3WWYA

The crystal structure of d-lactate dehydrogenase from fusobacterium nucleatum subsp. nucleatum
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
333
structure length
333
Chain Sequence
QKTKIIFFDIKDYDKEFFKKYGADYNFEMTFLKVRLTEETANLTKGYDVVCGFANDNINKETIDIMAENGIKLLAMRCAGFNNVSLKDVNERFKVVRVPAYSPHAIAEYTVGLILAVNRKINKAYVRTREGNFSINGLMGIDLYEKTAGIIGTGKIGQILIKILRGFDMKVIAYDLFPNQKVADELGFEYVSLDELYANSDIISLNCPLTKDTKYMINRRSMLKMKDGVILVNTGRGMLIDSADLVEALKDKKIGAVALDVYEEEENYFFEDKSTQVIEDDILGRLLSFYNVLITSHQAYFTKEAVGAITVTTLNNIKDFVEGRPLVNEVPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords D-lactate dehydrogenase
publication title Allosteric D-lactate dehydrogenases from three Gram-negative bacteria
rcsb
source organism Fusobacterium nucleatum subsp. nucleatum atcc 25586
total genus 114
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.1.1.28: D-lactate dehydrogenase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wwyA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wwyA01
3ICPA 3QVTA 1V8BA 4Y6RA 4RF3A 3MJCA 2V6GA 3ETDA 5TQVA 1EVIA 3UVEA 2BGKA 3GZ4A 3DHYA 3W8DA 2HMVA 5L4NA 3AM4A 1XHLA 3BTUA 4KTTE 3Q2KA 3IMFA 5DOVA 2OHXA 2X7HA 5JYEA 3KTDA 3F9IA 2ZYAA 1IHYA 3GEMA 3K30A 1Q0QA 1V9LA 4I5FA 3PLNA 2OL4A 3DL2A 5KCZA 1N5DA 2O2YA 3DZGA 3VPFA 5ADHA 5BR7A 1QYXA 2A4KA 4D44A 3STHA 1NQ5A 5HM8A 5IDQA 9LDTA 4NBUA 3TFQA 3H65A 2QW8A 1ZCJA 4PG4A 2P9EA 3PI7A 1LDEA 4QFCA 4XYMA 4DC0A 4E33A 5G0TA 1ZSNA 1BXZA 2IDZA 1XDWA 4F45A 4FFNA 3AM5A 2QRLA 3WIDA 4IJKA 4BNKA 3LU1A 4N5LA 3MEQA 4XKJA 1BVRA 4LSMA 1CDOA 2HDHA 1SPXA 2B4TO 2J3HA 5T5QA 1Z75A 2JFHA 3TOXA 5IXYA 1O94A 4DLBA 2UVDA 1EK5A 4HXYA 2Q2VA 1PGQA 4NK5A 2WE8A 1X7DA 2C2XA 4U0JA 4MIOA 3RBVA 1QYCA 4WLFA 3NDRA 5IDXA 1WWKA 1NFRA 3JCZA 3JQ7B 3ZWOA 4DUPA 5MDHA 3OQ1A 2VYNA 2SCUA 5EPOA 4D3DA 4NU6A 3UXYA 4OL9A 3UCFA 2Y99A 2HJSA 2V6MA 1C0KA 1ZMOA 1C1XB 1YB1A 2B69A 2DQ4A 5BT9A 1DC3A 1Y8RB 3U4IA 3RUEA 4BNVA 4ND1A 1XA0A 3NV9A 4KDFA 2W2KB 2X0NA 5KNLA 4ZQHA 1L7DA 4KTVE 5EMHA 3K31A 3UGKA 4DGSA 2BF7A 2GZ2A 4OKNA 4E5NA 3IDSA 1YJ8A 4MIEA 3Q9NA 5G0SA 3S2FA 4PRLA 3JQ6A 1K6XA 3O4RA 4CUKA 1JAYA 1RYEA 3IP1A 3JYPA 4MVJG 3C7AA 1B3RA 4IM7A 4ZQEA 4EJ0A 1SNYA 1NPDA 1IB6A 1ORRA 1E1MA 1Z82A 3H6KA 2BELA 3AY7A 1HE4A 1OC2A 2O4CA 2Y0CA 2O7SA 4XQEA 3PZBA 4XCVA 4IUYA 3QQPA 3G49A 1R6DA 4HBGA 4R69A 4Z3DA 1DAPA 3AOGA 1IOLA 1AXGA 1SBYA 3JQ9A 1EUDA 3KUXA 3CXRA 3ZWVA 4RLHA 4EI2A 1EFLA 1VJ0A 1DIGA 1PSDA 1MGOA 2G5CA 2CUKA 1LDBA 2Q2QA 4NK4A 4M54A 4Y67A 4AJIA 2GASA 3IJPA 2BFPA 2JAHA 2UYYA 5ENVA 4CMEC 3BXXA 3LF1A 4AICA 5BNIA 1PZGA 5CEJA 2TMGA 2C5AA 4OGWA 1E6EA 4J2OA 1YQDA 1Z6ZA 5A4DA 1N9GA 3C7CB 3NUGA 2PGJA 3OJEA 1B7GO 4B4UA 3GMDA 3TRIA 1IULA 3BAZA 1HLPA 3MCVA 1A9YA 4R51A 1H5QA 2I5PO 3I3OA 4JP2A 2DUWA 2BI8A 2Q99A 1UXIA 1NXQA 1F0YA 1V3VA 1XWFA 2NADA 3U0BA 1HRDA 2CF6A 1LLUA 3EZLA 4XGKA 3LZ6A 3R1IA 4WNCA 4NU5A 3H2ZA 3OJ0A 2WSBA 2GRAA 4RPHA 5DCYA 4ROSA 1LSSA 1GL3A 1ZK2A 3GVHA 4GX1A 1DLJA 3ZHYA 1ONPA 1PQUA 2GUGA 4LSWA 4D3FA 4XYLA 2DU8A 1Q7GA 1DRVA 2I76A 2FP4A 4FGWA 3PJFA 3H2SA 1ENPA 2I65A 1T1RA 2NLOA 4NBWA 3V1TC 3EDMA 3R3SA 3PHGA 4AJEA 4LK3A 3FRJA 1D1TA 1GR0A 5I8WA 2JFGA 1IZ9A 2NM0A 3FF4A 5JCJA 5ITWA 1L7EA 1P44A 3H3FA 2POQX 3N74A 3KV3O 1XR3A 3ZV3A 4BO1A 5A3VA 2IYPA 3MTGA 2OP0A 1Z73A 3PLRA 1I01A 4ZQGA 4XA8A 4XZ3A 5KOIA 5DBIA 3WG9A 3MJVA 3ZWBA 2EF1A 4BNGA 3PEFA 5JAZA 3RBXA 2OFPA 3VZQA 3FBTA 3JQFC 5AYVA 1AN9A 2P9GA 2JCVA 3NX4A 3RIHA 2PWZA 4WNIA 4E5MA 2ZTLA 4J1SA 5HA5A 4C7JA 5IAAA 2ILTA 4R1NA 2X22A 3RAJA 5CFZA 1R0LA 1BWSA 2DBQA 4FGSA 4AJKA 1ZUD1 4FD3A 3VPGA 4NZ9A 2RHRA 1O89A 2ZYDA 2AG5A 1PR3A 4LRTB 3D4OA 1K89A 3LT4A 1E7WA 1MXHA 3H9GA 4L0QA 1IY8A 2O3JA 2Y0EA 5KJ1A 4ALMA 1E3LA 5FFFA 3DBHA 2GDZA 3I23A 4MKXA 5ILGA 5L51A 1NAIA 3VPSA 1NPTO 2CZCA 3VTZA 2D4AA 4Q9NA 2FR8A 4PGFA 1R12A 4WCFC 2EW2A 4J6FA 1UXKA 3TZHA 3ZHBA 3H8VA 1A7AA 3FR8A 3JQ8B 4WUVA 5AXCA 5L7YA 5THQA 4IDGA 3AUTA 3HDHA 2HMUA 1JU9A 4Q3EA 2PKRA 2J6IA 1BGVA 2Y93A 3ZU2A 1CF2O 3C8MA 3PYMA 3ENKA 3O26A 4RF2A 1RM3A 5ICMA 5I9LA 1JLLA 3L9XA 3JQAD 5GZ3A 4JCOA 4N5MA 2AMFA 3HFGA 3QWAA 4FFOA 5JAQA 4AVYA 1XG5A 3DZHA 2YZ7A 4LVCA 3ONDA 1HYEA 4G81A 2B5VA 2G1UA 4R54A 3UCXA 4YJFA 3PRJA 3QWIA 2BFOA 3MJTA 2IEDA 1SB9A 3ROKA 3PYLA 4CMAA 1ISIA 3IUSA 4YXFA 2V65A 3RU7A 2WTBA 3KSDO 4TRMA 5L4LA 3IQDB 1B8VA 3PXXA 1H93A 3RU9A 4BNYA 2B4QA 1LUAA 4M49A 2Y66A 2Y67A 1MA0A 3AU8A 4RCVA 3LDHA 4RORA 3SLGA 1TA4A 3P2OA 3JTMA 3I5MA 1OI7A 3MWEB 5JCJD 1KBZA 4QXMA 1PS8A 1HZJA 2OOSA 3GQVA 3OP4A 3S2GA 1GUYA 3BMOA 2ZB7A 1L1FA 4CLOA 4L9RA 4YJHA 4E2XA 5DBFA 2C2YA 5KKAA 9LDBA 3BHIA 3C3XA 3F5SA 5IZ4A 3H4VA 3ANLA 2PD3A 2D1YA 3WSVA 5CDUA 2D0IA 1GU7A 1EUZA 2QZZA 1C1DA 3E9NA 3K92A 3W6ZA 2PV7A 5C7LO 3INGA 4Z9YA 3FNFA 4TMFA 2G17A 4RJTA 3CZRA 1D4FA 2VHYA 1B26A 5JNLA 2WYWA 5K6AC 1EK6A 3BMNA 2C20A 2DT5A 4DQXA 3DFZA 3IKTA 1VL0A 2R00A 2VZ9A 3Q0EA 1TXGA 1R37A 4BB6A 3RI3A 1ZMTA 1J49A 4A03A 2WEKA 4OXNA 3AY6A 4R9SA 2A92A 3WQRA 3VDQA 3I9JA 1CERA 4CR6A 4IDBA 1X7HA 5KVVA 1E7SA 1YH3A 3SVTA 4GSLA 3ULKA 4CM4A 4AFNA 2FPGA 3W6UA 1VRWA 4MINA 2O3RA 2OUIA 3PGXA 3IJRA 3KLMX 3G17A 3GN1A 4BNMA 1GV1A 5JY6A 3GRKA 2HRBA 3ZWAA 3DAPA 1H0KA 1NWCA 4JBHA 4YAEA 3KXDA 3E9MA 3R6DA 3DBVO 3ONEA 5B4TA 1V6AA 2VN8A 4FQ8A 1K6IA 4Y6PA 3GG9A 3WICA 1X7GA 3KEQA 4W9NA 3GG2A 1D1SA 4OH1A 3DBHB 3OF2A 4RVGA 4NQZA 5CDYA 4RO0A 1IPFA 4Y6SA 2Z95A 4Q3NA 3VOSA 4A10A 4K28A 4XRRA 2Q45A 2CDCA 1GQYA 4DIFA 5B4VA 2V6BA 1T2CA 1LRLA 5MGBA 4II3A 1NQOA 2O2SA 1HT0A 4Q3AA 4BL5A 3PWSA 4I5EA 4B8WA 3GC6A 4K9DA 4MVJD 1NPYA 4HUJA 4L73A 5IZCC 1Y81A 2X6TA 7ADHA 4J2HA 5J23A 3D3WB 4OYRA 1HSZA 2W2LA 2X86A 1MG5A 1LDGA 1T2EA 4R01A 4XB1A 1M67A 4DPMA 5TGDA 1J6UA 5TT1A 4PLVA 1H6BA 4UEKA 1PJ3A 3ST7A 3KVOA 1LSOA 4Z0TA 4YJFB 1DPGA 1ZO8A 1H94A 5I7EA 2HRZA 4J4BA 5JLAA 4P22A 3RC9A 1YXMA 1X1TA 1HDYA 4M8SA 1P1RA 3S2EA 3BMQA 1Y8QB 3K73O 3ZN2A 3CUKA 5DN9A 4DRYA 3V1YA 5IDYA 2HK8A 4Z0HO 2X8LA 1E6UA 2NVUA 4S1VA 1SO8A 1U8FO 3KYDA 2CFCA 2LDBA 1E7RA 1R4NA 1VLLA 3LK7A 4W99A 1BTOA 4CLOB 1EMDA 4U5QA 2AEJA 4B79A 4XEHA 4ILKA 4ALLA 4ZRMA 4DBZA 1ZJYA 5EQFA 3A06A 1YS4A 3K96A 3ITKA 3VZRA 4YAIA 1EDOA 4BKUA 3VH3A 1T24A 4DPLA 3HB4X 4I9NA 1EEHA 1UP4A 3JYLA 1J5PA 3DTTA 1HXHA 1XU7A 3RUAA 3WMXA 2I99A 1AGNA 5HS6A 1KEUA 1NTOA 3ZU3A 1EZ4A 3VH2A 4E6PA 1UDBA 1K2WA 3V2HA 1R15A 4Y9DA 4GQAA 3D4NA 3ZI0A 5IN4A 3O8QB 3GAZA 4E2WA 1P33A 1OBFO 3ROQA 1LDYA 2B4RO 3PFWO 4FIZA 1I2CA 2GCGA 3GK3A 1K5HA 2P91A 4MP3A 3AOEC 2PLAA 2IXAA 3RJ5A 4J9UE 2CNBA 4YYZA 1P77A 1I3NA 3W1VA 1DAOA 4CM4B 3LSYA 5JDIA 1R0SA 4B3IA 1EQ2A 5B37A 2AG8A 4I5DA 4QQRA 1NP3A 1A72A 3OIGA 1PGOA 4M86A 2FOIA 5LCXA 4QO8A 1JVSA 3FTPA 1XQ1A 2W90A 4A2CA 2F1KA 2NWQA 2YV3A 3ANNA 3DFUA 4NFYA 4ALKA 4CUZA 2YYYA 2VQ3A 4O0LA 5TNXA 2VHVA 1SEPA 2PD4A 3L4BC 4UVGA 1Y7TA 2NQ8A 3JQBC 4CR8A 2VYVA 2W8ZA 4WCDA 4W6ZA 2BFAA 4BV9A 4R1TA 5TX7A 1LLCA 4FFLA 3H9EO 1N8KA 4PCVA 4ND4A 1JDJA 1QYWA 1X15A 1DFGA 1YL7A 4QX6A 3H9JA 4J7UA 3GDFA 1NFFA 4Z6KA 1P1JA 3NTRA 1XELA 2VHZA 3CTMA 3QVOA 3X2EA 4JIGA 2CDAA 3CE6A 3GGOA 2FPIA 3QRWA 1VC2A 2E82A 2W98A 1H6DA 2PH5A 3RFVA 3SJUA 4D41A 1QLHA 1HETA 1LX6A 3BMCA 3KSUA 2V6FA 3JQ7A 3S55A 2GF2A 3PHHA 1EVZA 4FS3A 4RQTA 1OOEA 3GLQA 3W4IA 2EGGA 3I9OA 1S7CA 3D3EA 1C1XA 4NR0A 3Q9UA 4Y98A 1Y8RA 2GLXA 3NJ4A 3QHAA 2IZ1A 3DR3A 2BGLA 1BVUA 2GERA 4Z0PA 3DB2A 1X0VA 2W2KA 5A9RA 3E8XA 4L76A 4BMNA 2H1SA 5AXBA 2C7GA 3WIEA 1FK8A 5L7WA 4BQPA 3WWYA 4WLVA 4QT0A 2NTNA 3E03A 2X9VA 4R1UA 4RGBA 2HCTA 1MUUA 3RFTA 1P0FA 2YY7A 3H3JA 3FBGA 2QZ9A 3QVXA 3HDYA 1HDOA 1TI7A 2FR0A 1EFKA 3GUYA 2PGLA 4GX0A 3UCEA 3UKOA 2UUPA 3DZFA 4GPD1 4ALIA 2PZLA 3JQCA 3B1KA 4PZEA 3GDGA 4GMFA 4AJPA 4YEDA 1YB5A 4NIMA 5FI3A 2BHLA 5DP2A 4UEOA 3GR6A 1H9AA 1U2GA 2ZCUA 3QV1A 4D3SA 1GDHA 3KYCB 4W7HA 4EUFA 1ZK3A 1K6JA 1UUFA 1ZEMA 2Z5LA 1F12A 4HFJA 4IQGA 1B3BA 1LLDA 4CM8A 3F4LA 3UW3A 4BO5A 3FCOA 3BHMA 2JL1A 3OEWA 4FJ1A 4XWYA 3SLKA 3KETA 3NAQA 1ULUA 1UH5A 1SZJG 2EP7A 3M2TA 4XDYA 2X5OA 4KOAA 4QFDA 3W4JA 1BRMA 2BLLA 1UR5A 1HDZA 2O50A 2VUTA 4GX5A 4MKRA 4CV2A 4FJ2A 3T4EA 5L7TA 5JSFA 3EMKA 4UVIA 1HL3A 4GKBA 1ENYA 2ZB3A 3KYBA 4FOSA 1JA9A 4LMRA 1WZIA 2ZQZA 4WE3A 3NTOA 4FBGA 2VYVD 3ZU4A 1K0UA 3ZHZA 2VWHA 5L53A 4MIYA 5T8KC 3RUHA 3VKVA 4DTIA 1KETA 5C3MA 3EK2A 5KIAA 5KJFA 4F46A 1WLYA 3QLJA 1ISGA 3IC5A 2HAEA 3P2YA 1FDSA 1H6AA 1F8GA 1B8UA 1LSUA 2HLPA 5AXAA 4XB2A 1A71A 2FZEA 3OQBA 1G6KA 3MJSA 3TL2A 5ENDA 4WJZA 3AM3A 1GZ6A 1H2BA 1Z45A 2PKQP 1PQWA 5FYDA 1EVYA 1VE9A 1W8DA 4CMEA 3WGGA 1LQTA 3ETEA 1YDWA 4NNJA 5LC1A 5KWEA 2PTGA 2O3QA 3BTSA 1IL0A 2C29D 2D2IA 4BMSA 3SX2A 4FN4A 4OKIA 1YL5A 2YQ5A 1FDWA 4BO3A 3BMCB 2E49A 1P74A 5KVQA 1JKJA 1NR7A 3UICA 3FN4A 1GUZA 3WTCA 5I7SA 5FWNA 4BNWA 1T2DA 5JDCC 2ZTVA 1KVTA 4HKTA 3E18A 4Z9XA 1B15A 2A35A 5A05A 1Y5MA 3WS7A 4A0SA 1XEAA 3PP8A 3JYOA 3LC7O 3RBZA 3UH1A 4DQUA 3OSUA 5A1TA 3OBBA 1DHTA 1P1FA 4R16A 1NAHA 1ONOA 5A06A 4CQLB 1IYZA 1U3VA 1Z7BA 3O03A 4UUMA 4XR9A 3DQPA 1NQAO 4PG7A 3EHEA 4LISA 1X1EA 1HDXA 2GSDA 4L4XA 1HDRA 3A1NA 1Q1NA 3UFXA 3PFFA 2D8AA 4KWIA 4J49A 4E30A 2XOXA 2C5EA 3LT1A 3E48A 5JMWA 1V3TA 2QG4A 3DDNA 3IP3A 3JD1A 4O63O 4RVHA 4XQGA 3GN2A 2A9FA 1E3WA 2FRDA 4ID9A 5G2OA 1GZ3A 4CM9D 3PIDA 3VVCA 5L4SA 3JQ8A 2EHDA 4AJ4A 3PPIA 4CMCA 3OEYA 4GSKA 1ZFNA 2CVQA 1ZK1A 5TF4A 4ONEA 1Y6JA 4QEDA 3WNVA 3JQFA 3RUIA 3G1UA 1VSUA 2EKQA 2CDBA 3ZWWA 4TRRA 3AI3A 4UUNA 1A4IA 1B2LA 4XX0A 5G4LA 4AL4A 4CM8B 1W73A 2G82A 1NWHA 3EVNA 1HE3A 4P38A 4WK6A 1BDMA 2QQ5A 3D64A 1F8FA 5KJEA 2RAFA 3WLFA 3LQFA 2OMEA 5AOVA 2BI7A 5IG2A 4TVOA 1XLTA 5I7FA 3K6JA 5GZ6A 2WE7A 2C59A 2Y05A 3F1KA 1GAEO 3FNGA 1VKOA 3ZW9A 1YRLA 3KLPX 4FOOA 3FSRA 4FPXA 4ND5A 4XD2A 1QXSA 3U5TA 1OZAA 1VI2A 4HFMA 4OJNA 1LXCA 1DHRA 3TOZA 4J9VA 3JD2A 1J0XO 2E4AA 2X1HA 1X0XA 1W4ZA 3RQSA 4X54A 4BO7A 1Z7EA 2ZYGA 1Y9EA 2LDXA 3CZMA 4H7PA 1PJCA 2GN4A 1SB8A 2ZK7A 1KYQA 5JO0A 1ZVMA 1UP6A 4MVJF 1GY8A 2NTVA 5HTOA 5KTKA 4HP8A 1P1KA 1KERA 1O95A 1KVRA 1BMDA 1JTVA 2DC1A 1VPDA 5DCUA 2EGHA 3I4CA 4DPKA 3WGHA 2WYVA 2JCXA 5EQDA 4BNFA 4A26A 3WOHA 2V7PA 4URFA 3ONFA 1HF3A 2Y1OA 3GY0A 4GWKA 3V8BA 3VDRA 1YB4A 3E5RA 3ICCA 5JXWA 4P4GA 4INAA 1ZK4A 3E5MA 3NEPX 3UOGA 3ANMA 4H3VA 5K9ZA 4ZRNA 2B35A 2VYND 3WGIA 3FNHA 4IXWA 1YE3A 3H5AA 1PJ4A 1O9BA 2ZATA 3RCBA 3WGTA 3WX0A 5C37A 1TT5B 4EEXA 2PA3A 4CMJA 5CP8A 3KBOA 3SBOA 4G5HA 3SEFA 1UAGA 3V5NA 1C0LA 4MPDA 3I9KA 3WGOA 5C7IO 2CMDA 4N18A 3NT4A 2RHCA 4YJDA 4R3WA 5KJCA 1Q7CA 4RDIA 2H5LA 2NV6A 2QX7A 4BUCA 3D5TA 4B4WA 3E9QA 5BSFA 2VT3A 2R2GA 4KQXA 4O6VA 4DVJA 5EERA 3RC1A 5JYDA 1M6HA 1LDNA 1PU2A 2C82A 3WFJA 3ZWPA 2BD0A 2I6TA 1WXDA 4JK3A 4XRGA 1P0CA 1A7KA 3EW7A 1DJQA 1NX6A 5THKA 3HB5X 4Z3KA 2AQKA 4RVFA 1EUCA 2NTJA 1UZLA 4PFJA 3ZV4A 2EW8A 1CEQA 1N7HA 4BKRA 1ULSA 3VH1A 4C4OA 4NBRA 4YT2A 1I30A 3PZRA 4HADA 4J7XA 3RJ9A 5K0ZA 3WNQA 3ASUA 4RPJA 1FF9A 3WYEA 2ZIZA 1HEUA 5EESA 4RVDA 1KC3A 4JXKA 3S1LA 3PGJA 1I5RA 1IPEA 3VZPA 1E3WB 1I3KA 1QP8A 2WMDA 3HSKA 3TPCA 1WVGA 3PDUA 5JW6A 1HTBA 4U6SA 4N5NA 3C1OA 2P9CA 4LW8A 3ORFA 4IIUA 3B6ZA 4PLYA 4ZN6A 5DCWA 3RKUA 5T64A 2BRUA 3L6EA 3FWZA 3GPIA 4M87A 3D3WA 3SC6A 1LNQA 1RM4A 1AHIA 1U4SA 4ZU3A 3JSAA 4A73A 3R0IA 1YL6A 3AI2A 1BXGA 4FDAA 1N1GA 2WD8A 3AWDA 3HFSA 1PL6A 3DMTC 4HWKA 4PN3A 4IS3A 2AA3A 1XCBA 2VWQA 3VHRA 2C07A 3ZWMA 3PK0A 2OBNA 2FY8A 2PZKA 5JC1A 2ZJ1A 1Y8QA 1I8TA 3I83A 1HDCA 4UUOA 5L9AA 5JBIA 4XYGA 3ZWXA 4R4JA 4BOYA 1OMOA 2XPCA 3RC7A 3TZKA 1E7QA 4BKOA 2X23A 5EL0A 4D42A 3TN7A 4UVHA 4EEZA 3DBLB 1G1AA 3LLSA 4WCFB 5U9CA 4B4VA 5I7VA 3OIDA 4WEOA 2EJWA 2RIRA 3QP9A 1LEHA 3VKUA 2VNAA 3KOUA 3AW9A 4E0BA 1M75A 3RUDA 2HK9A 2J5RA 5I9MA 2C54A 3KSZO 5IZCA 3E6AA 4BIIA 4EW6A 1DJNA 2IZ0A 3RFXA 4B7XA 4F6LA 4BNNA 3FPCA 1MB4A 4B4OA 1GFSA 3M2PA 3INTA 2XAAA 3M6IA 2O48X 1N2SA 3UHAA 4JJIA 4LCEA 3O38A 1ARZA 1EQUA 4EITA 1M6WA 1QLJA 1GADO 4IMPA 4BGEA 4PLCA 2Y1DA 1ISFA 1P1IA 3GUCA 3L9WA 1VKNA 4FC7A 4BO8A 3O8QA 4FCCA 1SCUA 4YPOA 2DM6A 2DBZA 1PX0A 2DPHA 3G0OA 4IY1A 1GYQA 5H82A 2PGDA 3TF5A 5GY7A 3RC2A 3FPLA 2H6EA 4E5PA 5CHEA 2NU7A 3F1LA 4IXTA 3W8FA 1VL8A 3C24A 3CIFA 5BSHA 4J4TA 3DOOA 1T2AA 3VVBA 1ZKMA 1WDLA 5EN4A 2YHIA 4MDHA 4NJMA 2VCYA 4O59O 5EINA 1JAXA 3ITDA 4EBFA 4ESOA 2YW9A 4IJVA 4IIVA 5TS3A 2BKAA 2PK3A 1PZHA 1A9ZA 2JJYA 4I08A 2UV8A 1XYGA 1F06A 4G65A 3TJRA 4I9HA 3KZVA 1ZBQA 3JD3A 2I3GA 3OJFA 4N7RA 1T26A 1DIBA 2Y1GA 3NYWA 4FW8A 4OIMA 3U4DA 2Z1NA 3MJEA 3DO5A 3I9LA 2JFFA 1XQ6A 5KJ6A 2DUUA 4ND3A 4GL4A 3FD8A 1RJWA 1LRKA 1I2ZA 2F00A 3GHYA 3TNLA 1DC6A 2OGUA 5CPBA 3AUSA 2BFMA 4OQZA 4YA6A 8LDHA 4ZJUA 2X5JO 4PG6A 2GPTA 4HFRA 2X58A 1F17A 4GGPA 4D45A 4RLSA 5LDHA 4QSMA 5BNFA 4YTEA 3KB6A 3AOEA 4IDAA 4D43A 3QWHA 4KWHA 3GVCA 4CLRA 2EIHA 4GBJA 1E3IA 3IUPA 4J0EA 3TQHA 4AJOA 4B8ZA 4EUEA 2HKIA 4GH5A 4ND2A 2HK7A 1YBMA 4ALNA 1BXGB 2PNFA 4R5MA 4WASA 4LMPA 3C7DB 2UAGA 2GN6A 2OXIA 3DTYA 1A5ZA 1N92A 3P5SA 1RPNA 2GYYA 1LI4A 2AHRA 3OECA 4K6FA 2JD1A 1DSSG 3GDOA 2YUTA 1NASA 3DZIA 3X2FA 3GNQA 1KC1A 1GV0A 1R66A 2AQHA 2X9NA 5A5FA 3L4BA 2OORA 1DB3A 3JQBA 4MVJH 3T4XA 2BGMA 2WYUA 1NNUA 3LF2A 4UREA 5ITVA 4JJGA 3PYXA 2Q49A 3Q2IA 3L07A 1NVGA 3BZUA 2R00C 4FR5A 3WGYA 3EAGA 1DRWA 4CMBA 3WQSB 3L77A 1M66A 1CQIA 1UZNA 4GGOA 1J4AA 4BS9A 5A02A 3LT2A 4PLTA 2IRWA 5U4QA 4IQ0A 2D59A 2GGSA 1FDUA 1GEGA 4NPCA 3JQGB 3UN1A 1O5IA 3PVZA 2AE2A 3TZCA 3I4FA 3ZGYA 3KYCA 4YVFA 1E6WA 3LC1O 1XU9A 4YB8A 1R4MA 5L40A 2VNSA 1LC0A 1IHXA 3AUAA 2QRKA 2FZWA 3AI1A 2CVOA 8ADHA 4AJ2A 4I1IA 5B4UA 2P4QA 1U5CA 4BO0A 2IODA 2ZKLA 4CMGA 4TWRA 1Y5RA 5G0VA 4W9NC 4WKGA 3U4HA 4BO6A 3ZWCA 5BSGA 4DC1A 3BA1A 1RWBA 1ENZA 4ITUA 4PLZA 3I6IA 3O9ZA 3Q6IA 1ZZEA 3SXPA 1HDGO 1TEHA 3WB9A 2HO5A 2YHIB 1VM6A 2Y1FA 4JX8A 4NJMB 1Y9AA 1HYGA 1ZW1A 4QUKA 4BKQA 5ICSA 5A3JA 1PL7A 3NGXA 3EYWA 3K2BA 1RYDA 2RH8A 3WJAA 3DHEA 3VPXA 3H9QA 4OMUA 4YWJA 5ER9A 3CINA 1S6YA 3NTQA 3PJDA 1YKFA 1HZZA 5CDGA 4KUEA 2P5YA 4Q3BA 1WNTA 4RDHA 1P31A 3L0DA 2Q4EA 2PZJA 2ZCVA 4XGIA 4R1SA 3FI9A 3G1TA 5A9TA 3ASVA 3SJ7A 2P5UA 3MZ0A 1MFPA 2Y1CA 4AJNA 5A5EA 3H5RA 4EDFA 1OFGA 3I52A 1YOVB 2W2LD 1QRRA 3C85A 3PQEA 1DFHA 3DHNA 1U7TA 1U8XX 3ZNOA 3UAGA 2XXJA 3H5NA 3M1LA 1G0OA 5JFOA 3MTJA 1TLTA 4BNUA 3ETGA 5F5LA 3DC2A 4XIJA 4DIOA 1PJBA 3ENNA 1W0CA 5COQA 1VL6A 4BO4A 3C1TA 5T67A 4IDDA 4U0KA 1QMGA 4ZD6A 3N58A 4PLGA 4K6CA 1PJQA 2Q4BA 4CLRB 5LDGA 3TFOA 1DC4A 1SMKA 1U3UA 4YJGB 3GGPA 1JWBB 3RD5A 1PEDA 3HADA 3WQQA 2JKVA 1CWUA 3COSA 3VZSA 4L74A 5JMPA 4CQMB 4YCAA 5T8KA 2VWGA 4WOKA 3ZNPA 1DEHA 3ZHXA 4FB5A 1WPQA 4M1QA 1SOWA 4DQVA 4AJLA 5CAEA 4BMVA 3F47A 3CMCO 4EYEA 4CQLA 3JQDA 5JO9A 3ROMA 2JAPA 3VPHA 1PJ2A 4Z9FA 3ZWNA 1DIAA 1HE5A 1BW9B 3MWDB 3OH8A 5A9SB 1SEVA 1I10A 1U3TA 2DTEA 1JW9B 1LQUA 1ZXLA 2FPPA 1QV7A 3K9QO 4GAEA 4Q3CA 5H81A 4O5OA 3QVWA 3I9MA 3MOGA 2W4QA 5CG1A 1V35A 5DDIP 1GCUA 4PRKA 3T7CA 1BHSA 1UJMA 4BNXA 4PVCA 2FWMX 3LYLA 1E3SA 2VOEA 5CEEA 1R4MB 4NHEA 2ZJ0A 1QV6A 4FSHA 2J8ZA 5AXDA 4CUJA 2E37A 1X14A 3GEGA 3PJGA 1E5QA 1MG0A 4IBOA 3B1FA 4BO2A 4HV4A 4RPGA 4MOWA 1KVSA 2EXXA 3GT0A 4HNGA 1GYPA 4KP7A 3WDSA 1FDTA 4J7CA 4BNLA 5KVSA 3A28A 4PLPA 1C0PA 2Q1UA 5CG2A 3PQDA 3OETA 1HE2A 3RUFA 4W82A 4NBTA 2CVZA 4FFRA 1DO8A 5I8ZA 4EZBA 1MLDA 3GNTA 4BB5A 5A03A 2JCYA 3OA2A 4F6CA 1HLDA 2WD7B 1YDEA 4E13A 3TSCA 3ZZNA 4E3ZA 2PD6A 3HN2A 2NUAA 1LRJA 4XIYA 2GN9A 3GVIA 5CDTA 3GRPA 4YT5A 5U1PA 1Z74A 2PH3A 1B16A 1BDBA 4A27A 2EWMA 2IZZA 2IYOA 3WWZA 1DFIA 2B5WA 3VH4A 2GNAA 3PIIA 3GFGA 2VTDA 4CMKA 1AXEA 2YJZA 4JBGA 3BYZA 4TRNA 1WW8A 3WMWA 3NGLA 4YRAA 2J3IA 4NMHA 4JNKA 4M55A 1PL8A 4UULA 1D3AA 3BIOA 1CETA 1SOVA 3NT2A 4L8VA 4CMIB 5BNTA 1GPJA 3JYNA 1MP0A 2X0RA 3GVXA 4ZA2A 4TVBA 3W4KA 5I9NA 3GZNB 4GX2A 2UDPA 5HRUA 5GZ1A 1Q0LA 1PTJA 1HKUA 4L4RA 1RKXA 1TT5A 4UVEA 4TZKA 2DTXA 2FSVA 4L75A 1NHWA 1Q7BA 4YQZA 3T7EA 1HSOA 2WJPA 4YR9A 3CEAA 3JQEA 4IJUA 3N7UA 5IJZA 2J3JA 4K1LA 4E5YA 1UXHA 3ZV5A 1LC3A 3P19A 3ROPA 2GZ1A 1I2BA 3DONA 1EVJA 4TQGA 4YT8A 4KZPA 3WBBA 1QORA 1VSVA 1NR1A 1G0NA 3ADOA 4CM5A 2YQ4A 2FSSA 1A27A 4IQ8A 4J1NA 4CLXA 1OC4A 3EY4A 2OO5A 2C0CA 3QIVA 1YJQA 2ZTUA 5TJHA 4G2NA 2EERA 4HY3A 3CKYA 1LBEA 1I33A 1LTHR 2EJVA 3DAGA 2DPGA 5T6BA 2D5CA 3F3SA 4H15A 4C7KA 2VRBA 2FMUA 4GLLA 1T1SA 3IIEA 5DT9A 1N7GA 5DNAA 1IZ0A 1YQGA 2NNLD 4WGGA 4R68A 3Q11A 4KMSA 1K3TA 2WDZA 5DBGA 3D5QA 3S2IA 4BNHA 4J1TA 4WECA 4QO7A 3U09A 4J0FA 3C1AA 1ISJA 3PHLA 5TC4A 4U8GA 2EKPA 1B14A 4TKLA 2VHWA 1H2HA 4TSKA 2X5KO 4NI5A 3ZU5A 3TZ6A 1I32A 4RVUA 4R41A 3BHJA 4IDCA 4L4SA 3QWBA 4OXKA 4BNTA 3GOHA 4TRJA 4P4NA 3WTBA 2NU6A 3NT5A 1T4BA 4J4HA 1VJTA 4OQYA 3ZNNA 4PG8A 3MOIA 2VWPA 5DF1A 4D46A 3G3EA 2O7QA 2YDYA 5JE8A 3IS3A 3WXBA 2O3SA 4JJFA 4OAQA 4GVXA 3AY3A 1ADFA 1N1EA 3Q3CA 4II2A 1MC5A 3KRTA 3DOJA 3NDIA 4W4TA 4E21A 2E48A 4W7IA 2VUUA 4WLOA 3CMMA 1MFZA 2VTEA 1DLIA 5G4KA 1P1HA 4RL6A 2HMWA 4XJSA 4XJTA 4BHTA 3HDQA 4P8RA 2FR1A 4KQWA 1BXKA 1ISMA 5JS6A 1ONNA 1UDCA 3K2EA 3FHLA 3B70A 5ER6A 3ZDFA 1ZH8A 1HYHA 4DLLA 4ZQFA 4XYBA 4KDEA 4R5HA 3WBFA 1V3UA 1B8PA 3DBLA 4IS2A 3FNEA 3JQAA 3EZYA 4WCFA 4D0RA 3DBRA 5FI5A 5A04A 4OOEA 2P2SA 1E7MA 4BNJA 5IF3A 3OFSA 2UUOA 1B0AA 4IMRA 5TLSA 1KS9A 3OICA 1FDVA 1PGPA 1XIVA 5EIOA 2YFHA 2Y0DA 4BO9A 1UAYA 3JD4A 2IE0A 1JVBA 1KVUA 1ADGA 5C5IA 5KVCA 3FTNA 4I5GA 3HQ4O 3HE3A 2ZQYA 1MXFA 2ET6A 4FC6A 4TZTA 2Y68A 3NJ8A 1I3MA 2B83A 3DMTA 2AW5A 7MDHA 3KHUA 4RPLA 2JD2A 3PQFA 4LVUA 3U4CA 3DMYA 1E3EA 3INRA 1LSJA 1A4UA 1PS9A 3QE3A 3QWFA 4FJ0A 4TROA 1KEVA 3PJEA 1U4OA 1AE1A 1GYRA 2AEMA 1WMAA 1X13A 3K8ZA 2G76A 3LT0A 4J91A 2Q1TA 3ZNQA 4U7WA 3HN7A 2J5QA 4CODB 1Q0HA 4IDFA 3ADPA 3DZJA 3VC7A 3EVTA 1LDMA 2I67A 1GPDG 4RF4A 1TB4A 3JQ9C 1D7OA 1JKIA 1H9BA 1I0ZA 4IINA 6LDHA 4NJOA 1ZJZA 2BH9A 2GO1A 2NU8A 3GF4A 4LN1A 1JWAB 4PZCA 1RM0A 1UXJA 4F3YA 2O3TA 1KEPA 1O0SA 4EGFA 4YACA 3S8MA 5B12A 4YAGA 3IOYA 2C7VA 4CL3A 1M76A 2G0TA 1E5LA 3RKRA 4YQYA 1ISHA 3KEOA 2I9PA 4CMHA 1DRUA 2O4UX 1T2FA 4UVDA 2NQTA 5K6AA 2IEBA 3U49A 4DA9A 1XGKA 1U9JA 3B20A 4I9UA 2PFGA 1IUKA 1ADBA 4K26A 5IFLA 2JHGA 3QW2A 4J90A 5FF9A 1NM5A 4JROA 3W8EA 4PVDA 3EC7A 4Q39A 1KOLA 1CJCA 2EKLA 3BTVA 4DREA 1T25A 3JD0A 2QIOA 1YONA 2I66A 2NU9A 1F14A 1KVQA 4B3HA 2AXQA 5F1PA 1FXSA 2WM3A 1NYTA 1KY5A 1UXGA 3QSGA 4GWGA 3WGQA 3GAFA 1QG6A 1PJLA 3FWNA 4OO3A 3ON5A 4DL9A 3WGZA 5F3RA 5G4KB 1FJHA 5JY1A 2Q1SA 4ZICA 1E1LA 1SC6A 3F5QA 3HZZA 5EJ2A 4JN6B 4CJXA 3OM9A 4E5KA 3PHIA 1WDKA 3P7MA 4CR7A 4R9RA 1Q2XA 1ADCA 2B36A 4WOJA 1I3LA 3TZQA 2CY0A 1P45A 1NVTA 2YV1A 3ZV6A 1E1NA 1IE3A 4MVJA 1N9GB 4UEJA 5ILOA 3EGOA 3F6YA 3JQAB 4HNHA 4YRBA 4NBVA 3DBRB 3DOCA 4RPKA 4N54A 4CM6A 1GUFA 3RSHA 5COBA 3UUWA 1DC5A 1BG6A 5TRTA 4XR4A 1H6CA 2GR9A 1CRWG 3WR5A 1HWYA 4JBIA 4A5OA 4AG3A 2ZTMA 1RM5A 1NFQA 5BQFA 1LA2A 4DYVA 3TL3A 4BVAA 1PGJA 1C0IA 4WEQA 3JQGA 3OJOA 4DLAA 1E77A 4MP6A 4OXYA 1NVMB 3DEYX 1PJTA 2Q50A 4D0SA 4CM7A 4BGUA 4FFMA 4RQUA 4EJMA 2GD1O 3GFBA 4PLWA 2HMTA 3AK4A 2OBYA 2VHXA 2J5KA 1P9LA 1YQXA 3LC2O 3PWZA 1GQQA 4O1MA 2JHFA 2ZB4A 3V2GA 3ZW8A 1JN0A 5DOZA 1CQJA 4J3FA 4U6QA 1EDZA 1JQBA 4LCJA 3EUWA 4RZHA 2PY6A 5ES3A 2D5AA 5L3ZA 2BMAA 1PR9A 3GH3A 3D4PA 3WLEA 2WWRA 1TVEA 4OM8A 5DZSA 1WAMA 2H9IA 4DMMA 5BSEA 5F21A 2CD9A 4J1QA 2NACA 2DKNA 3QY9A 4RV9A 1ZEJA 3AUUA 3ZCXA 4R3NA 1WZEA 1XKQA 4MVJI 1MV8A 2VRCA 2P68A 1YWGO 4AJHA 4DMLA 1KEWA 2VT2A 4A7PA 4E2YA 1QR6A 3AU9A 5CPFA 5JC8A 1ZNQO 3OMLA 2OZPA 1YOVA 3GHHA 4J16A 4CL8A 1NHGA 2Y1EA 2EV9A 3TDKA 3GVPA 3V1UA 2HSDA 3H7AA 3AFNA 1GZ4A 3K5PA 2DFVA 1PZEA 1UP7A 5C7OO 1PWZA 3ABIA 4IPTA 4P4LA 1E7YA 1QYVA 3LLVA 1DDOA 3QVSA 4OOFA 4WLNA 3AFMA 2QYTA 1EE2A 1JKFA 4J43A 3D1LA 4JP3A 3RROA 3KM0A 4WLUA 5H83A 4CLHA 4XQCA 3RASA 3GPDG 5T57A 2Q3EA 4WPGA 4GVLA 4YJGA 4OHUA 3OIFA 4DXHA 5JCXA 1YGYA 1E1KA 4OSOA 5JAMA 4H16A 4NH4A 3IL2A 2DBVO 3L6DA 3NRCA 4IGFA 4LGVA 4B7UA 3HG7A 3TWOA 3VAZA 4CQMA 4ZQBA 4AJ1A 3AJRA 3GMSA 2QRJA 1GEEA 1LU9A 1PQPA 1DBVO 2RH4A 3HHPA 3NKLA 5JAIA 3E1KA 3MJ4A 3OHSX 4IZIA 1D8AA 3CSDA 4BGIA 2YFQA 4MVJE 3FR7A 2NVBA 1PIWA 2JD0A 3PHJA 1BW9A 4GI2A 2AEFA 4PIVA 4MVJP 4E31A 5A9SA 2AE1A 5DP1A 3G79A 2E6UX 2Q2WA 4GLOA 4QTZA 2GN8A 4BV8A 5L95A 1WDMA 4NG5A 1I24A 4JQCA 3DZKA 3I6QA 4CLDA 4B7CA 5F1OA 4UUPA 5FEUA 2AQ8A 5KKCA 4Y8VA 1C3VA 1R16A 1U3WA 1ZIDA 2OP1A 4IJWA 1ZSYA 2DTDA 2TMDA 4DBVO 2AQIA 4JLWA 2J3KA 3U9LA 3HWRA 3PTZA 3GGGA 5TT0A 2PKQO 3JYQA 3E82A 2IXBA 1EBUA 1V0JA 4BNIA 1DIHA 3OA0A 4I8XA 3BMOB 3DZBA 3R3JA 4GKVA 3VTFA 3A4VA 4YJHB 1FMCA 3CPSA 4ZVVA 4RZIA 4Q3DA 4BKPA 2DAPA 1PJSA 4D7AA 4DWVA 4PG5A 2R6JA 3IAHA 3RUCA 2X4GA 1CIVA 3CH6A 1U2DA 1ID1A 2O3UA 4YRDA 2HU2A 1C1DB 5CDSA 1PZFA 2I3AA 1W6UA 3GA0A 1DOHA 4XYEA 5TJ9A 4XGNA 6ADHA 3U3XA 1O8CA 1I36A 2DFDA 4FFPA 1E0DA 2O23A 1XSEA 3WYCA 3BMNB 1MC4A 3OQ6A 2P4HX 2HJRA 3I9NA 4E2ZA 4CM1A 4ZGWA 2VRCD 2WD7A 3HJAA 5L45A 1AHHA 2QYSA 3L6OO 3H9UA 1DXYA 2YHUA 2YV2A 4E4YA 1CYDA 3IKVA 2NVWA 2GZ3A 2FHSA 4CV1A 1C14A 5TIIA 3WYBA 3SC4A 2PZMA 4ALJA 1WMBA 3U62A 4D79A 4PLFA 1TT7A 4S3MA 3M1AA 3A9WA 1ENOA 1UDAA 2CSUA 3WFIA 2D3TA 5G0WA 4ZHSA 5HWSA 2XF8A 1GCOA 3PWKA 2A94A 4QECA 4IDEA 1KIFA 2B0JA 4CMIA 1UZMA 4WLEA 3BTOA 5GMOA 4YAKA 2HMSA 2VOJA 4KUGA 1VJ1A 4LRSB 4MVJM 1GQ2A 3GZNA 5IN5A 2HQ1A 3OJLA 4CPDA 1BSVA 2HUNA 3V2UA 4XQ9A 4CQMD 1QYDA 5TSDA 2ZB8A 3ZH2A 3ZWYA 4IGEA 4EUHA 2Z1MA 3KO8A 5B1YA 4PLHA 1PGNA 1GTMA 1ZSVA 2EG9A 1O6ZA 2DVMA 4HX5A 3HDJA 4AJJA 1WP4A 1R0KA 4BNZA 5AVOA 1E92A 4YDRA 4CV3A 2X0IA 1MX3A 3WJ7A 3Q1LA 5HBRA 4NDNE 3D7LA 4YBZA 2Q1WA 4HFNA 4E12A 3DAFA 4MP8A 4CV0A 1EBFA 3UF0A 3JV7A 2VZ0A 4IZHA 1YO6A 1OAAA 1PS0A 4UAGA 4GMGA 4NFHA 4OSPA 4BGVA 2Q46A 1ZXBA 1Y1PA 4RVSA 5HS4A 4DYDA 4JGBA 4DIBA 1QSGA 4CM3A 2DBRA 4NFSA 3NDJA 3BMQB 2X0JA 2NSDA 3L4SO 1U5AA 1GD1O 1U1IA 5DULA 1KY4A 4YT4A 4M89A 4MO2A 1ML3A 2FN7A 1LJ8A 1YBVA 2XXBA 3HNPA 2VZ8A 3WSWA 5COAA 2NVUB 3PDJA 5JPIA 2RCYA 1U7HA 4CLEA 1M2WA 3KYDB 4B3JA 5IXSA 5JDIC 1AUPA 2EEZA 1T4DA 2PR2A 4KUHA 3F4BA 2X9GA 1R4NB 5F5NA 3LVFO 2YDXA 3DWFA 3F46A 3HUDA 1NQTA 3I1JA 4EJ6A 5IDWA 5JDCA 5G0UA 4BQRA 4E32A 1P3DA 1SAYA 1ZK0A 1QKIA 2QHXA 4TKMA 2RBEA 2VUSA 4MKZA 5F1KA 3GEDA 1E3JA 1PWXA 3GNSA 3RVDA 4XDZA 1YVEI 4RF5A 1EE9A 3RWBA 5CEFA 1U28A 2DLDA 2H63A 3B1JA 1NBOA 1LLQA 2B37A 3DXFA 5AQ1A 3QJ5A 1DIRA 4MJLA 2CF5A 3QA9A 4CM9A 3D0OA 4YAJA 3A14A 2EP5A 4PZDA 1YBAA
chains in the Genus database with same CATH superfamily
3H3XA 1V8BA 4NP6A 4F85A 4TVSA 4G8DA 4MUJA 4RENA 5BSWA 5TQVA 1OHHD 3CHYA 4BVBA 4X7PA 3S70A 3P0JA 1ATZA 4AROA 2H06A 2HMVA 5T3UA 1XHLA 3BTUA 1D2CA 1YE5A 3I64A 2AL7A 3ZE9A 4NX2A 2J0VA 3GLFB 2VPWA 1RXVA 1WBDA 3UJ8A 4BCBA 1EG2A 2HWKA 3LVQE 3RVPA 3G5TA 3F9IA 3QPVA 1IZZA 4KO8A 4NOMA 5KYVA 4Z2AA 3OM1A 3NKFA 5DV9A 3PLNA 2IEIA 2XYQA 5KCZA 1WU7A 2RC5A 4G0VA 3DLTA 5FH9A 1Z26A 3DZGA 3C6BA 5ADHA 4O4IA 1RBQA 2VXOA 4P7FA 5GGXA 4KIJA 4CXMA 1H2RS 1NQ5A 2Y27A 1RLTA 3EXIB 4RGQA 5BPFA 1ODLA 1XTVA 5JH7A 2JDIA 4PG4A 4AC9A 3NTUA 4K2AA 4LZLA 5IAJA 3QBVA 3N0WA 5BMVA 4N48A 1ZSNA 3AVQA 1D2EA 1S8NA 1T3ZA 1WJGA 2ZIAA 3GCDA 4FGLA 3W3AH 1KJYA 2C78A 5ALXA 4G0NA 1H0RA 4DLYA 1KR5A 1C4OA 4DG9A 2QRLA 4KPYA 3M89A 4IJKA 1II9A 3LU1A 4N5LA 2C2GA 4WADA 3IEMA 1XRSB 1CDOA 1KFCB 4LSMA 2JJQA 2J3HA 1GGFA 1HFEL 3FDZB 5BORA 4AM8A 2JFHA 2FPIB 4OPMA 2B7CA 5F7JA 1XFAA 3TOXA 2FWBA 1O94A 4RM3A 3GLIA 3A05A 3MB5A 5JZSA 3RYFA 1XZKA 2Q2VA 5HYVA 2DF8A 3R3HA 3A04A 4QYIA 1YQQA 2GWRA 2WE8A 4Q9IA 5ELXA 1X7DA 2C2XA 4LHZA 4P83A 3DEZA 5IK2D 1V5IA 4WLFA 1KDOA 3LIIA 3RVQA 1WWKA 3UENA 3JQ7B 3ZWOA 3NIFB 4DUPA 3R5SA 1GFZA 2VYNA 2SCUA 1IQUA 4JMPA 1NLMA 1SZDA 3RV3A 5KDLA 3UCFA 2CEAA 2IS1A 2GKOA 4Q9HA 3M6FA 4TXHA 4R2WA 4YJ3F 4FZ3A 4J0JA 3KKMA 4JOCA 4AP9A 3H2IA 4JC8A 1AZSC 1C1XB 1YB1A 3W6NA 3WRYA 2OPHA 3P0RA 1P2SA 3QLTA 2FJ0A 4LDJA 2HF2A 1PLKA 2GUWA 2Q4TA 3F7NA 3GRFA 3U4IA 5B7QA 5JSZB 4ND1A 4DMGA 3NV9A 1G55A 4KDFA 3E4DA 2C1XA 2X0NA 4GUAA 5ITZB 4QAJA 3WBJA 4ZQHA 2A4MA 2Z5FA 1TA0A 3UGKA 2IY7A 3G9TA 4OKNA 5E0OA 3IVXA 3OX3A 4ZI2A 1T5BA 5CA0F 2OZVA 4MQFA 2LRHA 2QNBA 1KK2A 1WULS 2QTFA 1ORWA 1SQ5A 4IXNA 4HDOB 1J22A 2IYEA 5TF0A 3VC1A 2F8LA 4H7DA 4IM7A 4ZQEA 4CI0B 4EJ0A 4UQOA 1IB6A 3WK9A 2RMKA 1E1MA 2BFEA 2BELA 4G0YA 1SWVA 3RC8A 3UJHA 1HE4A 4G5OA 2DY1A 3TO5A 3WL7A 1A9XA 2O7SA 3CY6A 2J1LA 4A3SA 3RSGA 4ESVA 2XKJE 1YKSA 3PZBA 2FN8A 1GGJA 2CFTA 4IUYA 1R6DA 4MYCA 4L1KA 1DAPA 1N6RA 1IOLA 4CTJA 3JQ9A 1EUDA 2O6LA 3A6EA 1ZMBA 4G23A 3IEPA 4JBXA 4RLHA 1U0RA 2V7TA 1XDGA 5HMMA 1PSDA 1EHCA 1VA5A 2V3WA 4NK4A 1OYYA 2Q2QA 1QAOA 3R0XA 4M54A 4Y67A 3TVDA 3IJPA 3V1LA 2GCPA 4BATA 2QTAA 2JAHA 2Q3HA 3S5UA 1BE0A 1VMKA 1Z6YA 2CCGA 5BNIA 4Z1OA 4Z2YA 3AFHA 3OX2A 5ANRB 3TQOA 4RMNA 4QGSA 1K27A 1E6EA 4OGWA 1YQDA 4U3JA 3QY0A 3ZDBA 1N9GA 2PGJA 2IHBA 3L18A 3ZD6A 2AHOA 3QJYA 4JYBA 2ZBPA 3GMDA 2H4XA 1IULA 5JBNA 1HLPA 1O3YA 1Z5NA 2XITA 1A9YA 4G63A 4CEJB 2Z58A 1H5QA 3DVRX 2I5PO 1GKKA 5IT0A 2J09A 4RIEA 5J2UB 3ISTA 4ZAGA 2ZE7A 1O4WA 1NXQA 1F0YA 2NIPA 2NADA 4ZWNA 1W35A 3EZLA 3NWJA 1GQRA 3QU4A 4LYGA 3A10A 1A2KC 3OT1A 4MW6A 4O4IB 1WQ3A 4W5WA 3H2ZA 4AP6A 3SC2A 1CS4C 5KQRA 2C8JA 4Q4AA 2C4VA 3UJBA 3ZXXA 3GVHA 4A2PA 1CQPA 4D3FA 4XYLA 2AI1A 1DE0A 1NATA 4HSGA 3VYVA 5JH7B 1B41A 1XC7A 1Q7GA 1DRVA 2DU8A 2I76A 2WNIA 3KR0A 3PJFA 4FGWA 4YHHB 3GT7A 1MABA 4FFDA 3KJHA 3SM3A 4MRAA 3FGNA 1J8YF 1WF3A 2BCJQ 4B7ZA 5UKDA 1RTTA 3ENZA 4EW1A 2NM0A 5JCJA 5ITWA 2VAWA 3I2FA 3H3FA 2POQX 3N74A 1MN6A 3ESDA 1G4HA 3ZV3A 3NC0C 4OATA 4DG5A 5ADUS 3D2CA 4WBXC 1TYCA 5IVHA 2D0PB 1SC4A 2GRUA 5KB3A 1M8GA 3MTGA 3LAWA 2OP0A 2O5RA 3GGDA 3SIXA 5AQEA 4AZSA 1I01A 1DJOA 2ZVPX 4RQAA 3I9V6 1X3LA 2D2XA 2XVYA 3C41J 4ZVTA 5EE9A 3ZWBA 2ZREA 3O4JA 2CLMB 4BNGA 2H3EA 4R8LA 3NXSA 5EJGA 4F86A 3AHIA 3G2KA 3OKCA 1G21E 2ZAMA 3JQFC 5DN6D 3TGLA 3R0ZA 2ZIUB 3LQKA 2Y8EA 1ULAA 2F3UA 1RP7A 4TMXA 3L79A 4CKZA 2NP7A 2GSWA 2KMLA 1XZPA 3MN1A 4JVNA 1OZGA 3U1TA 1U6KA 4MUYA 1O9GA 3IB6A 4PZAA 4WNIA 3OCWA 1QQ6A 4PNZA 2DSTA 2OCGA 4DHWA 1DCKA 3A9SA 4II7A 4R8SA 4UDXX 1YB6A 3ZHSA 4ISBA 4R1NA 3C6ZA 1U1FA 1BX0A 4RGVA 3P9QA 3PBKA 4FGSA 1S89A 2N1MA 1ZX1A 3R6LA 2FX2A 4FD3A 2ZUTA 4EB6B 2ANCA 4OGLA 3V8MA 3WK7A 3C6KA 3OLXA 3TIXB 4NBLA 1ZVQA 2VDMB 1PR3A 4PY2A 4BNDB 5BQXA 4Y1GA 2JJ8A 4MV3A 2C9CA 2H18A 4ICIA 5U4XA 4L4UA 3QU9A 1MXHA 1HMPA 2UZIR 2M6SA 4L0QA 1HKHA 2IT1A 5E9WA 4ALMA 5BN4A 3DV0B 4AAYA 3KKLA 5JNSA 2XMZA 2HPVA 3V00A 4MKXA 1TNDA 4MB2A 2DZDA 2WJZB 5EP1A 3HCPA 1ZJ4A 1F4LA 3G2QA 1TF2A 2CZCA 3A37A 3VTZA 1N6KA 4Q9NA 5DCLA 4PGFA 1U0SY 3S29A 3Q4GA 4FT2A 2BFEB 2IPLA 1UXKA 2Q7OE 3ZHBA 2VP6A 4WUVA 3TIVA 3CVYA 1EX1A 2VHQA 1W30A 1PHRA 2HMUA 4OHCA 3F5FA 1LBHA 4X5OA 1JU9A 3U4QA 2R87A 1C50A 1CFZA 2AG6A 2PKXA 4IGAA 3AR8A 5H68A 4FZJA 2A7XA 1SKAA 3OLWA 5I9LA 1QPZA 1JLLA 3DG9A 4QELA 1DEAA 3DMHA 3L9XA 4GE0A 4JCOA 5GZ3A 1ZR2A 4U2BA 4FFOA 3VR1A 3LBIA 2AOUA 3ONDA 3VPCA 2PX3A 4G81A 2QM3A 2G4VA 1JHPA 2B5VA 3AEQA 4L50A 2C5SA 4UU8A 1IZ7A 4FLEA 4Q21A 4R54A 1SK9A 4YJFA 2GTIA 3H1TA 5TV2A 1GTL1 1SIWA 3DEAA 4B32A 1XK7A 3HXOA 3TOVA 2O2GA 4D4LA 1NW7A 3ZY6A 1WOMA 3HACA 1JEDA 3PYLA 4QUGA 1JIQA 3UJPA 3S8EA 3SXUA 3SIPA 5JI3E 2P8JA 4C78A 3H5WA 2WG2A 2J9ZB 3JAMA 4TRMA 1QG4A 2PJZA 2EFHB 1Z4JA 3IQDB 2VH2A 4H4CA 4RESA 5B2FA 3G5AA 1DXHA 1OYOA 3AUYA 3GFPA 4MUKA 4M49A 1PKXA 3EAFA 1Y98A 4B6RA 8MHTA 4RCVA 4BX3A 1FA9A 4RORA 1IZYA 4KYIB 3I5MA 1OI7A 1DJLA 3MWEB 1E1RA 1SQ0A 3ILHA 4I9GA 6NULA 4O25A 4LHEA 4RE6A 2OOSA 2Q8QA 1OGIA 1Y7PA 4Z9AA 3OP4A 4K86A 1GUYA 1PR6A 2H92A 2ZB7A 3BMOA 3FPSA 4FX5A 4K9MA 4L9RA 2VK2A 3TKYA 3EMDA 2C2YA 4G86A 1QIIA 4B6EA 2FPUA 1R8QA 1ZD1A 3K0CC 5SZJA 2Z2ZA 3F5SA 4PZ0A 4YROA 5IZ4A 4MV0A 3T38A 3DDHA 5KCMA 5CDUA 2N46A 1JIJA 3IJ5A 5K4AA 1XWWA 4MQ6A 3K92A 3PKIA 4PGHA 2PV7A 5C7LO 3MT8A 1RI2A 3N8IA 2O0KA 4URXR 1AGPA 3U4MA 4B81A 3L49A 3R3XA 4DDTA 1D4FA 2VHYA 3RTDA 1E9AA 5CIQA 3F7MA 5K6AC 2LKDA 2G5GX 3UQYS 2DT5A 3LUCA 1SU6A 3HCBA 5FPSA 5SZKB 1DKRA 4M0UA 4CKBA 1R37A 2DPMA 2W4IA 1DC7A 2XDAA 3GJ5A 4V39A 4BB6A 2N1BA 4Z7NB 2PYDA 3AQIA 3LQQA 1J49A 3N87A 4MQMA 3AY6A 4R9SA 2A92A 2OSVA 2QV0A 1W85B 4NOKA 1FMFA 3A3PA 3RRJA 4F6RB 1DQYA 3MAJA 1E2BA 5DM2A 5AJHA 1CERA 4S05A 1Z2EA 3ZDZB 3KKOA 1X7HA 1YH3A 2PPLA 3T35A 1BS9A 3I8OA 2OHIA 3L8YA 2FRXA 3O82A 1VRWA 4LQDA 5MHTA 2O3RA 4UM5A 3ETCA 3RSQA 3KLMX 3G17A 4BNMA 3IQIX 1GV1A 5AI6A 2QSUA 3KQYA 4ZCPA 3GRKA 1WW2A 2AFIA 1AQJA 1DWUA 3IGFA 3ZWAA 2OE2A 3AVUA 3QZUA 2Q8NA 4OP1A 3QYAA 3U7QB 4EARA 1H0KA 5HFJA 1SHLA 2OKGA 4H0NA 2GK6A 1NVXQ 1EUCB 2PU7A 3ONEA 5E1MA 1P3JA 2VN8A 4G0ZA 2QXTA 1QRTA 5F52A 3AL3A 1NP6A 1D1SA 3M3DA 5K8JB 2IQIA 2YZ2A 4JB3A 4BZPA 2A0WA 1Q14A 3BG5A 4HNAA 3M6MD 4HAWA 4H17A 1DP4A 2QS9A 3FROA 4IO0A 3UT5B 4NPHA 3CH7A 1YFLA 3ABSB 5EPUA 1FFDA 4J94A 3G5MA 4DIFA 1UOQA 4R1PA 1U94A 4ZDWA 1R5JA 1LRLA 5DBEX 1TIPA 5J4HA 4G4IA 1V8DA 1HT0A 5EUBA 1K8YB 3MLEA 1P61B 4GR5A 4AMUA 2IOQA 1LPBB 3UXMA 4B8WA 1T6NA 1SCQA 3L8HA 4K9DA 4DHEA 4HUJA 4HSEA 3L0IB 4MMXB 5ALWA 5IZCC 3KXKA 3SICE 1HC7A 1CVIA 2JJ2D 4H60A 3NAGA 4J2HA 2XT0A 3RS8A 4ZTZB 2ZT7A 3VR4A 4XB1A 4JI4B 4DZRA 2AOUB 4TKVA 3T94A 4RA6B 3P45A 1J6UA 4KXNA 1Q0UA 1H6BA 1Y7IA 2Z8ZA 1E89A 1IM5A 1OFIA 1SUWA 1PJ3A 2YMQA 4V02A 2EX0A 4YJFB 1R8XA 1XZFA 2W6ZA 1H94A 2CNWA 3D4IA 5LXTA 4G01B 4IDHA 1A9QA 4W9RA 5JLAA 5BT8A 3RC9A 3T7RA 2CLKB 2IW1A 1J2YA 3HL0A 1BCSA 1CHNA 2QLFA 2ZRGA 4V1CA 4QGAA 2NXEA 4KKXB 3GT3A 2I8CA 4CG3A 5FWXA 3K73O 3CUKA 1MF7A 5DN9A 3FKSA 2B4KA 3RR2A 2P4SA 1E6UA 1DAEA 2AOTA 4EA7A 4PPGA 5JARA 3FDFA 3IHLA 3L1KA 3RWMB 1JLKA 5LA6B 5JV5A 3REGA 1AXRA 1PK9A 2CFCA 2LDBA 1R4NA 4COOA 2KX7A 3LOPA 5IRCD 3PEWA 2N9UA 3LK7A 4EO7A 3KUUA 1CEEA 3HK2A 4ZCMA 1XCLA 3D6AA 2ZJAA 4DR1B 2OV6A 4U5QA 4Y9SA 4OCZA 2FW9A 4ZU1X 4B79A 3NB0A 4A91A 4C4AA 4GZ5A 3M5DA 1NUAA 3SE0A 1WABA 4K5QA 4F60A 2Z4RA 3K96A 3ITKA 3VZRA 2CW5A 5I5EA 1X77A 3KE8A 4UEWA 2IZ7A 3HB4X 4KE7A 5MN5A 1TM7E 5DM1A 1H85A 5BW5A 1A8QA 1UP4A 1J5PA 3C4VA 3N2LA 5GWXA 1CJUC 1HXHA 1KI6B 1G9XA 2FUG1 1RQ7A 3RUAA 5GOZA 4PHCA 5FLEX 3NIDB 2PZAA 3IIIA 5A5GA 1NTOA 3ADBA 2YYSA 5CX1A 1OH5A 4J2TA 4HGYA 1WW3A 2WSIA 1UDBA 4C1BA 1EXDA 3A27A 3V2HA 1R15A 1OFTA 4Y9DA 4GQAA 1JJBA 3D4NA 5KWSA 3D8SA 1GL6A 1RQXA 1E1CA 4EW2A 1K2VN 1YBHA 2A59A 2BFFB 2ZDHA 3O5AA 3HR8A 1OBFO 4E2WA 4F5EA 1GA6A 3H05A 3PFWO 3TPZA 3ZJ4A 5DRTA 3NYRA 1QF9A 3S7TA 1D6JA 4YI3A 2IU4A 3UK7A 4DRZA 2QMYA 3HYNA 2KM1A 4K9KA 3RJ5A 1X38A 2CNBA 4ANFA 4LVNA 1I3NA 1TUIA 5DHAA 4BZXA 3PFCA 1QH8A 2DFNA 2CNOA 2PFKA 4NCKA 3QMMA 4B3IA 4UAJA 1A1VA 2BDUA 4V0NA 1T35A 4C4XA 2ZJ5A 2KQUA 2JS7A 5ARDA 2RGAA 2W6JD 4V0LA 3L8ZA 2KI5A 4TSRA 2TMYA 2CFSA 1JVSA 3GRAA 3TXXA 3W7AA 3RF7A 4A2CA 4F2DA 2F1KA 4OGGA 1ORVA 2XUIA 4M7WA 2QRVA 5B3KA 1YZHA 1NVAA 1SEPA 2OORC 4BWVA 2P6PA 2LTAA 4DJTA 1O97C 1NDUA 5TX7A 1C2YA 2Z6VA 3GJQA 2PWBA 4FFLA 3IPXA 3ZVLA 2PSFA 3STVA 5FDFA 4ND4A 1AKTA 1N36B 1QB7A 1YL7A 4EABA 3FA2A 4Q03A 1W36C 2WM2A 1PD0A 1I6KA 3H9JA 2IZ6A 4ZT6A 1DNPA 4J7UA 2J85A 4Z6KA 3EPKA 1CRQA 5BW4A 2EJCA 2A5GA 3CTMA 3QVOA 5J63A 5BWCA 5LOVA 2HA5A 2QI9F 3NATA 2O8BA 4IHJB 1XRRA 3G0HA 2WZCA 3UKDA 3VHLB 4HVCA 3AINA 1SZCA 3QBEA 5IC4A 3F6PA 2AWOA 2WUDA 3ECSA 5LPNA 1VSQA 4PC2A 3VU1A 5TQJA 2YYAA 4D41A 3ZXSA 1I6WA 5THXA 2Q5JA 4HLQB 1LK7A 1NW9B 4IJMA 1WUHS 5HF6A 5KS2A 2H17A 2BFCA 4AF8A 4XWGA 1TTTA 4YCJA 4PONA 2DCMA 2EBFX 3DE6X 1C9EA 2AZDA 3FM9A 3W4IA 1TZMA 3CT6A 1S7CA 5B2ZA 3I6YA 5ESXA 5EC8A 1E1YA 2C9OA 4C5AA 3Q9UA 4YCNA 2WP8J 4WI1A 1PLJA 4JITA 4Y98A 1UODA 2GLXA 2NUBA 4XASA 3TIGA 2IZ1A 5AO9A 4G1FA 2JBWA 1R0YA 5HKOA 5BMOA 3CLSD 2GERA 3DV9A 1XRJA 1CDDA 1X0VA 1Z33A 2E21A 1K86A 3DB2A 3GFVA 3OOHA 4HDRA 4LWPA 4PW0A 3TGPA 4E88A 4QUJA 4KVFA 2QMQA 3LCVB 3F71A 1PD1A 1GAWA 1ZL0A 4OB6A 1QIDA 2GPJA 5GONB 6GPBA 1BVHA 1U1GA 3MWYW 1PYOA 1RKQA 3RVLA 3ZDRA 2ABWA 4EHKA 3SAJA 3QF4B 4UJ3A 1ABBA 1XF1A 4EAQA 2VS1A 4UM9B 4RGBA 4M9CA 3KB8A 2ZI4A 1Z6XA 1EXMA 4EG8A 2R0QC 3FBGA 4LFCB 2Z2JA 1RWNA 5JSQA 1LH0A 1TI7A 2FR0A 2C3MA 3GUYA 1K8ZB 2SECE 4ALIA 2PZLA 2JHCA 5CM8B 1UKZA 1EHYA 3GDGA 4X1KA 4YEDA 1U0LA 2AF3C 3CRRA 1GGNA 4NIMA 4XAQA 5DP2A 2I1LA 4U9IS 3O83A 3GR6A 4UEOA 2ZCUA 4KAAA 3N8GA 1P19A 4MKIA 2ZU6A 2B78A 5CX1B 1K6JA 1NJ2A 1UUFA 1O7JA 1ZEMA 3KVRA 2PQ0A 1NXVA 3A4MA 1THGA 1B3BA 1XZJA 2QNRA 4IQGA 4UXHA 4A8TA 3F4LA 4D9KA 1CUXA 2FZ5A 4DZTA 4DB4A 1ZOIA 4CF4A 4XWYA 3W2HA 3KETA 3SG0A 3TLZA 1SZJG 4O4JF 2FEAA 5I3ZA 4Z99A 5IW8A 2X5OA 5D51S 1CD5A 4Q48A 1RT9A 3W4JA 1U04A 3A8TA 3PS9A 3O4HA 4GX5A 4XM0A 5KSPA 2WY2D 4GPAA 1JP7A 4FJ2A 3TSZA 2ZXEA 3EMKA 4UVIA 4D2IA 4MW2A 5CFNA 3ZIUA 4GKBA 4S1TA 2ONJA 4TVKA 5DTQA 1JA9A 4YPVA 4HI0E 3HKEA 3QVKA 1V1RB 3NW9A 1N2EA 3O6VA 4AMZA 5HGXA 3KHSA 2VWHA 1JR6A 3DNPA 3L8GA 4IDNA 2JIZD 1PR0A 4RSGA 5T8KC 2AXPA 3CR8A 4MRMA 3VKVA 3VR3D 4DRXB 2RGEA 1R64A 1TM4E 4E08A 1GN9A 4JLBA 2XUOA 3O2JA 3ZOZA 1WLYA 2AIRA 4ML3A 4RABA 4BE7B 4LRQA 5KJFA 3K6SB 4JEIA 4DV6B 1QCCA 5G1OA 2QVBA 4XLTA 1LSUA 5FPQA 2NPFA 4BEBA 4YQEA 5BN3A 1JA1A 2G07A 2X9LA 2Z9DA 1ZLXA 2QLTA 1WE2A 2FZEA 2R1TA 2HX1A 3MJSA 3O21A 4FMDB 1Y4UA 1XYVA 4HDSA 4OQFA 5D7BA 1HM5A 4UNNA 2ANBA 3GB9A 5LQJA 1P73A 1YD7A 3QENA 4WJZA 5ECDA 4FKBA 4MUFA 4EATA 1TU4A 2BM9A 4ZXPA 5DO9A 1EVYA 1T8UA 2OILA 3DE3X 3RB8A 4CMEA 4DXDA 1NIPA 1IY2A 3ETEA 5LOVB 4HLUA 4GICA 4XIIA 2PMDA 2O3QA 2OHVA 4KI7A 1J9EA 1EFVB 1IL0A 1ZITA 1DQNA 2B6HA 4G9GA 4QU5A 4BMSA 3IOEA 4WNYA 4PZYA 1YL5A 4ZOEA 1VLVA 3U3ZA 3HJUA 2YRXA 1GKLA 3KLOA 5EP3A 1X7YA 1ZD2P 4CTOA 2C83A 4ENVA 1JKJA 1NR7A 2AK3A 3FN4A 3P52A 2BFCB 3CVWA 3A4IA 3WTCA 3O94A 3BWVA 3EE6A 2AV6A 1FTQA 4BNWA 1YS1X 4G4SO 3N6RA 4L7VA 5K6TA 4LDZA 1T1GA 3KYIB 4QBKA 5E7MA 3ZGVA 3U56A 1ML4A 5A05A 5JR3A 1NMXA 3K70B 4NATA 3KKQA 2UKDA 2YKGA 1PV4A 1XEAA 3IUYA 4EKYA 3PQ6A 4JYPA 5IX8A 2O14A 2VKTA 1TQDA 4J3NA 3LC7O 2DR3A 4KHPB 5E6RA 2HSGA 2KJQA 1KH2A 2WPDD 1DHTA 2GHRA 1IJKA 3AXSA 4IKPA 2IUFA 4IKEA 5CAEB 4OGKA 4BCCA 3PNKA 2F8SA 2IHNA 1A76A 1I6MA 5CDFE 3O03A 1FTSA 1NSTA 1H1DA 1Z63A 2ZWIA 3DQPA 4YMHA 4PG7A 4NCBA 4MR8A 1HDXA 3QLUC 1JG3A 4JLNA 1SOMA 3H99A 3HTXA 3SQLA 4J49A 1M1YA 2A9PA 2QENA 3LGXA 5H0IA 2DWPA 4B6GA 1V3TA 1FXWF 1YJXA 2WQ7A 5BRAA 3GN2A 4DADA 1Z5UA 5K8LA 2BR3A 2XWPA 4E5VA 1TADA 2MTBA 2HWUA 2IHJA 1LFAA 1VHJA 3HBAA 3KZOA 2HHHB 5M34A 2G7ZA 4X1KB 1ZC3A 3AP1A 4REQA 4AJ4A 3DA8A 3OEYA 3TRJA 1ZFNA 1K5PA 4CMCA 5INTA 2OAEA 1Y6JA 3GW8A 3HFRA 3T3PB 1VSUA 5ALVA 2EKQA 1DBWA 1Y3DE 2BBOA 3PXUA 1WXGA 2ZXFA 3ZWWA 2O8EB 3AI3A 2V6IA 1B2LA 5G4LA 2JLAA 2G82A 4QIHA 2C84A 2G9VA 2I2DA 2EW1A 3EIWA 3EVNA 4O2BA 4RS4A 4CIVA 1O0BA 2HFKA 1BDMA 2ZRBA 3DEJA 4ZMSA 2WT9A 2PT9A 4EY7A 1F5SA 1HYQA 1L4KA 1IONA 3ZZ1A 5BW8A 2H65A 3W9UA 3PQ7A 5AOVA 1IAQA 4KB5A 1GGVA 4TVOA 1G42A 1XLTA 4LGYA 5I7FA 5GZ6A 2ZYWX 1OXSC 3JY6A 1R27A 3F1KA 3DNMA 1VKOA 3AEKA 2J9FB 3AR3A 3ESXA 1ULZA 2DPYA 2G70A 1YRLA 2DUMA 3KLPX 4FOOA 4FPXA 3QX8A 4ND5A 1IY1A 1US8B 3CUYA 4UUAA 4OJNA 4FP9A 3PJRA 2BGIA 3O8OA 1LXCA 1DHRA 3BSYA 3EVDA 3MTQA 3V7WA 1IQRA 4UTPA 3JARA 3T5AA 1TIKA 1PYDA 5DASA 4AW9A 3C6QA 1J0XO 2E4AA 3MMPA 1W4ZA 1MX1A 1JR3A 3RAPR 3WIUA 1GFIA 3A6FA 2HT1A 1ILWA 2LDXA 2XE8A 2BGNA 3CZMA 4UTOA 2GM9A 2B3DA 2ZK7A 3AB7A 3IQGX 3VSBA 1DG3A 2CL6X 1SBIA 2NPIA 2W6QA 3RYHA 3SEQA 2J9RA 2FDXA 3D6FA 1X19A 3OZ7A 3SIRA 1ZVMA 2Z9BA 4ZIRA 5EJ7A 1BX1A 1MO5A 2CNKA 3JAWB 2NTVA 1BEZA 4E6EA 1I7QB 2PA0A 3PUWA 1ODCA 3MIIA 1VHDA 1WF6A 1K8RA 2HJHA 3M9WA 4EWLA 2DC1A 5DBHX 4ZFNA 4CL2A 2EGHA 3VO1A 5A0FA 2GEUA 1PT8A 1PJZA 2JCXA 5EQDA 1T1IA 1W0KA 3M3HA 2V7PA 3EA5A 3ZTYA 3WDMA 4MA0A 1YFKA 3MF4A 5K4HA 2ZKIA 3ICCA 1CIJA 1UC4B 4ACAA 5JXWA 3A6DA 5GJBA 4LZWA 1UKBA 2QQ0A 1X80A 3TS1A 3RS3A 1P5ZB 4R05A 4BMCA 4XVUA 1CC1S 1YE3A 3EGXA 3H5AA 1PJ4A 2AZMA 5DTJA 1L5HA 4BVKA 2HGZA 2TS1A 1T36A 4JLJA 3WGTA 1IWBB 4C6TA 5LKAA 1S7GA 1DX6A 2V98A 4UU7A 5ICEA 3SBOA 3E3NA 4UBKA 3Q98A 1FTNA 3DR5A 5C7IO 3P97A 2DGDA 2DB3A 2CMDA 3PPYA 2RHCA 4YJDA 3QVLA 1VOTA 3FCEA 4R3WA 1P1CA 1K7XB 3SZUA 1JDPA 2H5LA 4H6PA 2YQZA 3CC8A 4RDIA 1SBZA 4OU5A 3U3DA 3D5TA 2IHVA 5FT9A 3E9QA 1Q3TA 3GFSA 2VT3A 2RGCA 2DKFA 3DE4X 3SZGA 2RGRA 1Q0RA 3NONA 2X2FA 1ACJA 3DFKA 1H4TA 2QW0X 3HA2A 1R18A 2C82A 1WMDA 2Q6IA 3ZZ0A 2FGJA 4BMDA 2BD0A 4K46A 4LF6B 2ONZA 1WXDA 1FX0A 3H5VA 3MGAA 1NX6A 5THKA 1AF7A 1WHTA 5LP6A 4Z3KA 4PWYA 2C9BA 2C9MA 2G8LA 3GRZA 4PO8A 4MR8B 2PBLA 4HUTA 1N7HA 3KTFA 3RH0A 1YFZA 2R79A 3E22A 3TKLA 3KD2A 4YT2A 1I30A 3DT6A 3PRYA 3PZRA 4J7XA 1M1YB 4RFSB 4TV9A 3WNQA 4BRSA 3ASUA 1B1AA 4U39A 3ZIAD 2H11A 4BN0A 5CLIA 3EPHA 3PGJA 1I5RA 5KO2A 2CHUA 4OTZA 5TMDA 4P0TA 2JLWA 4NMLA 1EXWA 2PM8A 2WMDA 4BEVA 3K2IA 3HSKA 1WVGA 2AJBA 1W47A 2GF0A 3PDUA 3IOMA 3UM9A 1HTBA 1G5HA 4N5NA 4H1VA 2R5WA 3GWGA 2DWOA 1FQOA 4M8NE 2QYOA 4IVRA 1ZQ9A 1AA9A 5HP4A 5DCWA 2VJBA 2QUJA 5T64A 2QTVA 4DQDA 3L6EA 2OHGA 5BQPA 3WNDA 3MRSA 2NV0A 4IDPA 3A6GA 3SC6A 4IG9A 4QLBA 3J7TA 2GRJA 4MUGA 5EP4A 3VOAA 5JYCA 1J33A 1CB7A 2NU6B 2AMYA 2V97A 3NM5A 3GJ7A 2HT6A 3JSAA 1XNQB 4JB2A 1X3SA 4IH9A 3AI2A 1NIJA 1W9HA 1BQEA 2PGIA 2GEVA 1YNOA 1N1GA 3MJRA 1PL6A 4RVOA 3PFIA 4IS3A 3FVRA 1O8BA 3HCRA 3K5IA 1RSZA 4FFSA 5K09A 4ZI7A 4RH0A 3GEHA 3L7AA 3PK0A 5CLLA 1GPMA 1W25A 5DLDA 3T9AA 4P0PB 1M7GA 2PZKA 4IFBA 2IOYA 3W2EA 2PAAA 3OOJA 4ZT5A 3ABRB 3FNRA 3RG8A 3TBKA 1KSJA 4R2HA 5BSMA 1EAYA 3H4TA 3PITA 4HPJB 5CLHA 2HL6A 3KXPA 4M1YA 3QXJA 3ZEIA 4G0UA 3S2UA 2DHDA 4UHBA 5BSUA 3WWEA 2O8DA 1E6MA 3LYAA 2PG3A 4JLOA 4EEZA 3DBLB 5FA6A 3CQ9A 1PR4A 1Y6RA 2GZSA 3G6KA 3KP1A 3KALA 2PUCA 2GJKA 5JWOA 2JBHA 2EJWA 2RIRA 2PVSA 1Z5OA 2VNAA 3KOUA 2V03A 1M75A 2L69A 1NZFA 4X60A 1B42A 5I9MA 1EJ2A 4I4IA 4QZVA 2GHTA 4H6XA 5EI5A 3N7AA 4XXHA 2JNWA 4QVKA 4EW6A 3CZQA 1HNZB 1XZDA 1JHOA 3LNTA 5I7HA 4P7JA 4ZCQA 1BU5A 2H59A 4MLPA 3A1FA 1ONBA 3AYXB 3VTKA 5BOSA 2XAAA 3SLRA 2G77B 3ZZMA 4FYIA 1N2SA 4JJIA 1EKXA 5E9QA 1ARZA 4M0CA 1A9XB 1GADO 1KZYC 1YZNA 3LCRA 3ELYA 4HO1X 4BO8A 1S2IA 3O8QA 3S27A 1IN6A 1STOA 4EYSA 1S1CA 1PX0A 2Q3LA 2YCLA 3G0OA 5DLQC 4BDTA 4RTOA 5E1BA 1OGJA 4KAJA 2PGDA 3WHPA 2BR5A 1X7ZA 1YTLA 3RC2A 3SQNA 1EFAA 2WU0A 2K7FA 3KL2A 3F1LA 2OK7A 3HM9A 1VL8A 3C24A 3QG1A 1JMYA 2YXDA 3CIFA 4ZV7A 5BW6B 1RPAA 1TC2A 1VMAA 3VVBA 3TRKA 3DVAA 3VNUA 2JVIA 1IWOA 3WLIA 1SXHA 1BGWA 2XT9A 2CLIB 2WLSA 3A2NA 4MDHA 4NJMA 1BDIA 3FYUA 2VF8A 3WWOA 7ABPA 3T7IA 4EBFA 1J24A 3LRXA 2Z04A 1EJ0A 1UWLA 5K0BA 4OREX 4X1OA 3AO0B 4B2LA 2YW9A 1PT5A 2H16A 3AILA 4KIFA 4LJ7A 4RH3A 1NQWA 4IJVA 5LP6B 1W93A 2OKCA 3Q85A 4IIVA 5T4BA 1SCBA 3FXAA 2PK3A 2XCTB 4OI4A 4F5YA 1EWVA 4I08A 5CNKA 1RAFA 2TRSB 4HMQA 1F06A 4WA8A 3PR3A 3E22B 4NPAA 4I9HA 2VF5X 4UCFA 1OIXA 3WKAA 1ZBQA 4TV9B 4BU0A 7GPBA 1U1EA 3BKWA 2O52A 2I3GA 3OJFA 4N7RA 4ZYTA 1P75A 2Y1GA 3NYWA 3PUZA 1Z88A 2W83A 3MJEA 3DO5A 3ZIDA 2JFFA 4DJEC 4X7RA 5K0CA 5ISMA 5BV1A 2DUUA 3CJRA 4C5CA 2R8XA 3FMGA 1LRKA 1I2ZA 1UPFA 4N8EA 1PV1A 3A0RB 2X3FA 1UCFA 3FGPA 3G2NA 4OQZA 2BFMA 4PO1A 2CK3A 1F2TA 3ILVA 1AX9A 1PEYA 2BM0A 3ZCUA 2C04A 2X5JO 4ZJUA 5KYKA 2Z6AA 3IAS1 4L02A 3B1ZA 1N6HA 1NXWA 1U9CA 2QA5A 3K35A 1CEYA 3B3FA 1K4MA 2IKQA 1VPLA 2JJ1A 5BNFA 4YTEA 4HEQA 2QTGA 2ZR9A 3OFNA 1ECBA 4PYRA 1JQEA 1AVTA 5JJKA 2XGSA 3L7IA 3P9NA 1DAGA 1DZIA 1ESMA 1X7XB 3GVCA 4GBJA 3IUPA 4NULA 3TQHA 1EEXB 1U7PA 1I1HA 4NZNA 1TFRA 4B3MB 2APJA 1FVFA 1AKNA 2CEKA 3G7NA 3C15C 4MVCA 1WCWA 4LMPA 2XRMA 6AT1A 1B6RA 3Q0IA 3P5SA 2WHPB 3KR2A 4X92A 2J30A 1LI4A 1OXXK 1ZN7A 3D0KA 3OECA 2QRMA 5CD1A 3I04A 2AW3A 2JD1A 2EDAA 2V0NA 4UHKA 4A82A 1Z3CA 5A5FA 3A2KA 2Z43A 2WSYB 2X40A 4YMSA 2R8ZA 5A4IS 2VTBA 2ILVA 2R68A 2X15A 2JIOA 4KIGA 4L95C 1C2TA 3GFOA 5HJ2A 1SKYB 2WMYA 3ZY5A 3IAEA 4G0PA 2AZTA 3M6VA 3EAGA 1DRWA 1ZN9A 3WQSB 3L77A 4MI6A 3FMPB 5T4EA 1CQIA 3SDSA 3J81k 2WF5A 4KXLA 3UC9A 3YASA 4HGQA 3HB7A 2DQKA 4X8OA 3WRWA 5M3BA 4PLTA 1L3BA 1N6OA 3MMZA 2D59A 4LI3X 3MGCA 1NBEA 2IXFA 4NPCA 1H2EA 5IMBA 3JQGB 5FRDA 5HUQA 1O5IA 3AERB 3PVZA 5BWBA 5AUNB 5BOSB 4YVFA 2PHZA 1KOFA 5L40A 4J16C 4YCMA 3AUAA 2ZYTX 1ZIXA 2KB0A 3UAOA 4EHAA 3AI1A 3EDQA 4FOTA 2HQSA 3N75A 4KPUB 3DCNA 1U5BB 3HP7A 1DTWA 1NC3A 8ADHA 16PKA 5HJ5A 2P4QA 3GLTA 4BO0A 2IODA 5E8RA 1M2HA 1OU4A 2EWWA 5CB6A 1Y5RA 8AT1A 2MR5A 4W9NC 2E4UA 5SZHB 1RLIA 5JSUA 3MT0A 2OYCA 2WU8A 5FBLB 1KBOA 5TARA 3X1KA 3LUPA 3R9KA 1FTYA 3H6HA 1W1IA 1G20E 2YVLA 1KU6A 3A1TA 4G5SA 1HDGO 4R1MA 1VM6A 4NJMB 4JX8A 3RRBA 3P2MA 3VI4B 1XEWX 1Y9AA 2D7CA 4M0LA 4KO4S 3NGXA 3WK4A 1NN3A 4GD3Q 4QU0A 1HNNA 3K2BA 3H97A 2O6HA 1O5TA 1TQ4A 4CIWA 3AHJA 3SEAA 1SXJC 4EY4A 2ZRHA 3CWZA 1S6YA 3NTQA 2AOXA 4RHEA 1L9KA 1YKFA 4RJ2A 5CDGA 4KUEA 4KN6A 4MI9A 3EGWA 4QBHA 5DGCA 5JCOA 2XZTA 1QZTA 4Y1EA 1OXUA 5FUVA 3L04A 3VISA 4D92A 2Q4EA 1V1JA 2CT8A 1E9CA 2YV4A 4I3FA 3FI9A 4UZEA 4P3YA 2IV3A 3SJ7A 5DRYA 2P5UA 3V55A 1E9SA 3QTTA 2REBA 2WHXA 3CLRC 4IWYA 4KWTA 1OFGA 5K3SA 2CHGA 4AJNA 4BB9A 3N59A 1J1IA 3UMSA 5IM4A 2XA2A 1OHHA 1YOVB 2WT4A 5EAIA 1N4AA 3G2JA 1RKBA 1Z08A 1U7TA 3QKSA 4IQFA 2ZSFA 2CV0A 5JT1A 1ZISA 3H5NA 3M1LA 2ZRQA 2A0XA 3DH0A 3H1EA 3I12A 4YASA 3OKAA 3D8RA 3ETGA 2WG1A 1UMKA 1TKBA 3DC2A 4DNFA 1PJBA 3ENNA 4K8RB 2C96A 2GXAA 4D6XA 1VL6A 3EBLA 1F7UA 2PS0A 4ZD6A 3GLSA 2W4MA 3DDCA 3NHJA 3A6HA 4K6CA 2QX4A 3SP1A 2GEKA 3LUFA 3D8BA 5AW9A 4MZDA 3QFCA 5LMUB 4RHYA 4OYYA 1ZU5A 5D01A 3RIYA 8GPBA 4LWZA 1JXMA 3C43A 4K9SA 1NBMD 2P9ZA 4WL0A 2JA1A 1O97D 1PEDA 3HADA 3NOXA 4AUNA 1Z0ZA 2H1RA 3PGLA 3KPJA 5JMPA 2HCFA 2HU7A 4G56A 3X44A 4YCAA 3P0EA 2E6KA 3ZHXA 3A6ZA 3V4VB 1MRZA 4M1QA 3RRMA 1SOWA 3GELA 1NBME 3RS5A 5JNVA 4DLVA 3ROMA 1J0EA 4MS3A 3W3ZB 1OX4A 5FBWB 3HJBA 3OESA 3ZWNA 4BC0A 3MWDB 2NZWA 5FKJA 5KWIA 2XCLA 2NYVA 4O2RA 3TR0A 1NI5A 3D8NA 3BRCA 4QOFA 2JARA 3SQDA 1JLSA 2I2XB 1HI9A 3D2AA 3LLMA 1JG2A 5CFOA 2AVDA 2I91A 3U3MA 5IK2A 3IA2A 4O2AB 1VQ1A 3K9GA 4IR7A 3DP9A 4M9SA 1KNQA 1KJWA 3PV0A 3QVWA 4QDUA 2PH1A 4YY3B 1FP6A 1UIRA 1P8JA 3MOGA 2N47A 3B7PA 5KYYB 5CG1A 4Q18A 1V35A 4B2PA 3HI4A 3T7CA 4IILA 3LC0A 3VZDA 2P65A 5MGNA 2FWMX 1M2OA 2PSEA 3KAQA 4KPGA 4LY0A 4RD0A 1MC1A 1UKCA 4I7EA 3VGPA 4ABTA 2FSGA 3I28A 2XVXA 4F3KA 5GINE 1VIDA 3NIGB 1UQUA 3W79A 5AXDA 2ZJ0A 3KKKA 1JBEA 1DAHA 4CUJA 1X14A 3GEGA 2R7AA