3WWYA

The crystal structure of d-lactate dehydrogenase from fusobacterium nucleatum subsp. nucleatum
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
333
structure length
333
Chain Sequence
QKTKIIFFDIKDYDKEFFKKYGADYNFEMTFLKVRLTEETANLTKGYDVVCGFANDNINKETIDIMAENGIKLLAMRCAGFNNVSLKDVNERFKVVRVPAYSPHAIAEYTVGLILAVNRKINKAYVRTREGNFSINGLMGIDLYEKTAGIIGTGKIGQILIKILRGFDMKVIAYDLFPNQKVADELGFEYVSLDELYANSDIISLNCPLTKDTKYMINRRSMLKMKDGVILVNTGRGMLIDSADLVEALKDKKIGAVALDVYEEEENYFFEDKSTQVIEDDILGRLLSFYNVLITSHQAYFTKEAVGAITVTTLNNIKDFVEGRPLVNEVPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-lactate dehydrogenase
publication title Allosteric D-lactate dehydrogenases from three Gram-negative bacteria
rcsb
source organism Fusobacterium nucleatum subsp. nucleatum atcc 25586
molecule tags Oxidoreductase
total genus 114
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.1.1.28: D-lactate dehydrogenase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wwyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wwyA01
1XU7A 1F8FA 3ZV3A 3WTBA 4IQ0A 1ENZA 2QRLA 2Q99A 3RUFA 1HT0A 5FFFA 3QJ5A 3ITKA 3MZ0A 2PD6A 3PHIA 3DMTC 4ZGWA 3H3JA 2X4GA 4ZRNA 4JK3A 3N74A 3CINA 3QP9A 2A35A 2VT2A 4EEXA 3PTZA 3M2TA 3EVNA 5CG2A 1Q2XA 3V8BA 2FPPA 3SJUA 1F17A 2IDZA 4WCFA 1WDKA 5IJZA 1V35A 3WGIA 1T1SA 1P1FA 3PLRA 3RFVA 2ZTVA 3JV7A 3U4DA 3DDNA 2PV7A 3CE6A 3I3OA 1KEPA 1ISMA 4YR9A 3AWDA 3I6IA 4DQUA 3UAGA 5FI5A 2BRUA 2H5LA 4L73A 1V3VA 3QA9A 4Q3BA 4UUOA 5DBIA 4U5QA 1ZVMA 2O48X 1YB5A 5LDGA 4IDCA 1X0XA 3R6DA 2B5WA 3TZ6A 3QV1A 5IAAA 1IUKA 4ZQGA 2B4RO 1XLTA 4IXWA 4C7JA 4CV2A 4JCOA 4N18A 3PQFA 1R15A 1LRJA 1QRRA 2W2KB 5BT9A 4AL4A 1FXSA 1T1RA 5IDYA 3I9OA 1Q7GA 3I9MA 4ONEA 1WDLA 4CM6A 4FSHA 2CD9A 1UXIA 4WASA 2E48A 1NASA 2JFGA 2VHZA 2PGDA 3UN1A 5CDYA 5K6AC 2OBNA 1WLYA 3U4CA 3C8MA 4RVUA 4D41A 2IEDA 1UDBA 4HX5A 3RUDA 4YDRA 1CQIA 1CYDA 2PZKA 4WCDA 3PHJA 3WTCA 2Q2WA 1ADBA 1KVQA 5CPFA 1E3IA 2DFVA 4MVJP 1P3DA 4NR0A 3IJPA 1G0OA 3ZWVA 2EW8A 4RVGA 1JA9A 1JVSA 5KJ6A 2AMFA 3FPLA 3NT5A 2VHWA 3PQEA 3JD0A 4J7UA 1X1EA 2O2YA 3D0OA 4W4TA 1MP0A 2EERA 1SEPA 2CDAA 2E6UX 4N5LA 3T7CA 2HDHA 4MKZA 3JYQA 2VRCA 1LSSA 2JCXA 3O4RA 1PQPA 2EW2A 5THQA 1E3WA 4AICA 2ZQZA 3SVTA 2NSDA 1MXFA 5I9MA 2Q1SA 2P9CA 4J1NA 4DVJA 3L6DA 4R3WA 2Q2VA 3NDIA 4DIOA 3OHSX 1CDOA 2EWMA 3BMQB 1W73A 1EUDA 1XQ1A 2JCYA 3GN2A 1N92A 2BGMA 4W99A 5K6AA 3AW9A 4IMRA 1I2BA 1A7KA 4Z0HO 1EVYA 1DLJA 2PNFA 4P4GA 4ALMA 3G49A 3DBRA 3MJEA 4EITA 3U9LA 4WK6A 3E82A 1R4MB 2RH8A 1C1DA 1FDTA 4WLOA 1UR5A 4RGBA 5TQVA 1YE3A 2Y1OA 4B8WA 4F6LA 4NBWA 3VH3A 4HP8A 4IM7A 2ZTMA 4XQ9A 4BQRA 4J91A 4NFYA 3DQPA 4CQMD 4AJIA 4IZHA 1CRWG 2D1YA 1E6EA 1W6UA 3VPSA 4PLTA 4Z0PA 2OP0A 3RAJA 2CUKA 2J3IA 4BO0A 2GSDA 1DIGA 4GSKA 5COAA 1P1HA 4GX2A 3ZH2A 4W7IA 3AM3A 5K0ZA 5MDHA 4FQ8A 1PJ4A 2P91A 3TQHA 2VOEA 4Q9NA 2H1SA 3UCFA 4Y6PA 4TKLA 2V6BA 5EERA 2GR9A 5FI3A 1UXGA 2VTEA 5A9RA 4X54A 1ADFA 5BR7A 2EKLA 3ZDFA 9LDTA 3B70A 1GTMA 1Z7BA 3RC7A 4NDNE 3I9NA 2E37A 3N58A 1K3TA 1M2WA 1W8DA 1N5DA 1CIVA 1WWKA 4J9VA 1PQWA 4GI2A 4CV1A 3A28A 3PJFA 4DBZA 4R68A 5KJEA 1B3RA 4XQGA 4GX1A 4HV4A 1PL6A 4BGVA 3RBVA 4AJ1A 5JPIA 1CERA 4Z6KA 1N1EA 1B3BA 1HRDA 3LF1A 1EVJA 3TNLA 2HK8A 3L4BC 2F00A 4JJIA 4RZHA 3RFXA 5JO0A 2VYVD 2VUSA 2JD2A 2RHRA 3F4LA 5F1KA 3IIEA 5I8WA 1XU9A 3PWZA 4DWVA 4TZKA 5A5FA 3EC7A 3V2GA 4E5KA 2O3JA 1EBFA 4II3A 1MLDA 5ILGA 1KC1A 2EGHA 5T64A 2D0IA 1B15A 3UGKA 4WECA 5TF4A 1LUAA 1PZGA 2X9NA 1DJQA 4AJLA 1YJQA 2W2KA 3FWZA 3IKTA 4RF3A 1ULSA 2Q4BA 3JTMA 4II2A 4J90A 3VPHA 3LC1O 4FIZA 2W8ZA 1YS4A 3BZUA 3BHIA 4NMHA 4KZPA 4BNMA 3KEQA 1C1XB 1HKUA 1EK6A 2P9EA 1LSOA 4TRMA 5KTKA 5BQFA 4KMSA 5C5IA 4H15A 2NADA 3FNGA 5L51A 3GNTA 3GRPA 2G76A 4GH5A 4GPD1 1NHGA 3O38A 3GHYA 1HSOA 1LDEA 2B83A 2O3TA 1N8KA 3UKOA 3FD8A 4D0SA 4DC0A 2PGJA 3DONA 4M55A 3KO8A 3I5MA 5I7EA 4JBIA 4CL3A 1EQUA 3GUCA 3WMXA 4NNJA 2GN4A 1D4FA 2GZ2A 2FZWA 1DOHA 1DO8A 3KZVA 3G1UA 3KYCB 3SX2A 1F0YA 3KRTA 1HETA 1PJ3A 1U4OA 3B1FA 4E6PA 4TZTA 4FDAA 2UYYA 2ZB4A 3INGA 4JJFA 3BMQA 1C0IA 2WD8A 3NYWA 3DBLB 4OSOA 5HBRA 5TRTA 3ZV4A 1EFLA 2PZJA 4NHEA 3ETDA 3RROA 1IB6A 3INTA 3ADOA 3ZW9A 4Y98A 3VPXA 3TWOA 1MGOA 1QYDA 1R4MA 3JQ6A 3V5NA 3ENNA 1IY8A 2X23A 1H9BA 2HJSA 4GX0A 3UF0A 3KLMX 5KCZA 4R69A 1YGYA 2EXXA 3JQEA 2ZB7A 2FZEA 4R1TA 1UZMA 4JROA 3KUXA 1YWGO 5JAQA 4RJTA 5JNLA 4KQWA 5ICMA 2QX7A 4ZU3A 2CFCA 5L3ZA 4BGUA 4A26A 4R1NA 1G1AA 1HE2A 3C24A 1F06A 3FWNA 5T5QA 4NJOA 3F46A 2DT5A 3HSKA 2CF5A 5DCUA 1B26A 1U3VA 3QY9A 1XSEA 3Q1LA 3HG7A 3MWDB 3WICA 4XYLA 4I5DA 1D1SA 1UP7A 2H9IA 1P1KA 4FBGA 4BNWA 1PSDA 4ZN6A 3PJEA 5L4LA 3JQCA 3NV9A 4IMPA 2V65A 5G4LA 3WXBA 5L53A 5DBFA 3SEFA 1FK8A 1T26A 2VUTA 3KOUA 1U2DA 3ZZNA 4J1TA 4NFSA 3DEYX 4JP2A 2PK3A 2G5CA 3BMOB 4E3ZA 1JTVA 1LBEA 4R41A 1KBZA 3PIDA 5JDCC 4ALJA 2RCYA 3WQRA 3L9XA 4I9NA 3AFMA 3JSAA 4KQXA 2IE0A 1H94A 5DULA 3ZU4A 1F14A 5I7SA 3ZHBA 4PG6A 4PRKA 3NTRA 4FOOA 5JC1A 3I6QA 1YDEA 2VZ9A 1UP4A 2PWZA 4LISA 3TL3A 4MVJI 4PLYA 1T4DA 3OEYA 1HZZA 3UH1A 1XWFA 1QYCA 5TS3A 4D44A 9LDBA 3TZKA 2DM6A 2YV3A 5GMOA 5BSEA 1RM0A 2A92A 5BSGA 1KOLA 1O89A 1X0VA 3RASA 4AJKA 2PKQO 2VWHA 1QSGA 4U8GA 1DXYA 4A2CA 1DIAA 1YB1A 4Z9XA 4B3HA 2QQ5A 1GQYA 3U4IA 3DZFA 2Y1DA 3R3JA 4AJPA 4E32A 2I6TA 3AJRA 1VJ1A 3DZKA 1B8PA 3KSUA 3K5PA 1QR6A 1ULUA 5CDSA 3L4SO 2P5YA 3WSWA 1A4IA 5JSFA 4KWIA 2FSVA 3WGYA 4BNYA 1C1XA 4HKTA 2O3RA 4JXKA 4OSPA 2RAFA 5JS6A 4MP8A 4BS9A 5JDCA 3R0IA 1Y8RB 4KDFA 3SJ7A 2GRAA 2PZMA 2J3HA 3RU9A 3GNSA 4WEOA 2O50A 3OJEA 4JIGA 2W90A 5C7OO 4LK3A 2P4HX 4XGNA 1Y8QB 2UAGA 3GVPA 4JX8A 4CR6A 4L4RA 1NAIA 1ZMOA 4CM7A 1AGNA 2NTVA 3NT2A 1HDOA 3PZRA 4LCEA 2ET6A 3RKUA 1VI2A 4RPKA 2J5KA 1UAYA 4RPLA 1NVMB 2ZYAA 1ZK4A 5T57A 3KYCA 3L6OO 1MG5A 3GK3A 3TSCA 3U62A 3D4NA 2VQ3A 3D5QA 3H9QA 3NDJA 3IUPA 3GZNB 2HMTA 3W8EA 1K2WA 5A9TA 1YRLA 3LT4A 3JYOA 4WLUA 5IDWA 3PEFA 4I08A 3DBLA 4HNHA 2VZ8A 1OFGA 1LX6A 1C0PA 4IY1A 2Q1WA 4GWKA 5A3JA 1XCBA 1CETA 5IDQA 5ITWA 4G65A 4IJVA 2GN9A 3ETEA 4JBHA 4L76A 4BNHA 4QQRA 5TNXA 3UOGA 4CL8A 1U4SA 1EFKA 3FBTA 4YT8A 2YFHA 3RJ5A 4CV3A 3D4PA 3LLSA 3COSA 2JL1A 1Y9EA 1NWHA 3WSVA 5FWNA 5KJCA 2ZATA 3RKRA 2X0RA 3GPDG 3DXFA 2VNSA 4YXFA 5A06A 3ORFA 2E49A 5G0UA 1ZUD1 2ZIZA 4IJWA 5EJ2A 3VZRA 1CWUA 1UH5A 1Q0HA 4K26A 3ROQA 1P0CA 5IXSA 4PLCA 4ALKA 1KEUA 1GV1A 5A04A 2J8ZA 2BMAA 4NJMB 5JXWA 4RF2A 1CF2O 1PS0A 3FCOA 1VE9A 2XXJA 2VHXA 4LRTB 4BGEA 3NX4A 1YQXA 1NPYA 4K6CA 5EINA 1H5QA 5EQDA 1LC0A 4BV8A 1WDMA 1ISIA 3E9QA 1F8GA 4PLHA 3CZRA 4B4OA 3PP8A 3NDRA 3ON5A 4IJKA 3BMOA 5TT0A 1H9AA 4H3VA 4A03A 1MG0A 3IAHA 2SCUA 4NZ9A 2HSDA 4E2ZA 1MFZA 4KP7A 3GY0A 1GU7A 1HSZA 1LDGA 3G1TA 3C1TA 4BO7A 3VKVA 1NYTA 1XHLA 4LW8A 2V6FA 3GDOA 3PDUA 3Q2IA 4PLZA 1PL7A 3ASUA 3LSYA 4P38A 1CEQA 4PVCA 5IN4A 1Y5RA 4CMIB 3DHYA 1AHHA 4BO3A 1UUFA 3MJSA 1JDJA 4B3JA 3ZWMA 5AXCA 3U49A 3PFWO 1ZK2A 1TVEA 3C7CB 2Q45A 4M49A 2WYVA 4BKPA 3DBHB 2JFFA 4MOWA 3RVDA 4ROSA 1UXJA 1P77A 1DSSG 4FS3A 4OXKA 4DUPA 3TF5A 4QFDA 1ZNQO 3JQ7B 1TT5A 2YFQA 3IC5A 4ZQHA 5DCWA 4BL5A 1SB9A 3CKYA 4B4UA 1NAHA 3AUUA 3JQFC 4HXYA 4XWYA 1Y8RA 3K92A 2Y93A 4ESOA 2Y05A 3CIFA 3I52A 2DUWA 4R54A 5AQ1A 1I5RA 4OHUA 3AUAA 1E1MA 4F3YA 1Y8QA 1NFRA 1PGQA 1Z82A 4XDZA 2PFGA 1PJQA 1A72A 5H83A 4XA8A 4DQXA 1JN0A 3KHUA 3PHLA 1K6IA 1O95A 2EKQA 3TFOA 3RUEA 4XYGA 5ENDA 1N1GA 1ORRA 2B5VA 5L4NA 1XYGA 4B4WA 4WCFC 2HJRA 4YJDA 3K2EA 1SBYA 1DJNA 3GDFA 3A4VA 3Q6IA 3R3SA 5CPBA 4EUFA 3GZNA 4HFNA 4DTIA 1DB3A 3M1AA 5G0TA 1VL0A 2A9FA 2NVWA 3H7AA 4I8XA 4K9DA 2VT3A 3HFGA 1U28A 3KETA 1LRLA 4PZCA 3B6ZA 4GBJA 4LN1A 4CR7A 4EUHA 1I2ZA 2PA3A 2AG5A 2Y0CA 3FTPA 5CDUA 5KKCA 2DQ4A 3I4FA 1W0CA 3E6AA 1DIRA 3WB9A 1PEDA 3WDSA 3H4VA 1P33A 1DEHA 1GV0A 5ES3A 5JDIC 5KVVA 3JD4A 2BHLA 4YAKA 1V6AA 3X2EA 1U7HA 2FY8A 4O5OA 1U1IA 3ENKA 5BSHA 1J4AA 3Q3CA 1PIWA 3SXPA 2RHCA 1M76A 2HO5A 4Q39A 1UP6A 4A7PA 4HADA 3NRCA 4CUZA 4UVHA 5TT1A 3M1LA 4RPGA 3SBOA 1LTHR 5FEUA 4YPOA 2QYTA 4P22A 1SZJG 4NU6A 3DTTA 4E2XA 4LGVA 4J4HA 1QG6A 4RL6A 5U9CA 4PVDA 3MWEB 3NKLA 1Y1PA 5DT9A 4FC7A 4PLWA 3Q9NA 4GLOA 4I9HA 4XKJA 4EZBA 4BNVA 3AY7A 1Y81A 1HLDA 3DTYA 3ZWPA 4NJMA 2O3SA 2WYUA 5CEJA 2VHYA 4FR5A 1O9BA 1UDCA 2HU2A 1NWCA 5TX7A 1PZHA 1I01A 2HLPA 3OIFA 2IXBA 4N5NA 3DZGA 1VL8A 3GUYA 3O9ZA 2O3UA 4URFA 3VZPA 3P19A 5JDIA 1ZK0A 1E7YA 3HDJA 2GCGA 3RBXA 1JWAB 1ZCJA 4DBVO 2BELA 5F21A 3W8FA 3QRWA 3HB5X 4MVJG 4BHTA 3S2IA 4ZA2A 1JAYA 1B8VA 4CLOB 1N9GB 4XR9A 1QP8A 4B8ZA 2OBYA 3IL2A 3ZHXA 1RYDA 2O4CA 4YEDA 1JU9A 4GQAA 1IZ0A 5T6BA 4LRSB 1RJWA 1LDYA 3I23A 2AQIA 4KTVE 4H16A 4BO8A 2LDXA 2XXBA 1E7SA 3NJ4A 1U2GA 3OEWA 4K28A 1NBOA 1D3AA 1SNYA 4CMIA 1Z45A 4MIYA 2Y1EA 2EG9A 3RC2A 1QXSA 1XR3A 1M6WA 1X14A 3FF4A 3GG9A 7ADHA 2PD3A 4D43A 3DBHA 2RBEA 4J3FA 5CP8A 5B1YA 1BTOA 1KERA 4EBFA 3HADA 1NXQA 4EDFA 4RVDA 5U4QA 3JQ7A 4U0KA 1I10A 4A5OA 3TZQA 4BNUA 4EJMA 3H2SA 1P1JA 2UUOA 1H93A 1UJMA 3FNHA 3QWBA 2OHXA 1WMBA 4J0EA 1RPNA 4YAEA 7MDHA 4CM9D 5HS4A 2JD0A 3JCZA 2I99A 2E4AA 2C59A 4GGOA 4GWGA 4JP3A 1E1LA 2DAPA 2GLXA 3PJDA 1R0LA 4CQMB 1ADCA 3A14A 4EYEA 3ZW8A 2AEFA 1B2LA 1KETA 1KEWA 2X8LA 1E77A 3VPGA 2WTBA 3AUTA 3T7EA 1NM5A 3ROKA 4A10A 3TL2A 1GUYA 2QW8A 4WJZA 2Q1UA 5G0SA 2ILTA 1ZH8A 2C5AA 3QLJA 4PIVA 4OXNA 4YJHB 3ZWAA 3BMCB 3PLNA 2D5AA 5LC1A 3IKVA 2RIRA 3GGGA 5KVQA 1EVZA 3HE3A 1K6XA 2WE7A 4FPXA 1LXCA 1XQ6A 3TJRA 4IUYA 2DTEA 4XIYA 2X86A 4CM5A 4BNFA 5JCXA 3G79A 5LDHA 3F1KA 4TKMA 1I3NA 2HRZA 4O59O 4U6QA 1BXKA 1QMGA 2PH3A 1FDWA 1YBVA 3QVWA 2VWGA 4QO8A 3GEMA 3PVZA 3CSDA 2DPHA 4CMHA 1XELA 3WBFA 3MEQA 3FN4A 4Q3NA 4E12A 3D1LA 1YH3A 2ZB3A 5I9NA 3GA0A 2YY7A 3NUGA 1Z6ZA 1UDAA 5JMWA 3DZHA 3PWSA 3DAPA 3JYPA 3OM9A 1A71A 1GYRA 2XF8A 3ZHZA 1HTBA 2Q50A 1LQTA 1P9LA 2A94A 3EVTA 4WLFA 4FD3A 1AXEA 1Z75A 3IP1A 1G6KA 3V1TC 4AJNA 5ADHA 2AHRA 2B37A 3K31A 2B69A 1PGNA 4R1SA 1PU2A 4M87A 1TA4A 4RQTA 4OAQA 1AE1A 5JYEA 4BB6A 1KEVA 2ZYGA 4M54A 3MJTA 4MVJH 4CMAA 1KYQA 3BMNB 4RDIA 5K9ZA 5JLAA 4TMFA 2Y68A 2ZJ1A 4J1QA 3DOJA 3JQAB 4L8VA 4YYZA 2GZ1A 3PGJA 3NGXA 3VTZA 1Y5MA 3BIOA 1GEEA 4CLDA 4MP3A 3WWYA 5CDTA 4MO2A 4ZQFA 5AXAA 5JAZA 1YL7A 4PG5A 4BNJA 4D79A 2OP1A 1WZEA 5BNTA 1AXGA 1N2SA 4UUPA 4RVFA 3JQDA 4RORA 4WLNA 2QYSA 3BTUA 1L7EA 2BGKA 4NI5A 1U8FO 1EE2A 4NBUA 1BWSA 1IHXA 1N9GA 1ADGA 3H9JA 5F3RA 4CLOA 5T67A 2C20A 2GO1A 5DOZA 2O23A 1HL3A 2VYND 3IUSA 4H7PA 5C3MA 4IIVA 1U5CA 1YB4A 3HHPA 4PCVA 4TWRA 1DFGA 1PQUA 1AHIA 5GZ6A 2OOSA 1ZJZA 1SAYA 2QZZA 4WPGA 3OSUA 2BLLA 4Z3DA 3N7UA 3OA0A 2C29D 3H9GA 3O26A 1I3KA 1E5LA 3LDHA 3OJFA 3WGZA 1PGOA 3K6JA 3OFSA 5I8ZA 4BO6A 2VNAA 2GZ3A 2YHIB 2ZYDA 2HK9A 4TQGA 1XDWA 4IJUA 4CMEA 1I2CA 2QG4A 3VDQA 2JD1A 1Q0LA 1GEGA 1YO6A 3ANMA 4D42A 2YQ5A 1EVIA 1QYXA 3GNQA 2ZQYA 4NFHA 4QFCA 3TDKA 3DOOA 4BKRA 3GRKA 2X7HA 3E48A 3E8XA 4J4BA 5CAEA 1R12A 1E3JA 1JKIA 1JQBA 1P45A 4LVCA 1QV6A 4U6SA 4XQEA 4QECA 5DN9A 5THKA 1R0SA 1NR7A 1LLDA 2O2SA 1BW9B 2JAPA 2Y99A 4CQMA 4WE3A 2NM0A 1M75A 4D7AA 2QIOA 3HDYA 4W9NA 1ZIDA 3BTOA 3G3EA 3I9JA 4UVEA 3ADPA 4TROA 1QORA 1BMDA 3FR8A 3K73O 4GAEA 4XJTA 2EV9A 3VH2A 4XB1A 4XEHA 1H6BA 1R37A 2YDYA 2J3KA 4YJHA 1H6AA 2Y1CA 3BMCA 5F1PA 1S6YA 1NTOA 3HJAA 1GUFA 4J43A 4OQYA 4OGWA 1VLLA 2PGLA 4WNIA 1YQGA 4J2HA 1F12A 3T4EA 3VPFA 1PR3A 3VHRA 4ZVVA 3P2OA 1DC6A 2DUUA 4RLSA 1GYPA 3LC2O 5DF1A 2DLDA 4L74A 1I3MA 4XCVA 4KUHA 3WS7A 2F1KA 2ZTUA 3FPCA 4EW6A 3ZGYA 3MOIA 1T25A 1WAMA 4BIIA 2AXQA 4CMKA 5AOVA 1ZXLA 4DYDA 2XAAA 3RD5A 2D59A 1B16A 4KUGA 1PR9A 3UVEA 3LT0A 1IHYA 3CEAA 2VYVA 3U0BA 2GERA 3GAZA 2P4QA 4XRRA 4DXHA 3H5AA 1EDZA 3WGGA 4DRYA 4BKOA 1ZEMA 2C54A 2AA3A 4Z9YA 1WVGA 2JFHA 2CZCA 2I5PO 3BMNA 4BO9A 4DLLA 5U1PA 4CQLB 5AXDA 3S8MA 1GDHA 1K6JA 3ZHYA 3W6ZA 4F46A 1A27A 1LDNA 4OMUA 4E5YA 5IG2A 1DC5A 1GCUA 3TPCA 3JQAA 4PG7A 2OORA 3LQFA 1U3TA 4RLHA 1XEAA 1YBAA 2FRDA 3I83A 5L4SA 4OIMA 4C7KA 2VHVA 5C7LO 1DHRA 2EEZA 1OOEA 3IP3A 2D5CA 3ZU5A 3JQGB 4OYRA 3WQSB 2HAEA 1LSJA 2YUTA 2NACA 4J9UE 1KVTA 1X7GA 2XPCA 2V6GA 1E7WA 2FR8A 4UVGA 3MCVA 4F6CA 2BFOA 3NJ8A 1PS9A 4WLVA 4LSWA 1QYVA 4PLVA 2W2LD 1R4NB 3KSZO 8ADHA 3OA2A 4OKIA 4BNGA 2NVUB 1QLHA 2OGUA 4GX5A 5DNAA 1HDYA 2C2YA 2PLAA 2ZK7A 3OQ6A 2HMSA 5G4KB 4PZEA 3RUHA 4I5FA 3F6YA 2QRJA 1TT5B 4Q3DA 3QQPA 1C0LA 3OH8A 3BTSA 2WSBA 1PJLA 4MPDA 2EHDA 1VJ0A 1QKIA 5B12A 4YBZA 4DMMA 3KTDA 1YQDA 3GQVA 4JJGA 1O6ZA 5IDXA 1U9JA 3C3XA 2WDZA 5J23A 2H63A 4B79A 4YJGB 5LCXA 1FDVA 4CLXA 1EQ2A 3F5QA 4FFOA 1VSVA 2YHIA 3INRA 4MIOA 4IXTA 4MVJA 3U5TA 1PGPA 2VCYA 4Y6RA 1KVSA 2J5QA 1I24A 1HE5A 3F3SA 3GPIA 3F47A 4BKQA 3NAQA 1ZBQA 3O03A 5C37A 1HXHA 3OJOA 3G17A 5F1OA 5A02A 2BFPA 3FHLA 3PJGA 1TEHA 1YL6A 1FDSA 3WNQA 3CXRA 3HQ4O 6ADHA 5COQA 4A0SA 2WMDA 1GCOA 3FSRA 4CM8B 3AY6A 2C0CA 3V2HA 1BW9A 2AQHA 3ZWNA 1DRWA 4KOAA 1ZZEA 1BDBA 3LT2A 2A4KA 4AJOA 4E5MA 2VOJA 1RWBA 1HDZA 2AQ8A 3L9WA 4YQYA 1SB8A 4OH1A 5GZ3A 1Q7BA 4PRLA 4QXMA 5JCJD 4ITUA 1SCUA 2YV2A 4E5PA 3D64A 2CDCA 1NQAO 4DPMA 1LLUA 4J1SA 2NLOA 4EGFA 3P7MA 5ILOA 3CMCO 4OJNA 2AW5A 4FJ2A 3E18A 2DBRA 3GVCA 4LMRA 1L1FA 1T4BA 5JY6A 3KLPX 4J0FA 1E6UA 1UZLA 1EE9A 3WG9A 3OECA 4BMSA 4DLAA 1ZSYA 4EJ0A 1EZ4A 3WLFA 3BHMA 1H6CA 4UEJA 5COBA 4LMPA 1EBUA 1I30A 1M67A 3AUSA 1P1RA 2VWPA 4TRJA 5L95A 2PKQP 3DO5A 5A05A 2HUNA 3OBBA 4PG4A 2BI7A 1X7DA 1MXHA 1HF3A 2I65A 3C85A 2R00A 2B36A 4GSLA 1EEHA 1EUCA 2D2IA 5JAIA 1TI7A 3JD1A 1BXGB 4I5GA 4QSMA 1VM6A 1NVTA 2EJWA 3WYCA 4BO5A 1ONPA 4IQGA 1ZJYA 3E03A 1DIHA 2NQTA 5DDIP 3MJCA 4HFJA 5DP2A 3VH4A 2FWMX 1UZNA 1X13A 3S55A 3JD3A 2PD4A 3VDRA 1HDGO 2BH9A 4CQLA 2ZTLA 1YBMA 3GMSA 4PZDA 3WYBA 3DL2A 3RJ9A 1LEHA 1DIBA 4J7CA 1LRKA 5ER6A 4S1VA 1VL6A 1VKOA 4XYMA 3AI1A 1SMKA 1A9YA 4DQVA 1B8UA 5CG1A 4OKNA 3D3WB 4LSMA 4YT2A 1ZKMA 2QZ9A 4GL4A 4WOJA 3ST7A 4EEZA 1OBFO 3OICA 4K1LA 3GVXA 3WGOA 3JQGA 3BAZA 3CH6A 3A1NA 4DA9A 1DAPA 4O0LA 3VTFA 1I0ZA 2QHXA 4R1UA 1GFSA 2D4AA 2J3JA 2HQ1A 5JY1A 5KNLA 2YYYA 1HZJA 3HB4X 3VVCA 2AG8A 4Y67A 1ID1A 2NVBA 1GY8A 3VAZA 3WGQA 4FGSA 2TMDA 4GMFA 1GL3A 3WWZA 4B7UA 1R4NA 2NVUA 1SC6A 4Z0TA 4AVYA 2OO5A 3FNEA 4J16A 3FNFA 1HWYA 3EAGA 5G4KA 5TJ9A 1LLQA 3EZLA 4NH4A 3JQBC 1YVEI 1E92A 2O7SA 1YJ8A 4XR4A 5I9LA 3QWIA 1DPGA 3QVOA 1P74A 1Z74A 2GDZA 4FFNA 3H5NA 2DBQA 4RVSA 4BNKA 1HYGA 1T2EA 5L40A 1LU9A 5CHEA 2OXIA 4YJGA 1HDXA 2IZ0A 3CPSA 4AJHA 1GZ4A 3BXXA 3GOHA 4CPDA 3LLVA 4W82A 2HMVA 4D45A 1YL5A 4QX6A 4AJEA 3ZN2A 4FB5A 3KSDO 1A5ZA 3GLQA 4O6VA 3LK7A 2G0TA 4JGBA 5DZSA 3TZCA 1LSUA 3AU9A 1M66A 2I66A 1TT7A 3EW7A 3QHAA 1IULA 5B37A 3B20A 5EMHA 3PYLA 1SO8A 2CVZA 2C7VA 2YV1A 4NBTA 3OF2A 1ARZA 4BV9A 4ND4A 2BKAA 4WUVA 4R16A 3U4HA 5TIIA 2AE1A 4NBVA 5IN5A 2UDPA 5BNIA 5H81A 3MJ4A 5G2OA 4HBGA 4BNZA 4NPCA 4CM8A 1BDMA 1ISGA 1E6WA 2ZCVA 3GH3A 2EP7A 2VRCD 1ENOA 3UFXA 1GZ3A 3CMMA 3DHEA 3JQBA 5B4VA 2X0NA 1P44A 4ALNA 1PTJA 1NP3A 1YOVB 3PYMA 3RUIA 4FW8A 4RQUA 1TLTA 2W4QA 3AK4A 3I9KA 4YTEA 4J7XA 3I9LA 4RZIA 1B7GO 1MA0A 2X1HA 4NBRA 1K0UA 1T2AA 4YT4A 5TSDA 2GNAA 4XYBA 5L7YA 4Y6SA 1C3VA 2P9GA 3RSHA 1D1TA 5DBGA 3AI3A 3PRJA 4MIEA 4F45A 3AY3A 3CTMA 4EI2A 4E31A 1FF9A 5KIAA 4CJXA 3ZWCA 1NPDA 3EY4A 3H2ZA 1JW9B 1O94A 4R51A 5KKAA 4CLEA 3OP4A 4E2WA 4YA6A 3WIDA 1X15A 3RC1A 4QT0A 2YQ4A 3GT0A 4GMGA 2NTJA 4NG5A 3WGHA 5TC4A 3PHHA 2DU8A 2X5KO 2B4TO 1NFFA 3RU7A 4YRAA 1YDWA 2FOIA 3VH1A 1E1KA 2IYOA 4IGEA 3ANLA 4I5EA 2OUIA 4NIMA 3UICA 5KJ1A 1E7QA 3K30A 4G5HA 4PLFA 5F5NA 1Y6JA 2HCTA 4MP6A 3NTOA 4MVJF 1BXGA 1XIVA 2CF6A 2FR0A 4XGKA 1BG6A 2EP5A 1V0JA 3V2UA 1T2DA 3H9EO 4R01A 3Q2KA 1I36A 4WNCA 4DPLA 1AN9A 2Q4EA 1MUUA 3GF4A 1W4ZA 3STHA 4HY3A 1KY4A 4ZQBA 2Z1MA 2W98A 3RCBA 1WP4A 3GEGA 1DHTA 4YWJA 1V3UA 1ZO8A 3GC6A 4L9RA 4FJ0A 4YAJA 1LLCA 2GYYA 5A3VA 3K2BA 3ZNPA 3D3WA 1L7DA 5EN4A 1KY5A 3WGTA 2V6MA 4CMGA 5JW6A 4YRBA 2DBVO 1MC4A 4KUEA 4Q3EA 1EUZA 2UV8A 4I1IA 2Y1FA 5G0VA 3WOHA 4YAGA 5JYDA 4E0BA 5CDGA 4RF4A 3PK0A 4FOSA 4O63O 4DMLA 3BTVA 1DFHA 3DMTA 4IBOA 1KIFA 1VC2A 1SPXA 2ZCUA 4FN4A 3LVFO 2YDXA 5ER9A 5FF9A 3ZV5A 2E82A 3G0OA 2JHFA 2Z5LA 4AJJA 3AOGA 1Z73A 4BB5A 2IYPA 1NQ5A 3QW2A 3ABIA 3PGXA 3DR3A 4XX0A 1DFIA 3PHGA 1MFPA 5HS6A 2C07A 4P4NA 1NR1A 3EK2A 1LQUA 1JAXA 1DC3A 5TJHA 2CVQA 1DLIA 2O7QA 2Y1GA 2FHSA 5BNFA 2FSSA 4DPKA 1IYZA 3QE3A 4IQ8A 4TRRA 4ALLA 3L77A 4EUEA 3K9QO 1QYWA 2NUAA 2Q2QA 4XRGA 1GR0A 3UXYA 3K8ZA 2CNBA 1DDOA 3M6IA 2X0JA 5HA5A 2VTDA 1OZAA 4M89A 3QWHA 1P1IA 1IOLA 3ETGA 1PJBA 2NQ8A 1JLLA 3L0DA 3DFUA 2IZZA 3GFBA 1I32A 1BXZA 1GQQA 4JLWA 4LCJA 3KM0A 1HYEA 3TN7A 4L4SA 2IODA 5GY7A 3UCXA 1OMOA 1E1NA 1V8BA 4L0QA 1U5AA 4D46A 3K96A 2X9VA 4B7CA 3TOZA 2NTNA 4Q3AA 4QEDA 1DC4A 3F9IA 3E9MA 4AG3A 3LC7O 4BQPA 3GAFA 3EYWA 1YOVA 3RIHA 1Q1NA 1XGKA 2EGGA 4WOKA 3RI3A 3MJVA 2VN8A 3VOSA 1R6DA 2IXAA 1ENPA 4XB2A 3S2GA 4TRNA 3H6KA 3ZNOA 2HRBA 1NX6A 1PJCA 4L4XA 1A7AA 3DC2A 1WNTA 4QUKA 3OIDA 4OO3A 3F1LA 4OL9A 4ND3A 4K6FA 4OXYA 3SLGA 2I76A 3ZWBA 3GGPA 4WGGA 1LDMA 3FR7A 3VVBA 2PTGA 1ZSVA 2NNLD 3AM5A 1MV8A 1ZEJA 1H0KA 4Q3CA 4BO1A 4E5NA 2CY0A 1O0SA 3PWKA 2ZB8A 4YACA 2LDBA 1QV7A 3QWAA 4W6ZA 5AYVA 4MKRA 4XJSA 5EIOA 1GPDG 3SC4A 2DC1A 4A73A 2GUGA 5L7WA 4FFRA 3PFFA 1JVBA 3A9WA 4I9UA 3EUWA 4IDGA 1OI7A 3FTNA 4CMEC 4FFMA 1HLPA 1WZIA 2VRBA 3HDQA 1LI4A 1PJSA 2WD7B 3D7LA 3MTGA 1HE3A 5F5LA 3E1KA 3IOYA 5FYDA 4BNLA 3ZU3A 5CFZA 4W7HA 2GASA 2Y0DA 1KVRA 5HRUA 3PPIA 2Q1TA 4OM8A 3ASVA 1I8TA 4ZRMA 3RUAA 3GMDA 1RM5A 1U8XX 4S3MA 3ICCA 3JYLA 3PYXA 5IZ4A 3DBVO 3S2EA 2GPTA 3HNPA 3HDHA 3JD2A 2EJVA 1NFQA 5JBIA 2PH5A 3OJLA 2R2GA 2AQKA 3BA1A 3L07A 2P2SA 4E13A 1R66A 2EF1A 4W9NC 3ZNQA 3ZV6A 1D8AA 2OL4A 1C14A 3GN1A 1BRMA 3JQAD 2FMUA 3R1IA 2FPIA 3ICPA 4TVBA 3GHHA 3BYZA 4CUJA 4MVJE 2Y66A 5IF3A 3GDGA 2B4QA 2OMEA 1PJ2A 4CM9A 5AVOA 3O8QB 4P4LA 2GD1O 3ANNA 3FRJA 4OOEA 2C5EA 4CR8A 4KWHA 3U09A 4IINA 1ZFNA 1RM4A 1ZK3A 1Z7EA 4NK5A 1M6HA 1ONNA 4IDBA 1LNQA 3RFTA 3H5RA 4DC1A 2GF2A 2OFPA 2DFDA 3ONFA 6LDHA 1N7HA 3L4BA 3PQDA 5JC8A 2D3TA 4CUKA 1ZW1A 5ICSA 3HUDA 3IQDB 1IPFA 1BVUA 3WFIA 3U3XA 3DOCA 2X5JO 3CUKA 3DAGA 3MOGA 3WYEA 3DMYA 3W1VA 2D8AA 1K5HA 1PS8A 1SOWA 1YXMA 1VJTA 1IL0A 1E3LA 1NPTO 1U7TA 3H8VA 3HZZA 1R0KA 1I3LA 2Z95A 4J6FA 3RUCA 3F5SA 4JBGA 1ML3A 3DWFA 3ONDA 3E5RA 1B14A 3KYDB 4HFMA 2JHGA 2YHUA 1VKNA 4B7XA 3HN7A 2IZ1A 4MVJD 3KEOA 4DLBA 1A4UA 1FJHA 4IDEA 3PXXA 3ROMA 3DAFA 3DFZA 3VC7A 2JAHA 1RM3A 4B4VA 4CM4B 3L6EA 2B0JA 4MKXA 4E2YA 4OQZA 3ZI0A 2YZ7A 2VZ0A 4XDYA 5DP1A 4R5MA 4MJLA 1EDOA 1NQTA 3AI2A 3NTQA 3OIGA 4RPJA 2P5UA 4INAA 2O4UX 3JQ8B 4FFLA 2UUPA 4BNIA 3PI7A 3D4OA 5IXYA 4A27A 2NU7A 3WX0A 1XA0A 2GN6A 2I9PA 4YAIA 5JMPA 1O8CA 3FI9A 3DZJA 2G1UA 1D7OA 3JQ9C 3ZWYA 3AFNA 2BFAA 4WKGA 4UREA 4FJ1A 4RV9A 2VUUA 3W4IA 2BFMA 3AM4A 5TGDA 4DYVA 2B35A 4CM3A 1IPEA 2DPGA 4UUNA 3GZ4A 4ND2A 2FP4A 5DCYA 3P2YA 4J49A 3ZWWA 4IDFA 1BGVA 2Y67A 4YT5A 1H2BA 4UAGA 2POQX 4D3FA 1GZ6A 3EDMA 4MINA 1DRVA 2G17A 2C2XA 1HDCA 4N54A 3GG2A 4E33A 1E5QA 1GYQA 2VWQA 1GADO 2JKVA 3PDJA 3EMKA 3B1JA 2Q3EA 2Z1NA 1GD1O 2CSUA 4UVDA 1P31A 1LA2A 4BGIA 4E30A 4GLLA 1WMAA 3TFQA 4AFNA 4ILKA 1T24A 3W6UA 2VYNA 3EGOA 3RC9A 2WD7A 2DBZA 2NV6A 5A9SB 3IJRA 4GVXA 4KDEA 3JQ9A 4R4JA 4BUCA 1GAEO 4HNGA 3ZU2A 2FR1A 4ND1A 5JFOA 1H6DA 1X1TA 2BI8A 2EIHA 3IMFA 1N7GA 4WEQA 5CEFA 1KVUA 4B3IA 1PGJA 2HMWA 3HFSA 4YQZA 1E3EA 3GVIA 4G81A 3OQBA 3GVHA 1IZ9A 4ZD6A 3DZBA 2DKNA 4HWKA 3F4BA 4M8SA 4IDDA 5JO9A 4BO2A 4P8RA 5L9AA 2J6IA 4NU5A 2PR2A 3GGOA 3WFJA 2AEMA 3GFGA 3IS3A 4O1MA 4DIFA 4QO7A 1DBVO 4GKBA 2WM3A 5L7TA 3H9UA 5EQFA 4XGIA 2GN8A 1BHSA 1ZK1A 3UCEA 2IEBA 5TLSA 4ALIA 4HFRA 1WXDA 3LU1A 4BVAA 4E21A 3O8QA 1VPDA 5B4TA 1GQ2A 2XOXA 4M86A 2NU8A 1HYHA 2YJZA 4NK4A 5HTOA 3KV3O 2CVOA 8LDHA 1X7HA 2WE8A 2WYWA 3BHJA 1SOVA 1K89A 3D3EA 3ITDA 4R9SA 4WLEA 5EL0A 3TRIA 4N5MA 3D5TA 2IRWA 3GR6A 1V3TA 5B4UA 5KWEA 4LVUA 3FBGA 1KC3A 3KXDA 4RVHA 2TMGA 1ENYA 2FN7A 4U7WA 2O3QA 1BSVA 2H6EA 4RCVA 4BNXA 4BO4A 2PZLA 4CODB 1FMCA 5GZ1A 3AOEC 1J49A 2CMDA 4R3NA 2PY6A 1LDBA 3TOXA 5KOIA 1A9ZA 3I4CA 4R5HA 1MC5A 4JQCA 3UW3A 1OC2A 1S7CA 4YRDA 1YONA 4QTZA 5AXBA 4Z9FA 4ZJUA 1HEUA 2R00C 4RF5A 2ZJ0A 4BNNA 4PG8A 1AUPA 1UAGA 1Y9AA 3QSGA 4DGSA 3WBBA 3E5MA 4XD2A 4IS3A 1J6UA 3WJAA 3LYLA 2JJYA 5EESA 5KVSA 3X2FA 1YKFA 4FFPA 4ZHSA 3KYDA 3OJ0A 2HKIA 1PX0A 1BVRA 3PIIA 5JAMA 2NU9A 3RBZA 4UULA 4YJFB 3WLEA 4CLRB 3P5SA 5JE8A 4CM4A 3NEPX 1CJCA 4PLGA 1HE4A 4BNTA 4CLHA 1C0KA 1J0XO 2R6JA 4D3SA 4NQZA 1VSUA 1ZXBA 2X22A 3EZYA 3WQQA 3C7DB 3NGLA 4IS2A 4FC6A 4ZQEA 1XG5A 1NQOA 3JQ8A 4M1QA 4MDHA 4GGPA 2Q46A 2PKRA 2ZKLA 5EPOA 3QVTA 5BSFA 1DAOA 4PGFA 1FDUA 1Q7CA 1E0DA 3AOEA 3LF2A 1V9LA 1JWBB 3HWRA 3WR5A 4CMBA 4BOYA 4CMJA 3QVSA 4R9RA 1GUZA 4BKUA 3SC6A 4IIUA 2DTDA 3RWBA 1PZEA 3HN2A 3S1LA 1OC4A 3VZSA 1ONOA 2C82A 4IPTA 4E4YA 4Y8VA 1PZFA 4UUMA 3B1KA 4WCFB 2DVMA 4ID9A 5A1TA 3C1OA 3H3FA 3PZBA 4IZIA 1H2HA 2OZPA 1E3SA 4PN3A 4RDHA 4IGFA 1NNUA 2NU6A 1T2FA 3KVOA 1JKJA 2YW9A 1CQJA 5C7IO 1VRWA 3DB2A 5CEEA 3DHNA 1PJTA 2W2LA 4XQCA 3C1AA 2RH4A 2JCVA 1ISJA 3IDSA 3Q0EA 4UVIA 4UEOA 1TXGA 1B0AA 4KTTE 3QIVA 1U3WA 2AEJA 1WPQA 3W4KA 1JKFA 3WMWA 5A9SA 1G0NA 2J5RA 3T4XA 4CMCA 4BMVA 4UEKA 3MTJA 4D0RA 1PL8A 4YCAA 4J2OA 3CZMA 3KBOA 4Z3KA 1ISHA 5KJFA 2UVDA 3Q11A 1WW8A 2BGLA 4RO0A 4TSKA 3V1UA 5HM8A 5I7VA 3RQSA 1TB4A 1XKQA 4XYEA 3ROPA 2QRKA 4GVLA 5I7FA 2WWRA 3ONEA 3V1YA 2X0IA 3KYBA 3UUWA 2HMUA 1QLJA 1EK5A 2HK7A 1LC3A 1HDRA 2I3GA 4AJ4A 2P68A 2X6TA 4G2NA 4FGWA 5T8KC 5DOVA 1RKXA 2Q49A 1EMDA 5G0WA 2NWQA 2DTXA 5IZCC 5L45A 1I33A 3ZNNA 4N7RA 1ZMTA 3WJ7A 2V7PA 3E9NA 3OETA 3I1JA 4IDAA 4XIJA 1O5IA 3LZ6A 3W8DA 5MGBA 3A06A 4FCCA 4AJ2A 3GEDA 1UXHA 3JYNA 4D3DA 3AU8A 4JN6B 4EJ6A 5ITVA 1Y7TA 1P0FA 5H82A 1E3WB 2X9GA 1SEVA 3LT1A 5A4DA 3Q9UA 3ZCXA 5KVCA 4TVOA 3QWFA 1ZSNA 2AE2A 5JCJA 3DZIA 1R16A 1GPJA 2I3AA 1PWXA 1MB4A 1J5PA 3M2PA 4J4TA 4PLPA 3KB6A 3H65A 1U3UA 1RYEA 4ND5A 4Y9DA 4XZ3A 5IFLA 4DL9A 1ISFA 1NHWA 5ENVA 3QVXA 1Q0QA 4YB8A 3W4JA 1DRUA 2X5OA 2BD0A 3ULKA 5A5EA 4C4OA 1OAAA 3DBRB 3NT4A 4RPHA 1KS9A 3S2FA 5T8KA 2BF7A 3VKUA 1C1DB 2X58A 4DREA 5IZCA 4JNKA 4GKVA 3WIEA 3ZWOA 3ZWXA 2G82A 4CV0A 2WEKA 2CDBA 5HWSA 3EHEA 4CM1A 4ZICA 2GGSA 3TZHA 1E7MA 2C7GA 1E7RA 2EKPA 1IE3A 4PFJA 4L75A 4YJFA 3VZQA 3UHAA 4MVJM 3SLKA 4CLRA 1UXKA 2FPGA 2I67A 2Y0EA 5A03A 4DIBA 4BMNA 1T2CA 3C7AA 1PWZA 1LJ8A 4HUJA 4U0JA 2WJPA 1MX3A 3JQFA 4OOFA 3WNVA 4YVFA 3OQ1A 3OMLA 1NVGA
chains in the Genus database with same CATH superfamily
4HDMA 7AT1A 1F8FA 1FUUA 1KP3A 2B8EA 2XOKD 2QRLA 1AB6A 1XD9A 2YIJA 4F5YA 3FZEA 1HT0A 4I6JA 3ITKA 1CVLA 4HGQA 1T9DA 4IG4A 3CNLA 2X4GA 3A4NA 3FJOA 4YO7A 4QTUB 5CVCA 2PBLA 3N74A 1EXVA 1NW4A 2H3HA 1WG8A 4Q16A 2A35A 1DE0A 1HY3A 3AONB 1O77A 1ESEA 1TJYA 1Y1TA 2VT2A 2WMOB 1JPUA 2Z4TA 4FN5A 3M2TA 4KAFA 3NORA 3U3ZA 121PA 2ISCA 2JIZA 2OC9A 2OOKA 2WWXA 2G5PA 3V8BA 5L3VA 3PCRB 3OIWA 2IDZA 1DTEA 1EGQA 1VCNA 2FUKA 2V4MA 3C3JA 2O14A 2ZBRA 3PXDA 2H52A 4D9IA 5BSWA 1V35A 3SYLA 4TXNA 3HUTA 5D5PA 4UM7A 3PLRA 1G5QA 1N6RA 2COKA 2PLWA 3C4QA 3UHJA 5DX0A 4I1VA 3CQ9A 3NIBA 4L5CA 4L5BA 4KIWA 1C7IA 3VA7A 2NO6A 1E0AA 3ONWA 4G5FA 1WXWA 3KQMA 3HH8A 1OH5A 4DZRA 4IW3B 3CY6A 5FBQB 4DQUA 2YV4A 2IBTA 2Q27A 5FI5A 3UAGA 5LWHA 5L3SA 3CR8A 821PA 1DIOB 1V3VA 3MCAA 1CT9A 3AVPA 5JCZA 1VIVA 1FXWF 5DBIA 5AM1A 1U0FA 4TTTS 4DWOA 2O48X 1YB5A 4KH1A 5LDGA 4D9NA 2XUJA 1BQEA 3QV1A 1M5TA 1Z6YA 4IIJB 1NN1A 2HH9A 5FJIA 1XLTA 2Q3HA 2Q7DA 2WD9A 4RFSA 4N18A 4DLZA 1SR8A 2W2KB 2VDKB 1FTSA 1KYWA 1FPQA 1FXSA 3FNRA 4OHBA 2EFDB 3BWMA 1K8RA 4HXGA 5IDYA 4F92B 4HDAA 2CL7X 3CLTC 1KXZA 5AMXA 3FZGA 2A1TS 3EE6A 4YPFA 1WDLA 2B25A 4Q4DA 3UFBA 4GR4A 1G291 2CD9A 1UXIA 4UW9A 2V4UA 3K5IA 1MBZA 3JZMA 4IH4A 1RDFA 3MTDA 3LQRA 4RLQA 1QVRA 3UN1A 3ICOA 1CB7A 1WLYA 3L06A 3C8MA 3U4CA 1J22A 4NECA 1UDBA 3RUDA 4D97A 4YDRA 2PZKA 1U5BA 3PUVA 4MWZA 2HJWA 3V80A 2EDAA 2P2DA 2ZETA 5CXSA 1E3IA 5B58T 4IUBS 4MVJP 4F91B 4WNAB 3PIRA 1HFWA 1CNMA 2V4ZA 3M49A 4R9NA 4TS3A 4YDQA 1QPGA 1OKKD 4EX6A 2XWQA 4QBTA 3NT5A 4ZYXA 4HVCA 3HDTA 1X1EA 2ZSKA 2GK4A 2O2YA 3D0OA 3D6FA 3TSWA 3W3ZB 3W9UA 1Y7IA 1P61B 3T7CA 4Q1VA 3D81A 1LFAA 4EVRA 3PJRA 4PGGA 5GM1A 4M8KA 2JCXA 4EVQA 1EU1A 3O4RA 3SVTA 1HO3A 5E3IA 5DGIA 2GM9A 3K9CA 1HFJA 5FNVB 1G2QA 1QX3A 5I9MA 1P60A 4J1NA 3ZBUA 1FUEA 4IF4A 5DWVA 4R3WA 4CBVA 3T7RA 4DIOA 4ZMSA 4I2VA 4UHEA 5JZBA 3BMQB 2HM7A 2VAWA 1K3FA 2JCYA 1SVIA 1ZLXA 2A33A 3GN2A 1N92A 3LW7A 4UZSA 3CUWA 1C4OA 3OIUA 2ZIUB 3S5UA 3UK0A 1SXHA 2VSFA 5K6AA 3AW9A 4IMRA 3E23A 3VBCA 5AVVA 1UBOS 1JA0A 2WLSA 4F4HA 1L7AA 3TIFA 5AVSA 4ALMA 1UBCA 3TQCA 4QYMA 3MJEA 4U8HA 3IUEA 5DNDA 4HGOA 2P8SA 1ZHOA 2H06A 4RZ2A 1B93A 1JR3E 1FDTA 4KO8A 2CXTA 2OMKA 2REXB 4YUWA 4CIBA 2HB6A 1RLMA 3MIZA 4L8GA 1H2WA 1TAHA 3K1ZA 1TM1E 4Y3UA 2O07A 3WXMA 1ZN8A 5F1YA 4BP3A 4F0JA 1A77A 2AL7A 5F12A 4BQRA 1P80A 5AOBA 4IZHA 4OHCA 3UC5A 3E0QA 2D1YA 1E6EA 1TKAA 3CGWA 3V4PB 2CLOB 3VPSA 4AC9A 2XMZA 3VR5H 2C94A 5K0FA 1TJ3A 3BA6A 3ESXA 5JWHA 2CUKA 2ZUTA 2ZR9A 4J7AA 4KR6A 1DIGA 4BQEA 3QVLA 1U94A 4GX2A 4M38A 4YROA 5PNTA 3BZWA 2ZIVB 3AM3A 5MDHA 3D1VA 1KFBB 1SVWA 3QLVC 4OKSA 1PT5A 1PJ4A 2P91A 3MT9A 1G98A 1RLJA 2GD2A 2H1SA 4I50B 4TKLA 2RJ3A 4I14A 4MUKA 5JS2A 3JW8A 4AZ3B 1ADFA 2ZRKA 1BA2A 3B70A 3VYVA 1K3TA 1M2WA 2WPNA 2QTVB 1UADA 3EQZA 4M76B 1CIVA 1T35A 1UMDA 2GESA 2BUAA 5DLDA 1PQWA 1WA5A 1YBHA 4GI2A 4KXFB 1SWWA 1YQTA 2IE8A 2MSNA 4FR2A 4L8WB 1PV2A 4U02A 1PBTA 4JU8A 4RMJA 5C5DA 4EQ6B 1W75A 1GGFA 1Z4QA 2RGNC 4QLBA 1B3RA 4XQGA 2G67A 3QFFA 3TK1A 4MRAA 3JATB 4HV4A 3KQYA 3RBVA 3T12A 1WHSA 4RANA 4BASA 3WMRA 1WRBA 2B1QA 4ARZA 3B48A 1GWNA 1N1EA 2ONKA 2V5VA 4DV7B 3TNLA 4WW0A 4X7PA 1S2NA 3L4BC 2F00A 5EMJA 4RZHA 4CGYA 3THYA 3ZJUA 2YWJA 1RWPA 4G9BA 1EXWA 3AZPA 5KHOC 1F3LA 3VU3A 5FL7D 2RHRA 4ZOAA 1WS6A 2LVBA 2XKJE 5EZQA 2Z5FA 2YHBA 5A4JA 2FQXA 5JNTA 2H1OA 1P19A 4NPHA 2IYEA 4TZKA 3A1WA 4W5HA 2ZBVA 3V2GA 3ME5A 4G9GA 1U0GA 2O3JA 3T1HB 5ILGA 1MLDA 5CMLA 1OZGA 2EGHA 5T64A 1KHTA 2D0IA 1B15A 3IDFA 3DXYA 1DJOA 1KFCB 2R8BA 3OE5A 4MWCA 5TF4A 3ADKA 1SUIA 4F56A 1ZWKA 1F60A 2O2IA 5JADA 1ZCZA 2BCGY 3FWZA 4D8WA 3IKTA 4GEKA 2ZJ4A 3NFRA 3CWCA 3IVXA 4JI3B 3O4HA 2B61A 1WCIA 1XN1A 2O0KA 4RKWA 3S0JA 3DE0X 1LZKA 1YS4A 4OGKA 1HLFA 2C8KA 3SYKA 4ZGGA 4OM7A 3AUXA 2ZJAA 3BHIA 3IT3A 3CC8A 1U1DA 2DLNA 1C1XB 2R1VA 1ZC3A 4E4TA 2VCEA 1JECA 4RHTA 3Q72A 4TRMA 3SAJA 1Z7WA 1TCBA 1IEWA 1Z0JA 2IGBA 3C6XA 2R11A 2MYNA 3FOBA 4PO1A 3GRPA 4ZT3A 1YQUA 2OKCA 4GH5A 5FD8A 1ZMXA 4GI5A 4C7BA 3O38A 1Y89A 2HTFA 4Z4GA 2PLNA 4OQFA 3GHYA 4ZI7B 2RGEA 3Q7QA 3W2IA 1YNSA 5C1IA 4UTXA 3FD8A 2RG7A 4C9BA 1UIRA 1VE5A 4FFBA 2P6OA 2RFLA 2PE5A 1Z17A 3KO8A 2BR4A 5KC9A 4N7MA 3EVFA 1IUNA 4JBIA 2OCDA 1FFBA 1RHUA 5CT5A 3WMXA 3QKRA 1WUYA 4EA9A 1UM8A 1D4FA 3UA4A 1R6AA 5G02A 3KZVA 3LAWA 4PX3A 3WFZA 4PE5B 1W0KA 5SICE 5M04A 1TTTA 4DLNA 3S2ZA 1W94A 2GRUA 3E9DA 3G1WA 2P2LA 3VPBA 1IWOA 1ZGCA 5HQJA 2AD5A 4OMFG 1EWRA 1Y4SA 2FWAA 1DWPA 1F2VA 1JYEA 3JALA 1U31A 3OC0A 2R86A 4C88A 2WD8A 3EDYA 5DGCA 1UJCA 2VTVA 4MGYR 3DBLB 3ZV4A 3NB0A 2HOQA 2PZJA 2R68A 1K2VN 1BCRA 3GGDA 1M9NA 3IQEA 4MCAA 4V0KA 2AOXA 2HSWA 1J9ZA 3ADOA 4YDHB 4G09A 2AFRA 1JLSA 1RJFA 4AF6A 1CR6A 2QT9A 1GZ7A 1V7CA 1PHRA 2CYCA 3HU3A 3KXLA 1MGOA 3U7IA 3A3OA 5IBPA 4TSFD 3D4IA 1ZRNA 3JQ6A 1NW9B 3V5NA 3PUKA 1Z68A 5ADHA 3HJNA 4KW7A 2Q9BA 4MW5A 3UENA 1IY8A 4AF7A 4WN9A 3L7OA 2J9YB 5KCZA 4RZUA 4EAAA 2JRLA 4EENA 4DKXA 4EUSA 5I9TA 1TJNA 2OZLB 3U4QA 1N0IA 2A5FA 1VPTA 3DC7A 4L5JA 1UZMA 4NU0A 3TCXB 1RQXA 3P4YA 4HGPA 3O2NA 1N77A 4GE0A 3U6BA 5JAQA 3D7SA 4LYYA 4RJTA 5JNLA 4C6TB 2QX7A 4M8NE 4P6VF 5L3ZA 1VJRA 1JSCA 4FE4A 2Q7OE 1Z7GA 1QAMA 1CY0A 1X86B 4EMSA 1PFYA 1J1ZA 3UYLA 2WWHA 1PDVA 3KKKA 4HC4A 4MAAA 2AFHA 4MUMA 1M8FA 3TIIA 1UFQA 1NQVA 1LV8A 5DCUA 4EY4A 2A9PA 2VNIA 1MNQA 3HG7A 4QHYA 4XYLA 4B3CA 2CGEA 2WZQA 2QVBA 1E32A 4ZVRA 1E9CA 3FDZA 1P1KA 2APJA 4EX7A 4ZYZA 2PQ6A 2GCOA 5L4LA 3JQCA 3VR1A 4IMPA 3TL6A 4Q34A 1JNYA 1G3IA 2ZUWA 3T7TA 1VHWA 3O8RA 2J9GA 3C3KA 3KOUA 1C5KA 5EQTA 3AR9A 3PRHA 2XOEA 1Q5PA 2C3PA 2IEZA 2A1UB 2G0NA 1YCHA 3NHBA 4PICA 5DK6A 1BH6A 2H7VA 2G70A 4JVOA 4GP9A 4R41A 4I7EA 1AGYA 3EQ8A 1L4HA 2RJNA 3KV1A 4I5IA 3OT5A 4I4LA 4NYIR 5CJ2A 5H59A 5JDCC 3IUQA 4ALJA 4AJ9A 4KQXA 2ZKIA 3HBFA 2IE0A 4N0PA 5F7JA 4C05A 1L5RA 5I7SA 1S96A 2G0AA 2Q6TA 4XCQA 4PRKA 2W6ZA 3TQFA 1IAQA 1M6YA 1PLKA 2VZ9A 1KHHA 4QGBA 3BRCA 3TL3A 4EG5A 3WISA 3AJEA 4PNPA 3UH1A 2D0OB 4ZV7A 3L01A 1HT2E 1QYCA 3IERA 2IYNA 1E58A 4YYEA 9LDBA 4NE7A 3LD9A 1USIA 4GMXA 2HLDD 5BSEA 5LIRA 2B99A 2ZT8A 2NZUG 2V74B 1PDWA 1X0VA 4AJKA 1MVOA 3PL1A 1LPAB 1Z6QA 1YR2A 4EP1A 1HH4A 3GLKA 3ITEA 5EWMB 1DXYA 3TBKA 2C5BA 2R1TA 1PWHA 3A9TA 1YB1A 1WEHA 3DMGA 4Z9XA 4M0CA 3OQPA 1GQYA 3U4IA 1LPNA 3CKKA 1H23A 4B3HA 2CHVA 2Y1DA 2VA8A 4GP7A 4EKGA 2ODTX 4AJPA 1TTPB 3T38A 4FHGA 3K5PA 1QR6A 2JFXA 3HL0A 4UZEA 4NCBA 2IU3A 2WKRA 3ICWA 1TM4E 1VMDA 5EZYF 5T4FA 2C2WA 3RTAA 1U3GA 4P0TA 1SM4A 1SBCA 1W52X 3HCCA 3NPAA 2FSVA 3WGYA 1YQWA 1A9RA 3AF0A 3NWOA 3EQ6A 4JXKA 4QUBA 2RAFA 4ETIA 1ZM3A 4BS9A 1V4NA 2HA0A 4BZZA 1K08A 2O8DA 4RSGA 3RU9A 3RANA 3UKJA 3FFXA 1I7QB 3FTQA 3PVCA 2O50A 3OJEA 5TVGA 4JIGA 3OCWA 1Z18A 2ZRHA 5AJHA 4Z4QA 2G04A 4QUIA 3S3TA 1CZHA 1CR2A 1Z3IX 3UHPA 1MX9A 3ZIAD 2UAGA 2X8WA 3GVPA 4CR6A 4TYPA 1NAIA 3K1YA 4HQNA 2NTVA 3NT2A 3MRVA 4UE3S 3PZRA 4NYJQ 1CE8B 4LPSA 3RYFB 4AQYB 4C4SA 4L15A 3LP6A 1VA4A 2M6LA 5CR9A 5JBNA 1UAYA 1Q0ZA 3K9LA 1NVMB 1I2AA 4BMOB 1E9FA 2R6DA 2VP5A 5KSPA 4FZ5A 3D4NA 3D5QA 4Q6BA 1M0SA 4EMBA 1A5TA 3KL2A 3LPAA 4S24A 3VU9B 1JRLA 4BVLA 1UK7A 4QG3A 3EGCA 2ATXA 2E1RA 3L0BA 4RK4A 3GIWA 3LT4A 1X6VA 2JKYA 3P9CA 3PEFA 4MV6A 4Q3KA 3SX0A 5IDWA 1P4GA 3KQUA 1O8BA 1FJXA 1LX6A 1C0PA 4BLSA 2QTWB 2C98A 2CXNA 1X9GA 3PFIA 4OQXA 3C5VA 1P5JA 3OPMA 4GWLA 1ZD8A 1V95A 2AJDA 4RTNA 1PLLA 5KTTA 5ITWA 4UTNA 1GN8A 1RAHA 1YDGA 2GN9A 4JBHA 4JIMA 1ACLA 1SKBA 4J0QA 4KQEA 5DGDA 4QQRA 3WK6A 3PQ3A 4TZ6A 5CLHA 4K7JA 1KYTA 3UOGA 3WIUA 4EO9A 1U4SA 1DCTA 3PT9A 2C83A 1BDIA 1A9OA 3E70C 2RJOA 1RS0A 3D4PA 4I46A 4FU0A 2EP8A 2YY6A 2QSYA 4B85A 4CFSA 1WKVA 1NWHA 2YOHA 2W6IA 5LIPA 1D2NA 1R64A 2FLVA 2ZUDA 2ZATA 2ZSFA 1T91A 1EJBA 4QOJA 5DTMA 2X0RA 3GPDG 4L8LA 1HOXA 1Z34A 4LWZA 4M9CA 4KNYA 4PX2A 3R7LA 4D8UA 2VNSA 3FZQA 2VIIA 3ORFA 4NOKA 4JI1B 3T1YB 2WIFA 2Z56A 4IJWA 3VZRA 2VR1A 4L6CA 4YRGA 2RHDA 1NF8A 3HK2A 4DPMA 2XRFA 4K26A 2X2PA 3KZXA 1WD5A 1P0CA 2IYXA 3B36A 3C5CA 3JZIA 5BYKA 2OA0A 4H9GA 2BT4A 2GCEA 1TGYA 2WT8A 5D7NA 3BDVA 3QFCA 3Q8WA 5KNBA 2J8ZA 2MSWA 3R4CA 3PEYA 1GTL1 3AEQA 4W8HA 5SZHB 1VE9A 3VX3A 3LIPA 4RVCA 1U0NA 1OGYA 4ZCPA 3OTOB 2LR0A 2JGEA 3DOFA 4MUYA 1CRZA 5K4HA 2JFUA 2WSMA 4I3HA 1KU0A 4OHWA 2FN9A 4K6CA 1Y3AA 4AZ0B 5FOQA 4KGXA 1US8B 5EQDA 1LC0A 3OCXA 1ISIA 1CG6A 1Y1QA 4IEIA 2BFCA 4YJ2A 2DXIA 2HIAA 2WUGA 5KTSA 3NDRA 4BWGA 2YMPA 3IUJA 3BMOA 5KQRA 1H9AA 3QFTA 4H3VA 4LJSA 4BLQA 5JJIA 3K2QA 2ZRFA 4R05A 1CUBA 1DDGA 2SCUA 3AF4A 4NZ9A 4UU0A 3I58A 1EP3B 1USVA 4H0FA 1MFZA 2M1ZA 4G5YA 4WBNF 4QOGA 4HDOB 4HX9A 4JJ4A 4Q4JA 4JT2A 3I05A 1HSZA 4KC0A 1IWPB 5FWDA 4BO7A 3IXQA 3VKVA 1YS9A 1CS0A 1RYNA 5EHNA 2YMLA 5TEVA 1E62A 1PL7A 1BJTA 5JS7A 3ZJYA 2IQ5A 3W05A 3OCZA 2DJ5A 4P38A 5D3ZA 3V7WA 1G5IA 1FBTA 2H1CA 1Z63A 2A5YB 5HZMA 1MB0A 2YHAA 4M36A 1P2VA 1QPZA 1Y5RA 1MTOA 3DHYA 4IAOA 2V7VA 4ZVNA 1GSHA 1W7AA 2PWPA 4EKYA 5AXCA 2DEUA 1TCUA 1ZK2A 3RJTA 1UIMA 4MEAA 3R6WA 4L9SA 2ZJ3A 3KVVA 4GOOD 4HTFB 3DBHB 1V47A 2P77A 5JBQA 3S68A 2QLBA 3FTCA 2EDCA 4NU8X 1D09A 2TS1A 2OXTA 1DWQA 1P77A 1TM7E 3TF5A 4QFDA 1WB9A 3W0LB 2YFQA 1U28C 4OPMA 1MAHA 4BB9A 1BRTA 1GGJA 3M1IA 3PSAA 1SB9A 4BL5A 2O8EA 2PV0A 2IHKA 1NLUA 1NW3A 1NAHA 1RABA 1PWYE 1WJGA 1RWQA 3GLTA 4AMBA 3PR2B 3I5XA 1Y8RA 3K92A 5JD6A 4BC1A 5H4HA 3PNOA 2JGFA 4Y2RA 4R54A 3D3NA 1I5RA 5AQ1A 1Y82A 4OHUA 3JWHA 2C4VA 2CB9A 4OLFA 1J8DA 1MIOA 1MOZA 2JNWA 3DLIA 5GVRA 4O33A 1Y8QA 3W8RA 2PX0A 5AW5A 1Z26A 4UDNA 4YUZA 2KBEA 3OQMA 1QYRA 5H83A 2VYQA 1BGXT 2IDMA 2C5HA 2ZU0C 2G28A 1UMKA 2VK2A 1IN8A 3TFOA 3RUEA 3KDAA 1ZM4A 4P4TA 4HG2A 1TIKA 5ENDA 3WLAA 1FVOA 4DSNA 5L4NA 1NG1A 1XYGA 1FYFA 1H1LA 1RTKA 2VYCA 2ZT6A 1K97A 1ICEA 1QAQA 1P4SA 2HY7A 1J20A 3IUBA 3K2EA 4BNDA 3LKDA 1OLUA 3UATA 1C9EA 2JGNA 3M1AA 2ZBUA 4M88A 2HPHA 2YCBA 4YAFA 1E2DA 5G0TA 3ZUPA 4ZYWA 3T7IA 1BH2A 1L3CA 3HFGA 4DMUB 3NETA 3LK6A 5J4VA 2JFPA 5EUQB 3UO8B 3KETA 1SXJA 1E2KA 3B6ZA 4PZCA 4LNAA 4W5NA 5NULA 2AFIB 2Y0CA 3TPZA 3HCNA 3HI6A 4P83A 4R2JA 5KKCA 3A1FA 4FDVA 1W0CA 4MAMA 5ADUS 1VKJA 3RYCA 5AM2A 2YW2A 3H4VA 1P33A 5DLYA 2JIRA 2OGWA 5IBCA 3M82A 1NBIA 3VV3A 4Q0MA 4M0UA 2FSUA 1V6AA 3FYTA 2FY8A 1C8BA 1WF3A 1U1IA 4O5OA 3FA2A 5BSHA 5KNDA 4M1KA 1J4AA 1ZJJA 1PIWA 1NXWA 2RHCA 5JQGB 1KTVA 2WHXA 1UP6A 5IP5A 3NRCA 4UVHA 4DABA 4DSTA 1G9TA 3SBOA 1LTHR 3M1YA 2QYTA 1SZJG 4CEJA 1R0YA 1T5BA 4NU6A 1GPWB 4E2XA 1LTQA 4Z53A 3LNTA 4W8OA 3VNSA 3OEHD 4AIRA 4EGSA 3J80A 2XUAA 1NV8A 1JMYA 3KPVA 3FFTA 3WADA 1ADJA 3ZHSA 4G01B 4BNVA 1YE5A 3HCEA 3CX8A 3EXIA 5FOUA 3M89A 3SC3A 4WCVA 1IRXA 5HKOA 1C8VB 4TUYB 4BP8A 1F8XA 5LNK6 3LOUA 2ZXUA 4LQDA 1SG6A 5LFAA 3OWXA 1I01A 2OCYC 4B2IA 3CNBA 3K2IA 3TAHA 1JU3A 4AW9A 4EY5A 5KTMA 1ILEA 1ZUNB 2VNHA 4MRMB 4D8TA 1XAIA 1RWMA 2ZVPX 1R6TA 4FMPA 5DWQA 2GA9A 2WTXA 3BN3A 3VPCA 1TJPB 2GTHA 1XPOA 1IQPA 2Y9MB 3BL5A 5FT9A 5JDIA 1P7ZA 3FNBA 4EB6A 10MHA 3WDLA 3BE8A 3SM3A 3EPKA 4G1VA 3RBXA 4Z49A 3AVTA 3OJCA 1JWAB 4LY0A 3WI7A 4ZAWA 3W3AH 2BELA 3C45A 2H0QA 5H9VA 1M1UA 2P11A 3CWQA 3NBZC 2GDJA 3H2GA 4MW9A 1FZQA 5HILA 4BHTA 5EKUA 1X9HA 1AT1A 1T8YA 5E7JA 2FPXA 1ZONA 3BCUA 3AHIA 4ZT6A 3WWCA 3Q7EA 1Y6FA 3G0DA 3HI4A 3CNEA 4V3BA 4B8ZA 2YZNA 5H02A 2OBYA 2QXUA 5M2QA 3DXZA 1ONSA 4EHJA 3ZHXA 1DO2A 1XV5A 1BCSB 3MINB 5F7OA 2O4CA 1NIJA 3SDZA 2V3WA 3GT4A 3H1BA 3KZCA 1IZ0A 4I4IA 4YLEA 4LRSB 4YBRA 3N05A 2EFHB 1POXA 4ENTA 2LDXA 2IU6A 4HLCA 2EU8A 1E7SA 2V7XA 1U2GA 2W6NA 1PYGA 4IXDA 4K28A 4UMDA 4XTCS 3RRZA 2X3YA 4OIFA 3WJ7A 2R8ZA 1GU0A 4IHJA 4X6XA 3PNKA 3F6PA 1QXSA 2YNMC 4C5AA 1M6WA 2CKMA 2FPLA 3LW8A 2DF8A 4LIPD 1A7UA 1ABBA 3MGGA 4NMMA 2WWYA 4Y9UA 3SFTA 5JT1A 5DB4A 4QYIA 4K40A 3S7TA 1LF0A 3OEEA 3OKPA 4EDFA 3CFYA 5U4QA 3ZBTA 4DR2B 1S1CA 4LDPA 4O4IF 2B9EA 4A5OA 2YVKA 3TZQA 3EXG2 1SKUA 5LQRA 1I6KA 1WUHS 2B2CA 1AA9A 3H2SA 3MPUA 4RD2A 2VJYA 2D3WA 3EJWA 4WA7A 2OHXA 4QAQA 4J0EA 4G25A 3SBXA 2DPXA 1FFEA 2QVYX 1YJXA 4MI1A 2R6FA 2JD0A 3C6KA 3JCZA 4BWVA 4CM9D 4PYNA 3D6HA 1CDZA 1RU3A 2HNKA 3EOAI 3ONVA 2OAQ1 4DEXA 5KQSA 1CLUA 1J23A 4FGJA 5CBKA 1E2PA 4RKQA 4I1PA 1H4SA 3FCEA 3ZW8A 3WKAA 3VZCA 1LNZA 1WSDA 1I7LA 2PX6A 2X76A 3AUTA 3BGWA 2XYQA 2C4KA 2BFBB 2OEPA 3R3XA 1L4GA 2NO5A 3EVCA 3DTVD 4MGKR 4DUGA 4YHHB 2Z8XA 4D92A 2QW8A 2NIPA 1FFGA 3AB3A 5DBEX 3QLJA 4IVPA 4PIVA 4YJHB 3L8MA 5KU7A 5K8CA 4WN9B 1GGHA 3ZDXB 1NVKA 1TF5A 1KI2A 1ZRHA 3GGGA 2NZYA 5CLLA 5DYWA 3PFHA 2PKYX 3HE3A 2WE7A 4ZC8A 1FC0A 3VR4H 3WRXA 5KQLA 2Z8ZA 2Q8PA 3P5BA 4PGMA 4INJA 4XIYA 3SPXA 3O1JC 4CM5A 2Q3CA 4BNFA 5CX4A 2ZSUA 4HH0A 4S0XA 4DY4A 4XWOA 3F1KA 2WUEA 3DJYA 1B43A 4TKMA 5IHXA 1NBHA 1N4AA 2XCQA 3NAGA 3MCWA 3QVVA 4LOAA 5LU8A 2BTEA 1ECCA 5A7FA 1BXKA 2PH3A 4CVNA 4M4SA 1XHEA 4M0FA 4ZVTA 1YBVA 5SZKB 5JNWA 5CB4B 4CMHA 3NVKI 2DPHA 4C14A 5HQ3A 1DUIA 3II6X 1RTTA 3GBVA 2XZPA 1KPHA 3JSXA 4RIIA 5A0FA 4QYXA 5I9NA 4N9QA 1GT6A 2Y71A 3NUGA 3CVYA 1Z62A 2QBYB 5JMWA 1RLUA 2X8JA 5DMHA 3I39X 4MICA 1GYRA 1ZA2A 3A3PA 4HOYA 3ZHZA 2RHHA 1P9LA 3CZ9A 4WLFA 3EVTA 4WK0B 2DCMA 5LJIA 4O4JF 2DPYA 3IP1A 4W5TA 1VI6A 4AJNA 4Y9TA 2RAPA 5A71A 1T0UA 2ONJA 1YZVA 2AHRA 3RG2A 3K31A 3ZE7A 1M8PA 2XZOA 3QJGA 5LMCA 2PQ0A 4OV6B 5AKLA 1N3BA 4HAVA 5JYEA 2F62A 3MWEA 3LKBA 2R60A 2OCLA 2Z30A 3PRYA 2IYWA 4CMAA 5D6NA 3BMNB 4MQ6A 1M2OB 3L7LA 5JVDB 1QC5B 4I2NA 3EGXA 1P5RA 2V6IA 3T3MB 2GZ1A 2P75A 3PGJA 5H80A 1XZLA 2GXSA 4LZAA 4PQRA 3DEHA 5LA6A 3BIOA 2IGTA 1OQAA 2P5SA 4NONA 3FZYA 5C52B 1NU6A 1PSZA 2VK4A 2Z57A 3DE3X 5KAPA 1V1MA 4CLDA 4MP3A 5ITVA 3WWYA 4HQ0A 1Y6RA 3HZHA 1AC5A 2D1QA 3ELUA 4MO2A 4UUQA 4N47A 2WT9A 2RKWA 4B9AA 4DJEC 2IFTA 4I55A 4A2WA 1WZEA 3BICA 1BKDR 2QRGA 3NBFA 5I48A 5ELXA 4LOKA 4UUPA 3TX6A 1JHUA 2BEWA 1RXSA 4TV8A 1E79A 2QYSA 5D8DA 1E9SA 1U0LA 3HMKA 4A3SA 1PN3A 3A6EA 2WMYA 3AFOA 2JCSA 1G5RA 1GNVA 4NBUA 4HSGA 4Q05A 4C0LA 3H9JA 1ADGA 1OKKA 1UK9A 4D99A 4V0RA 5LLSA 3L0SA 1USKA 1HL3A 3IUSA 5KI6A 4EW1A 3OE4A 2EJCA 4FDTA 2OO3A 2X77A 1AHIA 4UU7A 3B53X 4LX8A 4XW2A 4RH1A 1MQ8B 5DI3B 4HDRB 2BLLA 1QF7A 4RACA 5AKXA 5B3KA 3N7UA 4HI0E 1I3KA 3UJ8A 2ZSHA 4FEGA 2WFMA 4O2AA 1E5LA 1GITA 4WSOA 2EC5A 3OJFA 3OZVA 3DEJA 4GU5A 3TINA 3WGZA 4ID3A 1PGOA 1NW7A 4IWNA 3GLHA 3VNVA 2PUDA 2Y76A 3OFSA 1N7JA 4D0GA 3BK1A 3K05A 2MR6A 2YHIB 2C5GA 2ZWPA 3ETJA 1XDWA 1AS0A 2JD1A 1RC0A 1UC4B 4IIEA 4Y2UA 3L4EA 3UA3A 2JJ2D 2WDPA 2FEAA 1YO6A 1DQYA 4G1FA 5KOYA 2QN3A 4HRVA 1VSTA 4MA0A 5DHUA 4D42A 4TMVA 5KX5B 2YRWA 3U60B 1J8YF 3NKFA 5LP6A 2P6NA 2IYFA 5B7NA 3TPFA 1THGA 2JFZA 4BKRA 3IHLA 2X7HA 3B13B 5CXXA 3MXOA 3T9FA 3UWDA 1NNEA 4TTRA 1OFTA 2HJ9A 4RA6A 5TEWA 3W2HA 2X8BA 1E3JA 1GG5A 3IE2A 4FTWA 1JEAA 3CTPA 1H5NA 1QV6A 4U6SA 4I9FA 4XQEA 5DN9A 4TT3D 2O2SA 4ZEMA 4C6SA 4BBPA 2WVJA 1AHPA 3ADCA 2NM0A 3K0AA 1KO7A 1M75A 1VBFA 3Q9LA 3SLRA 4D7AA 2XVZA 2YWBA 4ZZ0A 3P94A 4W9NA 2QT1A 3BTOA 5F35A 3G3EA 3IQHX 3EDOA 3PHBE 5I9BA 1DTSA 2IF0A 5BOSB 4XJTA 1IVSA 1BMDA 4TTQA 3EWNA 5EP4A 4DR6B 1U2DC 4LQCA 2GZSA 1RMYA 2IYVA 2YDYA 3T1TA 1H6AA 1XLUA 2Y1CA 3BMCA 4R2LA 5DM0A 4GDFA 3TW8B 3R5FA 1T29A 1W8IA 1S6YA 1NTOA 5CYFA 3VNQA 4N0DA 4JBYA 5GONA 3BB4A 4OGWA 1VLLA 3ZD6A 1MEOA 4NWIA 1J07A 1QIJA 4J2HA 2IZ5A 4LNUA 3VPFA 4X1KA 2OKGA 1PYOA 1ZITA 3NALA 4WVFA 3EEYA 1VB3A 2QW0X 2GSWA 1KI6A 2R47A 2FRDC 3E84A 4KXUA 3VHRA 2AK3A 3P2OA 2H16A 1AMNA 5DF1A 2JGJA 1Q95A 4L74A 3QMWA 1J00A 3JWJA 2KS6A 4LUCA 2XUKA 2QL9A 3A27A 2XMQA 2QU7A 3C87A 4QDKA 2YR0A 3VMFA 1G19A 1SCAA 3F4KA 3DDUA 3GA7A 4EW6A 4F1JA 2F90A 2PIDA 2IEYA 1JIQA 5HIKA 1O7JA 5KZMB 4U6NA 3J81A 2ODWA 2PMFA 2IH2A 2AXQA 3WLNA 4W7SA 5B64A 3C3MA 5AOVA 3NHPA 1CY6A 4N49A 1Y9ZA 2JLAA 5B1SA 4EHIA 4AQDA 1X1BA 3KELA 3E2MA 4HYQA 1X1DA 4UE2A 1EUCB 2Z2JA 3CEAA 3NV7A 1JLHA 4ZYTA 3NNSA 3GFTA 1TLLA 3Q98A 5FL7A 1U6JA 3LDUA 3VC1A 1E2JA 5JPCA 2PPVA 1Q7RA 3FFWA 3NWBA 1EDZA 5WRFA 4QJBA 4DRYA 4YJ2B 2QN2A 4BKOA 1N6NA 4PS0A 4EJ2A 1UOPA 4GNRA 2C54A 5ES4B 1WVGA 1WUTA 1ZCAA 1OD6A 2I5PO 4DCTA 1G20E 5AXDA 3U0VA 5C1BA 3PC3A 1J9EA 1A27A 5HPYB 1JHXA 1SN7A 2VFAA 3L8CA 3JQAA 4PG7A 4U2EA 4YJ3A 4E7PA 3TLKA 2N3ZA 2QQ0A 3K1AB 4QU0A 1YASA 3HEAA 4JI0B 1QOZA 5CDFE 4LOLA 4CN9A 4V38A 4HF7A 4OGFA 1OREA 2FE4A 4A9AA 4OHFA 1OIXA 3B2QA 2R62A 4PVDA 2ZREA 2H65A 1OLSA 1OOEA 1YR3A 3T52A 2R1ZA 2QOEA 1AKEA 4EY7A 1VGVA 2OCAA 1CEXA 2Z9CA 3AHCA 3WQSB 5KYGA 5ULLA 4K9KA 3AEKA 3EUAA 2FEXA 4BFWA 2DH5A 2IXFA 2V6GA 2HDNB 3AGQA 4WXYB 3S70A 5JZVA 4JVNA 4YIHA 3ZHRA 3K8OE 4PYQA 1J56A 2Y92A 1O6CA 1O6FA 3V8NA 5ALSA 2ZEJA 3IR7A 4KN8A 3NJ8A 1CRLA 1HUQA 5BRJA 1VL1A 3TIGA 2I7XA 1WVIA 4PLVA 4RW0A 2W2LD 2W37A 1FYDA 1R4NB 4D6YA 4Q47A 1M0EA 3V7NA 2OGUA 1BX1A 4GX5A 3O9MA 3RGGA 1CJKC 1Z0FA 2C2YA 4RZQA 2PLAA 2N46A 2ZK7A 4D5GA 2UUBB 1QANA 5EUCA 1QG2A 3R6TA 3DGEC 3H11A 3GJQA 2VG8A 3E61A 1ZOPA 4JBNA 3B3GA 4R3UC 5HCIA 1PBNA 3RYIA 3IPLA 2D2XA 5FOWA 1PJLA 1TZCA 3WBKA 1M2GA 2WICA 4ETNA 1DBSA 3KTDA 3C6ZA 1XNHA 4P33A 1O6ZA 2XQJA 1V1RA 2I1VB 1U9JA 3BQMB 3H99A 2OBXA 4IDNA 3QXHA 4JJAA 3BGSA 2OFXA 5EUBA 3SSAA 4GBED 1XCGB 3DOUA 5LCXA 3QU2A 4R84A 4UC0A 4CLXA 2VF7A 4KLRA 1ODCA 4M1OA 1MRSA 1PG2A 2DECA 1U7ZA 4NBLA 4US1R 3O75A 5J3JA 4M1TA 4BVKA 3EVDA 3OU2A 1MKYA 1CY4A 1RHQA 4G85A 3V7FA 4R2IA 1VQ1A 5D87A 3KCQA 1IFXA 3QEKA 2QAGA 1RAIA 2DWPA 3H04A 3L2OB 2OK8A 1UBLS 3NAQA 4M0PA 1QHFA 1XRJA 3I37X 1H1LB 5FCDA 3AETB 5C37A 3GJ8A 3PJGA 4ZO4A 3F5DA 4GXQA 1KYIA 1L4EA 2PGXA 3OM1A 4BNDB 4MQ5A 3IQIX 1ULZA 3HQ4O 2OECA 4MHSA 2FEPA 5COQA 3WNQA 2WMDA 1GCOA 5CA1F 6ADHA 2HJHA 2PM8A 2RGAA 3AY6A 4LZJA 4PEVA 5KYYA 2Q1XA 4V0ME 1WXHA 1QHHA 3FOCA 3S28A 4ZAGA 4KOAA 2C8VA 1EX9A 2A4KA 2FXVA 1RWBA 4AMZA 1WSBA 5FBRB 4OH1A 2DPMA 1ATZA 2Q21A 1KZ4A 5CTJA 2HYIC 2JH9A 2WP0A 1Y8ZA 3H2KA 2A88A 5AWFC 1PSWA 3D64A 4PFKA 3QVMA 4Q4AB 2QJFA 1NQAO 1SQ6A 1N5IA 1LLUA 1AK9A 2AOWA 2J3MA 2NLOA 1ECGA 3AHEA 3P7MA 3QA3E 3BFXA 4KBYA 3T5BA 4A0GA 4AP5A 1QP0A 4FJ2A 1NUAA 2DBRA 1R5BA 2F6RA 4H31A 4MYUA 1L1FA 3Q8MA 3O2SB 4CKBA 1T4BA 3N86A 1T8SA 1LD3A 1RBMA 1KZ1A 2PVCA 3DF7A 1YC2A 1N2CB 1OF1A 2GLUA 1K7SN 3KLPX 4ZJZA 2VAXA 1T9CA 3QXSA 5G1OA 1KH1A 3PTAA 2ONZA 3K70C 1TFRA 2NYRA 4KWEA 1H6CA 1CFJA 3HR8A 4MSUA 4NL4H 4DMGA 1SKQA 3IDOA 5L95A 3K16A 4POOA 1YFLA 4RD1A 2HUNA 1K86A 4BN4A 3RVMA 4ARBA 1JUDA 3B2NA 4Q48A 1IEQA 3UV6A 4BQFA 1V7QA 1AGRA 3VR3A 5IVDA 1XF9A 4HJRA 4XVRA 5HZGA 2R00A 3SU8A 2D2IA 3IMEA 4K6OA 3VU8A 3JD1A 4ICIA 1N3IA 1QYIA 3N28A 5L8VA 2H92A 3OO0A 4RTRA 1NXTA 4J16C 4QSMA 1RRMA 2A30A 4V1CI 5REQA 4F2WA 1J70A 1XXHE 1E3DA 4AN1A 1HRKA 3GB9A 1V26A 3VH4A 3MJCA 3N53A 1QB7A 2QPOA 4N3GA 2C4NA 4OQDA 4CG0A 4DE5A 1Q84A 5IM4F 4B45A 4PAWA 4ZO8A 4D2IA 1UM9B 2CZGA 3VDRA 4CQLA 3AEYA 4REQA 4QG7A 2NO9A 2KPOA 3DL2A 3RHZA 3V1LA 4AG6A 1DIBA 2BSAA 5BVHB 4CQNA 3LJKA 4KEAA 4OHOA 2VJOA 1VL6A 1VKOA 1SMKA 4DLYA 2D00A 4U4AA 4UDYX 1AURA 4G8JA 4GMDA 1DKRA 1DZ3A 3IBSA 4G1CA 4QQKA 4AULA 4YT2A 1ZKMA 2EQ5A 2QZ9A 4KKXB 4OQEA 3I6YA 4WOJA 5F3DA 4K1LA 2C99A 3OICA 3UXMA 2EKZA 2R6ZA 5C51B 3KPUA 3VC2A 1V8DA 3VBEA 2A5JA 3GCXA 4LHZA 1W5EA 2AJTA 4L6AA 1AH2A 1DAPA 1I0ZA 5K8UA 2QHXA 1GFSA 2D4AA 2J3JA 3HBLA 4EJSA 3KE8A 4W1QA 5KNLA 3HB4X 2VDMB 3G2LA 1ID1A 1GY8A 3VAZA 1H0SA 3TSAA 4H18A 1BQ4A 4Q1DA 1JFVA 2DCUA 1E4EA 4YMWA 3A9SA 2ORYA 4FILA 4CW7A 2XTZA 4OEHA 5KUTA 1SC6A 3IA2A 4AVYA 1XNQB 3T5DA 4D9FA 1NUPA 1C1HA 4UNSA 1L2TA 3ZIAA 4LHWA 4Y6OA 2AEEA 1EEXB 1V11A 4FFSA 4OMCA 4NH4A 3WK7A 3JQBC 2H9AA 1E92A 4JJ7A 4XR4A 5I9LA 3MFYA 1PTJC 1OIWA 3Q5DA 4RHUA 5EHGA 5KAMA 1WO8A 1WXGA 2DKOA 3WVNA 2ILVA 1Z74A 2BV3A 2I4OA 4G0ZA 3ZGVA 4U3JB 2V3VA 3A2NA 3I64A 1XLVA 4F9TA 4HZUB 4RVSA 1JH8A 4PFQA 5ALUA 3N8KA 2OXIA 1HDXA 5FWAA 3U1TA 4CPDA 3L6RA 3AIMA 4BE7B 4D45A 4UBLA 4QX6A 1N5MA 4NCNA 4O6VA 1AKTA 2QYHA </