4UFNA 2I03A 3A2NA 3SC2A 1VXOA 1LZLA 3QVMA 5D3ZA 1XLVA 4W1QA 2JIDA 4RE6A 4P9NA 2XUAA 4K6HA 1CUBA 2OPHA 5CMLA 4RE5A 4ZGBA 3IVMA 1N1MA 2VQ6A 4Y2QA 3V1MA 1QJ4A 2UZ0A 5HCUA 1DWOA 1U2EA 1USWA 2Z8XA 3I2JA 2DSNA 3I2KA 2RIPA 1BROA 3WA7A 1NX9A 3AUKA 1VE6A 3STVA 2QJWA 5DNUA 2XT0A 4G9GA 1CUVA 2PU7A 4KAAA 4MWTA 3E3AA 2HL6A 5I7UA 5AI6A 4KRYA 2OGZA 2WHPB 1LNSA 4BATA 5JZSA 1J2EA 3R3UA 4EUSA 2XQIA 1A8UA 4AO7A 4B81A 4BC1A 4UPDA 4ZV9A 4KE9A 2WM2A 5HF5A 2QR5A 4KE6A 1CQZA 1X2EA 3G8YA 2WSLA 2GZRA 2OLEA 4Y2JA 5ALKA 3IULA 2HFKA 2PVSA 1AURA 3PF9A 4GLBA 5E4TA 5HK9A 5AKGA 5C81A 4Y2YA 5JARA 3KD2A 1HLGA 2BUBA 3WMRA 4PSDA 4J0DA 4TPKA 1FFEA 1CVLA 3AZQA 4J0HA 4P93A 5EHNA 4TGLA 1UK7A 4G4GA 4UBIA 1BEEA 3GFFA 1EINA 4C6HA 4OYLA 5IVDA 4KE7A 5D6OA 2PPLA 1AUOA 2RONA 1W75A 1MJ5A 5IVKA 2PSEA 3N0TA 3ZLTA 3C5VA 2JEYA 2O2GA 4X6UA 4FLMA 4N5HX 4Q82A 4FFWA 1L7AA 4GDMA 2H7XA 2ZYSA 4BVJA 2ONCA 1IZ8A 5JAHA 5AK6A 1XQYA 2XQKA 2C0PA 2XDWA 3I2FA 1WCYA 2O7VA 5I9IA 5AJHA 3GUUA 5AKEA 3KWJA 1M33A 2HRRA 3NOXA 2CKMA 3M83A 5HQ3B 3B5EA 3K6KA 2FUKA 1DU4A 3WK6A 5JD4A 5AKXA 3WKDA 2JBWA 1YCDA 3DLTA 3KWFA 5ALZA 3FCYA 5FV4A 1ISPA 3N2ZB 1LPNA 3G9UA 4Z49A 5CXUA 1DTEA 3ZLUA 1BS9A 4PQEA 5KWJA 3FWHA 3RLIA 2BUCA 5FRDA 1E66A 1ZIXA 4DMCA 1GQRA 1LPOA 2C4HA 3U1TA 5E2IA 5DYTA 2W6CX 2HU8A 1GXSA 1XZJA 2Y2VA 3L1JA 4UBJA 3WK7A 3QH4A 2BGRA 1WB4A 3H19A 2FJPA 5SYMA 4ARBA 3JWEA 4Y7DA 2QXUA 2CB9A 3RM3A 1MAHA 4WFKA 1H2YA 5FLKA 4BB0A 2VEOA 2IIVA 4WFJA 5AI8A 4BRZA 4UFPA 3A70A 2Z8ZA 1ZJ4A 3HEAA 2I3ZA 4GW3A 1LGYA 5CTAA 1YA4A 4RNCA 1Y37A 3NGMA 4BC0A 2NW6A 4EB0A 1XZHA 3B12A 1MT3A 4HRYA 4PSUA 5AKYA 4N8EA 2YYSA 1LBSA 1UOPA 1F0PA 4B7ZA 4INZA 2IITA 2QJRA 4UBKA 4CFSA 2WIKA 5T4HA 5LZ8A 3WJ2A 3L1IA 1DX6A 1IUOA 2P8SA 1UKBA 1QIMA 1VE7A 4PO3X 2FJ0A 4N5IX 4DSAA 3PE6A 5ALIA 4EY4A 3IBTA 1ZGCA 1JMYA 1ORVA 1C4XA 4G8CA 4KE8A 4KRXA 5DNWA 1BE0A 3ZPXA 4JYPA 3RARA 4FFVA 5LYYA 4ZREA 4JEIA 4X85A 2VJDA 1G42A 3TJMA 1EHYA 1W4LA 1T4MA 2WILA 4PV7A 4K5QA 4M0MA 4C4XA 4DYHA 4IH4A 1GT6A 4AMZA 1FFAA 1VA5A 1AKNA 2XMBA 2VSQA 4C4YA 3WKBA 3ED1A 3H1AA 2D5LA 5D3KA 4YX9A 5FDFA 4H7IA 2WLSA 3F67A 3QMWA 4X3CA 4BP8A 1K4YA 1UOQA 3E4DA 1XFDA 1XZAA 4I19A 1UOOA 1TRHA 4Y9SA 2WIFA 2X5XA 1CUUA 1GPNA 2XLCA 1W6RA 1YAHA 2ZSIA 1CUJA 2JGEA 4KACA 2XMRA 5AOBA 5EHQA 3VJMA 2RGUA 1LBTA 1YAJA 5AM3A 1GKLA 5AKIA 1O6FA 1CLEA 1MX9A 3HI4A 4X7BA 4GEGA 3C6ZA 1HQDA 3HYSA 3HLKA 2J4FA 3O4JA 4I4CA 1JU3A 2IX9A 5T4BA 5ALVA 1IVYA 1EB9A 4X90A 1UK9A 1IUNA 1GQSA 5HKAA 2AJDA 1W52X 4U2DA 4U2GA 4YPVA 2VJAA 1FFBA 4J0KA 5LKRA 2ZJ7A 4BP9A 1AMNA 4FDMA 5FKJA 2EDCA 1U65A 3R3XA 1K6EA 5JZBA 4U2BA 1EK2A 2JF0A 3DQZA 3DOHA 4QEKA 1MX5A 2PM8A 2QUAA 2PL5A 5JATA 3FCXA 3QPCA 1JKMA 4IQ4A 3ICWA 4YK7A 1LPMA 4DNPA 1QONA 1IUPA 4UHBA 3STWA 4QLOA 4CG3A 1OCEA 4GBGA 5A62A 2XUJA 1SC9A 2XUIA 2VAVA 1H22A 1YS2X 4IH9A 4DSZA 1NU8A 5DYWA 3R41A 4N8SA 4HTAA 5CXXA 1ZICA 2JGKA 1LPBB 2FX5A 3BL8A 3C8DA 1CIJA 3D2CA 3R3WA 4UBNA 3HSSA 3O95A 4XWGA 1EDBA 1DT3A 5A2GA 4DNFA 3BDIA 3BF7A 3O0DA 2PSDA 2XE4A 2YXPX 4G8BA 5K3FB 4B6GA 4Y2VA 1CUXA 4KJXA 3NWOA 4LXHA 1GZ7A 4KAJA 3CN7A 1J06A 5AM5A 5ALYA 2J4CA 4MEBA 1WOMA 1TCCA 2GYVA 3IUMA 1F6WA 1E8MA 1LZKA 2BCEA 4CCYA 4X6YA 5ALRA 1MPXA 3I2HA 4MQLA 4AX4A 1TQHA 3FLAA 3HABA 3Q0TA 5ALLA 5C8XA 2VT6A 4ARAA 1ZD4A 4X94A 1E5TA 1XROA 2R8BA 3SWWA 3V9AA 1KU0A 3GBSA 1C7IA 1R50A 1AX9A 3PFCA 1CFJA 5BV7A 1EXWA 3D5EA 5ALPA 4BE4A 4GECA 1E3QA 4Q34A 5JALA 3AINA 5ISMA 4BCCA
chains in the Genus database with same CATH superfamily
3HM2A 1BVHA 5BV1A 4AS1A 2I1QA 2NYAA 3P94A 3V7YA 3Q7EA 4WLVA 4PNPA 3D6JA 4XGKA 3ZYCA 4E31A 1SRQA 3U9TA 2XYRA 4HP8A 3ZXSA 2ZJZA 3I9V6 3UJ6A 5K6TA 1PL6A 3AVVA 2I2CA 5JW6A 4MXDA 3IPCA 3D4IA 4V0OA 3OPXA 1XZBA 2DR3A 4I5IA 4QNNA 4G4SP 2WMNB 1AQUA 3F4LA 4RM3A 4DV6B 2E85A 4I50B 1C1YA 4QUGA 3FE2A 3ZZUA 2DFLA 4Z4IA 4EB6A 4ZT5A 2QK4A 1PKXA 1OWOA 3ED5A 1FXWA 1QK3A 2FG6C 4Z2YA 1ZO8A 5CB6A 1FJ2A 3ZDAA 1GPLA 1M6VB 2LXNA 1SOVA 2VI5A 2WHYA 3C24A 3C5EA 5CNKA 4YRQA 4LF4B 2ZRFA 4IDNA 4JJ8A 1J4AA 1KJIA 1UJ4A 1VIMA 1SWVA 1WDWB 2GVDC 2HY7A 2IW1A 2GK6A 2X9NA 3DWEX 5ICFA 5J59A 3V1TC 4ER6A 1R37A 1XZGA 3LHKA 4JBYA 4ZXFA 4F2DA 2WUDA 5KTYA 4MRMB 1B76A 3AIKA 3LLMA 1HSOA 1XVVA 2V98A 1USVA 5IC6A 4H77A 2Y0DA 4KQ9A 1Q44A 3AKCA 2FRDA 1SZDA 1Q0TA 3ZBUA 1JKJB 4M36A 1FFHA 4DXHA 3FB1A 3OJFA 1SUCA 2ZULA 1CUDA 3N8KA 4WERA 1JJFA 1GRCA 4IJKA 4J7CA 2JLQA 1K6IA 1KWGA 5KUTA 3NJ8A 1NVVR 4D4HA 4RUKA 3OCWA 5JQGA 3GG2A 2Q62A 3I9LA 4NOMA 5G4LA 2QBYA 1LPAB 1RMQA 1ZG3A 1OU4A 1Z6PA 2QR2A 4L22A 4R8KA 4X1OA 4NE2A 1ECGA 2PX5A 3HA5A 2PGIA 4D0SA 3WNDA 3JRWA 4RJTA 4YJFA 1NKTA 1ZPDA 3G1TA 4C06A 1BHQ1 1FK8A 3F71A 2GEJA 1TC2A 2BEJA 3QXCA 4X71A 3QWIA 4TYNA 1GSAA 1Q1ZA 1U9IC 1OGJA 2RHWA 821PA 2Q29A 2Q5FA 1E32A 1LPPA 3ETEA 3DPSA 3MCUA 4FZJA 4HF7A 3I01A 3KOZA 4BVAA 1VYTA 2PUJA 5EXXA 3N53A 3KQOA 5HG0A 1BXKA 5EPEA 2WHXA 4LGVA 4OQFA 3EJ6A 3T3DA 4BJ3A 1NLFA 1U6IA 3W6NA 1F0YA 4RTOA 3O8BA 1JT2A 2WM3A 4IJVA 3RYHB 4ID9A 2PUWA 3ZW9A 3U4DA 1TJNA 2VQDA 5H80A 4YYZA 3SQDA 5E38A 5DCLA 1M1UA 2R5FA 3IALA 2JFPA 5H1YA 4B34A 2QGFA 3WLIA 2QM0A 1NQ5A 4E30A 3B5IA 1KY5A 4U02A 2D1RA 4Y6PA 5T4EA 4B31A 3CX3A 2W4IA 5DBOA 5EIBD 2FN4A 3GQBA 2F1JA 5T6MA 3A9SA 3DMFA 2X9LA 1EP3B 2BGGA 4CTMA 3GLIE 1MH1A 1K8RA 1S4QA 3ELUA 4I55B 1YB6A 3NZEA 4NE9A 1UPTA 4O2LA 4GOMD 1XXHA 4CIVA 3N6XA 5E9JA 5HQJA 3V7UA 1VI5A 2NG1A 1Z5VA 3O7WA 4M49A 3T95A 3JZDA 2R6DA 3JQQA 3M4NA 1JR2A 3U6BA 1D6JA 1Z8FA 4B3XA 2VWQA 5C8VA 3CNQS 3W77A 1W2GA 1ZHOA 3SP1A 1UEJA 5F2KA 4YRBA 3GVHA 1CUYA 5DNCA 5BNZA 4ZN6A 2HTFA 3VZDA 2H1FA 3S0JA 5TQ0B 1K4MA 2OBMA 3WLAA 4NENB 4ZICA 2WINI 1T9BA 4DLUA 1EM8B 3R5HA 1OSNA 4G0YA 4TTIA 1I7DA 3JARB 3EEOA 1ABBA 4NU8X 4I55A 3SEQA 1FXWF 1I1HA 4LGCA 2FN3A 4A03A 1PT6A 4JSTA 2BF4A 2C31A 3C2QA 2H1LA 1H2XA 3ONDA 3ZCXA 5JH7A 4ZPJA 1ZNWA 3OQOA 3VSDA 4YWHA 2Z56A 4FKMA 4QDOA 2D4AA 3C6XA 4GLOA 4OIFA 4DCCA 1CEXA 2I7VA 5D3QA 3MELA 3I9JA 3RGWS 1U1EA 1ZKDA 3GCDA 2OV8A 1DO8A 2DHQA 2OBLA 1PR4A 1JAXA 3H18A 4ZODA 2IYZA 4N0DA 3W6PA 3TLKA 2R4TA 3OE5A 2GBFA 2JCXA 5G2OA 2I22A 1GU0A 1TAGA 1NJ2A 3B3JA 2QGNA 5A6SB 5KBYA 3AVXA 3RAGA 3BCSA 3P2OA 3W9SA 5HKLA 3NTRA 4MR8B 5AM4A 3CHYA 2ZYRA 5KYVA 1P9WA 4BFYA 3ZWXA 3KQNA 3OQ6A 3F5MA 3T5AA 1TKCA 5JAPA 4M0KA 2B83A 2IT1A 3OFSA 2WQZA 3LH5A 4U7GA 1RQ2A 3OG9A 3TXXA 2XT6A 5IMBA 2QW1A 4PAQA 4TT3A 1IN4A 1FJGB 2I9PA 2OYRA 3UT5A 1G5QA 1X1EA 3VSEA 4BKRA 2CZQA 4UDNA 4JJKA 3NBQA 1B0PA 4CW7A 4B3SB 1AQNA 1ZDMA 2H1IA 3BMOA 4PIPA 4PVDA 4YRPA 4G1FA 2P6NA 4K81B 1MHPA 1QO9A 1VCOA 4WZ6A 1NC1A 1RU3A 2CUNA 3EXFB 2OFFA 2MHCA 3GVIA 1COWD 1KJ9A 3M8KA 1E89A 1GZUA 3NATA 3PUJA 4BKQA 1O5OA 4O1MA 4XI9A 3TZLA 4E2XA 2NTNA 1K5HA 1WTCA 2WWGA 2GJ9A 4ITRC 3VHXA 4F60A 3L93A 3C5WP 3JZAA 2WT4A 4QSMA 4RPKA 2WZBA 4Q9DA 1NI4B 3IELA 5BWLA 5LKAA 4AJ9A 5CD1A 4Y6SA 2VF2A 4OHYA 3Q72A 1C9DB 4R3NA 3PLRA 3A36A 5L6MB 2ZB2A 3K7EA 4KIWA 1B42A 4XLTA 2R6AA 1LJ8A 2RAUA 2XRMA 3ABRB 5F52A 3M6IA 1WVIA 2RE8A 5BN4B 3VZSA 4C7OB 4O2BA 3GDHA 2XYHA 2AJCA 4DMUB 4RF5A 2VZ0A 5SY4A 3UW3A 2PX4A 2FQXA 3WLQA 4NCXA 3NUQA 1X92A 3ZK7A 3UKOA 4D56A 4F72A 1C14A 1TJ3A 3R3ZA 4XD7A 1DIAA 3ZJ4A 1ZMBA 3MBIA 4LRWA 1WAMA 4OGKA 2EKPA 4RD1A 1A96A 1M73E 1VA4A 4B3TB 3FDXA 3H2BA 2PYDA 2FX3A 3RC3A 1IATA 1CR6A 1PDOA 1RQRA 1U8EA 2VTDA 4FUTA 4CQNA 2C2KA 3C3AA 4J91A 4EEKA 4YV1A 3E9DA 3LY5A 2P6UA 4PGAA 1IXSB 1DAEA 3H5RA 4G84A 2Q6LA 3DM9B 2BIFA 4PZPA 3ZWPA 4MW0A 2P1RA 4R1TA 1V2HE 2X22A 4MA4A 1FSGA 4ES6A 2NP7A 2ZYHA 1I1QB 2C94A 2BEKA 3WZMA 4ARVA 4BLWA 5AOAA 4DQDA 5FXMA 2XMDA 2OHHA 4DSUA 1OBFO 1UF9A 5EGSA 4JV5B 1FTYA 1XJ5A 4A0HA 1RHRA 5J1SB 1SUPA 2WMDA 1MC5A 1JBQA 4ZOAA 4S1WA 3EXHC 2FMIA 2HBZA 2X8AA 2ZJYA 3HUDA 3I53A 4C01A 2E5FA 1IHOA 2VXCA 4BMOB 2SBTA 3OEWA 3N5KA 3SJZA 1SJ9A 1MUUA 2TECE 2XZDA 3OHMA 3GUCA 1QHGA 3WHPA 3QPWA 2NTVA 2N47A 3G85A 4K1LA 2PX3A 4Q12A 5AR1A 4BLQA 1DAKA 5CYGA 4JU8A 4M9ZA 3OZAA 3FFAA 5CNIA 3ZCRA 1QIEA 2OEPA 5C3MA 5K01A 2CUTA 5HUHA 5F98A 3Q11A 4N48A 5E7IA 3TLEA 3ZJ5A 3PGA1 1V16A 2I8CA 1GNRA 3HUUA 4N18A 5DULA 4BB5A 5KQPA 3WLFA 1WM1A 2CVZA 2G36A 4Q03A 5BSFA 3UMYA 2JAUA 3PXBA 4BVBA 2I1VB 1JFRA 2NYRA 3SZLA 3QOYA 4BZWA 3MTJA 3NKVA 1ZWKA 3HVJA 4QDUA 2PRZA 5LPNA 3G8DA 3VA7A 1Z2OX 2HR1A 2XSZD 1M74A 4WBXC 1T25A 1GPAA 2O2SA 4WCFB 5DO9A 4D81A 2V65A 1H5QA 2FDRA 3BCUA 1GQ2A 3TCKA 3X1MA 3HDQA 2HW8A 1TVEA 5EVJA 4YI3A 4AQ7A 5JD6A 1SXHA 4JB8A 5KMGA 4RTSA 4EPWA 4IDGA 2XB6A 3WOVA 4ME6A 3QY0A 3DDUA 2PNJA 1BRTA 1WDLA 1J1IA 3A9VA 3ENNA 3F96A 2V7EA 2AFIE 2J59A 1A9YA 2VG8A 4HPJB 1T8PA 3NTOA 1R4NA 2DU8A 3GFBA 1AUXA 4PFJA 5JQGF 1WE2A 2MYPA 2PNFA 2X5NA 4FFRA 1JLLA 5H68A 4RJ2A 1RJ9B 1L4UA 4Z7JA 2Q1WA 3KIPA 4QOGA 1XUOA 3CF0A 3DE0X 1MTOA 2ZQ5A 3G7NA 2NVUB 2B98A 4BEWA 5KQRA 1XA0A 1M6YA 5E8JA 4BLTA 2A9RA 3OQBA 3I0NA 5H59A 4QECA 5DP1A 5CFRA 4NPCA 3OTOB 1OB2A 3NEPX 4GKKB 5DDIP 5CM9C 1TA0A 3N59A 4TWIA 4LY9A 3UAGA 4XYGA 2QZ4A 5DSXA 2WTXA 5FI0B 1UXJA 3RDPA 1LDGA 3VVLA 1C1XB 1P0IA 4IZOA 2QRVB 4S2EA 5JMWA 2FPPB 1TYEB 3I8OA 1P77A 3LBHA 3PFIA 4HR7A 5FYDA 3DAYA 3PTLA 4L1KA 2WK1A 4IIUA 3FWNA 4QYMA 2C2WA 3QENA 1VZ3A 2WYUA 3ST7A 2HWKA 2GI4A 2E6UX 2GFHA 2HO4A 3B2EA 1PDVA 4E13A 3P4XA 3U9SA 2X8JB 3FYSA 4BJHB 1KJZA 3NHRA 3C48A 1II8A 3HFRA 4OEHA 4RCZA 2Y1FA 3AESA 1YF3A 5JXJA 4P2GA 2ZAGA 1YVRA 2GF9A 3QV2A 3ACBA 4UARA 5ERXA 1PV4A 1HNWB 3JATA 3RPEA 5LU8A 4JCCA 4M9CA 4BNHA 4JNCA 2HHJA 5KX5B 1U8ZA 3PCRB 4Y0VA 3NO4A 1YL6A 3E7WA 1HT2E 3N8NA 2HJRA 1JIIA 1WMDA 2OHFA 2G5PA 1M2OB 4I99A 4JC0A 1WF3A 3QLUC 5TY0A 3PR3A 3S5JA 4AAYA 3HN7A 4UDOA 2R1VA 3WQRA 4ZPXA 3WIBA 3SGLA 1VL8A 5C7OO 3KQMA 3FPEA 4HRVA 3NT5A 1ZVKA 4QOSA 1PW5A 5LBIA 3W5HA 4EHJA 1YBFA 1ZRHA 1J25A 3T9BA 3TSOA 2R8ZA 1TEXA 3IBYA 2V6JA 4FQ7A 4FJ2A 3ND7A 2F3SA 4HNSA 3TNDA 2YC2C 3GNSA 1E8NA 3OETA 4F45A 2TSYB 4LNAA 1NMZA 3FYUA 3HCAA 1L5WA 4G0OA 3DOFA 1EWYA 2OQVA 2HIMA 3V2IA 4MQMA 1J2RA 4ZT4A 2DBRA 1ZM7A 5CT4A 2Y4OA 3UMCA 3KKQA 3I9KA 2EQ5A 4XUGB 5DW0A 5JJLA 2I4IA 2C92A 4PQGA 3EGDB 3QEAZ 3SKVA 1UXIA 2FK7A 1EG7A 4ZIRA 4CLXA 3I6QA 3NHYA 2Y1KA 4EEXA 1MEOA 2Y6UA 5D87A 1U6JA 4UD6A 4G23A 4R51A 2IXTA 4Z1MA 2ODTX 5E7QA 2XT9A 2JKVA 2L2QA 3O8OB 3OO1A 4C2AA 4KHPB 3AG6A 2Z9BA 1IJKA 1P2VA 3GH3A 1KBOA 4HVCA 4I4NA 5CDYA 4TXMA 1DWUA 2AWOA 1ACLA 3IPLA 3PUVA 4U8GA 3EAFA 3L8EA 4RD4A 2MR6A 2IHYA 3ET4A 4W63A 4FINA 4ZQBA 2IYAA 3CPJB 5C32A 4KOAA 5CH5A 5LYJB 3VSAA 4P36A 4K6MA 3LJKA 4PO9A 3HNRA 3DC2A 4MYSA 3H2YA 2ZS8A 4QWWA 1OB5A 2QTAA 4LXIA 2HN9A 5IAKA 3PNLA 2QUBA 4Q02A 4WASA 1L9KA 2Z1MA 3DT8A 3L7NA 5CX1B 4URVR 3ZDYB 4ZYXA 1YJXA 3ASUA 2B5OA 1SCNE 1G66A 2GF0A 1C50A 4UNIA 4DY4A 4MYDA 1P62B 1B1AA 3FHJA 1E7WA 2P5TB 3H2KA 3Q41A 5FEUA 1JH9A 3ICCA 4FIDA 2R6ZA 4HDRA 4KPUB 1SG0A 1XAGA 3VYTB 4R0VA 1J1UA 1OI7A 1Y5RA 3VSBA 3RBAA 3QPBA 1WU7A 2BJHA 1GQFA 5FUVA 4CV0A 4EVQA 3M81A 5BW5A 5T3YA 2BHSA 2VRWA 5TDHA 1MB9A 4E5NA 4B3DA 4EVIA 1AK1A 3IMCA 4GQAA 4RJLA 4UUQA 1OJLA 5IH7A 3FB4A 4EM6A 1GV1A 1Z4KA 1WXXA 3ABIA 1USUA 2RI1A 1GUFA 3O8QA 4IIJF 2IV7A 4B48A 1QTRA 3BWVA 2OO7A 5D8DA 2F1RA 3JQAA 5TB5A 1NOKA 4Q7LA 1UP6A 4MAFA 3QVUA 2QLBA 3DULA 4MKXA 4B76A 3MQ4A 4OIMA 3D5TA 2NXNA 3PA6A 1G5FA 2BCGY 3PF8A 4IG9A 4Q3LA 3DBOB 3GJ7A 3O8DA 1W88A 2HREA 1Y48E 2CC2A 4KGXA 1GAEO 2VNKA 1QV6A 1ECLA 2HQSA 2XQVA 3JALB 1NLMA 3LF2A 4CM8A 1JJIA 5B7NA 3WC4A 1MIOA 5D2CA 1U5CA 2C8VA 3ECSA 5FWXA 1QV7A 3W3ZB 4NZOA 1KIFA 3PR1A 2AXEA 4J3JA 2A14A 2A9FA 4KJZA 5KX5F 1JVBA 2VTBB 1EUQA 4HH1A 4EHHA 3K1TA 5C7LO 4Y1EA 4P83A 4IOJA 4Q6WA 1W0KD 5F2NA 5BP7A 2F3UA 3R5JA 1H4TA 2C7BA 4OAPA 4U0KA 3ZE7A 1UL1X 2MINB 2ZYGA 3OMLA 4QEDA 3WGLA 2QJTA 5JV5A 3VDMA 6YASA 1PQUA 1JG7A 1NR5A 1RXCA 4C0LA 5C8ZA 1IMOA 4FR5A 4JJFA 1K2VN 2G63A 2KW5A 3ANNA 4G5XA 3N74A 4TLBA 3BQNB 2V55B 5EJ5A 3CUUA 1IY1A 1QC5A 4FSDA 1S4MA 1TCAA 2FW6A 1HA3A 1VKHA 2A9JA 2WIAA 4NU5A 4UREA 3S7TA 4EMBA 1OT3A 1JR3A 2DFPA 4WOPA 1Y9AA 5DHFA 1UFKA 1Q20A 3SYRA 2D59A 4QLAA 1PZHA 2C7VA 4EX6A 2RFLA 4Q66C 2IJGX 4TTAA 1TZJA 4DQUA 4YLYA 1ZNZA 3C3YA 3PK0A 1F1BA 2JFFA 1NTOA 4TMZA 1W76A 1Z75A 4NFLA 1N0UA 1T3SA 2DCUA 3DW1X 4OP2A 4F86A 1E5DA 2ENUA 1ONBA 3ROTA 1V8BA 4JZYA 3K0CC 4HWRA 4UOZA 1M0SA 1SELA 4WLOA 1W48A 3BORA 1GLNA 2QRQA 1BQEA 2ZWAA 1W30A 1N5RA 3L4EA 5KNLA 4CG0A 1G2PA 2HZ7A 4WCVA 4PYJA 2O5EA 3ESZA 3AJRA 3KQHA 2QR3A 3QX3A 2DT5A 4B3FX 2HWUA 4JCOA 4YS6A 4P35A 3ZDDA 4LZNA 1YQ9A 1UDXA 4MW4A 1GTG1 1G291 3M1LA 5E4JA 1OKKA 1YS1X 1M2NA 5BSGA 2IWRA 1SUWA 4UPVA 5CHEA 3FOFC 2TYSB 4TL8A 3RUHA 1MJFA 3UA3A 4D9CA 1U81A 1U2GA 5LYJF 1B23P 3UMVA 2BEWA 3VKFA 3ZDRA 1PT9A 4HGPA 4CVNA 5JAIA 1QU3A 3N8GA 4BX9A 2O6LA 1FDSA 4P1ZA 2XX3A 2QRJA 3EDOA 1DV1A 4YRJA 1J07A 3IAUA 3RSQA 1U5BA 1PW7A 1D03A 4LSWA 4AWXA 4B3IA 1ZM9A 5B7QA 5LQKA 4X64B 1NGSA 2GBIA 4JA2A 1CS0B 3C1AA 4PBRA 2IP4A 2BFEB 3ZI4A 4DFDA 1W5AA 2CMKA 4J0FA 1BS2A 1K66A 1Z2EA 4AK9A 2R1TA 4DV1B 4H7DA 3JAKB 3ZD6A 3WLJA 5KINB 1A1VA 3E1KA 1CE8A 4P32A 4DCUA 3H7AA 3JYLA 2B35A 1XEXA 4TX1A 4LFCB 3LX5A 2DBYA 5JROA 5EG5A 2VZ9A 2ZZNA 4L8WB 3C98A 3UQYS 2GHRA 3IMGA 4LOHA 3NCTA 3E9YA 3QVOA 5CBPA 4C0HA 2VHQA 1B00A 3P9NA 4RD3A 3TH5A 3EX7C 1M8JA 1G20B 1VJDA 5I9MA 1WZEA 1KO1A 5EZYF 3B1ZA 3S29A 4XVCA 2BFEA 1U3DA 2OZKA 1DWPA 1N5OX 2WFZA 3K0EA 4GM0A 4OI4A 5DT9A 3SEFA 3ZNOA 2GUGA 2PRIA 2Z57A 2CNLA 5DIZA 1BSVA 2PZKA 4EUEA 5DNEA 3ZWOA 2JAWA 1X3LA 5GJBA 4EFKA 2HCBA 6Q21A 2Y1XA 1CZLA 2YL2A 4IYJA 4K9SA 4AWBA 1H42A 5JVDF 1CUFA 1KXZA 3U4QA 4X41A 2NSYA 3M3DA 4EGSA 3VM6A 3T7EA 3W7AA 3WRXC 1NXPA 2ZPAA 3H16A 3PC3A 2QL7A 4IQ0A 3GRKA 4AZSA 1GN9A 1GZ3A 3NIDB 3EGXB 3D54D 2UUOA 3D5QA 4NONA 5LZ7A 4LRQA 3DJFA 2GZMA 5CLJA 3K9NA 2C2XA 2OKCA 1Q77A 2PJZA 3QNUA 1M5UA 2ODBA 4X0EA 4BNXA 3NTLA 1ADJA 1QVAA 1R15A 2LCFA 1ES9A 4KR3A 4ZAGA 1CUHA 3DL0A 1QQ6A 3AP3A 1GTZA 3NANA 4WX2B 1PJSA 3OJCA 4EG5A 1VXRA 1FTSA 2QRPA 3BB1A 3AR9A 5LXTF 7ABPA 4UOEA 2AZTA 2OORA 4O4LA 1ONNA 1FVOA 4MGIR 1BU8A 1R9MA 4R7GA 3WLLA 3ZHCA 1B8NA 4MA0A 1DPFA 3HVHA 5DTQA 1E9SA 2E0IA 2E21A 5KOHA 4GOKA 5KSWB 2J5KA 5I8ZA 3UMMA 2ACEA 2CDNA 2XVZA 3LHDA 2RMKA 3WQQA 5KYNA 3NWBA 3L9WA 1HOTA 1XCMA 4G6ZA 4ZMBA 3DVLA 3KM0A 3R7BA 4CMEC 2JCVA 2FU5C 2OXFA 3EDRA 5JS7A 2H4WA 5GONB 1AGNA 1GDHA 1U9JA 1UBHS 4GZ6A 3GEDA 4Y2RA 1VC2A 3K2BA 2YZ7A 4B32A 2B9EA 2J41A 2YYYA 3WWCA 2DUMA 4LYDA 3EXIB 4O6VA 2GESA 4JLWA 4EW2A 4YJ3A 3W8NA 4DNFA 2IZ7A 4UEOA 4YRNA 3MWKA 2GPWA 2C2OA 2VNHA 3EOAI 3OQMA 3QPUA 7YASA 1KI9A 1QWSA 1Z68A 3GR6A 2B0JA 4ND1A 4YP5A 2HJSA 2V6GA 5F5NA 1BCSB 2CHEA 2FSGA 3HLTA 4YHBA 2G83A 2NO6A 3W4IA 1Z0ZA 5CUQA 1FQWA 3P4UA 3G9XA 3S81A 5EHZA 3D8RA 3CW8X 1J97A 1K5PA 3SJCA 5K0JA 4W5QA 3QWBA 4PX5A 2ZIFA 5BN3A 2LIPA 4GMHA 5A4IS 5D3MB 2R96A 4PM4A 2IK8A 4XLLA 4A0RA 4B3RB 5FUWA 4MNTA 4Z53A 4IDQA 1NVWQ 4E5MA 1S3SA 1XZCA 4OHWA 2LWIA 4JIMA 4I3HA 3FSGA 3RSLA 3DKIA 3JWIA 3U0VA 2ZBVA 1Q0RA 3FOEC 3K0AB 2ZRJA 2AR0A 1OMOA 3MG9A 3YASA 5BQ3A 4MV5A 5D84A 1V96A 4GRIA 3V1YA 2XE7A 5LL6P 1NBMD 2HRZA 3ZR4B 1RPJA 4H0CA 4MOWA 4OUDA 1BE1A 1TXGA 3ZGXA 3U4AA 4EQZA 1ZMOA 1I7PA 1K08A 3QKSB 3RS7A 5BORA 2ZRBA 1V95A 4MS4A 2Y1OA 3CPEA 2ZREA 1J9GA 3QKSA 1O95D 1TQ4A 4H9GA 4LPSA 5DGHA 3RKUA 3HXOA 5IUJC 4BCDA 3DO5A 1CJCA 4X45A 1MQ8B 4MVJD 4YR9A 5HRCA 1GQQA 1KYWA 1L3CA 4B80A 1R3UA 3DLPX 1D5WA 1XRRA 2A7QA 5CB4F 3ZU5A 3K0BA 2BSQA 2FPXA 3ADKA 2AI1A 4GM1A 4TUYA 1GYQA 4LV6A 2IYNA 4HI0E 2REBA 2XHZA 4MZDA 3SCZA 2Q1SA 1C1DA 1PV2A 2EQAA 4R2XA 2P2ZA 3I5YA 2FWPA 2PU5A 3IA2A 4WK4B 2C5FA 4A8PA 3R3YA 5JJ5A 3HRHA 1IHYA 1U1DA 4PLWA 4UE2A 4EQ6A 1GVHA 1T0HB 5IC5A 5EHIA 4LF7B 3QFCA 3ZZMA 1PT8A 3VX3A 5JS8A 3IVRA 1EDEA 1SKYB 3ZY5A 1ZJ5A 2ZBEA 4X20A 5EZQA 1B2LA 3R5KA 4PF1A 1P2DA 3NFYA 3T6KA 3O2JA 1UBRS 1TVMA 1EIZA 4N6OA 5FLEX 1EB8A 1IVSA 3GU3A 4DMGA 4JKOA 2PUDA 2ZUWA 1SBHA 4TZTA 3WA7A 1JYSA 3WR5A 1BHSA 4HVAA 2Q3DA 4WWHA 5CX4A 1NW6A 1NSFA 3ETLA 5B1DA 1U5AA 1U8TA 3M5DA 4FGWA 2VL7A 2XNDD 1WPXA 4GXTA 1KY2A 4PG5A 3S55A 1GUDA 4WECA 4I8IA 4W1RA 4LV8B 3VHRA 3O2SB 3O7MA 1I4LD 4O2BF 1SULA 5IAOA 2YTZA 2GN9A 5GONA 4JI4B 4EHFA 1IWBB 1RWQA 3QXHA 5DBFA 3TOXA 2FY8A 3TSZA 1TEVA 5DP2A 3LXMA 2GN4A 4UCFA 2OL4A 1LRJA 4S35A 3KKEA 2J45A 1MFPA 4ETNA 3WGTA 1IL0A 1J2JA 5KOHB 3LC1O 1DAHA 4B1FA 2Z6QA 3TEFA 1C0LA 1A7KA 2EEPA 3BHJA 4CEHA 3NALA 3AUUA 1NIJA 3BB4A 4MB6A 3TQRA 4TMFA 3V33A 4YT2A 1KF0A 4LXUA 4YA6A 1CK4A 3DMDA 2EL9A 1FYWA 1LW6E 5BT8A 3VC2A 1JFSA 3DE3X 1K6XA 1UC9A 2Y99A 4C04A 3DZ8A 1I0LA 2JLXA 3P19A 1HZZC 3ADBA 3USES 4G25A 2FETA 4KR0A 4RHUA 1XPJA 3W5UA 3DEIA 3RG8A 3GLUA 3ESCA 3ASVA 4QBFA 2P40A 4B79A 2VQEB 4N5NA 4XIIA 3EGXA 3B89A 1ZH6A 4C4SA 2IEDA 5ICCA 3UJ7A 3C3MA 5L4LA 3ELDA 4E70A 4FYIA 4CZ2A 2DUNA 3U4QB 2X41A 1N75A 4G63A 1JL3A 1LA2A 5B1SA 1ESNA 2AQ8A 3QPDA 1CU1A 1UAGA 5HUJA 5ELLA 3W2GA 3TX2A 4LAFA 4D2IA 5M34A 1GEGA 4FYYA 3LYUA 4NU0A 1VSUA 2H7VA 3COWA 4ZFNA 2FN9A 1R0WA 2XCOA 1G8AA 2M1XA 2ZJBA 4N0MA 4NARA 4L4YA 1S8FA 1N1GA 3GLGA 1CZHA 1ZN7A 4W6ZA 2CNDA 1HDCA 2GK4A 2B5WA 4TSFD 3AF6A 3TIIA 4GYWA 4WJLA 3QU2A 2QM3A 3RS5A 1UBEA 5K3BA 2C5AA 2HWXA 2PK3A 3DOOA 1XZNA 16PKA 2B36A 2F3RA 4UVGA 3AEQA 4BJ5A 2PZGA 2ZT5A 1D9ZA 4ZHQB 1INLA 2EOAA 2ZDGA 4C88A 3G5MA 3IUPA 4OA5A 4RJJA 2JA1A 3E0XA 3KZVA 3MJDA 4R98A 4M60A 5FWNA 2B78A 4F1KA 1JLSA 2QEQA 2IHJA 1NFRA 1WW8A 1XEWX 2AIRA 3ETNA 1QUFA 2HF9A 4G26A 4LXXA 2FHSA 3CLSC 3IHLA 1R66A 1VOTA 1XQXA 4HYYA 3BGSA 4LS3A 3LSTA 1QKJA 3IQGX 5DLDA 1E1RA 3HDYA 5F12A 1HOXA 3T7SA 2DQSA 3EBLA 3FDZA 3QUCA 1OPXA 3DAFA 1XVTA 2HRBA 2JK0A 2C9DA 4HY3A 2FEAA 1XC7A 2RHDA 3ND8A 3GPDG 3Q3JB 4P8RA 4KYVA 4LZLA 1YI1A 3PKIA 4ALIA 4URUR 1JWBB 1KXJA 1UPUA 1V3QE 4JLDA 3E70C 3PWZA 4V1CB 5JNLA 1CVRA 4LISA 3O82A 1QKIA 5I51A 1E18A 1FPQA 4UMDA 2IHZA 1G41A 4A91A 1MB4A 4HYEA 5HMMA 2IL1A 4DCMA 2Q5LA 3EXG2 5DYNA 4YRDA 1RPNA 1CJBA 2CK3D 1J20A 2CNOA 4OREX 1QAOA 1PYGA 1QG2A 1Z17A 3EQ8A 3MGKA 5DM0A 3WSTA 1XAJA 2A0FA 2VQ3A 4J94A 4BNZA 4MMYB 4LDQA 4F2GA 1P2SA 4YMLA 1XAIA 3HDVA 3KELA 1Z45A 2A33A 3V8BA 4HWOA 2WTMA 3ANXA 1ORRA 3F5SA 5LB4A 2P91A 1ECJA 2C88A 1PZXA 4FHDA 1ULZA 2JRCA 2DKFA 4QA9A 3HGQA 5LLTA 3Q0EA 2GO7A 1MX1A 2AG1A 3NEAA 1IEWA 1ITZA 1Z7YA 4C4PA 3KQSA 5A7HA 1KIAA 3HA2A 2F43B 4KXUA 4C89A 3DXFA 1SU6A 1YRLA 4XGQA 3INYA 4WRRA 4OHPA 5F1PA 2R8XA 3D3NA 2WHEA 4F97A 1MQAA 2CEKA 1HE5A 2Q0SA 1A3CA 4J16A 4RDIA 3AR8A 3OPVA 4NXNB 3C43A 2A0YA 3LIIA 4TTTS 2C54A 4YH1A 4JI1B 3ZV4A 3CLRD 2CNKA 1M34E 3PQ3A 2A67A 2FEPA 2H9IA 3FMOB 3W3AD 2QXTA 1WSBA 4QWMA 5JC8A 1XTJA 2CDAA 2G40A 4BO4A 4U8HA 4WXPA 1S2GA 1W88B 2OHVA 4NFYA 2FSVC 1XJ0A 3L7LA 2HI0A 2V74B 2CLIB 4MV3A 3RQSA 3RJMA 4MAAA 4OQXA 5U9CA 3BH6A 4PFKA 2BBSA 2Q3HA 3I6YA 3IBGA 4FJ0A 2FWJA 1IXZA 3IPRA 1QX4A 4L08A 4BMVA 2OPBA 3N05A 5D7BA 3D0KA 1CW2B 1AZLA 3TLGB 2H2GA 4LW8A 1RE1A 2OQRA 5T6BA 4OHZA 3RYFA 1DC6A 2MWMA 2QY6A 3EC2A 1GGKA 4UQOA 3VYRB 4D43A 1DZ3A 3IE1A 2UVQA 2RHCA 1C8LA 4RV4A 3CGGA 1P74A 3JASA 1Z63A 1A7UA 1WLYA 5IJZA 2WM9B 1G8GA 4FT2A 3UXHA 4FCWA 1X9GA 2VNIA 5CG1A 3HB1A 2I55A 4HGZA 2HMSA 3UGTA 3ZJVA 2R8EA 1P2GA 3SG0A 4ED9A 4A8JA 4U00A 3UENA 4RZUA 4ZQEA 3RRZA 3W9BA 2X14A 4IVQA 4KPYA 4C1BA 4UBMA 1CF2O 1ATIA 1R88A 2FFHA 2CSXA 1H2HA 1ONOA 3TFOA 4WBSA 4DXDA 4L51A 4YROA 3BIJA 4RWEA 2VDNB 4QZVA 3BB3A 1B74A 5CX1A 2FHPA 4QXRA 2CLOB 4TT8A 4BFVA 3A3YA 5NLLA 1NBOA 1C7FA 4JC5A 1S8OA 4Z0TA 4BFTA 4L76A 2X76A 1ZKMA 4OV6B 5DBHX 1KH2A 1EWVA 2IF0A 3D1VA 3WJ7A 3UUEA 3X2EA 2F8MA 3FGNA 1BRMA 4J4BA 3KKZA 1HDZA 4KFTA 4BNJA 2GD2A 2BKAA 1ODTC 4EYGA 3AZPA 1TM3E 3HJTA 3J7TA 1BAPA 2VS1A 1M2WA 1TF2A 1CCWA 2CFSA 2K2QB 1V8FA 3LDFA 4XM1A 5ALHA 4C0SA 1NZJA 2AG5A 2YXLA 3DMTC 4KMRA 2ZJFA 3GQVA 2IHUA 3AWIA 3IBCA 4L73A 3PUKA 4ZZ2A 1EK0A 5FF9A 4G1CA 2C95A 3OOHA 4DYVA 4G0ZA 2Q5JA 4EVSA 2ZPUA 1P4RA 2J6HA 2YASA 4H1UA 4QOEA 3CRQA 3A2LA 4EZBA 3WAJA 3S1AB 2GF2A 5T7BA 3KEGA 1GNPA 5DVZA 5FULA 3KJHA 5J5AA 4XWYA 4BNDB 5JAOA 4DKXA 4RGYA 1Z88A 2G80A 2GZHA 4PNZA 4XGRA 3R0IA 1PR0A 3PLAE 2CWWA 4ARSA 2XYVA 1QLHA 5LFAA 3FHCB 1EM8A 3A27A 3FWKA 2XI4A 4D46A 2A9PA 3EZ9A 4JJAA 4JKYA 4K46A 2QQ5A 3D0QA 4JVMA 4P84A 2X0EA 2G7ZA 4G4JA 4GKAA 2I62A 4DR2B 1QAQA 4ZQIA 3K0FB 2Q0QA 5EXTA 4MVJM 3WYNA 3MYYA 3AB8A 2PKYX 1T8YA 1K0UA 2OV4A 2OZLA 3VR6H 5A9SA 2AFIA 3FTCA 3CUKA 4IJ5A 2SECE 4UNQA 1W87A 1VSQA 1XDZA 3C4QA 3G0BA 3U19A 3CO5A 4H7HA 2PXHA 1SXJB 1CC1S 5KTNA 1DUSA 1KC1A 4LUCA 4F71A 3P5SA 5FLYA 4M7OA 4QBGB 4EO9A 4CKWA 3D2AA 5KX5A 4CIBA 1REQA 5D5PA 3WVNA 3ADDA 2YWRA 3JVEA 2CLFB 2OCGA 4C0XA 1BX0A 4CNQA 1LEHA 1P1IA 1WDKA 3TGLA 4ZO6A 3AESB 2YUTA 3ROXA 1LBEA 3OZTA 2YVLA 2X0NA 4QNRA 3AR2A 3KTOA 2ZUDA 2BM0A 3B3GA 5K99A 2QSYA 2BYTA 4HMOA 4MJ3A 1FTGA 4LXQA 4YMHA 3RTGA 1JHAA 2LP4Y 3W8FA 1KDPA 2X2FA 2GKSA 3BIFA 4OB8A 5CA1B 3BDAA 3ZBQA 1IQUA 3K96A 2X0DA 2P68A 3U56A 3ZVNA 1PZEA 3U4IA 4XJSA 3BXXA 3GA5A 1L5MA 3AI3A 5AOVA 4PRZA 4UEQA 3PX2A 5EFOA 3Q6MA 5KIAA 3C3EA 4WVFA 4CUJA 3UANA 1CY0A 4MVJH 1THTA 4I2NA 1QYDA 4X8MA 4BDTA 3AHJA 5CLLA 1X9HA 3J81A 3AVTA 3CCCA 1PHPA 4FGSA 5ALSA 4YONB 3ZK9A 3FYDA 1WY7A 1FU4A 3GAZA 3HQ4O 5KTSA 4YJ2A 2Q1YA 1RJ9A 1ZSYA 2W2KA 4TQAA 4YLGA 4J7AA 4A10A 1T4BA 1J09A 2QLTA 3E2PA 4UBLA 2BP7B 4AJ1A 1R0ZA 2DCMA 2PFGA 3JY6A 4OX9Y 3GI1A 4HAXA 5TGTA 1OTXA 3HCBA 1X1SA 4BWFB 2I1WA 4E2FA 2QTRA 3CZ9A 4FI3F 3UM9A 2JKZA 1T24A 2VDJA 2E7ZA 2ZIGA 3BRCA 3PCXA 1P0FA 3UXYA 3PQDA 4EAQA 5I5EA 4LC9A 3EUFA 4I8DA 1BVRA 3QQPA 4PZAA 4DWJA 4X6XA 1GT91 3G1UA 4LZPA 1GU7A 2F64A 3Q8LA 2ZWVA 2JVJA 2ZJ1A 3OJEA 4XRGA 2G88A 3FLBA 1AA9A 3OT1A 2BDUA 3WGHA 2QT0A 4E12A 4UHEA 5F77A 2C97A 1DO2A 1P44A 4L9AA 4M98A 4ND5A 1UPBA 4Y18A 4B7CA 5FTWA 1QLWA 3HV2A 4XDGA 3WRVA 4CM6A 1L2TA 1ZR4A 1J0AA 2P3OA 1DTWB 3F2IA 4J90A 3GP5A 2VP9A 2HH9A 3QFHA 4TTJA 4FB5A 1V1RB 3MMZA 5KB3A 2PBLA 2C84A 3BH0A 3ZGOA 4TYPA 1C3VA 3MLEA 2IKQA 1E59A 4MUBA 2JBAB 1PZFA 1Y7HA 4RQUA 3HXPA 1D0VA 3FPJA 3ZCQA 4BMYA 5DU2A 5I8PA 2H63A 2I9KA 4QC2A 2XUPA 3DMRA 1DCMA 3FGPA 5G3YA 4NHEA 4S05A 4FP9A 2XOKA 1Y9ZA 1OYWA 2D0DA 2OXCA 4M6WA 4RKQA 4DV4B 3KVNA 1P8AA 3DE7X 2FDCA 3H8WA 4OBEA 1B16A 4UUNA 1MD9A 2GDJA 1MORA 3AL0C 4PINA 3WFJA 4ZTZB 1SB8A 1S2MA 1Z6AA 2XITA 4FCCA 3MLBA 4ZOBA 4E5DA 1L4FA 1Z7WA 5EI5A 3ZHOA 3DV0A 1FDIA 2QWXA 3KCQA 2EU8A 2YNMC 3QXSA 2H52A 2DERA 2NM0A 1QNLA 2ZRPA 2QVLA 3C0KA 4TS3A 5EERA 5JG7A 4CM3A 3IR5A 1L4HA 3A2MA 3OH8A 4JP2A 4CG1A 4C07A 2B3TA 2PKCA 2D0PB 3UIEA 1QFYA 3KEOA 1X8LA 1Y81A 3T12A 4ZO7A 1RM3A 4HGNA 3EA0A 1AOXA 1IMJA 2D0OB 2O5CA 3VPFA 1A5SB 1QHNA 1ISIA 3G2NA 4Q7EA 3L4BC 5CTJA 3QFSA 2RHRA 3JPWA 1JT9A 4C6TB 2A5DA 3RC8A 5TARA 4MS3B 1UZUA 3ZWBA 3OICA 4FHGA 5AM0A 4AZTA 3P71T 1YIOA 3KJEA 1MC4A 3W0LB 4KDRA 1XRPA 5HKBA 2NPOA 4GU5A 2ZWOA 2PG3A 3PNPA 3ZOKA 5M29A 1FP7A 4BX0A 2OAGA 3E8SA 1O6GA 2VYVD 3O74A 4AJPA 1ETHA 1BKYA 2V5VA 3G17A 4XIFA 1FU7A 4UMVA 4EG1A 2CW5A 4F84A 2VSOA 3H8VA 4O2BB 2HMWA 3BILA 3B7WA 5JY6A 2PCJA 3F8WA 2XB2A 4HFJA 3UKJA 3L1HA 3B1VA 4QXMA 1L6RA 1MO3A 2JPDA 2HIAA 1U9ZA 3L05A 3NWPA 2VUTA 2YWDA 2GN8A 1LQUA 3QLEA 3GEEA 2IYLD 1U0NA 5FOTA 1YFLA 3KALA 1J0XO 1AGYA 1PTKA 3N9IA 3EG5A 4FCVA 2YWEA 2FMXA 2ACWA 3VVMA 2BPOA 3MGGA 2AMVA 1T8SA 2ET6A 4ASUA 5CM2Z 3SC6A 3KSRA 1FYVA 4R9VA 2J6IA 2TMGA 2C5BA 3GY0A 5DLQC 3MMPA 3K9BA 1NX6A 3QEJA 3V7NA 5BMVF 4I1OA 4BXOA 5DGDA 4AJHA 5L6LB 2V6BA 5AIBA 4N6GA 4Z86A 1W5SA 4ARCA 2ECFA 2A57A 4F06A 2FSVA 4BNLA 4EI8A 4YRZA 1FZQA 1TTTA 3ACDA 2FF7A 1Q1AA 3D1LA 3O4HA 1J24A 2H57A 4AURA 5J3JA 5JY1A 1IEVA 1ZMRA 2PS1A 1THGA 1GNVA 2B2CA 2R11A 3JD4A 3P2YA 4NDAA 5F5LA 5BNFA 3SDBA 5KQMA 4QUHA 4KXQA 2LCQA 1P5JA 1VRCA 1Y1TA 1Y34E 4BAUA 1URPA 4RY2A 4MGHA 2IS2A 4GC9A 4L3OA 3O1JC 1CDDA 2EARA 1NN5A 1QF9A 3DKPA 1IZ7A 3PZRA 3QMPA 3WIEA 3UATA 2V5UA 4CKXA 4G2NA 5CDFA 4D02A 3JX9A 1T35A 4QOIA 5AI9A 3E84A 1KOFA 1TNDA 5EIFA 3U31A 1JG1A 2EP7A 3A4LA 4MVXA 1SEPA 2NPFA 4N41A 4S3MA 4JJ6A 3GIWA 4HEA6 2UZ1A 2FVXA 3SI7A 2IYTA 4KN8A 1R4AA 2JHAA 2HADA 4XUEA 2E4YA 1NVFA 1QYWA 2WTAA 3A1CA 3WQHA 5CDUA 5AKHA 4UUMA 1SKUA 1GZHB 2CJPA 2H7CA 1REQB 3I05A 5EKXA 2IC5A 1DXQA 4ERXA 3WYDA 2RDMA 3E8MA 3DNFA 3QEBZ 3WZLA 5IYZF 3FSJX 5I01A 2H07A 3JARA 3NUGA 4QLBA 3U3KA 2FE4A 4O4JA 3RJ9A 1KQFA 5AHXA 2I71A 4P3YA 2PD3A 1KOJA 3C6YA 4RTKA 2JHGA 1QHFA 2O1XA 3OO0A 4JBWA 1PEAA 1UK8A 2HV9A 1UH5A 3GZJA 1NXOA 2QL6A 3TPZA 2UZIR 1O0BA 1NQTA 1MJNA 3A2NA 3PL5A 2JG3A 1YXMA 2WWRA 4IM7A 4CCSA 3QVMA 4E4RA 1O87A 1TU3A 3ILVA 4HUTA 4K0RA 1P6QA 4ECAA 1T5LA 1XLVA 2CFIA 3K1AA 3TW8A 3NG1A 4MROA 2NSDA 4RE6A 4W1QA 2NX2A 3AHCA 2HK7A 3F7OA 3MEQA 4P9NA 2XRFA 1G9TA 4J1TA 1CZNA 5CMLA 3CGWA 1Y3CE 4RE5A 2F17A 1W85A 3HFGA 4TTPA 2H29A 4AMGA 3OT5A 1YZTA 2DKNA 2O8NA 1DQPA 2CJWA 2Z43A 3MUFA 3B6ZA 1M6EX 2VQ6A 2CV0A 1VM6A 5BWNA 5HCUA 1P5HA 4L6CA 1W96A 3K30A 4BQQA 6REQA 1BVUA 2P8JA 1RWMA 1VCHA 5IH3A 3ZHZA 4P5EA 1I3MA 2Y3IA 4TV9F 2EVWX 5AQEA 2BGUA 5KNBA 3P7MA 2R62A 3D2LA 1EDZA 2CDRA 4XASA 3T1OA 5L9AA 4JEHA 3COJA 1Z36A 1O96B 1RTKA 2IUUA 3DBHB 4L75A 1EFKA 1KK0A 2CUKA 1UBUS 2D5CA 1QAMA 2ZJ4A 1L4LA 1ZNXA 1W5EA 2A4KA 2OCAA 1BMTA 2G9ZA 2GASA 2QJWA 1ODIA 2XCIA 3MAJA 4EL5A 4G9GA 5FBWB 2J1LA 1F2VA 2HLDA 2G1JA 1YMUA 2AQHA 2W2TA 3IJ5A 3NBUA 3PWSA 5FBQB 1KJNA 1VL1A 2BH9A 3HP7A 2XNHA 1E2JA 2PA0A 5I4IA 3TOVA 2DYKA 5TMPA 4YAJA 4KRYA 2OGZA 5LQCA 1LNSA 4C7JA 4WZAA 3TRFA 1W59A 5B3JA 3RG2A 4EUSA 4R1LA 3UB4A 1NJFA 3P0HA 1QDLB 2FWBA 3ROZA 3V4PB 1JSCA 2JZCA 1DLIA 2NU6B 1M5RA 5KSZA 3L02A 3GLSA 4UPDA 1VJ1A 2YWGA 1G7RA 3EIEA 4M9QA 5LQDA 4BXOB 2VDPB 3V8PA 1IY9A 1Z82A 2WM2A 4LJAA 1Z4NA 3KT6A 1PYOA 1Z2CA 2BL4A 3Q3HA 2QR5A 2O2CA 3TR6A 1Y1QA 1G6HA 1ZGZA 4DA0A 3I2YX 2GN2A 1RR6A 1OF1A 3G8YA 3IUEA 2GZRA 4QQRA 4Y6LA 3CPSA 4Y2JA 4YREA 5LDDC 5KNDH 3GRYA 4HXYA 2ODNA 2OLKA 3KTDA 3P9ZA 4XEUA 4XSGA 2GPSA 5GM2A 1YJ5A 3AV3A 3ICOA 5BQ5A 4C0BA 4CR8A 4D7AA 1QHHA 1EPUA 5HK9A 3T7TA 2NAPA 2VLBA 4I1YA 4RXUA 2FAXA 1IBCA 4BO2A 5C81A 2J33A 3B20A 1UC4B 1G7CA 2PUTA 5G4KB 5JARA 4LOJA 4IOMA 2DH5A 1TLFA 1HLGA 2WYOA 1Y7PA 4WN9B 1ZYUA 4GPZA 2GT1A 4EATA 3N2EA 4GICA 5AK0A 5EE3A 3TGWA 5KU1A 3LZ6A 3ZY4A 1DQSA 4TPKA 3UWDA 1HT3A 1D4AA 3E05A 1D7AA 4B5KA 2A94A 4LI3X 4P4LA 1QR2A 2GPBA 3DEKA 2BFAA 3T4EA 4FHCA 3IAXA 2YV3A 4B47A 5IDXA 2IHVA 1KYXA 1C4WA 1KR2A 3GFFA 1JEJA 4OMDA 4QDJA 4C6TA 4O8CA 4PRLA 4U63A 4UCQA 4AS3A 1L0BA 5IVDA 1YZNA 3JQBA 4FQ8A 1KYZA 4UZEA 2Z1NA 2NO7A 3M6FA 1AUOA 5ICGA 5AUNB 4CUZA 2NVOA 4IDDA 1XYYA 3IILA 4LCJA 5AVRA 1Y4UA 5BQOA 5F5XA 3FSEA 2QN1A 2HQBA 3DE6X 3M6XA 5KNCD 4Q7KA 3AF5A 2JGDB 1QGUA 4U9IS 1T6BY 5JYEA 4FYPA 3TTSA 1YD7A 2EJVA 5LMCA 2EIXA 4FLMA 2D0IA 2RAFA 1YBMA 1ESMA 3L82B 4KO3S 4N5HX 2ZWPA 4Q82A 1LC3A 1R8YA 1RYDA 1GRNA 4FFWA 2GB4A 4IV5A 2CXUA 4X62B 1ZZEA 2H7XA 1FXSA 2ZYSA 1G7SA 4BQFA 4ENPA 2C9BA 3KNZA 4N49A 4WNIA 4RGQA 3AEKB 2EP8A 4NCBA 2NSJA 4RSRA 1PRYA 1XQYA 2MMCA 2YV1A 4HB3A 2N9UA 4JSRA 4LJKA 4NRDA 3S1LA 4CIYA 1B6TA 1T36A 1D6MA 2AR9A 2UYYA 3FTQA 2I4RA 4C3OB 1MPTA 2HKIA 4MIKA 2NLOA 5B3KA 3EHEA 1UZMA 2PWYA 1ZN8A 1IRIA 5LA6B 1I5EA 4G5SA 3WX0A 3JQDA 3ZZ1A 1GA1A 4DKJA 1SMKA 5L3SA 1TT5B 3BERA 3GMTA 4L7VA 2CEAA 5E95A 2VYQA 1JJVA 1XTQA 2P2LA 2Q6IA 4Z3OA 4NQZA 4LE2A 3LCUA 1R0XA 3BWMA 4QQ8A 5AKEA 1WSWA 1N2ZA 3NHUA 5T5QA 1P1HA 2EW1A 4S2UA 4BQSA 2BTEA 1FFGA 3GFQA 3DZFA 2HRRA 2YICA 1JHVA 4HQLA 1L7NA 4HS4A 4M8NE 4CHTA 4Q9HA 1OFUA 3LPDA 3LVRE 4D6XA 2D2VA 2QORA 2P62A 2NP6A 2KB0A 1WXGA 3LTEA 3PIDA 3TE7A 2IXEA 1VMIA 1ECPA 2PMBA 2VWGA 3BAZA 3O0TA 3KUCA 3K53A 1ZZGA 4QXPA 1U80A 1A0OA 2AHOA 3WKDA 1BOOA 2NGRA 3L7AA 2IEBA 5FB3A 2IIPA 3K9GA 1SUIA 2ZM5A 1H8EA 3OIGA 2Y1CA 3KWFA 4JASB 2VDMB 2BFFB 1FRVA 5FI3A 4C14A 3FCYA 3JD0A 4Z4CA 1ISPA 1IJEA 4KVZA 5FV4A 5IULC 1H1DA 1KO8A 4KYUA 4ER0A 1V4NA 1G1AA 1ORTA 3CM0A 3VZPA 3GEGA 1Z25A 4NJEB 1TJYA 2JJQA 3ZD8A 2QLNA 4PQEA 3BM5A 4AJKA 2Q3LA 4YCAA 2JASA 4KVFA 2V0CA 5FRDA 2V9PA 1HT1E 4BX2A 4K1XA 1LX6A 2AYYA 1GCIA 3AJ8A 2IWHA 1DTWA 1ZIXA 2BBOA 1H0RA 2XTAA 3D8UA 3ZV6A 1AM4D 5D01A 2R7LA 3ZV5A 1YHNA 5KYYA 5A1JA 1NVDA 1F38A 1IG0A 1PEDA 1EWTA 4IDPA 4IVRA 4DG8A 2VTBA 3CVVA 4D4LA 5E2IA 5DYTA 4KPFC 1Z2PX 2V8OA 1C30B 2HU8A 1GXSA 3HMKA 1EWQA 1PWXA 1XZJA 1SQ6A 2HJ9A 2Y2VA 1QRDA 3I9V1 1VMKA 1LLUA 5K05A 4XCQA 3A4TA 3DTYA 2YRWA 3K8ZA 3R6LA 3X1JA 1W47A 3TMAA 2GTPA 2OFOA 4V24A 4C08A 4O4LF 2A5LA 3RBVA 2BEVB 3EB9A 3M7IA 3EOZA 1MAHA 3CZPA 3RM3A 3WIUA 1RYFA 1Z5GA 3EEQA 4L02A 3ZWMA 2VK1A 2PX8A 3T0GA 1ZSVA 2A59A 1TK2A 1A50B 1KZGB 1ZS9A 1PNTA 2P2CA 3UJPA 3TPCA 1EQUA 4BB0A 2IIVA 5AI8A 1OQAA 3FZGA 2GK3A 4BKOA 3MUEA 4YDHB 1EYZA 1QZTA 1G9XA 3KZMA 2PXXA 1SXJA 3DG9A 4HB4A 3BMXA 1RJFA 2PX2A 4P5DA 3A6DA 4HKTA 3I0MA 1KHTA 3FKSA 3ONNA 3TQOA 4BX3A 4ER7A 1QRSA 3K9CA 2PLWA 3BD9A 3VR4A 3HEAA 3OP4A 4K9QA 4FE7A 3NNDA 2I3ZA 3D6MA 2QUKA 2ATXA 2PJDA 1E64A 2P4SA 4QIHA 4PHCA 3K0FA 4GPAA 3QIVA 1U3CA 4JK3A 4WUTA 2VCHA 2BGWA 4RD0A 4FMBB 4L0DA 5LQAA 3FNIA 1NBAA 2HNKA 4E6PA 1N7IA 4CL0A 1PFYA 1Q7EA 4PSUA 1M76A 3PNQA 4WLFA 2H1VA 4KO4S 2PGDA 3W2IA 4QBHA 3AWDA 2O8DA 3W5JA 2GVZC 3I64A 1GNSA 3BA1A 2IITA 5LIRA 3CFYA 1N36B 2FN7A 2PZLA 4WT7A 5EZYB 3USZA 4FYJA 2IS1A 1R6AA 3X1YA 4JP3A 2CY0A 3MFQA 1NUTA 1ZRSA 1K7SN 1WMBA 1M5TA 2EBFX 2GN6A 2IEIA 3H4VA 4H3SA 1FMFA 1ISJA 1TOAA 1LK5A 2IE0A 1B3BA 1G21E 4NJMA 4V03A 4ZVOA 3UGKA 4GI7A 3M6VA 1AXEA 1NYLA 3QTBA 1C9YA 1Q74A 3Q7PA 2WZCA 2OE2A 1IUOA 1TM1E 3F78A 3INRA 3L0SA 1XTTA 3NASA 5LC1A 1PL8A 2WAYA 4PONA 1W6UA 4FFNA 3SZMA 3FZNA 4UBOA 2AJTA 5H3CA 3OJ0A 1JILA 5L3VA 4L78A 1T8RA 3SQLA 4DCTA 4N5IX 4ZZ1A 1IY2A 1ULBA 5LXTB 5B1HA 3KYCB 2FN8A 5CHYA 1J70A 5ALIA 1X7YA 2IY9A 1I6KA 2VP3A 3UEOA 3W1WA 2LV8A 4OLFA 1ZGCA 1DMRA 3E61A 3PT5A 4M87A 4UULA 4HNTA 2WJYA 3TNYA 3THYA 2ZOSA 4DREA 1BCRB 4MWCA 2PUEA 3OOJA 1NVVQ 1ORVA 1GAJA 3G9QA 4G8CA 4OHCA 1TQ8A 5IAGA 2BN4A 5IPFA 3EDYA 4BFXA 2ODPA 1BE0A 2XTNA 3S2UA 3CX8A 3GGDA 4NEHB 2YZGA 1ISSA 4O0LA 2R79A 3RARA 1ZH4A 2E4ZA 2J3LA 3TZQA 5B7PA 1A04A 3AR5A 3CY6A 1E7RA 1TD1A 1XYGA 2PIDA 3IAS1 1BFDA 4ZREA 2RI0A 3IP8A 1HDXA 5AJXA 5IDVA 1HE1C 4X85A 2VJDA 1U8FO 3CWQA 3RS4A 1G42A 1HV8A 4PV7A 4BO1A 3I0ZA 2D3TA 2OHGA 1P60A 3C97A 5BV8A 1N9GA 4NC9A 3HN2A 1X6VA 4M0MA 4C4XA 1Y82A 2D5IA 1GT6A 3KB2A 3V8MA 4J07A 4PN3A 5B6PA 4ALJA 4N76A 3HEMA 2P1DA 1ADFA 3BICA 5LBUA 2XAAA 3KAJA 2VTKA 4EF5A 2I65A 1H4SA 2VSQA 3C8UA 5ILGA 4BMZA 4I4LA 3QK7A 2I66A 1A2KC 5BPHA 3E23A 4EJSA 5CCEA 3QLVA 2HRCA 3DBRB 4KTVE 3ZBPA 3EMKA 3BAFA 3H1AA 5ANRB 1H69A 3WTCA 4D9IA 1F0KA 1KZYC 4H7IA 4D41A 4DR3B 3I1FA 1ETUA 3FD8A 1KQ3A 4PZCA 4X3CA 2AFRA 1XNHA 4BP8A 1F12A 4GNRA 2RGYA 4O33A 1K4YA 1UOQA 5FH9A 1MJHA 3DW3X 4RHXA 1ZC3A 2FPSA 3DDHA 3PDIA 5TE9A 4BWYA 4CMIA 4U5XA 4MAMA 5EA2A 5ENZA 3U80A 3P2EA 2FNAA 5I7RA 1QO0A 4Y9SA 1YNSA 2PKEA 2WIFA 3CT6A 3B6KA 1OLXA 3P96A 1RYZA 2A9OA 4K26A 4NAVA 5JMOA 2VH1A 3E8XA 2VJQA 4L6IA 1E1NA 4ZXPA 3RAPR 1EGMB 3ZCSA 1NVAA 2RG1A 2G09A 1DZIA 3LOQA 3OE7A 2JGEA 2I2DA 3DFIA 2XMRA 2EF1A 3WB1A 2C3MA 3ZDBA 1EFPA 1JHUA 4L5AA 3KSUA 2MYUA 2FSHA 4R3UC 1JEOA 1JHRA 1YAJA 3URKA 5JEDA 1KQPA 1Q22A 5AKIA 2H59A 2KSQA 3HO8A 2WJJA 1AO0A 1DTSA 1M6NA 3LUDA 1DAOA 3HP1A 3C6ZA 1B6RA 1HF3A 2VXOA 4OJKA 4OI1A 2W2LA 4JDPA 4RA9B 5IWAB 3TQTA 1DJPA 4ZYLA 5C37A 4F5EA 4NAHA 2ZYTX 1CY6A 3UT0A 4BEVA 3NVDA 3J80A 1EVKA 3L07A 2NTEA 3HJAA 3DFZA 1W8DA 4YAOA 3THXA 1XTRA 2O2ZA 1X7XA 2R2AA 4XSVA 3WTBA 1X7WA 1LWNA 2WA2A 3CKLA 2ID8A 1V0JA 2KWIA 3OPYA 3E9NA 4R8VA 2F1OA 3FNFA 4HNQA 1ZN2A 1NN0A 1NJGA 2W4MA 3NYWA 3T3GA 3NXKA 1IVYA 3E7PA 1G20A 1R0BA 3PDWA 1WCIA 2ZCUA 1ZH0A 2I76A 2PRYA 4Y2GA 1IUNA 1GQSA 4GWKA 4YJDA 3SSAA 1DEAA 5HKAA 2I7XA 2VJAA 4JI5B 4IFBA 3CVWA 4DV2B 2QN8A 4J0KA 1N78A 3LBIA 2FCRA 3KQQA 1L5ZA 5C51B 1DE0A 3F6PA 5AHRA 6ADHA 1M7HA 2ZR7A 2XPCA 1X1RA 4WA7A 1AMNA 2F8TA 2EDCA 1S3FA 2PVPA 3SF0A 1K6EA 1PSDA 1YDWA 4DSTA 4C2TA 1QTNA 1EK2A 2FTKE 2FW1A 4R1MA 4U2BA 2H3EA 3I92A 4NBKA 1L5GB 3VNAA 5CB8A 4RVFA 2OAQ1 4MQ6A 3EODA 3HH8A 3HKCB 2C5EA 4BN0A 1DKMA 2WJHA 4YCSA 1J9EA 4KXWA 2QE7D 2J46A 1ZHFA 2PL5A 3LT5A 4IKOA 4PRKA 1O6CA 5JATA 2Y0CA 4GSLA 3FCXA 4ZYVA 5C52B 1WDTA 2VA8A 3FY4A 2QSUA 3PC4A 2PMDA 5BSUA 4JLKA 3F1KA 3WADA 3UKDA 2Q4BA 4RFSA 3UQZA 3W4JA 3GUYA 1A4RA 1EE2A 1Z62A 2FPKA 4PLFA 1KSGA 2Y68A 4OK5A 4AJIA 1K6MA 1PR2A 4WZBA 1LWOA 4YK7A 4BB9A 3CSDA 3G5UA 1AN0A 1CJMA 4DNPA 4W7IA 4ZHQA 3Q3EA 1JEAA 1SHTX 3HWRA 3LPAA 4J1NA 4MV1A 4NBNA 4OQNA 4G56A 3ZGVA 4Y98A 1JXAA 2Q4DA 1Q3HA 3ICPA 4UHBA 1TIKA 1R0KA 1VRVA 2Q8QA 4NV0A 2GPJA 1XNQB 1F4VA 1PBNA 1YULA 1FW8A 3IP5A 4NQRA 5GVRA 3WMFA 4EABA 2XUIA 5A62A 1ZIPA 3GLFE 2EZ4A 1RIFA 2VAVA 2YJ6A 3COPA 4Q9JA 4AIIA 1T5HX 5JWHA 4I4IA 2HT6A 4V0ME 4H6WA 3ZY6A 1R4MA 3IEMA 5CXXA 1G64A 1MLDA 4W5NA 1BS1A 1L4KA 4Q7MB 1ZICA 4FPXA 3LUCA 2JH3A 1LPBB 1Y3FE 1WXFA 3MBKA 2X6QA 2IEYA 4X24A 2C9YA 4H3KB 3SHWA 3CLHA 1TQ6A 4YRCA 2H48A 3D2CA 3P4YA 3GAMA 5LP6B 3NDIA 4PX3A 4KXLA 1LBQA 3GRFA 2GEVA 5A2GA 5JD3A 2IODA 5IS2A 2GRAA 4LZOA 4M22A 4JYAB 4B6EA 5KNDD 2HT1A 4RZXA 4B6GA 4Y2VA 5HOEA 1EK5A 4CKBB 1EVJA 3UCXA 3W6OA 3QKRB 3NWOA 5J23A 1IHPA 3RASA 4NJOA 3KPJA 3U4MA 1MVLA 1ODFA 4E2YA 1C8BA 4G5FA 3ZU2A 1ZNYA 4KWIA 1PX2A 3FPAA 3UPDA 4MQ4A 5DX0A 1Q50A 3NU1A 1J06A 4KN9S 3SJAA 3TQHA 4KVAA 5FWXB 3ZLJA 4CE6A 4MCIA 2J4CA 1V9LA 4FNOA 2CFRA 3TBFA 1WUKS 2XWSA 2ZE5A 3HCOA 4KUGA 1JB9A 2BGTA 2QYOA 3FWPA 3LM8A 4JOSA 2XA9A 4RSGA 1A9OA 3KVVA 4EQ6B 1EEXB 5BYAA 4UC0A 2FZCA 1E8MA 3B6IA 5TPWB 1SHJA 2WW8A 4FHEA 5AW2A 1GSHA 1D0SA 1Z3CA 3M1IA 4X6YA 4KO8A 5EWJA 3FPSA 4KR9A 2OLJA 1MPXA 4AX4A 4E51A 1P3Y1 4XEHA 4UJ3A 3IEPA 1G6OA 4QQKA 3T5CA 3KFXA 1GPDG 1V11B 3TJRA 3FLAA 2NN3C 2OT3B 2QIOA 3FKQA 4MVJF 1MC8A 1KYVA 3CLTC 3G2PA 3Q0TA 1OLUA 1CQPA 2ZROA 3QVGB 4IXWA 2FUG1 1VJCA 2YW9A 1K97A 1LRKA 2LIVA 2MSDB 2YY5A 4FSHA 2VHVA 4QAQA 3SHFA 1Q7RA 3NOQA 2COEA 4X94A 1OZFA 3O4RA 4KI0A 3SFTA 1GEEA 4GGPA 4RVSA 4CHGA 2R8BA 1YQUA