3WWYA

The crystal structure of d-lactate dehydrogenase from fusobacterium nucleatum subsp. nucleatum
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
333
structure length
333
Chain Sequence
QKTKIIFFDIKDYDKEFFKKYGADYNFEMTFLKVRLTEETANLTKGYDVVCGFANDNINKETIDIMAENGIKLLAMRCAGFNNVSLKDVNERFKVVRVPAYSPHAIAEYTVGLILAVNRKINKAYVRTREGNFSINGLMGIDLYEKTAGIIGTGKIGQILIKILRGFDMKVIAYDLFPNQKVADELGFEYVSLDELYANSDIISLNCPLTKDTKYMINRRSMLKMKDGVILVNTGRGMLIDSADLVEALKDKKIGAVALDVYEEEENYFFEDKSTQVIEDDILGRLLSFYNVLITSHQAYFTKEAVGAITVTTLNNIKDFVEGRPLVNEVPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-lactate dehydrogenase
publication title Allosteric D-lactate dehydrogenases from three Gram-negative bacteria
rcsb
source organism Fusobacterium nucleatum subsp. nucleatum atcc 25586
molecule tags Oxidoreductase
total genus 114
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.1.1.28: D-lactate dehydrogenase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wwyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wwyA01
2O4UX 1HRDA 1A7KA 4XGIA 4CUKA 1LLDA 4AJKA 4NFHA 3V1YA 3RBXA 1I3NA 5A04A 1P1JA 1GTMA 3CEAA 3QSGA 1DC6A 4N7RA 1FMCA 3K5PA 4R01A 4LMRA 2O23A 1PJ3A 4NBRA 4LVCA 5DT9A 1UH5A 3ANLA 3EK2A 5C7OO 1HEUA 3R3JA 4U8GA 5C37A 1IPFA 2BFAA 1SOVA 4ZICA 3H2SA 1C0PA 1JN0A 4MPDA 4WLNA 4BNYA 4CM4B 4A73A 4JX8A 5A9SA 4LISA 1P45A 4BQPA 3OJ0A 3ZWNA 4TRMA 3FR8A 1JU9A 2E4AA 2WD7B 5TF4A 1K89A 1WXDA 1Y7TA 4YVFA 1TEHA 3WDSA 1W0CA 1N2SA 2GYYA 3PWZA 1YS4A 3C7DB 3ANMA 5G0VA 3HADA 5FEUA 2J3IA 1XGKA 2BLLA 2EWMA 1W73A 2ZIZA 4HWKA 2YHUA 2GCGA 4RPGA 3FCOA 3L6DA 2J3JA 1NQTA 5T8KA 5THKA 4Y6SA 1YWGO 1T1SA 2GGSA 2XAAA 4GX5A 1Y6JA 4PZCA 3L6OO 4B4UA 3DR3A 3EZLA 1F8GA 1P1KA 3M1AA 3DOCA 4O59O 4TZTA 1PJQA 3MJSA 3OIDA 4R1SA 2I67A 3H9UA 4J4TA 2A94A 3JYLA 1GAEO 1PQWA 4XIYA 5EERA 4TRRA 2R00A 4CM3A 4YJHB 3I83A 4J90A 4WCDA 4I5GA 1Q7GA 1N9GB 1E7WA 1BW9B 1NR1A 3AJRA 1E7SA 1SC6A 5KVVA 3HZZA 1I2CA 3KSDO 4J1SA 5G4KA 4ZQFA 3B20A 3JQGB 1SPXA 4IMRA 4ALJA 1V35A 3OECA 1EFLA 1LUAA 3JQ9C 1I3LA 2EXXA 1GZ6A 1P74A 3LT2A 1WZIA 2PY6A 2XXJA 3L4BA 3KYBA 1NASA 1D8AA 4MVJM 4CM9A 5TJ9A 1QLJA 4H3VA 3ZWMA 4OXKA 2UVDA 1U3UA 1I30A 4EW6A 2DTDA 3PYLA 3WGYA 4OYRA 3CZRA 1PQPA 1F17A 1U4SA 1V6AA 4NI5A 4QQRA 1NHGA 4BKPA 3DL2A 3JQEA 1XR3A 2VZ9A 3QV1A 4G65A 4K26A 2X0NA 1SAYA 2FZEA 4AJ4A 4OM8A 1YDEA 2J3KA 3GY0A 3ZNPA 2GRAA 3I5MA 2I76A 1EMDA 3ROMA 3PDUA 4RL6A 4E6PA 3DBVO 4H16A 4CM6A 5CDSA 4CMHA 4CV2A 4LRSB 3ZWOA 1ADBA 2J5QA 1SBYA 1WDKA 2IYPA 4FFPA 4FOOA 4NMHA 1XQ1A 1OC2A 4WECA 3KYCB 1VSVA 5IZCA 3A28A 4TVBA 3ZCXA 3QWHA 5T6BA 1E3EA 2GN6A 4I8XA 5JXWA 4HXYA 2Y0DA 3IKTA 1GADO 1I36A 1LDNA 2JJYA 1Y8RA 4A10A 2IEDA 5BT9A 1HKUA 2HMUA 2CY0A 4RDIA 3BTSA 1RJWA 3FN4A 2HK9A 5A4DA 3IC5A 3PRJA 1QRRA 5B4UA 4PLCA 3U09A 4YYZA 3HG7A 3WB9A 1SZJG 4P4NA 1TT7A 3VZRA 4RZHA 4JIGA 3WFJA 3DBLA 1ORRA 1HE3A 3U5TA 2YY7A 3WGTA 2DPHA 4AJOA 1LX6A 3ZU3A 4GMFA 1F06A 3GGOA 4IS3A 1GPJA 3RWBA 3Q3CA 4OQYA 3STHA 3WSVA 5CFZA 1AE1A 4GL4A 1NHWA 4A27A 3H3FA 1KIFA 1DRWA 3ULKA 3D64A 4J7XA 1N8KA 5CHEA 1DLJA 3TZCA 2AW5A 4KP7A 4A0SA 1ADCA 2CVZA 2QYTA 5ILGA 3JQFC 5IDYA 1CQIA 1K2WA 4RPKA 2O2YA 3RUIA 3GF4A 1I2BA 5JS6A 5KCZA 2Y05A 5B1YA 3H4VA 1E6WA 3PWSA 1LLUA 3QA9A 4Z3DA 4Y6PA 3ROKA 3W1VA 5KTKA 5JY1A 3FNFA 4HNHA 1EZ4A 2WWRA 5B12A 4WOKA 5EINA 1YJ8A 4FFRA 2HDHA 4TKMA 1EDOA 1HETA 1XIVA 3NTQA 2TMDA 5THQA 7MDHA 5A9TA 1HZZA 3PYMA 3QLJA 1ZXLA 1CIVA 1NX6A 1LDMA 2PNFA 3EUWA 3CXRA 2NQTA 1MB4A 2BGKA 1Q1NA 4BNWA 4BNGA 2W2KA 4K28A 2VWGA 2OP0A 2ZB7A 1D7OA 2C5AA 3FNGA 2Q99A 1T4BA 1WMAA 2FY8A 1EBFA 4E5PA 4A5OA 4XR9A 4JP3A 3C3XA 4DLAA 3PZBA 1GV0A 3WNQA 3G79A 1RM5A 1ZSVA 4DPKA 4NK4A 2AQIA 4RQTA 3C8MA 1XLTA 1PGPA 2VHYA 4DVJA 1E1NA 4OJNA 2Q2VA 4QFCA 1MLDA 1O6ZA 3GVIA 4IPTA 4NH4A 2Z95A 3BMNB 4OHUA 1YGYA 5A1TA 5JC1A 2NSDA 4BB6A 4CMGA 3EVNA 2I3GA 2RAFA 1DFHA 4PG6A 4XYEA 3MOGA 4W9NA 2EP7A 3NGXA 4B7XA 4I9HA 2V6FA 3WGOA 3JSAA 1CEQA 5MGBA 4ALKA 2P9EA 5B4VA 4Z3KA 5F5NA 4TQGA 4PN3A 1X14A 3OEWA 3K31A 1H9BA 1E6UA 1PGNA 3IP1A 3LVFO 4BB5A 4BUCA 1HE5A 3HE3A 1K5HA 4ND4A 4CR6A 3M1LA 1A7AA 4HNGA 3CE6A 1PJTA 1HDGO 1XU7A 3RFTA 3PIIA 4UEKA 2VUTA 2EW2A 2B4RO 2CVQA 4JROA 1CWUA 4HFMA 3WR5A 1R0SA 3PZRA 3R3SA 5L51A 4W7IA 2FWMX 1GEEA 4TROA 1BXZA 2X58A 1NPTO 3JQ7A 5BSHA 2IXAA 2DLDA 1FDVA 2YJZA 4MDHA 2O3SA 4BKOA 2VYND 4QTZA 1H0KA 3AU9A 3QWAA 4ALNA 1D1TA 2AA3A 1HE2A 3Q0EA 3T4EA 3BXXA 3WSWA 2VNAA 1HYHA 3IQDB 4ALIA 4PLTA 1E3JA 1I33A 4IQ0A 4UVHA 2Y66A 4EUEA 2G82A 4OXNA 1Z73A 4TZKA 3L9WA 3G17A 4XD2A 4IDCA 3C85A 3NTRA 4NHEA 3RU7A 2P4QA 2VRCD 4YBZA 2C82A 3O8QA 3RCBA 4CPDA 1LNQA 1EK5A 5TC4A 4BOYA 3FSRA 3TF5A 1M75A 3TFOA 5EESA 4L9RA 1UJMA 2VRBA 2E6UX 1UDAA 3KRTA 2IDZA 4NBTA 1Q7CA 1C0IA 3QIVA 2C0CA 4BMVA 5BSGA 2DUWA 1Q0LA 3KHUA 1ZBQA 3EAGA 2GZ1A 3VVBA 2HK8A 5I9LA 3LK7A 5A9SB 5A3JA 2NWQA 4UVIA 4AJNA 4ZJUA 1LTHR 4CM4A 2OP1A 5TRTA 2EKQA 2O50A 3C1TA 4TSKA 3P19A 2X5JO 4CLDA 3GDFA 1U3TA 3DWFA 2ZJ0A 2GERA 3V2HA 4B7CA 4E5YA 2XXBA 4XCVA 1YL6A 2J5KA 4MIOA 4IM7A 3WWYA 4L4XA 4BO2A 1R66A 1DBVO 3AM4A 3KLMX 4B8ZA 4NIMA 2O2SA 3AUUA 1JAXA 1IUKA 3O4RA 3X2FA 1B26A 1LRJA 2FR0A 5KOIA 3FPLA 3JQCA 4HV4A 1JAYA 4XJSA 4GSLA 2QG4A 5EQDA 1VJ1A 4YJDA 2FOIA 1DEHA 3H8VA 2JFFA 3UFXA 2A9FA 1OZAA 1RKXA 3ZWXA 4MKZA 5KVCA 3KETA 4ZQHA 1BWSA 2DFVA 3OF2A 4QX6A 5T64A 2HO5A 3GPDG 2Q4EA 1M67A 4YJHA 4BGVA 1PQUA 1TVEA 1W6UA 4GPD1 5ILOA 5G4KB 1WWKA 1B3RA 3O26A 1T2CA 1H6DA 4RF3A 4HFRA 5L4LA 4MP3A 4MVJG 2O3QA 2YDYA 1U5CA 1YRLA 5A06A 2OZPA 1KVUA 5F1KA 3QVXA 1ULUA 1JTVA 2HQ1A 5JYEA 3I52A 3DBRA 3RD5A 1T2AA 3O38A 1EVJA 1MC4A 3DZBA 3JYNA 3W8EA 2CSUA 2JD2A 1LSJA 1ULSA 4NK5A 5BSFA 4P4LA 2PKQP 3PWKA 4YT8A 1EEHA 1ZK1A 1U5AA 4MKXA 3VOSA 3GVPA 3FRJA 2XOXA 2P5YA 3PJFA 1QV7A 2AXQA 2GN8A 3E03A 5CDUA 1YQGA 2IZ0A 3RUCA 3A06A 3RQSA 1E77A 2AE1A 2QQ5A 5TSDA 1SEPA 1I3KA 3TOXA 1B7GO 1SB9A 4II3A 2IYOA 2NUAA 3T7CA 3QWFA 1BGVA 3PHLA 3ZZNA 3TZ6A 4D3DA 2GF2A 5DCUA 1YB4A 1P1FA 4I5EA 4WOJA 2E48A 4II2A 4DMLA 3NJ4A 4FSHA 4RPJA 2C07A 3PHJA 1Y8RB 4Z0PA 4DBVO 5IAAA 2R2GA 1WZEA 5GZ1A 5JDIA 1IHYA 1UZLA 4YB8A 1QSGA 2Y1EA 4R3WA 4XGKA 1GDHA 3OA2A 1ZO8A 2RH4A 2Y93A 4QO8A 4K6FA 1VL8A 4KQXA 3DMYA 5TT1A 5K0ZA 3LYLA 1MP0A 4R9SA 3IKVA 3S2EA 3DBLB 4WJZA 3NJ8A 3VPHA 1A9ZA 4DPMA 1YL7A 3JD0A 5B37A 4GX0A 3NTOA 1IB6A 3UH1A 1VJTA 2PLAA 4BIIA 3BA1A 1GFSA 1ADFA 1PS8A 2GN9A 3F9IA 4URFA 4GLLA 1JKFA 3Q6IA 4AJLA 4FC7A 2JAHA 2NTNA 2QRLA 3GZ4A 1U8FO 4GWKA 3RIHA 1V0JA 4EDFA 4BGEA 4YWJA 1KOLA 4HBGA 4B79A 4L74A 4Z9XA 3WQQA 2XF8A 5IZCC 4EUFA 3PVZA 1B2LA 1E7YA 3AU8A 5JBIA 5G2OA 4W4TA 3W4JA 4AJJA 2DTEA 1CYDA 1X0XA 2BHLA 2CF6A 2HRBA 3C1AA 2QHXA 3WJAA 3VC7A 5K9ZA 3NKLA 1SB8A 2WE7A 3ZH2A 4ZGWA 2C2XA 3TL3A 1E1MA 4UEJA 1LDBA 1XU9A 1PL6A 1VLLA 3UCXA 4DC1A 2X9NA 3CTMA 3HSKA 3H2ZA 2D5AA 4IJWA 2X1HA 3GNSA 3A1NA 3TZQA 4YAJA 3AY3A 4DLLA 2P91A 1IZ9A 1WNTA 1OAAA 2OOSA 3HFGA 4ESOA 1P77A 1YDWA 1K0UA 3GHYA 3GVXA 1NBOA 3ON5A 2J8ZA 2W2KB 4XDYA 3GMSA 4WPGA 4EZBA 3GG2A 3OJLA 1LLQA 2TMGA 4C7KA 2D5CA 4PVCA 5F1OA 2NU6A 1B8PA 2EEZA 3A14A 4CL3A 3HNPA 1V9LA 2JFGA 3G1UA 1R4NA 2CFCA 3VAZA 3HJAA 3G3EA 1EVIA 1YONA 4ILKA 3U49A 4YT2A 2C59A 4IUYA 2FPPA 3L9XA 1AGNA 1ZIDA 4IDBA 2CNBA 2V6BA 4BNJA 3R6DA 4EEZA 1QG6A 3WLEA 2NM0A 1UR5A 1DDOA 2X23A 3MJVA 4JN6B 1Z6ZA 2G0TA 3ONEA 4B3IA 1P1RA 3GDOA 1QMGA 4ND2A 3RKUA 3COSA 2A35A 1PGOA 4BNTA 2P9GA 3LZ6A 5A5FA 3QRWA 1G1AA 3DZKA 2XPCA 4R5HA 4GVXA 1UZNA 3OMLA 4PLGA 5JAMA 3FWNA 4TRNA 4NG5A 2IXBA 4R9RA 4FJ2A 3X2EA 4KTVE 3CZMA 1GCUA 3CIFA 2WYVA 1MXFA 5COQA 4B7UA 2OMEA 4PLWA 2Z1NA 3ZHXA 3RBZA 3IUPA 3SLKA 1QKIA 3L6EA 4WLUA 2HJRA 4G2NA 4J1QA 2YV3A 5TX7A 1SNYA 4CM7A 2VT3A 4FPXA 5DOZA 4I5FA 1FXSA 3D5QA 3F4BA 3JQ7B 3A4VA 1U7TA 3U62A 4RDHA 3ETDA 2W2LA 2ZK7A 3V2UA 1NFQA 2QZZA 3E6AA 3M2PA 3RUHA 3PLRA 1RM4A 1LRKA 1NTOA 3PQDA 4W82A 1TLTA 1T2FA 4GX2A 2QW8A 2X0RA 4D43A 1LDEA 5A9RA 4RZIA 1UXIA 5TT0A 1W8DA 1VSUA 2PTGA 1YQDA 3EMKA 1L7DA 3PGXA 5DCYA 4J6FA 4E5MA 1PZEA 3P5SA 3BTVA 4FOSA 3WYBA 3NDRA 4Q3EA 4ZD6A 3O8QB 2H63A 4F6LA 4YPOA 4MVJH 4IMPA 4R3NA 1L7EA 4MJLA 3TJRA 2Y1DA 4WGGA 1KEWA 1LQUA 1CDOA 2C7GA 4GVLA 3W6UA 1DFIA 4M8SA 3RU9A 4R68A 2C29D 3PP8A 3QVWA 3U0BA 5A5EA 2QRJA 4FIZA 2VOJA 1XELA 3S2GA 2CZCA 4GQAA 2VUSA 1DOHA 3DBHA 2C7VA 5U4QA 1YBAA 4KDFA 1ISIA 3NX4A 4DTIA 4K6CA 3AFMA 2UAGA 3WLFA 1WMBA 3DHEA 4GLOA 1K6IA 4HADA 2G17A 4BO9A 4OOFA 3WICA 1PWZA 3G1TA 3KSUA 3E5MA 4E13A 1N7HA 2HMSA 3GAZA 5F5LA 1PL8A 3DQPA 5KVSA 3DEYX 4GX1A 1X0VA 4RVGA 1EE2A 1EVZA 2AE2A 2BI7A 4J1NA 3JQBA 1NFRA 3JYQA 3RBVA 2IRWA 3F47A 1YO6A 4FGSA 1NQAO 2HUNA 1M2WA 4PZDA 2VN8A 2OFPA 1DRVA 3GNTA 4MVJE 1E5LA 4UREA 4Y67A 2B83A 4NU5A 4IDDA 3UGKA 2PGDA 3RKRA 4FW8A 4I08A 2VYVD 4DGSA 5JW6A 1T24A 5L4NA 2UUOA 3NV9A 4F46A 3GMDA 3U4DA 2O4CA 1GD1O 2D1YA 3OH8A 3ZU2A 4OKIA 4YT4A 3MJCA 1BXKA 4P8RA 1M6HA 1X15A 3WG9A 2AQKA 4CUJA 3D1LA 4BVAA 3RUEA 2V6MA 4R54A 4RF5A 2NVWA 4WK6A 5COBA 4ONEA 4QFDA 5COAA 5CEFA 2JD0A 3R1IA 4MOWA 3WGHA 5ICMA 2G76A 4XJTA 3AUAA 5TIIA 2Q1SA 2X5OA 1Q0QA 3DZGA 3I23A 4IXTA 4PLFA 3BZUA 1PJLA 3DBRB 4U7WA 1E7MA 1ZNQO 4ZQBA 4PZEA 4J2HA 2VHVA 1NWCA 2AHRA 3EY4A 3DOJA 3ICPA 3EC7A 4PLYA 3GRKA 2O7SA 1UP7A 5U1PA 2J3HA 3L4SO 4J4HA 4HY3A 4Y98A 4Z0HO 2VWHA 1HDCA 1FK8A 3DZFA 4JCOA 4B3JA 1DIGA 1M6WA 3RJ9A 2WJPA 3UKOA 4DLBA 3I1JA 2PD3A 4MVJP 4XGNA 3IL2A 3IJRA 1W4ZA 4K9DA 4L75A 3N7UA 4YCAA 3WGGA 2Y68A 4CLRA 2OBNA 2POQX 3GOHA 3O03A 2B36A 3PHIA 2VUUA 3M2TA 2HMWA 2I6TA 4UEOA 4XYMA 4YDRA 1Q0HA 3AOGA 5H81A 3GZNA 2ZJ1A 1OI7A 5DNAA 4CLEA 3AY6A 3ZWYA 3OA0A 4AJHA 1IPEA 4W7HA 3ZU5A 1A5ZA 1BVRA 4GSKA 4WLEA 5L9AA 4R41A 4R5MA 4D0RA 3H5AA 1HTBA 1MG5A 2P9CA 1XQ6A 1GUZA 3AFNA 1MA0A 2Q2QA 1R12A 4PCVA 3SC4A 4A26A 4BNMA 4PGFA 4CQMA 2ZYAA 4N5LA 3CUKA 2OO5A 3RC9A 3ZV4A 5CPFA 3KYDA 1ISFA 5T5QA 1C1XA 3I4CA 4DBZA 3LLSA 1WP4A 1P1IA 4HUJA 1NM5A 1AXEA 4JBIA 3RC7A 3VPXA 1H94A 1O94A 3ZU4A 1F8FA 3AK4A 5H82A 1HE4A 3E18A 3SXPA 4IXWA 3VH3A 1BG6A 2HAEA 3K2EA 3QE3A 3ZHBA 4FFOA 3ZHYA 3ZNOA 4F45A 1NNUA 4WEOA 3TN7A 4ZQEA 1PX0A 3GN1A 2YQ4A 2GO1A 1YE3A 1HDXA 3B6ZA 3KEQA 4CMKA 5ITWA 2VHZA 2O3TA 3JD1A 1RYEA 5EJ2A 3KZVA 1B0AA 4BO7A 3DDNA 3RROA 3GGGA 5I9MA 3WTBA 4DYVA 5JLAA 3NT5A 2AQ8A 5JCJA 1DJQA 2Z1MA 4FFLA 5CEEA 2H9IA 1B14A 2FSSA 2VZ0A 1PWXA 3U4IA 4PRKA 1IYZA 3D5TA 3ENKA 2QX7A 1I2ZA 1Z7EA 3KVOA 3M6IA 4XQEA 4BL5A 1BXGA 2W4QA 3C7AA 3WGZA 1QORA 2GSDA 2OXIA 1HSZA 1GL3A 3ETEA 2BMAA 3MWDB 3Q9NA 3AM5A 4PG7A 4EBFA 1EVYA 3R0IA 4GAEA 4KOAA 1B16A 4CMIA 5KNLA 4F3YA 2VQ3A 4CM9D 2Q2WA 4PFJA 3ZWAA 2VCYA 3UN1A 5G4LA 2V7PA 2VWPA 4WUVA 5ER9A 2YQ5A 2Q50A 4YEDA 2JL1A 2NADA 2OBYA 1SOWA 1R4NB 5EPOA 3FD8A 5HS6A 1VPDA 1C3VA 4NU6A 1I32A 4XA8A 1B3BA 3VPSA 4BNXA 1HXHA 1RPNA 2P2SA 2JKVA 1GR0A 1XCBA 4WASA 1ENYA 4ZRNA 4D0SA 4XX0A 1LC3A 1EUZA 4M54A 5LDHA 5CAEA 1HYGA 1JVBA 3LT1A 5G0TA 3DAPA 1T1RA 1WPQA 2EERA 1KEPA 5I8WA 3GT0A 4BNNA 4RJTA 4IDEA 3PYXA 1QR6A 2GDZA 1Y8QA 1PJSA 1X7DA 2Y1GA 5IXSA 2A92A 2NVBA 3BTOA 5A3VA 2VOEA 1QYCA 5TJHA 3VKUA 3JQAA 4TWRA 3V2GA 2EJWA 1Z75A 1GZ3A 3ORFA 3QWBA 4O5OA 1ML3A 2EKPA 2DAPA 2ZYGA 1HDOA 5LDGA 4NDNE 2V6GA 1NQ5A 3H9EO 3GA0A 2B5WA 4UUOA 4BO5A 1UXJA 3PQEA 5MDHA 2I99A 3IMFA 1QV6A 1ENOA 2VNSA 1XHLA 3KO8A 2FHSA 1J5PA 2NLOA 2YW9A 1YBVA 5F3RA 1UUFA 3EVTA 4M49A 3OJEA 3B1KA 4QEDA 4L76A 2EGHA 3DMTC 4KQWA 1O89A 1SEVA 1BMDA 1GEGA 3PFWO 4BO4A 3BHJA 2EV9A 4ND1A 2WEKA 3HN2A 3OJOA 2V65A 3NDIA 2VTDA 5BNFA 4I9UA 5L7YA 1KVSA 1NYTA 4PG5A 1DAPA 3UOGA 1G0OA 3DHNA 3PDJA 4YACA 4BNHA 4NFYA 4B3HA 1LU9A 2VT2A 5JFOA 1IHXA 2DM6A 4XYBA 3EW7A 4S3MA 1WVGA 3SEFA 2AEMA 4DXHA 1WDLA 5B4TA 2BRUA 1LBEA 3BYZA 4X54A 3INRA 3E8XA 3ADOA 1HDZA 1L1FA 4D42A 4BO8A 4U6SA 1PJ2A 5T57A 4Y8VA 5DP2A 3E48A 3EHEA 1VJ0A 3F1KA 1F12A 1N92A 1DC3A 1GUFA 1DC4A 2UV8A 3GFBA 4CV0A 5F1PA 3GUCA 3OJFA 1ADGA 2IE0A 2O3RA 3DBHB 3PXXA 4IS2A 4NR0A 1DIHA 4C4OA 4J7UA 5IFLA 1MFZA 1YB5A 1ZJYA 3ADPA 4NJMA 1X1TA 4XRGA 1O8CA 3ANNA 4IIVA 1NQOA 4MVJI 9LDTA 4HX5A 4G5HA 4KWIA 4OIMA 3W6ZA 6ADHA 3KB6A 1IZ0A 5CDGA 3VTZA 4Q3DA 4ALLA 1ZXBA 2AQHA 1ZK4A 1ZMOA 5DCWA 1MV8A 5DP1A 3V8BA 1ISHA 4UVGA 1Q7BA 1MC5A 2VHWA 1HL3A 5GY7A 1EQ2A 1KVQA 4YJGA 3LT4A 4CV3A 1BSVA 4MINA 3VTFA 3GVCA 1YKFA 3ZHZA 5AXCA 2EJVA 3JQ9A 2ZQZA 3OICA 2GNAA 4CV1A 1RM0A 1GPDG 3NYWA 3VH4A 4CM8A 3SJUA 2VWQA 3IAHA 2GPTA 4L0QA 3PK0A 3WGQA 1YB1A 5HS4A 4Q3CA 2A4KA 1I5RA 4E0BA 1IY8A 1PGQA 3TOZA 2J5RA 1R0KA 3TWOA 3GFGA 4WNIA 1Y5RA 2DT5A 5HBRA 4EYEA 6LDHA 1MGOA 2Q1TA 4L8VA 1QP8A 4B8WA 5KJFA 3NT4A 3BMOA 3W8FA 3FI9A 4IDGA 2CDAA 1BTOA 3RFXA 3AUTA 1U1IA 4CQLA 1E1KA 3AUSA 3NAQA 1JVSA 1H6AA 4IBOA 2UDPA 3TRIA 4JJGA 3S8MA 4BNLA 3KTDA 3VKVA 4EGFA 5AQ1A 3TQHA 2I3AA 1H5QA 2B35A 2QRKA 5DZSA 1HZJA 4JXKA 1Z82A 5DULA 1B8UA 1T26A 2ZYDA 4M86A 4ZU3A 2FN7A 2W8ZA 4O1MA 2X22A 4Y6RA 2CVOA 1P1HA 4QT0A 4FB5A 2YFHA 1MFPA 5KWEA 2F1KA 2O3UA 3FR7A 4XDZA 1N1GA 1EQUA 4WLVA 4UAGA 1ZSYA 5T67A 1E3SA 4YRDA 1CF2O 2C20A 4ZA2A 3QVTA 2GUGA 1NXQA 3PGJA 3LC2O 5T8KC 3INTA 4CLRB 2C2YA 5K6AA 2YYYA 3GH3A 1I01A 3GZNB 5DN9A 1N5DA 2R00C 4BO0A 1GY8A 3JD3A 5L45A 4CM1A 4YAGA 2NVUB 3E1KA 2Q3EA 4RGBA 4E3ZA 1JDJA 4OXYA 4XR4A 4UUNA 4CR8A 1DFGA 5IXYA 1EE9A 3QJ5A 3IS3A 4IQGA 3B1FA 1BDMA 5JCXA 1LDGA 4L4RA 3WWZA 3UW3A 4BNVA 2YUTA 1R37A 3L4BC 4Q3NA 5BNIA 1TXGA 4WKGA 4CQMB 3AI1A 4CLOA 1ZJZA 4I1IA 1MUUA 3KYDB 1VRWA 4HP8A 4Q3BA 3JQ8A 3JQFA 1C1XB 3VZPA 1DO8A 4RORA 1LSUA 4IZHA 1AXGA 5ENDA 1E5QA 1PZGA 2F00A 2PWZA 1VI2A 3AI3A 3E9QA 3MWEB 5IDXA 4OSOA 2W98A 4CLXA 1LSOA 1DLIA 4FJ0A 5JO9A 1R6DA 4PLZA 1LI4A 3JYOA 3N74A 3B1JA 4DWVA 3WIEA 2BGLA 4Z6KA 3TSCA 1LDYA 4ZQGA 3RC1A 3U4HA 2ZCVA 3EZYA 3AY7A 3DAGA 4UUMA 5FF9A 2B5VA 1GQYA 3WBFA 2X7HA 4G81A 2EKLA 4J0FA 1NFFA 3Q1LA 4LN1A 2PV7A 3DZIA 1F14A 3IDSA 4FD3A 4ROSA 2FPIA 1XYGA 2YFQA 3FPCA 4GGPA 5TQVA 1N7GA 5DDIP 4LSWA 4I5DA 3DHYA 3UUWA 1BXGB 4MVJA 4XB2A 4U6QA 1C0LA 4EEXA 2NTVA 1ENPA 2EW8A 2Z5LA 4IJVA 4MO2A 2DQ4A 4DQVA 4M55A 4TMFA 1Y1PA 1FDUA 4CMIB 3GG9A 3PJEA 3DFUA 3QW2A 3BIOA 3JCZA 3MJTA 1GQQA 1YOVA 2HJSA 4UVDA 3FBGA 4AFNA 4O6VA 4CMCA 2YDXA 4XQ9A 5AXAA 3BHMA 1ZSNA 1X7HA 2H6EA 4DA9A 2P68A 3U9LA 5EL0A 3SLGA 3UCFA 3OBBA 4TRJA 5EIOA 1I24A 1PL7A 1E92A 2CF5A 1DXYA 1NPYA 4MKRA 4BS9A 4R4JA 1PJCA 5GMOA 4D7AA 4KUEA 3D3WA 2NACA 1M76A 5JAQA 1U4OA 3F6YA 3ONFA 3F5QA 1J0XO 3I9OA 4O0LA 2WYUA 3ZWCA 3E9NA 4CR7A 1KEUA 2X9VA 1ID1A 4WCFA 3ZWBA 5ENVA 4ZVVA 2PZKA 2B69A 1I8TA 1WLYA 1NP3A 1Y8QB 5IDQA 4AJEA 1U28A 1A4UA 1VM6A 3I9MA 4BO1A 1HYEA 3K2BA 1KC3A 3JQAB 4DQXA 4DRYA 4D45A 4XQGA 3E5RA 2E82A 1PTJA 1H9AA 4FQ8A 4XYLA 3I4FA 2OORA 1ONNA 3FBTA 3K6JA 1C14A 2NTJA 4YTEA 4IJUA 2PKQO 4GMGA 5HTOA 3KM0A 1PJ4A 4PIVA 2Y1FA 2JHGA 1JA9A 4FBGA 1VL0A 2Y67A 3UF0A 1U9JA 2JCXA 4B4WA 1BDBA 3ZDFA 2FZWA 2BH9A 4LVUA 1IL0A 2PD4A 3WYEA 3FF4A 5L95A 2DC1A 3KEOA 2HK7A 3WIDA 2FR8A 3I6IA 2WMDA 1ZEJA 2JHFA 5FYDA 3KXDA 3RAJA 4ALMA 3AOEA 4OGWA 1YVEI 3B70A 3JQ6A 3ZV6A 4M89A 3Q11A 2ZTUA 3L0DA 4N54A 1AHHA 2PGJA 3D0OA 2E37A 3H9QA 3K9QO 1GQ2A 4J7CA 5IF3A 2ZB4A 3UCEA 5BSEA 5ICSA 1QLHA 3H9JA 3PLNA 1VE9A 2Q45A 2EHDA 4INAA 3QVSA 4LGVA 1H6CA 3H3JA 2Y0EA 4W9NC 3MZ0A 4OL9A 2HCTA 1UXHA 2GD1O 3OETA 3OQ1A 4JQCA 4E21A 1PS0A 2YV2A 4WLFA 1ARZA 3ICCA 5HM8A 4RVUA 3DTTA 2X4GA 1RWBA 1PEDA 2ET6A 1DPGA 4J16A 4DIFA 2G5CA 4DMMA 4F6CA 1FF9A 1C0KA 3HDHA 1GV1A 5CDYA 4BKUA 1P33A 4NJMB 3E82A 3SX2A 3P7MA 2I9PA 3JD2A 3OM9A 4NNJA 2WD8A 1SMKA 3GAFA 3NT2A 5A03A 5JAIA 1H6BA 1ZZEA 2I65A 4EJMA 1V3VA 3DAFA 4DIBA 2ZTLA 3KBOA 3ROQA 4YAEA 5I9NA 1OFGA 5L3ZA 4D79A 4YQYA 3IUSA 4R1NA 4YJGB 3HDJA 5I7VA 3OHSX 2NQ8A 2PA3A 2JFHA 5BR7A 3DFZA 3WMWA 3LT0A 4OOEA 3DOOA 5KVQA 8ADHA 3WGIA 3DXFA 3HDQA 3LSYA 4GI2A 1A27A 1OBFO 2VHXA 4GGOA 4RF4A 3WTCA 3BAZA 4CM8B 1UZMA 4FS3A 2GLXA 1ZEMA 1DAOA 2B4TO 2ZQYA 2DTXA 3ENNA 4XYGA 3VDRA 5JNLA 3NUGA 1U3WA 2FR1A 1A71A 3GDGA 4TVOA 5CG2A 3ITKA 4E2XA 1XWFA 1DC5A 3GGPA 3BMOB 1C1DA 1G0NA 2X9GA 1O5IA 3SJ7A 3HN7A 4YJFA 3ZW8A 5JY6A 2DBZA 3P2YA 2GN4A 1LSSA 3GK3A 4CQLB 4J4BA 4W99A 5G0UA 3QWIA 4BMNA 1EBUA 3EYWA 4IGFA 5AVOA 3SBOA 4E2ZA 4D3SA 5JDCA 3H65A 3CMMA 4EJ6A 4NZ9A 3CPSA 4OQZA 1ONOA 5I7SA 1ONPA 3JD4A 4LMPA 1A9YA 4AVYA 1UAGA 2H1SA 3LC7O 5KJ1A 3VHRA 4B4VA 1E0DA 2O3JA 1SO8A 2BF7A 1UP4A 4KDEA 5GZ6A 1WAMA 4YA6A 4E2YA 4OO3A 3QY9A 1OMOA 5JMWA 2QIOA 1K6JA 4MIEA 5DF1A 1KY5A 1UXKA 4PRLA 2PH5A 2W2LD 3QQPA 1U3VA 4P38A 4R69A 4RLHA 1DB3A 5TGDA 5JE8A 1QYXA 3BMCB 5I7FA 1R16A 1HF3A 1O95A 3KSZO 4FDAA 4L4SA 4PLHA 5KJ6A 1VL6A 4IINA 3WXBA 3ASUA 2GZ3A 4RQUA 5JAZA 4FJ1A 9LDBA 3ZWVA 1BRMA 4D41A 3PHGA 3U3XA 1NPDA 1FDWA 3GEGA 5EQFA 3TL2A 2ZKLA 2RHCA 2NVUA 4P22A 1DSSG 5TS3A 1EDZA 1UP6A 3W4KA 3WQRA 3VDQA 3D4OA 5CP8A 4Z9YA 2YHIA 4JBHA 2YV1A 5IZ4A 2CDBA 3VH2A 2PGLA 4CLOB 3KUXA 1NVGA 1BVUA 1D1SA 4UVEA 5KKAA 4J91A 1T25A 3JQ8B 3I6QA 5A05A 3MJ4A 4QXMA 4Q39A 1T2DA 3ZV3A 4BMSA 4OKNA 3OIGA 1LQTA 5TLSA 2ZATA 2OUIA 3OQBA 1ISJA 4FR5A 5DBIA 5IN4A 2CDCA 1ISMA 2JD1A 3IJPA 1CRWG 1TA4A 2FPGA 4GBJA 1MG0A 3WMXA 5JSFA 2ILTA 4AG3A 2WTBA 4N5MA 3FWZA 4CMEA 5ITVA 2IZ1A 3RASA 4IIUA 3RI3A 2LDBA 4XB1A 1GYPA 4J9VA 3GN2A 1AUPA 3DZJA 3V1TC 1T2EA 1P31A 1E1LA 2DKNA 1QYWA 3GPIA 1CJCA 5K6AC 2C5EA 1PZHA 3WOHA 2NV6A 4IGEA 3GEMA 4J43A 1OOEA 3D4PA 4YRBA 1TT5A 3VVCA 4LCJA 2FP4A 4W6ZA 3GUYA 3ASVA 1Z45A 1JWBB 4DC0A 1K6XA 3L07A 3WNVA 4BQRA 4CUZA 5IG2A 1DHRA 3FTNA 4YR9A 4ZN6A 3RSHA 3F5SA 4ID9A 2VYNA 1VC2A 5JDIC 4RPHA 2DBRA 1P9LA 2WSBA 3SC6A 4LRTB 4BHTA 2CMDA 2AEJA 2DPGA 3ROPA 1CERA 3F3SA 1J6UA 1GUYA 1PJBA 2LDXA 2ZB3A 1YOVB 1ZFNA 3EGOA 2HMTA 2YZ7A 4KTTE 4ITUA 2FRDA 1P0FA 3RUAA 4A2CA 1Q2XA 1I10A 4LCEA 4LK3A 4UULA 2VRCA 4FGWA 1M66A 2JCVA 1TB4A 3PI7A 3GEDA 2J6IA 3OIFA 2HRZA 5A02A 3D3EA 1ZMTA 2ZTMA 3DB2A 4GWGA 5I8ZA 3AWDA 3INGA 4H7PA 2PK3A 1GZ4A 1X13A 4DIOA 1ZVMA 2QYSA 4P4GA 4BV8A 1H2BA 3KLPX 4DQUA 3GHHA 3O9ZA 3VZSA 5JYDA 5BQFA 3LF1A 3NDJA 4A7PA 3S2FA 4OAQA 1HLPA 4L73A 5KJCA 2HSDA 3D3WB 1HLDA 2B37A 1D3AA 2D0IA 5ER6A 3IP3A 5AOVA 4WCFB 2BFMA 2BI8A 4H15A 3VZQA 3WYCA 4DYDA 1FJHA 4FFMA 2D4AA 3BTUA 4CMAA 3HB4X 1NAHA 3K73O 1HSOA 4JGBA 4R51A 1DIBA 3H7AA 3GVHA 4DUPA 4CODB 1R4MA 2NU8A 1GYQA 2IEBA 3Q2IA 3I9JA 5JMPA 4PG8A 2Q4BA 5CG1A 3PJDA 2H5LA 2HKIA 1MX3A 4PLPA 4KMSA 1QYVA 4E2WA 3D4NA 4R1UA 1NWHA 1HT0A 5FI5A 1N1EA 4AJ2A 4KWHA 2BELA 2IODA 1FDTA 3ETGA 2CD9A 3S1LA 4EITA 3AI2A 4QUKA 1JLLA 3DTYA 3I9NA 4YRAA 2X0JA 4KZPA 1NR7A 3SVTA 4CQMD 2HU2A 4RVSA 4WE3A 3FNHA 4AL4A 1V8BA 3PHHA 4QECA 3PQFA 3ZWPA 1NVMB 4RVFA 2EP5A 5H83A 4TKLA 1KS9A 2X0IA 4NJOA 3F4LA 4JK3A 4M1QA 3ZV5A 3FHLA 3JV7A 3K96A 1BHSA 4DL9A 2PZJA 3VH1A 1UDBA 3TFQA 3UICA 5I7EA 4E5NA 3IOYA 4IDAA 1S6YA 1DJNA 1WW8A 4RO0A 3T7EA 3MEQA 5FFFA 4U0KA 3H5RA 4NBWA 1ISGA 3GNQA 3I9KA 3LLVA 3K8ZA 4RCVA 1E3WA 2DVMA 2B0JA 4WNCA 3ABIA 1K3TA 3H5NA 4IJKA 4WCFC 4U0JA 1E7RA 2WDZA 1YJQA 3QHAA 4BKQA 3TZKA 2D59A 2UUPA 4PVDA 5JCJD 4PG4A 1JW9B 3CSDA 2ZTVA 1O0SA 2RHRA 3GC6A 3JYPA 3V5NA 1Z74A 1LA2A 4LW8A 3OEYA 1EUDA 3F46A 4BNKA 3ONDA 3AW9A 3OQ6A 5L7TA 3BMQB 1MXHA 5F21A 3UHAA 3U4CA 3DC2A 2D8AA 1KVRA 2G1UA 2SCUA 1PR9A 2FMUA 2I66A 4B4OA 5C3MA 3RUDA 3ZN2A 1IE3A 3H9GA 4D3FA 5HWSA 3RUFA 1XDWA 1GCOA 5HA5A 4GKBA 4DPLA 4BNFA 3C1OA 2HLPA 4D44A 5L7WA 3JTMA 3AOEC 5DOVA 4Q3AA 4XWYA 3OFSA 3LQFA 2DU8A 4UUPA 3Q2KA 3RC2A 2X86A 4MVJF 4IZIA 1XEAA 3PPIA 1B15A 1D4FA 5EN4A 3PEFA 4KUHA 3F1LA 2DBQA 4N18A 5FWNA 4CMJA 4N5NA 2BGMA 1ZK3A 2WE8A 2W90A 4AJ1A 1KEVA 5KIAA 4YT5A 1PSDA 3FTPA 1JQBA 1KERA 4JLWA 3ZW9A 5C5IA 3WJ7A 1SCUA 1C1DB 4NBVA 2WD7A 4YJFB 2BFOA 3CH6A 4RLSA 1E6EA 1X7GA 4HKTA 1NAIA 4I9NA 3GRPA 5JO0A 5L53A 5ADHA 1PU2A 1LXCA 1ZKMA 2GASA 3LU1A 1PIWA 2NU9A 5HRUA 1PZFA 4J0EA 3JQAD 3MTJA 3S55A 1J4AA 5L4SA 3C24A 3HB5X 5FI3A 2P5UA 4E4YA 1XG5A 1V3UA 4WEQA 2Q1UA 5DBFA 4E31A 2RH8A 1E3LA 2JAPA 5LCXA 1HWYA 3E9MA 2QZ9A 4XZ3A 2AG5A 2HMVA 2OL4A 4HFJA 1AHIA 3NEPX 2DBVO 1I3MA 3HFSA 1KC1A 2X5KO 3KV3O 3VPGA 4Q9NA 4Y9DA 3PJGA 1N9GA 1ZK0A 1BW9A 4ND5A 3W8DA 4M87A 5TNXA 2IZZA 4E30A 4LSMA 1Y9AA 3JQGA 1DIRA 4RV9A 3JQBC 4ND3A 2BFPA 3I9LA 3NRCA 2RIRA 4OSPA 4MP6A 4R1TA 3BMCA 1ENZA 4BNIA 4FN4A 1EUCA 2VTEA 3G0OA 3OSUA 1G6KA 2PD6A 4MP8A 4XIJA 5L40A 3DZHA 4YQZA 3CMCO 2EF1A 4BV9A 4A03A 3T4XA 1QXSA 3FNEA 3N58A 1LLCA 1QYDA 1IULA 5KJEA 2Y1CA 5ES3A 2YHIB 1I0ZA 4GKVA 5JDCC 5AXDA 2AG8A 4NFSA 4E5KA 4CL8A 7ADHA 5EMHA 5JPIA 4ZHSA 2X6TA 3GLQA 1ZK2A 1JKIA 3MTGA 3RJ5A 1DHTA 4RPLA 3IIEA 1LEHA 3DONA 1HDYA 3NGLA 1Y81A 2D3TA 3KYCA 3UXYA 1KETA 4R16A 4FCCA 4OH1A 3ITDA 4S1VA 3UVEA 1CETA 3ZGYA 1A72A 4QO7A 2Y99A 3ZI0A 2CUKA 4BO3A 3ZNNA 2I5PO 4CMBA 1T4DA 4OMUA 4E33A 1UXGA 5J23A 1UDCA 3UAGA 1Y9EA 2X8LA 2EGGA 1VKOA 3HHPA 5KKCA 3I3OA 1B8VA 4IQ8A 3K92A 5CPBA 1EK6A 1GU7A 2ZB8A 4IDFA 4CJXA 3D7LA 1KY4A 3WFIA 1Y5MA 1TT5B 3TZHA 4EJ0A 4FC6A 2DUUA 1HDRA 1DIAA 3LF2A 2Q1WA 3Q9UA 1YL5A 4JP2A 2Y0CA 1YQXA 5IN5A 4XRRA 1CQJA 4QSMA 5AXBA 1KBZA 2RBEA 4FFNA 1LJ8A 4XKJA 3ST7A 1RYDA 2FSVA 1X1EA 2B4QA 2PR2A 3WX0A 1JWAB 1DRUA 5U9CA 2BD0A 4U5QA 3DO5A 4PLVA 2D2IA 2PZMA 2O48X 2JCYA 3RFVA 3K30A 4BKRA 3C7CB 2EIHA 1A4IA 4J49A 3ZWWA 4AICA 3VPFA 5DBGA 1IOLA 4JJFA 2OHXA 1P3DA 4JJIA 4ZRMA 3WBBA 4BGIA 2AMFA 4BO6A 4C7JA 1PGJA 1LRLA 1LC0A 4CMEC 4NPCA 5C7IO 5CDTA 4EUHA 3HDYA 4DREA 3P2OA 3BHIA 3TNLA 2RCYA 2E49A 4AJPA 4Z0TA 1XKQA 1XSEA 4E12A 1JKJA 3S2IA 4JNKA 1ZUD1 3GQVA 1H2HA 1O9BA 2O7QA 1PS9A 4GH5A 1XA0A 1PR3A 2WYWA 3CKYA 1E3IA 2WM3A 2PKRA 4RVDA 5JC8A 3PIDA 4Z9FA 2GR9A 2BKAA 3W4IA 1R4MB 3A9WA 4J1TA 1ZW1A 3QVOA 1S7CA 1Z7BA 4O63O 3HUDA 1J49A 2AEFA 2EG9A 3MJEA 3DMTA 1R0LA 5GZ3A 3KOUA 3QP9A 2UYYA 3LDHA 3CINA 4XEHA 4YAKA 4RF2A 3RVDA 2GZ2A 2NU7A 4JBGA 3MOIA 1ZCJA 1RM3A 4E32A 2Q49A 3TDKA 3HWRA 2ZCUA 3L77A 3BMNA 2DFDA 4KUGA 2P4HX 3GR6A 5C7LO 2C54A 2VYVA 1P44A 1YBMA 1AN9A 1F0YA 5IDWA 3TPCA 3H6KA 5LC1A 1H93A 5G0SA 4BNUA 4NBUA 1KVTA 4WLOA 1WDMA 1KYQA 4J9UE 1VKNA 4RVHA 4YXFA 4D46A 4BNZA 3WQSB 1YXMA 3PFFA 2R6JA 1TI7A 1ZH8A 3AM3A 5BNTA 3WS7A 1GYRA 4BGUA 4YAIA 2PFGA 4XQCA 1E3WB 1YH3A 3EDMA 4J2OA 3G49A 1EFKA 3JQDA 1OC4A 3PTZA 5AYVA 2PH3A 1U2GA 1U7HA 1V3TA 5G0WA 4J3FA 2Y1OA 4MIYA 4EI2A 3ZNQA 4IY1A 3HQ4O 4AJIA 2OGUA 1UAYA 5IJZA 4MVJD 4CLHA 3V1UA 1U8XX 4NQZA 4K1LA 1FDSA 2Q46A 2NNLD 3BMQA 1NVTA 3LC1O 3MCVA 1R15A 1U2DA 4HFNA 1P0CA 1E7QA 4CM5A 5CEJA 8LDHA 2VZ8A 3OP4A 2PZLA
chains in the Genus database with same CATH superfamily
3IQWA 1YK1A 1HRDA 3KR1A 5D7BA 5DKFA 2ZBGA 2H00A 4NFHA 1U2TA 3NOQA 3RBXA 1P1JA 4AXXA 2A3RA 2VAPA 4R01A 4WERA 1ZYUA 4QPPA 4YAUA 2O23A 1MH1A 4NBRA 1X1BA 2QTWB 2SKEA 1QNFA 1N2XA 1RHRA 3ANLA 3HR8A 2XCQA 3A3YA 4PE5B 4XQ0A 4J94A 2J9GA 4WDRA 3A2KA 3USES 3X0DA 5LL6P 1I6WA 1K7EB 3QUCA 5C37A 1TO1E 3C70A 2NSLA 3LHDA 4RJ2A 2BFAA 4KEAA 3P27A 5K99A 3H2SA 1C0PA 1DOAA 3AP1A 4MPDA 4WLNA 3ZE1B 4FDVA 4G1CA 4F5YA 5A9SA 2VBGA 3GRRA 2V1XA 1QIEA 4LISA 2J09A 2XOKD 2OVFA 4X7BA 2NZXA 1AVTA 3ZXYA 4L0CA 5BN4A 1DARA 4F4UA 2ZYSA 2MYNA 4FFVA 2R4UA 4NV1A 3FR8A 1FU7A 4FMCB 4L7VA 1USKA 4NC9A 5KSOA 3HO6A 5TF4A 1K89A 3PPYA 1Y7TA 4A0RA 1TEHA 2QUHA 1N2SA 2GYYA 1E6MA 4HN2A 4HWSA 5G0VA 1I7NA 2PWAA 4TV8F 3V80A 2YKGA 4KDRA 3TM5A 1DTWB 2VLBA 2EWMA 3T1VA 4LI3X 4DR1B 2WKSA 3WLNA 4IQ4A 3FCOA 1PEKE 3KWJA 4CTOA 4AP5A 6CHYA 3HXQA 3WQBA 1JZTA 3V42A 1GRVA 5THKA 4CF7A 1YWGO 3V8NA 3AEYA 2AC4A 3KJGA 4GX5A 5M3BA 2G36A 4B4UA 5INTA 3Q3HA 2D1QA 4O59O 3MJSA 4Q82A 2CW5A 3C45A 4DEYA 3P2MA 4QXPA 2I67A 1BYIA 4W8HA 1Y3IA 1E6KA 1H5UA 2GCEA 1PQWA 2SNIE 2ENUA 3BFPA 3MLAA 3QVVA 5EERA 5ELLA 3PNKA 3UHJA 3TUZC 4Z4FA 5AKHA 4ZOCA 2KB0A 2VHCA 4J0DA 1QJCA 1NR1A 4K5QA 4UDNA 1OYWA 2BEUA 3KXKA 5DYTA 4U5XA 5KVVA 3HZZA 4J1SA 3EGXA 5G4KA 3HXOA 4ZKDA 4ZQFA 2ZRKA 5LP1A 2E5LB 4I1OA 4K8RB 1VMDA 5TPZD 3JQ9C 1LUAA 3Q3GE 4MMYB 1U8UA 3KK0A 5CYFA 4LDNA 2EXXA 3G5MA 2JH8A 3B6JA 3LT2A 4P7KA 3L4BA 2XXJA 5E2AA 2X2FA 1NASA 1ZQ9A 4XASA 4MVJM 4N47A 4EJ2A 4IJ6A 5TJ9A 1KGDA 1QLJA 1SVUA 3AIKA 3IUBA 4EW6A 1ZIOA 3PYLA 4MTLA 3M6LA 4UM9D 3CZRA 2IC5A 1KI7A 4RCZA 4ZK6A 1F17A 1U4SA 3KVRA 1V6AA 4NI5A 1UPCA 4QQRA 4RIFA 5ALMA 4KR6A 3DL2A 1L4UA 1XEFA 1WB9A 2GKGA 1X7YB 1UDRA 1NQXA 3HKEA 4G65A 3D8NA 4JVSB 4JI6B 1TIBA 3IBYA 3QFTA 2EGUA 3LO5A 2K2WA 4LC1A 2R6GA 3TQSA 1YDEA 3FBWA 3RSGA 3V4ZA 2IEGA 1Z6XA 4B3BA 4BBAA 3AVTA 3Q5GA 2FEOA 4N1AA 1EMDA 3ROMA 3VNBA 1VFNA 2LTAA 1YFJA 3DBVO 4CM6A 2HYDA 3RSSA 1C3LA 3RS5A 4IAOA 4CV2A 2J0EA 4LRSB 1NJFA 5ALHA 4XJVA 2J5QA 1WDKA 2IYPA 4W7SA 2IX3A 4WECA 1YOBA 3GCGA 2F1IA 1VSVA 2ALJA 4ZO9A 1MABB 5EJ5A 5IZCA 2DQSA 3A28A 5AKGA 4P3XA 3ZCXA 4HG2A 2I78A 3KWMA 4KK4A 3PUJA 1TM7E 1I36A 1LDNA 1QG2A 2NYVA 3JZMA 4IHAA 5HUHA 4GZMA 5FULA 1VKHA 1IIBA 4NG4A 4RKWA 3D6NB 1HKUA 2HMUA 2CY0A 4K6HA 4RDIA 2UYHA 3FN4A 4MCAA 4G5SA 2VT6A 4IO0A 4G23A 3IC5A 4CIWA 1X19A 1RXCA 4TYYA 4KV9A 1YU6A 2JI6A 1JHAA 1VSTA 3FYUC 4PLCA 4OHZA 5KREA 4DQKA 3EG5A 1QIIA 3HG7A 1SU4A 4GI5A 3A6HA 1M1YA 4IV5A 3DXYA 4K8OA 4O8CA 1CHDA 1HY3A 3IT3A 3C74A 5JT1A 1TPZA 3KKOA 1OB2A 2WF8A 2J6CA 4RZHA 3ZY5A 1A04A 4M1YA 4TPKA 1F1JA 5CYPA 3HH8A 2FZCA 4GM4A 1ORRA 1HE3A 3OMWA 5FV7A 3WGTA 4BC0A 4YCSA 2CBZA 4XLLA 2DFNA 3OI7A 4CTJA 5LKRA 3ZU3A 4O4LA 3MUFA 3RWBA 3GGOA 4UJ3A 4H17A 2H1OA 1PFUA 4IVQA 2MMCA 3WSVA 5CFZA 5B2EA 3U4GA 2PSJA 4ZPJA 3G2JA 4DM3A 3JQQA 2QJRA 1J8DA 1KIFA 4FDTA 1JSCA 4NL4H 5K3CA 3I0MA 2O1XA 5CHEA 2PQMA 2OENG 2CVZA 4OMFG 4HVAA 3TTWA 1FRZA 5JATA 3FB4A 4UU0A 4ERXA 3JQFC 5HDQA 3CF4G 1L7BA 1MT0A 5HF6A 3TUJC 2GAFA 2BI4A 1M2JA 1IZ7A 1LBHA 3OOHA 4NCJA 1E9AA 2AR0A 2N1MA 3PNYA 4FQ7A 4NVRA 2HNBA 1EM8A 1YI0A 1PD0A 3NBFA 4KXYA 2IVZA 4FOTA 4B09A 3REFA 2YIVX 4BWFB 5JY1A 1O2DA 1VLHA 3C0KA 1W4RA 5B12A 2P6UA 1TTHA 2IHUA 3AKCA 4RY2A 5EKXA 4TKMA 2HDHA 4NYIQ 5THQA 2TMDA 7MDHA 3NMUF 2PMBA 1HZZA 2C7BA 3FHCB 4F5WA 5EIXA 1DVRA 5CGZA 3UK6A 3QLJA 5HK9A 1M1ZA 3I9FA 1MJGM 2QL9A 4AU1A 4BNDB 1O95D 4KRYA 3TLGA 3CXRA 3PVSA 1M5UA 1RTTA 5DNDA 5BSUA 5SZHB 4BNWA 2DR0A 1Q1NA 2JAXA 2Q41A 2QUKA 2R1VA 2ZVDA 3L84A 4RGYA 5D3MA 1UFVA 1DIOB 3T1YB 2DUNA 5GONA 4RS4A 1Z5PA 2FY8A 1KOFA 3HR4A 4E5PA 3L0IB 3Q6NA 1PEYA 2I2DA 5A0VA 3C3XA 3D6JA 1IM8A 3PZBA 1NNI1 3CNLA 2J3DA 1K68A 1KEZA 1TUBA 3EUEA 4B80A 1RM5A 4D8TA 4KR2A 3FIUA 1R5JA 1M6NA 1IXYA 2AQIA 4PBSA 4K86A 3WXMA 4KRFA 4MUAA 3TW8B 2VLIA 1JJIA 2XB9A 3ZD7A 1R5NA 4QYMA 1E1NA 1W76A 2NU7B 1BEUB 4KO8A 4OJNA 2H18A 4ZMSA 5EFOA 3THWA 2ZIUB 4IPTA 4D8XA 1QQTA 4Z53A 4L5IA 2HU5A 2QL7A 4BB6A 4E11A 1TAHA 5JC1A 3EVNA 5FPYA 4QHTA 3HI6A 1M8FA 2B21A 1E2UA 1R5OA 4N39A 9ABPA 2VPQA 2ZIWB 4W9NA 1HBJA 2EP7A 5B57C 3DMDA 4O2RA 1US8A 4EY3A 3UV3A 5K0JA 2VQFB 2DWPA 4N49A 1V5WA 3ELYA 3JSAA 3THXA 1OV4A 1W0KD 2P9EA 3IPCA 4PN3A 1X14A 2P40A 4TWIA 3UJCA 1ZWKA 1DTEA 1F6WA 2IYTA 3V9PA 4X65B 1PGNA 3EGWA 2AJTA 4IH4A 4FMBB 1CP3A 4L5AA 3GJQA 1N6HA 3TR5A 2ZTSA 1W0JD 4BUCA 2P2DA 1HE5A 1K5HA 3I76A 1VFPA 3MAAC 4HNGA 4Q21A 1J2UA 1P6UA 2ERYA 3CE6A 4IXNA 3H2IA 4WKNA 3RJTA 3PIIA 4UEKA 3NNNA 2VYCA 3QUTA 2CVQA 3AJAA 3FKSA 4Q1AA 3IE1A 5DSXA 2P69A 4UXHA 1AV6A 1R0SA 4BJ3A 1O6FA 3A3OA 4JJZA 4YRJA 2IBMA 5IWAB 1BXZA 2XSZD 4FGLA 3DC7A 4HAWA 2X58A 3G7SA 4BAUA 5BSHA 1ZNXA 1FDVA 1CKEA 2AN3A 2DLDA 1TUIA 2YJZA 4UM8B 4ESVA 3GUHA 4QTZA 4EHDA 1PAUA 3S7TA 3WL5A 1D1TA 2OB2A 1LBTA 5KMGA 1UOQA 4CT0A 1VBKA 4WY2A 4MQFA 4ZVQA 4DA8A 1A8UA 1HYHA 4S1NA 4PLTA 1KSHA 4B48A 3U9SA 5EFZA 2A1UB 4R2KA 1Z73A 4TZKA 3L9WA 4QDJA 4NY1A 4IDCA 2QS9A 5C31A 1G20A 3DM9B 4MO9A 4XIFA 1EX6A 2HQOA 5CT6A 2WILA 3T9EA 4TSFD 2CBXA 1XMOB 2VRCD 3IBTA 4YBZA 4ZOAA 2P6PA 3T41A 3O8QA 3RCBA 2WZBA 4G4SP 2J59A 4NAUA 2CEAA 4WKOA 4BFVA 1KYWA 4D8UA 1C4WA 1PYOA 1SRQA 2JLSA 3LECA 1T5OA 1VCIA 4P2GA 4ZZ2A 3ESQA 4L9RA 2VRBA 1FNDA 4H7KA 1UDAA 1IN7A 2P41A 4MV0A 3GJXC 1WQ4A 3QIVA 4WT7A 2C0CA 1SIOA 2RI1A 3RK0A 1MD9A 3VHLB 3KHUA 2FYTA 3EAGA 3JAWA 5GOZA 1GKKA 3L7BA 2HK8A 2P75A 1XPUA 2ZETA 4FLEA 5E9JA 4B6JA 2GCOA 1WCWA 4AJNA 4B5KA 5A3JA 1SD2A 1N2CA 3K0BA 1YR6A 1JBQA 1FFDA 2AN5A 3CM0A 2EKQA 1APBA 4B81A 2O50A 2AC2A 5E9QA 4BB0A 2X5JO 4CLDA 2G9UA 3KJQA 1KJZA 3V2HA 2E4WA 4C22A 2ZU0C 5E6RB 5JD5A 3LE8A 4DLNA 4G0UA 2WR8A 1RC1A 4WN3A 2NUTB 4WZBA 3F6BX 4G9EA 3ZHSA 2F9MA 3RABA 1ZD3A 3MCAA 3KLMX 5EHXA 1B2RA 1JV2B 2XQJA 3AUUA 1YZGA 4EVIA 2JFNA 3X2FA 3AO0B 3ER8A 1Q1AA 4C0XA 1ZA1A 2QTGA 1J0DA 1T6YA 5EE5B 2PN1A 1YVPA 1JAYA 2RKBA 3TKYA 1GNTA 2OR3A 3B89A 2QG4A 1VJ1A 5AJUA 1TYDE 2VP3A 3DPSA 1DEHA 1E96A 2MT9A 3H8VA 3A3NA 2IOYA 4EHKA 3MCWA 1OZAA 3L82B 4DVJA 1RVDA 3LKZA 3OF2A 2ODEA 1ST2A 4DJAA 2QENA 5T64A 2F3TA 3CLRC 1OKKA 1TECE 5BN3B 4RKEA 2ASVA 3WGJA 4YJHA 3INNA 1IXSB 4GPD1 2RJ3A 3KUKA 3O26A 2ZDGA 5KKNB 2GSWA 5BMVB 4DWOA 1PZNA 3T34A 3MBKA 3EC1A 4MP3A 2GN0A 2HNAA 1T4CA 3WWPA 3OX2A 1AGRA 4RXMA 2VDUE 1II9A 2YXLA 3HJCA 5A06A 2OZPA 5FEUA 3ELWA 5F1KA 4ZPXA 1PSWA 1ULUA 1JTVA 1TJYA 4IZ6A 4TT3A 1WMSA 3BD8A 3I52A 2WNHA 1BE8A 3O38A 1QVZA 2A9RA 2H7CA 3X1KA 1MC4A 1NVVQ 3JYNA 2C2GA 3R7FA 2JD2A 2Q3CA 1ULSA 4QNNA 2FSHA 3ML1A 1GZSA 2GYUA 1VA5A 4JBNA 2PKQP 3LX6A 4K3UA 3UYKA 1X80A 2WWGA 3MVEA 2H92A 2YVQA 3ES9A 2GEBA 1KORA 1OZGA 1W25A 2IDKA 3VOSA 3W3AH 1ZD4A 4X8OA 1Z68A 3DEAA 2P5YA 4JYCA 1QV7A 2XCOA 2GN8A 1E1QD 5FRDA 3U31A 1FL9A 3IVAA 3LDGA 4G8BA 3A06A 4OJQA 3WKBA 4ZI7A 4YK7A 3ZE6A 4BX9A 4MI3A 2QQ5A 4DNPA 3WC4A 4KL8S 1SEPA 3BL6A 4PPYA 4YPVA 1X7ZB 3TOXA 1B7GO 5EEHA 4PYKA 4II3A 1XQ9A 2NUAA 1ABFA 4RKFA 4RHYA 3RV4A 4ZQCB 3PHLA 4GQIA 2H06A 4WESA 5DCUA 2ZT7A 1U2PA 4WOJA 1G5RA 3QA3E 2YC2C 4B75A 5FL7A 4DMLA 1TW3A 5IXJA 4RPJA 2C07A 2FLWA 3DM5A 3PA8A 2JIZD 1O4VA 3I6YA 3CJRA 3IBGA 1Y4SA 2R2GA 4RY0A 3WL4A 3LBYA 2IEYA 4EA8A 4MW7A 4M8IA 4HI0E 2XA1A 4W1SA 2R96A 4R3WA 1T2UA 5DPMA 4C04A 4QM6A 3GP3A 2FRXA 5FWDA 1P5RA 2G6TA 1ZO8A 2RH4A 4FMDF 2Y93A 3EARA 1X7XA 2IXDA 1G291 5EKSA 4GVPA 3KD2A 3D7SA 2PS1A 3SVZA 2EG5A 2QQ0A 2PL3A 2CK3D 3X1XA 4ASUA 4G86A 3AKZA 4LTMA 1IG0A 1YRAA 2BFFB 3BSSA 3DBLB 3QITA 4R9SA 1XTPA 2AWNA 4FWBA 3P9QA 1A9ZA 2VQDA 4V2UA 4R7GA 1K92A 5FJJA 5B1SA 1CUCA 1PQYA 4GX0A 4LF6B 3NTOA 1IB6A 1AX9A 1VJTA 1XTKA 2PLAA 3AV3A 1TK2A 1NMYA 3AB7A 3BXHA 2IPLA 4RS3A 5ALVA 2C3YA 3BA1A 1W9MA 4URFA 2GN9A 3K6SB 1QIHA 1M9NA 1JKFA 3CWQA 4IMJB 1EHCA 3KALA 4FC7A 4UHFA 5IAGA 2JAHA 3M4JA 4HTFB 2PG3A 1P73A 3G7UA 3REQB 3VR6D 1V0JA 3RJZA 3PSAA 2JZCA 2FGJA 3PA6A 4HBGA 4B79A 3OCYA 2MR6A 4Z9XA 4QYIB 1B0ZA 3WGVA 1KO5A 3V7FA 4PPQA 5IZCC 2NXNA 2BGTA 2WU1A 1KZGB 1WF6A 4GOND 4LXTA 1FY2A 3MGAA 4MWSA 5JCOA 2OFWA 4W4TA 1B73A 3QOWA 4M0MA 2HRBA 2BHLA 3WJAA 4BUJA 2QHXA 1SBQA 2BCGY 3AVQA 3ASYA 2CJWA 3NKLA 1SB8A 4QJ5A 2WE7A 2BKXA 3ZH2A 4RHUA 1LZKA 1O57A 3PKZA 3ENVA 4ILEA 4UEJA 2EF0A 3RE1A 3CR8A 1TRKA 1J00A 2H11A 3DE0X 4I2VA 4KYIB 2J6HA 3UPDA 4TVSA 1D1QA 4PPGA 3CTMA 1XAGA 2ZE8A 2RC6A 3HSKA 4M8KA 3H2ZA 4E7PA 3KZKA 2O2ZA 1RJDA 4EFMA 4J0KA 4PS0A 2C4VA 4OQMA 3VSDA 2XGOA 3OTWA 4FD2A 4QDXA 4R71A 5KTOA 4NDAA 1YHZA 4GDMA 1GAQA 3ON5A 4ZXPA 2CXQA 1DI0A 1R8SA 4FR2A 2P5TB 2V4ZA 1UK6A 2PKEA 2FSPA 2PAFA 3EOAI 2GARA 1K7FB 4EZBA 2TMGA 3RPEA 4W5JA 1CJVC 1NA5A 2EEZA 1NT4A 3HUTA 2HDNB 3HNPA 4BVHA 4W5QA 3O4GA 2BUAA 5HILA 3HJAA 4YT2A 4ILKA 2C59A 4E70A 4HH0A 4KYUA 4KJXA 1B6SA 2A1TR 1SXQA 4FHGA 3R6DA 5J47A 1JSRA 1SHTX 3L1UA 2E9SA 2JHAA 4WFIA 1DS6A 1E5VA 1GGMA 1Y7HA 1UPAA 1LH0A 2FRDC 3OIUA 4JBLA 2HZBA 4Y2HA 2G0TA 5DM60 1JYSA 1E2GA 3ONEA 4V1CB 5T7BA 1ZC3A 1UKCA 5WRFA 1QMGA 4ND2A 3COSA 2PE5A 2MSWA 1XD8A 3CFYA 4PWZA 2P9GA 4WVFA 3G68A 5TQ0B 4BNTA 5A5FA 5LXTB 1JUDA 5FWYA 1LV8A 4R5HA 1H0RA 4GVXA 1UZNA 3VJRA 4EJSA 5P21A 4X95A 5ISMA 3FWNA 4TRNA 3AV0B 1QB8A 2IXBA 4R9RA 4Q1VA 4X85A 4FJ2A 3MIIA 3M3DA 1GCUA 4O0MA 4BX0A 4C2BA 1Y4DE 1BMFD 4LJKA 3V7NA 2JH3A 3QJYA 3RBZA 3PFIA 5A4JA 2X2OA 2HEIA 2QT1A 3MPOA 2AFIE 3SJZA 2WUDA 2QD2A 1Q0SA 4EB8A 1OROA 4H3SA 2VATA 2CYAA 1PFKA 3LHIA 1H4VB 1YR7A 2J45A 4JGIA 2O2GA 4YJ3F 4WN9A 3SHOA 3ZBTA 3AF6A 2VJYA 3KQKA 5U4XA 1FXSA 4EH1A 1SXPA 3M49A 5AOBA 1Y7PA 2Q07A 3DKRA 3CKMA 3IHTA 5C1DA 2I1VB 1EJ6A 1FJGB 2H9YA 3DV9A 1OZFA 2REQB 4Y6QA 3LO8A 3BF8A 3VAYA 5A1JA 2QZZA 2F55A 1J8VA 2XEDA 4LBWA 5H1YA 1RLJA 3PQDA 1LRKA 1BFDA 4KNWA 2I6GA 2CB0A 2CE7A 2YWRA 3G9XA 3A4LA 5DNYB 2QW8A 5A9RA 1LDEA 1GNQA 4QJBA 3DAOA 1UXIA 2XF2A 1W8DA 1VSUA 4RZIA 2ZP1A 4HC4A 5DCYA 3UATA 3WO0A 1OU0A 1RNLA 4F84A 2MYUA 5J2TB 3N8NA 1L0BA 3GCXA 2WUEA 1MV5A 1SCKA 2QSYA 4GBGA 1H2XA 1VBFA 2H63A 3TRFA 4E46A 4EUKA 4YPOA 4BU1A 4R3NA 1L7EA 4MJLA 4WGGA 3W0LB 1KEWA 1FX0A 1K27A 1PFYA 3IQIX 4GVLA 4XVRA 4E4RA 1DFIA 3TNFA 1JALA 4RTJA 1AGXA 4GP6A 2OV8A 2A9VA 1NBWB 3QVWA 3V8PA 3L7LA 2QRJA 4L51A 3SJCA 1QHSA 4M0KA 4BV2A 2BYTA 3B6IA 3ROZA 3S2GA 1UM8A 2J46A 3G0CA 4ZAXA 1J20A 1YULA 1P0IA 2QGNA 3P9PA 5FO1A 1W1WA 1SUEA 3QFFA 3NPMA 2ZAOA 1YE8A 2C7VA 4M53A 4G5RA 4R9UC 4ZI5A 3U3RA 4JYZA 2DSNA 1SU7A 2TRSB 1L7XA 2ODNA 4KDFA 4KHZA 4KPGA 2F3PA 1G41A 2C5HA 3TCXB 3NX4A 3V34A 5MN5A 5FPKA 4PZUA 4DTIA 3ZDZB 3F4KA 4ZVNA 1F51E 2BLNA 1DMRA 2OZKA 5JPCA 3AEUA 3RWMB 5K2MA 1KQPA 1QHYA 2BGUA 3DHEA 1MW8X 2QAGC 3CF6R 4JP8A 1BJKA 3GZJA 4I81A 4TS9A 1K6IA 3EF1A 3PE3A 1YCDA 3WHIA 1Y63A 2X6QA 4HDNA 1ZRSA 2A7QA 3KSUA 4YCLA 3AFGA 4R7TA 1N7HA 5KNCD 2PLFA 1TJ3A 5ERGB 4ZHQF 4ESHA 3OAAA 1VHLA 2BI7A 4PR0A 1P2BA 1VG8A 2X0EA 1ISSA 3FMIA 1FP6A 3OLCX 2QI9C 2Z9CA 1BRTA 1CP2A 3CRNA 3NEYA 2HUNA 3K53A 3HB1A 3HMKA 2IOHA 1DRVA 3GNTA 2YRFA 2EQ5A 4Q6WA 5FADA 4UTRA 4KQMA 1ZGAA 2DX7A 4E94A 5L4NA 4F3KA 1D2CA 3EVZA 1KO8A 1R2QA 5BSVA 2IYYA 2W7TA 4G36A 2PL9A 2VH5R 3N7TA 4TXLA 5JPDA 1M6HA 3KVNA 1ILWA 2RAPA 4FCWA 4BVAA 2V6MA 4UUBA 4BDSA 2AB0A 2O8CB 1KNXA 2QNRA 2Y0BA 3CRW1 3BH7A 2ISQA 2R7NA 4QUDA 5CEFA 1GPH1 3OLZA 2G76A 2OBLA 1JE1A 4L4UA 4XJTA 2Q1SA 4DIMA 1Q0QA 1SWVA 2QTFA 3KT3A 4WSOA 3REGA 1X7WB 1SC4A 2J9FA 1V1JA 5DH9A 1AU9A 1TQ6A 2FG7C 3P2KA 2D2EA 3C5CA 3KPVA 2OA0A 4U7WA 4PTYA 1GM5A 3AJEA 2V9ZA 4ZQBA 3R0JA 4OJYA 2I4TA 3RYHB 2IYFA 1L9XA 2YJ3A 3OG9A 3WK5A 1UOEA 2O7SA 1UP7A 1NATA 3EUAA 4HLNA 4TZ6A 3L4SO 3TQOA 3O21A 3C8DA 4Y98A 4PM4A 4EHIA 5TY0A 2QSZA 2F8TA 2Z2YA 1YC2A 2A5LA 2W2XA 1HDCA 1MJHA 2IW1A 1FK8A 3B6EA 4JCOA 4YR7A 2NV2B 4Q18A 3HLYA 3TXYA 3P94A 2PD3A 2B25A 1PCXA 2Q5FA 2ZE6A 2HWWA 4MVJP 1SUDA 1XPJA 4YCAA 3DSRA 1ZGZA 2H7VA 3N7UA 2Y68A 3I28A 3E22A 5TDHA 3OP1A 1RZUA 1E1YA 2OBNA 2RCNA 3M2TA 4XYMA 4UEOA 3LX4A 4YDRA 1DAHA 3GZNA 1Q7RA 2CXSA 1JQ5A 2ZJ1A 2ZSJA 4OQFA 5DXFA 4CLEA 4U7PB 2PQ6A 2ATXA 2R97A 4QNMA 3GLGA 3GUZA 5FNZA 1IUPA 4ETWA 3CRVA 3NNSA 4W7HA 2AYXA 3BVPA 2C99A 3TEFA 3P4XA 4MR8A 3ORYA 4L85A 2DWOA 2B2NA 1G4UR 1QDLB 2CLIB 1XQVA 1YQUA 1HQYE 2PRIA 3PXBA 4IKOA 4D0RA 2XZTA 4GKAA 4P0QB 4G0OA 3T5DA 5JWOA 4LV6A 3V7YA 4B3XA 3R2JA 1JQ3A 5K4HA 1O5OA 2ZRDA 3N6RA 2Z3WA 5LNK1 1MA0A 3R5JA 1R0XA 4PCVA 4BNMA 5K3FA 2F3QA 4D4KA 2OHGA 2OO5A 2WF6A 3OURA 4BMXA 5T5QA 1UZUA 3GU3A 3A8TA 4B6PA 1Y1TA 3EIHA 3O82A 4DBZA 2AKEA 1WP4A 3T9AA 4LBZA 1KZ6A 4UOZA 1X2BA 1PT8A 3HVJA 3F49S 1QFMA 1O94A 5FCDA 4D57A 1F8FA 4HZIA 4L50A 4F8YA 2BISA 1T2VA 3QOXA 4EL5A 1LVHA 1MPXA 3NHUA 4F45A 1AT1A 2JJQA 3BKWA 1NNUA 3TN7A 4ZQEA 4XEUA 3E7FA 1W88A 3MS7A 3TVDA 1GRRA 2YQ4A 2GO1A 1MTZA 4EYKA 3U3MA 4F2DA 3B6ZA 1GKUB 3NVDA 4FZJA 5FBQB 2ZS7A 2FN3A 2VHZA 3KNZA 4KN5A 4Q00A 1GAWA 2GFHA 3GLVA 3JD1A 5EJ2A 1Z4OA 2XUJA 3AEXA 3KZVA 1XMQB 3ZDQA 4BE4A 3RROA 3WRYA 2A9QA 3NT5A 4LJ4A 5LUAA 3A0UA 2Z4SA 3E9ZA 2PRJA 3F2VA 3TIXB 3UGQA 1MPTA 2Z1MA 4GOXA 4IJMA 4ZCRA 4HDOB 4BE7B 1KYZA 1TQ2A 3O3MB 2HW8A 4DCNA 2HSZA 5C0OE 3H3XA 3MTEA 5BN5B 1HLGA 2BHTA 1QWSA 2Q3HA 3D5TA 4J75A 4PXYA 4BL5A 5ITWA 2JJ2D 1W30A 3GX1A 4CI9A 2W4QA 5C1BA 3C7AA 1QORA 1GL3A 3ETJA 5B3JA 4AROA 4FYXA 5IHXA 1T5IA 3AM5A 3RQIA 1LLFA 2XZPA 4MITA 2N75A 3R0IA 1E5TA 1PK8A 1XKTA 4GAEA 5E3JA 1YQEA 3UBMA 4C0WA 3NIGB 2B1QA 3MRVA 3EIWA 5ELMA 4DMUB 2QQEA 2XVZA 4E88A 2QMEA 2CUNA 2Q2WA 1WULS 1LK5A 2BF4A 1U5BB 2WSSA 1G19A 1Q44A 5BYJA 3UN1A 4FFSA 2ZRNA 3O3CA 2P0YA 4Z4HA 4ZT7A 2DMRA 3UA4A 3D02A 1GZUA 1QCDA 4IIGA 2Z2IA 3VTAA 3I1IA 2NP6A 1VMIA 3NEAA 3FD8A 1ZGJA 2FSVC 1C3VA 3LI2A 2UUBB 1I32A 1G3IA 2W5UA 5DK6A 1B3BA 2HLDD 1NRIA 1RPNA 2FMKA 3PQ3A 4MPTA 4PEVA 2O8CA 2WFLA 5EUCA 3KYJB 3MWLA 2JKVA 4ZRNA 4LWPA 2C9DA 1XWWA 2D1SA 2FZ4A 3PJRA 1DCMA 3Q3VA 1GA6A 1YA4A 5JCOC 2ZG6A 3A36A 1KYXA 2CJXA 4RAOA 5CT5A 1JVBA 4LXHA 2BMJA 1ZH6A 4YLEA 1XRJA 2VUHB 2UZ3A 2MSLA 4WTOA 4AK9A 3FTCA 3JVIA 1KK2A 4S1WA 5I8WA 1V6CA 3JW8A 1FXWF 4J7AA 3SSMA 4CF4A 3PYXA 1A2OA 2WAAA 1Y8QA 3QVKA 4MMXB 5IM4F 4LFBB 3BGIA 3JALA 1V5EA 2NVBA 4JI8B 1V7CA 4YRGA 2Q9BA 4QGGA 1QYCA 3S68A 3CVXA 4TWRA 1DGQA 3QQ5A 2FMFA 2X1VA 1C1HA 2Q3DA 5ALUA 4KAAA 4RJJA 1ML3A 2CJYA 2VP9A 4H2DA 3CO0S 2VPZA 2XB2A 1ADJA 1AK1A 1KF0A 2V6GA 3RVNA 4HH1A 1ZINA 3H9EO 3ESRA 3HV2A 3CHYA 4UUOA 2VPPA 3R8FA 1XDDA 1UXJA 3PQEA 4P7JA 2Q5EA 3MJFA 3IMFA 4N3AA 1DDIA 1YUMA 1Z7GA 4NCAA 5KNCH 1RHUA 2LP4Y 5ESRA 2A9PA 2DQZA 3IP5A 4PYQA 2YVUA 5F51A 3A04A 2FHSA 4NOMA 3DXXA 1J5PA 8AT1A 4C03A 4DSZA 5FBHA 4X1KB 5JISA 4R51A 3EVTA 4A8HA 1LPMA 2YXEA 3HEAA 3KKMA 3VSBA 1JAIA 3GV0A 1MAUA 3GJSA 1UC4B 3EZ2A 4OK3A 4HEHA 4CIVA 4E5UA 5A4IS 2GXAA 2OGTA 3AVPA 3LLMA 4Q9JA 2WJJA 5J4VA 3JXEA 1G66A 3PQ2A 3R0XA 3N0RA 1KK1A 4E1BA 3HTXA 2J0UB 1CY6A 2F9FA 2WEKA 2XTMA 3IH5A 4IDQA 2IEIA 4PSKA 4YO8A 3TB4A 2ZZMA 3EQ8A 1KDYA 3OPNA 5L7YA 4AKSA 2JCBA 5JAPA 4PG5A 3UOGA 3W9YA 1G0OA 2WPNA 5BWLA 4KGXA 1BMQA 1LU9A 4HRYA 2B9EA 2VT2A 5JFOA 4G1UC 4TMZA 2R1TA 1WVGA 1KOGA 1KGSA 4Z9BA 1CUVA 2CLCX 1W581 4TTPA 4ARBA 5HRCA 2JZOA 1SG0A 4JD5A 3TTYA 5JWRA 1HL7A 4HNRA 5T57A 3KOMA 4BP3A 1K9SA 3A1FA 3EHEA 3QXXA 4DJJA 4MRSA 3O8NA 2UV8A 2Y77A 3GFBA 4ZAYA 5F1PA 3OJFA 5C9ZA 1Y89A 2JGRA 3DBHB 2IE0A 4IS2A 2JI8A 5G40A 4C4OA 5HJ5A 4AC9A 1GNVA 2FF5A 4C30A 3VNAA 3F7TA 4IIVA 3LFUA 3E9CA 4DLVA 4FGUA 3AJ9A 3RHFA 1KAGA 4HX5A 4G5HA 4MUKA 3ACDA 1V47A 4X44A 1ETHA 4AO8A 6ADHA 3KB6A 1K88A 3JWJA 5LLSA 3VYRB 3UMVA 1NW9B 5CDGA 4DUGA 3DKPA 4Q3DA 3H19A 4RE5A 3LPDA 2ZROA 3ZX5A 5H16A 4ISCA 3VI3B 2YFKA 4P7BA 5CCBA 5JZMA 1BXRA 1ZMOA 3PVCA 1BEEA 5DP1A 4RELA 2ONZA 1NUSA 4E5SA 4TLDA 2IUTA 5AMXA 1E4OA 2VHWA 4JI1B 3V4VB 2FVYA 2RGWA 5LQJA 2F43B 3WLRA 5IKXA 1BSVA 3AL3A 3ICEA 2I2BA 1NKTA 4CF3A 1MAHA 1WG8A 3BXGA 5AXCA 1KP9A 4PQFA 4AWBA 3NVKI 4C7OB 5CW2A 1GPDG 3PR2B 1BOFA 3CG4A 4KXUA 3VH4A 2BGGA 4NYJQ 4CM8A 3SJUA 2VWQA 3ZW7A 1ZH0A 3PK0A 4L0QA 5CR9A 3L8MA 4RJKA 4XM0A 2A4KA 4K9SA 1IQ0A 2YR0A 1RPTA 3PQ5A 3GFGA 4C4TA 1N6OA 1VCOA 2AXEA 2VDWA 4Q01A 1QP8A 3NNDA 2NP7A 3K70B 3EFOB 1IDOA 1ZS9A 3MGCA 3MHPA 2XH8A 5D00A 4IDGA 1ZM2A 1J8FA 2CDAA 4AKHA 1U94A 3V1LA 3QFCA 5BVHB 5C8YB 1U1IA 4WKPA 1PSZA 4CQLA 3NAQA 2DPYA 2BOVA 4J0CA 1RJ9A 1AQNA 5ECYA 4YUAA 5I7OA 5D84A 2E21A 2QDXA 3NEJA 3S8MA 1HC7A 2D13A 1Z13A 5LSAA 1FSZA 4EGFA 3PXAA 3ANYB 3H1GA 1O97D 3HFRA 3LX5A 1NXTA 3GPCA 4NE9A 4OXQA 4B0PA 4GGMX 5DZSA 4PYLA 4DCCA 1QDUA 4CVNA 4S1PA 5DULA 3IAXA 1B8UA 2CZGA 5ALKA 1GZ7A 4E09A 2O8BA 4M86A 3CV3A 4XWWA 2W8ZA 2WFZA 1ID8A 2CVOA 4QT0A 1ZRNA 2IHVA 2YFHA 2JIQA 3TTTA 1II8A 4EMBA 3Q5EA 2QBYA 3SOZA 1L5SA 2O3UA 2ZJAA 4JYMA 4KFRA 5ALWA 4RZ3A 5HF5A 3G2PA 2PT7A 3OOJA 4QUHA 3DA8A 2LRHA 3I1YA 4G0ZA 4I4TB 5T67A 4JHLA 2C20A 3IAFA 4WA7A 4E14A 4ZCMA 2BTOA 1XTZA 1E99A 2I4RA 3CVYA 4PO8A 2F3RA 3PGJA 3GT7A 1ETUA 3R4VA 1J1IA 5DMXA 3INTA 3VSEA 4CLRB 1KO7A 3VO2A 2XDAA 2OO3A 4U4AA 5B3KA 4BEBA 4KE6A 2GILA 5LYYA 3WZMA 1N8TA 1PR2A 1I01A 1ZQ1A 1POXA 5LMCA 5LPNA 1N5DA 3ABOB 1XL0A 2WT4A 1K4KA 3JD3A 3Q3IA 2H4JA 4YN3A 1QCZA 2ZUVA 1SG9A 2NVUB 4DANA 4XD7A 2DPLA 4N0EA 2WWTA 4NH0A 1M83A 2FMTA 1DFGA 4L6CA 3OTOB 1RRVA 3IS3A 1N5RA 1KBQA 1QGED 1LJUA 4N0DA 1RWKA 1UBKS 2J67A 4A8JB 2EOAA 1LGYA 3B1FA 4X61A 1E2IA 3KQSA 5JCXA 3WWZA 4IICA 4BNVA 3MUOA 1RSZA 1QGUB 2B2CA 2GRUA 2YUTA 4Q3NA 1QFYA 4CQMB 1T35A 1SVWA 4JVNA 2B8TA 4S12A 5E7MA 5EWMA 1MUUA 1CJUC 1IHOA 4R3UC 3O1HB 4FE7A 2ST1A 3FAKA 1DO8A 1O08A 1LSUA 4RORA 3COJA 1A9SA 1GOTA 2BGIA 3FCSB 3UXEA 2QY6A 3G88A 3N6XA 5FP0A 4EFKA 1C9MA 2VXOA 3K5WA 3PTLA 3QE4A 2ZJFA 5ENDA 2X9QA 2PWZA 3NONA 3UZUA 1VI2A 2ZCJA 1RXIA 3WHKA 5IDXA 4OSOA 4DV2B 1MQ9A 3W6PA 1SZDA 1T36A 4YFYA 1R6DA 4LMBA 3EGIA 3VU3A 2I6UA 2Y4OA 1N9ZA 3N74A 3DQZA 4JHXA 3TNJA 3ZDAA 4DRXB 3NHWA 1PYGA 2BGLA 3OPVA 4N7BA 2HBZA 4NF2A 5FTMA 3TSCA 2HU7A 1AA6A 3MK31 3QEKA 3HGQA 3LLUA 3QLUA 4UCQA 1PJ8A 4ZQGA 3ZHOA 4ADSG 4D0GA 3E3OA 2I7XA 3FRIA 5KDOA 2J9XB 2CLEB 5FF9A 1GQYA 4C7BA 3WBFA 3CKLA 1YMUA 1WX1A 5AK0A 3TGWA 3S70A 3UH0A 4J0FA 3LQ4A 3KUUA 4KXQA 1KJJA 2GH1A 2R9VA 2PV7A 3DZIA 3PDWA 2MR5A 3IDSA 3QPAA 4FZ5A 4LYYA 4NZMA 4TRMA 1JLHA 4Y6OA 3WKDA 3GGSA 5TQVA 1XVAA 3JQPA 1TCBA 3R9XA 3IPXA 4AYXA 5DDIP 5JAOA 1U0FA 1HT1E 1YRQA 2I6XA 1I1HA 1T29A 1PBNA 1YCFA 1EWRA 3DHYA 4I5DA 4MVJA 5BQXA 4EEXA 5IX8A 1F0KA 4K1XA 1RBMA 1XYYA 2GZDA 3MB8A 3NTLA 1GNRA 5F5XA 3BD9A 3Q12A 4HDRB 1NLUA 2DFPA 4QOFA 3RS7A 1Z6AA 4OYHA 2OO5C 3G2QA 3FIJA 2JH9A 1KZHA 3L06A 3GG9A 3PJEA 3DFUA 4FOPA 4CRWB 2WFAA 4AFNA 4UVDA 1NYRA 4JITA 5J4YA 3MCTA 3RTAA 2YDXA 3WBKA 1RIIA 3TE6A 4XQ9A 2AKYA 3KUCA 1OIVA 2FF7A 3MT0A 2J08A 1EA5A 2CMFA 2IGBA 4GXTA 5E1BA 4MGEA 4MV4A 1FIUA 3O8BA 3U0VA 1DUSA 3BQNB 1VPTA 5EL0A 3EHDA 3SLGA 3OBBA 1OCEA 1UJ2A 2CN1A 3D6AA 2FWNA 1A9OA 2QRZA 4JELA 5EIOA 4JA0A 1UFRA 2C98A 4ECAA 2K7FA 1AC5A 1TF5A 4PAMA 5KQPA 5KWVA 2NUPA 3PS9A 5FA8A 3GA5A 1QV9A 4ZT4A 1E62A 1Q3HA 4D7AA 3KPYA 4Q9AA 2WIFA 4WBNA 4G9BA 3U7QA 1QH8B 1JDSA 5GADl 1KK3A 2R4TA 5ESDA 2OYCA 3OJXA 1M5RA 3EIUA 3B6MA 1O6BA 1WE2A 3CA8A 1VCMA 3NWPA 2V7WA 2XOKA 3E84A 4A5SA 3I9OA 3CF2A 3ZWCA 1VA4A 1Q95A 1QX3A 2FG5A 4CR7A 1OVMA 4QD3A 4WCFA 1ID1A 3F96A 3GUUA 3NCHA 4ZVVA 3ZWBA 1UJ5A 2CV0A 2PZKA 2X4LA 3DZ8A 4M6WA 1IM5A 4NYIR 4O2BB 1HORA 4UBNA 3QGMA 3KQWA 3NETA 4EPYA 1VM6A 4EL0A 4KQIA 1XWIA 5GQSA 1C7QA 3E9EA 3PGMA 4TUYB 2XZDA 3OZ7A 4YRKA 3V00A 3BEOA 3ZDCA 2J1LA 2W48A 1THTA 2E82A 3FPKA 5BVGB 1KH2A 1PTJA 2F3UA 4NCXA 4KXNA 1GZHB 2B94A 2W6QA 1ONNA 1UBUS 5AQEA 1ILEA 4JBWA 2PXXA 1Y9ZA 2NTJA 2W2TA 4OJKA 3KJEA 1T9DA 2KMLA 2ECPA 2ZDHA 4XTRA 5EXSA 5TPWB 3AKDA 1EE1A 2QR2A 3EWSA 2F17A 2OEPA 3KM0A 3DDUA 4TMYA 1K7CA 2HRDA 4PIVA 4DMFA 3DLTA 3NO4A 1JA9A 1R6XA 3EZ9A 4YV1A 1CZHA 1U9JA 5DJ5A 3RAGA 3ND6A 1I7PA </