1DWPA

Crystal structure of hydroxynitrile lyase from manihot esculenta at 2.2 angstrom resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydroxynitrile lyase
molecule keywords HYDROXYNITRILE LYASE
publication title Structure of Hydroxynitrile Lyase from Manihot Esculenta in Complex with Substrates Acetone and Chloroacetone: Implications for the Mechanism of Cyanogenesis
pubmed doi rcsb
source organism Manihot esculenta
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dwpA00
4K6KA 1QLWA 1WB6A 5AM4A 5HF9A 2RIPA 3OURA 1VOTA 1K63A 3KSRA 3KWJA 4KE9A 3FSGA 1GT6A 4C89A 1QE3A 2PBLA 4OPMA 1CUEA 1TRHA 2HA7A 4BCCA 3QITA 3D2AA 5D7BA 4U2EA 4X6UA 5A7HA 4MJ3A 3FLBA 2O2IA 3G9TA 4Q34A 1DQYA 1GPLA 4N5HX 3N0TA 1LPMA 3TGLA 1EB8A 3QBJA 4TPKA 4L3WA 3DOIA 3WK8A 1H2WA 2WLSA 4B82A 1G66A 5LIPA 3WZMA 2PX6A 2WFLB 4KRYA 3WYDA 2WM2A 5K3FB 2XUAA 2Q0XA 1GKKA 3EQ8A 4MXDA 3VDXA 5JAHA 1CUDA 3HJUA 1F8UA 1KU6A 1P0MA 1QO9A 1THGA 1SFRA 3A2MA 3FYTA 4W1SA 3C5VA 3LCRA 2GBIA 1BU8A 2H7YA 5DNWA 4MYSA 1DTEA 2VEOA 4G1FA 3G0IA 3I2FA 1WPRA 4X71A 5FOQA 2HRQA 3HSSA 4JYPA 2PU5A 5CTAA 4C88A 5FPPA 3NGMA 4BCBA 1VKHA 4N8EA 5HKBA 3HLKA 2WIKA 5IH7A 5ALGA 3DKRA 5EFZA 2PVSA 4I4CA 1ACLA 4Y2JA 1XZJA 2ACEA 5KREA 3FCYA 5FRDA 4HAIA 1E8DA 2O2GA 4KE7A 1DX4A 1F0NA 2HA6A 4Q05A 3QMMA 3PUHA 2OGZA 5BWBA 3H2HA 3FVTA 4BZWA 3ILSA 3OG9A 4X3CA 1J06A 2DCMA 3R3VA 3E4DA 2CEKA 4G8DA 4PSDA 4DNQA 4BP8A 5DNVA 4Y2VA 5CRIA 4Y2SA 2HA4A 3DD5A 4BB0A 3IUQA 3IIIA 4FDMA 1B6GA 1YA4A 4UHCA 3HYSA 4EZIA 3BIXA 4QDZA 3H04A 4EUSA 1EINA 3C43A 3KWFA 3RK4A 1L7QA 1A88A 1W76A 2PSEA 2HA5A 2RAUA 1TIBA 5FDFA 3I2JA 5K3BA 4AO8A 2CB9A 4UHDA 4X6YA 1MT3A 3C5WP 4UUQA 5K3DA 1K4YA 1ZD4A 1IMJA 3B5EA 4XWGA 2WIGA 5EIEA 4F5ZA 4KJXA 3ESAA 2YXPX 1PFQA 2XLBA 2XQJA 2J3DA 3EBLA 2GYWA 3F67A 4LKOA 4EY7A 3AUKA 1ODCA 1P0IA 1OILA 3GFFA 2OCGA 4MYDA 1Q83A 4AO7A 2HM7A 3FWHA 2VAXA 5YASA 1KU0A 2FJ0A 1MNAA 1IVYA 3MUNA 4G8CA 2ES4A 1AGYA 5AOAA 4LYEA 4DSZA 2GBFA 4A23A 5AM3A 1RYYA 3M81A 2IIVA 3RKSA 5DNUA 3C6YA 3Q8WA 1LGYA 3B3QA 4LHEA 3VVMA 1DWOA 4I3FA 4BZZA 2JGFA 1EI9A 3IURA 1YCDA 1XKLA 1BEZA 5T4EA 2D0DA 1XZIA 5AIBA 4B9AA 3TEJA 3G0BA 3R3ZA 5ESRA 3RLIA 5FV4A 4BE9A 1RP1A 4YASA 4F21A 3QM1A 3I28A 1OCEA 3R0VA 5LZ5A 3LIPA 2PPLA 5CXXA 3WI7A 1QIGA 4PQEA 3WKBA 3WKEA 1FFEA 1K5PA 2JGEA 1QFSA 1CUSA 1R50A 3SC2A 1XROA 3HI4A 3I1IA 4U2BA 4TVKA 2P8SA 4ZI5A 2Y2UA 4LIPD 4ZXFA 2XMZA 2W6CX 1VZ3A 5AM5A 4IH1A 4ETWA 4WY8A 2WJ4A 5AI5A 5I7UA 1XZFA 2OGTA 4AX4A 4Q1VA 3T52A 1JFRA 3FOBA 3U0VA 4KACA 1ZOIA 4J0JA 4X90A 1Z68A 5AKYA 4XJVA 4X95A 2QM0A 4B80A 1A8SA 4G5XA 2XQGA 1GQSA 5FUMA 4H7HA 3I6MA 5AJHA 2D5LA 3IVMA 2XUJA 1CUUA 2G63A 3H1AA 1YB7A 5AI8A 5AO9A 2ZYRA 4OB6A 1TQHA 4FFWA 4NVRA 2VAVA 5ALOA 2XMQA 2B4KA 2XUKA 4LXHA 1T4MA 5FXMA 1FFDA 2QXUA 4QEKA 5JANA 1QIDA 2WSLA 1QIMA 3FVRA 4Y2RA 3H19A 4GXNA 5LKRA 1JJBA 2FUKA 4AZ0A 5DYWA 3DEAA 2HA0A 1ORWA 2HDWA 2DHDA 2G4LA 1SCIA 3BE8A 2AJCA 4Y2PA 4EHBA 3STVA 4DMFA 2WG1A 3QZUA 4RPCA 3LIIA 4X7BA 4QE3A 3BWXA 1QIFA 4WY5A 1X2EA 1ZI9A 1BRTA 2VJAA 2WIJA 4GW3A 1SC9A 5DYYA 3C6XA 1R3DA 1U8EA 5JZSA 2XUDA 2QUAA 1SCKA 3WL6A 5KWIA 3L1HA 5LZ7A 3WK9A 1UK7A 5EHXA 3WL8A 1VLQA 4QDXA 4QLOA 1GKLA 1XFDA 3ANSA 1VZ2A 2DHEA 4BDSA 4FBMA 2Y2VA 2CKMA 5AKZA 2JGIA 4DYHA 3QPAA 1TCCA 5AKGA 3L1JA 3WZLA 3W04A 1SCQA 2XT0A 1XZCA 4W1RA 3D4LA 2PL5A 2DR0A 1ACJA 3D2BA 1VA4A 4QA9A 4W9RA 1RWQA 3HRHA 5CT5A 2QXTA 5D6OA 3F96A 3K6KA 4WFJA 3EQ9A 2WUFA 1LPNA 2XUHA 5AKLA 5EI5A 1UFOA 5AH0A 3TRDA 5LLSA 3V48A 2XQKA 3AFIA 2PUJA 2X8BA 3CN7A 2HIHA 3M82A 5AK5A 3V9AA 4B83A 2QKYA 2V96A 3I6YA 4E14A 3DYIA 4CG1A 2WU3A 1LPSA 2WTMA 5D3KA 1QIEA 5K3EA 1LLFA 3HACA 3ED1A 1IUOA 1VJ5A 4BVKA 2I3ZA 2XUFA 4DGQA 2QMQA 4UHEA 3BIWA 3H17A 5ALIA 5DTJA 3C6ZA 4Y7DA 1WPXA 2G5TA 2GBCA 2WU4A 4FBLA 1SOMA 2O7VA 1XRRA 5HFNA 4JNCA 3QPCA 2PSFA 4OB8A 1VA5A 1HBJA 4J0DA 4FTWA 1GXSA 4C4XA 5E4JA 5CXUA 1IUPA 2CBGA 4WJLA 3L1IA 1LPPA 3G0GA 3NWOA 1MN6A 2RI6A 4CG3A 2DFPA 3C8DA 3F97A 5CT4A 1YAJA 4Z49A 4GDMA 1ETHA 3IUNA 1XQYA 2XMDA 4BCDA 4HXGA 2WFZA 3ZV7A 2BJHA 3O4HA 4C4YA 4C4ZA 2Z3WA 3V1MA 4W1QA 5A2GA 4MQMA 3AJAA 4CCWA 2B9VA 1NU8A 3WKAA 4HXEB 5LZ2A 3M83A 1UOPA 3ESBA 5HCUA 2FJPA 3HC7A 1CUJA 3EF3A 2ZVDA 4H7DA 1QTIA 4X93A 1QJ4A 2XUGA 4X92A 1TK3A 2WUDA 2VATA 1JMKC 3AINA 4BRSA 4WFIA 2WHPA 1CUWA 4EB0A 1CUZA 2C5FA 2I78A 1ZD5A 4MQLA 1MJ5A 2GBGA 4OU4A 4Y9SA 2B61A 1BN7A 3VJLA 1T2NA 1UT6A 1Y7IA 2G5PA 1BN6A 2HA2A 3W9UA 1R1DA 3WWDA 5J3JA 2VJCA 4DMHA 2PKYX 3WMRA 2B20A 2Y6VA 1C7IA 1ISPA 2WILA 3F98A 4O08A 5ALEA 1K6EA 3OC0A 4KAAA 4NMWA 5AKIA 2PSJA 1E5TA 2EEPA 3O9VA 1QIHA 4G9GA 1L7RA 4ZWNA 5AI4A 4C87A 5EHQA 3IBTA 3WWCA 4KR0A 4INZA 4ITVA 1LBTA 3FYUA 2DQYA 2WHPB 3FSGD 1EVQA 2OCLA 4J0HA 4IO0A 5C81A 1JI3A 5ALNA 1A8QA 4OCZA 5HK8A 1Y37A 4G4IA 5JAUA 3STXA 2Z8XA 5ALXA 1LPOA 4DSAA 3ZI7A 3IDAA 4DTCA 3CCCA 4H7IA 3R3UA 2QRUA 1EDBA 4W63A 4PW0A 2HU5A 5AOBA 2VT6A 2VF2A 1CUYA 1FFBA 2WUEA 2GZSA 4OU5A 1AX9A 2C0PA 2ZSIA 1UK6A 4OD0A 5E2IA 3WJ1A 1H22A 3BL8A 3IUJA 5BWCA 1JU3A 5ALLA 1FJ2A 4FLEA 4RE5A 2J3QA 1Y7HA 6YASA 1HKHA 2WTNA 2JEZA 2ZSHA 3FYUB 3WK6A 4X85A 5LZ9A 1F6WA 2O7RA 3B12A 1M33A 3GROA 5AM1A 4AB1A 4BC1A 4X6XA 3C45A 4DNFA 4H7KA 1YSCA 1H2ZA 5HKAA 5AKJA 1XZDA 2WG2A 4K2AA 1J07A 4WDRA 1DU4A 1R88A 4C01A 1AKNA 3BJRA 5FPQA 4BAGA 1YA8A 1CVLA 4UHBA 1AC5A 4CI9A 5AK3A 4BVLA 3ESCA 1UXOA 4GHWA 4ZREA 1HQDA 4E11A 4UBMA 1XRNA 4DNOA 3E0XA 2NW6A 2ZYSA 3N2ZB 1UKBA 1UOQA 4B81A 3GBSA 2PM8A 2QTBA 3WYNA 1MO2A 1N8SA 5LYYA 3G9ZA 5H3HA 4Q82A 5JAOA 3WWEA 2WIFA 2OAGA 4KRXA 5LZ4A 5CH5A 4CCYA 2PSHA 4M0MA 1ZIXA 3WIOA 2VSQA 5AICA 1GPKA 5ISMA 4D9JA 5C8VA 2CUTA 4IQ4A 4BAZA 4J0KA 1WOMA 5JALA 5AI6A 2ZYHA 4FNGA 5CURA 5JD4A 1K8QA 4C6HA 5D3ZA 3LP5A 3I2HA 4B7ZA 2QJWA 1BS9A 5EGNA 1CUHA 4OYLA 4HVTA 5CT6A 2BAGA 4U2GA 4Y2QA 3G0DA 3G9XA 5JARA 1DWPA 4FMPA 3IA2A 5A7GA 1CUFA 1ZI8A 4W1PA 3AIMA 2BUAA 4N5IX 3VISA 1J2EA 3MUOA 3W9BA 3ZLUA 1LZKA 3C8HA 2EDAA 1WB5A 4K5QA 2XI4A 2Z5GA 3PE6A 4JYMA 4PV7A 3AIKA 1NU6A 5BV7A 5A7FA 2OCIA 2BCEA 5CH3A 1YR2A 4YPVA 4FOLA 3OOSA 3QH4A 4CCYB 3O9MA 2Y6UA 3WK4A 3UMJA 2WQZA 3H2JA 4DMCA 2E3JA 4ARBA 5FLKA 3AZOA 1YAHA 4S0XA 2DQZA 1CV2A 5AK6A 2YASA 3FLAA 3WJ2A 1XRMA 1H2XA 4L0CA 1W75A 1VXOA 5JD6A 3DJYA 3AZPA 3PFCA 2J4CA 4QWMA 2OPHA 5JADA 3F8SA 2J4FA 3JW8A 3DDUA 3PFBA 1EB9A 1QOZA 4J7AA 4N8SA 2X5XA 3H18A 5DTIA 4J3JA 5AKXA 1DWQA 3CCBA 5ALYA 3A2NA 3C70A 3D7RA 4F60A 2AJ8A 2LIPA 3HEAA 4X97A 2K2QB 2JEYA 4A16A 4H7EA 4AN0A 3PICA 4JH0A 4BTLA 1AQLA 1X2BA 4B9EA 3CN9A 4ZV7A 3BF7A 5AOCA 1XQWA 3PF9A 2OCKA 4CG2A 3D5EA 5EIAA 1XRLA 1LBSA 4UHHA 5DLPA 2HADA 1JJFA 3PUIA 1TAHA 4XX1A 4P9NA 3A2LA 1DQZA 5HK9A 3EQ7A 4AZ3A 4BATA 1ODSA 1UKAA 4KEAA 1L7AA 2DSNA 2ORYA 1EK2A 1CPYA 2BKLA 4B0PA 3V1LA 4AMZA 3I6ZA 1HDEA 1DINA 4I19A 3WA7A 2OAEA 1A8UA 2C58A 3BDVA 1ZD3A 2QJRA 3RARA 1ZIYA 3U1TA 4EY5A 3CXUA 4U2CA 5AKHA 1PJAA 1XLUA 1XRPA 1N5RA 4MEAA 4RNCA 5IVKA 1VXRA 2IX9A 4WCVA 2ZJFA 4QLAA 1CQZA 1Q84A 3ZWQA 1DT3A 2V98A 4EY6A 1XZGA 4AQDA 1YS1X 2BGNA 2AJLI 1VE6A 2UZ0A 2VJDA 1E8NA 1QGED 4UBIA 4PF1A 4EA6A 1XZLA 4M0EA 4UFOA 2VJBA 5ALHA 1WHTA 1R9NA 5FP0A 2V9ZA 4YK7A 3SK0A 3VJKA 4JUIA 4DLNA 1O6FA 3GZJA 4KAFA 1AMNA 5JATA 4K6GA 4HRXA 2CZQA 4UHFA 4B0OA 1MPXA 4X00A 4QWWA 4AMYA 2H7XA 3KOOA 4WDQA 4Q3KA 1W1IA 3QVMA 4QNNA 3W06A 3UUEA 4NZZA 3WL7A 2WKWA 4MWTA 3BF8A 5SYMA 3X3HA 2QVBA 2YYSA 4P92A 3D0KA 2WFMA 3R41A 1XQVA 2RHWA 1XZKA 2XUQA 1XZBA 3IB3A 4L72A 4BVJA 4N8DA 4KYVA 1ZJ4A 1UK8A 5LKAA 5LZ8A 5C7YA 3FCXA 5HQ3A 4FWBA 4G9EA 1HPLA 1X70A 1A7UA 7YASA 2EDCA 5ALTA 4F0JA 4KE6A 3H0CA 3DL7A 4UFPA 1ZD2P 2QZPA 3AZQA 3DNMA 2ROQA 1BEEA 1EA5A 2GZRA 2QR5A 4HXFB 1ZGCA 2X76A 3NUZA 3V1NA 4MEBA 3BXPA 1R9MA 1UOOA 5IVHA 4G8BA 2JF0A 3P2MA 3EIOA 4EBBA 1QFMA 2ZYIA 2GYVA 3VJMA 3W2TA 1ZGBA 5F4ZA 3DS8A 4BBZA 3YASA 4GWLA 4IH4A 1THTA 2W22A 2HU7A 2VT7A 3WK7A 1ZI6A 3I2KA 5HQ3B 3MVEA 5K3CA 1U2EA 1GQRA 3WA6A 2V97A 5ALUA 2BUCA 2XQFA 2JGMA 1EHYA 3V1KA 2RONA 1KEZA 1EH5A 1H2YA 1CUCA 3PF8A 1G5FA 1XZMA 4DM7A 3H2GA 3STYA 1CUAA 1LPBB 1E3QA 4JEIA 4GBGA 2CMFA 3O4GA 3STTA 5K5EA 4QZVA 1MAHA 4UFNA 3PDCA 5AHXA 1UZAA 5AKKA 2JIDA 3I2GA 3K2IA 1I6WA 5LP1A 4U2DA 5JIBA 1QONA 1LZLA 5DJ5A 2OQVA 2AJBA 2XMBA 5ALPA 2Z3ZA 3ZLVA 4Q3OA 4G4GA 2XDWA 2HRRA 5IVIA 2OLEA 3C87A 4A5SA 2R8BA 1UKCA 4X94A 3QMWA 1XZAA 5DYTA 4ROTA 1S8OA 4J0IA 2HA3A 3T4UA 5HFAA 3JWEA 2JBWA 5ALDA 1E66A 3BJMA 1N1MA 1MX9A 3S2ZA 1EVEA 5ALKA 1TCBA 3WKCA 3H1BA 4UBLA 1ORVA 5CH8A 3O95A 4GLBA 4K6HA 1XZEA 1CR6A 4Y2TA 2VA9A 4MWSA 2FX5A 4HS9A 4OB7A 3F9CA 5AP9A 4DIUA 3M3DA 4DNPA 2PU7A 2XLCA 3FYUC 1E89A 1WCYA 2ONCA 4PSCA 1XKTA 3VVLA 1CIJA 1MU0A 2XUOA 1ZICA 1Q0RA 2WG0A 3A6ZA 4RE6A 4OSEA 3KD2A 2QT9A 3LLCA 1CUGA 5T4HA 1UWCA 2OQIA 4QDOA 1QIIA 5JZ9A 4FLMA 1MTZA 4FLFA 5A71A 1ZJ5A 2AXEA 3ICWA 2WUGA 2ZJ7A 3HXKA 3DCNA 2IITA 3G02A 5JYCA 1P0PA 5DWDA 4FFVA 1MX5A 3G0CA 3I1YA 5CMLA 4NS4A 3IUMA 1LNSA 4UPDA 4B85A 5T4FA 5ALJA 3DOHA 1MX1A 1D07A 1DX6A 1CUVA 1IUNA 2RGUA 1QIKA 4P93A 4E46A 4L9AA 2R11A 4X91A 4BYMA 1AURA 5HF6A 2JGJA 1QZ3A 5HZGA 1CRLA 1JKMA 2Z8ZA 4LYDA 5JASA 4UBNA 4UBOA 1JMYA 3WQHA 4XIIA 3DKKA 5EHZA 5KWJA 4H0CA 1USWA 5HF8A 5IKXA 3OM8A 4J0GA 4BE4A 3G8YA 4CIBA 4OUKX 2HFJA 1CFJA 4H77A 5KBYA 5CW2A 4LXGA 1TCAA 1WHSA 3DQZA 4PO3X 5JAPA 5ALWA 3O4JA 4KE8A 4UBKA 5CBKA 3WK5A 5ALRA 1CUXA 3AILA 4GECA 3C6BA 4GI1A 4LXIA 1EDEA 4J03A 3PI6A 1JU4A 4H18A 1BCRA 3QPDA 1CUIA 1FFAA 2PSDA 3QYJA 2XMRA 5C8ZA 2C0QA 2BFNA 3IULA 2GYUA 3WLAA 2VTVA 4TGLA 4ZV9A 3DYVA 3ZPXA 1BROA 2ZJ6A 1JT2A 1CLEA 3JYHA 1F0PA 5ALZA 4H7JA 1BCSA 1E8MA 4ZGBA 1TKRA 4G4JA 1OXMA 2HL6A 4BRZA 3DL4A 1CQWA 1P0QA 5EIHA 3ESDA 2HHAA 4AN1A 2C5GA 2JGKA 1JJIA 3G9UA 1YASA 3E1GA 5BOVA 2H9YA 1EX9A 3G7NA 3D59A 4CFSA 1MAAA 3QMVA 5AI0A 1ODTC 3STWA 4GEGA 5I9IA 3D3NA 2XQIA 5ALQA 1MNQA 3D2CA 3O4IA 5E4YA 2HFKA 4EY4A 2ECFA 1G42A 2XUIA 2I03A 3R3YA 5AM0A 4BC0A 2JGLA 3H2KA 5JZBA 2WJ3A 3VKFA 5I8PA 1NX9A 3FBWA 4U2FA 4YX9A 1J1IA 4IHAA 3OPMA 5E4TA 1LPAB 2XMGA 3ANTA 4M0FA 4EY8A 5IVDA 2DHCA 5ALVA 4QDTA 3R3WA 2WHQA 3DLTA 1HLGA 3WKDA 4DMKA 3KXPA 1XQXA 4Y2YA 1N5MA 2AJDA 3A70A 4XVCA 2OGSA 4UBJA 4WFKA 4BAUA 4IH9A 1B41A 3GA7A 1EK1A 1AZWA 3AIOA 3SWWA 1W4LA 1HL7A 4Q3LA 4Y2UA 3FNBA 3E3AA 4B6GA 4FHZA 3WIBA 4HRYA 2QOEA 3MGAA 1UK9A 1Q0ZA 2XMCA 2ACKA 2WIDA 5JD5A 3NOXA 1XLWA 5AKEA 3LS2A 1BE0A 4AXBA 3GUUA 1W6RA 3KDAA 5AK4A 2XB6A 2C7BA 2C4HA 4ARAA 2I3DA 1YB6A 5ALFA 2OG1A 5FKJA 3R3XA 2XE4A 1G4HA 4H35A 3HABA 1QIJA 1GPNA 4Y2XA 2XUPA 3OTQA 5K3AA 1XLVA 1R4ZA 1QO7A 1C4XA 4J0CA 5AM2A 2VQ6A 2PUHA 4CIAA 1DT5A 3ICVA 4BDTA 3GELA 2XMSA 4B84A 2WHRA 3FLEA 3UUFA 2QS9A 1FFCA 5ALMA 5AI9A 5C8XA 4RGYA 4P08A 1EXWA 2BUBA 2HU8A 3K9BA 3WL5A 1PV1A 1H23A 2WJ6A 2O2HA 5ALSA 4HZGA 3FAKA 5A62A 1XZHA 2H1IA 4E15A 1GZ7A 4PSUA 4BTVA 1QTRA 1U65A 3HZOA 3I2IA 3ZLTA 3STUA 5HF5A 1CUBA 3S8YA 2CJPA 5EHNA 3SX4A 3W05A 5A6VA 1W52X 2RHTA 1U4NA 1IZ7A 2OXEA 5CT9A 1GGVA 1EDDA 2BGRA 1C7JA 1FSSA 3O0DA 1IZ8A 1WB4A 1CEXA 1O6GA 3H2IA 4AO6A 4V2IA 3Q0TA 3WWOA 1AUOA 4H7FA 1YS2X 3R40A 4QDUA 2QUBA 4BP9A 3WWPA 2WFLA 4ZRDA 2H7CA 4HTAA 3RM3A 4FNMA 3BDIA 3TJMA 3VXKA 4PNZA 1XRQA 5K3FA 5T4BA 5CT8A 4KAJA 5SYNA 4OYYA 4FKBA 2Y1KA 1VE7A 1WM1A 2YH2A 5AIAA
chains in the Genus database with same CATH superfamily
4PYQA 4K6KA 4LHXA 4MQEB 4HB0A 3TL2A 1R5OA 3UK6A 1R0RE 2W2VA 1P19A 2WRZA 3LPNA 3M1LA 3NU1A 3P97A 3TIGA 1N2JA 2BE9A 2PT9A 1H6AA 6GPBA 4CIYA 2XGJA 4V0OA 3SZ3A 1SHKA 1VOTA 4EHDA 1S0UA 5FV7A 1L6IA 3ZXXA 2FZ5A 3KWJA 4KITB 1D0VA 4WZAA 5JWRA 4WOBA 1GT6A 4JGGA 2GCEA 4NI5A 4UZFA 1UWLA 4G37A 4MIKA 5ANRB 5J9FA 3AOEC 4ZOBA 2XYVA 4J29A 1K9SA 1QH1A 2AXQA 3KPYA 3RHZA 4BLPA 1A4XA 5J1SB 2JS7A 3KE9A 1KJ8A 4D9EA 3PNSA 1DUIA 4L57A 1RAEA 4U2EA 5D7BA 4BLOA 4J16C 5A7HA 1CDEA 3QHAA 1U8XX 3BB4A 4MJ3A 4MUYA 4DIOA 2DPYA 4OHKA 2A30A 1NVAA 3E2PA 4NF2A 2A1UA 4TXNA 4HT3B 1AHHA 1QSGA 1Z6GA 1AUVA 2YOGA 3QRWA 1N5JA 1MLDA 4N5HX 3N0TA 5IC5A 1ZH8A 2IHUA 4TQ9A 1K3UB 3F5DA 5DWVA 3ETCA 2X58A 1E2JA 5IDVA 5TQ0A 1E2KA 1G5RA 5CD9A 2NV2B 1OHHD 1LS1A 4L3WA 1YK1A 2JFPA 2PS0A 2REBA 2LIVA 1UFQA 4PGGA 5CR9A 3RSLA 2R4UA 4N3AA 3SQMA 1H2WA 2WLSA 4B82A 4B6EA 3KX2A 4ZYWA 5LIPA 4MYRA 2EIXA 4M9UA 2D1YA 5AJYA 1J0BA 1SKQA 3W79A 2VQEB 2VBCA 2PX6A 1OFUA 4MW0A 2FY8A 1IZZA 2VXOA 4HDSA 4ZANA 3MWGA 2IEZA 5H59A 3CZAA 3K9LA 3V8BA 2VTKA 4I08A 1O9HA 2PG3A 4JVSB 1U1CA 1YOVA 1GRNA 3ZJTA 2LUOA 2HCJB 1L5SA 2TECE 3N2KB 4RETA 5H81A 2N42A 3PWTA 4RY2A 4B3FX 3EE6A 2W37A 1TF7A 3GG2A 1Q95A 3KOYA 5H4HA 5CDYA 4LZPA 3MAGA 2MSWA 2VTBB 1G6HA 3PXBA 4UMVA 2XRFA 3L5KA 2I1WA 3EQ8A 3HU3A 4MXDA 1RZVA 4BX2A 4RVCA 5JAHA 5F35A 4WBNA 1J7JA 1F8UA 3IDFA 1A27A 3AIIA 4YJGA 5BMVB 1KU6A 1JIXA 1P0MA 4GLLA 5KMGB 2X3FA 1EWYA 3K5IA 5DT9A 3BFJA 2IOQA 3HBAA 3RIHA 3OH8A 4HLCA 3C5VA 3CEPB 2HHJA 5BR4A 3EPJA 2IDJA 2Z83A 1DKLA 4C07A 1UMCB 2I29A 4ML3A 4MV0A 2B7BA 3BFXA 1R0BA 3WB0A 1GU7A 1KYQA 2XR1A 2O5CA 4J43A 1Z0DA 1ZQ9A 2GBLA 3JASA 5HVNA 5K2OA 3AVWA 4UULA 3BREA 2P6PA 1WPRA 1YDFA 3QF7A 4O0MA 4UNIA 4X71A 4OJNA 2NG1A 4HV4A 3DM5A 5I5GA 5CTAA 1EVKA 1NZJA 1SQ5A 2AYXA 4JKIA 2PX3A 2RKBA 2PIDA 4RZ3A 5CLIA 1D5CA 1QC5A 7REQB 4OM7A 4YLYA 2KW5A 5KX5F 5KNLA 1VKHA 2P5UA 3B6KA 3R5KA 3HLKA 5HKBA 4REMA 3OAAD 2HR1A 2JJ1A 3UVEA 4NZ9A 5IH7A 1JHUA 4M2LA 1J1UA 4X1YB 3DKRA 3I58A 4G2TA 2PVSA 1V1RA 4Z4CA 4XCXA 4Y2JA 4RF5A 5FTJA 3FJ1A 1OF1A 2P91A 3O2NA 3WFZA 2ACEA 4F12A 2X86A 1R0LA 2YCBA 3MT9A 2ZI6A 4XJXA 5FNVA 3U81A 4G0XA 5KREA 3MQFA 2EARA 1H4VB 1A4RA 2BZ1A 3VDNB 4Z1MD 2IW3A 3D4BA 1DAEA 1PS8A 4HZIA 4IDDA 3UATA 3JVVA 1J42A 5CB4F 4ZOAA 3MWKA 3P0IA 1V43A 3R5TA 5AVYA 2YXNA 2O2GA 3E7PA 3MINA 4EFDA 1F0NA 1C9KA 1G5TA 1LCIA 1GTL1 1TXGA 2Q8NA 2YHBA 3IP5A 3LKVA 3PXXA 2GUWA 3CX7A 4RCZA 4F2DA 1FC0A 2QSZA 5I5EA 1D9XA 1FRNA 1PGPA 1HE2A 1NZFA 4Q1BA 5BWBA 3H2HA 3TZLA 3WLTA 3HE3A 1J9GA 5CPFA 1AKRA 3DDCA 4GR4A 4MR9A 4EX7A 4CL3A 5JUWA 1J06A 1UBKS 2FFBA 3IQXA 4UM9D 2DCMA 4I55A 3TUZC 3NBZC 1GG9A 2J6HA 2BDUA 3JQ8B 4YYEA 3ITDA 4F8EA 5LOVB 3U09A 4BLRA 2Q6KA 1EAMA 4FXOA 4DNQA 4LZAA 1MUUA 4TUYA 1W5AA 5BVGA 5TS3A 1P4HA 1Y1TA 2FZKA 1C14A 1RD4A 4KH0A 3L8CA 1K5GA 2ZM5A 3KCNA 5BW8A 3LWDA 3K6SA 4Y2VA 2FXIA 3ENNA 4BO8A 2F48A 2P3OA 2PD6A 4AI6A 2TSYB 4ND7A 5BYBA 5CRIA 3RAPR 5GJCA 2OZLA 821PA 3A06A 2AK2A 1KFJB 1PGJA 2HA4A 2O20A 2YY7A 1UODA 2ZTLA 1D2RA 4MCAA 2WJPA 4O2BF 3IUQA 5CLLA 2EERA 1TU4A 1H1TA 2D54A 4HNSA 5EP1A 2AC7A 3KKNA 1W29A 2QVYX 4H1VA 3VYTB 2AX3A 1RWBA 4G0MA 1E2PA 1G19A 1PFKA 1W25A 3UJ7A 5KQSA 3GCDA 3TQHA 4EZIA 3BIXA 2FU5C 4EG7A 4EGAA 4FKZA 4YUVA 2UYHA 3Q0IA 3TLZA 4Z4IA 3TW8A 3P0EA 3UMBA 4EUSA 3EFEA 2BGIA 3GJ8A 5CEEA 3IVXA 1Q0SA 2LV8A 2X9LA 3TXXA 3TOXA 1EINA 2PXXA 4KLRA 1U9ZA 1VJGA 2II6A 3PP8A 2AH5A 4Z53A 3PGVA 4MKZA 1I7NA 1S1CA 2GT1A 1A88A 1E1KA 3TCNA 3GGOA 1TIBA 2H4XA 2OP0A 1I6MA 4HWGA 4AJNA 5BP7A 5ITZA 5K3BA 3B6ZA 3G49A 4HAZA 2HLHA 1WF6A 3ZU6A 2CB9A 1L5LA 2B7LA 1MT3A 1X7GA 4G01B 4UUQA 1KSGA 2CHGA 3QX8A 5J5VA 2Q3JA 4P98A 3UMSA 3PE3A 4KQ9A 1L4YA 2BR3A 4KLCA 1K4YA 2W71A 4ND6A 1DBIA 1SC4A 3A0UA 2B1IA 4CF5A 4ZK2A 5KPDA 5L3SB 1S2MA 3EYAA 2WIGA 1NFRA 3QU7A 4P4UA 4RK4A 4ZQHA 4WCDA 3OZ7A 3SHWA 4EFNA 2IIBA 1DBSA 3MWFA 4X00A 1DRKA 2PL1A 4HFMA 4PYMA 5JD3A 3J80A 2GOYA 4O4JB 4QDKA 2HJGA 1TKAA 1V9SA 4EY7A 5FYDA 1RPTA 2ZYAA 3AJ9A 3AUKA 3SOPA 2KS6A 2BW0A 3VR3A 1XMSA 1N2HA 2J3MA 1ODCA 1ORTA 5CK5A 4CM9A 4EYOA 1OILA 2OCGA 1EFRA 1P81A 3BMNB 1KI4A 2PRIA 4HQNA 1H3NA 4FYHA 4QBKA 2B3TA 2V6JA 2ZWIA 2GBPA 4II7A 2HM7A 3R0JA 4KQ1A 4PWYA 2CFRA 1OC4A 3FWHA 4RZ2A 4PZLA 1FSFA 5EQFA 1I2MA 3MUNA 1E6LA 2ORIA 4G8CA 1H93A 2ES4A 1AGYA 1XI2A 2WFAA 1H8EA 3DD1A 3KHUA 3MFYA 4K28A 4R9VA 4RKEA 2CMGA 3UMRA 4EUNA 5LVAA 2J87A 3FOWA 3PZRA 1GG5A 4FS8A 4UUPA 1DXOA 1P2BA 3I1JA 4P2GA 1GPAA 4LX0A 1Z0AA 2YZGA 3AR5A 4BWYA 2B4TO 3GUZA 2BHSA 3C6YA 3QA3E 4YBRA 3LPLA 2D1FA 1QAQA 2Q2NA 4UAUA 2BD0A 2IH5A 1V3UA 3VVMA 3ZK7A 1K2WA 3PB3A 3J7AC 4BZZA 5JJIA 3HKCB 3KB1A 3H2BA 1G7SA 2XWJI 3QEKA 3G8DA 1P5RA 2PXAA 2WNSA 2D0DA 1XZIA 3VNSA 4FFBA 3RYIA 4Y2HA 1DC3A 3QMPA 3RC7A 2PBRA 1J70A 1MRSA 1I13A 3FSJX 5EWLA 2GFHA 3RYTC 4IF6A 1AU9A 4D0RA 1H94A 1A76A 3AEQB 2FSIA 3I72A 5AR1A 5FR2A 3W2IA 1DAPA 4JHXA 4IWYA 5KUTA 5A3VA 5EKTA 4DIBA 5L4NA 3KTFA 5DGCA 4EGCB 4MV9A 1K4KA 1QHXA 4KJZA 5EC8A 1SVIA 4JHLA 1XELA 3EGXB 4TMVA 3N39C 4IKPA 1D2NA 1IIRA 4E94A 2H2IA 3B60A 3F3YA 1QG2A 1XPRA 5HCIA 3R0VA 5FAKA 4YGXB 1Q7TA 3NRJA 3PYXA 2AQHA 1FTNA 2JHCA 3BWMA 4NNJA 4BNTA 1AKVA 1S9HA 2K7ZA 1JPJA 4F9EA 1FTYA 1YO6A 1EIWA 3N8DA 4JC8A 1K5PA 1RAHA 4Q18A 3V5NA 2JFWA 5KINB 3A05A 5JOQA 1GTVA 1Y3IA 3AM5A 1R50A 3AL3A 1V3QE 1L8XA 5E7JA 2R68A 3HUTA 3VH2A 3ABQB 5CYOA 3VR4A 1HORA 3P0FA 4U2BA 2AKAB 2GEVA 4WK4B 4EJFA 1PL8A 4EZEA 3PPYA 2P1DA 1T5SA 2CLFB 2P8SA 3H11A 5F51A 4E5PA 5BY2A 2J3KA 3SFTA 4ZQCB 4EL5A 2Y2UA 1YS9A 3OUZA 3W3ZB 4KREA 1Q92A 3QLUA 1L7BA 3LX4A 3T7KA 4RIHA 4A8JA 3DEYX 1X8XA 4U00A 3SE0A 4ETWA 1C3OA 3NHPA 2R00A 4CU5A 1GTZA 3AI3A 3CRW1 2CWWA 4LQCA 4NP6A 2HMTA 3CR7A 3PA6A 5FTKA 1E1NA 3DW1X 4HQ6A 2QM7A 1NJ1A 4AC9A 3JALA 3JYPA 4TYPA 3U0VA 5KAMA 1MT0A 3NBYC 1LJ8A 4MUBA 1ZOIA 2FMXA 2WF6A 5B1IA 1P18A 3D43A 4J0JA 1CR4A 3AR3A 1YDMA 4JR2A 4MHOA 4X90A 3QHPA 2PANA 2E49A 3PX3A 4G0OA 2A14A 4YFVA 4BWFB 5KYUB 3DA8A 4C3UA 2PH1A 5EZ6B 1KA9H 1COWA 1U0EA 5JC1A 1E6EA 5TQJA 2OBNA 1MVOA 4TKUB 1SKAA 3BWCA 4FONA 5KI6A 4E5SA 1EM8A 1DUSA 2M6SA 1G20E 3N0XA 4W8GA 3Q3GE 5JO0A 3LI2A 2CXNA 1IM2A 3PX7A 4JQYA 3L01A 2Z2KA 4RYLA 4ACAA 1ECLA 3QPBA 5HE8A 4BVAA 1DCMA 3HUEA 5JT1A 4E5DA 4C6TB 3C97A 3ZZ0A 4QFMA 3OE4A 1XXLA 1HC7A 1UT5A 1NM5A 2YY6A 5KC8A 3ENVA 3JAKA 5F7XA 1M2OB 4J7CA 5IBCA 2BGGA 2ZRMA 3RUIA 2B98A 5DBFA 3EDRA 3UG7A 5M34A 1XU9A 4QRDA 3NOOA 1TQHA 3JD0A 5FPYA 2VAVA 8GPBA 1JFLA 2XMQA 3C3EA 3WWYA 4C0SA 2RBEA 4GP9A 2IYOA 3OZAA 4M9ZA 2QLTA 1PSZA 3EA0A 4XYBA 4CQJA 1DRJA 2QXUA 4LYFA 4Q9KA 2V9PA 4RH1A 2AFIE 4LV8B 2DCUA 1NBOA 2P8JA 5D86A 1OBCA 4Q00A 3SC2B 4CEHA 1YBHA 1Z5OA 2ECKA 3CZMA 4DDMA 3HTXA 1OLSB 1XTZA 3HDTA 1TTPB 4IQ8A 2FP4A 2XRMA 4HDQB 5LBIA 4Y2RA 2IEGA 1RKXA 1EXMA 3SBEA 4EIWA 4GXNA 2P6NA 1FLVA 4KQKA 1JJBA 3PYMA 3SSAA 4CGYA 3HDQA 2C31A 4KG7A 5D2CA 3SXJA 3PWSA 4IDNA 2GN2A 3ICPA 5JZVA 1SZDA 2G40A 4C0WA 4Y1RB 2HA0A 3GEGA 4I9GA 4OM8A 1J5XA 2A0FA 5EQDA 8ATCA 1OH5A 2OHGA 3UZUA 4RAOA 1U2GA 1C1DB 2WU1A 5B3LA 2G4LA 2H1FA 2FW6A 2RHGB 1SCIA 2KBFA 3W8NA 2FW7A 1Z0IA 5B7QA 3WXMA 1QPZA 1HDRA 3BEOA 4IIJB 4UU8A 5H83A 1U2ZA 3KZXA 4X62B 3KDPA 4EHBA 3MLBA 1WWKA 4EECA 2WG1A 1IEWA 4HWSA 4ND8A 4KQWA 5EGSA 1LVGA 2RE8A 1IBSA 3BWXA 1CYDA 1QVAA 4E88A 1N8NA 5TIIA 2VH1A 5EJAA 3UXEA 4MUGA 4PC1A 3UJDA 1R0WA 1X2EA 1BRTA 1ZI9A 2VJAA 1FW6A 1JKJB 2WHEA 1CDZA 1WG8A 1VL1A 2QRVB 2H1OA 4QUKA 1UBSB 2NZWA 4JOCA 3KVOA 1CG6A 4GW3A 3UAZA 3W5VA 1XGKA 2A58A 3OEED 1SC9A 1QH8B 3RBXA 5DYYA 1JYSA 3X44A 1GHTA 4X66B 3ZVMA 1KI6B 3C6XA 2HY7A 3BH6A 3L4BA 1E58A 4Z99A 5DHTA 1WZNA 3ZCTA 3LC0A 3WL6A 1YVDA 2QPOA 3RJTA 3TCKA 4R1MA 2LKCA 5EUCA 1L5VA 5LZ7A 1HDXA 4R0NA 3WL8A 4M0CA 4JKOA 5FWYB 1NTOA 1GTG1 1E1CA 3CJTA 3IQGX 3T1OA 2NUTA 3L93A 4COOA 1CR1A 2IY7A 3HZRA 3ANSA 2ZT7A 5C5CA 3MJTA 1WUTA 2DFLA 3FKSA 3MUFA 5FNZA 4BDSA 2UV8A 1S3SA 1W1UA 4IMJB 4DV2B 3WGQA 2ODPA 2Y2VA 1ISGA 1XTTA 1AQUA 3BMOA 1KAOA 2JGIA 4LS3A 3WADA 5A6SA 2EWWA 2NVOA 4FEAA 4DDVA 1PJBA 1QDEA 1Z75A 2DTEA 2ZKLA 1JR3E 4FOPA 4ND4A 3L1JA 4S2EA 2OHHA 3OD1A 4OHPA 4RKRA 3W04A 3VYSB 1R2QA 3HBJA 4AZ0B 1A71A 3OPQA 4M1KA 4PR0A 1XMOB 4JV5B 1XZCA 2ZG6A 3D4LA 1GL7A 4NJOA 1R0ZA 1KJIA 5I4CA 5I7FA 2DR0A 3EF0A 3OIUA 1MGOA 3C4QA 4XPIA 1IPHA 1Y8ZA 5BN3B 5FUQA 4XLLA 1ACJA 3SLKA 3O8OB 1VA4A 4FN4A 4A8TA 2BZGA 4QA9A 4YV2A 3N2GA 2AEMA 2O0KA 3HRHA 3SHFA 4LPKA 3L6BA 4NONA 2O0HA 3IAEA 1QHSA 1UJ2A 3AUFA 3PUKA 3F96A 3BX1A 3K6KA 3TM5A 3MCWA 3ZWXA 1VMKA 4JQZA 2C2HA 4HAXA 3GZNB 3HFSA 3MWDB 4G25A 3QWHA 3TFOA 1Q7GA 3HUFA 4OIFA 3GV0A 2NVUB 3UK1A 2ESRA 5AKLA 1U7WA 4L74A 5EI5A 2QE6A 5AH0A 5HCNA 2PL3A 3SQOA 4HOYA 3TRDA 3WGHA 3VJRA 1LUAA 2PUJA 4PNEA 3IMEA 2GEJA 4Q4HB 1NJGA 4DCPA 2PGXA 3EGDA 2HF2A 1QQ5A 4YUWA 4HZUB 2X1MA 4CYMA 3OKFA 4CM4B 3TZEA 1Q17A 2WM8A 4K87A 4MV5A 4K1XA 2Q6TA 2ODQA 1WCXA 2ILVA 2QN8A 2NTJA 1U0LA 2CUNA 3EB9A 3JZDA 5FOSA 3FR7A 4B83A 1HH4A 4GP6A 1E20A 4R7GA 3SR4A 1WTCA 4K0KB 2FMHA 1SVOA 3VMFA 1RJ9A 2WAAA 2J3LA 4ZJPA 5LCXA 1FDUA 1YRAA 4WCFC 4QHSA 2WTMA 2D00A 5D3KA 2WUVA 2HMSA 5CGQB 3Q9UA 1QIEA 4QUHA 4OQNA 3CF6R 4N76A 2EGHA 4KN6A 4UU0A 4DGSA 1MC5A 3BGSA 4LYHA 3ZJVA 4R6WA 5T6MA 3H2YA 4REQB 4D42A 7GPBA 2PH7A 1MZVA 4KO4S 1F12A 3N05A 3OQIB 4KRGA 3GX1A 4WNCA 3H9EO 3SVLA 3VR2D 4C0AC 1L4UA 4J9VA 5KYNA 1NBAA 1PW5A 1HGXA 1RRPA 2XITA 4J3NA 2X7HA 1SC6A 4OK5A 3KZ1E 2I3ZA 4UE3S 2X4LA 4G8JA 2QU7A 4DGQA 2ICAA 1CHNA 2Q6VA 3GFVA 3UJAA 2UDPA 1GQOA 3TL3A 2WT9A 2GZDA 2GNOA 5JQGB 2ZJZA 4YRLA 4E07A 1NYLA 3C6ZA 3G79A 1V26A 5JMPA 2P2LA 1N7IA 3RVOA 1AHIA 3TRFA 2ZE7A 3W8EA 4MI1A 2I4MA 3I04M 1OA1A 3CHYA 4N4AA 2G5TA 2HQRA 3RKRA 1OMOA 3B1VA 3N2NA 4AJ1A 1HR0B 4MB2A 4NJMA 5J5AA 3RAFC 2ZYDA 1PJRA 2DGDA 1SOMA 2GK4A 3QTLA 2JCYA 4AKIA 5T5QA 5TMBA 3RSSA 3UJ9A 1IQ0A 1Y80A 1WRBA 1Z62A 1NOIA 1IK6A 2BHLA 3NRBA 3FTEA 1FSPA 4WY2A 2H7VA 3ZGOA 3F1LA 1XSEA 1P3DA 1OXSC 3MTAA 1IDOA 2DWCA 3HU1A 1P4SA 4FTWA 1CP2A 3RVQA 3BRQA 1PJSA 2I4IA 2XCTB 3IO5A 2WWGA 4G81A 1N5OX 2GJAA 5BSKA 4YJ2F 4ZFNA 2ZUCA 3A11A 4XR9A 3RU7A 1UC9A 5KOHA 4MV3A 4YQEA 2DTDA 3CC8A 5F1YA 2EFJA 2OXCA 5LQSA 2YNMD 3PC2A 3L1IA 4PG6A 2HB6A 3G0GA 1Z38A 3V33A 3H05A 3LY8A 3IAS6 3ZNOA 1MN6A 5KVAA 3AU9A 2AJTA 3BG5A 2PXCA 3BK7A 4OFXA 5CYPA 2PMEA 4CIWA 1KC3A 2VRNA 2FPKA 2IYXA 3MWEA 4YR7A 5I51A 2Y77A 1R7RA 1YAJA 1R0KA 1GNLA 4TXMA 2HLPA 3SF8B 2XKAA 3BTVA 1DIAA 1RZ3A 3CW2A 1NXPA 3DO8A 4HAVA 1BNCA 3H6KA 5EQTA 2W2KB 3RWOA 1ETHA 4WMLA 4PO1A 3DE1X 2RARA 3FFXA 3IMCA 3TQFA 4ANFA 5BQXA 4CKCB 2XMDA 4BCDA 4TSFD 4ZOLF 2AUNA 2WFZA 1AO3A 2Y1FA 4MQFA 3QVTA 3SYKA 1VIVA 3BMXA 3RFCA 2I8AA 5G4LA 1V96A 2I4OA 4FFOA 4QXQA 3A10A 3HO1A 4GMHA 1U0SY 4TMZA 2EW2A 2ZULA 4OA8A 4W1QA 2Q5QA 3L6CA 5A2GA 2QJTA 3BXZA 4ZQFA 4PZ9A 1YFZA 3V4PB 1U02A 3DLIA 3JATA 2WJZB 3E2IA 3PQ2A 1A8PA 1KC1A 4R40A 1X7ZB 2RJOA 2XQVA 3F3SA 2D59A 3IP1A 3N59A 3NP9A 3OQ6A 2O2EA 5IHXA 4BKUA 4TRNA 5LA6B 2JAPA 2XV1A 4ZK6A 2HD4A 3L6OO 3CEMA 1JZTA 1KOFA 4ZYXA 4UUNA 1NU8A 1TA9A 4GLJA 3AUUA 3DJFA 4Y9TA 2GLUA 5FTLA 5JJLA 3BYZA 1TW2A 1NLZA 3M83A 1DQRA 4PG7A 2DF8A 2ZAOA 3R4CA 1KY3A 4IX9A 2GZ3A 3RJMA 3VR0A 2W42A 3BE4A 5F9HA 2O4UX 3JZFA 5JWOA 5K0EA 4CQNA 2Z4RA 4AJLA 4RESA 7MHTA 1P6XA 1LEHA 1NXSA 1T9DA 4BNMA 2OB2A 4FMDF 4YCDA 4B76A 1S89A 3QNUA 4KQHA 4KK3A 1X74A 4X93A 4UCWA 1XL1A 2RGDA 2CNBA 1NNI1 3GRAA 5DI3A 5AW6A 3VO8A 1QJ4A 3L05A 4JX9A 2W0SA 4PZZA 5ICGA 1VBKA 1MH1A 1PHPA 2UYYA 5C4MA 3A6EA 3EQZA 1K75A 4WFIA 5IMBA 3S1SA 2H2DA 3W1WA 1PD0A 3K4QA 5J58A 5C7OO 4P7JA 4TT3D 4QJIA 3PPIA 1QQ6A 2BMFA 1ZD5A 3IA7A 1N1DA 3IX7A 3GYBA 4D5GA 4ECEA 3ESZA 1G6KA 3WV5A 2VIIA 2VDWB 2L17A 4OU4A 1SVWA 1ONPA 3EWAA 1ZVVA 1M1YA 1KDRA 2ZETA 4HF7A 4N54A 3N76A 4N48A 1T2NA 3CNNA 4RFLA 5KDLA 3RBZA 2BGMA 5BOSA 2QTFA 2IZOA 3SY8A 3C2QA 4FYXA 4D3XA 1IEVA 1HM5A 2QW8A 5F5LA 2P6UA 2CBZA 2YWRA 3KFVA 2CGEA 3WIUA 3KYDA 3COSA 4DMHA 1KWGA 4FQ8A 2IYWA 4RA9A 3UJCA 5TQVA 4PFSA 3K6RA 3PRJA 3AKZA 3DE7X 1OWPA 2B20A 3JD4A 3N74A 1C7IA 1MB9A 4ND5A 4RV9A 2QRQA 3T54A 1DAKA 2WILA 4M9SA 1VQ1A 1G9SA 3S0JA 4R6XA 2X22A 1YVEI 5DP2A 3HP7A 2VQ3A 3OC0A 2HNBA 1P9OA 4F7WA 3TQRA 1I4OA 4U7GA 4XM0A 3IPRA 3MSCA 4ATNA 1SVSA 4HAYA 4AIRA 3PHBE 4YV0A 3LQRA 5IT9A 3NH9A 5AKIA 3TFWA 4B3HA 3R5FA 2CT8A 4OHWA 2QLBA 3MTJA 2EEPA 3NT5A 1U0FA 2C5EA 5IMSA 1LC0A 2DLCX 5U9CA 1Q7CA 3U7IA 1KRHA 2OSBA 2WWFA 2C7QA 5EZSA 2Q0HA 4LE0A 4MARA 4ZWNA 1A8HA 1RCFA 4PXYA 3ZEIA 2NO9A 4AXXA 5IUJC 4INZA 1PEAA 1U2DA 8OHMA 3RJ9A 2LCIA 3W2FA 4YC7A 5GTDA 3FPKA 3QFTA 4JJIA 3ZOKA 2YYAA 3WMXA 4D9FA 1BFKA 1J99A 3DFMA 4QARA 1SXJE 4J0HA 1NJ5A 1PJQA 2Q8QA 2GJ8A 3N7UA 4C4RA 5KYYA 1Z4JA 1DXHA 4OGKA 3HM9A 1NVXQ 1XVUA 3IIKA 1D4FA 2WAMA 5ALNA 3FDIA 1ZL2A 2UVPB 3QXHA 4PPQA 3ZOZA 1KQFA 1FFXA 3BT7A 3WYBA 1ZG3A 5C9ZA 5AJUA 1YDEA 1YJCA 2FCRA 1A77A 2ZATA 4QBTA 5CNJA 2I80A 1DG3A 4Q4JB 2B94A 3R3HA 1YKGA 4R1LA 5ALXA 1WIWA 2VUTA 1X3LA 3HB4X 4D9GA 1JG1A 1Z8FA 1REQB 4NBRA 4EKNB 4H7IA 3QVOA 1W8IA 4Y98A 1JIJA 4I4NA 4BMVA 5MFZA 3CVUA 2Q4OA 4MYTA 4CT0A 4JJEA 5A4IS 2Z09A 2V0CA 2GEKA 5CIQA 4B31A 1EDBA 1UPXA 2ZUBA 3IR5A 2VYCA 4ZJZA 2HUNA 2C5SA 4BB9A 3IL2A 2GBLC 1RLMA 2ZBVA 3CKKA 3EWNA 3KQSA 1E5QA 5KOJA 1DG1G 1QH9A 3B53X 3RQIA 5CUQA 4BO3A 1N6IA 1SCDA 1KZ9A 3TNDA 2VF2A 4DUYB 1SELA 2HMUA 1CUYA 2ZE8A 5CVCA 5LPNA 4AY2A 3LY9A 2KM1A 4QRIA 2WUEA 1EWRA 4KH1A 4GL2A 2C0PA 3L18A 2ZSIA 4AY6A 3IUJA 1LI4A 3N7TA 4BN4A 5B5SA 5BWCA 3Q7RA 4YFYA 2Q5IA 1GJRA 3IUPA 4DA7A 3P2KA 4ZYVA 1TU3A 2CDRA 4JI3B 1JU3A 5B64A 1VHTA 1VMEA 2VDLB 3ASYA 1VE1A 3JRXA 1Q1ZA 2GO1A 4ASUD 1EE2A 1CEYA 3HCOA 3UFXB 2UYCA 1A97A 4LGYA 1RC8A 3U5ZB 3TMAA 4A0FA 1QZXA 2R2AA 1PLLA 4PICA 1U1IA 2TYSB 1OFUX 1T2UA 1VPDA 1IY8A 4YRFA 1TT7A 1F6WA 2O7RA 2PMFA 1JX6A 2ZI4A 3B12A 3IALA 2EVWX 2QLLA 2DH6A 3GROA 4L02A 4JQCA 4O4HF 5AM1A 2PUBA 4NFLA 1SBNE 4DNFA 2AFHB 1DARA 4ER7A 3MELA 2AZMA 3CWZA 1PQ4A 2X77A 3R8FA 4HL6A 4MPTA 4XLTA 4QOEA 5EE5B 1HDCA 1WL8A 5CG2A 1NRXA 3PUJA 4P7GA 3FVWA 2PKWA 2IW1A 3C98A 3KOMA 1BJKA 1Z2AA 2FN3A 3IPLA 3TW4A 3VKUA 1M5RA 4ZYTA 1R88A 4WEQA 2HSDA 3FFTA 4YCJA 2R2GA 2IELA 1Z4NA 4S3MA 3U7EB 5J4KA 1CVLA 4P35A 4UHBA 2XCQA 4GYWA 2FF5A 3AC0A 3CPSA 5E3HA 5JCOA 1LSSA 4CI9A 3UUWA 2PD4A 3ESCA 1HYEA 2XA9A 1QXSA 1K8ZB 2HK6A 1JQLB 3A9RA 3QWBA 4RENA 4C6RA 4A0RA 3DLBA 2QLJA 1OZFA 3L6RA 4H9GA 3ET4A 4OMCA 4UBMA 2JI9A 4X3PA 1TK9A 3HGMA 4D97A 2IOYA 3L92A 5EJ2A 2GYYA 3PDWA 5AW5A 3DDOA 5KSZA 4IHJA 4HC4A 1RJFA 2V0NA 4BMXA 5HKKD 3N2ZB 1VHWA 4U5QA 5IJ0A 2JJ8A 4EUEA 5L7WA 2BGTA 4IEEA 3TEMA 1TQDA 4BNUA 4F3NA 1W93A 1GADO 1MO2A 3Q6MA 2OCBA 5DU2A 5JRZA 4R2HA 1M0WA 5JR3A 4BNZA 1E1QA 4Q82A 2BKXA 4E51A 3ZVLA 1WPQA 2PNJA 2HHHB 2UUAB 3V2GA 2JD0A 4KRXA 2Q3DA 3BQMB 4OLFA 5BSFA 4EYKA 1OIXA 4PIVA 5CH5A 2PSHA 4L2IB 4ALIA 1T0PA 3VYWA 3RVNA 5FD8A 4YI3A 1QF6A 5AICA 4UHJA 4LXQA 4ENPA 4HLDA 1GN9A 1WP9A 1W4CA 4Z51A 3GJ3A 1ST3A 4FB5A 2PRKA 4CCAA 4D9JA 3B36A 5C8VA 4AT1A 4AY5A 4OX9Y 1X0XA 4H08A 3PTLA 3K70B 1JEDA 2G5GX 3IELA 1YNOA 4TSRA 1GSAA 4CEJA 1CIVA 2ZITA 4TWAA 3O8BA 4BNHA 2O59A 2CF6A 2EAUA 1K8QA 1MP0A 1RXCA 2FNAA 1Q7EA 1PEYA 2WJIA 4NBSA 4QBHA 4X41A 3LZDA 5D3ZA 1ODFA 2BEUA 2D5IA 2BHNA 3LP5A 1ZUNA 4PCLA 5LMUB 2BFBA 2QTRA 3QKTA 4A1FA 1K66A 1SK8A 1T9GS 4BMOB 4R31A 2OHFA 2A0UA 1URPA 2BAGA 2C4WA 4M0DA 2XZLA 1OIVA 2Q9BA 3NHKA 2ZBQA 2QAGC 3TOVA 2YIJA 3GDOA 3X2SA 4AYTA 2EJTA 2VQSA 4QG7A 2HMYB 3IKLA 4KDFA 5F73A 3OZDA 4FMPA 1P62B 4OHUA 5FA8A 2OESA 5GPBA 3RYFA 3TTTA 2VHCA 2W2MA 3ZCQA 4ARUA 3IA2A 2A4MA 3T5PA 5LQAA 2EGGA 3HKEA 3FTNA 1CUFA 2P69A 3M6IA 2IXBA 2PLNA 3O6VA 4OY3A 5TPZA 3UGKA 1YL7A 1J2EA 1F60A 3VISA 2H85A 1LDEA 1XD8A 3M49A 3MUOA 1ADYA 4L07A 2YZMA 2M6KA 3TVTA 1YB1A 4YECA 1NIJA 2A5LA 2ZDHA 2BOVA 2I6XA 1XAHA 2ODTX 3PC4A 1GNPA 5LYJA 1QR6A 3T1QA 3ZIAA 4A4DA 1SEPA 4PGHA 2AZ4A 3O75A 2YJ5A 4L4ZA 3O9ZA 4GKVA 1NUHA 4EB8A 3K70D 3GU3A 2EDAA 2NU8B 2PHZA 1SCAA 4K5QA 2XI4A 3PE6A 4PV7A 1S3GA 1SVMA 1CQJA 1TYDE 3AIKA 4DG5A 3CU5A 4LJ4A 3SJ7A 3FTQA 1RQLA 1Z7GA 3IR6A 5A7FA 1WVMA 3WIVA 3RS8A 4UUOA 3U7RA 1E2BA 1QP7A 1OX6A 1M6NA 1QRDA 3UY4A 2VJPA 4FOLA 3QH4A 4EFKA 5K0JA 3SQXA 3A25A 1U80A 4O02B 6Q21A 3EZGA 2FAXA 2H4YA 2YV1A 1HUQA 4KPFC 3QYPA 3FWZA 3DDHA 2PEYA 2NU9A 1EWTA 1HQCA 4ES6A 1AVTA 1YAHA 2Q1SA 4GI3A 3BIOA 2WMOB 4Q6BA 3RFVA 5IBQA 3A14A 4YAJA 1L7EA 4D74A 3FLAA 3GMSA 2EJCA 2FUG6 3PCXA 5IAAA 3Q5DA 1KYZA 4BN0A 1XJCA 1NW6A 2J7PD 3GBPA 3OEWA 4HDRB 2F43A 4RHCA 1KEKA 3TAHA 4AKHA 3FGNA 3IPXA 1YL6A 2FLVA 1CVRA 2RHJA 3OCUA 3EZ7A 4Q1EA 2Z9DA 1XVTA 4R1SA 4W7HA 2VH5R 4AKTA 1OZAA 2UVDA 3PHIA 1XRMA 4G97A 1S6YA 2Q1TA 5ENZA 1NW4A 4GMDA 3RG2A 2F3PA 1OAAA 1VXOA 5FNVF 2Z4SA 3A58B 3E9RA 4YRBA 3GGPA 4YTEA 4E5YA 2DPLA 3KL4A 2XXAB 4P4NA 3UOAB 3NAQA 3ZWNA 1QU3A 4GPIB 2VF8A 2HK7A 5LQDA 2N0SA 3HA2A 1JECA 3JAMA 1ZRMA 2ZIAA 5EEHA 4Q1DA 2IT1A 1OXBB 5CM8B 1NFQA 5JADA 3ONEA 1L5QA 4RHEA 3SS8A 4E4RA 4G5QA 5AVOA 3M4JA 1YGPA 4FQ5A 3JS5A 5JC8A 5THQA 5M29A 3F9IA 1OWNA 1Y5IA 5JPCA 5BSTA 4DRYA 3PFBA 3X0DA 3OWOA 4RH0A 4RYDA 1HQYE 2B7CA 3EA5A 1QOZA 3R6GA 2WUWE 2DBVO 1V3VA 1MA3A 3L0PA 1K68A 3G3EA 4I55F 4O5AA 4TTJA 3HJAA 3EUEA 2E48A 2R4TA 1U8CB 5REQA 1N1EA 4NAUA 1I1HA 4P58A 1I6KA 2JCBA 2WC1A 4BP3A 5LU9A 4MROA 3OZCA 1B0AA 2ZOSA 4TUYF 3RRBA 4QU5A 1J8VA 2O5RA 3QLUC 4MR8A 2IUUA 3CCBA 1QE0A 4A8JC 3KETA 3M2TA 3U9TA 2Y05A 1Z6PA 4JBLA 5G1OA 2R00C 3QVSA 2IOFK 4EPRA 4ZVTA 3DHWC 2C95A 5L9AA 3NHLA 2QY9A 2LIPA 3B6MA 2RGRA 5H70A 5FHQA 1NYRA 4ZPXA 3ORRA 1UBJS 2WHYA 1OWLA 3KIPA 3GJRA 4X97A 1T2CA 3FDJA 4CTNA 2JEYA 3VKWA 4D4KA 2NO1A 4ER6A 4H7EA 2R8XA 3C16C 1CD5A 3JQFA 4YO7A 5TVKA 5J4VA 2G9RA 1XCLA 4JH0A 5AIBA 2YJZA 4WSOA 4FYWA 1CETA 1GPH1 2EWMA 3NPMA 2Z30A 4B9EA 2XIJA 4PZYA 1JALA 2PCJA 1R16A 2IWRA 4EHHA 2VHVA 4C7VA 1BX3A 2X2PA 2OCKA 5U4XA 4QECA 3A3YA 3NIGB 4D43A 4KX5A 3PL5A 2CVOA 4P5DA 4N12A 4GPD1 4PFJA 5EIAA 4DA4A 3NCTA 4WEOA 4X8HA 4YN3A 1IXKA 4X1OA 3W6OA 1NM5C 4KR9A 2RGWA 4I5GA 4D79A 4WA8A 5DF1A 1O2DA 4UHHA 2QN9A 2XE7A 1ZK0A 3NBUA 3D3QA 4CF3A 2C8JA 2AZDA 4EEKA 3RFUA 5F3RA 4O2AB 4X5OA 2HADA 2P2NA 4B8WA 3PUIA 5TLSA 1H4TA 1TAHA 3L0OA 3P9RA 3HO6A 3SKVA 2OR3A 3SFVA 2AI3A 4FFNA 1M2JA 1ZK3A 2VDOB 4U3JB 2OBXA 2IU0A 3JPYA 3O1HB 4TKVB 2WAYA 4H60A 4QUJA 1FYXA 1RQXA 1IOLA 3AHFA 3OFKA 3LVFO 4M21A 4FCWA 4QOFA 1RXUA 4WW0A 4MS4B 5COAA 4IUCS 5E3IA 3KZOA 1TM4E 3FUUA 1M34E 1OWOA 1WS6A 3OZWA 3DE0X 5CNKA 4EEXA 2EQ5A 3C3PA 3NALA 3UT6A 3OQMA 3QV1A 2ORYA 2XBUA 3E3OA 1NMXA 1MOPA 4ZEOA 5JMTA 3MG9A 4BMPB 3C7CB 1EK2A 3HVHA 5L53A 1CZUA 3H8VA 3UGJA 1L4EA 5G0VA 2P9HA 1PWYE 1WXIA 3VI4B 1HEIA 3AP1A 2FPUA 3CRRA 2PK3A 3EIWA 2BKLA 3JQCA 3ML1A 3OI7A 1U2GC 2ZWMA 4DPKA 3GGGA 1VIAA 2BSQA 3WWZA 2B1QA 5LSAA 4S35A 1B6SA 2G77B 4Z9AA 1DC5A 2HJHA 1KDOA 3LY5A 1IOZA 5DOZA 1JU9A 2KJQA 2C57A 4F1KA 2W6OA 4OKSA 4M54A 3NXKA 1H9CA 4ENSA 3U3ZA 4MX8A 4PPGA 1J0XO 1GITA 4IHKA 4RLSA 4J1NA 3M0EA 2G1PA 2C58A 4MR7B 3O4RA 3F7TA 2WSBA 2P9EA 5K0BA 2QJRA 3F5FA 3LC2O 3IOBA 4BGDA 1HFKA 1PR5A 3I04A 3INRA 1N2EA 3LDUA 4MWGA 1VBMA 3CXUA 1CHDA 1FTWA 4K26A 3MS7A 3L4BC 3AFMA 3RSQA 1GEGA 1WCIB 2QD2A 5IYZA 2DWOA 5DZSA 3TFQA 2W6IA 1A9ZA 3PNPA 1NQTA 2VK8A 4DC0A 1M83A 3FZYA 1GKYA 2ON6A 2W2XA 4WRRA 1VXRA 2IZ1A 2WMNB 1ORDA 2B69A 1BHO1 3FW1A 4YMTA 2ODEA 1PJTA 1EUQA 2NADA 1EG2A 3LUAA 4D9KA 4MWEA 4B2LA 1F38A 1IU9A 4BJ5A 1M75A 2ZPTX 5JISA 1Z0UA 3RS9A 4AZ3B 5JNSA 5MN4A 5JCXA 4Y18A 2FRVA 2ZJFA 3UFBA 3D6UA 1KBQA 4L28A 1BWQA 4Q03A 2B83A 3D3WA 1DIHA 2X2FA 2EGUA 3KCQA 1XYGA 1FDTA 4ND3A 1W96A 4EY6A 4HQRA 3O3MB 3H87A 2RGGA 2PRJA 2O8EA 2DFTA 1P7YA 4G09A 5DBEX 2IWHA 3ZHQA 2CLEB 2VNIA 3AP2A 3ACDA 4YHBA 1EYZA 2DXIA 2AJLI 2VJMA 2UZ0A 4BNDA 3PUVA 1GAQA 3FB1A 3EEBA 3IHLA 5AHWA 5KYWB 3UWSA 1X92A 3Q98A 4EA6A 1UIMA 3DVSX 1K8XB 3HL4A 3LOQA 4M6WB 1Z6QA 4MCHA 4I81A 1UCFA 2SCUB 2QTCA 4ZYLA 5A5FA 1N2ZA 3K9WA 4NCJA 4X7PA 2IH4A 4BVEA 4M9CA 1R9NA 5FP0A 4E21A 3E5NA 4KXQA 2J3JA 3BWDD 5A1JA 1EBUA 4YQFA 4LY9A 3SK0A 1VTKA 3F4KA 1T9HA 1E2QA 4JUIA 4LTNA 3VJKA 3C74A 4E03A 2QDKA 3ID6C 3NJ4A 4LDQA 2O8BB 1R00A 2QYTA 3NJ8A 4K6GA 5LWHA 4HRXA 5JBNA 5K0FA 4QPZA 2IF2A 3PCTA 1Y8QA 3B8EA 4LZLA 4ZP1A 1KHTA 1NY5A 1DFIA 1JR2A 2G80A 3VBEA 1D2EA 4KX3A 4M9RA 4P54A 2YS6A 3WSVA 4JLPA 4QO8A 3P9KA 4AMYA 2ZB3A 3BGVA 3E3MA 3F0TA 4EKEA 1W1IA 3QVMA 4L7VA 5G40A 3L6DA 4QYIA 1D3AA 4YRMA 5JYBA 2PA3A 2AQ8A 1ZH0A 4DV1B 3ZJYA 4XH9B 1GPDG 1A5ZA 3VHLB 1ZK2A 2WYUA 3GLFB 1O94D 3FVQA 1QWSA 2IS4A 4OOFA 4KRFA 2RHLA 1G3QA 3KFLA 4GUAA 1SHZA 2I3BA 3PXCX 3T12A 1C41A 1I0IA 4WN9B 3JPWA 1KO8A 2YYSA 5CFQA 1X8LA 4B4UA 2G6TA 2ZRGA 4TMWA 5ERXA 1JLSA 1OT5A 1TMOA 3K94A 3KE8A 4R1TA 3LRPA 4LHYA 1SVNA 4QYMA 4EJ2A 1Z63A 1XZPA 4GMGA 4TWBA 5ITSA 4G5YA 3BWEA 1XZBA 1Z9BA 1KXZA 3E7DA 3PLNA 4L72A 3B38A 2I2AA 4BQQA 4ZCLA 4AY3A 1K86A 4BQNA 3PQFA 1F2UA 1JLMA 5LKAA 1FXSA 3FCXA 3UWMA 3H4VA 4PHCA 4FWBA 3TBKA 3GF4A 3LYHA 3ZHZA 1FVXA 3HXPA 3E35A 2DY1A 4KGXA 4RWZA 1X70A 2Y4OA 1A7UA 1ZNQO 2PZGA 4KOAA 3KEGA 1D6MA 1DMRA 3FHLA 5BQ5A 3VHQA 4D92A 1YRYE 4DF3A 4QVGA 1KYVA 2EDCA 1E32A 5E7MA 2WVHA 4RVOA 4RK5A 4DSNA 1EVJA 3H0CA 1EUCA 1UKYA 4F4HA 2QTVB 3HCNA 4CLRA 5EAIA 5A0TA 4OFWA 4XYMA 5DIFA 1OBOA 1GLGA 1XL0A 3DL7A 2D74A 4EABA 1T4CB 1ZD2P 3DNMA 4HWTA 2FFHA 5DSZA 4K88A 2MHCA 1L4KA 2KMLA 1GKIA 1J6UA 3U1BA 2QTWB 3VHRA 5KO2A 5CDTA 2H5LA 3E5HA 5BYJA 3NC0C 1CQXA 3KJGA 1ODLA 4G89A 3UJNA 2CN1A 1ZGCA 1O97C 2BSXA 2ADFA 5K8TA 2JFYA 3HN6A 4WKGA 3GP3A 4AUMA 5NLLA 1ZJZA 2PZLA 2ZCUA 2FEXA 1TU0A 2XTJA 4PLZA 5BUQA 3M6LA 4WESB 1A9XB 1RRMA 3T4XA 3WISA 1ZN2A 4YXWA 3QE9Y 4BNYA 1K0FA 4GRIA 2ZYIA 3W2TA 4LC1A 1OR8A 3O2SB 4OK3A 4D3SA 1J23A 3DS8A 1DX9A 1PQPA 3Q7IA 2QN6A 4G4SO 5DLQC 5F64A 1T1SA 1YOBA 4GLOA 1B15A 1BVRA 1D2GA 4N03A 5JW6A 1THTA 3WGOA 4JLDA 3ELUA 1ZLXA 3LUDA 1CS0B 2E4AA 4FP9A 2CLSA 5A06A 3PX2A 1Y33E 1JVNA 3I2KA 4L22A 5FWXB 3N86A 5K4GA 5FUXA 2DPGA 3GCZA 3DE4X 4OJQA 4PRYA 2P9YA 5JRJA 2XEDA 5JFOA 1NRWA 4IM7A 1T29A 4MUMA 4ER5A 3WA6A 1FRZA 2V97A 2BUCA 1VYUA 1FFGA 4LNAA 1H66A 2JGMA 2Y9PB 1OU4A 2Z1DA 4UVIA 2VHJA 2RONA 2FPRA 2GD6A 1OXUA 2DQSA 2I9PA 3H86A 2C4NA 1KEZA 1MTOA 2D5CA 2P9GA 5JNVA 4GD3Q 1M73E 5TT0A 1ORIA 1X14A 2P2CA 3WOHA 3PF8A 4HNAB 3OBBA 3BZBA 2HWXA 3B51X 4XQGA 4HUTA 1Y9DA 4XIFA 4OATA 2FOXA 2H8GA 2ZR0A 3QEJA 1TFUA 2D2FA 5DTQA 1V71A 3TN7A 3UJ8A 4L9SA 4ARVA 4F06A 5TE9A 3SIRA 2D3WA 3A6JA 2H1LA 1JFSA 2W2QA 5J2TA 1T91A 2R7KA 3OUUA 1AKYA 4G65A 1NVKA 4W99A 4XIYA 2XD9A 1LVUA 1GZUA 4DIEA 3AF5A 4EMUA 1MGPA 3USZA 1GFIA 2Q0QA 1JN0A 4EHKA 1MAHA 3AETB 4BL5A 1DXQA 2I1LA 3ZIDA 3D3KA 1Q1AA 3FH0A 4DCOA 4F86A 2EHDA 4KPUA 2UXBB 1RLUA 3S44A 4DIKA 2EBFX 4PRLA 1PFYA 2O06A 2XCRB 1SUFA 1MZPA 1GUBA 3O7WA 3EG9A 2VUHB 4P4TA 2PYIA 1EE9A 3P2IA 4JJAA 4BV2A 2LE0A 5HIAA 3LPDA 4CODB 2A1UB 2VK1A 3HV0A 5A3RA 4ZTZB 1NLUA 1LZLA 3GRKA 4WOKA 2XMBA 2Q49A 4IFEA 3SEAA 1C0IA 2C61A 1ZNWA 4OGGA 4OFBA 5E4TA 3GRYA 4BMDA 4G4GA 4HDKB 1XCJA 3W5HA 3ZGLA 4AX8A 1R6UA 4IIUA 3WY9A 4IAOA 5HEKA 1FE8A 1SKBA 1JXOA 1VHQA 2B78A 5L4SA 3UT5B 2PGLA 4F38A 1ILWA 1AKQA 1UKCA 3DB2A 4U0KA 4B2PA 5I7OA 3Q87B 1WETA 4BZXA 2WOOA 3JQEA 3LV8A 4X7RA 4XFDA 1PHRA 1ADJA 2I99A 3ZD9A 4M46A 4QOIA 3GZTB 3DXYA 1KEWA 3FFAA 4ZQGA 4LSWA 2R6HA 2YHAA 3M70A 1CJMA 5HFAA 1S8NA 4V39A 2G0TA 4WKBA 1NV9A 5L40A 3F6PA 2O8CB 2YZKA 4HG2A 1JI0A 1U2QA 2QDXA 3EOBI 3QXSA 3GIDA 5CBPA 2RJNA 3IQEA 4BLQA 2B9EA 1O5TA 2ZWOA 3LFHA 2XY4A 1N2OA 4N1AA 2ZRLA 4GI2A 4KSCA 3VOTA 3VZDA 1J0CA 3C1AA 1YZKA 3R23A 2BE7A 5JH7B 2PZBA 1EVEA 3RTCA 3KQMA 4DZZA 1IB6A 4LF4B 2R1UA 1WVIA 1NXQA 1KYWA 2G5CA 2OCXA 4TV8A 2YV5A 4WK6A 1TCBA 4EVQA 1A95A 1WF3A 3G2MA 4WBNB 3EGCA 1DKNA 3H1BA 2VK2A 1EUDB 3ZBPA 1OVGA 1TYZA 4DRXA 3HUUA 3BXGA 4QELA 3PQ5A 3LQKA 4RL6A 1XIVA 1A5AB 2GJ4A 2X5KO 2QUJA 1GAEO 2GRUA 1SUSA 4K1LA 4CG0A 3S28A 2OBYA 1KDZA 4DKXA 2DQKA 4K6HA 3L43A 4OXNA 4TRJA 4CMGA 3CJRA 5JSZB 4HTFA 2XE6A 4MWSA 4NH4A 3I01M 5CLGA 2DB3A 2VBIA 4FHFA 4HS9A 4NDAA 3NBKA 1I7QB 3AMVA 3M6VA 1CZRA 1F48A 2V45A 3FWNA 4MITA 1U2DC 2J07A 5EERA 3TTYA 4B33A 4DIUA 2OV6A 5DTEA 4NBKA 3TUIC 3G2OA 2GA9A 4DNPA 2BT4A 1R27A 5AVTA 1WXFA 5TJHA 1WXWA 4GOLD 4RPKA 3DBLA 5GOZA 3T7DA 4PSCA 1XKTA 2NUPB 1CIJA 3ZE0B 1P74A 3R5HA 3HJNA 2H65A 4MA0A 4DG8A 4L5CA 4K9DA 2C59A 1Q0RA 1KEPA 2AN9A 2FW8A 4BNJA 3FE2A 3GI1A 2C04A 4U6SA 1ECPA 3I64A 3OZXA 4WJZA 1YA6A 1SOWA 2GFIA 3QVJA 4EMTA 5C1DA 5I7HA 1UFRA 3VGJA 2QSUA 5JZ9A 1MTZA 1VPLA 1E2FA 2AS0A 2GETA 3AEKB 3D64A 3L6EA 4NU0A 3RUEA 5MF6A 2JIPA 1GNVA 5A71A 1ZJ5A 4M1YA 4LSMA 3R6WA 2GWHA 3MAAC 4MA4A 3ZDQA 3DCNA 3P52A 2ZRCA 5CHYA 3V32A 2AQKA 3V8NA 1QHNA 1ZN7A 2FPOA 1RT9A 1P31A 3DF9A 3UNXA 4BLWA 2B82A 5AVSA 3G02A 4P3YA 2H51A 2F2TA 4YAOA 1YT5A 1XA0A 4MICA 3NRCA 2W6QA 2QIPA 3IUMA 3PHHA 1JXQA 4OP2A 4EW1A 4UPDA 4LHVA 3UMVA 3ROFA 3OEHA 3GEIA 3AFGA 3QU4A 4B71A 3EXHA 2Z1NA 4R3NA 1DBWA 2O3UA 5EEGA 2FPGA 4ZCSA 3TVYA 4YT2A 1OAOA 4NCKA 2FVYA 2HKIA 5KQPA 1JWBB 4NYIQ 1RZRD 1T8WA 3DBOB 3FPJA 3D6FA 3L49A 1QV6A 2ZRQA 4F5WA 2O7QA 3I8XA 4W6ZA 4DDKA 3Q8MA 2RGUA 1E9DA 1PO7A 1FRVA 1TM7E 4M22A 4GPEA 3UO8B 1IN4A 1IHOA 4KIJA 1D8TA 4QM6A 4NMHA 4IFIA 3R5SA 4MTLA 1UMBB 1ZCZA 4QD3A 2VPTA 5KPJA 3OIYA 3U4IA 1EAYA 1X1DA 1YTLA 2I7CA 2WYIA 2NOAA 5F5XA 3ZBQA 2C9MA 1X7XA 2ZDQA 5FWDA 3L4SO 1U9YA 4CW7A 1DJNA 3NXSA 3LOUA 1JKMA 4LYDA 3NO4A 2A59A 5IXJA 4ZVKA 3SNKA 3ZS8A 3DV9A 2Q3LA 2VRCD 1N5KA 4ZAXA 3P26A 1E5DA 1N2CA 1PBTA 3GH3A 2V7WA 4UBNA 3RK1A 1B1AA 5LXTB 5KJFA 1D1QA 5FUWA 1NR1A 2AWOA 2BTQB 1HURA 1HT2E 3UTDA 2A1TR 2IBSA 1DZ3A 4MTCA 2DM6A 5EQJB 4XIIA 3DKKA 4F9TA 5EKDA 4M4SA 2A7QA 4JYAB 3RVKA 1TC1A 5MFPA 4P0PB 3QLVA 2B2NA 3GDWA 3KEQA 4KLAA 2YW2A 5AJTA 4G26A 5JCOC 3X1XA 4IINA 1R8SA 2PZFA 2VHQA 5CEJA 1D4ZA 8LDHA 3K30A 4YMSA 3JAWA 4GP7A 3KU4A 4J0GA 5COBA 1E0JA 5BNIA 2EJWA 1EFVA 2I67A 1PJ2A 4IXTA 2QK4A 4OUKX 2HFJA 1DWUA 3O3CA 3H3XA 5KBYA 2O8DB 2H4WA 4LXGA 1VLMA 3HDHA 2P7IA 3T7RA 1TCAA 1ODKA 1W36B 2HO5A 1KS2A 3L0DA 1TA0A 9ATCA 2X8JB 3AKDA 4LC0A 4XWWA 1WKVA 1X77A 4KE8A 3GP5A 3T9EA 3PL1A 4MO9A 4Q1FA 5ECDA 3U4MA 1VCOA 2NACA 2PWAA 3C1UA 4NU5A 4PTZA 1BE6A 1W35A 3WK5A 3ZBTA 3HY6A 1MW9X 4IZIA 3NLLA 4IJ5A 2NVBA 4GECA 4Z49A 3FN4A 5IH3A 3W9SA 4H3VA 3IQZA 1MO6A 2FYTA 3OJEA 1EDEA 4KVZA 3AG5A 2QPTA 1KAGA 1PG2A 2P1RA 3FY4A 3N8KA 2ID4A 2ECQA 3G8AA 3PI6A 4IZOA 5AJXA 2VPZA 4IOKA 5IAGA 3QPDA 4P81A 1OSNA 3RTEA 4EUKA 1CUIA 4ZI7B 1FFAA 2BEWA 3V55A 4JVMA 1KL7A 1NJ6A 2XA1A 4NENB 3LCCA 1C8VB 1M0SA 3GLHA 1XKQA 1C4OA 5TRTA 3IULA 1JHPA 3IVCA 4GS5A 4OL0A 1LFAA 2R1ZA 2ZWPA 3WLAA 2IX3A 2VTVA 2I62A 4KC0A 4ZV9A 2EJVA 1O9BA 4XE5A 3DYVA 3ZPXA 3FNHA 4UCXA 4Q4CA 4RXUA 5M5BA 2P3SA 4IUDS 1OB2A 4WLNA 1HNZB 3L4EA 1F0PA 4Z0PA 3JTEA 4H7JA 3BVPA 5BNTA 2FRDA 2A86A 1BCSA 5CFRA 5ES4B 1RHQA 1P6QA 1WDWB 5IJXA 3C1TA 4HWKA 4IDEA 1C1HA 4BNWA 4IPTA 2RHHA 2AB0A 3FA2A 1E4EA 4CMEA 3KALA 1J09A 1K6XA 1U1FA 1XEWX 1OXMA 3QFCA 3V6LA 5JS6A 1DKOA 3T1YB 2HL6A 2WTAA 1LLDA 3DL4A 4ZJUA 3PNQA 4NH0A 3ZHBA 1E6KA 4MS3B 4PSKA 1QCZA 1SHJA 2FSVA 3KUDA 4MP6A 3LQQA 1YCHA 2YWGA 4AN1A 1DKQA 5BW5A 3OZFA 1F3OA 3O93A 4H0NA 1LX7A 3ZY2A 5KNDD 2O8CA 1QGYA 3U1VA 3EDCA 4DBLE 3EGIA 5DHUA 3RUDA 3BH7A 4I9HA 3ADPA 3I9V1 2ZBEA 3G23A 1SHUX 1Z33A 4KTTE 5JNTA 4GWKA 1ODTC 1ZGHA 3N28A 3UOGA 4YUXA 5C4IA 1JLKA 5I9IA 1N0HA 2D3TA 1T10A 2G8LA 3LLUA 1NOJA 5ALQA 4V1CA 4OQFA 2PGNA 3NASA 1C81A 3D2CA 3H7AA 4KO2S 3VC7A 4C0XA 4C6SA 4Z3KA 4JK3A 1RLJA 1VJ1A 2ATVA 2HFKA 2WJGA 3O4IA 2QMUA 2PX5A 1XQ1A 4ITRC 4EY4A 1NL3A 3TIXB 1CFZA 1PQUA 1OZ0A 5KOIA 3QPVA 3VHXB 4FFMA 4DR5B 2VTEA 3N0WA 2XUIA 3KQOA 1MR3F 3OLQA 4HGNA 2QRPA 2V3VA 3G1TA 3IC5A 4I1UA 3WJAA 2QQGA 4D4HA 1B8NA 1I3OA 3HGQA 1FYDA 4A6DA 5B6IA 3LH5A 5JZBA 2J46A 1A04A 3H2KA 1SU8A 2PS1A 2WJ3A 1Y4DE 2ONZA 3PC3A 1U6KA 1TUBA 4D8XA 1TX4B 1NX9A 1ADCA 1PUXA 4O3MA 1XPUA 4HH3C 3LUJA 1XPOA 1A9RA 4B46A 3TD6A 3P7MA 1U9IA 4QJ4A 2PT6A 1KEEB 2VS1A 3IGFA 4KFSA 1YQTA 3AW8A 4FNAA 2N9UA 3DE5X 4PLYA 1WMFA 5A3SA 3RK0A 3X1JA 3OESA 4Q6WA 1LPAB 2GEBA 3JALB 3P9XA 1Z0JA 2A5FA 1LRJA 3ANTA 3NEAA 4X45A 4RM2A 1QRSA 3F46A 3BD8A 1XT6A 2QZJA 4UHKA 3TNFA 1MV8A 4NG4A 2GFQA 3ZWWA 1JFVA 1FYVA 4G5GA 1GILA 1DTSA 5SZKB 1Z07A 3AI7A 5FPSA 3DXFA 4L3OA 3ZE6A 3KV1A 2WHQA 1UDXA 4IP0A 2H18A 1U0OC 2OE2A 2VXCA 2C8LA 3QQPA 1OASA 5DNDA 3KPJA 3ZVKA 3H1EA 2J6BA 4XVCA 1X9GA 1QUEA 3H75A 1JH8A 3QYAA 4GH5A 4L5IA 5TQ2A 3COJA 3DOJA 1EX6A 1KMCA 1K89A 2AX4A 1SRRA 4AS3A 1L7XA 3U2QA 2OBBA 1GFWA 3AIOA 2XECA 3HY4A 4E13A 1XC7A 4X24A 3K0CC 1AMOA 3CNQS 4LZOA 1U6JA 3KELA 4OXXA 2O50A 4DY4A 3VM6A 5CU7A 2YN2A 3SGLA 1QVWA 3RTAA 2XCUA 4ZU6X 5J4LA 2R66A 4FHZA 1K5HA 1Y48E 3K0FA 4JROA 4IIFA 1WJGA 3PQCA 4QASA 3NZEA 4UAGA 1PV2A 2Z8YM 3BA1A 1ZZEA 3O1JC 4IHJF 1ZVKA 1Q0PA 2I54A 2CY0A 1ZS9A 4MZDA 3TQIA 3UXHA 4F3RA 5FPKA 2M2IA 4X1IA 3IPYA 2FP4B 3K1AB 3QPUA 2ONJA 4C20A 4ZTUB 3JQFC 1AA9A 2GK3A 1AM4D 1KVUA 1VHDA 2NNLD 3GLSA 4HSEA 3GFRA 4IO1A 1CYEA 2X2OA 3AJRA 2ZIUB 2A2ZA 2WIDA 2XMCA 3FNFA 5JXHA 3UA3A 3KC2A 5EKXA 5GONB 3NOXA 3NT2A 1XLWA 5AKEA 2QZ9A 1UC4B 5JSQA 1NT2A 3WLEA 1BE0A 4MVCA 1FY2A 4AXBA 2OC4A 4PHFA 4W5WA 1OI2A 2YWXA 3GUUA 1Y3HA 2CZGA 3CUTA 2GN9A 4GMXA 4Y9DA 2XB6A 4FMBB 1EESA 2FPIA 3MW8A 1YB6A 1PS9A 2OG1A 2XE4A 1QH0A 3W9YA 1CIPA 3OU7A 3DF7A 4JLKA 2A0KA 3H2SA 4PS1A 4IF4A 5DRTA 2XUPA 3PVSA 1U4OA 1NUTA 3O84A 3THOA 4ESVA 3OTQA 2GXSA 3LHSA 4PO9A 3AL2A 4JYCA 1BS2A 1YR8A 1NAHA 2OWEA 2XCOA 3ZWOA 1SBTA 4WLUA 2PQ6A 3ELBA 2Y68A 4K9KA 2W8BA 4TQAA 1J2TA 1YACA 2CJFA 2CL5A 4I50B 1T36B 2PUHA 3RJZA 1P9LA 5AM2A 1VKRA 3MN1A 4CIAA 4YONB 2MIIA 1E5XA 1WW2A 1Z73A 3DVAB 3I30X 2K5UA 1VGQA 3UUFA 4YB8A 1FFCA 5CVVA 3MEQA 5HJEA 4FK8A 4ZI2A 1L7OA 3RFTA 1WQ1R 3FUWA 2P9CA 3U7JA 2ZR9A 2L2QA 4QUDA 1AKUA 1K6JA 3GN2A 5LYJF 4X6LA 4LRYA 2FGKA 1MD9A 1ZINA 2WD9A 4OMFG 5TEVA 2Q9UA 3K5HA 4U5XA 2ZSUA 1F5NA 3U7QB 1LJUA 1Q0HA 1RXIA 3IILA 4X63A 2V7VA 2GASA 2RH4A 3PXAA 1FUUA 2JFOA 4H1WA 1WBDA 2V5UA 3RUFA 1GTRA 2PUAA 2F8TA 1XEXB 2ABWA 2C84A 4RVGA 1SUEA 1NI4A 4LJSA 1CZKA 2NU6B 2O2HA 5ALSA 4HZGA 1IHPA 4C30A 1WMBA 4EJSB 1KARA 1OHHA 3Q3IA 3SX2A 1BX1A 4A0QA 4HNRA 1XZHA 4PAGA 2WPDA 5AESA 2D1QA 2I5PO 2QN2A 5DM4A 4XW2A 3BOSA 1ONNA 2ZGVA 4P32A 4K86A 1UINA 5BT8A 5HM8A 1G16A 4KZKA 4W7SA 3S55A 1E79D 4RS4A