1DWPA

Crystal structure of hydroxynitrile lyase from manihot esculenta at 2.2 angstrom resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Hydroxynitrile Lyase from Manihot Esculenta in Complex with Substrates Acetone and Chloroacetone: Implications for the Mechanism of Cyanogenesis
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Hydroxynitrile lyase
molecule keywords HYDROXYNITRILE LYASE
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dwpA00
4C88A 4BRZA 2IX9A 1G4HA 3I2GA 3EIOA 1Q0ZA 2WILA 1HDEA 1BCRA 3HC7A 1J07A 4WDQA 4FNGA 3WKDA 4HVTA 1VXOA 3HEAA 2OQIA 2XQKA 2QTBA 3O0DA 1H23A 4ETWA 2ACEA 1QIMA 2Y6UA 4Z49A 3O4GA 2X76A 4UHDA 2Z8XA 4KAJA 1JT2A 4ZXFA 2J3DA 4IH4A 1EVQA 4X6YA 4QA9A 3VJLA 4XJVA 3IUNA 2B4KA 1BROA 1XZFA 1O6FA 5EHNA 4ITVA 4PF1A 1MJ5A 4Y9SA 1ORWA 1I6WA 1EB8A 5LZ8A 3GUUA 3FSGA 4CG3A 3AINA 3DNMA 5AHXA 4N8DA 4EY8A 3WJ1A 1VOTA 4DSAA 5LIPA 2XUOA 2VJDA 3LS2A 2ZSHA 2JF0A 1EDEA 5D3ZA 5ISMA 1UOPA 2BJHA 3QH4A 1AX9A 1KU6A 2XUIA 5CH5A 1OCEA 2PSFA 4AMZA 1QIHA 4BVJA 2PL5A 2WG1A 2OQVA 4HXEB 3O95A 1LLFA 3I6YA 2OCIA 4UBOA 4LXIA 4BC0A 4FFWA 3T4UA 5AK5A 1ZIYA 2I3ZA 3UUFA 2VJCA 3TEJA 1CUZA 3FLBA 4INZA 1H2XA 3ICWA 2HA6A 1CLEA 4X94A 4DYHA 2ZYIA 3V1KA 4AO6A 4G4GA 4Q3OA 3H04A 5FV4A 5HF5A 4FFVA 5K3CA 4C87A 2GZSA 2JEZA 5A7HA 4EY5A 2FX5A 3ZV7A 1G5FA 3WK7A 2QM0A 1UWCA 4DMHA 4MQLA 2QZPA 4XIIA 1A8SA 4I4CA 3FYTA 1LPOA 3NUZA 2UZ0A 5AKKA 1W75A 4A23A 3WI7A 3DDUA 1CRLA 4Y7DA 4BTLA 5FUMA 4CCWA 1BEEA 4B84A 2FUKA 1Q84A 3STVA 2GYUA 4ZWNA 3WWDA 3HI4A 2HA2A 3IDAA 3ZLUA 1VE6A 3BDIA 4OD0A 4F60A 3C6YA 2WHQA 4WY8A 2RHWA 4L3WA 5BWCA 1ETHA 5C8ZA 3G8YA 1R4ZA 4OB6A 5EGNA 1XRNA 2BUCA 3BJMA 1IZ8A 3STXA 4BCDA 2VEOA 2Y6VA 3I6MA 2XQJA 2HM7A 3DOHA 2W22A 3QMVA 1DX6A 3BIWA 1H2WA 1CUVA 2CJPA 2Z3WA 2WU4A 1YB7A 5HKBA 1ZD5A 3EF3A 4DTCA 1JU4A 3VKFA 1MNAA 3U1TA 3WL7A 2ZJ6A 2E3JA 1DT3A 3M82A 4BP9A 6YASA 4UBNA 1WOMA 2ZYHA 5ALRA 1DWOA 5HK8A 3C6XA 4OB7A 1LZLA 5A6VA 5CT8A 3FVTA 1GKKA 4P08A 3MGAA 4CI9A 1SCQA 1XRQA 5CXXA 5CBKA 5HFNA 2QKYA 5H3HA 5ESRA 3R3VA 5E4YA 4H0CA 3ED1A 1UK9A 1RWQA 2CUTA 2ZYSA 3C8DA 1CQWA 5AKEA 2O7RA 2R11A 1EVEA 2CBGA 3QPAA 3OTQA 5FP0A 4BDTA 4IHAA 4Q34A 1ZD4A 2XLBA 4W63A 4JYPA 3WMRA 2PU7A 3FNBA 1XLVA 1QIDA 5D3KA 1MAHA 4HTAA 3VJMA 2XE4A 3F9CA 3I2KA 1QO9A 3BDVA 1MU0A 3STTA 5HQ3B 1MX5A 1S8OA 1YAHA 3I1YA 4H35A 3KOOA 4EZIA 2H7XA 1HKHA 1SOMA 3DKRA 2WIGA 2HA7A 3AZPA 4EA6A 3K2IA 1DX4A 3WA6A 4ZV7A 1N5MA 4O08A 2HA4A 1M33A 2JEYA 4DMCA 2GBCA 4XX1A 3WKBA 2ZYRA 1QIKA 1F0PA 4U2BA 1XZDA 2I78A 4PSCA 3N0TA 1ORVA 1IUNA 1GT6A 5IVHA 2DFPA 1CUCA 2EDAA 4H77A 1G42A 2VQ6A 4K6GA 1QIJA 4PW0A 3AIOA 1CVLA 4HRYA 1GQSA 5DTIA 3O4JA 1BRTA 5FXMA 5ALHA 4Y2SA 1DQZA 4QE3A 5EHQA 1D07A 1NU6A 5JIBA 4B9EA 3LIIA 2WIJA 1QE3A 4J0CA 2HADA 3VJKA 1L7AA 3DL4A 3C6ZA 1XRRA 4MEBA 1XFDA 2XUKA 1F8UA 2R8BA 4U2CA 1F6WA 2VF2A 4FLEA 3HZOA 1VKHA 2HA3A 1ZGBA 3QYJA 4J0KA 3H2HA 3MUNA 3QPDA 2WFLB 2PPLA 4DMFA 4HXFB 2VAVA 4QLOA 3C5WP 3UMJA 4QEKA 4UBIA 3TJMA 4C89A 3DKKA 3I28A 2OPHA 4DM7A 4RPCA 2OAEA 3V48A 2PSJA 4X85A 4M0EA 5A71A 3G0IA 4C4ZA 2CB9A 5FOQA 1WPXA 4BDSA 4UUQA 3FYUA 5EHZA 5CT6A 3A6ZA 1E8DA 4X97A 1LBSA 4KYVA 5JAPA 3QMWA 2C7BA 3AUKA 1P0PA 3H1AA 3EQ7A 4FLFA 4YASA 2IITA 2CZQA 3IBTA 2V96A 2XB6A 3BIXA 5HZGA 4UFPA 2H7YA 1QIGA 4B0OA 4BRSA 3BF8A 1UK7A 2ZSIA 3HLKA 2GBIA 1UKCA 1VZ3A 1HL7A 5JANA 3ICVA 2J3QA 2VSQA 4A5SA 1W52X 5KREA 2PSDA 4E11A 1K4YA 2FJ0A 4B7ZA 2WUEA 4N5HX 1UOQA 4LXHA 1YB6A 2XMSA 3DL7A 3AIKA 2WFMA 2HU8A 3C70A 3C43A 3R3YA 1WPRA 3I2JA 1ZD3A 1HPLA 5JAOA 1PFQA 4M0MA 4B82A 2O2IA 4HRXA 4FNMA 2WJ6A 2OGZA 2HDWA 1QTRA 4WFIA 5I8PA 2ES4A 4UBMA 1YSCA 3H18A 4J0IA 1NU8A 1LPNA 2PVSA 3R0VA 1J2EA 4B83A 1AMNA 4HAIA 3DLTA 5DYYA 1XRLA 3F8SA 1GKLA 4DGQA 2D5LA 2WUFA 4L0CA 4UHEA 7YASA 2C4HA 3M3DA 3V9AA 2HFJA 3WL8A 3D4LA 4H7IA 4OU5A 2DQYA 2HU7A 3IIIA 2VT6A 2AJ8A 4C4YA 3WWCA 3CCCA 5JATA 1FFAA 5DNVA 2NW6A 1OILA 3QMMA 4GXNA 2XQIA 2DHEA 4MEAA 2ROQA 3D7RA 4PSUA 2AJLI 3D2AA 1XZEA 4PO3X 4E14A 4B80A 1IUPA 1P0QA 2PUHA 1XROA 3ESBA 5EFZA 4CCYA 2CEKA 5AIAA 1JKMA 4LYDA 5FLKA 2G5PA 5HKAA 2WM2A 1XZKA 3GROA 5AKXA 5AM4A 1VA5A 1EK2A 2V98A 2PM8A 2WJ3A 3H17A 4ZRDA 4C6HA 3QVMA 2JGIA 3C8HA 5AI5A 2Q0XA 1DU4A 1LNSA 5A62A 1CUXA 3E1GA 3HSSA 4OSEA 1A7UA 4FHZA 1RYYA 1UXOA 4QNNA 1CUBA 4QWMA 4D9JA 1T4MA 5K3EA 3G9ZA 2GBGA 2OGSA 1H2ZA 4UHHA 4AX4A 2JGJA 3ZLVA 4G8BA 3WK6A 2WTMA 2XLCA 1EHYA 1QGED 4Y2VA 3WL6A 3MUOA 4X91A 5LLSA 5CURA 3L1IA 1GGVA 3WJ2A 4GI1A 3IURA 1Q83A 4MQMA 3LP5A 4X7BA 1N1MA 5K3DA 2V97A 3IULA 4U2GA 4LIPD 4EHBA 4F5ZA 5JZBA 1ODCA 4G9EA 4EY4A 4Y2TA 4C4XA 3BE8A 4QZVA 4A16A 5AOAA 4CIBA 2XUFA 2HU5A 4TPKA 1TCCA 1MNQA 2WUGA 4KE9A 3C5VA 1JMYA 5AI4A 1BU8A 5J3JA 3PUIA 1EDDA 4E46A 2HA5A 1C4XA 5KWJA 1VXRA 1L7QA 2WQZA 4P93A 3STUA 3DEAA 4H7FA 4L72A 3H2JA 3OPMA 1CPYA 2I03A 2CKMA 5T4EA 1K8QA 1FSSA 5AKHA 1LPAB 1XKLA 4FWBA 4EBBA 1QONA 2AJDA 1XQWA 3HJUA 1HQDA 1ACLA 5AKZA 4OCZA 2RI6A 1H2YA 3NOXA 2QRUA 2XUJA 3FYUB 1XZIA 3AJAA 3AZOA 3WWOA 2PUJA 4BTVA 3PFCA 3ZPXA 5I7UA 3FCXA 2VJBA 2OCKA 5CRIA 2JGKA 1CUSA 1CQZA 4EY7A 5C7YA 5AI8A 3NGMA 1SCIA 3B5EA 4X3CA 1ACJA 1R3DA 2QJWA 4NZZA 1RP1A 3G0BA 2Z3ZA 4G9GA 5FPPA 1WB6A 1U2EA 1Z68A 3JW8A 5BWBA 1LGYA 2XDWA 4JYMA 2OLEA 4DMKA 1N5RA 5ALIA 3WYDA 2DSNA 2AXEA 4FDMA 3WLAA 5HFAA 5JZSA 2XMGA 5DNWA 2BGNA 3SWWA 2PSHA 3A2LA 4Y2JA 5IVKA 3VISA 4AZ3A 1Q0RA 3S2ZA 1J1IA 1LZKA 3H19A 1AUOA 3VXKA 1XLUA 3F67A 1CUUA 4WFJA 3PF8A 4H7EA 3R3ZA 4BZWA 1LPBB 1VJ5A 3BWXA 2PBLA 3G9UA 4DNOA 5AM2A 1EH5A 4ARBA 4BE9A 1AGYA 3AZQA 4AZ0A 4ZREA 2VAXA 4XWGA 5T4BA 1E3QA 3B3QA 4I3FA 5KWIA 3LLCA 3STWA 1CUYA 3SK0A 1LPPA 4DLNA 4BCBA 4QDXA 1HLGA 4IH9A 5AKLA 2DQZA 4Q3KA 3K6KA 4IQ4A 5IH7A 5EIHA 4ZV9A 5C8XA 1SC9A 4WCVA 4Y2RA 2VT7A 4LHEA 4AN0A 4FOLA 1NX9A 3O4IA 1CUIA 5SYNA 1IVYA 1K6EA 5A7FA 3SC2A 3A70A 1JJBA 2VATA 4P92A 1UFOA 1CR6A 1XQXA 2PX6A 1FFEA 2WG2A 4BVKA 5JAUA 3D0KA 4JEIA 5JADA 1UT6A 4Q1VA 3TGLA 1ZJ4A 4J0JA 1QFMA 2QXTA 3O4HA 4H7HA 1C7JA 1ZJ5A 1XZLA 3ZI7A 3DJYA 2BKLA 1Y37A 5DNUA 5CH8A 4XVCA 2BFNA 4AB1A 4AO8A 4CG2A 1KEZA 3VVLA 4BP8A 4K6HA 1AKNA 5JARA 3WK4A 4KJXA 3K9BA 1LPSA 1H22A 5T4FA 3RLIA 2OGTA 3LIPA 4LYEA 4J3JA 4F0JA 5ALKA 3BJRA 3PI6A 5HK9A 3QPCA 2JGMA 1TIBA 4X92A 1QLWA 2PU5A 3CN9A 3WIBA 1QJ4A 1YS2X 4KRYA 3CXUA 1CIJA 1A88A 2WTNA 5AKYA 5LKRA 5AK4A 5CH3A 4OUKX 1TAHA 2EEPA 4GHWA 5DJ5A 4PQEA 2WFZA 3BXPA 1C7IA 3GA7A 4ZGBA 5I9IA 4QDUA 4W1PA 2WIKA 2QR5A 2HRQA 3FAKA 4YPVA 1JFRA 2Z5GA 5K3FA 3W04A 4KE7A 1GXSA 5YASA 5AI9A 3KSRA 5DYWA 2XUHA 1JU3A 5SYMA 5DYTA 3WL5A 5FDFA 3U0VA 4DNPA 5JZ9A 2HA0A 3O9VA 3FBWA 2DHDA 2WSLA 3GBSA 3ANTA 1Y7IA 3FLEA 2OXEA 1ZI6A 3R41A 4JH0A 1U4NA 2QUAA 4Y2QA 5ALSA 1EB9A 4J0HA 3W06A 1R9MA 4NMWA 3GFFA 4EUSA 2Y1KA 2YH2A 3OG9A 3PFBA 3IUJA 4WY5A 3WYNA 4B6GA 2VA9A 1X2EA 4C01A 1XZGA 2C58A 3OM8A 3IVMA 4JUIA 5EHXA 1GPLA 2YXPX 3ZWQA 3FCYA 3RARA 1R1DA 3HABA 1X2BA 3CN7A 5ALXA 1AC5A 3ESAA 3PICA 5AM3A 3FOBA 5ALUA 4X71A 1W4LA 5CT5A 4BATA 1BE0A 5LZ5A 4FMPA 4KRXA 4FTWA 3AFIA 2Z8ZA 4IO0A 2ECFA 3WKEA 4QLAA 4UHBA 5CTAA 4X95A 1DWQA 4YK7A 5JAHA 2HL6A 2DR0A 1XZHA 2ZVDA 3PDCA 4GLBA 1GPKA 2G5TA 5CW2A 2BCEA 2WU3A 3N2ZB 2BUBA 4X6XA 4H7KA 4GWLA 3KWFA 2WLSA 5IVDA 1XRMA 1XZBA 3PF9A 5E2IA 1WHSA 4S0XA 2XUQA 4CCYB 1P0IA 3HRHA 4PSDA 3R3UA 4RE5A 1ODSA 4N5IX 1VE7A 2XQGA 4EB0A 2V9ZA 2HFKA 4OB8A 1UKBA 4GECA 4AO7A 5AK3A 5HCUA 1LPMA 3NWOA 2XMQA 3V1LA 5E4JA 2QVBA 4BYMA 4GDMA 5HF8A 4WDRA 1CV2A 2BGRA 1MX1A 3BL8A 3I2IA 2JGFA 4RGYA 1CUDA 2B61A 4KAFA 3QM1A 4Y2UA 2WIFA 2H7CA 1ISPA 5EIEA 5T4HA 5C81A 4HS9A 3G0GA 5AP9A 3WZMA 3TRDA 3E0XA 3DYIA 4X90A 4LXGA 4AXBA 3RM3A 1B6GA 5ALFA 3WIOA 1PV1A 4DNQA 2JGLA 5CXUA 1JJFA 5BV7A 4B85A 1WHTA 2W6CX 3KD2A 3H0CA 1MT3A 1MN6A 3FVRA 2FJPA 1TCBA 4U2EA 2ZJ7A 5A2GA 2X8BA 3HYSA 4Q82A 4WJLA 1DINA 1QZ3A 3WQHA 4LKOA 5ALLA 5KBYA 4AQDA 5DWDA 3VVMA 4J03A 1MX9A 1IUOA 3HACA 4CG1A 1UK8A 2EDCA 2YYSA 5EIAA 1ZGCA 4RNCA 4Q3LA 3R3WA 3DYVA 1YA4A 2C5FA 1BCSA 3AIMA 3DS8A 3WK5A 4GW3A 4DSZA 3F97A 4DNFA 1W1IA 2XQFA 4CIAA 2P8SA 1FFBA 5ALTA 1QIEA 2XMBA 2JGEA 3FLAA 4G4JA 5ALQA 1BN6A 1XZCA 2C0QA 4FLMA 3V1MA 3FWHA 2JIDA 4J7AA 1AQLA 2PKYX 3JWEA 2AJBA 4MJ3A 1CUGA 1TK3A 5ALVA 1MPXA 4HZGA 5FKJA 5K3BA 2XUPA 4X00A 2H9YA 4ROTA 2QMQA 1Y7HA 2BUAA 3ANSA 5HQ3A 2HHAA 2WJ4A 3C87A 4H7JA 4KR0A 5AKIA 1BS9A 3A2NA 2RAUA 5ALMA 4B9AA 2O7VA 1TQHA 3WKAA 3X3HA 3P2MA 1DWPA 4WFKA 1USWA 3G0CA 1YA8A 5IKXA 4BC1A 3F96A 4OPMA 1IZ7A 1ZIXA 4J0GA 3MVEA 4MWTA 1EI9A 3ESDA 1GPNA 2D0DA 3C6BA 2B9VA 2QUBA 1WCYA 4KACA 2O2GA 2WHRA 3L1HA 3GZJA 3FSGD 1E89A 2H1IA 1E8MA 3OC0A 3KWJA 4JNCA 1UZAA 4RE6A 3DOIA 5DLPA 1XZMA 1EDBA 2VJAA 4BVLA 3JYHA 1CUHA 2RGUA 2XMZA 1E66A 4J0DA 4X93A 4W1RA 4B81A 4KE6A 5LZ4A 4V2IA 2WKWA 4BB0A 3G9TA 1QO7A 4NS4A 3W2TA 1PJAA 1QTIA 4QDZA 1XQVA 4HXGA 4QDOA 3IUMA 1YS1X 1W6RA 4FBMA 1MO2A 5AM5A 4B0PA 1ZI8A 1QIIA 1P0MA 1WB5A 2C0PA 3G02A 3M83A 3SX4A 1LBTA 3PE6A 4H7DA 1KU0A 5F4ZA 2YASA 2QOEA 4NVRA 1J06A 1WB4A 4G8DA 3RKSA 3WWEA 1ZOIA 1ODTC 3G7NA 1SFRA 3E3AA 5JD6A 2BAGA 1EINA 1FJ2A 1JJIA 4AN1A 2RIPA 1EX9A 3QBJA 1G66A 1F0NA 1A8UA 4Q05A 3V1NA 1XZAA 5JYCA 3DCNA 3O9MA 4H18A 4BAZA 5ALDA 1TKRA 1YR2A 4GBGA 4FKBA 5ALOA 3H2IA 2Y2VA 4U2DA 1QFSA 4N8EA 4F21A 4W1QA 2XMRA 5ALGA 3D3NA 5JD4A 2G4LA 5ALPA 5C8VA 1XZJA 4PV7A 4ZI5A 1U65A 3W9UA 2WG0A 4W9RA 3STYA 5IVIA 2AJCA 3I1IA 4KE8A 2OCGA 2WIDA 1XKTA 5D6OA 3WKCA 5LZ9A 4UBKA 2Y2UA 4QWWA 5EI5A 1A8QA 5K5EA 1XQYA 3PUHA 5ALWA 1R9NA 3EQ8A 3IA2A 3D2CA 4Y2YA 5LZ7A 2OCLA 4TGLA 3WZLA 1OXMA 3UUEA 5ALZA 1BN7A 3CCBA 2GYVA 3D2BA 1X70A 1E8NA 5K3FB 1QOZA 3R40A 1JMKC 5AOCA 2GYWA 3WWPA 4K6KA 5JALA 4UHCA 4CFSA 5AK6A 2QS9A 3Q8WA 1AZWA 1TCAA 3QITA 5AKJA 1DT5A 5HF9A 5LKAA 4UFNA 4P9NA 1W76A 2ACKA 4G4IA 5CT9A 5AIBA 4BBZA 2IIVA 4YX9A 1CFJA 2OG1A 4FBLA 1CUJA 2HRRA 4BZZA 5ALEA 1FFDA 2CMFA 5AICA 3R3XA 1EA5A 1BEZA 1YASA 4X6UA 5AM1A 2GBFA 2K2QB 3EBLA 3Q0TA 1CUAA 2XMDA 5AO9A 5AH0A 4OU4A 1DQYA 3G0DA 4KAAA 1CEXA 5JASA 2WFLA 1VA4A 2O2HA 3W05A 3W9BA 1THTA 2GZRA 2ORYA 3A2MA 3L1JA 3G9XA 1MAAA 2ZJFA 1THGA 4OYLA 1YAJA 2OAGA 3YASA 1IMJA 1EK1A 2G63A 2RONA 4I19A 3E4DA 1L7RA 2DCMA 3ESCA 3IUQA 3OURA 2PSEA 3H1BA 2XUAA 2B20A 4E15A 3OOSA 3H2KA 2DHCA 2X5XA 1K5PA 1FFCA 4QDTA 2C5GA 5CMLA 1GQRA 3I2HA 4DIUA 2QXUA 4U2FA 4PNZA 1UKAA 3ZLTA 1CUEA 2LIPA 2I3DA 1GZ7A 1E5TA 1B41A 2WUDA 4UBLA 3WK8A 4UFOA 2XT0A 5CT4A 4G5XA 3VDXA 1MTZA 2WHPB 3AILA 3WA7A 5ALYA 3GELA 2JBWA 5FRDA 1VZ2A 1JI3A 4UHFA 3I2FA 4MXDA 4BAUA 5E4TA 4L9AA 4UBJA 4ARAA 5LP1A 3LCRA 1CUFA 5AI0A 4TVKA 1K63A 1SCKA 2WHPA 4BAGA 4Y2PA 4MYDA 5BOVA 3QZUA 4M0FA 5AKGA 4AMYA 5LZ2A 2VTVA 4MWSA 1TRHA 1ZD2P 5A7GA 5LYYA 3F98A 5HF6A 4W1SA 5AI6A 5AM0A 3EQ9A 3ILSA 5FPQA 2XMCA 3DD5A 1UK6A 1R50A 3I6ZA 3S8YA 3M81A 4G1FA 5D7BA 3C45A 1N8SA 2XUDA 3IB3A 1U8EA 4EY6A 4BCCA 5AOBA 4K5QA 1QIFA 2HIHA 1HBJA 3FYUC 5ALNA 1R88A 3WK9A 1YCDA 2J4CA 2QT9A 2ONCA 1O6GA 5DTJA 5JD5A 1EXWA 3B12A 2J4FA 3T52A 2XUGA 3D59A 1CUWA 2QJRA 3KDAA 3BF7A 1T2NA 2XI4A 4OYYA 3D5EA 4Y2XA 4G8CA 5K3AA 3RK4A 1XRPA 1VLQA 4MYSA 4UPDA 5ALJA 4GEGA 5AJHA 1DTEA 1XLWA 2RHTA 3KXPA 3H2GA 4IH1A 3HXKA 4K2AA 1WM1A 1ZICA 3DQZA 1UOOA 1AURA 1ZI9A 4N8SA 4KEAA 4BE4A
chains in the Genus database with same CATH superfamily
5A4AA 2G6TA 3BXFA 3PIIA 1FQOA 3UB3A 5AFSA 1XMOB 4BRZA 2BCGY 1I3OA 1PR2A 3N74A 4FGLA 2IX9A 4QVIA 1DXYA 4PM4A 4ARSA 1YS7A 2POCA 2DJ5A 1G6HA 1HDEA 1AUXA 3AEUA 4PC2A 3OMXA 5GGYA 1J07A 2VA8A 1Y4AE 3I0NA 4WDQA 1WRBA 2EL9A 1P61B 5K0EA 2WV7A 2BI7A 1WDMA 3WKDA 3KQMA 2VNJA 4I0WB 3AHJA 1UMBA 2GK7A 1QSGA 2MR5A 4H3KB 3JQAB 5CCBA 4FFBA 3TINA 1H94A 3UMBA 3UAWA 1FQKA 2GCOB 3BHMA 3D9QX 2HK8A 4C4OA 4CJXA 5KYWA 1O97C 1I3LA 2QVZX 4WV3A 5F7ZA 4ZTBA 3P26A 4RF3A 3PXDA 4ETWA 5JXJA 2Y1CA 4HAVA 4GZ3A 4B3IA 4OX9B 1R4NB 2H00A 3PA6A 3GJ6A 2CN1A 2P9BA 1EMDA 4KOEC 3HBFA 2OESA 3U5TA 2D0PB 2Y6UA 1HRDA 4JQOA 1V4BA 4Z49A 5I3CA 3B9QA 2ZSFA 4FI3F 4K87A 4Q12A 3TZHA 1N9ZA 3AU9A 1KC3A 3GAZA 5C34B 2J48A 1V5EA 2VNIA 2XY4A 4OFZA 2ZSJA 4QTYA 2YYZA 2XNJA 3WGMA 4B09A 2EFGA 5FL3A 5IULC 5TC4A 4LE1A 3WTBA 4YMLA 1GUZA 1MEJA 2J3DA 3BMCA 1YZQA 4HQ0A 2XE7A 3GJ7A 3I9V6 1IHOA 4LBWA 4G8JA 1C7EA 3IT0A 3DLCA 5EJ8A 5B7GA 5TQJA 1FBTA 3IO5A 1M3SA 3OC6A 4XJVA 1ZL0A 5IMSA 1SKYE 1BROA 1N5KA 1VCMA 3EDRA 3CRQA 3MILA 2J0EA 2HJHA 3RVPA 3UOGA 4PF1A 1QVZA 2EZTA 1Y0BA 4Y9SA 5DHAA 2VPPA 3LWDA 2FPGB 3K8OE 5E6SA 2DWQA 5DRTA 3NW9A 3ORFA 3QE0A 4US0R 5LZ8A 3GRUA 2DBYA 3KJQA 4Q4HA 5IVPA 4RESA 3I09A 4GU5A 2BGUA 4CG3A 4CKWA 4CE6A 3D8BA 3EIQA 4Q7LA 2NU8A 2QN1A 3QVSA 2APJA 3HG7A 3S27A 1TEZA 5A9SB 2FCAA 2R6AA 4X8OA 3CVUA 1GUFA 5ETJA 1J56A 2PKRA 2QLNA 4RAQA 4EY8A 3HXMA 2GVZC 2ZULA 2QVCA 3H9UA 4BVHA 3MYYA 1W2WB 4B40A 3IKLA 1NYLA 2EQAA 3F7TA 4BNYA 1N5JA 1TFUA 4NPCA 2FWRA 1RJGA 3C85A 5J4YA 2Q5HA 2FRDA 4DLLA 8ADHA 2XUOA 1QNFA 2VJDA 3KKEA 4RA6A 4I1SA 2ZSHA 3FVVA 2NU9B 2BGWA 2CFRA 3OP4A 1S9DA 1RWVA 4O33A 4RJ2A 3GQBA 1UOPA 2BJHA 1O97D 2QTVA 4N7JA 5ISMA 1O0BA 2XUIA 2L69A 1JIVA 1OCEA 2X0RA 1RWBA 1WLYA 3B89A 3QF4A 4BU1A 2FW8A 2X3FA 3VC7A 3HGMA 1GXSB 1VMEA 4YRCA 4Z8XA 3RASA 2G08A 1Z5PA 3H9CA 2V1UA 4AMZA 1XTTA 2QP9X 4U2KA 5CIWA 5FTWA 2RI0A 3AFHA 3PC8A 2OQVA 4HXEB 4ODIA 4B73A 3II6X 1TYDE 5ARDA 3H9GA 3E9NA 4PTLA 1PJSA 3KKLA 3P71T 4HEA6 3V1TC 3ZCVA 3L5OA 2OCIA 4PZCA 4UBOA 5SY6A 4I1PA 3W6NA 4YT2A 4UTPA 4CMAA 2DERA 2E48A 1L4UA 3H65A 2DFTA 2PQ6A 4ZEWA 2OWDA 2PZFA 2RC6A 5CNMA 3T4UA 1XF9A 4IUYA 5H3CA 3KCQA 1IHYA 2Y71A 5LQJA 1XU9A 5AK5A 4GSYA 4MWZA 2VYVA 1NDUA 2O2EA 4DOMA 1EVLA 3CQ9A 1ZCZA 5JVDA 4KGVA 1ZMTA 5HYVA 3VZPA 4LHVA 1NRIA 4EA8A 4KRFA 1CUZA 5DI9A 1D03A 2EKBA 2OQRA 2ZBGA 2WD7A 1NUUA 3ICWA 2NUPB 3LBYA 4EF4A 1WTCA 1CLEA 1NLZA 3NTQA 4R7ZA 3E2IA 3KLBA 5E3IA 3EEIA 4OLAA 3HKCA 1YZFA 2GN8A 2P2SA 3VNSA 2V0CA 5ANRB 3TZCA 3OPYI 4U0JA 4PPNA 1MFPA 4LI0A 4NQRA 4QTTB 2PLNA 2QI9F 4H60A 3ASVA 3GN1A 3R24A 5BSGA 4G1BA 3RTDA 2OUKA 2CV2A 4V3BA 4D8TA 4C87A 2PUFA 2BJVA 5F64A 2IP4A 3KQVA 4DJTA 2M98A 2NADA 4XLTA 4YP5A 5FF9A 1G1MA 2I7DA 1E1DA 4IDCA 3UMGA 1NBMD 3UMSA 5JZMA 3A9SA 5KB3A 1CK4A 4XW2A 1YOBA 2H8GA 3BSYA 3OQHA 2XAUA 3P0HA 3E3LA 1VI6A 3PXUA 3EGEA 4HOYA 2WTUA 4RD3A 2YV2A 5JRJA 4MYTA 4DYVA 5ARBA 1L3CA 3OMLA 1KDYA 4XR4A 1OXBB 2PGXA 1YCHA 2F7SA 4RZUA 2HSWA 3VAAA 3VO2A 2WWYA 1A8SA 3JQBC 4I4CA 5KYWB 1LPOA 2FZGA 3NUZA 4JLNA 4LVUA 4OA8A 1YU9A 4P4NA 4Y9UA 5AKKA 4JFAA 1W75A 3RAJA 4ND5A 2YXEA 4Y1RB 1E2UA 2ZB7A 3DBOB 3QUCA 3DDUA 3N75A 1E0AA 1WP4A 1NVAA 2UYQA 4MYHA 1JEYB 3OBIA 1J5PA 5CVJA 4KGXA 1RHUA 3LOPA 1CR1A 1I9GA 3EGDB 4XVRA 2R5FA 4KWEA 1PR5A 2HA2A 4HGZA 4KDFA 3G1UA 3IDAA 4LJ4A 3T5DA 5ABPA 5C7OO 5CVTA 5F76A 3ETNA 3OWOA 3GEGA 3OE5A 2HH9A 4F60A 2C04A 3C6YA 1YJBA 1ZD1A 3B2QA 5E6RA 1RZRD 1XUOA 1IONA 2ZDHA 3LUAA 1XV5A 2YWCA 1DHRA 3Q5EA 2FNAA 3EUFA 4TV9F 2LKDA 7AT1A 2IHBA 1ETHA 1L4HA 2I8CA 3CJTA 2G6BA 3BIOA 3L0CA 4JKYA 3NEJA 2OKGA 3ONVA 3D6MA 1NVGA 1NULA 2CDRA 3NVAA 4OB6A 4OFBA 4FEEA 3TJZA 4H17A 1PWXA 3ZEAA 4QPJC 3HL4A 5JC1A 2XJ4A 4OGGA 2PTHA 1AKEA 3CSUA 5DGIA 2M1ZA 2VZEA 3GHHA 5A1JA 1E1RD 2XDQA 3F46A 2IWRA 2DBVO 3ZR4B 3HKEB 2QPOA 5HKKA 2C2HA 3CMMA 3N39C 1JHOA 1AT1A 5EYPB 2LW7A 1PVOA 3HVKA 3PEVA 2HJ9A 4BQIA 2P3LA 1W6UA 2BFDA 2C20A 1UXGA 1CUVA 2FEXA 4IIJF 4BQPA 4MIEA 5FWYB 1W19A 3DFZA 3KB8A 1YB7A 2PX8A 2VZLA 4L2IB 2PYIA 2VJOA 2AMYA 1MNAA 1STOA 1VHDA 4AJLA 3UJ3X 3MRXA 5EE9A 1XDGA 3V2HA 1S7GA 1RBZA 3CE6A 1I5OA 4DSNA 2J9XB 4H27A 2OZLA 4ZICA 3BH7A 1UMDB 1QYRA 1UBJS 4JEMA 4W9NC 1ID1A 5DE3A 3PDIA 5BSWA 4DPKA 3D7NA 1DT3A 5IUNC 5EJMA 5LP6C 4KN6A 4ZANA 1KZHA 2FN7A 3THXB 1IOLA 3M6FA 1DWOA 2VHWA 1N0HA 4EKDA 4JB8A 1P19A 3C6XA 3TLCA 4JLKA 3L02A 3R3SA 1K3FA 4GE0A 1EXDA 1C7QA 3DVQX 1KY5A 3QFRA 4FFOA 3AY6A 4A2QA 1ULZA 5KHOC 1AQ6A 1ZXBA 1DJQA 4RXUA 4P08A 3RIMA 4OREX 1HL3A 1B14A 2IYFA 3MGAA 5FLYA 4CI9A 1GL9B 3K1AB 3VNQA 3EXIB 3ZIDA 4DRXA 4YUXA 1P75A 2YHAA 1JG3A 3BRWA 4Y3UA 2UVDA 1XK6A 1MJGM 2JGDB 1TW3A 4FFLA 1W9HA 3VBCA 1AKYA 4Q4JB 1EFVB 1AB5A 2B35A 4XAQA 3INRA 5KMGB 4KQFA 4YB8A 5AKEA 1HMPA 1XVLA 2E6KA 3RAFC 2ZE8A 3OTQA 4BDTA 2HDHA 4IHAA 4J16C 2ZRMA 1FFXB 1R18A 1Z08A 3IIJA 3O8OA 4N82A 3GJYA 3QKWA 4PWZA 4BE7B 1W5AA 4C4TA 4UCWA 4HUQA 1W49A 1YVUA 3FTEA 3PU6A 3K70B 1HA3A 1I8TA 2XLBA 1CWUA 4PAQA 3NBQA 3IS3A 1SD5A 5EG5A 4W8GA 5B58C 3WMRA 3B60A 3GRCA 4DRYA 2ZOSA 5DSZA 1QIDA 2W00A 2HBRA 3AYXB 2ZSUA 3BB3A 3I76A 1OX4A 2ZRIA 2Z4RA 3LWBA 1EM6A 3KTDA 1AO0A 5BMOA 1MAHA 1WSBA 8AT1A 3TFQA 4AY6A 3K35A 4MWOA 3MG9A 2XE4A 4RK0A 3RF7A 3I2KA 5T8KA 1QO9A 3BDVA 2E4VA 3A1FA 2O8EA 5A5EA 2FRXA 3I05A 2C7QA 1BGVA 3GL9A 4CKEA 1FY2A 2ODEA 3SI7A 4YFVA 3G2HA 3D3EA 1SOMA 2NOAA 2ZZKA 3DKRA 4BGVA 1C8LA 1Z47A 2W8BA 4IDGA 3BFXA 4RIFA 3GJ0A 3EZ7A 4OLJA 3ZBPA 2HA7A 2IDKA 2SKEA 3AZPA 1NXPA 1BHO1 3PC8C 3W6PA 3IH5A 3R0QA 4BQRA 4EA6A 5C35A 1ZN2A 2KMLA 3VAYA 1VHQA 3ZDFA 1RHRA 5FNVF 4BEVA 4O08A 3H5OA 1L7DA 4I4TB 4R1UA 5GJVC 2WNIA 1Q15A 1Z3IX 4CM5A 1TYEB 1I4DD 2W98A 3D6AA 1Y6ZA 3MFQA 1QDLB 2F8TA 4QXRA 4XX1A 5KNDH 3ZHCA 5G4KB 2ZJZA 3QPBA 4BMNA 1QIKA 4C4SA 5LQKA 3E9MA 2XKJE 1WMAA 1SA0B 4U2BA 4HQFA 2WVGA 3EVEA 5BNWA 4RH1A 2AFIE 2ZBRA 2ZYGA 3OEED 2WM3A 3GBPA 4REMA 2YOGA 4ME6A 1IUNA 1GT6A 1YZKA 3Q2KA 1I6LA 3SGLA 2Y3IA 1WDWB 4ITRC 2W2KA 3CUKA 3OQ1A 2HF8A 3VKUA 4YP1A 1XHEA 3B3GA 1RAEA 1Z4LA 3NGLA 5P8WA 2VQ6A 1G41A 2P7IA 4GZ5A 4HDMB 2GCIA 1K75A 1F8XA 5H0IA 2QRMA 4Z4CA 2I4IA 3OU7A 8GPBA 3AF0A 4NYMR 1E3IA 1GQSA 3G9QA 2GAJA 3QW4B 4PQFA 3UCFA 3U1BA 2BEVB 3VPCA 4EUFA 3UCXA 4M7OA 1PEKE 5DTIA 3X2EA 4GOOD 1DSSG 3B8HA 2CZGA 3EIEA 2HO4A 2J41A 3NHLA 2CEAA 1R6VA 4Y2SA 5FFMA 2VBFA 3DTVA 5LD2C 3EEYA 5EHQA 4IVQA 2VBIA 4KQXA 2I2FA 3G79A 3BICA 3TL6A 3L06A 1HFJA 3L4BC 1K88A 3REQA 1R2QA 3RFVA 2J0QA 3M6IA 1QE3A 3OOEA 3N0VA 4NOLA 2FLVA 4EYOA 5CA0F 2G9ZA 3AW8A 3UWKA 3CPSA 4U5XA 4M36A 4QOGA 4V2UA 4JR2A 2EWWA 1ZESA 1P9NA 3KZMA 2XUKA 4MEBA 2GAAA 3FDIA 1L4YA 4Q1AA 4G56A 3KYJB 5BRAA 2RBKA 5D85A 2Q3JA 4ZEMA 3ZKWA 5G0WA 2NVUA 4FLEA 5MHTA 3V3KA 1VFPA 2QPAA 2XE8A 3LPCA 2DH5A 3O1JC 4QPPA 2XT9A 4CN8A 3QPDA 2PMKA 3NS7A 2TECE 4MARA 4CM6A 2ZYVX 2PBRA 4DMFA 5B6PA 5CA0A 3DE3X 4UE6A 4TS1A 5GP1A 4QLOA 3C5WP 3H4IA 4R9UC 4QEKA 3WL4A 2EJUA 5T64A 4C89A 3DVSX 3C0KA 4ROSA 1W5EA 2UUPA 3E23A 1CY0A 4GBMA 4LGYA 4ISCA 4C5BA 1EYZA 4DM7A 4RD4A 1YDFA 2NZXA 4OA5A 4IIGA 2QHXA 4RPCA 5G3ZA 5A3QA 3V48A 2I5PO 1JF8A 2GEBA 2PSJA 1QGAA 4CNBA 2HXYA 3BJEA 1V39A 1WXQA 2UAGA 1HDZA 3OCZA 5GADl 1Q57A 1Y6JA 4M0EA 3D6VA 2UZIR 1M6WA 1BWPA 1EFRD 1TEHA 1GPYA 1LNQA 4LWPA 4O4JA 4V0SA 2HMAA 1WXDA 2UZ4A 4EAAA 5FOQA 1UQTA 1A1VA 2D0OB 5JNUA 2FPKA 1WPXA 4TT3D 1PNOA 2JZNA 2POQX 3WLIA 4J7CA 4UUQA 1XE3A 1U02A 1OH8A 4JC4A 1GVHA 5A5DA 4JJ4A 2IS1A 3FMFA 5EJIA 4YT5A 3ROTA 1JLMA 3TOVA 4B48A 5GINE 1V8FA 4DDMA 4HNAA 1YIDA 1JR2A 3EZGA 4LDJA 3WQRA 2EG5A 4DY6A 5HHTA 3ZDAA 5K0ZA 1U7UA 4X97A 3MELA 3ZQUA 1YKFA 2PBZA 2JATA 4G2NA 4OK3A 1HDXA 3AUKA 3E3NA 2EARA 1NKSA 1P0PA 2JFGA 3H1AA 3HN7A 4WLUA 4YASA 4D1YA 5JT1A 2W0MA 3D81A 1GPWB 2H18A 2HDOA 3IBTA 3GZNB 3OD5A 4WXRA 2ILVA 2ECKA 3GRRA 4ZGGA 3U3KA 5CB4B 1WWKA 3PGMA 2SECE 2GN0A 3GGPA 1KKUA 4K9DA 4A6DA 4CIVA 4ZREA 1QIGA 3EPKA 4BRSA 4R2MA 3ZTWA 3R1IA 1B3RA 1H3NA 1MRZA 3LPMA 5KYTA 3NRBA 2BGLA 1NVMB 4FXOA 3PX7A 1GCOA 3Q7EA 2BEUB 2PKCA 5JDIA 2ZSIA 3HY4A 1H5UA 4OM8A 2AIRA 1QC5B 2O1XA 1HFEL 1FFSA 1O6CA 1EUQA 5KQPA 1IUKA 1UBHS 2ZI6A 3QG1A 1HL7A 1H5QA 4MHSA 4I8DA 4YQYA 4C43A 3F6SA 3JQ6A 4F11A 5K6TA 1IWPB 2RMKA 1D4AA 3JZAA 4Y67A 2YHUA 1D2CA 4MRMA 5JJBA 1I7QB 2O52A 3LZDA 2Y0CA 3BGSA 4Q4AB 3A9UA 4L50A 4FR0A 1X1EA 4XGIA 5UKDA 1TO1E 2VSQA 3FYSA 4HDQB 4KXWA 3U40A 1QVWA 4IVPA 5KREA 2JLXA 4E11A 821PA 1K4YA 2JBAB 4QYTA 2FXVA 4BBAA 3DTYA 3OICA 1B8UA 4PHHA 1Z38A 1QDUA 1JVNA 4MKIA 1Y3DE 1SQ0A 3PGJA 4RK7A 1RAHA 2QW8A 3KXIA 2VQFB 1UOQA 4DR1B 1N4AA 3PNOA 2AOWA 2HWXA 5KJFA 4G5FA 3MTGA 3AIKA 2WFMA 2HU8A 3EDYA 4RV9A 2NM0A 3K1ZA 5G0VA 4KQ2A 3MSXA 1QGYA 4RWZA 3UHOA 4DDKA 1WQ4A 2VYNA 3PL1A 5IAKA 3ZZUA 1ZD3A 3T99A 1Q20A 3TTSA 2R6DA 1HPLA 2JI8A 4RKQA 3ZD6A 3IQGX 2I6FA 1TVCA 4M0MA 4ZARA 4H1HA 1YI0A 1S4QA 2KPOA 2AYZA 1RRKA 2O2IA 3R6TA 4HRXA 4ZOEA 2C61A 2H06A 1TO2E 2YJ5A 3ELYA 4BQNA 1W36B 2WJ6A 1F60A 4G0NA 2YCLA 3PI7A 4TYQA 4WFIA 1G8FA 4HAWA 4O4LB 1Z88A 3AETB 4ASUD 1LY1A 1SXJC 1NU8A 5KOJB 3KZOA 1W36D 4BNVA 4IUDS 1D1SA 4IQ8A 4XX0B 4DA9A 3NHPA 4XGQA 2PVSA 4ZK2A 2XGGA 4CLHA 1YB4A 3R0VA 1I24A 1GTG1 1QX3A 2GJAA 2N3ZA 3L6RA 3V2IA 3FNIA 3DBRA 2ZP1A 2EFCB 3SQXA 3DLTA 2QJOA 3HRIA 2X15A 3ZJ4A 5JS7A 4JUFA 2IJGX 7REQB 1KK0A 5LMCA 2ZJ5A 2TS1A 4HX2A 4R8KA 1YJ5A 1US8A 3RT9A 1UANA 2J5XA 5ELMA 3ZW8A 1YV9A 4B3FX 1Y3BE 3MCWA 4FYPA 2RGGA 4Y6GB 3CR7A 3QQ5A 5F35A 4BXOA 2AUNA 1SIBE 1X15A 1RYMA 3IAM6 3ZCRA 1RI3A 4RD0A 2X0DA 4LA4A 3H8SA 3CKMA 4OU5A 1NI4A 3GLHB 2DQYA 2HGSA 2P27A 3LT0A 3RANA 1Z4QA 1UBUS 4PYIA 4IIVA 1I2DA 2HU7A 4YIHA 4L8VA 2VT6A 4B35A 1Z0KA 3A10A 4MR7A 2DWUA 2OA0A 3WKBA 1AQNA 2JH8A 3WWCA 2ZRPA 4PYOA 1QQ5A 1Y98A 2PJDA 3IAHA 3ZTYA 2V9PA 5DNVA 2C95A 3ESYA 2IYAA 3MJSA 3RH0A 3NZEA 2X0NA 2XQIA 3VSDA 4CGYA 2ROQA 1GZ6A 4QATA 4RVNA 1M2OB 2H4YA 3CRRA 1QAQA 3QKRB 3D6FA 1KIFA 2GFQA 4HH3C 2G1PA 2AJLI 3STHA 2DSTA 3D2AA 1GLVA 5B7QA 1QQ7A 1XZEA 2BM9A 3B1WA 4IIHA 4E14A 4I46A 3EEOA 4B80A 4TYWA 3EJ6A 1C3XA 4WLVA 2MYTA 1BEUB 2PUHA 4MGEA 3IUBA 3TTXA 2VYVD 1QGUA 4B47A 2VTBA 1PL7A 2DUJA 4GLLA 2IK8A 5EFZA 3UOWA 1Y9ZA 5L6MB 4CCYA 3DKIA 4UCFA 1MHPA 1JKMA 2E6UX 2FMFA 5HKAA 1P80A 1EVKA 1GTVA 1QH9A 4EJ2A 1UBEA 2OHXA 4B7ZA 4P3XA 3IXLA 4J6EA 3E6AA 3LWZA 4ZPJA 3UTCA 3ZY3A 3FE2A 5KJCA 3E7PA 5FBQB 5I4CA 1M8PA 3T12A 4PVDA 2NP7A 1DAFA 1HT0A 3BCHA 3SJZA 1EAYA 1DFIA 1XN1A 1Z8FA 1YFKA 2CYCA 2ZQYA 3BMQA 3NVDA 5FOUA 4C6HA 4Q7JB 4IIEA 2ZT7A 3RS3A 2RG1A 2ZJ4A 4YRMA 5I4IA 3R5FA 2FX3A 3FI0A 5DYNA 3U4QA 4X3OA 1PFYA 1E59A 3T5AA 1LNSA 5CLJA 1YBHA 5AIBA 1G8MA 3UT5B 1XNRB 1LC3A 2HUPA 1ZGZA 3E1GA 3M49A 5BWNA 1UQRA 2VUTA 1VL0A 3BTOA 3EW7A 3S29A 1UP6A 3H11B 1POXA 5FI1B 4EHIA 2HMUA 4ESEA 1NM5C 1YZLA 4RETA 5BUCA 1A7UA 5SY4A 1D2GA 3U7FB 4QNNA 3ZE1B 4QWMA 3TCXB 1XEXA 4B6FA 4LJ7A 4QM7A 1VCNA 1V6CA 2R86A 2QTRA 3PJRA 1ECCA 4RTNA 2GBGA 1DC3A 1Y6GA 2HIAA 2BDUA 4RK4A 2CE7A 4DIBA 1X1AA 3BIJA 1X7YB 1F4LA 4H1TA 2AN5A 4M9QA 4WHMA 4DV6B 2B98A 4HLUA 3OKPA 4GQBA 1NP6A 5IS2A 1NVWQ 3Q7SA 2PA0A 3DE5X 1F6BA 1V6AA 2EW8A 3B6ZA 3ELBA 3ZLVA 4DREA 4Z4IA 1N2CB 3D8NA 1JHVA 1L5HA 1M66A 1SUPA 1SG0A 3BMXA 2C29D 3HCPA 3KDPA 3OZ7A 1QGED 3KYIB 1OT5A 1FLNA 2D54A 3HB0A 1T4CA 3R5JA 4XA8A 2I3GA 4E5DA 4IR7A 3ISJA 4WEQA 1DZIA 4GVPA 3BXOA 4QOHA 3FWPA 1ENZA 1G20A 4H4EA 3UT5A 2OBMA 5LLSA 1HKUA 1P29A 3OIGA 3RYIA 1QS0B 1M7HA 4QAQA 1VLLA 2GD6A 4WXEA 3VOTA 4MCIA 3UFXA 3ZQJA 4OHWA 4DLVA 3A1UA 1RMTA 5EUBA 1H8HA 3UWPA 3WJ2A 1ADYA 4OI1A 2GLXA 3BHIA 4MQMA 3MWLA 4BVFA 1HLPA 4WD3A 4X7BA 5FFFA 1RJDA 3S7ZA 4CU5A 4YXWD 4KO1S 3BCRA 3IULA 5AVJA 1KMCA 2J1LA 2AOVA 4V0NA 3WYBA 3TZQA 2QUIA 3GO4A 4RCYA 5EJ5A 4HO1X 1ODCA 4JCCA 3I04M 1JHQA 2Z2XA 4TUYA 1GTRA 5IWCA 2X19A 4BKOA 1IN7A 1U04A 2O2DA 3AL0C 1WU7A 4I9HA 3G2IA 4RAOA 2ATXA 4TLCA 4UHJA 3DE1X 5CA1B 1NM5A 4D46A 1X8XA 3MCUA 4U7TB 1AKRA 1DG9A 1T9AA 2JFFA 4CIBA 4IXMA 1HT2E 1HYBA 1LQ2A 3C48A 2I6GA 4TPKA 1USIA 3TH5A 1U9JA 1MH9A 3VHXA 3OSZA 1MC5A 2KB0A 4GPIB 4AWBA 3GLGA 3THYA 3RT7A 1HFKA 5LJIA 2WUGA 5EINA 4ZU6X 1JMYA 3IDQA 1N5LA 1AA9A 5H16A 2KSQA 3RC8A 3AOEC 4TTJA 4J9VA 1B43A 3DB2A 5FTMA 2GAOA 5AW0A 2HA5A 4WFQA 2FFBA 3QOFA 4FFSA 3W8FA 2PH7A 4YMSA 4ERXA 1A9RA 1TCVA 5BSRA 5C32A 4TKUA 3KUKA 3CUWA 3ADOA 4HEQA 1NRJB 2JD0A 2FSSA 3DEAA 5EWMA 3UGTA 3VR5A 5IKOA 5H68A 3ET4A 4OQYA 2L19A 1A8IA 3L0IB 4LSZA 1GG2A 3FM9A 2HEGA 1X8LA 3TRJA 1G7CA 3TYXA 4LE2A 4K3UA 2G80A 1UFKA 3U48A 3OZVA 3DFMA 3QVGA 1BCRB 2CYAA 3PHJA 4K9RA 1DBVO 5EPOA 1K89A 1LPAB 1E1YA 1NV9A 5I7EA 4AY4A 3MRTA 4FQ8A 3U49A 4PLCA 2AJDA 1JB9A 2H16A 3LLSA 4M2LA 1XQWA 2NWQA 4PGGA 3S2YA 3GAMA 4B3HA 4DA8A 2YVAA 1YWGO 2EFDB 4QD3A 1PNRA 3WOHA 1TTTA 1BTOA 4CI0B 2FDCA 2BF4A 2B5WA 3A36A 1SURA 1OY1A 4FMBB 3CVXA 5K3SA 1WMBA 4QX6A 3NHYA 4PXSA 5JVDF 1JE1A 1W0KA 2A9OA 3B6JA 5F9MA 1KIMA 4RHTA 4LWOA 4JHXA 3EXHB 2PUJA 5EEHA 3TLKA 1JTEA 3S8EA 1ZZGA 2V55B 3BJZA 4ZI7B 3UT0A 2D8AA 1XFAA 3AB7A 4CF6A 1T5LA 2OCKA 2ZWIA 5CRIA 2C8KA 4L22A 2VDWB 2VP2A 1YDHA 1E3TA 4PSAA 2JGKA 1CUSA 3K20A 1CQZA 5ECYA 4ZVOA 5E38A 4A3SA 1IRIA 1ZD9A 3E9EA 2XA1A 3L1UA 3Q15C 1KSGA 1A1SA 1H2BA 3WNZA 3NGMA 3WV5A 1JKXA 5C3MA 2W2LA 1LFAA 3Q72A 4O4LA 3B5EA 2BWJA 4BBPA 3I53A 5IARA 1ACJA 1D0SA 1R3DA 3UB2A 1KH3A 2WMNB 3DHVA 3GUYA 3ABSB 4NZZA 1DXOA 4D74A 4DC1A 5AK0A 2WAYA 1JGTA 4YECA 5HG0A 1Y4SA 1MOPA 4X54A 2Y0BA 2EBFX 3COJA 4K0KB 2VTKA 1ISJA 1ZNQO 4F4DA 1OH5A 2IGBA 3T3HA 1I4WA 1WB6A 2FW0A 3N3BC 2CKDA 1V2HE 3DHYA 5IJ9B 3TLBA 3NHKA 2HJGA 5FPHA 3ETCA 1ESNA 1FS4A 3I9FA 4YPFA 3LGAA 3Q9SA 1ECJA 2C4VA 4FE7A 1FFWA 3KWLA 4HN9A 1LGYA 2DU8A 2XDWA 3H4TA 4JYMA 2DEUA 2UUAB 5JNSA 3U3DA 4RSGA 4EGAA 3WYDA 2DSNA 3EWSA 1DC5A 4HN4B 1ATIA 1G5TA 5AVWA 3P9CA 2R8OA 5DNWA 5IT0A 2BGNA 3L8EA 1SXJA 1NZFA 2D5AA 5B1SA 7MHTA 1I0LA 3H1GA 4GUDA 5F23A 3W8EA 1VKJA 3EVFA 4QTZA 3KJXA 1VJDA 4C7OA 2H4ZA 3SIPA 3L92A 5C4MA 3ZGZA 1IPEA 1ZCBA 4MCJA 1K7CA 3W0LB 2FWMX 1Q0RA 1WY5A 1P81A 3OUTA 4I99A 1KMHA 2GM9A 3HB4X 5BW5A 1N32B 3GUCA 2AEEA 3F4KA 2B6HA 5K1ZA 4PC6A 3TW0A 1TVEA 4R05A 3WGUA 1CYEA 3TSAA 5AW8A 1EZ4A 1PV2A 3PF8A 4WA8A 2ZM6B 3FKJA 5IJWA 1YRLA 3C5EA 3AF3A 3U4GA 4EOGA 4RTRA 4IFEA 1LPBB 3K1JA 2R79A 4IVNA 2VF5X 3G9UA 2PBLA 4D3FA 4DNOA 1EH5A 3CRW1 2GSDA 1TQDA 4ARBA 3N2EA 3OKFA 1ICEA 3IQWA 1NSTA 3NHMA 1OLSA 5FYDA 4FCCA 3JSXA 1OTHA 4MVXA 3ZWBA 3AZQA 4B6PA 5H5JA 3E7FA 2CCGA 1NF8A 3MBKA 4L5BA 1KQOA 1KS9A 3BGOS 4OL9A 1N25A 1E3QA 1E98A 1VHJA 3BFPA 4I3FA 3ROKA 4I55F 3TUJC 2XEDA 3LLCA 1OMOA 4I5IA 4UQPA 4ZVSA 4NYMQ 2G8LA 3UGKA 5F2NA 3HDQA 3CKLA 2A5YB 1OFHA 2C3MA 1EQAA 2Q2WA 4P2BA 4XQ0A 4WK0B 3TR6A 4JJIA 3O8RA 4L8LA 5EP4A 3L8FA 3L7BA 2E85A 2GZMA 4NABA 3CF0A 2XVZA 4IJUA 1ZN8A 4GYYA 3CEHA 5F3RA 1TJ5A 4Q3KA 5WRFA 1V3QE 2YJ4A 1A0OA 1UDRA 2QRNA 4CKXA 1LRLA 1XWIA 4CR7A 2H48A 2WMOB 2RK6A 1IHPA 3CT6A 1RJEA 5IH7A 3WMEA 5JI3E 1DWUA 2A57A 2ZI7A 1B6SA 4HQRA 5TRTA 4P0QB 1HXHA 4IXDA 3RGWS 3NWEA 1F7UA 4IKOA 2C3UA 1S96A 2Q6TA 3HP4A 4ONEA 1N5IA 2C4WA 2BFFB 2VIIA 1C3OB 2VT7A 2GA9A 2X77A 4M87A 4NCXA 4TT3A 3I4LA 4Y2RA 4AMUA 4E07A 4YV7A 5F1YA 1NMXA 5J2TA 3A0UA 4AF6A 2IPOA 5LXTF 3UFXB 4QXAA 2HWKA 4ARUA 4GGPA 4J2HA 4DG9A 2OBYA 1JKFA 2VJLA 3DG9A 4HLDA 5SYNA 2FPSA 2ZIXA 1UZLA 3HCDA 5BW4A 2HMWA 5A7FA 4LWZA 1KGSA 3SC2A 1JJBA 4IXWA 5CPBA 2QRPA 3E9RA 4LZLA 1VMIA 4LOLA 4PLWA 2AQ8A 1FDSA 3K5IA 3QI2A 3WY9A 1YF3A 1FVFA 4LK2A 4G36A 3ENNA 4JT9A 2PX6A 3V6MA 2ZBDA 1L5HB 3PYMA 1WXHA 2ZSAA 3P9NA 1KI4A 3L8HA 5JAUA 3SAJA 4L0QA 5DLDA 3CSDA 2XGOA 2O8DA 3TBFA 1V48A 5KWVA 4M4SA 3L3BA 1UT6A 1BAPA 3O74A 2G06A 4LRTB 1GN8A 3GPCA 4Q1VA 1KAOA 4RQBA 2F55A 4K9NA 2EFHB 3C1TA 3U7QA 3ZDZB 1A2QA 5ECDA 4H7HA 3G2NA 5EUMA 4C4RA 3C5CA 1JQBA 1XZLA 4C20A 4H1WA 3LW7A 3Q3HA 4D9BA 3TFWA 4RM2A 4YN3A 5D1NA 2BKLA 5F98A 4UD2A 1Y37A 3F3KA 1QOPB 3LC1O 3H5WA 2Q9UA 2ZCVA 4PZAA 4Y6PA 4Q9DA 2FW6A 2OHJA 4S1PA 1OZAA 2XCIA 4OKIA 4ZO8A 1U28C 1ULTA 4TRJA 3UANA 2C7GA 2IHYA 1FVXA 3WGYA 2D5BA 2O3JA 4PXAA 3DPUA 3VYWA 1PQ4A 4R1PA 4A8JB 2D5IA 3BE5A 1LLCA 1KGDA 3NC0C 4KYTA 4TXLA 4JP5A 4G24A 1N7HA 4PEVA 8OHMA 3AXTA 4YJ2F 1F48A 1ZJ6A 3O91A 3U3JA 1GD1O 3EH1A 5K8IA 4I5DA 1SHJA 1N6NA 1ZM7A 2ZTVA 3TZLA 5ALKA 1KEEA 1U8YA 1XD9A 1Z83A 3BJRA 3GFBA 2W6IA 3LPDA 3PI6A 3IQHX 3A3OA 4EO4A 2A2ZA 4WKGA 1AHIA 1YRYE 3OHSX 4N49A 1RJ9A 1PYGA 3OEWA 4MROA 1OKKD 4Q1DA 5E1DA 1B26A 2JJ2A 5MF6A 4Q7MB 1TIBA 2V1XA 4E7OA 1GQ2A 3L0SA 1KZ6A 1NAIA 2Y99A 3CCFA 3VR0A 3AR4A 3M6WA 1JQKA 1UOEA 1JHRA 1Z0JA 4KR2A 4BMVA 2BMFA 4XXHA 4YJ2B 2YUTA 3RWMB 3WGNA 1IDN1 3WIBA 1XRSB 2XNDD 2BW0A 3T94A 4BLUA 4BNDB 5JYDA 3S81A 5A3VA 4CLDA 5IK2D 1CIJA 5FEUA 3DE6X 1E2PA 1QGOA 2RGNA 1KJZA 3BM5A 3FA2A 1VMDA 4JMPA 5AKYA 1M2OA 4ISBA 3AF4A 3RJTA 2OZKA 2WM9B 1Z75A 5CVVA 3GNQA 3WP1B 4Z99A 1IHXA 1T4CB 4H9GA 2RGXA 4N01A 5E95A 5EZ5A 3FOWA 4YRTA 3R74A 4GHWA 3UMYA 1SBIA 2VP0A 3X43A 4NAVA 2MINA 2QV0A 4FS8A 3LRPA 2WWVD 3FWYA 2OLKA 3TPCA 2Q28A 4PQEA 1D4ZA 3GUZA 1OIVA 1A4XA 4RFVA 1N2ZA 3RHFA 1C7IA 4ZGBA 4NDNE 4QDUA 4DJEC 1M34B 2WIKA 1Q7TA 1PJLA 2J6IA 3OJOA 2B99A 3MBIA 4DT1B 2FSFA 3OFKA 3G13A 5KX5F 1Y81A 5YASA 5AI9A 4KNWA 3KSRA 5DYWA 1ULHA 4HH4A 3CUEF 4M8LA 3MRVA 5SYMA 4YDQA 4R8VA 1JNYA 4QC2A 2C78A 4PPFA 4A2CA 4DCNA 1U8UA 5LOVA 1U98A 3JWHA 4LDZA 3E7XA 2KQUA 4M9UA 2A92A 3O9VA 3N7AA 4KQIA 1PFGA 4UVGA 5KMGA 1PEYA 3CF6R 3SLKA 3N2LA 1EFVA 3VU3A 1FEZA 2PFSA 3DP9A 4DV1B 2ZR9A 4WK4B 2OK7A 1VECA 2P78A 3OPNA 5TV2A 3PUVA 4DC0A 4XVQA 3C16C 3H84A 5A3RA 3U4QB 1XVIA 3R41A 4LDPA 3BG5A 3EXIA 1RZ3A 1MVNA 2SCUB 2X9GA 4PLHA 3DAPA 3JD2A 4MRRA 1PN3A 5CJJA 1VMKA 4GWKA 1AHPA 3BMQB 5FBRB 2DPYA 3RQIA 3AHEA 4NX2A 1JDBB 4DUPA 3LPNA 1D8AA 2Y1WA 1TUBA 5A4DA 1SB8A 3F9IA 3HM9A 2W2XA 4ZOLB 1N2SA 1N9GA 5AHOA 3K0CA 3N8HA 1PFWA 2YV4A 4ZAZA 2ZUVA 3PFBA 4DV0B 2J5RA 3IAS6 5AJZA 4WY5A 3WG9A 4A0QA 3EX7C 4YT8A 1FTQA 1RWMA 3B9BA 1NVBA 4LS3A 3NR2A 3DDCA 2HHHB 8MHTA 5H59A 5J2TF 5FAXA 3TEMA 4LZNA 2Q5OA 3KNZA 1FYFA 2VA9A 2ZTUA 5JMPA 3RTGA 4H0NA 4L2IA 1DRVA 2WSMA 2XNKA 4HWKA 4MO9A 5T3YA 1JT9A 1GNQA 4C3OB 3DLAA 3CX8A 3OM8A 5A05A 1GTMA 2BFDB 3O94A 4LNUB 5BP7A 3VYSB 2EG9A 2QL5A 4K05A 3F6YA 1GPLA 1KE1A 2YXPX 2RGAA 3MGKA 4MITA 1REQB 3ZZMA 4K03A 2XDQB 3T7TA 2I8LA 1E3WB 1VQ1A 2QIPA 2VP4A 4PXYA 1EZZA 3VZRA 4H3VA 3LUHA 3TD9A 1X2BA 3CN7A 1JIKA 3NKFA 3GXBA 3HJFA 2XXAB 2GASA 4D4MA 1GZSA 2JFNA 3FPLA 5FLXA 1UPFA 3ESAA 5TDHA 2MSWA 2E37A 1GZ5A 1RHQA 1GR0A 3FG9A 3SXPA 1EGHA 3O3NB 4OSOA 5CT5A 2IXTA 4BATA 5JAZA 1N0WA 2FVYA 3OQJA 1T3GA 5L6LB 4FMPA 2EQ5A 2O23A 4FTWA 4QGFA 4UMFA 2DYKA 1XOIA 1PEAA 2QX4A 2Z8ZA 2EJBA 3AFIA 2H65A 1J9GA 3A7EA 3MC1A 4IWNA 3ZE8A 5LWHA 1WLSA 3ZOKA 3Q7TA 3PCRB 4LZZA 4TTRA 2ZB4A 1XDWA 4DQVA 5BVGB 4J1NA 1DDGA 1JHZA 2G83A 4QLAA 5CTAA 4X95A 1DWQA 1ZHOA 1X0XA 5ERXA 1SPBS 4KV9A 1BG6A 2HL6A 2W4MA 1E5DA 1KERA 4P36A 3FMGA 1ADFA 2XD4A 4GSKA 1AZSC 3PDCA 3N2KB 1WXFA 3KFLA 1QZTA 1Q12A 2YS6A 3AI3A 4C6TB 2CNNA 1JKJB 4GLBA 1VGRA 5LQRA 4FR2A 4HNAB 3BZWA 3AHGA 3VPHA 4UU7A 2PKXA 4IOMA 1B7GO 2FMUA 1H85A 2HPAA 2B36A 3BK2A 3EUAA 1WTAA 2JI4A 4J4HA 3GDFA 3ZY6A 4CEIB 3AEKB 1KMIY 3RHZA 3V8BA 3ND9A 4D41A 4G41A 3QPUA 4AMBA 2VL7A 1AS3A 4U7GA 3MJEA 4U7WA 5JWOA 3IPRA 4QVGA 3IKJA 3IL2A 3CEMA 3HJBA 1P4AA 1JLHA 2AUMA 4Q4LA 4PZPA 1QRSA 3CLUD 4NXNB 3KUDA 1DQPA 4AWAA 1CY8A 5SZIA 1P9LA 2GPBA 2WLTA 3HBNA 3KOZA 1ECBA 1QHIA 1TMGE 3KWFA 4JKIA 4QUIA 4BLTA 4CV1A 5BV0A 4CIYA 3KQNA 3UICA 4DV7B 3KPJA 3BL5A 4WOBA 3KQPA 3H5TA 3FXAA 4FIZA 2GYYA 1XRMA 2VNSA 1O2DA 5BT8A 1MO3A 1WO8A 3IDSA 3NYWA 3B78A 3PF9A 1KDZA 2OHGA 3X1DA 2VHYA 1I14A 1GGEA 4R3WA 4Q39A 1JNXX 3H8VA 2AVNA 4W5HA 5A06A 1F8YA 2BTOA 2BFCB 3C4VA 4GYWA 4ZAXA 3RTBA 3KX2A 2XUQA 3QMPA 1W88B 4Z1MD 2YUIA 1T8SA 5ENZA 1KQGA 1T9GR 1NE7A 1J8FA 3I61A 3B48A 1OYWA 3RT1A 3R3UA 5BORA 5ECWA 1L6IA 4EGJA 4BO4A 1Z63A 5DTMA 1Z5NA 1M1XB 1L1RA 2PL1A 3H86A 3LBIA 3N8KA 2GLUA 4FIDA 1KHHA 2COUA 5AESA 2C3YA 3MWEB 2XQGA 3BGDA 4LKRA 1AKWA 1I3CA 1X0VA 3T35A 4FN5A 3HJRA 2XBLA 3B53X 2ZRJA 1X42A 3M4JA 2HBYA 2HFKA 5BQ5A 2PNJA 4HADA 3FUVA 1DEHA 4D96A 1WV1A 1TM4E 4AO7A 1EFUA 1SIOA 5G3YA 1V47A 1W73A 1WSDA 3KIPA 3PFFA 1SOAA 4E2FA 4RTLA 1LPMA 3OY2A 5IH3A 2Z0MA 4UM7A 4DCGA 1TUIA 2X86A 1QHHA 2XMQA 3QJYA 4J4TA 1YQWA 3TIIA 2QVBA 3HVJA 4HAOA 4IO1A 1O6ZA 2CFCA 1DARA 2HCRA 4ITUA 4J1TC 5TPWB 4A03A 2O54A 2Y0EA 1ILEA 2SKCA 2P0AA 2GT1A 3PQDA 4GDMA 3EYAA 4UOQA 3ROGA 4F4IA 4GSLA 2W5UA 3CLHA 3RVNA 3GZNA 2BGRA 1ZN7A 2D1TA 1MX1A 3DV9A 2BKUA 3EISA 1N2EA 4BMYA 4NU5A 3S2IA 1VLMA 1CZHA 4Y0AA 5ICCA 2XGMA 3FIJA 3WIEA 5HJ5A 1B42A 1UINA 4ZOAA 4RGYA 4UARA 1GUDA 2ECOA 4PIMA 1QVVA 4FPXA 4QRDA 1GV1A 1PQPA 3SYRA 4NL4H 1JQEA 2ZYAA 4MI1A 2R7MA 4PG4A 5EWLB 4Y2UA 5MGBA 2XGSA 3IQEA 4EUNA 3TRHA 1NWHA 4AIIA 5EVJA 2FFRA 3TLGA 1GL6A 2BFMA 2VCYA 8ATCA 1P2BA 4ZOCA 1C81A 1G0NA 3U1VA 1KH1A 2BM0A 2FSHA 4Y9RA 4L07A 4QBTA 1SAYA 3G2PA 521PA 4EYSA 1W8DA 4QBHA 1GILA 4Z3OA 2AFHE 2COKA 1YH3A 4CKWB 4E70A 4G0WA 1BE8A 1BX0A 2QN7A 2FP4B 3A9RA 1P1HA 3GRKA 1Q21A 2QN8A 5PNTA 3RLFA 1UP7A 3DYIA 4TZTA 1FJHA 5HXAA 4ZJYA 2OHOA 5ALFA 4DDHA 5E1BA 2PHZA 3QW2A 5CXUA 1SMKA 1XJ0A 3TVTA 5D3MB 2WUWE 3ZCUA 5I51A 3WMXA 2QMUA 2WA1A 4NZPA 2O8EB 3UAYA 1W9MA 4E30A 2Q50A 1H0HA 1W1WA 1YMVA 3F1KA 4D9MA 5KOIA 1JLLA 3FZYA 3OZXA 2I9PA 4JP3A 3SIWA 3Q9LA 4H15A 2W6CX 1QQBA 3CE9A 2V5VA 4WEOA 1B2LA 1WD5A 4WZAB 1VP9A 3HWSA 3DV2A 4UATA 2OP1A 5IEBA 5JMWA 2VT3A 1CFZA 3KP1A 4B87A 3A58B 3AI2A 2X8BA 2WNHA 2NVUB 1ZUHA 3HYSA 5ES4B 2IPNA 3DMFA 4MGIR 1II0A 1KTVA 3WZ2A 1JB1A 5LU9A 5GMOA 4MINA 3EPRA 4EF6A 4DCJA 1QZ3A 2VXBA 3WQHA 4LKOA 4AS3A 5KBYA 2SBTA 3OECA 2IVZA 1U8CB 4DV3B 4J03A 1NQUA 3INNA 5HZHA 4WN9B 4FZ3A 2UYGA 1UK8A 2J87A 3OQIB 4MKFA 2GCPA 1DHTA 2C98A 3A4NA 2JGNA 2YYSA 3JYNA 1IWBB 3KPVA 1CY2A 3BWVA 2QX8A 2FMKA 4MAAA 1ZGCA 1CB0A 2DLDA 1J9EA 4RNCA 1GL3A 1UBLS 3R3WA 2BEVA 1X13A 3AR3A 4N9WA 1WDTA 2Y9PB 3DYVA 4D9KA 2GN6A 1EGAA 1YA4A 3PJGA 1KF0A 3PRKE 1BCSA 4JLUA 4B34A 9GPBA 1KZ7B 3QUSA 2XVXA 1ECPA 1BC5A 5JSKA 4KZPA 3D6JA 5JCZA 1GDHA 3P5SA 1W1IA 2AFIA 2R60A 4KLAA 4WACA 3N70A 5B55A 1FFBA 5CM8B 4LV6A 1YJQA 4EA9A 2ID7A 1ELOA 1UJ6A 2XTMA 3HFJA 5C18A 5BRJA 1MQ8B 1S7CA 1E2MA 1VJ0A 1SVSA 4MW0A 3GWZA 1MG0A 4UPVA 5D84A 1S5PA 5THXA 1M0WA 2QW0X 3RTEA 3VMFA 3OI7A 3O1IC 4AMGA 4D4JA 1XYGA 3K6JA 1FK8A 3PR1A 5ALQA 4A73A 1XZCA 1EVJA 1HGXA 2C0QA 3OZAA 4R1QA 4U3JA 3KETA 4FONA 3DZIA 4AYWA 5DNCA 3CURA 1U2QA 5BRNA 1AK9A 2JJ1D 2WVJA 3DW3X 2PUDA 4HP8A 1IBRA 4DW8A 3JWEA 1MO5A 1NMQA 3AP2A 3DONA 3S68A 2RK3A 3VR2A 2FR8C 3PD1A 2ZRGA 1QNLA 1C5KA 1XSEA 1NF9A 2OILA 5ULLA 2IXFA 2A8YA 4L4XA 4AICA 2YIMA 3P9IA 2UXBB 2I71A 1ZG3A 3HA7A 4KIFA 4HZGA 2V65A 2W8BB 1MPTA 1E3LA 3Q3GE 4X64B 3VI3B 1KYZA 4X00A 1XL1A 5EUCA 2R1VA 5LQMA 4LF8B 3I42A 1YR9A 3D7SA 3LX8A 4TVOA 1MJFA 1QTNA 1WKVA 1BFUA 2VOEA 3B7GA 1G21B 5CVCA 3FJ1A 4LCJA 1YI8A 4D45A 1FMTA 1QV7A 4QBGB 3RIYA 1Z15A 2I2XB 3JWPA 5JDCC 1SULA 4FHEA 1QBGA 2I2AA 3A1CA 3V55A 3CSSA 2VP5A 4KIGA 2WA2A 4NFSA 1AS0A 1J00A 4MVJF 3T3GA 2NACA 3GFTA 5AVQA 3UGJA 2BI4A 1C9MA 1HTWA 4TMKA 1PHRA 1FW6A 4DBVO 3MWYW 2REQA 3IP1A 2JJ1A 2I76A 4N6GA 3PVSA 3AOGA 2RAUA 5EWJA 3K15A 2X6TA 4UAJA 3ZU5A 1KKLA 1G64A 4LQDA 1TQHA 2JS7A 1JAHA 1T36B 2X58A 3L2OB 1DWPA 3PQ8A 1X1QA 2I4MA 4JY7A 1USWA 1ZWLA 3D3KA 1EX7A 2HMTA 5HM6A 1FFXA 1G6KA 3O8OB 1G1AA 3PTZA 4PYQA 4WKBA 4B2LA 2F90A 3SEQA 4ZYZA 1A9SA 2K7FA 3IQZA 3LDGA 3QFCA 3NHFA 5KNBA 1SB9A 3KAQA 4NULA 5LLTA 3H9BA 4K6FA 4BC1A 3UV6A 4C2AA 2GKOA 1FP4A 3F96A 1NFRA 2D7CA 3KV1A 2RAVA 3HDHA 3MMZA 4ND8A 4O4JF 3WIUA 4TMWA 5A2QA 5IJXA 1YRWA 2BMVA 1H1DA 1Q5PA 2DJIA 1DOHA 1U2SA 2A0UA 2Z2YA 3DOEA 4MWTA 3RVDA 4HQKA 1EI9A 3WLTA 2P2ZA 3U9TA 3BC1A 2GK6A 3I0MA 4EO9A 3ZZ1A 3VJRA 4PHGA 2QMZA 3GRZA 5T41A 4AAYA 4RHXA 3LG2A 1XVTA 1KEWA 5BXYA 1OIXA 621PA 4E03A 5JXWA 3F5QA 2D0DA 4QXOA 5JCOA 3R7WB 3T9EA 4ZYUA 2UDPA 3VO9A 1SBQA 2JEOA 2WYVA 4OHPA 4LF4B 3Q10A 2HNKA 1Y5IA 2DTDA 2JFVA 5FFNA 1S3IA 4I1UA 1VLZA 3IVGA 4H6PA 2PQ2A 1O6BA 1QE5A 1SBHA 2H52A 1FDUA 3OZIA 1JBQA 1XR3A 3HU5A 1DLJA 4IY1A 3FSGD 3JYLA 1Z4KA 5I48A 2QX7A 2PUEA 1VCOA 1PT7A 1SU7A 2BEKA 5EYPA 1KA9H 3WSWA 2VQEB 2BP7B 4MKXA 2UVPA 1UZAA 3MTQA 1WV0A 1FSZA 3HFSA 3IDOA 5U4XA 2OENG 3QFSA 3R0XA 4KL8S 1RQNA 3UMVA 2ABWA 1RI2A 2GK4A 5I47A 4N0DA 4PGFA 3ESQA 1J42A 2BEWB 2P4SA 4N5MA 5HIKA 3JYHA 2VHJA 4QGHA 4H7PA 3MGGA 3OFNA 5HA5A 1EUDB 4WZ6A 1HZJA 3TZKA 4CIDA 1A7AA 4XD2A 2HBQA 2YRXA 4M53A 4J0DA 1E66A 3W5SA 4B81A 4P1ZA 5LZ4A 1Q77A 1E2QA 5KVVA 3KLNA 1BA3A 2Z6AA 3DVAB 4WW0A 1DO2A 1CIVA 3N8NA 4TMTA 2ZZMA 1H42A 4N12A 4CPDA 1PJAA 4RDHA 2PX5A 1LC0A 2O3UA 2YVLA 4QDZA 4HXGA 3ZQ6A 1L8XA 1CP2A 3IUMA 4D3SA 1P6XA 3LC0A 4FBMA 3R7DA 3SZGA 5JJCA 1YQTA 1YZTA 1W4AA 3PRHA 5AM5A 2BIFA 1LKZA 3VKVA 4G6ZA 4FW8A 4M1SA 4L78A 3C6QA 3EHDA 2C2GA 1J1UA 5THKA 1T2DA 2PV0A 2XYRA 4Z51A 4MS1A 3CGGA 1X86B 2OP0A 1DI0A 4P7BA 2F6RA 1C9NA 4JGBA 1RC8A 1N2OA 1M7GA 2QOEA 3BIFA 3F7MA 3ENKA 2YC4C 1J06A 3QX9A 3KQTA 3NUGA 4G07A 4TROA 3ROXA 4DHEA 4W5RA 5GY7A 3IVAA 3PPIA 1XDBA 4CL2A 3EGDA 4KP7A 5KNCA 1ODTC 4P3KA 1M2VB 3HGQA 4UXJA 3CVYA 16PKA 3HL0A 4BFTA 5JD6A 2BAGA 1NBMA 2XA9A 1Y8QA 3NBYC 2QLMA 4G1MB 4MW9A 4PICA 1OZGA 3ZHSA 1FJ2A 1JJIA 2Q0SA 4WCFB 3QVLA 3FPGA 1F2UA 4JROA 4RY2A 5ENDA 1VHTA 1EX9A 2RIPA 4O02B 2VDRB 1XQ9A 4NJEB 2IZ1A 4KPFC 3ZEIA 1QHFA 1M7BA 1Y9EA 1XZAA 2GPYA 4L7QA 1JFSA 3DCNA 5BY2A 1T1RA 2IHTA 1E1QA 4JCOA 4LGCA 4OQMA 4CMEC 2A1IA 5ALDA 5M04A 2MWMA 3FMVA 4IZIA 3EVAA 5TR9A 3VU8A 1YR2A 3C24A 3GJZA 3L7DA 3V34A 2H4FA 5TMPA 1MKYA 3HLTA 1YB5A 1WW8A 4HAXA 3RU9A 1OJ7A 4QDKA 5KHLB 2ANBA 3I9OA 5TGZA 2FQQA 3T3MB 1GEEA 2HGZA 2PRKA 3S1LA 4BLVA 5DU2A 4MGHA 3K7EA 4UNQA 5E9WA 3WGZA 2WJPA 2QRLA 4BZPA 5TF0A 1TQ4A 2EWVA 2JH9A 1OAOC 2YHSA 4FYWA 4DM4A 2BKEA 3PUKA 1OLUA 5FT9A 1L5LA 3CUUA 5JD4A 4OHUA 4ND4A 2G4LA 2ZU0C 2ZUEA 2PWAA 3EMBA 4D9IA 1R10A 2XOEA 4D98A 3SOZA 4N40A 4OH7A 4ZI5A 1JXQA 4P82A 1L5VA 5BQ3A 2PZ8A 1U65A 1O54A 5JNVA 4W9RA 4JUCA 4ZODA 1R6UA 4HFJA 3B6EA 2Q1TA 4RMNA 3T9DA 2VRNA 3G23A 1J0BA 1Q0LA 3A9VA 1CZNA 3COYA 3G85A 2M1XA 3HZZA 5CX4A 1O77A 4EGCB 1NDQA 4EVRA 4ZVLA 4QQNA 2WRZA 1KFCB 2VF4X 3MD0A 5ELLA 4ENWA 4JSRA 2HN9A 4UBKA 5L7TA 4BRWA 3RWBA 4FUTA 4KSCA 3UEOA 1RE1A 3KBBA 3VHRA 3ZIAA 4BGIA 4L51A 2JFUA 4BBZA 2LBPA 3P32A 4OXKA 4Q9HA 4ECAA 4B3JA 1XQYA 3PUHA 3GUHA 1UAYA 1X1BA 4FFBB 2WK1A 2CLCX 3GFSA 4TGLA 5CUQA 3GQBB 3W77A 3WZLA 2R6GA 1OXMA 5C52B 1D7OA 2H07A 2NTJA 2Y1DA 2VPYA 3AM4A 1RIIA 2P9QA 5ICFA 2OD2A 4CZ2A 1BZYA 1J99A 2PAFA 1P74A 3AGQA 3CCBA 3W2GA 4OQ4A 5KSZA 1RQRA 5IFLA 5FR1A 1ZVVA 3ETEA 4IZ6A 3D6NB 1X70A 4Q7KA 1E8NA 4YC7A 1U31A 3SM9A 1JJAA 2FEOA 3LVFO 3VZBA 5EJ9A 1JX6A 4CM9A 1MIHA 4KAXA 1BO6A 5DNYB 1W93A 4K6KA 3ZH9B 5JALA 3FB1A 5K99A 1ZU5A 1I5EA 2OO5C 3O8BA 3UBMA 3DW1X 3IEKA 5A9SA 3Q8WA 3A1TA 4NXMB 1NG9A 2C2ZA 1H2RS 3DZFA 3IOMA 4LZWA 1NQTA 3IAUA 2CD9A 2B4YA 1M8JA 1B00A 4BYGA 3WLMA 4P9NA 3W5BA 1GTL1 1EG2A 4KXMA 5CG1A 1SELA 3EFOB 4I4TF 1DKRA 3F5DA 4BQQA 3GJQA 2J09A 3BAZA 3F6EX 4HFRA 3PKIA 2ZWOA 1SEPA 1D6NA 3QVOA 4FBLA 4M7PA 4MQEB 2FWPA 2JIZA 3ROMA 4IJ5A 4ZDIA 1OSNA 5KU7A 2P2YA 2KHZA 3KYDA 4MMZB 4A0SA 2HK7A 3U7JA 1V9LA 1PI3A 1FFDA 1SCUB 1TADA 1ZM9A 3BGVA 4BZZA 1TXGA 4DTIA 4J76A 3GEEA 1EA5A 2GPSA 5FUVA 4F9EA 3KQKA 4TV8A 3U62A 5LR6A 2NUTB 4OBWA 4X6UA 3IAEA 3QIVA 5AM1A 5C5CA 1T9BA 3EBLA 4L5YA 4AULA 4HCJA 1SXHA 1WY7A 3NQ41 1PL0A 4MUYA 5AH0A 1DQYA 4D97A 1LF0A 1ZCFA 1AF7A 2C9OA 1SC3A 3KR2A 4UW9A 5JO9A 1XT6A 1Y6QA 4ML3A 3DPSA 1V43A 2BONA 3HWWA 1ML4A 2Z98A 3FFWA 3ILHA 4C22A 1QTQA 3QLUA 2GHQA 4BFCA 2Z2IA 5REQB 1IQ0A 1ZY2A 3NXSA 4UXIA 3NPMA 2ORYA 3COZA 4QOFA 1R4NA 1BD3A 3NC1C 5BUZA 5KUTA 1I1NA 1U9IA 2ORIA 3Q6MA 3JVEA 3UENA 1GGKA 4I8XA 3LXXA 4ZEXA 5JS1A 4U7DA 2AYXA 3CIFA 4L85A 1ACMA 3YASA 2JJ8A 1MZVA 3Q4GA 3WRWA 5BURA 2IIPA 3R7WA 1MRNA 4JUAA 2W71A 3N7TA 4A1OA 5B30A 2M6KA 5DMXA 2FUG1 1YZGA 2Z9CA 3E4DA 3WLQA 3NT2A 4KQJA 5DULA 3QWIA 2DCMA 3KQQA 1Z3CA 1NR5A 3TXAA 4CQMD 4HNUA 5KVSA 1V1RB 4JLVA 4LC1A 1NBOA 2PSEA 1RACA 2XUAA 4DXAA 3ISVA 3JVDA 2EP5A 4Z9YA 4G0VA 3DE4X 3H5RA 2DP4E 3PWZA 2WJWA 5ELXA 3O93A 1C9YA 1K5PA 4OP3A 5KDOA 4IRMA 4XEHA 1FFCA 3I9LA 1XCPA 2HNAA 3HEMA 3OF5A 5DH9A 3WAKA 5JSHA 2V7BA 4BNMA 1AHHA 1WR8A 4UUAA 4DCUA 1L7PA 2AG0A 5CMLA 3V42A 5IKPA 2HKIA 4OHKA 1RI1A 4EH1A 1FNCA 3VBEA 4F4CA 3H6KA 1G17A 1KQPA 2DTXA 1UKAA 2R5WA 1K8YB 2LIPA 3QFTA 4PU0A 1OA1A 2I3DA 2PQ0A 2RCNA 1HNWB 4MV8A 2P69A 2F3QA 3C3CA 1GA4A 1MOQA 3RYIB 1G21A 4XDZA 4C2BA 4GDFA 2JAUA 3EGOA 2REQB 3DM5A 4NBRA 2WUDA 3PUXA 4PLTA 4L76A 2ZXEA 4UFOA 3CBQA 1N8NA 3KKKA 5DX0A 5J59A 5EXEA 2WHPB 3A26A 4KIWA 4DDTA 1KDVA 3D8HA 3LGXA 3WWYA 1VLJA 1FYWA 1J5XA 1ADBA 4J4BA 1S8NA 1HY3A 1N3YA 3C3BA 1LI7A 5E0OA 5EKXA 3T9AA 3TZEA 1V25A 5JJ5A 1ESZA 3WA7A 3MWFA 3EPJA 3GELA 4DLZA 1UFRA 2W6JD 1YDMA 1W4CA 2HT1A 1T1EA 5FRDA 1P3Y1 3NBZC 4UHFA 2BFBA 3ACCA 3ER6A 2YCBA 4M0CA 2VJKA 2QVLA 1ZIOA 1P4HA 3C3AA 5CDUA 4U6SA 4BAUA 4BGUA 2CMDA 1IOWA 1Q7CA 3FNQA 1EE9A 4ZCQA 4GI5A 4LOHA 2Z1DA 1WCIB 1O89A 3UMMA 3PG5A 1ZUNA 4IZHA 2HLDA 4LXXA 5AYVA 2QNIA 3GP8A 3CGWA 4X84A 1JEQA 4Z3DA 3PYLA 5AI0A 4YRNA 4EI7A 3NCHA 3QEAZ 4JQYA 4Q3CA 1G7SA 2V9CA 4JJZA 1I7SB 3U09A 2BTQB 3MCZA 3K71B 5IT9A 3IHLA 1EEHA 2DB3A 2FG6C 3D3QA 1BFKA 2XYGA 5EQFA 4BAGA 4Y2PA 1KYWA 2XPCA 3TVDA 1M8GA 3UXEA 3DZJA 5JE8A 1EFDN 4M0FA 2YQ5A 2O8CB 5AKGA 3L6CA 1HT1E 4I2VA 1X1CA 1L0BA 3ZBQA 4MWSA 4W8HA 3MCVA 4AS2A 1KPHA 5A7GA 1SWVA 4GI3A 1M6VB 1XTSA 1TCUA 4WKNA 4BX8A 4AC9A 3HVIA 2BFOA 3MN1A 4RLHA 2GRUA 2JHFA 1IWOA 2YHIB 2FWNA 5BNIA 4IS3A 1GAEO 4KQHA 4XD7A 3S1AB 1W59A 1RFGE 1OFVA 4QHTA 3ILSA 2VP6A 1ZMBA 3VPDA 2JCBA 3HO6A 4HGNA 5EVCA 2V4UA 5AW1A 2BF7A 3ANYB 3GDWA 3SKVA 2PEYA 1CQJA 1W85B 3BXXA 5AJYA 2YJNA 2XMCA 3ND7A 3DD5A 1UK6A 3C2QA 1R50A 3GW8A 1GZ4A 1W30A 4UASA 4KFCA 1SBZA 3K5PA 2PS1A 1L7OA 3M81A 3CIOA 3ZWDA 3HWRA 4IDDA 4G1FA 4I55B 5I5EA 4D9CA 3OQIA 4JEHA 1LSUA 5F52A 4N18A 1HDOA 1GRVA 1B15A 1TMOA 1T24A 1N8SA 1JYEA 2XUDA 5AJXA 2CXPA 3UV7A 4EMTA 4LFCB 3ZXXA 4FILA 4FS3A 3WMGA 1GA1A 4ANFA 4BCCA 5D86A 2I2WA 2P7HA 1GITA 3PE4A 3SX0A 3FLMA 3MS4A 4Q5IA 5ALNA 3L8DA 3ZUGA 4TZ6A 1G8SA 4DXHA 5HIAA 2Q2NA 3JTEA 1F12A 3AR2A 3VNBA 2A1UB 3ABZA 3RSFA 5JD5A