5AWFC

Crystal structure of sufb-sufc-sufd complex from escherichia coli
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
243
Chain Sequence
MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Dynamics Revealed by the Structure of the SufBCD Complex, a Novel ATP-binding Cassette (ABC) Protein That Serves as a Scaffold for Iron-Sulfur Cluster Biogenesis
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein/protein binding
molecule keywords FeS cluster assembly protein SufB
total genus 78
structure length 243
sequence length 243
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5awfC00
4TLCA 2HT1A 1ZD1A 2IYUA 2QP9X 2G0TA 4Z54A 1WRBA 1CLUA 3CO5A 3GLHB 4U02A 2WKRA 1VPLA 4BRWA 5HE9A 5GJBA 1F2UB 4HUQB 2J0UB 5CM9C 2OE2A 5KDDA 2NMVA 3SR0A 1NN0A 3CRW1 3PR1A 1Z83A 4D4JA 1VCMA 2Z43A 4KBFA 4F4IA 2ZUBA 1D2MA 3LX8A 3RC8A 3T5DA 2W0MA 3PXGA 2A78A 4D2IA 1QDEA 2P3SA 3QY0A 1Z63A 3GCGA 3CF0A 5GJWC 3SBEA 1DAMA 4ZCMA 2OUKA 3RYTC 3EASA 4C0LA 3MMPA 2RB4A 2IYWA 4JMPA 3B9PA 1GVNB 4G5GA 2WTUA 3AKDA 1OXUA 1DPFA 3EZFA 3I4LA 1LB1B 3I73A 2GILA 1EXMA 1P2UA 3OAAA 1CJTC 2UKDA 3I92A 2CHVA 3TAUA 3EARA 2NOAA 3NVAA 4I1OA 1U0JA 3B1YA 4DDVA 4JJKA 4CDGA 3SYKA 4A82A 1JR3D 3IIKA 4B32A 4JLPA 3FMIA 5FBVB 3UK6A 3LLUA 2RH5A 5DIFA 5FOVA 1N6LA 1Z0AA 1VTKA 1OXSC 2R6AA 4IOJA 1P73A 1SVWA 3GJ8A 4KODA 5AUOB 1NMZA 4A1FA 3VKHA 4ILEA 5FUYA 2EFHB 4JLOA 4QBIA 3X1DA 2R8RA 3LFUA 4DLUA 2B8WA 1NG1A 1E2LA 1XU4A 2VP9A 1I4TD 3ZIAA 2J7PA 1FNMA 3HPRA 4MGKR 6Q21A 2QY9A 2GEDA 2HJVA 2ZPTX 1UBFA 2PEZA 2BV3A 2Q9AA 4DCSA 1ZINA 1UEIA 4B47A 2DFNA 4MKFA 4Y0AA 3NBFA 4LUCA 3BIFA 2IYVA 1JALA 4LV8B 2NG1A 3B1XA 2H7VA 2ZRDA 2C2HA 1X8LA 2IYRA 3O8RA 2F1RA 4A8JB 1G7CA 1SGWA 1D2NA 2PX0A 1BMFA 1Q1BA 1Z2CA 3F0TA 4EFMA 4XVRA 4XVQA 2VP6A 5LBIA 1NN5A 4CRWB 1VYTA 2Y8EA 2WKQA 1NMYA 1OYWA 5KHOC 1JXMA 2JJ8A 2YZ2A 2GF0A 5DGXA 1T6NA 1M74A 1E79A 2ZRCA 2QORA 2XJ4A 1E4YA 3RS2A 4KJZA 2XAUA 4BQSA 2JLZA 1DEKA 4LBZA 2IWHA 5L8VA 2ZETA 5FL7A 1I4DD 4TT3D 4QBFA 3U2QA 2AR7A 1RW4A 3AVVA 3AVUA 2HF9A 4M1SA 1Z28A 5D3MA 3B1VA 3DMDA 5JWRA 3UMFA 1GG2A 1WQ1R 3NC1C 3QG5A 4XSGA 1GKIA 4Z51A 1FQJA 2HF8A 4PPGA 2BM1A 5HKKD 1ZM7A 1YZQA 2QRNA 4JJZA 4M9QA 1G5RA 3T12A 4GNKA 4KSCA 3REGA 2OG2A 2LCFA 1E1RD 1TMKA 1ZVQA 2NO9A 2WIBA 2FJUA 2GZDA 2BIFA 4BFZA 3HYTA 4MKIA 4RD4A 4XOIA 1F48A 3RDPA 5FUXA 2OXCA 1NG9A 3EPKA 1G8YA 3Q9LA 1Z0KA 2NTYC 2PX3A 2ZYUX 3QKTA 1OFIA 2ZRPA 3EC2A 1MH1A 2VL7A 1G5TA 2IW3A 2QMUA 3P20A 2O8CB 5ELXA 1FZQA 3L0PA 3AGQA 1UADA 2C8VA 2X19A 1KSFX 4GZMA 4KVGA 2WOOA 2GCNA 1GUAA 5C18A 1LS1A 2A7QA 3T1QA 3AF3A 1KZGB 3GPLA 3WYAA 1W4CA 1LFDB 2ZJYA 1RIFA 2L0XA 3AP3A 5FL3A 4C4PA 1JBKA 3ZS8A 1AK2A 5IHPA 2HLDA 2ZE6A 1AGPA 1Z0JA 1NJFA 3U6KA 2AK3A 3A36A 1A2BA 2GRJA 4NCKA 2EVWX 1AIPA 4EPWA 1TQ2A 1UKEA 1P6XA 1QHHA 2N1BA 4IFBA 4P4SA 5BN3A 2AN9A 4HUTA 1N5IA 2WWWA 4QGHA 3LAWA 1QF9A 2CDNA 3HDTA 1HE8B 3HPQA 3QENA 2VHTA 1US8B 4LPKA 1ONBA 1KGDA 5FR2A 1B0UA 3C41J 4HAXA 1E9AA 4KYIB 1IN4A 4PSKA 1XJ0A 5F98A 2XNDA 1AA9A 5HE8A 4QGGA 2OBNA 1XEWX 4D0NA 1P2TA 2ZRMA 3GEEA 1KOFA 4IDQA 3RSLA 4D0GA 3B82A 2WPDD 4JBXA 5HCNA 4JLVA 3UWOA 1IAQA 2FU5C 2P5SA 1ANKA 1SXJD 4GI7A 2QAJA 3IQWA 4TTPA 4TYQA 1NSTA 1PUIA 2C04A 3QPVA 2O52A 5JI3E 4C0KA 1CJUC 2CXXA 1EGAA 4G5RA 2FSHA 5DLQC 4LJ5A 1GL7A 1P9RA 3UANA 3VR2A 3P4XA 4AK9A 3EZ6A 4Q7KA 4PX9A 2ZQ5A 3ZZUA 3EZ7A 3HP1A 4MRVA 3QF7A 3QSYA 1XTQA 1UFQA 1UBGA 3KTAB 3LXXA 5FTKA 4AG5A 1KSJA 2YWGA 3CRVA 1JPJA 4M22A 3OAAD 2YVUA 1HQYE 4A0FA 4JT2A 2OLKA 2KBFA 2R6GA 3IHWA 4F93B 4JYCA 1ZC3A 1SKYE 5E4FA 3IBYA 3KB2A 2OBLA 1NMXA 1P5ZB 4G0NA 1OFHA 4PXAA 4CYMA 4KYUA 2X77A 1E98A 2VH5R 4AURA 1EG7A 1VDZA 3EG5A 1NVXQ 4DEYA 5DSZA 1LTQA 2WAXA 5FPKA 1P3JA 1PZNA 4B2IA 4EAQA 4F4JA 3LW8A 4M1KA 1NSFA 4OI0A 3VX4A 4Z1MD 5HCIA 2NPIA 1ZUHA 4CIDA 1MKYA 4M2LA 1JNYA 2J7PD 4Z8YA 3K9LA 1XTJA 2C77A 2JLXA 4I1VA 2WJGA 1E94E 1IN5A 3B85A 1CR0A 4X8HA 1OH6A 3QJYA 1R8SA 2XJ9A 1AZTA 3WYGA 3LQQA 4I99A 2OHFA 1XCGB 5AWFC 2BMFA 4NZYA 1M8PA 2XSZD 1ZUIA 4DCTA 3W90A 1X86B 2IUSA 5LDDC 1CF4A 1DOAA 4HAYA 3EPLA 5KOYA 4QM7A 4CEHB 4QOSA 4JBYA 4ACBA 1GSIA 1HYQA 2D4HA 4NE2A 1MV5A 3AH8A 3AQ4A 1E9FA 1N6IA 4MYUA 2KE5A 3DZ8A 1BMFD 2PH1A 4B3GA 2BBSA 1QHGA 2YYZA 1AQYA 2KBEA 2P65A 2QM8A 4ZIRA 1Z3IX 2DPXA 2QI9C 4N0EA 4V03A 2B92A 5JCPA 221PA 2GJ8A 1W0JA 3OFND 1P7CA 3LDAA 2AL7A 4IVPA 3AF1A 1CRPA 1KI7A 2FGJA 4LHXA 4YLGA 1BOFA 2VYFA 4IW3B 4ZIRB 1AN0A 4HB0A 4IOLA 1KMQA 4LJ6A 3N2IA 1H65A 3BB1A 3IILA 4HLQB 4JBWA 4KFRA 4NCHA 2N42A 1TNDA 1A4RA 1OB2A 3SHWA 3HJNA 4EJSA 1XXHE 4QHSA 2P0EA 3MWJA 3ZGXA 3ADCA 3PJRA 4A2PA 2H1LA 3NH9A 5HKKA 3ZD6A 4V0MA 2O8EB 3DVLA 4MH0R 5C4GB 1WBBA 1YQTA 3K0EA 4R71A 821PA 1CJKC 2WJJA 5EZ5A 3ADBA 3RSOA 2QAGB 3DZDA 4RSGA 3VU9A 1QHNA 5DHFA 2O8EA 1W4BA 2F43B 3ZVMA 4L5BA 3H1TA 2I1VB 3I61A 4EFNA 5UKDA 2VP2A 1RRGA 3U5ZB 4BFYA 1TU3A 1SVLA 2GJKA 4D0LB 2VF7A 3E2IA 1PVOA 1FMLA 5K8TA 1SVMA 4OL0A 1LV7A 2GKSA 2TMKA 4MRPA 4KLZA 3CH5A 3VHLB 2HEIA 4HAWA 4I1UA 1D2EA 3C14C 5EXTA 1QHXA 5DYIA 3THXA 5CJ2A 3BH7A 1QG2A 1W36B 4PFSA 3K70D 2ZJ2A 4OHYA 2WKPA 3U4QA 1DO2A 2GXUA 2B21A 3ECCA 3KFVA 1F2UA 3MCAA 4HUQA 3O8CA 3DOFA 2QPOA 2DFKB 2IS2A 5L3VA 3LA6A 1AKYA 2HXYA 3RRZA 5FI0B 1W0KD 3C5HA 4NONA 2Q21A 2O8FA 1FX0B 1OW3B 1C9KA 3JVVA 4A4DA 3BRWD 4LJAA 4GFDA 3R8FA 2CL6X 3CW2A 3KXLA 1JR3E 3GJ3A 2O8FB 4MA4A 3TIFA 3ZLJA 2QGNA 2KSQA 2ZJ5A 1SQ5A 3PENA 4JKYA 4B76A 5HPYB 4W5WA 3QF4A 1P60A 2QTVB 2XNDD 3WBJA 3GLFE 3IEUA 3TR0A 5G41A 3GLIB 1ZIPA 2NO7A 3A58B 4DSTA 4OHVA 3SQXA 1KAOA 2ZRAA 5HR5A 1JEDA 1VIAA 4IFEA 3TSWA 1NI3A 2ECKA 2FH5B 3U7HB 1I2DA 2CMKA 4DEXA 2D2EA 4JLMA 3L8ZA 4MQBA 1W44A 1GM5A 2VEDA 3CX8A 5TXGA 2WSSA 1J99A 4UXJA 2GCPA 1XMSA 3SU8A 1XDBA 1MRNA 1EFTA 2F9LA 2VTKA 5C1BA 2ZU6A 3TUIC 4MGIR 1P72A 4UNNA 2FSFA 1NJGA 3THWB 2HXSA 4UNRA 2E87A 1DELA 4D26A 4CZ2A 5AUQA 3ZQJA 2XTMA 1KDTA 1FQKA 4Q48A 4TMKA 5JS8A 2LKDA 2REXB 4RD6A 1U94A 1MO5A 3UIEA 4TQAA 5FUVA 4K8OA 2X8AA 3GLHE 4D81A 5JFGA 2YC4C 1SVKA 2GBLA 4B43A 1XNJA 2A5DA 4KLNA 1US8A 4Q9KA 4Z8XA 3M6AA 2IT1A 4Q02A 1PLJA 1R0ZA 4EIWA 2V4ZA 5HZHA 1DTSA 5L3SA 1S1MA 3C7KA 1QVAA 4LYJA 4PANA 3AKCA 3TMKA 1JXOA 3QVVA 2ZR0A 1NKSA 3EZ9A 2YC2C 3TQFA 1HEIA 2FOLA 4BLPA 4YXWA 3WXMA 4AYXA 1U0LA 2GTPA 4DBLC 3VR5A 3KKOA 3T1VA 4M1YA 5FFMA 1C4OA 2RGBA 4AG6A 1OHHD 1E69A 1MABB 2Z6VA 4L9WA 1ESMA 2XB2A 1X1SA 3DM5A 3FWYA 2QN6A 1BYIA 4EPTA 4GOXA 2ZRLA 3N5CA 4CEJA 4Q1DA 2IYQA 4E5UA 2V1UA 5EP1A 4ESHA 2IX3A 3GEHA 3AGPA 5FTLA 3LWNA 4QM6A 4KV9A 3CX6A 3EW9A 2EYQA 1LY1A 4QHYA 4D4KA 3SHFA 1S1CA 2XEXA 2EFCB 5L3QB 1HT2E 1TUIA 2I4IA 1II8A 2IEYA 3B8HA 3GJ7A 5DI3A 2BM0A 2JJ1D 3LO5A 1FNNA 5AJYA 2RGAA 2QGZA 1TAGA 1E2EA 2ZM5A 3P27A 2W58A 3R7WA 1GITA 4OI2A 5SZHB 3C5CA 4LHVA 2RCNA 1YR7A 4AWXA 2FGKA 3KQLA 1ZIOA 2C9YA 2D74A 4WOPA 2OT3B 1QBKC 2IF2A 2NQ2C 3C8UA 5IF9A 4AY2A 4HAUA 3UG7A 3CF6R 4TMTA 3WMFA 3B13B 3X1XA 3CNLA 4P33A 2GCOB 3GJ5A 721PA 1JPNA 2RAPA 4D82A 3ZZTA 3THXB 2CK3A 1F60A 2J3EA 4LC0A 4N0DA 1GFIA 2CE2X 4PPQA 5TV2A 2C95A 2C03A 3P4YA 2XZLA 1GL6A 1E99A 3PUXA 2V9PA 3TE6A 3FVQA 2CEAA 4HDQB 1T8TA 1XXHA 2CCJA 4FCWA 2WWXA 3FMPB 2ONKA 1WF3A 5JJKA 2BCGY 1NN3A 4P4SB 3NTUA 4LPSA 2R65A 3ICQB 3VNUA 3QXXA 3DO6A 1XPUA 3BK7A 3WHLA 3OIUA 3IHLA 1NNEA 3GMTA 4MYTA 3TRFA 5FOXA 2HYDA 5EQTA 2D7CA 3KJIA 5A4JA 2DY1A 2EW1A 3ASYA 2OFWA 1TPZA 1T0HB 1CIPA 2ZRJA 4J0QA 3FE2A 2QM7A 1OH5A 3MLEA 4XTCS 1LNZA 5JJIA 5CDFA 2QG6A 4MRRA 1GRRA 4WZAE 2QPTA 1VCNA 2GJAA 2WBLC 2ORIA 4DSOA 1UKVY 3CB4A 1G3RA 3NBXX 4DLVA 2O5VA 1R0YA 1N0WA 4HEJA 1E96A 1XEWY 2IHYA 1E2NA 4JL5A 3TNFA 3BFVA 5ANRB 1NF3A 3MSXA 4NDZA 4P32A 4URWR 2VHJA 4KHZA 5E95A 4PZZA 1XBTA 1KO1A 4WZ6A 5EXXA 2FSIA 1IY2A 1XWIA 2CL7X 2A9KA 2VHQA 4NKRA 1G6HA 3B7GA 1PLLA 2A5GA 3GQBA 1OJLA 3LX5A 3QBTA 3RWMB 3THOA 1JR3A 1U8ZA 3W5IA 2ZRBA 1DG3A 2DB3A 1KZ7B 1QVRA 1G5PA 2K5UA 3A1WA 2GXQA 3D8BA 3U3JA 5HZKA 2XXAA 4TYNA 5FUWA 2XZPA 4V0KA 4H9GA 3MWKA 1E2GA 1VG8A 2H16A 2C5LA 4RFSA 4YMVA 2F3TA 3PUVA 3VNVA 2ATXA 2PLFA 4GDFA 4OHWA 1M2OB 4ITRC 1BH2A 5J5CA 3EPJA 2GDJA 1WXQA 3KXIA 4Q21A 2W2TA 1CRQA 3A8TA 3NBZC 1N5KA 4TLBA 4QC2A 5J4KA 2YKGA 3R20A 1GKUB 3U3MA 3L0SA 1W47A 5DE3A 3AF2A 1ZP6A 1H8HA 1RRCA 1E9CA 2A2ZA 4OK6A 1NP6A 1W48A 5JWHA 1K5DA 3UXMA 4TMXA 3VR1A 1P2SA 2HDNB 4LRWA 1JAIA 2AHOA 2B7CA 2WM9B 3BB3A 5GVSA 3ICEA 3TVTA 3IPXA 2SHKA 2J41A 5BW8A 2VBCA 1N3BA 4EQ6B 2F55A 2D62A 4JLNA 1KDRA 4D6PA 1JAHA 1XCPA 4Q4HA 1Q21A 4KBGA 2QTHA 4ZPXA 4OJQA 1XCMA 5IK2A 1E9BA 3MFYA 3X1WA 2GZHA 3K0FA 4ON9A 1TL7C 1GP2A 2ZSBA 4GL2A 3HU3A 2I3BA 4OK5A 4Q18A 4W7SA 5DYGA 3UMRA 2QE7A 5FOWA 4A2QA 1YRBA 2YV5A 1RZ3A 2D06A 1G8PA 4FWTA 3PEWA 3FFBA 1XTIA 1YZUA 4IKEA 4YDHB 2C98A 3LD9A 4IXNA 4LJ8A 3TW8B 3DPUA 2JIZD 3THWA 2IBMA 5FL7D 1SVOA 3FB4A 1FUKA 1NLYA 1E2QA 5EP2A 5TARA 5K8LA 3HWSA 1G19A 3IIMA 5BXQC 4DZZA 2GK7A 1DAGA 3QBVA 4UQOA 1F2TA 4QHTA 1DARA 3TQCA 1JR6A 1JB1A 4QFMA 3U3OA 3B6EA 1FFHA 1XEXA 2O0JA 2WVJA 4OJKA 2IC5A 3RANA 1FTNA 5F9FA 2YWFA 2O0KA 5EE0A 3K9HA 2QAGA 2WMNB 2ZE7A 3TGPA 1LW7A 4KI0A 3CPEA 3FHTA 2P6RA 3IIJA 4BLSA 3AVPA 4FMCF 1E1RA 2C9CA 2CHQA 4NYJR 5D3QA 3M4YA 1XF9A 3OE7D 5BYJA 4MRNA 4TMZA 4QGFA 4HSEA 4DLTA 1S9HA 4R98A 5L3RA 1G9XA 3NXSA 1W4AA 1W5TA 2OBMA 4NYMQ 1TQ4A 3Q7PA 4IXMA 5C2JB 4L15A 1FL9A 1M7GA 3CNNA 2ZANA 4LBYA 3RABA 1XJQA 3TUZC 5FBRB 3EIHA 1U98A 1SZPA 4LBVA 4RKFA 4EPRA 1TEXA 3JZMA 4BLTA 2FFBA 4Q1EA 3K70C 3KFXA 3M1IA 1OF1A 1Q22A 3MJRA 4OI1A 1I4LD 1OV4A 2AD1A 1SXJC 3QVUA 1XP8A 4JT4A 3VMFA 1Q1QA 1NVVQ 1XRJA 2F1JA 1KI6A 2P6NA 3KZ1E 3N70A 5FTMA 5F3WB 2BMJA 4IRUB 2PT7A 4XVUA 1KK2A 5SZJA 2WWHA 2PZEA 3TSZA 1YZGA 3LNCA 3AEZA 4A8JC 3LLMA 4LSGA 1XFAA 4Q4AB 4FD2A 4LC1A 1XEFA 1VYVA 1OIVA 3WHKA 4TN1A 3CR8A 3V4RA 1IONA 2FNAA 1S4QA 4MUAA 4C0AC 1A82A 1R0XA 5H70A 2ZUCA 3HR7A 1ZYUA 4NCIA 3GJ0A 4F7WA 2OAQ1 1NLZA 4PQFA 3LRPA 4G5OA 4C7OA 4Q00A 2WPDA 1Z0FA 3KJHA 4JVNA 2DFLA 5CLQA 1LF5A 3Q5EA 4MDFA 3B9QA 1DAHA 2QRZA 1SXJA 421PA 1Z6TA 4W5JA 4M1MA 1MO3A 4KCGA 4ZI3A 3LBNA 1NBME 3EXAA 4M0LA 3QKSB 1ZNYA 3VQTA 1GKYA 1VYUA 5FBQB 3RAPR 1G17A 4PSVA 2H18A 4BFWA 2BWJA 1KK0A 4LZZA 1VCOA 2YWEA 1VKJA 3H4MA 1W36D 4GPTA 4UNQA 5KDOA 4N3NA 2AWOA 2FF7A 1OIWA 1U81A 1RRFA 4HLUC 4OHXA 4PZLA 1FP7A 3X2SA 4XTRA 4XIGS 4B3XA 1OLOA 2IF0A 4A6PA 1IJEA 1ZAKA 2E1RA 3FKSD 3Q8XB 3QKUA 4TL9A 1S96A 3ZZ0A 1KNQA 1AM4D 1E9SA 4RZUA 1Q3HA 1KHTA 4AKHA 2CNWA 2F9MA 2ZRHA 4EPVA 3RS4A 2PL3A 4Z1MA 3NH6A 4C0SA 5JSZA 3QEOA 4PHTA 4GSYA 1Q20A 1H8HD 3AVOA 2DYKA 3CH4B 3SE0A 2YINC 4Q7LA 1ZNXA 4Q1FA 2B8TA 2JLRA 1G1MA 1NVUQ 3RHFA 4TZ6A 4HLUA 3PEYA 1KK3A 2BVNA 2QBYB 4F38A 2ORWA 3ZYCA 4IOKA 3QKRB 3QIAA 4LWZA 1ZCBA 4EPYA 1Z0DA 1YZKA 4O25A 2IA5A 4E22A 3P26A 1N6OA 4E03A 5IK2D 4O0MA 5KSOA 5K8UA 2UZ3A 3I5XA 4M9XA 2JLWA 3AVXA 4QNRA 3THYB 3QXSA 1R4AA 3SFVA 3FTQA 2JCSA 2QE7D 2IYZA 3V4FA 1E0KA 1KI2A 2C96A 2OEPA 4URVR 2H57A 4LHYA 1W0JD 1CS4C 3CWZA 1GNQA 2C99A 1NL3A 1XJCA 3FPAA 3OFNA 3ZD7A 1G4UR 2BEJA 5F2EA 2GZAA 4E09A 1RE0A 3CNOA 4DT1A 2Q0HA 2JDID 4RY2A 2IEZA 1FTSA 2VHCA 3L8YA 4AKIA 4RD0A 2P2LA 3T15A 4NYIQ 3T61A 1N6HA 1XTKA 1XMJA 4RD3A 3PQCA 4C0HA 1BIFA 3PUYA 1YR8A 1EFUA 1DAKA 1AQUA 2B6HA 3OIWA 2IHBA 4QJ4A 4L8GA 5A5GA 4M21A 4L16A 4E07A 2OCPA 1EFRD 2F3RA 4YMSA 1PLKA 1TF2A 1DS6A 1YU9A 3OE7A 1X8KA 2ZR9A 2WJHA 2NPFA 5A0FA 2J46A 2NZ8A 2GXAA 2C9OA 2ZJZA 3K53A 4JSYA 4PQYA 3SI7A 3J81k 4WBSA 2NO6A 2R2AA 1CKEA 1UM8A 4A9AA 3NEJA 5AJZA 1KO8A 3RRNA 5DNYB 1Z6YA 3W6PA 2NGRA 1ETUA 4TL7A 4BZXA 2JLVA 3NWJA 1KJZA 3ND8A 2IYXA 2V6IA 3FMOB 3AF0A 1G3MA 2YOGA 1GDDA 1KY2A 1KO7A 3WP1B 1NIJA 2PT5A 2G3YA 1ZM3A 2RKOA 2PZGA 1E0JA 4OYHA 3REFA 1A5TA 3P1JA 4LV5B 3K70B 1IXRC 2XOKD 1CTQA 2AXPA 1D9ZA 2GA8A 4C3ZA 1RJ9A 1IN8A 1XZPA 2OILA 2YNMA 3GEIA 4MGYR 4MYHA 4Q4JB 4C7OB 2ATVA 4N1AA 1W7AA 2OCBA 1OXTA 2XZOA 5EZ6B 2ZAOA 3EC1A 4TTQA 2EU8A 2RGEA 3NKVA 4NH0A 5AK0A 4QRHA 1C1YA 2BHRA 3C15C 1N5LA 3NHBA 1ODFA 3TVDA 2DWPA 4PR0A 2Q6TA 4RKEA 4B3BA 4B6EA 3DKPA 2DHRA 3GJ4A 1KI3A 3FHOA 1U9IC 1P2VA 4FXPA 2JJ2D 3T5GA 1E2HA 2GXSA 3I62A 3JZAA 3VAAA 1BS1A 4HLCA 4ARZB 1VECA 4ZKEA 1IY1A 2GAAA 1MOZA 3KJGA 5JLJA 5AJWA 1R5NA 1ZM4A 2WSSD 1KI9A 4PC3A 3WRYC 3T06B 1G41A 4LY6A 2P5TB 4UXHA 2V8OA 2OAP1 4BLRA 1E1QD 4NPHA 4EKDA 5G53C 3Q72A 5CB6A 1N6NA 4A0GA 4V0NA 2R6CA 4ZKDA 3T1OA 3NDBB 3FFAA 1T5LA 2FEMA 4LGMA 4L9SA 1HURA 1OXVA 1COWA 1ZBDA 2QROA 2Z5FA 2ZI4A 2OZEA 2PJZA 3DL0A 3WRXC 3KJEA 4RCZA 2YJTD 2AKYA 1HQCA 2Q3HA 4RFVA 1NBMA 1T0JB 4KO8A 3FKSA 4FMBB 4P4UA 4TYPA 4XWAA 1OH7A 4H1UA 4C30A 4A0RA 4K81B 5KPJA 2J87A 4B2LA 3CIOA 2KJQA 2ODBA 1ZU5A 1L4UA 1VG0B 2BKEA 1PV4A 3AVQA 2OCAA 5HTKA 4TL8A 1AS0A 1XZQA 2CNWD 1DBSA 1WDTA 2BOVA 2BMEA 1T3LA 2ZSDA 3PG5A 4BEJA 3EA0A 3GJ6A 2D3WA 3ZH9B 4DB2A 1MR3F 5C46F 2EWWA 3DEFA 3T35A 4RZ2A 2GVDC 4DRZA 1W2GA 3B60A 4OK3A 4AD8A 3CUEF 5BQ5A 2BCJQ 2ZSFA 1XMVA 4IDPA 1L8QA 4Q5IA 1B23P 2CLSA 2FFQA 4KITB 4DB4A 3L2OB 4CW7A 3A1TA 3S1AB 4DDTA 2VP0A 1OHHA 1Q57A 1R10A 2A5JA 3IPYA 1T8UA 4FCTA 4BPBA 2IXGA 3BOSA 5EE5B 3RVBA 3LBIA 1J70A 4OQXA 4HZIA 3RS7A 4LJ7A 2DR3A 1JEEA 5KNCA 2QT0A 1ZJ6A 2BJWA 4ZV4A 4JS0A 3TBKA 4A2WA 2J9RA 1F2TB 3KQUA 3SYNA 3PVSA 1UF9A 2PZFA 3QOFA 1LS6A 4PTLA 1JQLB 2ZITA 4Q66C 2F7SA 5BYKA 2QL6A 4LJ9A 4YONB 2VQSA 3G82C 1KKMA 4W5HA 4DCUA 4ZCLA 3QE0A 1FOEB 2F6RA 1NVWQ 3A4MA 5GJVC 5E7JA 5J47A 2GNOA 5CYOA 3GLFA 5B64A 4LYHA 4JLBA 4AC9A 3H84A 2IUTA 5H1YA 2BJVA 1KO5A 1S2MA 2CLCX 1CU1A 2JJ1A 3W9YA 4BECA 3U44B 1IBRA 3BERA 4P4TA 4WVFA 4F4CA 2QAGC 2NIPA 3CRQA 5DI9A 3X1ZA 1N5JA 1QHYA 2XB4A 2XX3A 4DVGA 1M1YE 3KQHA 2JLUA 3PUZA 3BH0A 1G8FA 1U99A 4PPFA 3GFPA 4KXFB 4MKHA 4IJMA 3OF5A 4LYFA 1SXJB 1OH8A 1W2HA 3BB4A 3D31A 5KU1A 3U61B 3AUXA 3B78A 1IM2A 1KK1A 2QP4A 3DKVA 3WP0A 1EFRA 3VX3A 5FI1B 2RGGA 1T4GA 3C4JA 1A2KC 2VP4A 1G18A 2J45A 2VIIA 2J0SA 2HYIC 2X1VA 1Z06A 4FINA 1KSGA 5CYPA 4I1SA 3GLHA 5G40A 5GJCA 4BE7B 1KMHB 4RZXA 1IXSB 1FW6A 2JLQA 5JS7A 1BO6A 4Q4AA 3PV0A 4B74A 2KWIA 5KPDA 4FMDF 1SVSA 5KSYA 5BWMA 3EWSA 3W8NA 5GVRA 3IO5A 2UZIR 5H68A 3D7MA 1CR4A 5L3QA 4WA7A 4EFLA 2AKAB 4ZDWA 3R8CA 3EZ2A 4IHQA 4JLDA 2WSMA 2WWIA 3CLVA 1RVDA 3I8SA 3WNDA 5JMTA 3AVYA 3ZQ6A 2YHSA 5JEDA 4F91B 2XOKA 3VR4A 1P9WA 2ZJBA 3U4QB 4URUR 1W36C 3BH6A 2IYLD 4PO8A 4V0OA 3U3RA 3QUSA 1ZNZA 2J1LA 2IUUA 3A1VA 3CZPA 5TB5A 3NC0C 3EIQA 3VR6A 1OFUX 2J5XA 1IY0A 1G6OA 5CLLA 4DLZA 2QTFA 2BC9A 3W34A 1RYFA 1SULA 2W2VA 1Z2AA 4GOKA 5P21A 5IRCD 3I5YA 2GK6A 1U8AA 3PCRB 1Z6XA 3WBKA 5F9HA 3WYFA 4EUNA 1W5SA 4PSAA 4BFXA 3AUYA 4US1R 3GLGA 1GNPA 2B7BA 3FHCB 5CIQA 4DHEA 2FFHA 3BJIC 2ZE8A 3SJAA 1RYHA 4XSHA 2JJ2A 4IDHA 4TZ0A 3LQRA 1OE0A 1R5BA 1XD9A 2XTNA 3VKGA 4DC9A 2Z0MA 3RNLA 2V6JA 3GLGB 4G1UC 2QA5A 4LHZA 3I3SR 4BFTA 2A5FA 4H1VA 1GL9B 3HU1A 2E9SA 3ND9A 1E1QA 2ZS8A 4B34A 5KNBA 1IXZA 1DVRA 4YQFA 1AS3A 4JIMA 5KYKA 4LHWA 3AM1A 4NTZA 3MWLA 4PHHA 1D6JA 4EPXA 1XD2A 2O8CA 1T9HA 1COWD 1ELOA 1AGRA 5FOTA 4O2LA 4G3XA 4PO1A 1Q3TA 1NBMD 1KJWA 5JBQA 2FMXA 3SDZA 2PCLA 1G4AE 2FX3A 1CP2A 4RD1A 1E4VA 5E7MA 2VSFA 4U00A 4PC6A 4HDCA 521PA 4GMXA 4JLAA 3WNBA 1S0UA 4RCYA 1K6MA 2HCBA 2HV8A 3LY5A 4JLJA 2BBTA 1KDOA 1KI6B 2QU8A 2WJVA 4NYMR 1OIXA 4YDSA 1ZC4A 4YMWA 1UPTA 2W0SA 3O8BA 5DN6D 1E2JA 1YZNA 2WWGA 3BFXA 2BMDA 4C0BA 1T3SA 1Z6GA 1RPZA 2O8DB 4URYR 3BORA 2W6ID 4DUGD 3KKMA 3MUFA 4GZLA 2ODEA 4LX0A 2CJWB 4MDEA 2ZREA 2QQ0A 2IXEA 3QXJA 1R6BX 4QL3A 4O3MA 3BWDD 2ZXUA 2GAOA 4X8OA 4TQ9A 2Z4RA 4LOAA 3U6BA 4UNSA 3K9GA 4HB3A 1T91A 1Z8FA 2JIZA 2FSGA 2AK2A 2IYTA 4EJSB 2ZR7A 2ODNA 1KI1A 2ANBA 4Q7JB 4F92B 4D4LA 2PEYA 1KJYA 1IN7A 3V00A 4V0LA 4LK2A 2R62A 2ZVQX 1GRNA 1R0WA 3R7WB 2H5EA 4BLOA 1N6PA 4AYTA 4US2R 4ARZA 2J59A 1CR1A 2ZJAA 3B1ZA 3CR7A 1OB5A 3CF2A 3CPJB 4B35A 4QBHA 5DHAA 4B3CA 4DLRA 4P31A 2QBYA 2GEUA 2VLIA 1Q44A 5JRZA 4BUJA 3DM9B 1ZD8A 3IEVA 3MAAC 1RRPA 4PC1A 3MG9A 2AX4A 5CM8B 1QG4A 4NL4H 3H2YA 4UNPA 4WAUA 5D3MB 3RC3A 3LVRE 4XWOA 4R7ZA 5IDVA 1TUEA 4HDOB 3IUYA 4M1WA 2QT1A 2GVZC 4B73A 1HA3A 1TF5A 2QMHA 3RS3A 4Q4LA 3AKYA 3IDQA 2Z83A 1TQ6A 3K0CA 4FCVA 5FBWB 3H0KA 5J4LA 1JECA 3ZJYA 1O3YA 5JZVA 5FPYA 5IT5A 3VR3A 2MSCB 1ZNWA 1S3SA 1YR9A 4HAZA 3GP8A 5EUMA 5DISB 3F5FA 4QXAA 3BAFA 1XD8A 4D4MA 3OEEA 4RVCA 3DHWC 1YJ5A 1DO0A 4EQ6A 5E7IA 2W00A 3L43A 1F6BA 4GP7A 3GLIA 3IGFA 5CITA 3IBGA 4Q7MB 2PMDA 4M1OA 4HZUB 5JJLA 3QF4B 2ZJ8A 2GWHA 5EUQB 3SJCA 2FZLA 1S9DA 5J4VA 4BZQA 2J7KA 5M04A 4Q1AA 3UG6A 4V02A 5TVKA 4QJ5A 2OLJA 4C9BA 2GCOA 4TYYA 2JATA 1CEEA 2QSYA 4URXR 1EX7A 3P32A 3CKLA 3U3KA 4CEIB 2WHXA 4WW0A 4X8LA 3EAQA 1W49A 2O0HA 3ZS9A 4O2RA 3BE4A 2FPLA 4FN5A 3B1WA 1UBCA 2CCKA 1K5GA 1ZUNB 4CEIA 1DE0A 3FMFA 4GBMA 2R44A 3BS4A 3K0FB 4IEEA 4XD7D 5FPHA 3BC1A 3TR5A 4ACAA 2WICA 3ZVNA 4CEHA 3ONWA 2G6BA 5J4HA 3NEYA 1N0VC 2CJWA 4LJYA 1FUUA 1VHTA 2ONJA 5FH9A 4Q9HA 5JI2E 5JECA 1DAIA 2R6DA 4Q9IA 3B5JA 4IVQA 4NYJQ 3I32A 3TH5A 4DIDA 3AVTA 3QG1A 4JL8A 4YMTA 3TKLA 1NN1A 1KIMA 1UEJA 621PA 1XTSA 1V43A 5LB4A 2YOFA 2QENA 2Q3MA 3WMGA 1E3MA 3W3AA 1AZSC 4M4SA 1G20E 1SKYB 3FGNA 1E32A 2REOA 1HTWA 3OIVA 1XEXB 2FA9A 3VHXA 3A37A 1EWQA 1RKBA 3RS5A 3NBYC 1X8JA 4G01B 4BFVA 4B75A 1VG9B 3CM0A 2JLYA 3CZQA 2BKUA 3NIBA 1GZSA 2DCUA 2A5YB 4S35A 1G7RA 4W9MC 4ZDJA 3R9XA 4PQRA 3O8DA 4KVAA 1YHNA 2H92A 4M9ZA 2FDCA 5J4YA 1H8ED 2BBOA 4Q9LA 3CWQA 3SZRA 2WV9A 1U9IA 1GWNA 3AV0B 1L2TA 2XGJA 1GAJA 2FG5A 4LDJA 1TADA 2ZS9A 3UATA 1KKLA 2ZI7A 4XH9B 1OKKA 1OT3A 1U0HC 3OESA 4KU4A 5DI3B 3KUCA 1KI4A 4LJ4A 1MO4A 4LCBA 2ORVA 2MMGA 5KUTA 4PAOA 2C78A 3KQNA 1QHIA 2WIAA 2ZRKA 1SXJE 2JDIA 4OQNA 4B48A 3U60B 2NO1A 1LF0A 4HB2A 3QXCA 2JGNA 2ANCA 1N25A 4CEJB 1W4RA 3PFIA 3K09A 1YRAA 3KQKA 4TLDA 3X1YA 1K8RA 1FP6A 4A15A 3Q5DA 1U8YA 3KX2A 1KO4A 1ZU4A 3WMEA 4WZBE 3FOZA 3B2EA 1KYIA 2G1KA 4ZI2A 5JRJA 3ZIAD 2V3CC 4NCJA 5FTJA 1E9EA 4DSNA 1NRJB 4TSFD 4DSUA 1ZCAA 1J2JA 1HY3A 1CBUA 3AKEA 5KNDA 2NO0A 5JEEA 1P9NA 3AVWA 2VPPA 1EWRA 3K9NA 4C2TA 4KFTA 3NDPA 2OFXA 1WCV1 3KKNA 4C2UA 3SN6A 3A1SA 3D6TB 2CVHA 1Q0UA 1UDXA 4BFSA 2QNRA 4TWZA 3SEAA 1ZRHA 1ZW6A 1A7JA 4AIIA 4C0JA 3T1TA 3T34A 3CRRA 2J0UA 3ETLA 2ZYWX 3I1FA 4GP6A 3NG1A 4L4UA 2HUPA 4DLSA 1WMSA 1P75A 1GRQA 1Z6AA 3L82B 3EWAA 5EP3A 3ZVRA 4HZUA 3I8XA 4M8NE 2ZI6A 4PC2A 4JVSB 5FPTA 4A0HA 2Q3FA 2I1QA 3OEED 1Z07A 3MRSA 4JL6A 4PPNA 5LD2C 4MYCA 4ASUD 3D3QA 3KKPA 4RD2A 1GOTA 3QNUA 1E79D 4ZDKA 4OQLA 1KTVA 3TW4A 4U5XA 4CT4B 4DDWA 4Q47A 2F43A 2EFDB 2WMOB 2V1XA 2H17A 1QHHB 3KB1A 2FE4A 3L0OA 1M7BA 2FV8A 3LVQE 3LH5A 4A36A 4RZ3A 1RJ9B 1MT0A 1QZXA 2OM2A 4GT1A 4Q4JA 5DH9A 4YMUA 1D9XA 3UPUA 4FMCB 1KSHA 2VF8A 1S3GA 2YWHA 3PITA 1KNXA 2JLSA 2FPMA 2WOJA 2ZYTX 4MKGA 1JJVA 5TY0A 3GLIE 1HH4A 1WE2A 4IDNA 3GLFB 1OYYA 1VHLA 1XXHB 4QGAA 2RGDA 4BRUA 2REBA 2DFTA 4LI0A 4B3FX 1CJMA 2G0NA 4JZKA 2IL1A 3ZDQA 4HB4A 3EPHA 1EFHA 2BBWA 1R5OA 1NY5A 3KDSE 5B2ZA 1NY6A 5EE1A 3OEHD 5JSZB 1N6KA 4LYAA 2ZYVX 2GJSA 4TMWA 5FOSA 4JVLA 2FFAA 3K0CC 4FIDA 1R2QA 1DAEA 1ZM9A 3QQ5A 4DJTA 2ZTSA 5CJPA 1O87A 3MJHA 1MO6A 1BKDR 2AFHE 2OV2A 3K1JA 1TTTA 4B71A 3SYLA 3AP1A 3ZVLA 4B3DA 1SVIA 4QKQA 1D8TA 3QEJA 3CRMA 2W6JA 3C16C 2RGCA 1AS2A 4P0TA 1E6CA 1ZD9A 3TK1A 1BYUA 5KTYA 1T3HA 1HUQA 4IEIA 3A6PC 4ZO4A 4I4LA 1QRAA 3TJZA 2VRWA 5EXPA 2O8BA 3PEVA 4LV6A 1V5WA 2DWQA 4TLAA 4UJ5A 5LD2B 1IOZA 2XTZA 3A1UA 3H86A 1X3SA 3G5UA 4XJXA 4II7A 2GESA 1YVDA 2WJYA 5BN4A 4R9UC 1XB2A 5KSZA 4JVMA 1CULC 4DXAA 4I81A 3LW7A 4P3YA 2VHUA 1I2MA 5SZKB 1H8EA 4AI6A 1Q1ZA 3W8RA 2QMOA 2ZIAA 1TX4B 3SBDA 1SHZA 3MD0A 1W1WA 1NVVR 2NZJA 3CONA 4A8JA 3IO3A 1J8YF 4B6FA 3M0EA 1OPXA 2ZSAA 4V0ME 1OKKD 4QJ3A 2F1IA 1G16A 1P62B 4G5QA 4US0R 1U90A 3DDCA 3U44A 1JJ7A 2BDTA 1RFLA 1WBDA 2EQBA 4DCVA 4CGZA 4NHOA 3TUJC 1AKEA 1J7KA 2HCJB 3UMSA 2ZE5A 3CBQA 4UKDA 5KDLA 4HYYA 8OHMA 5TMPA 3WY9A 5L3SB 2GJ9A 2OFOA 3R9WA 1F3OA 1G7TA 4NCNA 4POAA 3E1SA 2CHGA 3IKJA 3RRMA 2VSXA 1M34E 2JASA 1UAAA 3EIEA 4BZPA 1X6VA 5EE3A 1OFTA 3OEHA 1G291 3OIYA 2ZROA 4PZYA 2WJIA 1L4YA 3Q3JB 1KDPA 5G3ZA 2FPKA 1W46A 5E3HA 1IQPA 2FZ4A 2FWRA 3E5HA 1XD2B 4EDHA 1YKSA 2D7DA 2IS1A 4TSFA 1TF7A 3VFDA 4B44A 1NLFA 1FMJA 2WWYA 1EESA 1GILA 3SS8A 3FDIA 4AKGA 4D25A 1E2KA 4LBWA 4C0QC 3K09C 3SJBA 1E2DA 2EWVA 3GJXC 4Y0VA 5AR1A 3RS0A 1XPRA 2XSZA 2ZAMA 2ZSEA 3AP2A 3K0AB 1Z29A 4JKIA 5DO9A 3OZXA 1J90A 2RHDA 4OHZA 4M9SA 2G77B 3E70C 3F3YA 4KFUA 2XNSA 3L0IB 1VIYA 5FOUA 3WNCA 1DAFA 1X1RA 5H8WA 3BFKA 1L7VC 2QMEA 3K8YA 4DLYA 4PHFA 4ABYA 1ZM2A 2ZI3A 3QKSA 3HU2A 2W2XA 5KSPA 4ASUA 4MITA 3VKWA 1DG1G 3BD9A 2IWRA 1MABA 2CBZA 1DADA 2QP3A 1N0UA 2GF9A 1CR2A 2ZRIA 4BGDA 4WIAA 3KTAA 4OQMA 4DCNA 1T5IA 1VMAA 1XMIA 4FMDB 1EX6A 2Z4SA 3PIRA 1HV8A 4HATA 4IOMA 4MUBA 2WWFA 4X8MA 1G8HA 2XXAB 5FBLB 1XX6A 4GMDA 4DIEA 4DDUA 4EJSC 4CVNA 3V9PA 1R7RA 5J40A 5BN5A 2HJGA 1Q1EA 2DBYA 1N6RA 3FKQA 1PJRA 1G64A 4CF7A 5GADl 2AFIE 3QPWA 3IQXA 1II8B 5G3YA 2QEQA 4R2IA 5SZIA 3MWYW 2IS6A 4BWYA 3CPHA 2DWOA 2R9VA 4JLKA 2BEKA 4AKEA 3BBPA 2XITA 2ZS7A 2RHMA 1AJEA 4TL6A 5FR1A 1IN6A 4WXRA 3SC3A 1UDWA 3R9IA 3VU9B 2P67A 5EXSA 4FI3C 1TU4A 2PBRA 3KXKA 1GNRA 4JYBA 4S2EA 1Z08A 4PHGA 3K0SA 3U7GA 2V7QD 2IK8A 4Q9JA 2VA8A 2OESA 1Y63A 5EJEA 1G3IA 2OSBA 4A6XA 2G83A 3SOPA 1SKQA 4OQFA 2AXNA 4TQUS 4MRSA 4UXIA 1LVGA 4WXPA 4PAQA 4TLEA 5JHGB 1SHKA 4TYWA 3I72A 4MGZR 1WP9A 5JWOA 2ZUDA 1M7HA 1NKTA 4B2PA 1ESNA 4G5SA 1W0KA 3G0HA 2EFGA 1G3UA 2J0VA 3THYA 2D2FA 2W6JD 4KSBA 2JEOA 3DMNA 4KAXA 5CIWA 4IDOA 2RMKA 4HAVA 4NMMA 5FTNA 1R8QA 5DN6A 4ESVA 2CVFA 1Y3AA 2G1JA 3ASZA 2A30A 4URZR 1E2MA 3RRYA 2IYSA 121PA 1ZMXA 2W6IA 4KFSA 2CE7A 4NU0A 4BASA 4DUGA 3CX7A 1G7SA 1GIAA 2H8KA 3HR8A 4M53A 3UKDA 2IXFA 3MGCA 2ZRFA 1E9RA 2UVQA 2ERYA 4NBSA 4AYWA 3ADDA 2X2FA 2ZU0C 1JI0A 1KMHA 2KB0A 2VO1A 3EA5A 3QXHA 3U7FB 1E2PA 3S1AA 4Q01A 2LKCA 2FEOA 3LV8A 4FWIB 3DOEA 1KI8A 4ZCIA 3ADKA 4JSTA 2G9NA 3OHMA 2Q9BA 1HT1E 1U2RA 3O47A 5EP4A 1QHSA 4CT5A 1UJ2A 1MRSA 4B33A 3Q7QA 3TSOA 3QPUA 1JQJC 1IHUA 1HE1C 4GRAA 4TMVA 4UJ3A 4BFUA 3BGWA 2ZI9A 4HI0E 4ERNA 3GLGE 2ZI5A 3W3ZB 2N46A 3SNHA 1E9DA 2MSEB 2CCGA 4R2HA 3RWOA 1OXXK 1J8MF 3HYRA 2KI5A 1II0A 2QUZA 2PJRA 2QSZA 1G8GA 3GFTA 4M1TA 1M6NA 1G21E 1XPOA 2O8DA 3F8TA 3QI2A 1UBEA 1UKYA 2VSOA 2O8BB 2R6FA 2OO7A 2ERXA 5TDHA 3N2EA 4Q1CA 3U7EB 1Q12A 2EYUA 2PCJA 4ZDIA 1E2IA 2QPAA 3LXRA 5CK5A 1E0AA 2X2EA 4OBEA 1Z5ZA 2JA1A 2P6UA 3JVUA 1IJFA 4OI4A 4D80A 1YR6A 1WB9A 3FYHA 1FX0A 4PO9A 4DWJA 4YXWD 4XWKA 5AUNB 1Z22A 1Z0IA 3AB3A 1E0SA 2ZRGA 1WA5A 5B30A 5JHHB 3KUDA 1XTRA 4DLXA 5CDFE 1UKZA 2PMKA 5AUPB 2FN4A 4DT1B 5AJXA 2W83A 3PEUA 3UWKA 4Q03A 3SQWA 4DKXA 3QKRA 4PC7A 1NIPA 2PLRA 4TT3A 3GD7A 5JCZA 2RGXA 2IS4A 1GTVA 3GFOA 3KKQA 2HT6A 3LBHA 1YZLA 1EK0A 4Q1BA 5FPSA 3RLFA 5CB8A 2EFEB 5KO2A 2OCYC 4BLQA 4NP6A 3BXZA 5LPNA 2ZRNA 1TEVA 2QQEA 1II9A 3A4LA 1KAGA 2A3RA 4A92A 4HLDA 2MSDB 1YZTA 5LB2A 2IYYA 1N2CE 1E2FA 3SFZA 3PUWA 2JAQA 3KL4A 3EX7C 4FW9A 2Q9CA 3TAHA 1Z47A 5EE9A 2G88A 3TLXA 1VG1A 4QG7A 2RGNC 3A4NA 5B58C 5C4MA 1CJVC 1P4SA 2GEVA 5K8IA 4XD7A 1VCIA 1A1VA 4BEBA 1D5CA 2GETA 1OSNA 2ZEJA 3W6OA 4U7DA 3AF4A 2WAYA 4IVRA 1RC8A 4NYIR 2ASEA 2AWNA 2F1HA 2ZJOA 1F5NA 3K0AA 4TTRA 5B57C 2YOHA 3Q85A 2CK3D 4QNMA 2GHIA 1P61B 2ODWA 2HLDD 1KY3A 2VP5A 4QBGB 2AD5A 5AJVB 4K46A 1G3QA 3NHAA 4YC7A 2OXRA 1S8FA 4Q19A 2V7QA 4OKSA 2J0QA 1CXZA 2V54A 5CK4A 2ZVPX 1EFCA 1TQDA 4Q4HB 4RJLA 3SJZA 3W6NA 4GOJA 2GBLC 2WZQA 4DLWA 1PUJA 2LWIA 1YE8A 2CL0X 2MMCA 2RGNA 2CLDX 2V55B 4PAMA 4RFSB 1FPMA 3VTKA 3W5JA 2QZ4A
chains in the Genus database with same CATH superfamily
2LP4Y 2AOXA 3KHUA 3L41A 4FLEA 2QP9X 5I7SA 2HT1A 2RG7A 1CLUA 3NGMA 3BTSA 3GLHB 3OJFA 1XZIA 4O8CA 1APBA 2VVTA 1TOAA 4BO4A 4CHTA 2ARKA 4HUQB 1AUVA 2BEVA 4EX6A 2FKAA 2J0UB 2OE2A 2BF7A 3P71T 2NMVA 3SR0A 4X65B 5KVAA 3TD9A 1YFJA 3EXEA 3IL2A 4ARUA 2HA3A 1SH7A 4D4JA 2Z43A 3PPWA 1RWPA 3OJEA 3OIGA 4LRSB 4MQMA 2ZUBA 3EHDA 1D2MA 3LX8A 3ZV7A 5C1DA 2DJIA 3TFOA 4NENB 2A78A 4D2IA 2GPYA 2H4XA 2PANA 2QL7A 4K9RA 5JDIC 1EVIA 1OYVA 1UJ6A 3GCGA 3GVPA 4GE3A 4HWPA 1PR3A 2FSPA 4WMLA 3SBEA 4UOZA 3ZW7A 2H5IA 3OQ1A 2RB4A 2IYWA 1N2ZA 1GVNB 3P9CA 5H5JA 3PL5A 4L9AA 4RIIA 3KC2A 4CF6A 1OXUA 3EUAA 3H5OA 4U9IS 5H0IA 2WNSA 2D2IA 2AB0A 3I4LA 3DEYX 3MOGA 5DBIA 3VSAA 3AONB 3E53A 2X40A 5M3BA 1K7XB 5C8XA 1Y6GA 2CHVA 4QWMA 2V96A 3EARA 2X0NA 5FA5A 5KX5A 4DDVA 2FPOA 1EPUA 2A59A 3WICA 4A82A 4CDGA 1X9GA 2P35A 1TM1E 1X7WA 1OR8A 2OBBA 4QQKA 1D09A 1Z0AA 3V8EA 5CBKA 1GDTA 4LDZA 3GEBA 1OXSC 1MQAA 1XZGA 3KEQA 4IOJA 4L3WA 5MFPA 1P73A 3COWA 1SVWA 2E4XA 2BR5A 5ALNA 4WX2B 4Y6LA 1XYVA 2CD7A 3RQIA 1E1CB 3WK5A 2PKYX 3AFMA 1GV1A 2J3IA 4A1FA 4Z53A 3HXOA 3H9BA 4N18A 3QHQA 5FUYA 4Y6GB 2EFHB 1YB4A 2XQFA 4JLOA 4FHZA 3OFKA 4JJGA 4ZREA 4RJTA 4K6MA 2QM3A 1QCYA 1ZI6A 5KQPA 1CSEE 4HN2A 3GRUA 4Z4GA 3VNSA 4ZALA 3LF2A 3NPMA 4JAVC 2Z4TA 2Z9DA 4P4NA 4X1YA 1GVHA 2PU5A 3L84A 1IL0A 1HLDA 4FNGA 4MV7A 4Q4CA 1YO6A 3DO8A 4NE9A 3DXFA 5LUBA 2Q9AA 3IAS1 1EZZA 4UOQA 1XDZA 2A6PA 5JZBA 3OX4A 2IP1A 3ER8A 4BNHA 4XB6B 5GGXA 3JD2A 2O7QA 4G1BA 4L3VA 2AQKA 2CKDA 3U09A 3WMXA 2WNHA 3ZIDA 1YIOA 3L7IA 1VE5A 2AV6A 2GSWA 2NT4A 4RE5A 2IYVA 3GLVA 1TZJA 4EVSA 2XTAA 2CLMB 2ZRDA 4TRRA 1RADA 3OETA 4TV9A 5EA2A 4LGCA 2DPYA 1AC5A 1G7CA 1MXHA 2GK3A 1D2NA 2XKAA 3RADC 1PN3A 5K6TA 2YRXA 3HY6A 2X5XA 5H81A 2WJ3A 4JP2A 2GF2A 4NE7A 2B69A 1FP4B 4TS4A 1NR5A 4CRWB 3OM8A 1VYTA 2V8BA 5BSVA 3OOWA 2GD0A 3GT3A 2E2WA 3ITEA 4ZPJA 1T6NA 3KRTA 1M74A 4FBLA 5C37A 2UYHA 3M3HA 3Q3GE 2QORA 1WP4A 4HDRA 1CNMA 5CLJA 5KC8A 3CISA 2XAUA 2JLZA 4G0VA 5H4GA 1E5XA 4NY1A 2DH5A 3GUZA 5L8VA 2E37A 2ZETA 2VXBA 3QUAA 4PX3A 1RAFA 2AR7A 2NVOA 1AQIA 1YJAA 3MB8A 1NUTA 3PKZA 3H05A 5HJEA 4WCFB 3AVVA 3AVUA 2JFYA 5AHRA 2XB8A 1A2QA 3DMDA 3U3ZA 1GG2A 2C2MA 1RBZA 3N8NA 3VPCA 3WIOA 1K3UB 2GB4A 3H1FA 2AI1A 3ZWVA 4AM8A 5K9ZA 2P2CA 1FQJA 1IK4A 1WX1A 1M1XB 4G56A 3UUEA 4CNQA 1JWLA 2Q49A 5LXTF 1ZM7A 4CUKA 4FONA 4JJZA 5TQJA 4RMJA 1JEQB 2OG2A 1K08A 4AZVA 4POOA 5GZ6A 3H9JA 1R3UA 1E1RD 3TLZA 1QK5A 1Y1LA 1YOVB 2WW8A 2GZDA 4OPMA 1QFZA 2BIFA 3WC4A 4MA5A 3HYTA 4XOIA 4Y2XA 4AJLA 2OXCA 2ZTVA 3QV2A 5LKRA 1MNAA 3FZGA 3TZ6A 1XNQB 5L3QA 4UU1A 1SM4A 2QD3A 4LECA 5LQRA 1ECBA 2QMUA 2V3VA 3P20A 1THGA 1UPAA 3KDAA 3L0PA 1GU0A 2IDKA 4O4IB 4OYLA 2ILVA 5KTNA 4AKIA 3ZHQA 4Q82A 1MTZA 4E5VA 2FMUA 2WOOA 4E11A 4UMEA 4UCXA 5KKAA 2IPMA 1GUAA 2JHCA 3DT9A 4FFVA 4OXYA 3SQMA 3U81A 4AZTA 3F78A 2AG1A 5FPQA 3U7IA 1TE2A 5EESA 5BQPA 4WHMA 1RIFA 1T34A 5FL3A 5JQGA 1VL1A 5TPZA 2H52A 3P9NA 1Z0JA 1JQ3A 1IUOA 2X9GA 4AUMA 3U6KA 1PBTA 1GGKA 2P69A 3A36A 4HQLA 2HKIA 5BVGB 1J24A 4MQ4A 2EVWX 4MV9A 3R9XB 1JKJA 5E3JA 5AVWA 2VNSA 2OMEA 2PGOA 2XWJI 3RYHA 5LFAA 3JQ9A 1UKEA 2I4RA 2ZTLA 3DNFA 2D59A 5DHSA 4RWEA 2AN9A 4HUTA 7ABPA 2JHAA 4QGHA 1AQ6A 4R1LA 5IASA 1QF9A 3HPQA 2G9ZA 1M67A 3FLMA 2JKYA 1KGDA 2I7DA 1XSEA 3QI7A 2PUBA 4LQLA 1ZOPA 5EGSA 1NW8A 1ZVJA 2JLBA 4NJEB 1IN4A 5F98A 2XNDA 1AA9A 3JWGA 3LZDA 2OBNA 4MQEA 4KXMA 1IWBB 1P2TA 3EF0A 4IDQA 4D0GA 4JBXA 2WPDD 3LHIA 3KAQA 4I3FA 1MVOA 4JLVA 2FU5C 2GS9A 2IEIA 1G0OA 3D7NA 1ANKA 5D6OA 3UWMA 1ZR4A 1RE1A 4GI7A 1RIIA 2L2QA 3IB6A 3LPLA 4TYQA 4DMLA 2WAAA 2O52A 1YB6A 2W6OA 4QTZA 5JI3E 4CMBA 3DBHB 4G5RA 1XQVA 1R50A 3CG4A 5DLQC 3L6BA 1ZONA 3ZKAA 5JJ5A 2YMQA 2OC9A 4Q7KA 3L8FA 1IYZA 4D46A 1XTQA 2GPBA 1UBGA 3ELUA 4LOJA 5ALIA 3IE0A 4MHTA 4WNYA 3I4CA 1KSJA 2AZDA 3Q7SA 4KQGA 1FY2A 2J4DA 1YBAA 3DCYA 4CLXA 5BWLA 4YRLA 4LA4A 1U2SA 2OLKA 1N2BA 3ESZA 3EQ6A 4JT2A 2XCUA 2R6GA 4W9RA 1XHEA 3IHWA 3VDXA 5I51A 1J5XA 1SKYE 1E7SA 1Q0QA 2OBLA 4ZYXA 3BN3A 2QY6A 1BDIA 3C4QA 1ZK3A 3RFXA 1QCCA 4UEQA 2PN1A 3U9TA 1NVAA 1NYTA 1DEOA 3EVFA 5ICFA 3RBZA 3ROFA 1NVXQ 4DEYA 4M7WA 1I3MA 3SMQA 4XIYA 2Z2XA 1PZNA 3HUDA 3NDRA 4OJMX 1R15A 1KFEB 1NSFA 3G13A 3R3VA 4BMSA 1IWPB 4AZ3B 1DBRA 1QV6A 1C0IA 1HTBA 2CLKB 2HMSA 3N1UA 3VX4A 3WJ1A 4CIDA 1A9XB 4Z1MD 5A4MS 1QE3A 2JCGA 1S8NA 5ENZA 2GT1A 4ZT4A 4C4AA 1FXSA 1U2QA 1ZG3A 5JAIA 1G20B 2C77A 3EXHA 3GDFA 1T9DA 4LGYA 1KVSA 3PRJA 4FHCA 7MDHA 4YAEA 1VSQA 3QJYA 1R8SA 4G86A 2XJ9A 1LQTA 3LQQA 2DBQA 2CNDA 1RTKA 4B46A 4C7BA 5CFRA 5EJ9A 4YMLA 2DUWA 4UE3S 4EVRA 3EVAA 1YS9A 1T4DA 1X2EA 5K05A 1ZUIA 1JSXA 1X86B 2IUSA 3BVPA 4X92A 1NNLA 3EYAA 4AJIA 5KOYA 4QM7A 4CG3A 3DW3X 4QOSA 4CEHB 2HA6A 3KJZA 5GGYA 2IOFA 4DCJA 4C21A 4DIMA 4KX3A 4YP9A 2OGSA 3AQ4A 1NW9B 1E9FA 5FX2A 2G1AA 4MVYA 4MYUA 5IVHA 4JK3A 3ZGLA 2UXDB 5LQJA 3GYGA 3I1JA 2YYZA 4PZCA 5K3FA 1LLFA 2L17A 3X3HA 2QM8A 1ZA2A 4N0EA 5JCPA 1W5AA 3DL2A 3PNOA 4YJ3B 2PUWA 4FGWA 1BTOA 1Z68A 5FO0A 5GONA 1T4CA 1P7CA 3JQBA 2B20A 5LM3A 1GTRA 4OLAA 4OHMA 2J9ZB 4L4SA 4C04A 1KAHA 3OPMA 4LHXA 3N3AC 3L04A 4YLGA 2VYFA 2ECOA 2IU0A 4ZIRB 3GDGA 1G98A 3N59A 4HB0A 4IOLA 4GX0A 3ML1A 3A1FA 4LJ6A 4O3FA 2VWHA 3DZHA 1H65A 4DSZA 1IAVA 4YBZA 4NCHA 1KQPA 2VJDA 2HLNA 1B2LA 1RKXA 3A05A 1YS4A 3SHWA 5EJIA 1OX4B 3HJNA 3AV3A 4LXXA 1XXHE 2X41A 5KKCA 4KLCA 2I67A 5K4AA 5GP1A 2PUCA 1FJGB 4UUNA 2O8EB 3VZBA 4RH0A 1GKKA 1J07A 1THMA 2PRZA 3ESCA 1CF2O 2WYOA 3MJEA 5C4GB 2QUAA 3JALB 2XNHA 1YQTA 1C3OA 3CRZA 2P7HA 3K0EA 4LEIA 3T5MA 821PA 1CJKC 3E9RA 1ZKMA 4H17A 2VT2A 5JH7F 3QFRA 4J0FA 1CB7A 5DOZA 3VU9A 1QHNA 5DHFA 2WYIA 2O8EA 4XRGA 3DFKA 3C85A 2WMDA 1CE8A 5HVNA 3DC2A 3EZGA 1QIEA 3I61A 1MOQA 5UKDA 2VP2A 3JQFC 4QTTB 4BFYA 4KPEC 1SVLA 2YXNA 3QUQA 4MVJF 1YQXA 5JS2A 4QXMA 1JR2A 1SVMA 2BFWA 2O06A 3BWCA 4KLZA 3CH5A 4MRPA 4R84A 5E9AA 3O8LA 2HRRA 5GMOA 1D2EA 1SO8A 2A14A 3C14C 2BFCA 5GQSA 5DYIA 2QVZX 4X6UA 5KWVA 1GZHB 4BVEA 3S81A 4PNPA 3Q8LA 2A9PA 1ZGGA 3PSAA 4PFSA 4PFKA 4CM5A 2ZJ2A 3K70D 2WM2A 4KSYA 3WK8A 4EY6A 1UMBA 3GLUA 4XYMA 3EMKA 3KFVA 1Z6PA 3MCAA 1I2ZA 1E3QA 1ZK1A 3S68A 3HEMA 2XWPA 2QPOA 4WVLA 2IS2A 4M7PA 2GFIA 3RRZA 5FRDA 4CFZA 1NOIA 3P0JA 2ZKIA 2H85A 3C5HA 2Q21A 2X5NA 1FX0B 3FZNA 4D9JA 4EG7A 5BSHA 4W1RA 3AHJA 3QNMA 4TWRA 4DUYB 1FNSA 1C9KA 1OW3B 3PGKA 1DB3A 3WB9A 1Z5NA 2K6GA 4A4DA 4YO7A 3U40A 2PSSA 5EIOA 2VAPA 3GF4A 3CW2A 5WRFA 3KXLA 1JR3E 5AW3A 4RPJA 4CGYA 3F9IA 2PNJA 2YXBA 4MA4A 1XPJA 3H75A 3GRAA 4BNIA 2BCEA 2QGNA 3AQIA 4NAVA 5EIFA 2XV1A 3PQFA 5AVJA 1GARA 1ZR2A 2BF4A 4GF5A 3NYRA 1F0NA 2VK1A 1B6GA 2XNDD 3HCBA 3R7NA 3WBJA 1PCXA 1NR1A 2PWBA 2V7UA 1J33A 3GLFE 1QM5A 4P1ZA 2VTBA 1GZ4A 1RQLA 3BEOA 3NZEA 1LPMA 1WKCA 4B8YA 2ZRAA 3SQXA 1VIAA 4J03A 3TSWA 2BGMA 4WKBA 2O3JA 3O75A 1DHRA 1BJTA 3PUJA 4R69A 2ZAYA 5CNJA 3X2FA 4JLMA 4KQFA 1LPNA 3L8ZA 2PS1A 3VVBA 2E89A 3JD0A 4BYGA 1SU6A 1GM5A 2HGZA 2VEDA 3CX8A 4U5QA 3FCAA 4F46A 4P3XA 4A5OA 6ADHA 4NCAA 2ECQA 2WEKA 1EVKA 3IUNA 4HS9A 4MMXB 1MRNA 1WZNA 2F9LA 2QUBA 2FKNA 2FK8A 3AX6A 2EW8A 3B12A 4UNNA 3UXHA 4L0CA 2MOKA 4UNRA 1DELA 1TCVA 4CZ2A 3PK0A 5AUQA 5CBPA 4K5QA 1U0RA 2NZYA 4UE2A 3INRA 2C7PA 1T4CB 2XGOA 3D5EA 4J1TA 1MO5A 2XNKA 3UIEA 4HMPA 1PFVA 1L5YA 1SIWA 3LQKA 3ER6A 2CUTA 4I8XA 3VOAA 4B43A 3IRVA 2GPAA 1XNJA 3ONEA 3WL6A 3C3YA 3ZOZA 5GONF 3MT0A 4Q9KA 3UBTA 5FHQA 2R1TB 4UHFA 1DJNA 2WTBA 1YAHA 2VT7A 2XYGA 4EIWA 2DERA 5TQ0B 2FTKE 4NJOA 4L07A 4GVXA 1LWNA 3AUJB 4LYJA 4DV0B 4B6PA 2BFDB 1JXOA 4FNOA 1OUMA 3PPXA 3P2OA 4UBNA 2IYFA 5EWLB 5T4FA 5A6SA 3PQ4A 3R0QA 1D4ZA 1FS5A 3LQ1A 1HEIA 2OCDA 3R3YA 4XUEA 5HF8A 3T7SA 4AYXA 1U0LA 2JGDA 1T26A 1XTVA 4RHFA 2XMGA 4QJIA 4E70A 1NQUA 3PNPA 4BJ6A 3WZLA 4AG6A 1MH9A 1OHHD 3GUUA 4YHBA 3AUFA 1R0RE 1YQUA 2X0KA 4IJ6A 4YJKA 5K7SA 4L9WA 1TCAA 1ESMA 2JCXA 3R1IA 2XB2A 3AC0A 2FRDC 3DM5A 4MWGA 1E6LA 2J5KA 3V1NA 1CY7A 1OA1A 2QN6A 3I58A 1MG5A 1BYIA 3OSUA 1BDJA 1ECGA 4KG7A 2ZRLA 3E4CA 2C9BA 2XUQA 4E5UA 1M2OA 5CDYA 5DYTA 5AVVA 1GYPA 3COSA 1KR2A 1ADYA 1CS0B 1DEXA 3ET4A 1FRQA 4R1SA 3CTPA 4YPOA 4U6NA 5CXSA 1JTFA 5FTLA 4KV9A 4IZ6A 2BFEA 5HA5A 3A2KA 4QHYA 3H0EA 3E9NA 3VU3A 2P11A 3AO0B 4FX2A 5THXA 1HT2E 5JJCA 4CMAA 3G0OA 1GTJ1 4LZOA 2IEYA 4UM8B 3W0LB 2EAUA 3E2PA 4E88A 4G89A 4X97A 2ZM5A 4Z7QB 4HGOA 5KREA 1PNVA 1QGDA 3AM5A 5I5EA 4EMUA 5SZHB 3C5CA 1S6YA 1DTWA 1JXAA 4LHVA 2RCNA 2EZ8A 3TRDA 3CU5A 2FGKA 3KQLA 1VZ2A 1GLVA 2C9YA 3IP9A 1VSVA 4OFBA 1EWYA 3D0QA 3TBFA 1QBKC 3NHKA 3TG2A 2JI9A 3AJRA 1QVWA 3UG7A 2BFCB 1XG5A 2OVBA 3X1XA 3O2SB 3CNLA 4CTMA 1JFSA 1FNCA 2ASVA 3GJ5A 3ZDCA 1V16A 3GB9A 2DC1A 3IQIX 4AWAA 4WD3A 3ZZTA 1JQBA 2CK3A 2L19A 1J21A 2VDNB 2VF5X 2J3EA 4A91A 4MOWA 5TSDA 2CE2X 2AI3A 5TV2A 2C95A 1QCZA 4EECA 3PUIA 4ENSA 5ED0A 1G8AA 3VXKA 4HDQB 1DMRA 3KYDA 1CEXA 2RHBA 2YS6A 1LBHA 1HSOA 1Q7RA 5TPWA 2BCGY 3QYJA 4C6RA 2PBZA 2HI0A 4P4SB 4CM9A 1PJSA 3NTUA 4HDMA 1O77A 2A9RA 1T8RA 2XVAA 1WPGA 1NQAO 1ZL2A 4UAGA 2ZXFA 4LK3A 3ICQB 3VNUA 2G09A 3D81A 2NSDA 3VJRA 3BK7A 2VZ9A 5EG5A 1KH3A 2IYNA 3OIUA 4F6RB 1IBMB 1OFGA 5TT1A 4NZ9A 1URPA 1W88B 4A27A 1XU7A 2HYDA 1H2RS 2D7CA 3KJIA 2N0SA 2DY1A 3QVGA 3LT0A 3A1CA 2H0RA 4JI3B 1N3YA 2PUDA 1QMPA 5DIZA 3MIZA 3OF2A 1T0HB 3HFSA 2NTJA 3I76A 3ZW9A 1JDZA 1P2GA 3MLEA 1R5JA 3DR3A 4N01A 1XDDA 4MRRA 4OP1A 3ECAA 1IMOA 1EM6A 2QPTA 2X15A 3Q9UA 4WZAE 3UJ8A 2P4HX 5AICA 4TKVA 4DSOA 4TZTA 1JG6A 1XIVA 2IOHA 3CB4A 4ZV7A 3VR5H 5K6RA 1YF3A 3NBXX 2D2VA 4KN6A 3BT7A 3VPGA 2C4NA 2HRCA 4MP8A 4X00A 4D9HA 1R0YA 4J0EA 2P1DA 1DXOA 2XKJE 1XDSA 1A88A 3N0VA 1SZJG 4MP3A 3UKJA 2ABWA 2XGGA 2ZXEA 3COZA 3RVJA 2FPGA 4EY7A 1DBPA 4P32A 4R2WA 4EY3A 2R0QC 2W6MA 3IAEA 3BTVA 5E95A 3TCNA 1XBTA 4E2YA 5JY1A 2QD2A 4MUFA 2UDPA 1P9OA 3Q4GA 3B7GA 1PLLA 1XAGA 1VGVA 1W94A 3CV3A 3D4PA 3LX5A 3ASVA 2G06A 4Q12A 4QPNA 4WK6A 5EPEA 4K88A 3C48A 1UZAA 3FCCA 1G5PA 2K5UA 2EBFX 1ZK0A 1KZ6A 1BJRE 2X14A 5F52A 3D8BA 3U3JA 2XKBA 2YXLA 5G4LA 1QP4A 5FUWA 3OCXA 5F4ZA 3MWKA 1E2GA 3TFWA 1YOVA 2C5LA 4EG5A 4YMVA 3QEMB 1XDWA 3RU7A 3UCEA 3VNVA 2JNWA 4D3XA 5KNBD 2G67A 5BV0A 4Q7EA 4WESA 4HK4A 3EEOA 1YQGA 4LDRA 1PD1A 3EVCA 3FPHA 2G17A 2W2TA 3NBZC 4PG4A 4U2KA 3PSHA 3W79A 3O4IA 4TLBA 1YE3A 3G0DA 4QC2A 4YIKA 5J4KA 5A1TA 1NUHA 3CJQA 2F9FA 2IEGA 1W47A 1C9DB 3CLTC 1NZDA 1POXA 5DE3A 3AF2A 4CE6A 4KQKA 4OQZA 2BDEA 3VYWA 1XAIA 4W1PA 2WU8A 3TG8A 4J4BA 1N36B 3UV3A 2E4UA 3ERCA 4S2UA 2IU6A 2GN0A 3HJGA 5GVSA 4CFYA 1YFKA 2BR4A 2B4RO 3RIMA 2SHKA 4OXIA 2WP0A 4LFBB 1N3BA 2C5FA 2WUFA 5AP9A 4OLJA 2F55A 3EGXA 1KDRA 1JAHA 1XCPA 2XEDA 4RIHA 4PZEA 4B6SA 1VPVA 2X58A 1V7PC 4ZPXA 4OJQA 1XCMA 3CT6A 4ZVOA 3RD5A 3PNKA 4IS3A 3MFYA 2HHLA 1RPAA 5E38A 4JC4A 1MC8A 4ON9A 1P0IA 2B4TO 4ZU3A 3VOBA 1DIBA 3LCMA 5FBKA 3S6JA 1KR5A 1FQOA 2ZDGA 4QOEA 3TMAA 5DYGA 3ZWOA 5DASA 4OREX 1T8PA 5A5EA 4ZC8A 2V9CA 3F4BA 1CUIA 5KJEA 1F38A 4C03A 1G8PA 3CKKA 4ZCTA 1Q0RA 4FWTA 4RGQA 1BS2A 1XTIA 1ZCZA 5TC4A 3LD9A 4LJ8A 4U2FA 4FR5A 3V4ZA 5FNVB 1KTIA 2IBMA 1VLQA 3PICA 1SVOA 2Q3JA 3FB4A 4MQEB 1FUKA 3RE1A 4D8XA 5BYAA 5ADVA 5K8LA 1OY1A 1J0BA 1M8JA 1R0SA 5F21A 1NOKA 1RM3A 2AVNA 3IJPA 3QBVA 4UQOA 1AMNA 3NM6B 1SA0A 3E22B 5DNCA 1GLGA 4MVJA 4INAA 5AW7A 3AUUA 5IDYA 1ZO8A 1A9XA 1NUPA 3DL7A 3HUTA 3RANA 5KS2A 2YWFA 1S2LA 1H2ZA 2R87A 2WVHA 2K7ZA 2W71A 1V11B 1PGOA 1X7YB 4KI0A 4LOLA 2H2AA 2P6RA 3EW7A 4BLSA 2C9CA 3K0BA 1YC2A 3AHCA 1DRJA 1OILA 4U4AA 3U4HA 5BYJA 5M7EA 3C8HA 3CLSD 1I4EB 1Q50A 2EZ9A 2HMTA 4HSEA 1Z4LA 4LNHA 1KXJA 4LY0A 4Y1RA 2Y4OA 5AVTA 5HM8A 3KQPA 1WMDA 2V7BA 2JAOA 3D8NA 1KMNA 1W8IA 3L0DA 1Z74A 2OBMA 2FRXA 1B8PA 4LMRA 5DK4A 5JALA 2OCGA 5J1TB 4B40A 4GI1A 4YQZA 5BUCA 3CNNA 3TUZC 2E18A 3EIHA 2O6HA 1Z35A 4LBVA 4EFKA 3CGGA 4HVLA 3JZMA 2FFBA 2GZSA 1ZH0A 1YZVA 2OHJA 4Q1EA 4D42A 3KFXA 3K70C 1OF1A 1KAQA 1M1YB 1WEKA 2O1WA 4OI1A 4BVAA 1K66A 2MSKA 5EWJB 1OYOA 2B8EA 1G6KA 1LPOA 1UANA 5AKXA 5KAMA 1NJ6A 4AXXA 4JT4A 3L40A 3ZLUA 3LC0A 4LF5B 5F3WB 4IRUB 3UK2A 1VIDA 4EJFA 4K2HA 3KOYA 3OJLA 3TSZA 2PZEA 3DYVA 1GZ7A 2CHFA 3I83A 4UM7A 5IYZF 4AZWA 2F8MA 3HUFA 3S1SA 1U7DA 2AQHA 1DWUA 3DW1X 1XFAA 2G28A 2ZUTA 4NMHA 1Y6ZA 1U2GA 4GPAA 1VYVA 4QQRA 2XAAA 1PHRA 2HN9A 4IIJB 3PFGA 4KPUB 3RPEA 5EI5A 4MPRA 1S89A 1S4QA 4MUAA 4TLLB 3WRYA 1R0XA 5TMEA 1R6VA 5JAHA 1O9HA 3HR7A 1I14A 3G2LA 1BEUB 1ZYUA 2EF0A 3AIIA 2VP3A 1XE3A 4H1HA 4NCIA 2VOEA 4IIHA 4X1YB 3QU7A 3BULA 1XQYA 1G8MA 1YVUA 1FFWA 2DFLA 3CSSA 4MDFA 4JEUA 1QDUA 1DAHA 4AJNA 4DZRA 3LOPA 5CDUA 4FX5A 2J67A 2YV4A 1Z6TA 3C1AA 4B9AA 4KCGA 4IDDA 4C6HA 1PSZA 1WIWA 3QKSB 1D7AA 1VYUA 3H5RA 4BLUA 1JQEA 2E3JA 3GH1A 4FTWA 3NBUA 3N07A 2Q3BA 2J8ZA 3X1MA 1A69A 2BWJA 1UFOA 2VZ0A 2TECE 1ATIA 5KDOA 4RV5A 1FVHA 4BMPB 5ALYA 2AWOA 1C8KA 1B43A 3IUBA 3OA2A 1PTJA 1NONA 3OPXA 4H7DA 3UCXA 1HFWA 4HYEA 4ND4A 3SFTA 4LKOA 2BDUA 4O4LA 1KEVA 1WHSB 4WEOA 4WZAA 2A57A 4QGSA 4B3XA 4EGFA 2WTMA 1DAPA 10MHA 3FKSD 4M76B 3Q8XB 1L4EA 4L5AA 1ZVKA 3JV7A 4QICA 1I10A 1P17A 4MV0A 3WKCA 4KP7A 4I7EA 4MUEA 3PFCA 3IAUA 4G5HA 4AMGA 3G02A 2OWDA 4PBSA 4V2IA 5C1IA 2CNWA 3B2NA 2ZRHA 5B1IA 5TRTA 3RS4A 2M6SA 2PL3A 4EGSA 2EKZA 5AQEA 1E3SA 3GDOA 1KS2A 3WGVA 4OB6A 3NOQA 3VYSB 5T3YA 5TE9A 3QEOA 4PHTA 3AF5A 3KLMX 1Q20A 1JG1A 1EP2B 2DYKA 3AVOA 3SE0A 3UA4A 3WKDA 3FLBA 4HHEA 2YWXA 1EGQA 4Q1FA 2B8TA 2DPMA 4OEHA 4P3PA 4ETWA 3NO4A 4IV0A 1B3BA 3RHFA 4TZ6A 4CIXA 4V0SA 1GQSA 1Y1RA 3V7NA 4Q93A 5J59A 3HYSA 1K4MA 3VI3B 3HKCA 4F38A 2RJOA 2JI6A 5HIJA 3ZYCA 2ZZMA 4Y18A 3PJDA 3QKRB 3QIAA 3ZNQA 4D9KA 8AT1A 2AYZA 1ZCBA 2OCXA 2YWJA 4RC9A 2I66A 5AW1A 2GM5A 2C20A 2XT6A 2CGEA 1DV2A 1E7YA 1JYSA 1SCUA 1TTHA 2AG5A 3OZEA 3WNZA 4E22A 3H99A 3PX7A 4Y6SA 3ZHVA 3WAKA 4O0MA 3L6CA 2A5LA 1ZW1A 2JLWA 3G7NA 4L22A 3QXSA 1RD4A 4IDEA 2V5VA 3GBVA 1T1RA 4TROA 2JCSA 4CMEC 4WLNA 2H7YA 5MFZA 3H9QA 1E0KA 4JVOA 4BE7B 1U8UA 1I2CA 4OSEA 1A9ZA 4PNZA 4URVR 4BZZA 4C6TB 3CWZA 2WAMA 2MR5A 4CMJA 1NL3A 3ZD7A 1GZVA 3IAHA 1C29B 2PGNA 4GBJA 3RUEA 4QXQA 4OA8A 3ED1A 5JAUA 4TUYA 4KNWA 4E09A 2O4CA 3AJEA 1QE5A 3CNOA 4DT1A 2JDID 1T24A 2FQWA 3AR9A 4OJYA 1A8SA 3QVTA 1EP1B 2G9VA 4PZDA 2FPGB 2Z3WA 2WIGA 3DFMA 3MT7A 3T61A 3M6FA 1XTKA 1XMJA 3DQPA 4MIOA 1T3TA 4GD3Q 3BQNB 4RMNA 3U80A 4M37A 2HF7A 3UFXA 1ISIA 2FOXA 2B6HA 4HRVA 3RK0A 9LDBA 3WWOA 4K9MA 3OIWA 4K9SA 4QJ4A 4Z4HA 4I5IA 3EQZA 1EXVA 4L8GA 2CMFA 1VA5A 1W4LA 4MR7B 4L16A 2OCPA 3TTYA 1QRTA 5LYJB 2Z58A 5IMBA 3PGMA 4YASA 2NU8B 4OKIA 1QVVA 4M83A 1QIDA 1UXGA 4W8OA 2C9OA 2ZDQA 3PHIA 5C8ZA 3W5BA 2GXAA 1XR3A 4PQYA 1IOLA 1ZUD1 2WKWA 3GAFA 3SI7A 4CL0A 4V1CB 4UEJA 4JITA 1CKEA 1UM8A 3JWPA 1GL3A 3K4PA 5EJMA 1LJUA 2Q2OA 4PNHA 5FI3A 4EZIA 5DM2A 4XQ0A 3B1KA 3ZU6A 1P7PA 2UZAA 4DCCA 1RYBA 4IJWA 5KYWA 2XDQB 5DNYB 2JLVA 2NGRA 4CJXA 1KJZA 1XRMA 1H4VB 1UINA 3EN0A 5KTPA 3E81A 3RSFA 1G3MA 2W6CX 5F51A 1L7RA 2WQZA 1GDDA 3ET5A 4ZOAA 4EZBA 3KZKA 3RYIB 5C53B 2PT5A 2G3YA 2WI8A 3RBVA 2C61A 3KVVA 3UJ9A 4U0KA 1E0JA 4OYHA 3REFA 4L95C 3OLCX 2HIGA 3HDHA 4QT0A 2Z9BA 4R8SA 1XAJA 1CTQA 4R4JA 5CGZA 4WERA 3KD3A 2YNMA 1JJIA 2J9GA 2ZSKA 3DDNA 4KIUA 4DN6A 4FFBA 1LUAA 2ATVA 4NG4A 4ADSG 1AO3A 3VH3A 1RLTA 1FUEA 2GM9A 2OCBA 2R7KA 3CEJA 3QPAA 4EHKA 5KQGA 2XZOA 5EZ6B 1EAMA 1OROA 3R8XA 1Z18A 3BXXA 5ALQA 3F1LA 4N7RA 1XQ6A 4QRHA 3FRHA 1HFJA 1C1YA 2FSVA 2PKXA 5CHYA 2CDCA 4EKYA 4W5TA 2MJLA 1WQ3A 1LLQA 1SIBE 2DWPA 4H7EA 3BRQA 5DBHX 5EHGA 3TLEA 2PU7A 2Q6TA 4PR0A 4B3BA 3NIFB 1KI3A 1A7AA 2EX1A 3DVAA 4CLEA 4F4HA 1M5RA 1DRUA 3RTBA 3QKWA 2H07A 3QWHA 3T5GA 5LMZA 4HQ6A 4R6WA 2VJPA 4HLCA 4ZVPA 1GGMA 3UJHA 4OJTA 4DAEA 3BSFA 1WXXA 1MOZA 5BORA 2V3WA 4BNWA 4DDKA 1R5NA 4RA6A 2WSSD 3WRYC 5LJLA 3FOEC 5B36A 1EJ6A 3PX2A 3T06B 4BMNA 2P5TB 5HIAA 1WM1A 4BLRA 3WA6A 1SVUA 1PZXA 5JCOA 1EE9A 4B1FA 1C8VB 1QZ3A 1E6KA 4JP5A 4XARA 1T5LA 2QTZA 3N3BC 3OT1A 4IIJF 1EH5A 1EUYA 3W8EA 1ID8A 3AZOA 4WN3A 1HURA 1OXVA 2ZI4A 2NZ2A 2QROA 3DL0A 3TQSA 4EI2A 4LHEA 3SC2B 3BZBA 2Q3HA 1GUFA 2QUIA 3EDOA 3GDWA 3NWOA 3GPBA 4X20B 3Q7RA 3LU1A 3E03A 3OZSA 4KO8A 4KR9A 1QYVA 3C98A 2O2SA 3FKSA 4FMBB 3A25A 1M2VB 3KLBA 4QFBA 4RL4A 1Q3KA 4A0RA 2YIMA 2GI4A 2ACEA 5KPJA 3M8KA 4R41A 3K1AB 1C2TA 3MWFA 1QGZA 1PV4A 3WL3A 2OCAA 3V97A 1K7FB 1U7ZA 4MW2A 2CNWD 1GFWA 4TL8A 2X4LA 4O08A 3UXYA 5AKHA 2YJ6A 3RFUA 4UMVA 3WKEA 1Z3CA 2D3WA 3O1JC 3UJ7A 2EWWA 4FYHA 1GTG1 2VNHA 4KDEA 4DRZA 5JMWA 1HPLA 3CUEF 5ECGC 3EOAI 3TLJA 3I52A 5BQ5A 2QVBA 1ZBQA 3SDBA 3ZCXA 2A33A 2BCJQ 2ZSFA 4U9HS 2XGSA 2MDTA 3ENQA 3K35A 3PYLA 1H2FA 4Q5IA 2BUBA 1SR8A 2PUJA 4LHSA 3WK4A 1B23P 3NS7A 4DB4A 3L2OB 3WS7A 5GZ3A 2YYSA 1T6ZA 1RZVA 4WSOA 1CZNA 2VP0A 1BN7A 4HGPA 4DYDA 4ER5A 1KP3A 2AUNA 4HDAA 3U1VA 5FWYA 1P1KA 2A5JA 3GG9A 3HCFA 5I9IA 1T8UA 3A6LA 3AR3A 4FCTA 4N5IX 1YI0A 5E1MA 3RVBA 2PD4A 1ENYA 4BP1A 3LBIA 1IVSA 1K27A 1YRQA 2A0XA 2FW1A 1J70A 2Y05A 4OQXA 1LGYA 5M29A 3CEHA 4LJ7A 3RS7A 1R27A 2M1XA 1WB5A 2QT0A 1ZJ6A 3BIOA 5J5AA 4ZV4A 1HETA 1XHFA 4J1QA 3QY9A 3DOHA 3KQUA 2O14A 1GEEA 3CINA 1A27A 1UF9A 2PZFA 3FYUA 3QOFA 3QVMA 4HWKA 4Y98A 3RQSA 2AGVA 2ZITA 3RYIA 4C78A 4NS4A 2QL6A 1PF7E 2IQIA 1JIVA 2PO5A 5EHQA 4YONB 4AT1A 1RQGA 1FE8A 3A4MA 4AJ9A 2WMYA 4JI4B 5IBQA 3GLFA 2RJ3A 3DE6X 3NASA 1U1DA 2IUTA 5H1YA 4X85A 2BJVA 2OCIA 2V5UA 1N0IA 2JJ1A 2G1UA 3U44B 5E9JA 1B14A 3BERA 2BUAA 2HK7A 3CE6A 3NRBA 4I50A 3K31A 4ZVKA 1Q84A 3CRQA 1KU0A 4MCHA 1RHMA 4MV4A 4R9RA 4ZAZA 1N5JA 4RTJA 2RHJA 1PL7A 1K3FA 1S2OA 4NBNA 4CCYB 4UTRA 3PUZA 5EJ4A 3BH0A 5JSQA 4PEVA 3H1PA 1LXCA 1UWVA 4IJMA 2ZJ0A 1XQ1A 4B5KA 1HX7A 1T2VA 3AUXA 3S7ZA 4ARIA 3DKVA 4QPJC 1NWCA 3AUAA 4GI5A 4RM2A 1BMQA 2P7IA 4EEKA 4P58A 4R8KA 5FI1B 2YFQA 1V48A 2JD1A 3MUOA 1JSRA 3F6PA 1NX9A 1K86A 2J0SA 5JSHA 3PDUA 5DBFA 3I6QA 5AQ1A 1XA3A 2I87A 2CT8A 2X1VA 4XPIB 5I3ZA 4JOQA 1L7MA 1YHYA 2UVPA 3R23A 4GWLA 5GJCA 4RA6B 1GUBA 1KMHB 2QRPA 1DMSA 1P0PA 4PX2A 3VZQA 1MPTA 2R48A 4ABTA 1RM0A 3IAM6 4ZCSA 4Z2AA 5AOVA 2C1ZA 5JYDA 2Z6AA 3CKMA 1KF0A 2RHTA 1JF8A 3HI4A 2IRWA 1TMOA 2SCUB 1BWQA 4LC9A 5KSYA 4PRZA 2YICA 4K9PA 3EWSA 3W8NA 4CKBB 1EUQA 1MORA 5GVRA 5H68A 3H87A 4NV3A 4EQZA 3MTDA 4UBKA 1K7YA 3V4RA 2H1SA 4EFLA 4YR9A 4BUZA 2P90A 3DQZA 1YB7A 1ULUA 3E7PA 1S7CA 1XOIA 3RUCA 4Y6OA 4IHQA 3UAXA 3IDAA 1JG2A 1G2PA 3BCHA 3I8SA 3TXAA 4XDZA