1DWPA

Crystal structure of hydroxynitrile lyase from manihot esculenta at 2.2 angstrom resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
b'PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYNITRILE LYASE
molecule tags Hydroxynitrile lyase
source organism Manihot esculenta
publication title Structure of Hydroxynitrile Lyase from Manihot Esculenta in Complex with Substrates Acetone and Chloroacetone: Implications for the Mechanism of Cyanogenesis
pubmed doi rcsb
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dwpA00
2WJ6A 2VJCA 2PBLA 4CCYA 1A7UA 2OLEA 4E15A 1BE0A 1ZI9A 1X70A 2XUIA 2Y2UA 5AKXA 1MAAA 1WPXA 2GZSA 3BDVA 1P0MA 4G4GA 4EA6A 4B0PA 6YASA 1AX9A 5EIAA 4X6XA 4QWWA 3D3NA 4M0MA 4ARAA 2WIFA 4XJVA 5K3DA 4EY5A 2CZQA 4MQMA 2HFKA 2VJBA 1QIDA 1XQVA 2ROQA 4BCDA 1LPNA 5CH5A 5JAUA 3F98A 4HXEB 3I6YA 3MGAA 5A62A 5DYWA 3V1NA 4W9RA 3F97A 5ALJA 1LBTA 1DU4A 3ANSA 4IO0A 2QVBA 4LXHA 5EFZA 5IVIA 4KE6A 5LZ9A 3BE8A 1GPLA 2HIHA 1AUOA 2AJLI 5I7UA 2ZYRA 2ONCA 2W6CX 1VZ2A 5DNUA 3FOBA 5F4ZA 4U2FA 5LP1A 1JMYA 3MUOA 1ZD4A 1YCDA 1HL7A 3GA7A 5KREA 4FBLA 1XRRA 4F5ZA 1VE6A 5AK3A 2PPLA 2VJDA 3O4IA 3WKDA 4G9EA 1XLWA 4U2DA 3ZLVA 3D0KA 1E8DA 1MO2A 3I1YA 4YK7A 4FNMA 4U2EA 1KU0A 3O9MA 4H7HA 3AFIA 3WL6A 5JALA 4Y9SA 7YASA 2BCEA 1CLEA 3FVTA 4DSAA 3LIPA 1YA8A 1ZOIA 3SK0A 1QIHA 2H7YA 2WG1A 5ALXA 3PUHA 3STWA 1NU8A 2AJDA 1U8EA 2OXEA 5JD4A 1QTRA 2O2IA 3ESCA 2Z8XA 5K3AA 3SWWA 3BL8A 2PU7A 4C4ZA 3DL4A 4QLOA 5E4TA 1E5TA 4PNZA 5FV4A 3DYVA 4AQDA 3DOIA 1L7AA 5AOBA 1WOMA 5K3CA 3E4DA 4TPKA 4AMZA 2EEPA 4B6GA 1CUHA 1E89A 4Y2YA 1BEEA 1XQXA 1R3DA 5JASA 1KEZA 3WA7A 1UOPA 2PSHA 4Q3LA 1DTEA 2ZYIA 4OYYA 1FFCA 4DTCA 4KAJA 2FX5A 4XWGA 2DHEA 1PV1A 4X00A 5DYYA 4AB1A 1YAJA 2C4HA 1R1DA 1MTZA 3BJRA 2QMQA 4FBMA 4FLFA 3R41A 4IQ4A 4Y2PA 4UHBA 3SX4A 4AO7A 2GZRA 4BDSA 3BWXA 5LYYA 4U2BA 3M82A 1ZICA 1L7RA 4K6KA 2H1IA 1F0NA 4DNQA 2WTNA 1EX9A 1F8UA 2HA3A 5EGNA 3QM1A 3OG9A 4Y2RA 1FFEA 1EVEA 1YAHA 2VATA 2XUKA 3A2MA 3BF7A 3PF9A 2JGIA 5AK5A 4GLBA 3DOHA 4MWSA 3STUA 1DQZA 3H19A 1UWCA 3F8SA 4OCZA 3U0VA 2FUKA 4DLNA 4BAGA 2WSLA 4IH4A 3JW8A 2LIPA 3I2KA 1DWQA 5CW2A 4LYEA 2WUEA 4GEGA 4BBZA 4GECA 4Y2VA 1WM1A 4W63A 1YB6A 2VTVA 1VKHA 5AHXA 3C5VA 1BS9A 1SCQA 3NOXA 3R0VA 1CRLA 5AKIA 5AO9A 2JEYA 2DQZA 1DT3A 5DJ5A 4H35A 3IUJA 3G0BA 3BXPA 4K6GA 2WQZA 1WCYA 1CFJA 3O0DA 5SYMA 4IH1A 1DINA 5ALGA 4GDMA 5JZ9A 3V9AA 3QMMA 1LZKA 2VT7A 3QPAA 1UXOA 4J0HA 3KSRA 2HFJA 1OILA 2B61A 3FYTA 5AICA 5FOQA 2WFLA 4QNNA 3MVEA 2HHAA 4WJLA 3V1LA 3D4LA 1BRTA 4FTWA 1GKKA 3PE6A 1IVYA 2GYVA 3DKKA 3M83A 1CPYA 4XIIA 5AOCA 3C6YA 3BIXA 5FLKA 5ALUA 2WFMA 1ZIXA 3EBLA 4PW0A 4G9GA 3N0TA 1CUWA 5AK6A 3WIOA 3VJKA 1XRNA 2HA5A 3FCYA 1EK1A 5ALIA 1XZJA 4BAZA 5LZ5A 4CG1A 2DHCA 1LGYA 3LP5A 3W06A 4ZGBA 3G9XA 4UHHA 3PICA 3R3VA 3FAKA 5E4YA 5AKYA 4H7DA 2CJPA 1QIGA 3WYDA 2H7XA 1GKLA 5AI8A 3S8YA 1Z68A 2C58A 2WHRA 1K5PA 4Y2SA 3G0CA 5FXMA 5HFNA 5HCUA 1DQYA 2RONA 2JBWA 3QH4A 1QONA 1B41A 2QUBA 1JKMA 2QTBA 4BZZA 2GBCA 3H2KA 4KYVA 4X91A 4DYHA 2R11A 3ZLUA 3O4JA 4GBGA 1A8UA 4CCYB 1OCEA 2WIGA 1MPXA 4BB0A 1T4MA 5AI4A 1TQHA 3WK9A 1E8MA 2X8BA 2OCLA 4B9AA 4YPVA 5DNVA 5E2IA 5AM0A 2NW6A 2O7RA 4A23A 1QIJA 2J3DA 1CUJA 2QJRA 2WIJA 1R88A 2WIDA 2X76A 2RHTA 2XMSA 4BRSA 2WG0A 5AM3A 2VT6A 3L1HA 4WDRA 1F0PA 3I2HA 2OAEA 1XRPA 2OQVA 5AKKA 1QGED 3WK4A 4K6HA 4Q05A 4BRZA 3FLBA 1AC5A 4FDMA 4INZA 2Z5GA 5JIBA 1F6WA 4Q1VA 5AKJA 4X85A 3G8YA 3GZJA 1VLQA 2C5FA 3FWHA 3VISA 3O95A 4ZREA 4N8DA 1THTA 4AO6A 3BDIA 1XRMA 3WA6A 2O2GA 2Y6UA 3ESDA 2ACKA 4G8BA 2PSEA 4C88A 4ZWNA 5T4EA 2H7CA 3IIIA 2CUTA 4HRXA 4UFOA 4QE3A 2DQYA 1USWA 4RGYA 3STTA 1E3QA 5FKJA 5A6VA 2OG1A 3OOSA 5JAPA 1EVQA 4J0GA 1NX9A 1Q0RA 3VJMA 3IUMA 1VZ3A 2DHDA 5K3EA 4B81A 3PFBA 4UFNA 1YSCA 1ISPA 4XX1A 2ZJ6A 1BU8A 1JU3A 2XMQA 2PUJA 1Y7IA 2PVSA 1O6GA 1MJ5A 3F96A 4H7EA 1YB7A 4W1PA 2XQFA 2WUGA 2JF0A 3R40A 5EIEA 2AXEA 1UKAA 3ESBA 2QXTA 1MNAA 1CUGA 3N2ZB 4P92A 2QS9A 2ZSIA 1AGYA 2HU8A 3JWEA 2WIKA 4TGLA 2JIDA 1B6GA 2GBFA 3SC2A 4RNCA 3S2ZA 4DMHA 2O2HA 5HK8A 2XMCA 1ODTC 3HXKA 2XT0A 3DYIA 5BWBA 1MX9A 5IVKA 5FPPA 2IITA 4I3FA 1ZD5A 1JJIA 4P93A 2B9VA 2OAGA 1TK3A 5D6OA 4ITVA 3RM3A 3ZLTA 1EB9A 1W4LA 4X93A 1CEXA 1UZAA 3DEAA 5EI5A 3TRDA 1QFSA 3WYNA 1K6EA 1YASA 3W05A 2GYUA 1XZDA 2Y1KA 3IVMA 3I28A 1ORVA 2WHPA 5HF8A 3FYUB 4BE4A 1VE7A 3HRHA 3V48A 4HTAA 2VAVA 1DX6A 5HZGA 3VKFA 2OCKA 2XMRA 2WFLB 3DDUA 2GYWA 2XQKA 4CG3A 4GHWA 4Q3OA 1QFMA 4UHDA 1DWPA 1JJBA 5KWIA 1N5RA 5JYCA 3ZWQA 3OURA 4CI9A 3I6ZA 4H0CA 4IH9A 4KACA 3WKAA 4BDTA 4QDUA 1U4NA 4MXDA 1ACLA 2O7VA 1CUSA 3ED1A 1XZLA 1W1IA 2I3ZA 3QPCA 2XUFA 4UHFA 4CIAA 5ALSA 4Y2XA 5IH7A 4LHEA 4UBJA 2C5GA 2P8SA 3IA2A 5AM1A 3DJYA 4UBLA 1CQWA 3C6ZA 3ZI7A 4EY8A 5EHZA 1QIEA 1BROA 4KRYA 4BP9A 3HACA 4UPDA 2HM7A 2HA2A 5JARA 2CMFA 4LXIA 5LKRA 2ZYSA 1XZEA 5FDFA 1EH5A 4S0XA 3P2MA 4C87A 1J2EA 1CIJA 4M0EA 4X71A 4NVRA 1QOZA 4UBNA 5HQ3A 4JEIA 5CT9A 1XZGA 1XZBA 2Y2VA 4U2CA 5ALOA 1WB5A 3IBTA 2FJPA 1TCCA 2IX9A 4PQEA 2HU5A 3EQ7A 1UK9A 2X5XA 5C8ZA 4AO8A 1UOQA 3B12A 4PF1A 1ZIYA 2G4LA 4JH0A 4X97A 3FNBA 5K3FB 5T4BA 1HPLA 1MT3A 4DIUA 1GZ7A 4EB0A 1VXRA 2XMDA 4I4CA 4QEKA 3O9VA 1MAHA 3T52A 4CCWA 4GI1A 1H23A 4I19A 2QJWA 5ALFA 4HXGA 1DWOA 2PL5A 1GPKA 3AIKA 3D7RA 1YR2A 4J3JA 1RP1A 4J0JA 4ZV7A 3AZOA 3ILSA 5C81A 1HDEA 2RI6A 3C8DA 1BCSA 1CUBA 2XUGA 1XRQA 2ZJ7A 4NS4A 3STXA 3R3YA 2Z8ZA 2BUBA 1XKTA 1R50A 2WILA 5AM2A 1WHTA 1UKBA 3TJMA 1AMNA 4OPMA 3QVMA 3Q8WA 4KAFA 5HKBA 3WL5A 2PUHA 1GT6A 1HBJA 3G9ZA 4OD0A 2QKYA 5LKAA 2R8BA 4G8DA 5AIAA 3QZUA 1JMKC 1A88A 5A7FA 1K63A 4N8EA 5CXXA 5K3BA 1VA4A 4C01A 3T4UA 1XZIA 1XZMA 3R3UA 1Y37A 2XI4A 4ZI5A 3E3AA 1CUXA 2WKWA 2HL6A 4CIBA 1R4ZA 3AINA 4HXFB 3U1TA 3WZMA 4UBKA 4KEAA 3CXUA 5ESRA 3CCCA 4YX9A 4BTLA 1DT5A 1MN6A 5JZBA 3QITA 1N1MA 2AJCA 1XKLA 3D2AA 4K5QA 1A8SA 3BF8A 3HI4A 2J4FA 4B82A 5JD5A 1W75A 4C4YA 5LZ7A 1XFDA 2G5PA 4AZ3A 5JATA 4QZVA 5AI9A 1FFBA 1U65A 3K2IA 1MNQA 5C8VA 1J1IA 1QIFA 3WK5A 3H04A 2XDWA 4W1RA 3KXPA 4FLEA 4RE5A 1UOOA 4BP8A 3G02A 2WJ4A 3Q0TA 1IZ7A 5ALQA 4A16A 5FPQA 3TGLA 1IMJA 2WLSA 2DSNA 3C43A 2JEZA 2AJ8A 4P08A 4J03A 1EB8A 2JGMA 5HK9A 3UUEA 1VJ5A 3YASA 4EZIA 1SFRA 2VQ6A 4DMFA 5CTAA 2DFPA 2WG2A 3WK6A 1JU4A 1UFOA 3UMJA 1M33A 2PSFA 3AJAA 5BOVA 5LLSA 1KU6A 4C6HA 5ALTA 3KD2A 2JGLA 2XQGA 4WY5A 4AMYA 4BATA 2XUDA 2OCIA 1W52X 1CVLA 4B0OA 2QZPA 1K4YA 3EQ8A 3AZQA 3C6BA 3W9BA 4W1SA 2JGJA 1P0IA 2WFZA 3L1JA 3EQ9A 3I2GA 3AILA 5AI5A 1QTIA 4G8CA 5CH3A 2J3QA 3IB3A 2DCMA 4AN0A 3GFFA 3ICWA 4UHEA 3WWEA 3IUNA 3WKEA 1CR6A 1H2YA 3G9UA 2I78A 3OC0A 2CB9A 2QXUA 1X2EA 4QA9A 3DQZA 4HS9A 1WB6A 4DNOA 1QIMA 2HADA 2YYSA 4WDQA 4PV7A 3KDAA 5LZ4A 5HF5A 1E8NA 1GQRA 4Z49A 1QJ4A 5ALHA 3FSGA 3R3ZA 2G63A 1A8QA 4J0CA 3E1GA 1FJ2A 5HKAA 4G5XA 2XQIA 5EIHA 1GGVA 5DTJA 3KOOA 4OU4A 2XE4A 3HLKA 1I6WA 4AX4A 5T4HA 3DS8A 2RGUA 3HC7A 3H2HA 4CG2A 5EHNA 2HDWA 3VXKA 2ZJFA 3DNMA 2G5TA 1P0PA 2YASA 3X3HA 2BGRA 2PU5A 2K2QB 4OUKX 3EIOA 4QWMA 2CEKA 4OYLA 4M0FA 3KWFA 1YS2X 2OCGA 3C8HA 5DNWA 4J7AA 3ANTA 1RWQA 1UKCA 2VF2A 2JGEA 4BAUA 3V1KA 3TEJA 2C7BA 3BIWA 5CT6A 1CUAA 5ALVA 5CMLA 4BTVA 4L3WA 4B9EA 1UT6A 3KWJA 1D07A 3HJUA 1H2ZA 3DKRA 4Y2UA 5AIBA 1XLVA 3M3DA 2WU3A 3QPDA 4JUIA 4H7JA 1G42A 2Q0XA 2XQJA 3C6XA 4QDOA 1QO7A 5ALWA 4L72A 4HVTA 4QDXA 1P0QA 1JJFA 4P9NA 1Q83A 4DNPA 3OTQA 4BZWA 4FMPA 5YASA 4X94A 2BUAA 3WK7A 2PKYX 2QM0A 3HSSA 2HRQA 4O08A 4BCCA 1JT2A 2ACEA 2J4CA 4X7BA 3F67A 1XRLA 1SCKA 1XQWA 2UZ0A 5HFAA 3K9BA 1Y7HA 3MUNA 3R3WA 5DWDA 4CFSA 3WJ2A 2ZVDA 3H2JA 1YA4A 1EHYA 1XZAA 3RK4A 2VJAA 3WQHA 5ALYA 2XUAA 3D2BA 5CH8A 4Y2TA 2HA7A 1ODSA 2IIVA 4B83A 3O4HA 4FWBA 4H77A 4RE6A 4KE8A 4MJ3A 1JFRA 1GPNA 1XQYA 3E0XA 2WTMA 5AP9A 1MX5A 3O4GA 4QDTA 1LPBB 3IULA 1E66A 3DCNA 4WY8A 1R9MA 4Q3KA 1W76A 2BFNA 4ROTA 4WFKA 1EA5A 4H18A 5JADA 4LKOA 4EBBA 4H7KA 4BYMA 1DX4A 2XUHA 5D7BA 4HAIA 2BJHA 4N5HX 4DMKA 2XUJA 1C7IA 2C0QA 3ESAA 5AKHA 1WHSA 4U2GA 3AUKA 3G0GA 2BUCA 4GWLA 4E46A 1AQLA 4OU5A 4Q34A 2QUAA 1AKNA 3WWCA 3WK8A 4PSCA 2QT9A 1G66A 4BVJA 3FLAA 4X6UA 4L0CA 5CBKA 1XLUA 2Z3WA 1C4XA 4JYPA 5AI0A 3H2GA 4G4JA 5SYNA 4ARBA 4LYDA 5JANA 1TAHA 4NMWA 5AM5A 4OSEA 1CUZA 3HEAA 5I9IA 3LLCA 4PSUA 1XROA 4N8SA 4FOLA 4MWTA 4OB8A 1ACJA 4J0DA 5ALKA 5JAHA 1L7QA 3FSGD 4KE7A 1SC9A 2HA4A 3PDCA 4KE9A 5C7YA 1FSSA 2XMGA 2D5LA 3IDAA 2C0PA 2YXPX 1ZI8A 2V9ZA 1RYYA 3H1BA 3H2IA 1EDBA 4FNGA 1SCIA 1XZFA 3OPMA 2WHQA 4BC1A 1BEZA 1EINA 2QR5A 4F21A 2OGTA 2XMBA 3FVRA 4QDZA 4EHBA 4B84A 2XLBA 2GBGA 3OM8A 2V98A 3WKBA 4B85A 5E4JA 1EDDA 3WLAA 1THGA 2EDAA 2I03A 2VAXA 3CCBA 4H7FA 4WCVA 2XB6A 3D59A 1ORWA 2HA6A 5ALEA 4FKBA 4L9AA 3H0CA 4X90A 1YS1X 2ORYA 2RIPA 1J07A 1QE3A 2Y6VA 5AKEA 3C45A 2H9YA 4EUSA 2AJBA 3NUZA 1J06A 5LIPA 4BC0A 4WFJA 2YH2A 4B7ZA 3HABA 4D9JA 3AIMA 1XZCA 3LCRA 1VXOA 3WL7A 1MX1A 1GQSA 1C7JA 3C5WP 5BWCA 5AI6A 2V97A 1LPPA 1UK6A 5CT5A 1IUOA 4X92A 3A70A 1EK2A 2JGKA 4RPCA 3GUUA 5D3ZA 3WKCA 1PFQA 3I2JA 4QLAA 4UBIA 3L1IA 4DNFA 4MYDA 3EF3A 2PSDA 4KR0A 4HRYA 5K5EA 2ES4A 2WJ3A 1LPSA 2FJ0A 2PSJA 1TCBA 5FRDA 3C87A 1GXSA 1T2NA 3G7NA 5FP0A 2CBGA 4N5IX 5JD6A 1ZD2P 5CT8A 1LPOA 4UUQA 4KRXA 3A2LA 1CV2A 1U2EA 4ZRDA 3I2FA 3IURA 4E14A 2RAUA 1H2XA 5AJHA 5EHXA 2DR0A 4LXGA 2VEOA 1FFDA 1BN6A 4DGQA 3NWOA 1LNSA 4J0IA 4W1QA 5A7HA 1LLFA 4Y7DA 3STYA 5A2GA 1VOTA 4Y2JA 5H3HA 3WI7A 3WJ1A 2OQIA 3STVA 2CKMA 3V1MA 4ETWA 2W22A 1LPMA 1UK7A 3WZLA 3ZPXA 1CUYA 4C4XA 5AKZA 4H7IA 2RHWA 5ALLA 2BGNA 3F9CA 1HKHA 1ZJ4A 3QBJA 4A5SA 3LS2A 5DYTA 1N5MA 1AZWA 5C8XA 4AZ0A 5JZSA 4F0JA 1UK8A 1ZD3A 5CRIA 3K6KA 4EY4A 2XUOA 3WWPA 5HQ3B 3R3XA 1MU0A 1N8SA 5AH0A 2HU7A 4XVCA 3B3QA 3PFCA 3WMRA 4E11A 3GROA 5EHQA 4C89A 1H2WA 2V96A 4KAAA 1IUPA 5AOAA 2ECFA 4UBMA 3FBWA 1HQDA 3G9TA 3CN7A 3D2CA 5HF6A 1AURA 3BJMA 4J0KA 3W04A 3I1IA 1PJAA 3FLEA 5AM4A 3RKSA 3NGMA 1W6RA 2WUDA 4MYSA 3G0IA 4GW3A 4ZV9A 3ICVA 4UFPA 1LZLA 3ZV7A 3PI6A 1BCRA 1CUFA 2PX6A 3QMVA 3VVLA 1TRHA 4LIPD 4MEBA 5KBYA 4IHAA 3FYUC 3D5EA 1ZI6A 4K2AA 1IUNA 1EI9A 5D3KA 2QRUA 4UBOA 4BCBA 3LIIA 5DTIA 3I2IA 4EY7A 2HRRA 4UHCA 1VA5A 1LPAB 4X95A 1QIKA 3I6MA 2XUQA 1QIIA 1BN7A 2EDCA 5AK4A 1CUCA 5J3JA 4FLMA 4AXBA 3FYUA 3FCXA 1FFAA 4V2IA 2E3JA 5BV7A 2JGFA 4PSDA 5T4FA 1CUUA 2WU4A 4DM7A 4FHZA 4Y2QA 5FUMA 3VJLA 5DLPA 4BE9A 5LZ2A 5I8PA 5ISMA 1K8QA 5JAOA 1WB4A 2ZYHA 2VSQA 3HZOA 2HA0A 4AN1A 4OB6A 4BVKA 3W2TA 5LZ8A 3WL8A 3H1AA 3WIBA 5ALPA 3DL7A 2QOEA 3VVMA 1R9NA 4NZZA 1JI3A 4JNCA 5A7GA 1WPRA 2D0DA 1QO9A 1XZHA 1H22A 3VDXA 4OB7A 1ODCA 2OPHA 4HZGA 3AIOA 1LBSA 4MQLA 1QLWA 3B5EA 5ALMA 4MEAA 2ZSHA 1CUIA 4PO3X 3DD5A 4Q82A 4WFIA 3QYJA 5AKLA 4G4IA 3WWOA 5KWJA 1QZ3A 5ALRA 5ALNA 2B20A 2I3DA 1EXWA 3PUIA 3DLTA 4F60A 4KJXA 3RLIA 1OXMA 4X3CA 2PM8A 1CUVA 2XLCA 4X6YA 5IKXA 4FFWA 5CXUA 4YASA 5ALDA 1ZGBA 3H18A 1HLGA 5IVDA 1EDEA 3W9UA 2XUPA 3H17A 1G4HA 2WHPB 2GBIA 5CURA 2BKLA 3G0DA 3IUQA 3QMWA 2VA9A 4JYMA 2BAGA 2Z3ZA 3UUFA 3HYSA 5HF9A 3WWDA 4ZXFA 1ZJ5A 1CUDA 5K3FA 5AKGA 4B80A 5ALZA 1IZ8A 1Q84A 5CT4A 2OGZA 3PF8A 3RARA 1TKRA 3A2NA 4EY6A 3GBSA 4DMCA 1XZKA 5IVHA 1TIBA 1NU6A 3AZPA 1S8OA 1O6FA 4TVKA 5A71A 1X2BA 2B4KA 2OGSA 3C70A 1SOMA 4BVLA 3M81A 3JYHA 1CQZA 1ETHA 4G1FA 1TCAA 4FFVA 4GXNA 1ZGCA 3GELA 1G5FA 4DSZA 3CN9A 3A6ZA 1Q0ZA 2XMZA 2WM2A 1CUEA 2WUFA
chains in the Genus database with same CATH superfamily
3AOEA 1X15A 2JEOA 4LKRA 3AHIA 2C4MA 2BDEA 3OLVA 3C1AA 1H9BA 4PAOA 4C43A 2FPRA 3M5DA 2QRVA 1TLLA 1Z29A 1PZGA 1M2HA 1ZA2A 2FHPA 3E3MA 1FP4A 1H0KA 2AX3A 2VQFB 1ZI9A 3UJPA 2XUIA 4LHSA 4PR3A 1MAAA 3NTLA 5FFFA 1VLMA 5A1TA 1ABFA 3WG9A 4BO5A 1FW8A 3CLTD 5B1DA 3K5PA 3SIWA 3ZCTA 3UKJA 2PAAA 4P4LA 2V6MA 3NHLA 4KBGA 3SXUB 4KNYA 3UOGA 4X6XA 3SZ3A 1AB5A 4QWWA 3D1VA 3BXHA 2C04A 3FLMA 3A58B 4EB6A 1H2EA 5EXTA 4ARAA 1AKVA 4BN5A 3SOZA 3MPUA 1XKXA 4X1YB 1F2VA 4LGYA 4MQMA 4OVKA 4JI2B 3UUWA 4RGQA 1RC8A 5IYZF 1GGHA 2YHUA 4ZT7A 1QO0D 2F9LA 3LC2O 3PHGA 2AI1A 2H63A 2AWNA 3ZWCA 3F98A 3WAKA 2I6XA 3EK2A 3LBFA 1A9ZA 1JIVA 1P77A 3I6YA 2QRLA 3M5WA 2DY1A 4MWBA 1NF8A 2PYZA 3VV3A 5DYWA 5K2OA 4YMIA 4A36A 4PZYA 3GJZA 3HEBA 1Y6QA 1BW9B 4GPIB 4DYVA 1NATA 4GVPA 1MT0A 3I5XA 1HO3A 3N7TA 3HMKA 2FKAA 4KSBA 4U6SA 3KYJB 5A02A 4NCAA 2QVBA 2EBUA 4KE6A 3ELWA 4G8JA 1GPLA 3EIEA 5CLHA 1PQYA 4BNTA 1GQFA 1Y8CA 2IHTA 2VBIA 5LQKA 2R97A 4H2DA 2R44A 4MA4A 3SR4A 3TEFA 1NF9A 5C7LO 5DNUA 5F4ZA 4KDEA 1W93A 2VLIA 3E7FA 4TTTS 4U2FA 2AMJA 4ZVTA 1CHNA 1T1GA 4KPFC 3MUOA 2BP7A 1BXZA 1T9ZA 5BMVB 1FRFS 1U0LA 1ZD4A 2Z2YA 3SEQA 1EU1A 4RGBA 3KVNA 3CJTA 2J31A 3VHRA 2CXUA 3HA5A 3EMKA 1TM1E 3T61A 1UDBA 4D41A 3QXXA 3IXMA 2X2EA 2QY9A 5BUZA 1YHZA 5AK3A 2OPBA 5EE0A 3E8MA 3WYFA 3VUFA 4EJSB 2P9ZA 1BKDR 5IK2A 4Z2YA 5JSZA 4NPHA 1DBPA 2VJDA 4HRAA 3RIGA 1ABEA 3K2BA 4QVIA 4IR7A 3QV1A 3WKDA 1LSOA 2RFLA 3LO5A 1B0UA 3L6RA 4EHFA 4YUYA 1UJ5A 3CZ9A 4V0NA 5KOJB 1NBIA 3JD3A 2Z2IA 2ZYVX 2R6DA 3I1YA 4QD3A 2RK6A 3MPOA 4YI5A 1DBVO 1U7TA 2ZYTX 3MCUA 3QMPA 2P2LA 4A0FA 3H9JA 4U2EA 3ETDA 4L8GA 3EC2A 4LJ6A 5A4KA 1QM5A 1UPAA 1A5SB 1SIWA 1NASA 3O9MA 3I30X 2ODNA 1WQ4A 2DJIA 2OKCA 4M9SA 1N5LA 4OGWA 3REQA 1KAMA 1VBNA 3L79A 4A8PA 1GNLA 4E2XA 2EBHX 2J3MA 3QWFA 5JROA 5LOVF 3DO8A 3AF6A 3H97A 1RKQA 4UD2A 2DRIA 4Y9SA 3ZZMA 5JALA 1M73E 2HW8A 3SX2A 2QRMA 2D6FA 2DBRA 3DCYA 2BEUB 1RBYA 3B7GA 3MWYW 2J9FA 4OHMA 4ZCLA 4KK4A 4O1HA 5F5NA 1SCJA 1UDXA 4QARA 3BDAA 4ZK6A 3KXIA 1TGYA 5JI3E 1NU8A 3KSMA 1EVIA 2QE7D 1T36A 2AJDA 5B6PA 1SUSA 5CK5A 5E6SA 1Z36A 2OXEA 3KJZA 5HHTA 5JD4A 3UFXB 1MTOA 2CXXA 2Q2WA 2WYUA 3HR8A 3JR7A 2QTVA 1EP2B 1U3TA 2I99A 2O2IA 3QXSA 3HL4A 1WXXA 4FT4A 2OGWA 1CIVA 4X0EA 4AJ9A 3SQLA 1AZSC 2VXOA 1NA5A 4CM1A 4LY0A 4R9NA 3DL4A 4KQEA 4A0GA 3M4JA 3LD9A 4QUGA 1MB0A 3KT8A 4RTPA 4IIUA 4UUPA 1E5TA 1U0GA 1ZSVA 2P1RA 3UQZA 3VDQA 1Z17A 5K09A 5B1SA 4P81A 3RVNA 5KI6A 3PGMA 5DCLA 1CIPA 3FVQA 2CNWD 3DOIA 1L7AA 5AOBA 1M6VB 3NH9A 3W3ZB 3DAOA 4BB6A 1U7OA 4FZ3A 2P65A 4MKZA 4TPKA 1DI0A 1PR4A 2PVPA 3WY9A 2B4YA 4B6GA 3FWKA 2HBQA 3CFYA 5FFMA 4K03A 3L8MA 4Y2YA 1BEEA 1T1RA 1XQXA 5FTJA 1R3DA 1ESDA 2FI1A 4GOJA 3NONA 2VT2A 2CLDX 2HY7A 4C5AA 2HF2A 2RGEA 3ESXA 3OUUA 2GF9A 2VPTA 1CR4A 1KDRA 4JL8A 5K8IA 4TYNA 3ITDA 4PCUA 4D1YA 4JIGA 1NN1A 2HRCA 4QPDA 4UVDA 3QWIA 3NXSA 3RDPA 4ALMA 4C6RA 1T0BA 1I36A 4IDAA 1S4QA 1U63A 3OWXA 1SXIA 1LJ8A 1PWEA 2HREA 4QREA 1PWYE 2NSJA 4LHVA 4G0OA 1OROA 2QR2A 3KB8A 2IPNA 3A27A 2CBZA 4J3NA 1RU3A 2FX5A 5IJ9A 1J8QA 4YJDA 2DT5A 4AF7A 4DV2B 1KZYC 4RA9A 2I71A 3EDOA 1SQFA 5JS7A 1KEEA 4BY9E 2RGGA 4RL4A 5DIFA 1S02A 2YWDA 4AB1A 5DRYA 1CJUC 4Y9TA 3RIMA 3GLGB 1NNEA 5KU1A 1GSOA 1TJYA 3WGJA 2X5OA 1WUYA 1A9SA 1NRWA 3G2QA 3IIEA 2WNSA 1YAJA 2CD9A 2Q5OA 3NJRA 2P3SA 3D0OA 3GJ8A 3PRYA 4GZMA 3JAMA 4DUGA 1PV4A 2ZRGA 4XB6B 3PJRA 1SPBS 1TUBB 4TZKA 4ZRNA 4ZYWA 1G3QA 1WUHS 2QMQA 2OK7A 4Z0NA 2B83A 1UBCA 1XI2A 1SKQA 3B2QA 1T15A 2XNCA 1L5LA 1YOVB 3GK3A 1G5QA 4X8HA 3TZKA 2IW1A 1FLVA 2AS0A 4BDSA 1SQ6A 3HPQA 2OM2A 3P4YA 2YVAA 1F9AA 2P35A 3H7AA 1R9JA 1NTOA 1NRIA 1NGSA 2PIDA 1LLUA 3O7WA 4X63A 1QZXA 4TYQA 3UMVA 4CF3A 3ONFA 4DRYA 1LD3A 1E7SA 3KQUA 1OH5A 2JCYA 2P78A 2Q3EA 2WF5A 2RJ3A 1W47A 1L7RA 1EHIA 2XODA 2A9FA 2CWDA 2G88A 1F0NA 1NKSA 2WM9B 4L50A 2OZVA 4DNQA 1W49A 4LYAA 1W2GA 1XT6A 1Y9AA 2WTNA 1GDDA 5JNRA 3RVMA 1LQUA 3TN7A 2O7QA 3KZNA 1VJ1A 1A04A 5JQGA 3QUTA 4PAWA 3P9KA 1CEEA 3O3OB 3O83A 1DIHA 2IXFA 2FG5A 1QVAA 3FDFA 3GLHA 4U8HA 5F4BA 1VRWA 2LGJA 4YNBA 5FF9A 1XD2A 6Q21A 1V0JA 2TRSB 4XDZA 1EVEA 2DKOA 2VATA 3PIDA 4XX0B 1BRMA 4F9EA 2FPKA 4YFYA 3TWOA 4CXMA 3A2MA 3U62A 4KW7A 5H82A 3CF4G 1CY0A 3BWVA 3CNNA 3N3BC 3V2GA 1IBLB 4HH1A 1KQOA 1II8A 1TT7A 1V5FA 4MP3A 4ERXA 2FSSA 2Q5EA 3DOHA 4L75A 3ER8A 2AMYA 3STUA 2ZRBA 3GUZA 1Q19A 3VH2A 3AP3A 4G5FA 1V39A 3AI7A 3GIWA 4RKWA 5CVCA 5AT1A 3OO0A 1IHUA 4OCZA 4W99A 2QSYA 2IOHA 2PRIA 4U4AA 1TVEA 2P0YA 3HLYA 4BAGA 1K7CA 3HKEB 5CM8B 3JW8A 3I2KA 3H1GA 1E0DA 1L4HA 3CONA 4NV3A 1ST3A 3VR6A 4WBXC 5B64A 1AD2A 2WUEA 5AWFC 2O0LA 4I2NA 3NAQA 5J2TB 2Q7OE 3HB7A 1IWPB 2AGVA 1ZD8A 5F5XA 4GECA 3WOVA 3ZS8A 4Y2VA 2W6JD 4F4HA 5JJIA 1MIHA 1E5VA 1NFFA 1T34A 4BV8A 1LNQA 3C5VA 5E9JA 1BS9A 3BICA 3KHKA 2ZUFA 3AP2A 1CJCA 1YI1A 3GNLA 1S9DA 3GZTB 4RH1A 4BEVA 4EKDA 4FVTA 3C3YA 5GV8A 4JVSB 3JQ7A 4C7VA 3TZLA 4HUTA 5BSHA 1ZKMA 2F9FA 3I9LA 3G0HA 1R64A 2OEPA 2QN9A 1FUEA 1A7AA 1X0VA 2VP0A 3INYA 5KYNA 3DHWC 1HLPA 2X8JA 3VR5D 1CRLA 4UTNA 1U99A 2FMFA 3FOCA 3GD5A 4XAQA 5AO9A 3L3BA 2D3TA 3IBYA 3E5MA 5T5QA 2NT3A 4UUNA 2UVPA 3HKCA 2V7PA 3RSSA 3VA7A 2DQZA 2R6FA 2OQ2A 3C2QA 3JYQA 3E4CA 1JDZA 4XIYA 1Q14A 1VLJA 3DPSA 3G0BA 1NVFA 1SQSA 1UC9A 1Z7YA 3M33A 4L76A 2I2AA 2HBRA 4K6GA 4NBVA 5HQJA 1S8FA 1KDVA 1X77A 3S7TA 3X44A 3D7MA 2BFBB 1N32B 4MLCA 1VSUA 2AQKA 2V7WA 3FR8A 3BZWA 4MUHA 2W83A 4LEIA 1DDIA 4MR9A 3EMBA 3O1HB 4RY2A 4ICIA 1JW9B 2NZ2A 4YPFA 3RK0A 4D4GA 1FIUA 2V03A 2D0OB 4WKGA 3A9RA 2GZ3A 1R10A 1D03A 3UFXA 4AURA 2WP8J 3QF4A 2ERCA 2GPJA 3K3PA 4MKFA 4RPIA 5THKA 2JC3A 1M10A 2FZVA 1C3XA 2PWZA 1XTVA 3PIRA 1EXMA 4QBKA 4BWYA 4J8PA 1SVLA 5ELMA 1X6VA 5EJEA 3CRW1 4Q16A 4EIWA 1T8UA 2IEZA 4IG4A 2AW5A 2OC4A 4R84A 5I8ZA 1R0KA 2J30A 1DELA 2J9FB 2D1SA 3P9QA 1Z82A 2GPWA 4LHWA 4PX3A 1UZMA 4V1CI 1M1XB 1JALA 3ETHA 2AOUA 2VOEA 4PYKA 3ONVA 3QEMA 1Y1TA 2FSUA 3QA9A 5DGXA 2F1IA 1RM4A 3CF2A 4AJEA 2WTUA 1Q95A 2NXEA 5AICA 5FOQA 3N86A 10MHA 1WF6A 1YL5A 4QUDA 1UBGA 5D85A 4I08A 4FMCB 4UEQA 2UXCB 3WICA 2H4WA 1ZR4A 3D4LA 2H2WA 1ZL0A 2FE4A 3AG6A 1C4WA 3IR6A 4JUCA 4L4RA 4PXAA 3DC2A 4MGHA 3SXPA 1AA6A 1SBZA 1IVYA 1XU7A 3OVMA 5J4VA 2H7VA 4KV9A 1FSGA 5FHRA 3ZKWA 2X2FA 1GPJA 2FEOA 3W8DA 3T3IA 1EM6A 4OK5A 4ASUD 3JAWA 2Y99A 3FKSD 4OAPA 3VR2A 1ULTA 1FUKA 4FE3A 1CFZA 3WV5A 2ZUBA 3ZW7A 1HE5A 4GM4A 3EGDB 3ZCXA 1EFAA 3Q98A 2WFMA 3F4KA 2Z9DA 5ALUA 4ZALA 4KO2S 5DDIP 2HC9A 3NORA 4MV4A 1KYWA 3AJRA 1MB2A 5EKSA 2EWMA 4C0BA 3OEEA 4TWAA 4B6SA 1JKXA 2FR0A 2GBLA 4URZR 1HDXA 5BMVA 5CDFE 4MWGA 1EVKA 4G0WA 2QNBA 1JH9A 1OWPA 1XRNA 3ZD7A 4QGFA 2A1IA 3O93A 3FCYA 2IYWA 1EK1A 2J59A 3O2JA 3PEUA 5E7MA 3CNHA 3K1AA 1TA4A 4C5BA 3DLPX 1GN8A 3PGLA 4GWGA 4HEJA 1JGTA 2XZPA 3ZI0A 3BGIA 4CG1A 4IHJB 2YJ6A 2QROA 4TT3A 4IX9A 2A59A 1V8PA 4AJ2A 4TMVA 1LDEA 5FBZA 3W9SA 1SBNE 5LXTB 3ZTWA 1JG6A 2IHBA 1EWQA 3VR4A 1JAHA 1JNXX 1NMSA 1SKAA 1V5GA 2JJ1A 3H5OA 3O31A 4D8UA 3HJHA 1P4HA 4B09A 5LQDA 3GXOA 3PGVA 4ZVMA 1B0PA 2I4TA 4Z9YA 3R3VA 3VMFA 2CYCA 3PDIB 1JV2B 2XGJA 1U2SA 2RH9B 3L4BA 5EJIA 4P3KA 1YCGA 4GM0A 1T6XA 1Y8RB 1MBZA 3ODPA 4MI3A 3UTDA 3BC1A 3WLNA 1PJRA 1SVSA 2CMHA 4EKGA 3K71B 1K2WA 2Q5QA 2G7ZA 3HUEA 3V8QA 4OQ4A 3WYDA 1YL6A 1GKLA 1M2GA 2DPYA 3AKDA 3PC6A 3S8YA 1T25A 4BKQA 3RTBA 3VO1A 5JC8A 1W34A 2I2CA 3QY9A 4XA8A 1QYVA 1DC7A 5E3JA 1NUHA 2FF7A 4RFVA 4D9MA 3NCHA 1K08A 4M0PA 4ZANA 1ENPA 4L7QA 5J63A 4HNQA 4GR9A 4MWOA 4MKGA 4J16C 5HILA 2PTGA 3E82A 1DRWA 4YRCA 3B89A 2YUIA 2JI7A 3CEAA 3GLIB 2A0UA 3ICCA 1UIMA 1C8BA 2BMAA 4BBPA 1BX1A 3HO1A 1JKMA 4H08A 1DKLA 1KMHB 4LVNA 1C50A 1E3EA 2GCNA 4WQMA 1SVNA 4X91A 3LE8A 2GAAA 1SC6A 1L5SA 1Y3CE 3ZLUA 4GBGA 5KU7A 5LQNA 1MC5A 3L0OA 3NT5A 4L2IA 5JRJA 3OZIA 4GRIA 3RVSA 5KPJA 2RHBA 2ZVJA 4CMIB 2OO5C 3ZOZA 2H0RA 5AI4A 1F38A 1NMYA 1QV9A 5CD1A 1VDZA 4EPVA 2OCLA 3L0BA 4RD0A 3AO0B 4AKSA 3OF3A 4D3SA 3P4XA 5BW8A 1UKZA 4YAUA 3C97A 2H1SA 3ZE7A 4FHDA 3R1IA 5AM0A 2VYFA 4ZEVA 1UZLA 3HL0A 3A3YA 2O6LA 3TLEA 2BR5A 4MR8B 4DVJA 1QIJA 1GEEA 5JDCA 4EX7A 3U5ZB 3LUBA 1SHUX 5C8XA 3LQ4A 2WIDA 4QM6A 3ZCPA 4YRSA 2RC5A 2QRJA 3JU3A 4M98A 4P0TA 5HS6A 1T9KA 4EG4A 3L1HA 2YHIA 3I2HA 3O7MA 3K8ZA 3WL4A 3DBLA 4YCBA 3FPHA 2WPDA 3VC7A 5AJWA 1IOLA 3AP1A 2MINA 1E0SA 5CFLA 3HVKA 4FYWA 4HT3B 1UPBA 3EZGA 1QF7A 5I9MA 5B4UA 2EZ9A 3MT0A 2H1FA 4Q05A 1RWXA 4P8RA 1SEPA 4BRZA 4QYIA 3I72A 3FLBA 1C9NA 3Q7TA 1P2SA 1Q16A 1RFLA 4IDOA 1EEHA 1HFKA 5C3MA 4BO1A 4EJSC 1F6WA 1TM5E 4FHGA 5TB5A 1P2DA 3M6FA 4KBYA 1QH8B 4OBXA 1Y5NA 5EQFA 3SYLA 2DFLA 4C29A 1DBSA 4OTZA 4XI9A 3Q5GA 5TMPA 1S7GA 4RV4A 3R0QA 4N8DA 1QRRA 1THTA 1LDGA 5BYJA 4AJNA 3JQBC 4Y8VA 3KPWA 5T8KA 4AO6A 1ISJA 4UD6A 5KNBD 3OZXA 4PGMA 1SD2A 3LCVB 5EMHA 1F4PA 1MA0A 1Y8AA 2Z95A 2NTYC 2ZU0C 2W2NA 4G8BA 4YBZA 3ROXA 3GLTA 3LHKA 5HE8A 3RRNA 3WMXA 4AZSA 4C88A 1XTJA 1HDIA 3MTGA 4PPGA 4R2MA 4X65B 3IIIA 1I4DD 2CUTA 4XB2A 5TR9A 4BVFA 4OQYA 3ES9A 2WDPA 4EQ6B 4UFOA 4CMGA 2GEKA 3IQEA 1DARA 3CE9A 1FE8A 3L0ZA 4M7OA 5DGDA 1KOGA 2FPUA 4QE3A 3RSQA 4M22A 1RYHA 3DDSA 3U0BA 3THYB 3TIGA 4AJPA 3PXEA 4N5NA 5IYZB 1R15A 4KTTE 1I2ZA 3KQLA 2O5EA 3DVLA 3CUTA 3FUWA 4GXQA 1OLSB 1E3QA 2PBZA 1XQ6A 4INOA 4CDRA 1CS0A 1UXGA 4XD2A 2DQSA 4PX2A 4J0GA 3UW1A 1RT9A 3KQPA 1UCFA 1YMUA 5A04A 3IUMA 2IWRA 2BBOA 4Q6WA 4ACBA 4MIEA 4B81A 1IN1A 5JMOA 5BORA 3TRHA 1W4CA 3EPHA 2X3UA 1YE8A 2IYQA 2E1RA 3H99A 4UFNA 5IK2D 1Z4LA 2GARA 1NBMD 5F9MA 3UAVA 4UNRA 4IKPA 4LDPA 1E62A 1K88A 2DOKA 4OQDA 4I4TB 2NO9A 5AVYA 2ZJ6A 3EIXA 1W5BA 1ZGGA 3ZR4B 3F7TA 1JU3A 1T6YA 3EDMA 4RVUA 1TM3E 5WRFA 1M2NA 4U7WA 3V8VA 1CEQA 1TZKA 3FHCB 3DBHB 4KFTA 1VI6A 1QF6A 1PFUA 5JMTA 2CCJA 1OB2A 3LP8A 2OBFA 1IY2A 2CY0A 2BFPA 3PFKA 2CFTA 2RI0A 2EV9A 3I0ZA 4XQ9A 3GBVA 4EFNA 4D25A 1Z0FA 3QG5A 3KEGA 1YC5A 2QGZA 1CRPA 3D7LA 2GXQA 4FCWA 4L7VA 2J7PD 4I4TF 1UJ2A 1A95A 4BMYA 3ZGOA 2PRYA 3R40A 3L4JA 1XTRA 1HOTA 1FP7A 3COSA 3ECAA 5EIEA 2D7JA 4FSDA 1OZ0A 1OYYA 1AKTA 4GI7A 4GX5A 1B3RA 2PD6A 3FJYA 3GFTA 1ZBQA 3REGA 3UJ8A 1BU5A 4CTOA 2WTEA 1CUGA 1MRZA 2G1UA 1IEXA 3N2ZB 2QS9A 3MRTA 2PO7A 4FR2A 1GTSA 5DCWA 2P9YA 3OOWA 1EFLA 5KSPA 2NM0A 4YQZA 4RYDA 2WIKA 2L19A 3BWBA 1K8RA 4NR0A 3EDCA 2QX6A 3SC2A 3U4DA 4B40A 1TJ3A 1OREA 3DFFA 3H05A 4DMHA 2A3RA 4MW9A 5LFAA 1W36C 5HK8A 1K7YA 4JYCA 2YMQA 4XCXA 1RQGA 4R8LA 5BT9A 4Z1OA 4RL6A 1BXGB 1KPGA 2C97A 1F2UA 2GF2A 1TPYA 4H4CA 4ARZB 2OD7A 4W5WA 1EQ2A 3KLMX 3MINB 3W8RA 3WIEA 5ED4A 4C22A 4JXXA 2XT0A 3VTZA 3MLBA 1X0XA 1QO0A 3DOJA 3DYIA 4K3VA 4OUDA 4WFQA 1QRSA 3CB2A 5F9HA 4Z4EA 5BWBA 3KZVA 3AI1A 3TRIA 1JAXA 3B9BA 1NMXA 3ZY4A 3TNYA 5IVKA 3HR7A 4HB4A 4F5WA 4W5RA 2I76A 1CNEA 2HBZA 1FNSA 2XOEA 4OEHA 5FL7A 3ZHUA 2MSWA 3GAAA 3T1HB 1ZD5A 4F56A 4O2BF 5CP8A 5LDHA 4OOFA 3DXFA 2PRJA 3T7CA 2IKSA 1G2IA 4CM8A 3U3RA 1CWUA 1ZOLA 1FW6A 1OAOC 4QTYA 1BX0A 4F04A 4I55B 5D6OA 1GFSA 5AQEA 4ITVA 2JARA 5JCOA 1YFZA 1I2BA 2H85A 3RM3A 4MVWA 5CX1B 1V71A 3RAJA 3TW6A 4DY4A 4WBNB 2AZDA 1UC4B 1M34B 4H3VA 4M8NE 3ZHSA 1UZAA 3IKLA 3A6LA 3IMKA 1E2LA 1PTJC 4K6FA 2GEDA 2AIRA 3D5QA 3EVBA 3JQEA 3LWNA 5FLEX 2N1MA 4NBTA 1I5OA 1K1EA 2KS6A 3WYNA 1A98A 4GVXA 2W6ZA 3QRWA 1YS6A 4AZTA 2ZBPA 2BIFA 1E1MA 2NYAA 1FFXA 3LECA 4G41A 4OQXA 3FYUB 2ZDHA 4BE4A 3Q41A 1SHKA 4D74A 1SVMA 1W5AA 4OJTA 3K5HA 4GVLA 4ZVQA 3ZY6A 4DSOA 2Q1YA 1RLIA 1ZW6A 3DMHA 5BWOA 1J0AA 5AJXA 5AXCA 1W7AA 4UU8A 1Y42X 2QX9A 1XNRB 3HFSA 5CCEA 4HMPA 1FDWA 3K1ZA 4KITB 3TW8A 3PSAA 1NG1A 2VSYA 3RYCB 2XMRA 2ONJA 1NURA 1RRFA 2WJHA 1K6JA 3FR7A 4FC7A 4PGGA 5DGTA 4IFIA 4TWRA 2RGBA 4UHDA 3JR3A 1DWPA 1M2OB 4DBZA 4DRZA 1WBJB 4QPNA 4JENA 3SHTA 2C3PA 2XUZA 3I6ZA 1SOWA 1QHHA 3SYMA 2JDIA 2QL5A 3UAOA 3AB7A 4BDTA 1HURA 4XEUA 1GG8A 3IXQA 3L9WA 2PGAA 1K97A 1PZEA 3LO8A 1X7ZB 1IOWA 5EHGA 5IAKA 3USES 2G08A 3FI0A 2AR7A 4FI3C 5ADVA 4WZAE 3D1JA 4D9CA 1BS2A 1XZLA 4NF2A 4F6RB 2Q45A 3C3BA 2I3ZA 4YJHB 3NETA 3QTTA 2IZ7A 4DJTA 1C7EA 4M60A 2OKGA 3A37A 3VNSA 1QP7A 3AU8A 3ZWOA 4GX2A 4CIAA 4CRWB 1JHQA 3H7IA 2PZLA 2JIBA 3SZOA 3EX7C 5A6SA 1EJ6A 5LN1A 2PT6A 1WV1A 4FDLA 2CV1A 1ORRA 3ROTA 2FSVA 2PUFA 3WGTA 2FA9A 2RARA 1KY4A 2YMLA 1BS1A 4DJAA 3FTPA 5AM1A 1RBZA 1J09A 1CQPA 1RYBA 1EFTA 1ZM7A 1JHUA 4CKEA 3UWOA 4DR1B 4A4DA 4RTJA 4CJXA 4PYOA 1WY5A 2PGDA 3WB1A 4F7WA 1K9SA 2ZJ2A 5GONA 4EY8A 4I1PA 1GP2A 1IPEA 3RVDA 5LBUA 2F4VB 2COEA 2RD2A 1QIEA 3AF3A 2X2PA 3E9RA 1L5ZA 1BROA 4RQAA 1G1AA 4NJEA 3WYEA 1ZUNA 3LW7A 5IF9A 2AZMA 3HACA 4RXUA 5AW7A 4KFCA 3CLRD 1SR8A 1YVDA 2PUEA 1MVOA 2P2NA 3DCIA 1ZMRA 2HM7A 1RJEA 2OILA 3AVOA 3ETCA 4NC9A 4RLHA 1Z47A 3P0RA 1GPAA 5TNXA 4CKEB 3BH0A 1FUIA 4Z4FA 2QDXA 4X9XA 2CUZA 1O1YA 3Q5DA 3RHTA 1UT8A 1NVAA 3SCZA 3DE7X 2WEKA 2B8WA 3MT7A 4MULA 1K2VN 1H1LA 1IFXA 3PUJA 4JBLA 4TS4A 4C87A 2VHVA 1S2LA 4YAEA 1E69A 3KSBC 3HVJA 4C20A 4BMSA 4M0EA 2ETXA 1C4OA 1I2DA 1UEJA 2QUIA 1QOZA 2WWTA 3CTMA 2ATXA 5ENVA 2C42A 5EP1A 1Z3CA 4DOMA 1ADYA 3V4VB 1RLJA 1N6NA 1A7JA 1XZBA 3IQWA 2XZLA 2P2SA 2GCGA 1T10A 1DQNA 1LTHR 3RFXA 3C3DA 1ZYUA 2PUCA 4MVJF 2GCPA 1WMEA 2QLBA 1ESEA 3VKHA 5TGZA 1SGWA 3KE8A 5E6UB 3F6SA 3QK7A 2BOVA 3HKDA 4HDRA 2E55A 3NVAA 3EQ7A 3RC9A 1UK9A 4LYHA 4WLUA 2QQEA 1CB7A 1XFAA 2X5XA 2YQZA 3H0EA 2Q50A 2RHDA 2C4NA 1R0CA 4N65A 5BNIA 3KEQA 3HWX1 3TOSA 2ZT7A 3HDHA 5EYPA 2CWWA 2G4LA 1TD1A 2FTKE 1A5TA 3JYLA 4IIJA 4BN0A 2XW6A 2JDID 4G5OA 4Q0MA 3F2VA 3TLZA 4C6SA 2ZUTA 1MT3A 4DIOA 2BKAA 3VZPA 4K28A 2BHTA 4HN9A 1GZ7A 4RHXA 1NONA 4GP7A 3CLTC 4B5LA 1VXRA 4UARA 2C7RA 5AW3A 1W85A 1SWWA 3MUFA 1P1RA 4QEKA 4D80A 1AIPA 3NNDA 1D6SA 3C7DB 4O2AA 1KSFX 3O9VA 1MAHA 4E5NA 3T5AA 2O2XA 4ND1A 1EEXB 2DFNA 2DBVO 4Z0PA 1H23A 4IJQA 3EG9A 1HT1E 5G40A 5K3OA 4AUNA 2QQFA 4HDNA 1DWOA 3SR0A 3RUAA 4U39A 4ZVPA 1POWA 5B12A 2IKQA 4NULA 1M5TA 3NJ4A 2C2WA 2WV9A 1WEHA 3D7RA 3TLAA 1YB2A 4YWJA 1G16A 1HFEL 3P26A 3R7BA 1EFUA 1NI3A 1Q7TA 4KWEA 3KVRA 1YUMA 1IHOA 4AIRA 1XYYA 2Z08A 3SS7X 2ORED 5C81A 4BGDA 2BMFA 3U4CA 1HDEA 4GE0A 4KMMA 1CUBA 3LL7A 3OM1A 4RIIA 1I7NA 1XRQA 4FHCA 4NS4A 4I14A 1ND6A 3UK2A 2Z8ZA 5DI3A 4D0LB 2BUBA 3VR6D 2IXEA 5JISA 1YE3A 2OOKA 1RMTA 1PYOA 4EL0A 4D79A 3PQ5A 2BCJQ 2FQYA 2QI9F 3Q5EA 4AIIA 3T1QA 1XLTC 2NXWA 5KTPA 1H2AS 4PC7A 1AMNA 3OEHA 4QHYA 2PMCA 4O4IB 4JL5A 2LWIA 3Q8WA 3OEED 1KQGA 2QN2A 1G59A 2R6JA 1IWBB 3EGVA 3M6VA 4RAQA 2QJFA 4MHTA 4YO7A 4L02A 3WL5A 3K0CA 1K7XB 1GT6A 1R9GA 3AKYA 4OD0A 2QKYA 3E1KA 5E1BA 2C5BA 1L5VA 1SC1A 3G23A 1HDCA 3IE2A 2AOUB 3QZUA 5FWDA 3S55A 4D3ZA 2VNAA 2ZQYA 4EYOA 3DZKA 5A7FA 3L7CA 4N8EA 3OZUA 1FBNA 2PLWA 4Q3EA 2OD9A 1XDUA 5K3BA 3HDGA 5JMPA 1JR3A 1GJRA 4C01A 2GEBA 3DBVO 3FOZA 3G8CA 3H6GA 3MGCA 3SX0A 1UZUA 3S28A 1JR2A 3QUBA 5KQSA 2XI4A 2Z56A 4Z54A 1SUFA 5F78A 1VPDA 3GVIA 3LG2A 4FSHA 1E32A 5I5EA 2W2QA 2HL6A 4RM3A 3PEVA 1PEYA 4ZZ0A 2CLHB 3BK7A 3SQXA 3CVVA 4P22A 4J75A 3VDMA 4FYIA 1O0CA 1T1IA 3BRCA 1R4ZA 1D4OA 4BBJA 1N8KA 2PQ2A 4PLWA 4PG8A 2Z1DA 4PNPA 4INPA 4UBKA 1E96A 1UFQA 2I8AA 3C3CA 3CXUA 3G2KA 1KS2A 3W3AA 1CJSA 1P5JA 1UBSB 3PCTA 3EOZA 4LJAA 1AUQA 1WXFA 2RHHA 3DZFA 1O89A 4A6PA 3NOQA 5JZBA 1NBOA 1QHHB 2PLRA 4O3MA 2AJCA 2DH5A 4BMZA 2WJGA 1Z0UA 3KU4A 3D2AA 5EG5A 4FZVA 4A6DA 5ENDA 5A3QA 4LBWA 1LDBA 4R1QA 3LUFA 2W6MA 1W1UA 3C7KA 3HI4A 4PCLA 1RJGA 1D2RA 3HEMA 4ZRMA 1KYVA 1SCAA 4R68A 1QKJA 2J9GA 4CKYA 2FZ5A 3IE1A 2R48A 3M6UA 5F2OA 1BVRA 1K6XA 2AKEA 2WWWA 3F6EX 2WF8A 1HFJA 5LZ7A 4F1KA 1JLLA 3FOAA 1J8MF 1M1YB 1GRVA 3I64A 4RV5A 5C8YF 1D7OA 2B8JA 2XB9A 5AI9A 3P9ZA 1JPUA 1DUIA 1HDYA 2PJRA 1U65A 4BMVA 1MNQA 1J1IA 1EXNA 1HQKA 1BXRB 2W42A 3KFXA 4RHUA 2XXAB 4R8MA 1Z4JA 3MXTA 2XXAA 4R0MA 4G81A 2QTNA 3DEFA 3MM4A 4CTNA 5ICCA 1IJFA 1ZM4A 2WVGA 4L5JA 4F2HA 4FLEA 4PHHA 4LG1A 3GVXA 2G1PA 4PHCA 2GPNA 3D6FA 4BP8A 4PQYA 4D97A 2RGCA 3AVQA 3Q0TA 4AY5A 1W0CA 3DLAA 4L0MA 3VR4D 5CIYA 3D8SA 5D3MB 5LYJB 1QG6A 2W5UA 3OWHA 4AJ1A 1N0UA 4PGHA 1N2SA 4IYRA 5SY6A 4IMRA 1XV5A 1C7RA 3DV9A 2OA0A 3BVPA 4E31A 2PGOA 2QQ5A 3QUSA 2YVKA 3KP1A 4OHVA 2JK0A 4WINA 3GLHB 3GT3A 4N5MA 1U6IA 1Q0QA 2AJ8A 5EWMA 4C4AA 4DV7B 2Q3HA 1FU8A 4J03A 4BL5A 5DOZA 3K1YA 2AB0A 2Z2KA 5HK9A 2VHXA 3UWSA 4GUAA 1WABA 1VJ5A 4GLOA 2E9SA 1OTXA 4HGRA 4K1XA 2QG6A 5M3BA 4DLVA 1RQ7A 2OD2A 4OUDB 3EZ9A 3O74A 3AIIA 4LA4A 1GM5A 2EBFX 1CC1S 2YWEA 4QKQA 4OLBA 4YAOA 5CTAA 5BSVA 2FFHA 2XYPA 3WK6A 3X1DA 4RPHA 2B4TO 3BAFA 3EASA 1E5LA 3PPVA 1TMOA 2IOQA 2VF4X 1O6ZA 4XUEA 5L8VA 3KFLA 1X9HA 1M33A 1MG0A 3RHFA 4JJIA 2W58A 1J8YF 2GK4A 4PZPA 4L78A 4OYRA 3HBMA 2XDQA 2VDRB 1C3EA 1EK5A 2R4TA 3KJIA 3G59A 5LLSA 1Y5RA 2PV7A 2WHXA 1ORTA 4KXMA 5AVWA 3EVNA 1ZN8A 2O2SA 2G9ZA 1U7HA 3A9VA 1FL9A 3LQ2A 2CSUA 4L8LA 4U1RA 5DHSA 4B46A 3C1OA 2W2TA 2R79A 1W52X 4BUZA 4OBEA 1UH5A 4EUSA 1EUCB 1YR3A 5LQMA 2C2ZA 3UJBA 2XGGA 1E3WA 3E2MA 4QAQA 1K4YA 4WASA 3CH5A 3L7KA 1H4VB 2BSXA 3CE6A 4HQRA 4XIGS 3REFA 3VNRA 2O8BA 2X14A 4EF5A 1P33A 1SCDA 2JGJA 4HNRA 4HVLA 5BRJA 3EC7A 4EFDA 1VQ1A 2G4CA 3EQ9A 3W7AA 4HYQA 2GPSA 1LC0A 2YJTD 1UC8A 1U9CA 4YJ2A 1FNDA 3WDMA 1OGIA 3FNFA 2QMUA 3A14A 1XTTA 4AN0A 1JFLA 1ZGJA 4BLUA 3GBPA 1TIKA 1SUWA 2W6PA 3WKEA 5KNBH 1CR6A 3G9UA 3EVEA 5AXDA 3SIPA 4U7PB 2Y9PB 1FTGA 3C14C 4O2BA 3NTQA 5DSZA 4B3JA 1VYTA 4QA9A 4NBSA 3RFCA 3VPSA 3BMQA 2IU6A 2HADA 3KCQA 2XOKA 3OZCA 4EZBA 5FWAA 4WDQA 4NEQA 4G2TA 5KOHA 1JDUA 2FZLA 3L0SA 4MQEB 2FX3A 2Q0SA 1C1XB 3QTLA 2FR8A 1FMFA 4GBMA 4YMTA 2NACA 5HF5A 1J5PA 2VRNA 3U19A 4U6NA 2BZ0A 2DBYA 1E99A 4G85A 5KCZA 3M4NA 2AZTA 2BONA 2EL9A 3A4YA 3PSHA 2NYUA 4Z49A 2DKNA 1XCBA 1FVOA 3EB9A 2ZEJA 5TJ9A 1XO1A 4X45A 1GG5A 2G63A 2JGAA 2EVWX 5DBIA 2VKTA 2G07A 3AF0A 1FZQA 3I01A 3E1GA 3E18A 4J0CA 4MMYB 5BQPA 2EYUA 2GK3A 2ZWMA 2BN4A 4E5PA 5HKAA 2X0RA 3BWDD 3L41A 2QAGA 1Z2PX 3C6MA 4PN7A 5ICFA 4RZXA 5A0TA 1ZWKA 4F86A 2OFPA 4YB8A 4DABA 3TH5A 3EODA 1JSRA 2F3UA 1JFVA 2V6IA 1G3MA 2VJMA 4RA6A 4BNKA 5HUHA 3U7QA 4A10A 5JDIA 1O94A 4CMBA 2YBEA 4P3XA 3OQ1A 2VYND 3FCUB 1CP3A 3MD0A 3T35A 4DCCA 4F92B 3BT7A 2ID4A 3ZVLA 621PA 1J22A 5C7OO 4MYCA 4EO4A 4CG2A 2F8SA 1NUAA 5FJIA 5CB6A 4ZHQB 5EHNA 1DL5A 3CISA 4LQ4A 5TQ2A 1C1HA 4BO8A 5LB2A 2RGNA 3HUTA 5HQTA 3NB0A 1CQIB 5IT9A 3N8HA 2QBYB 5ES4B 2G3YA 1V11A 4PIMA 3DNMA 1YDWA 3PQCA 5D5HA 3DVAA 1ZOPA 2ZRKA 4OYHA 1IU9A 2OFWA 2QI9C 3PEFA 1RQPA 2IEBA 4WX2B 2PU5A 5ICMA 2P8JA 3P9XA 1OWMA 4JJEA 3B1XA 3OCYA 5CA1A 4HVAA 4NK5A 2LBPA 5KX5A 2CEKA 4FFNA 3EWNA 4M0FA 2ZB4A 1ZN7A 1X3SA 1P7CA 4LRSB 4HZUA 1C30B 1GTZA 4XSGA 3T5CA 5C4GB 1R12A 4KH0A 2X9GA 3QNUA 3L0DA 2D2FA 3JZIA 4FN5A 1Q0SA 2E48A 3T5TA 1LDMA 1ADBA 1V7QA 2ZE5A 2EGUA 1QCYA 2UV8A 1KMCA 2YW9A 3MJ4A 1N2BA 4N0MA 1D1QA 5D01A 1P2FA 2KJQA 2VZLA 3OIFA 4CUZA 1NWCA 5K6RA 3UJNA 2I3GA 2HWXA 2GEJA 4BLRA 1LLCA 5C1DA 5ALVA 3V7UA 3A32A 3PV0A 4RD4A 3Q7SA 5FHQA 1AGXA 4FQ5A 4OKSA 2J6BA 3A11A 2VOJA 1IXRC 3T15A 3KWJA 3KK0A 3KWLA 3TB4A 3CEHA 3VR5A 3HJUA 2B8NA 3QVGA 3DKRA 2CNBA 4LI3X 4YP5A 5EWLA 5F77A 1MUUA 3P20A 3AVPA 4JUFA 4NE7A 2QEQA 4JC8A 1OI2A 3HJRA 4ENVA 5IT0A 4N3CA 2WU3A 1Z0IA 3QPDA 5JU6A 1GXSB 4KU4A 1RIIA 5E9WA 1YDMA 4U9HS 1I7LA 1G42A 4KXVA 1GADO 4MV5A 3QLUA 4RHCA 2Q0XA 1CJVC 4LYJA 3OU2A 5ALWA 4IHKA 1L1FA 4AUEA 2GN1A 3ZVMA 1XD8A 1W0JA 1L7MA 4YJFB 2B35A 3S29A 2NUPA 1V5IA 3D3EA 1FSPA 1G7TA 2ERYA 3LPAA 2WVJA 3BBPA 4K86A 4UCFA 4EI2A 1ZY2A 2GILA 3N2GA 4TTRA 3HXLA 4MPTA 3V2HA 5E2AA 2BUAA 2MSKA 3P97A 4UXJA 2YQ4A 1EAMA 2O8DB 2XSZA 1KAHA 3EXG2 3SJBA 5ADUS 1CQJB 1K4KA 4EW6A 4GPTA 3MJFA 2QM0A 4K1LA 1E2EA 4P83A 4O08A 2YHSA 4X3OA 2PUBA 1KGDA 2OMEA 4BCCA 4I9UA 1DBRA 1WXGA 2JAPA 3UHFA 3F67A 2DXIA 4BOYA 1BOFA 5LMUB 1NL3A 1ATZA 2BFOA 1I4WA 4YDHB 2HUPA 4BFWA 5F7OA 3CBGA 1U02A 4RWZA 3OU7A 2WE8A 5CPBA 5HPYB 2IYRA 3MUNA 2BFAA 3R3WA 4NYJR 3RIXA 1I3LA 2GEUA 2PA0A 2XWPA 2Z4TA 1FDRA 4QOSA 2EQAA 1ULHA 2HJRA 3KB2A 1VJGA 2FZEA 1SD5A 2AC2A 3V9AA 3WJ2A 1TECE 4A2PA 4G5QA 1JYFA 1OFVA 4P31A 1EHYA 2WTBA 4RD6A 4CUJA 1ZK1A 3OPYA 3W5CA 2W9XA 5EJ9A 5JJKA 2IYFA 1Z13A 2HQ1A 1ISHA 3GDOA 2REBA 2XUAA 4OP1A 2HCFA 3DO5A 4Y2TA 4RLQA 2EIHA 1PBNA 3OSZA 1P0FA 1DCKA 1N2ZA 4HG2A 3T7IA 1KC1A 2IH2A 4JJ6A 4KVFA 1JTEA 1JEJA 4GZLA 4MQFB 1XTKA 1TEVA 1JILA 3VO8A 4DBLE 4ZI7F 1KO7A 1BQ3A 1E79A 1X87A 2IIVA 4MQ6A 4LVUA 1GV1A 3D8HA 1CETA 3LF1A 4QOHA 1QTNA 2A9JA 4ENQA 1G5IA 2WVHA 1NI4B 1E3LA 3U7GA 2IYSA 5C31A 2DUUA 1M54A 1ZN9A 1JHPA 2GOYA 4L0DA 5C34B 2QYSA 4C3ZA 4DG5A 3JYNA 1Z6QA 3UG7A 1F12A 2PLAA 3GEPA 3TS1A 3K6SB 4P0QB 2AG8A 1V3TA 4BRWA 1NE7A 2V5UA 4OHOA 4MNTA 5BOSB 1MQAA 1XQYA 3E0XA 3IHWA 4KX3A 2OTCA 1RHRA 2B3TA 3PUXA 5K0ZA 1TU4A 1Z88A 4MP6A 3AHJA 4QDTA 3FWZA 3SJCA 4DIKA 1SUEA 2R5FA 1QAQA 3CM0A 2BTOA 2HLNA 1NFQA 1E66A 1I8TA 1QBKC 3ESQA 4JI7B 2IE0A 5I3CA 4Q3KA 5HGJA 3ZIAD 1QKIA 1NN3A 3ORRA 4NYMQ 3WS7A 3DUFB 1S2NA 2CXSA 4WFKA 3U81A 3BBLA 4H18A 1MOZA 1S01A 5I6DA 4JBWA 5JADA 4C76A 3MNFA 4BYMA 1RSZA 4Q9NA 1JTFA 1BFDA 1G8FA 1Z3IX 4IS2A 2AKAB 4UVHA 1E1NA 5D7BA 1B2RA 4S04A 1SN7A 2YJ3A 2BFEB 3IX7A 3A06A 1CNMA 4HAIA 2BJHA 4ZU6X 2OP0A 3O26A 1JPJA 3O75A 3EFEA 2QTCA 3WIVA 4AF8A 1LSJA 3AR5A 2EKQA 4F12A 1WHSA 4MLDA 3WB9A 1XPOA 2P69A 2ICAA 4ZDKA 4OU5A 4CEHA 3R3JA 1PSWA 4V0KA 5TMDA 3ZCRA 2WM3A 1QDUA 2EFCB 3WWCA 1E7QA 1XPJA 4A6EA 4ALLA 3K0SA 3WK8A 5F3RA 4R9UC 3PGXA 4NL4H 3EQZA 4AD8A 3CA8A 2ZZKA 3AUUA 3E23A 4YDRA 1KO8A 3UWPA 3SBOA 4Z53A 1O8BA 2BMEA 3V4LA 4NATA 2I6SA 2GN9A 5DWQA 4HVCA 3SF8A 1OBCA 2Y1CA 4K05A 5CK4A 3FLAA 3LKVA 4L0CA 3DZIA 1XLUA 4LTMA 1RHJA 2GWHA 3AR7A 4NOKA 2AE2A 3K5IA 4CBVA 2R1TA 1ZJ6A 4XVQA 4D3DA 4Z4QA 3WIDA 4M9UA 1FXWF 4FOSA 4L95C 3UK7A 3D4IA 5SYNA 3SVZA 1KMHA 4WNAA 4JY7A 2W43A 4LYDA 3DMRA 3O82A 2O8VA 1JEQB 1YZTA 4BO3A 2GVNA 3R7FA 4BLPA 3LYHA 2W8ZA 2EJWA 3QA3E 4JBXA 2OO7A 2GM9A 1UJBA 1CUZA 3HH8A 1TIPA 3V97A 3UXYA 1RI3A 3QUAA 1PGNA 1XMIA 2WICA 4ID3A 3LLCA 1D9XA 1YRLA 1T3HA 2A9PA 3IVCA 5KKAA 1TF5A 5LD2B 4XDYA 4OB8A 3QPWA 4MIYA 4ADSG 2Z1MA 4CHGA 3QELB 4EPYA 2ESRA 1L7QA 3JQ6A 3A6PC 1IQRA 4GYYA 2JBAB 3O3MB 4OJNA 2Q7XA 3B1YA 3FDXA 2WKSA 4EUKA 1L4YA 3LFHA 4KE9A 4FBGA 4GMXA 5CYGA 4ZPJA 1QHSA 1JKIA 4EDHA 4H15A 2XMGA 2D5LA 1Q22A 2YC4C 2C0PA 4CKZA 4IIBA 2CT8A 4XD7A 4YP6A 3PZBA 3UXMA 3EDQA 3O3NB 2EBWA 4JJFA 4DUPA 3L6UA 2PIAA 2JH3A 2JFGA 2KB0A 3BIJA 3H1BA 1WZNA 1G8SA 2SBTA 2XJ4A 3B60A 4MUKA 1YIDA 2BFFA 1LRLA 2VBFA 3I92A 2ZULA 1XD2B 2J48A 5JSHA 2Y27A 1NRJB 4BC1A 2R8XA 5A2QA 2Z8YA 4LWPA 3HFJA 4F21A 4KREA 2WZQA 2ZATA 3PI7A 1WWKA 1M6NA 2AQ8A 2OGTA 5TXGA 2J32A 1FTSA 3NBFA 3T7SA 1MO5A 2B1IA 3D6JA 3I8XA 3UHJA 5TT1A 5L4LA 2I54A 3W5UA 5B1YA 4D0RA 3ZJUA 3WGQA 2W4IA 2A5YB 9LDTA 1SXGA 3LQFA 2GM3A 1E1CB 1V48A 2QYTA 3A1UA 3KPJA 1KI6B 1P4AA 2D1FA 1N2EA 3G6WA 3LPNA 1U2ZA 3O1LA 2HNAA 4N6GA 3K0EA 1F3LA 2BV3A 1X9GA 4Y6RA 2ZKLA 3IUPA 5DK4A 3BK2A 3WKBA 4B85A 3ZZTA 3B53X 3EN0A 5KYWB 5H70A 1TYBE 2WU1A 4FFBA 2P4QA 2EDAA 5EQDA 4EI7A 1RI1A 3SQMA 4JI4B 1UAYA 2ZI5A 2C82A 1AMUA 3UW3A 5I7HA 3J81k 3BSYA 1NI4A 1OASA 4ZCTA 1C8VB 2QQGA 5DIZA 2EC5A 2IUUA 4PLHA 4EA8A 3ICOA 3DO6A 4F06A 4MR8A 2HA6A 5J2UB 4FKBA 4FSXA 3ZDYB 1QCCA 4OHXA 3WGVA 5EUQB 3ZU3A 1E1QA 1ECBA 1SXJD 3HWSA 2ORYA 4HBZA 3KBOA 3UOWA 4BJ6A 4DEXA 3EXEA 1W4RA 5TE9A 5LNK6 4GQIA 13PKA 2ZCJA 3AETA 3QU5A 3RVBA 5I7RA 3N8DA 5AKEA 5LUAA 4NP6A 4XCVA 4B8YA 1Q2UA 1VBFA 1BDHA 1RPNA 3LF2A 2EKPA 1QGOA 2POCA 2Z04A 3EARA 4BECA 2W2PA 4EELA 3TLYA 5BN4A 5KNCD 1P2GA 1Z6GA 3NUZA 4X62B 2FPIA 1S2MA 3QF4B 1FJHA 4BC0A 4ZOQI 4WFJA 5LIPA 1PUXA 2WAMA 1H3NA 1NC3A 2GLXA 1WDKA 2ZTVA 3AY6A 4XSHA 4B7ZA 5IAAA 2P3LA 1L1RA 1L4GA 2IPMA 2PKQP 2ST1A 2J3KA 4CW7A 1NT2A 3VVBA 3K72B 3AONB 1U5BA 1GCOA 2VNHA 3MK31 4QIHA 1YK0A 2OORC 3FFAA 4QUHA 1D3AA 1E6CA 2DWPA 3IERA 3M5PA 4QOJA 4XYLA 3JARA 1HETA 1F4LA 2BF4A 2IEYA 1JYSA 3WL7A 5BW6B 1MX1A 2KSQA 3FI9A 4PWZA 1GQSA 2A1UA 2I6UA 2VIIA 1OI3A 4HGNA 4E21A 1NAIA 1AM4D 3C5WP 2I2XB 5BWCA 5AI6A 3T1YB 4K9MA 5ILQA 5A4MS 3FZNA 3CX3A 1LPPA 5CT5A 5KTYA 1QUEA 1RIFA 4TL9A 4B71A 1YUBA 3GOQA 1WUIS 2ZSJA 2ZSBA 3E58A 3GGSA 3A70A 1PX0A 2JGKA 3PLNA 1G2OA 3L0IB 4FEAA 4KQJA 1UBHS 2AFIB 4RPCA 3P32A 1ES9A 3AR9A 5D3ZA 3RIHA 3WKCA 4D8VA 1CVRA 3I2JA 4DDKA 2F8TA 2YWCA 3INGA 4ZV4A 4KHPB 4MYDA 2I33A 2CXPA 3R3SA 4BUJA 1E1RA 1MEJA 3QPUA 5KINB 2LKCA 4NENB 1D9ZA 1L7BA 5FR1A 2IUEA 4Y2HA 1TJPB 5J43A 1TTQB 1OF1A 1X1DA 1MQ8B 1RQLA 3NYIA 4GR5A 2FN8A 4YS6A 1KBQA 1HL3A 3AI2A 5AOVA 5KHAA 1GXSA 3KOWA 1UMCA 3JAKB 3QENA 2PJZA 3TE7A 3TNJA 3G7NA 3DBRB 4F72A 1RCTE 4CMIA 5K05A 3FGOA 2ABWA 2M32A 1FNMA 2QPAA 3R4VA 3LH5A 4C03A 3JYOA 5JD6A 1NF2A 1YBAA 4OIFA 2V0GA 5LD2C 2F1JA 3K1AB 3KZMA 4TN5A 3BXOA 4A1FA 2IF0A 2YOGA 3ZBPA 3V8BA 1Z22A 3AM1A 1WO8A 2FETA 3IURA 4HDOB 4PX5A 3REQB 5LBIA 3G5TA 1RRCA 3BXGA 4PIPA 4IQFA 2DR0A 4LXGA 5L7TA 5JUWA 1B0ZA 2GM5A 5EZYF 1A77A 1BVYF 4XRRA 1JSCA 2WWYA 4QJ5A 4WA7A 3UBMA 2J41A 1QH1A 4KXXA 1O95A 1KK3A 1LLFA 2ZPAA 3ABIA 3HNPA 2H9IA 3FBGA 3IVGA 2PO5A 4OBWA 5F1YA 4MRVA 3THWB 4XUGB 3FGZA 1LVGA 3IUBA 5L3RA 2PNJA 4TVOA 1KI1A 2EOAA 3O84A 1AQYA 4TVBA 3MTDA 4DLTA 1E7RA 3CRNA 1M9NA 2B92A 3C3XA 1O95D 1RYEA 3UXHA 2FPWA 1FVXA 2OQIA 4R16A 1X86B 3DTNA 5AHRA 2W22A 3GLUA 4V0SA 2ZJ3A 4W7SA 1E6WA 1XJQA 5HIJA 1LPMA 2WJJA 1N0IA 3BMCB 3KYDA 2VHJA 1K9VF 3CIFA 2XJ9A 3M1YA 2WSBA 2Q3MA 1CUYA 4Q37A 1U8ZA 1GL7A 4HGQA 2NVUA 5KNCH 4P7GA 4ZGWA 5AKZA 5BVHA 3DAPA 3QPBA 4LDAA 5ALLA 1GU0A 2QWXA 3K32A 1WZUA 1Y4SA 4TT3D 1MC8A 4KXUA 3LFTA 3SIRA 2GO7A 3WAJA 1RXYA 1AKWA 3GEGA 2G70A 5DO9A 1P6UA 4B2PA 1E4VA 3LS2A 3U1VA 3EFBA 1N5MA 2WMOB 2BGGA 3OETA 3RROA 3WL3A 4GGPA 3DV2A 1KDZA 4RTLA 4YT5A 4DMGA 5JZSA 3KV3O 2CSXA 4U7DA 3UJDA 1ZD3A 2UZIR 1DLIA 3K9WA 3KD3A 4OFZA 5CRIA 1GNSA 1J39A 1S1CA 3MWGA 5CDYA 4R2KA 5LLDA 3RJ5A 3KTAB 4B6QA 4L4XA 1SBYA 3RC3A 3UK1A 2BGWA 2XGSA 3WLMA 2GESA 4I3HA 4UCXA 5AUPB 1UANA 2VPZA 3PG5A 3ZXUB 1TAUA 2IDJA 2PX8A 3EYWA 4MA0A 4OGLA 4PPFA 3DFZA 5AH0A 5EZSA 1W2HA 4HGZA 4E2YA 1G7CA 3KSDO 3PFCA 4DA9A 1G19A 2PJDA 1U3FA 2P11A 4I50A 5DCYA 1U2RA 3GROA 3GGGA 5CCXA 3FX2A 5EHQA 4W5TA 1HX7A 3O91A 4TL6A 4B7CA 2WLTA 3V7NA 1JLHA 3DTVA 4IRXA 4NK4A 3P52A 2MR6A 3CF6R 3CO0S 2ECFA 5FPTA 3GNSA 1HQDA 2WHEA 2X8JB 5K0LA 3INTA 4B6OA 2OSBA 3FF1A 3G1UA 4G89A 3T7RA 3QEMB 3TNFA 4E12A 1P5HA 1VL8A 3BJMA 3ZWDA 2WJIA 2C96A 2AJTA 2QE6A 3OKAA 4HMQA 5KEIA 2HHHB 3E3NA 3RWMB 4P3NA 3WJAA 1NSFA 4J0KA 4HLUC 1U1EA 1FP4B 1PR3A 3USZA 3I1IA 3ED5A 2H4ZA 1FYFA 1PIWA 4F3YA 4FGKA 2B5OA 3F5DA 4AFNA 4R1SA 3HGMA 3RV4A 2Z0MA 2UYGA 1LNZA 3ZZ0A 2GZAA 3BORA 4E32A 1LZLA 2ZOSA 3QEOA 4YACA 3ZV7A 3P9NA 3TSCA 2EW2A 1SOAA 3NUGA 1LEHA 3ZV4A 1IIRA 3PI6A 1W8DA 3IQZA 2ZVPX 2A0WA 5E7JA 4QICA 3K0FA 3RWOA 5IMSA 3ASUA 1M2FA 3ZHBA 3I58A 1NY6A 2PV0A 2J3JA 5TQ0A 2XX3A 1SBQA 2LZ0A 3QMVA 4H3KB 4JXKA 1NLUA 1PL6A 3A3OA 5KJ6A 1LI4A 4QNMA 3S1AA 1D6MA 3FYUC 4IHAA 2R1VB 5LNK1 4XWTA 1H9AA 4YP1A 2VSFA 1VPWA 5FNVF 4ZZ3A 1GAQA 3OSUA 3ZBQA 1IUNA 5JWHA 1QQAA 4GRAA 3W79A 1GQOA 1ID1A 3SKXA 2CVQA 1T6ZA 5CEFA 2M2IA 1Z63A 3L4SO 1PVVA 3EAQA 3RREA 3TG2A 2ZRMA 2V7QA 4PZUA 1A71A 2Y66A 5DTIA 1WVMA 4EY7A 1PR0A 4NV0A 3BEDA 3H75A 1V16B 4CI0B 1ELOA 1ZO8A 4MDFA 1C0PA 4N12A 4XLLA 5LQJA 5DBGA 2Q4DA 1Z8DA 3DV0A 4Q7KA 5H68A 2RKWA 2PX5A 1H2FA 4JLUA 1T5HX 1ORIA 2EWVA 3L8YA 4WV3A 3SS9X 3C5EA 8OHMA 4RJTA 1QIKA 2R25B 3LNCA 4XWAA 1OTYA 3TBFA 1VPEA 5FOVA 3DQQA 2WJAA 1R6TA 2FUEA 4LF4B 4G0VA 3ICQB 4RAOA 3RUCA 3FCXA 2DCUA 5C80A 4GT1A 1TQDA 2JGFA 3D6NB 4M87A 5T4FA 1YZGA 4QBGB 2BE7A 3ZDEA 5E2BA 2JIZD 3WLPA 3P0JA 4FHZA 4Y2QA 3GLSA 4LOIA 1XK6A 3M6LA 5REQA 1W36B 4Q4CA 3CUWA 4BE9A 5LZ2A 2GRAA 4BU1A 1UMBA 1EFPB 1W87A 2ZRPA 3D0RA 4JA2A 4U7GA 4D7AA 5I8PA 2G5GX 2EIXA 3H5AA 3ZU6A 5JAOA 4AJJA 1KWKA 4B3RB 4YPOA 1NXPA 2VPIA 4S1PA 5BSRA 4BEJA 4EM6A 3OZGA 4OLJA 2GH1A 4B87A 4J90A 1T5SA 1QB7A 4OB6A 5BSTA 5KYWA 4RENA 5DMHA 2D59A 3G2HA 3R6LA 4BVKA 5LZ8A 3L0YA 3WL8A 2CXRA 4MP8A 4M55A 2BLLA 2IU4A 4Q93A 4FIZA 1B26A 2O1SA 3QU2A 2GEVA 2VHUA 1DUSA 3J80A 3UJCA 1U1IA 2VO1A 4GI3A 3VVMA 1R9NA 3C8MA 5CR9A 4DG9A 1B74A 5KVVA 1N6OA 3P8ZA 3CH4B 3L77A 1SVWA 1JEYA 4C06A 3NDJA 3HB0A 3QVOA 5FBHA 1JI3A 3NASA 4HX9A 2ORIA 4ZC1A 1EGHA 2MYTA 3IHKA 4TL7A 3FPLA 2W8BA 4TLBA 3RU3A 4DM4A 2IYAA 1XZHA 4YYEA 1C3OB 3VDXA 3RABA 3O5AA 2HF7A 3OO1A 2G36A 2R85A 3HYRA 2C7PA 5IN4A 1N6RA 2IDMA 3D54D 3TD9A 2I1VB 1AXRA 3T9EA 3EZFA 2AFVA 1N0VC 4ODIA 3AVVA 1A9YA 1XVUA 1W0JD 3HFGA 3IAS1 3N2GB 4HZGA 4F2DA 1N7HA 1QLJA 4CM9D 4QQ8A 4PGFA 1N8TA 3TD6A 1O03A 3B1VA 3I5MA 4MQLA 5EPOA 4R83A 1DGQA 3GVPA 2JI6A 3MMPA 4O2AF 3DHEA 4V38A 5FUYA 3ZH9B 1HR0B 3KJFA 4PO3X 1OIWA 1EWTA 1Y1KE 4TTQA 4Q82A 4MKXA 4YRJA 3SQOA 4JV5B 2IIBA 1O97C 4RJLA 5AKLA 2V45A 4Q47A 2RJNA 3UNXA 5IJ0B 4N9WA 3WWOA 4B3HA 1E61A 1WMFA 4RIFA 5KWJA 4MCJA 3SYRA 3BYZA 4RY9A 4A2CA 4FJ1A 3OFJA 3X1JA 1MFPA 1GNQA 2I3DA 4LHXA 1E7WA 4G0PA 4MKHA 4WADA 5FOUA 1ZJWA 2A1TS 2F8MA 3PNMA 4LXTA 2J5QA 2ATEA 3CUYA 4KSCA 4YUAA 5JNSA 1KO5A 1RRMA 3L6CA 3VNAA 3B6EA 2YVLA 3TQHA 4RANA 3ICPA 4G5YA 4CE6A 1TO2E 5JG7A 1P4RA 4H6VA 1OXMA 2JJQA 2FGJA 3PUZA 4HRVA 1QWSA 3U4GA 3G68A 4X6YA 4FFWA 5DHAA 4F5DA 5JCXA 1NP6A 1MO6A 1GZ4A 3OD5A 5CXUA 2CNLA 4KQ9A 5ALDA 3WFZA 1BJRE 4CKWB 3DMPA 4NQRA 2OV1A 1HLGA 2FPGA 3PWKA 5EJMA 3PXDA 1V9CA 4JGBA 5CDSA 2FN9A 2DWOA 1RAHA 5B57C 2C9BA 2Q6TA 3IO3A 5JQGF 1GLVA 1KOFA 1V7CA 1X13A 1E2DA 2HQOA 3KYIB 3AKZA 3WRYC 1YQGA 4N48A 4I50F 1Y4DE 4LBZA 1B4DA 2WHPB 2JFYA 1MMFB 3AUTA 5DW0A 3WGOA 3B13B 3A6HA 1NZFA 4HF7A 4B44A 5KX5B 3CG4A 1Y3HA 3VZRA 1SJ9A 2NP6A 1P45A 4CMEC 2C8LA 3DE0X 4WE3A 5DHTA 3UUFA 3GWGA 3OE1A 2CC2A 3C16C 1R74A 5EE5B 3H6KA 2IPLA 4RO0A 3GRPA 1IK6A 4LJ7A 1T5TA 5DP2A 1LS6A 1T13A 2C3YA 4OM8A 2JFWA 1ECGA 3UKOA 4FE4A 2C2BA 2YFKA 4KUGA 4D3YA 1EUDA 5J23A 1VLVA 1IZ8A 4HY3A 3S0JA 4LXYA 3EZ6A 1NSYA 1O5IA 2F43A 4OSPA 3HDTA 4TQUS 4BLTA 5KJCA 1FMJA 2A9VA 1E2QA 2IEAA 2VP3A 2GK6A 4QU9A 5K03A 4K9OA 5KTTA 3KIPA 1VPVA 4I5GA 2QT1A 3DUFA 4DNXA 3HADA 5HXAA 3B9PA 1JDNA 2HEIA 2Y1GA 3F3MA 1TRKA 4AG6A 2Q5IA 1OFTA 3RSFA 1DFIA 821PA 1HY3A 3U80A 4PZLA 4PBRA 3PYXA 2FVYA 4N0QA 1X42A 5DMXA 1TM4E 4QUKA 1WCIA 5IVHA 3O4VA 3IOCA 3TVDA 2VDMB 4G26A 1OW3B 4Z99A 4NBKA 1DDOA 3P7MA 4JP3A 3THWA 3LCCA 4Y9DA 4C0XA 1PU2A 4PYLA 2HPHA 3RYHB 1YFKA 3L84A 3NYQA 1EQUA 2MSDB 3N8NA 5ER6A 4P2GA 1GKYA 2JIQA 3TAXA 4FMCF 4OGKA 2R87A 1FQWA 1JZSA 1NI5A 2OGSA 4FFDA 2MYUA 2W2XA 2WYOA 5HJ2A 1AGPA 2HK9A