5AWFC

Crystal structure of sufb-sufc-sufd complex from escherichia coli
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
243
Chain Sequence
MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/protein binding
molecule keywords FeS cluster assembly protein SufB
publication title Functional Dynamics Revealed by the Structure of the SufBCD Complex, a Novel ATP-binding Cassette (ABC) Protein That Serves as a Scaffold for Iron-Sulfur Cluster Biogenesis
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 78
structure length 243
sequence length 243
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5awfC00
1OH5A 1QDEA 3RAPR 2AKAB 4DLTA 3ZLJA 1KZGB 3FTQA 3HYTA 5F2EA 621PA 3R7WA 2CVHA 2VHTA 1D9ZA 4RZ2A 2WZQA 3KJHA 3F0TA 4M1OA 1E9SA 3K09A 4KU4A 4JL5A 4CEJB 3NWJA 3L8ZA 3MLEA 1E2KA 2BCGY 4V0MA 5BYJA 3RRMA 4JYCA 4DDTA 1M7BA 2QTHA 3V9PA 3O8RA 2UVQA 4PAQA 1AKYA 3BGWA 4DT1B 2ERXA 1XJQA 5KPDA 5CB8A 1FOEB 2ZRAA 1C1YA 1F60A 4HSEA 1F2UA 3DO6A 2IWHA 3QPUA 1AGPA 2QMUA 4LJ6A 1D5CA 1OHHD 5AK0A 5EQTA 4EJSA 3QUSA 2BM0A 5E7IA 3I92A 2A30A 1M7GA 4DDVA 2OAQ1 4D4LA 4X8MA 1GIAA 1DO0A 2NO0A 2ZE5A 3EIQA 1LFDB 2VP5A 4KSCA 3X1YA 2RGNA 3A4MA 1LTQA 8OHMA 1XTIA 2ZE6A 4ZIRA 2W00A 4HAXA 421PA 1KDPA 2QTFA 1XMIA 3ZD6A 1OXSC 1D8TA 1TADA 1SVSA 2QPAA 1JEEA 3H4MA 4DB4A 1NIPA 1AM4D 1XTKA 3P26A 4LBVA 5JJLA 1EFRA 5FPHA 3DKVA 3RNLA 5K8UA 5FFMA 2PLRA 2VSFA 1RIFA 3MJRA 2ZS9A 4HB0A 2HCJB 1M74A 2FX3A 2LKCA 2OBLA 2HYDA 3RC3A 1CF4A 4AI6A 5EZ5A 2RGCA 3U2QA 1ZBDA 2JAQA 3TMKA 2GETA 4BFSA 2D7CA 3W5JA 1OXTA 5KO2A 1P75A 2OV2A 1JJVA 3AKEA 4BLRA 1II9A 2O5VA 2OCPA 3OF5A 2QRZA 2V54A 3QI2A 1DTSA 2IYXA 4KLNA 1UADA 1SXJE 1KYIA 3CRRA 4GDFA 2CK3A 1ESNA 3RRNA 4QG7A 3SR0A 5KNDA 5LB4A 2NQ2C 1W1WA 4M1SA 3EPJA 3EPHA 3RANA 1W48A 3VHXA 2VEDA 4MQBA 3D7MA 1E2HA 2EFGA 1RW4A 4TN1A 3NEYA 3GEEA 3OIYA 4OI4A 4DC9A 5FH9A 4A8JA 4NYJR 4TL8A 3W6NA 1G18A 3I1FA 4DIDA 4UNRA 1CU1A 1FFHA 2C9YA 2PEZA 1T9HA 4B43A 1XPOA 1BOFA 2GF9A 2PJRA 2CMKA 3ZYCA 5JI2E 1E9EA 4JLKA 3RSLA 3SFZA 2NTYC 1R0XA 2JATA 3PQCA 4GOXA 5BN5A 1DELA 1GVNB 1GNRA 2FE4A 3L0SA 5KSOA 3ZS8A 3QVVA 4LZZA 1Z0JA 5GJCA 2ZS8A 2AXNA 4WXPA 4EKDA 4Q1CA 2ZRKA 1NJGA 1BMFA 1B0UA 1RZ3A 4CW7A 2QBYB 5F9HA 1Z6AA 4G0NA 1X8JA 3T06B 3TK1A 4HAYA 1JJ7A 4V0LA 5H1YA 1Z28A 3F5FA 3GLIA 1DARA 4MGZR 3KX2A 3FPAA 2ANCA 4UKDA 1KSGA 4ACBA 5JSZB 3P1JA 5JFGA 5DIFA 5BQ5A 4YMSA 5C2JB 1W0JD 2AK3A 1DAMA 1GDDA 1X3SA 4U02A 1E0AA 1AA9A 4OHZA 1PV4A 5EUMA 1G8PA 3MFYA 4RKFA 3CH5A 1YZNA 1MRNA 1LF0A 2VPPA 4DLWA 1E69A 1GKUB 3W5IA 1ZRHA 2XX3A 1ZNZA 5CM9C 4QGFA 5GJBA 2VHQA 1G3IA 2EQBA 4RKEA 1G6OA 5CYOA 5FI1B 4JVMA 3VX4A 1G8GA 1MABA 2CLCX 3NC1C 4WBSA 2ZUDA 3WYFA 1CS4C 3BS4A 3BBPA 1RYFA 1UEJA 4I1UA 1DG3A 1G21E 2PH1A 2QGZA 3KTAB 3KJEA 1DAHA 4TSFD 1E2GA 4MDFA 4JLDA 2H18A 2PCJA 4QL3A 2MSCB 2J7PA 5JS8A 4QBIA 2W0MA 1KZ7B 2VSXA 3CO5A 3FYHA 4KLZA 3U6BA 2VP4A 1YQTA 5JCZA 1M8PA 5IK2D 4GMXA 3QBVA 4HAZA 4U00A 3J81k 4WOPA 1ZC3A 4XVRA 4CEHA 4D0LB 3PEUA 5P21A 4XTCS 4QJ5A 1TF2A 5C1BA 2ZRJA 3TIFA 3NBFA 5LD2C 1N5IA 2WSSD 2J0UB 5FPTA 4MITA 3Q7QA 5J4YA 3CM0A 4ZPXA 3WMFA 2QZ4A 1UKVY 3IKJA 4FMCB 3N2IA 3AF1A 4KV9A 2D4HA 4NTZA 3K9GA 2D62A 1XPRA 3AGQA 1MT0A 3E5HA 4QGGA 3FKQA 4DLYA 5HZKA 1XFAA 4EDHA 4CZ2A 4D6PA 4BPBA 2W6JA 2C78A 1FUKA 3CZQA 4DSNA 3RS7A 3T15A 2O8EA 3QXSA 1HH4A 1EFTA 2XZLA 4P4SA 4G1UC 1GNPA 1R5NA 3P4YA 4TLBA 4WXRA 1XRJA 2YNMA 1G7TA 2B92A 2EVWX 1CLUA 1TU4A 1SKYB 1WCV1 3BFXA 4TMZA 3CBQA 4PANA 1W2GA 1Z0FA 3OFNA 2YWFA 5EP2A 4BFYA 3DMDA 5GJVC 2AD5A 3B60A 2QSZA 1N6LA 1XD8A 4KFTA 4PZZA 1P61B 2GXQA 3M0EA 4RFSB 3QXCA 2FV8A 3GD7A 2RGGA 3KQLA 3OE7D 4N0EA 3R9WA 2QPOA 2DR3A 2FFQA 4Q4LA 3C16C 1SHKA 4HDCA 2CXXA 1G7RA 1U8ZA 2YV5A 1GKIA 1KO8A 2VQSA 3O8DA 4EPYA 1KJZA 2ZPTX 4L9SA 4A15A 2O8FB 3UANA 3BXZA 4ZV4A 1XEXB 2XJ9A 4II7A 4QGAA 1S1CA 4TQ9A 2V7QA 4F93B 2IK8A 4OBEA 1R5OA 1DOAA 1U0HC 2BCJQ 4MRSA 4D26A 3GLFA 3BFKA 3I73A 3EG5A 1LW7A 4TLCA 3RHFA 3ZZTA 1JEDA 3GCGA 3GJ7A 1U9IC 2L0XA 4MRNA 2AR7A 1Y63A 2ODBA 2B6HA 2R6FA 3NG1A 3RRYA 3VR5A 2Q3HA 1KNXA 3RC8A 2J7KA 1UBFA 3ZZ0A 4XH9B 2F3TA 2ZRCA 3A1VA 3C7KA 2HLDA 3K0FB 2QEQA 4G5OA 4C0QC 2F1RA 4JBXA 1XMVA 5CITA 4ZDJA 5CJ2A 3U7EB 1N0VC 1XXHB 2DBYA 3KB2A 2RB4A 2HF8A 1NY5A 3QENA 4P4UA 1UFQA 4TYWA 2OXCA 2F1HA 2AFIE 2OG2A 3PJRA 4IDQA 4NL4H 4URUR 3GJ0A 4GRAA 4QRHA 1DPFA 5C46F 5L3SB 1G20E 1JBKA 1P60A 2ORVA 1YR8A 2GVZC 4Z8XA 3EWSA 4V0KA 4G3XA 4S2EA 4O0MA 3TGPA 5DHAA 4NCIA 2O8BB 2PL3A 3A58B 3P32A 3K9NA 1YVDA 4X8LA 4Q7MB 2VP9A 1OHHA 2OEPA 5AJVB 3EAQA 4KI0A 3JZMA 3QEJA 4EPRA 3GLHB 1OFHA 4GBMA 4QNMA 4JBWA 1N6RA 2GBLC 3FVQA 3T35A 1F5NA 1W0KD 3BRWD 1JB1A 2GJAA 2ONJA 2AK2A 1TF5A 1A82A 2Q3FA 2ZVPX 2HXYA 3LFUA 3FMOB 4HLCA 4BZXA 2CE7A 2HEIA 3WYAA 3GLGB 3VAAA 3C14C 4LJAA 1WBBA 4PFSA 1HT1E 1NY6A 3B8HA 1DG1G 1MO3A 3EA5A 1Q3HA 4HZUA 2Y8EA 1G6HA 3B6EA 2LWIA 3RRZA 2ZRHA 1A4RA 3LA6A 4DSOA 4XWKA 4B2LA 5C4GB 4DJTA 5FTJA 1GM5A 3AVTA 3PG5A 1M2OB 1JXMA 1FQJA 1ZIOA 2A78A 2ZSDA 1IY0A 3QEOA 5HE8A 4ZKEA 1OYWA 1S1MA 2V55B 1G5TA 2N46A 3QF4A 4AKIA 1GL7A 1ZVQA 4KJZA 5A4JA 2DCUA 3GMTA 4JSTA 3FMFA 2J41A 2WIAA 3LV8A 4OHXA 4TMVA 3R7WB 1J8YF 2X2FA 4LWZA 2RH5A 4A92A 3N5CA 3ZH9B 1U9IA 5CLQA 2ZYTX 4A0FA 2AHOA 4GPTA 2IUSA 1G8HA 1II8A 3KKOA 1ZM4A 5AUPB 2PMDA 3CX7A 4Q4HA 3MRSA 4MA4A 1N3BA 3SQXA 4IOJA 2WPDD 2ZU6A 4BFZA 2BC9A 2WTUA 1RFLA 3THYA 2ZXUA 3BD9A 4NCKA 1W36D 3QF7A 4DB2A 4MUAA 4G5SA 4M1MA 1F6BA 2XTMA 4OK5A 2ZEJA 1ZM7A 1YR7A 1VG0B 3WY9A 4B3FX 2WIBA 5F98A 4NCNA 2QAGB 4MKFA 2Q21A 3WBKA 3ND9A 2FSIA 4JKYA 2WWYA 4HAVA 5EP1A 3RLFA 1AS2A 1N5LA 3A8TA 2JGNA 3AKCA 1Z07A 4UXIA 3GJ4A 4KBFA 4QOSA 4EFMA 4NE2A 1YE8A 2WM9B 1WF3A 4RD4A 1NL3A 3SHWA 5TXGA 4R9UC 1RE0A 1NLFA 5FI0B 4TYYA 4BZQA 4F4JA 1HA3A 3ZGXA 1UDWA 4TTQA 2NIPA 3Q9LA 1G5PA 4O2LA 4B3GA 4E03A 1TX4B 1BKDR 1GL6A 3KDSE 2GBLA 1OV4A 4LGMA 3WMEA 1W0JA 1E9AA 1D2EA 5DI3A 3K0SA 5AUNB 1QHHA 3FFAA 1TQ6A 1FL9A 1Z6GA 4TL6A 2FDCA 2NMVA 2ZJOA 1G1MA 1ZM3A 4NH0A 3FGNA 1A5TA 3AQ4A 3BERA 4FN5A 5ANRB 4EFNA 2OXRA 4ARZA 4Q1DA 2BIFA 1LV7A 2XOKD 5BWMA 5LDDC 3GEHA 4L15A 5HCIA 1E4VA 2QROA 4EAQA 3Q72A 4A0RA 4ESHA 3CNLA 3S1AB 1G291 4UNPA 4HUQA 5AUQA 3QKRB 4AWXA 4TSFA 4CYMA 1MOZA 3U44B 4DCTA 1WE2A 5CB6A 4UXJA 3ICEA 2G77B 4ESVA 2C2HA 2GVDC 2ZR0A 3AF4A 2XAUA 3U3KA 5IK2A 4CF7A 1GRNA 2HV8A 5FOUA 4LPKA 3PEVA 2F1JA 2QMOA 1OH6A 2JJ8A 4LX0A 2F1IA 3NBYC 4DBLC 3ZQ6A 2ZRNA 2XTZA 2FSHA 4Q4AA 5C4MA 2WJYA 5DISB 3GJ6A 4NCJA 5IHPA 2WSSA 3KKMA 4A2WA 4A6PA 2BHRA 2P3SA 1KAOA 1TQ2A 2FG5A 3AF3A 3Q3JB 1CTQA 2W83A 2GILA 3B1ZA 3CRW1 2OO7A 4LHXA 4D82A 3M6AA 5KTYA 2ORWA 4S35A 1AS0A 1TUEA 3C8UA 3OAAD 4MYUA 4QFMA 3W8RA 2FFBA 3MGCA 3EIHA 4BFXA 1S0UA 2PJZA 1E9FA 1XWIA 3D31A 1Z0DA 3FMPB 2ECKA 4BZPA 1NI3A 2OLJA 3A1UA 2P65A 1ZM9A 2CBZA 2B8WA 3ECCA 3HU2A 4I4LA 1KI6B 3U6KA 2G0TA 3ADBA 3LLMA 4LJ8A 4LYFA 3CWQA 1HQYE 3NIBA 5EXXA 1KO5A 4NU0A 1VCMA 2KI5A 821PA 2GDJA 2P5SA 1TNDA 4NPHA 4H1VA 2IYTA 3WNCA 3HYRA 3EZ7A 1G41A 2VYFA 2R44A 3SFVA 1GUAA 4KFUA 4TZ0A 4IVPA 1II0A 3MCAA 4P31A 1MABB 1UDXA 2D7DA 1JR6A 2XTNA 2WKPA 1T8TA 2IT1A 2ZSEA 5J40A 4IW3B 1EXMA 4QHSA 3I8XA 4TLDA 3PVSA 3W3ZB 3CW2A 3OE7A 4PAMA 4XWAA 3KUCA 3BB3A 1Z2AA 2OUKA 3R9IA 5K8LA 1AK2A 2A7QA 2VP2A 4R2HA 2FFHA 1N6OA 1Z0KA 4MRRA 4JVNA 4IXNA 1XX6A 5D3MB 5TY0A 2O8CA 3P27A 1XTRA 1N5JA 2C9CA 2OCBA 4EJSC 4OK6A 1KKLA 3VU9A 2JLWA 1I4DD 5AUOB 1N25A 1S8FA 1L7VC 4DUGD 1DE0A 4JKIA 1FNNA 2N1BA 2ZETA 4URZR 2CLDX 2RGNC 2RGDA 3F8TA 4CRWB 2NO7A 3U61B 4F4CA 1KI1A 3FWYA 5KDDA 4MYCA 2GCOA 4BFUA 1F2TA 1N5KA 4N0DA 4KODA 4AC9A 2GA8A 3B78A 1KK1A 1Z6XA 2H57A 3LRPA 1UF9A 3X1XA 3UPUA 2EFDB 1VIAA 2WV9A 4M9QA 2ZRDA 4YC7A 1NBME 5GADl 4P4SB 3RVBA 2Z43A 4TMWA 5HKKD 2J5XA 3P4XA 4AD8A 4Q18A 3PEWA 4D4JA 2B7BA 1K8RA 3PCRB 4BRWA 2O0HA 1KSHA 3AF0A 3MG9A 3O47A 3T1VA 1X1RA 4TLEA 2QT1A 4PSVA 3TSZA 4LV5B 4GL2A 2XNSA 2IYYA 3NC0C 1I2DA 2MSEB 4MRVA 5SZJA 2X19A 4KXFB 3RWMB 1E99A 1P6XA 1E4YA 2Q9BA 2OE2A 1ZM2A 1C9KA 4GOKA 4I1VA 3D8BA 1FW6A 1G7CA 1UKEA 2VF7A 1RKBA 1UJ2A 3TSWA 5B58C 5IRCD 3FHOA 2EW1A 4FCWA 2ZJ5A 1EGAA 5CDFE 1K6MA 1W0KA 2MMGA 4MUBA 4UNQA 2GAOA 3I3SR 2BEJA 1GFIA 4A8JC 3VMFA 4MKIA 3TQFA 4P33A 4U5XA 3X1DA 4D0GA 3L82B 2H92A 4OQLA 2F55A 1P73A 2DWPA 2ZYVX 4NYMR 4C7OA 3ZVMA 2P67A 2WICA 1W46A 4QBGB 1ZYUA 4BEJA 2CDNA 3QJYA 1CULC 2OCAA 4WZAE 1M1YE 2QM8A 1D9XA 3QBTA 1E0KA 1CR0A 2DWQA 2G3YA 3TW8B 2WHXA 1T6NA 3VHLB 1S9HA 1KTVA 2H7VA 5H70A 4PO9A 1PJRA 4PZLA 2Z4RA 4ERNA 2ZUBA 4WZBE 1XU4A 4FIDA 1QVAA 3HWSA 5LD2B 3EIEA 5L3QA 2V1UA 4FW9A 1ZINA 2DPXA 5ELXA 3GQBA 1JI0A 2DFKB 4NDZA 3OIVA 3U3MA 4FMBB 2ZRMA 4Q4JA 3WRYC 3CR8A 1DS6A 2JDID 3VX3A 1NLZA 1YZTA 2VTKA 5G3YA 5AJYA 2WPDA 1NVWQ 3OIWA 4YMTA 5FBLB 2C77A 2QT0A 1E2DA 2IHYA 3THWB 1VG1A 3QXHA 4US0R 2H5EA 4TYQA 1P72A 1US8B 4DCUA 1QVRA 2NPIA 3VR6A 2F7SA 2EYQA 1X86B 2AFHE 4FMCF 3EX7C 5FBVB 1FNMA 3KKNA 4LY6A 4KFSA 3RSOA 2XXAB 4Q5IA 2PEYA 4GZLA 5LPNA 3K0AA 1U8AA 1OIVA 1E2MA 3DHWC 3VFDA 5J4VA 1D2MA 2ZQ5A 1FQKA 1EX7A 3ZVRA 2A5FA 1Z29A 3AVUA 4Y0VA 3THXB 1RVDA 1RC8A 3IUYA 4MGKR 2ZAOA 1VHTA 2WBLC 2YC2C 1TMKA 3T1OA 1HEIA 1S2MA 1DAEA 2AWOA 3NH6A 4HZUB 2DB3A 1GG2A 1ZNYA 3MWJA 4RFVA 1AZSC 1ZD9A 3BJIC 4ASUD 2GHIA 2CLSA 3C4JA 2O8DA 1XP8A 3TKLA 4ITRC 1R2QA 5KDOA 3RS3A 4W5JA 2P6UA 4TTPA 3QF4B 2XZPA 3SYNA 3ZVLA 2Q6TA 5DE3A 2W2VA 1RJ9A 1KO1A 1MO4A 3DM9B 4RD6A 4AYXA 1WQ1R 4JLOA 3N2EA 4M2LA 4MKHA 2J0QA 4M21A 2ZSAA 2XOKA 4IEEA 4RVCA 3FB4A 5CYPA 4QJ4A 3RS2A 2LCFA 3E2IA 1DAGA 2D2FA 5FOXA 2JEOA 2R2AA 2WMOB 3UWKA 2ZJZA 2RGAA 4DWJA 2UKDA 3THYB 4URXR 3SNHA 4LJ5A 5TARA 4KFRA 2REXB 2ZREA 2CL0X 3CF6R 2W58A 2JLRA 1P62B 2EFCB 1WBDA 1KK3A 2YOGA 3Q5DA 2FFAA 2GZDA 3QVUA 1ZNWA 4GI7A 4Q7JB 1NLYA 4RZUA 2V3CC 1VDZA 4B35A 3NH9A 2IWRA 3NTUA 1CKEA 1ZP6A 3CNOA 4A0HA 1T3SA 5JJIA 5IF9A 3AF2A 4PC6A 1EK0A 4EUNA 1JR3E 2W0SA 3Q85A 1SXJD 3ZDQA 1NG1A 2JLXA 4IHQA 3OEED 4M0LA 1IM2A 3IBYA 3B5JA 1SKYE 3SJAA 5TMPA 2IF0A 1OFUX 2FEMA 3AUYA 3OAAA 3W34A 3I72A 4YMWA 2WVJA 3IDQA 4LDJA 4V0NA 1J8MF 4DLZA 1VYVA 4POAA 1TU3A 4RJLA 2FZ4A 1Q1QA 2OBNA 3AEZA 3GFPA 3G5UA 4C3ZA 1ZAKA 3VNVA 3WMGA 2EWWA 1PUJA 1ZD1A 3CPEA 1E2NA 1UKZA 2ZSFA 4LYJA 5FUXA 1MH1A 3QG1A 3QKSB 4RD2A 4ZCLA 4P32A 5FBRB 4FD2A 5FUYA 1WB9A 2WWHA 3L0PA 4HZIA 4W5WA 5EE1A 4ARZB 1MRSA 1SVIA 1T0JB 2I4IA 3X1ZA 1YHNA 4CEIA 1NG9A 1OB5A 4L9WA 3KB1A 4BLTA 2DFNA 5JS7A 4HUQB 1KI8A 3CWZA 1S4QA 2FMXA 2W6ID 2AD1A 1QG2A 3H1TA 4DRZA 4BEBA 1QZXA 3IIJA 1SGWA 1SVMA 1A2KC 4LV8B 2VH5R 2N42A 4US2R 3MWKA 2QQEA 2J0SA 5G3ZA 5L3RA 4XD7D 2FNAA 4EQ6A 1TTTA 2BKUA 2HUPA 2GJKA 1KHTA 1S9DA 4B3XA 2Q9AA 3CR7A 1E94E 3LBIA 2FSGA 1KMHB 1G3MA 1ONBA 1JR3D 3LLUA 1AJEA 3LO5A 1E9BA 4PAOA 3IGFA 4PQFA 1CJMA 1XXHE 5FPSA 1KI9A 3F3YA 3RS5A 2ZANA 2ZU0C 3EZ9A 4DUGA 2BBOA 1IN7A 1P9RA 3IHLA 4PPQA 1G3UA 3IILA 5TB5A 3R8CA 5JHHB 3K70B 2ZE8A 1P5ZB 2NG1A 3FHCB 3FE2A 4MYTA 3K8YA 3W8NA 4DHEA 4WA7A 2WOOA 3VR1A 4W9MC 2GZHA 4RD1A 3VR3A 1G4UR 5HKKA 2IL1A 1E2EA 1RRCA 5IT5A 2CEAA 1KDRA 4HDOB 2ZI5A 3GLHE 3QXXA 1TPZA 3BH7A 5IDVA 1U0LA 3ICQB 4B71A 3JVUA 1EESA 4IVRA 3M1IA 1OH7A 1NKSA 3B82A 4Q1EA 3AVXA 2QN6A 2ZROA 4PSAA 5DLQC 1KK0A 2R62A 1TF7A 2CHGA 1FP7A 4IDOA 3ADCA 3B1XA 3AVQA 5G53C 1N6NA 4M9XA 3TUJC 1R0YA 4XSGA 3A1WA 3GLGE 3TVTA 1AZTA 2PZGA 4KVGA 1GRRA 5JMTA 3U5ZB 4OI2A 4HUTA 1HURA 2Z83A 4IVQA 1E2FA 3ETLA 1GKYA 1E79D 1FX0B 1ODFA 1R10A 4PHHA 3UG7A 2JLQA 4F4IA 1XD2B 4BRUA 1G17A 1ZCAA 2RGEA 4J0QA 4A0GA 4ZI3A 1S3GA 3SYLA 3W6OA 4BLSA 1U81A 2GJSA 2CJWA 3D6TB 5C18A 3U7FB 4JBYA 521PA 4C2UA 2O8CB 2XNDD 1CP2A 1E2QA 5KDLA 3TAUA 2WAXA 1OE0A 4DDWA 4HLDA 3B9PA 2FOLA 2J45A 2IA5A 2W2XA 2X8AA 2ZI9A 1CJKC 3DOEA 3HR7A 4Q1FA 4JZKA 2HT1A 2QSYA 4NYIQ 3SJCA 3I5XA 3GJ8A 3SZRA 4M1TA 3QIAA 4Q00A 4C0JA 4U7DA 1IXSB 5KUTA 2REOA 1Q21A 2FJUA 2QNRA 1RRPA 1F48A 3QSYA 4B3CA 4DT1A 2IS2A 1JECA 3FFBA 5EE5B 3QXJA 4RZXA 1NVUQ 1A7JA 1SVKA 1Q0UA 2G88A 2RMKA 4D81A 1N6HA 4TMTA 4DCSA 5SZHB 4LBWA 5FTKA 5FUVA 4DIEA 3AUXA 1LF5A 3ZJYA 2GEUA 4BLPA 2H16A 1BH2A 5FOVA 1OFTA 3AKYA 2XITA 3CRMA 5H8WA 5E7JA 3B1WA 2IBMA 2R6DA 4B73A 2OZEA 2QAJA 4LYAA 4F91B 1SXJC 2ZM5A 3MWLA 2QU8A 1Q22A 1Z22A 2JDIA 2WJJA 3BC1A 4Q9LA 3TNFA 3AVPA 2IEZA 2I1VB 2IXFA 1YKSA 1A1VA 2F43A 2C95A 4C0SA 1W4AA 4JVSB 4HEJA 3U4QB 1FUUA 2CL6X 1P9WA 2PT5A 5FOWA 2AKYA 4C9BA 2E87A 2IUTA 3V4RA 4QJ3A 3B7GA 4L16A 2BBTA 5CDFA 1XCMA 4RZ3A 5BXQC 3DL0A 4LJ9A 1Z5ZA 4IDHA 4TLAA 2VHCA 4YDSA 1ZUNB 4YONB 3VNUA 1L2TA 1OLOA 2D06A 3HU1A 2FF7A 4MYHA 3TR5A 3V00A 2ZJAA 4I99A 4B48A 4M4SA 1IONA 1QBKC 3HR8A 4WAUA 3U60B 1Z0AA 2OCYC 1HV8A 4XSHA 2IYWA 4OQNA 4Q01A 5EZ6B 5FBWB 4EPVA 1RPZA 3CF2A 3R20A 2QA5A 2QRNA 5CK5A 3V4FA 3NEJA 2JLYA 1J90A 2BBWA 1O87A 2JJ2D 2GCPA 1L8QA 2ZRIA 5FTMA 4ASUA 4ZDKA 4NYMQ 1DADA 4A9AA 2FA9A 4DVGA 2WWXA 4OQFA 2V4ZA 1Z08A 5KYKA 1VCNA 2ZRBA 1PLKA 3C5CA 2JLZA 4LOAA 4ZCMA 4UNNA 3CH4B 3HPRA 4IOKA 4Q03A 4LC1A 4F38A 1F2UB 3LVQE 1ZMXA 1JNYA 2NO1A 2NZ8A 4EJSB 1XEWX 5FTNA 1OH8A 2BVNA 2PLFA 3X2SA 3IPYA 1OSNA 4DXAA 2QPTA 3NHBA 3PIRA 5DGXA 2JASA 3LDAA 3G0HA 1R4AA 3HP1A 2G1KA 4Q4JB 4ZIRB 2QBYA 2EWVA 2QE7D 4L5BA 4PHTA 4LK2A 1L4YA 1XEFA 4YMVA 4M22A 3H0KA 3K0CA 2REBA 1BO6A 4TYPA 3LW7A 3PUZA 5JSZA 5DN6D 4AYTA 2OAP1 4XJXA 5KHOC 1AIPA 3KXIA 4UJ5A 1BYUA 3MSXA 3KFVA 5E4FA 2J1LA 2FPLA 2AL7A 3KJGA 4RY2A 2P6RA 2C9OA 4NKRA 2ZITA 4GNKA 4CIDA 3VR2A 4ZDIA 3MD0A 4HB4A 1E98A 1IN5A 2FSFA 2XEXA 1SXJA 4B47A 1W7AA 2PT7A 1WXQA 3SBDA 3IEUA 3OEEA 4PQRA 3NDPA 1JAIA 1GITA 1EFCA 3FHTA 2Z5FA 2A5DA 1DAFA 3SJBA 1P2UA 2BBSA 2BKEA 3KKPA 1R0WA 3KTAA 4RSGA 1TL7C 2ASEA 4YMUA 2TMKA 4ILEA 1GP2A 1NKTA 4LBZA 2H1LA 2ODEA 3K53A 2ZI6A 3VTKA 4TL9A 3BH0A 4D4MA 2F9LA 2GEDA 5D3QA 3AKDA 4A8JB 1WMSA 1FMLA 1RRFA 1RJ9B 3BK7A 3L0OA 4NYJQ 3DMNA 5J4LA 2ORIA 4DLXA 4KITB 1A2BA 1IXRC 1QHXA 1TUIA 2BV3A 2ZR7A 1E0SA 2J0UA 3SEAA 4N3NA 4OQMA 2GCNA 2BMJA 1E6CA 3NKVA 5AJZA 4DLVA 2IW3A 3UMRA 3TJZA 4GZMA 1NF3A 4NZYA 1W49A 1ZUIA 3AB3A 4PC7A 3EASA 2W6IA 3KJIA 1S3SA 1IQPA 3JZAA 1GRQA 5FPKA 2ZJ2A 5J4HA 1H8HD 3WRXC 3T5GA 1JPNA 3GLIB 1XB2A 4DZZA 2J0VA 4JLMA 4XD7A 4FINA 2QMHA 4V02A 4PXAA 4R7ZA 1F3OA 1NN5A 2Q9CA 2UZ3A 1JR3A 3PUYA 4MH0R 3HDTA 3AV0B 1Z6YA 4JLJA 3SDZA 1VMAA 3L43A 2OFWA 3TH5A 2R8RA 1E32A 5EP4A 1H8ED 2WKQA 5JJKA 3IIMA 1WA5A 4TMKA 3L0IB 1ZCBA 3AGPA 4DSUA 1EWRA 4PZYA 1XZQA 3B13B 3CIOA 3IO5A 3EC1A 4RFSA 4PSKA 3LAWA 3FMIA 1QF9A 1EG7A 5B64A 4B6FA 2KB0A 4IKEA 3TW4A 4C2TA 4EIWA 3PUWA 2GF0A 3BB4A 1XTQA 3EARA 3CKLA 5FL3A 5JCPA 1QHNA 1IOZA 2Z6VA 2NZJA 1QRAA 3IBGA 3DZ8A 1OXUA 4GP6A 3T1QA 3RWOA 1P2TA 5KSZA 1T5IA 2E1RA 1CEEA 2DHRA 1DO2A 4LYHA 1SVOA 1E2LA 1XEXA 3W6PA 3R9XA 4CEHB 1NN1A 2R6CA 1K5GA 1KJYA 1BS1A 4MGIR 1UBGA 4Z51A 3AVWA 2ZR9A 5LB2A 4EPTA 1IN6A 4K46A 3VKGA 2ZAMA 1N6KA 4RCYA 4L4UA 2D3WA 3THOA 3QOFA 4OL0A 3PUXA 4PPFA 4AG6A 1G5RA 1KK2A 4F7WA 2R65A 1E79A 3TAHA 3ZIAD 3A4NA 4WZ6A 3K0FA 1ZC4A 4RD0A 4GT1A 1LB1B 4PO8A 4XVUA 4JYBA 3BIFA 2XNDA 1XXHA 4LPSA 1W36C 2O8EB 4JJZA 2G1JA 1M34E 2WWGA 4Q48A 1OFIA 1OYYA 1JPJA 2NPFA 2VF8A 1YZUA 5JBQA 1Q20A 4OJKA 1KNQA 2ZSBA 4BFTA 4BGDA 1IN4A 1LNZA 1P7CA 1ZNXA 2J59A 4D25A 2FPMA 2XSZD 2V6IA 3AP1A 4I81A 2IX3A 4P3YA 1N0WA 3T1TA 2XGJA 2ZS7A 1X8LA 4QM6A 2JJ1D 2GEVA 1IY2A 3AM1A 1GAJA 1SQ5A 2WKRA 5LBIA 3A6PC 2C96A 3AP3A 1VG8A 4OK3A 2D2EA 1W4CA 1PLJA 2YWHA 2ZJYA 4PPNA 2EYUA 2J3EA 121PA 3GLHA 4X8HA 1KSJA 3SBEA 2LKDA 2XZOA 2GZAA 4YDHB 4JLVA 2JA1A 1UBEA 2BEKA 1NVVR 1E3MA 4OKSA 1ZJ6A 2WWFA 1NN0A 3KL4A 2FPKA 3C41J 4G5RA 5F3WB 3LXRA 4EFLA 4B75A 4DDUA 3GLGA 3GLFB 2P2LA 3FKSD 3DEFA 5BW8A 4A2QA 2VSOA 1W47A 4QBHA 4ACAA 5HTKA 5KU1A 5JECA 4LC0A 1E1QD 5DYGA 4QKQA 5JZVA 1T4GA 4W7SA 3W3AA 5FR1A 2QORA 1UAAA 3ADDA 1TQDA 1JXOA 4K8OA 2CL7X 3LXXA 2CCKA 1PLLA 5G41A 1NBMD 4E09A 2ZRFA 1OXVA 2RGBA 3NVAA 6Q21A 1D2NA 3UG6A 3TBKA 3A36A 3H86A 2EU8A 3T34A 3U7HB 3QG5A 4DSTA 3CZPA 4KYUA 1OIXA 4PPGA 4IFEA 4JL8A 2VL7A 1IBRA 5JHGB 3RS4A 5CIQA 5FPYA 4B3BA 2JJ2A 2YINC 3Q5EA 5J4KA 2JLSA 5AJXA 2NOAA 1QG4A 2ATVA 5B30A 1SHZA 5DH9A 1ELOA 1KI3A 2CVFA 3FDIA 1KY2A 1N6PA 2CCGA 3KUDA 4HLUC 3AP2A 3M4YA 4URYR 3FOZA 1JQLB 4C0BA 3EZ6A 5BN4A 2KWIA 2IS1A 4LJYA 1Q3TA 5KNBA 3DZDA 5K8TA 3ND8A 4R98A 3UXMA 4Q9KA 4AG5A 4BASA 1PUIA 2V8OA 4DEXA 5JEDA 1BIFA 1ANKA 3T12A 2JLVA 2KE5A 2QAGA 2KBEA 1Q1ZA 1U94A 1FTNA 1LS1A 1T3HA 5DO9A 1KOFA 1QHYA 4M1YA 2ZVQX 3SN6A 4B44A 1COWD 4M1KA 2IYQA 2GTPA 4TYNA 4G01B 5DYIA 3A1TA 1CR2A 3KFXA 2G6BA 2IHBA 1P9NA 5E95A 3B1VA 4URWR 4A4DA 2OILA 3BH6A 3IQWA 3LQRA 2QE7A 1AS3A 2OBMA 3ZS9A 5CK4A 5TVKA 3TRFA 2F43B 4FMDB 3HPQA 4OJQA 4QNRA 1G64A 3LBNA 5J47A 2I1QA 5EP3A 5DN6A 3ASYA 2J46A 1HY3A 1T5LA 4IXMA 1CR1A 1KO4A 2YOFA 3R8FA 1G3RA 3LNCA 4HLQB 1OKKD 1FP6A 3TUIC 3O8CA 2ZUCA 1KIMA 4AIIA 2IXEA 1XF9A 5KSYA 1LY1A 1DEKA 4BLQA 1CR4A 4MKGA 2IXGA 5CJPA 3WP0A 2J87A 4HYYA 4NHOA 2HJGA 3K1JA 4JLAA 3WNDA 4KVAA 4KYIB 4AYWA 1BYIA 1MR3F 1P3JA 3DDCA 3EXAA 3OZXA 4LHVA 3UMFA 2KJQA 2ONKA 2GXSA 1YR6A 1II8B 2GXAA 1G7SA 3S1AA 4D2IA 2QP3A 4Q4HB 3QKRA 4B6EA 2PCLA 3WP1B 3U44A 4FWIB 3QE0A 1LS6A 3KXLA 2WWWA 2A5JA 1W4BA 4NONA 1Q1EA 1IHUA 1V5WA 2YZ2A 4I1OA 1CIPA 2F6RA 4QC2A 4V0OA 5BYKA 4B33A 2H17A 3EC2A 4D0NA 4JT2A 1QHIA 3L8YA 1ZU5A 1NMXA 1P2SA 2WAYA 2ZI4A 1KO7A 1NVXQ 2GXUA 5UKDA 1PVOA 3HJNA 3PENA 3BOSA 2ZIAA 1NMZA 4OHVA 221PA 5JWHA 4A1FA 3W90A 3EA0A 4HLUA 1N0UA 5FUWA 1AN0A 5E3HA 1FTSA 1HUQA 1L4UA 1VIYA 1G8YA 5E7MA 1FZQA 2K5UA 4NMMA 2YHSA 1H8HA 4WVFA 2YOHA 3IQXA 2B21A 2ZRLA 4JIMA 1GZSA 1XMJA 2B8TA 3A4LA 4LSGA 2MSDB 4DLUA 4H9GA 4B76A 4HAUA 1R7RA 3VR4A 1YU9A 3K9HA 3TQCA 5M04A 3IHWA 2FN4A 1TEXA 4AKGA 4AK9A 4LHZA 2BOVA 1KI6A 5DI3B 4W5HA 4TTRA 3D3QA 1QHHB 2OM2A 3K9LA 721PA 4DLRA 1WDTA 3EPLA 3CPHA 4BE7B 1IAQA 1G8FA 1SXJB 2WJHA 4D4KA 4AKHA 2JCSA 1SULA 1AQUA 1H8EA 4NP6A 1YRBA 1VKJA 3TVDA 4Z1MD 4KHZA 3PR1A 1KY3A 2PBRA 3ASZA 3ONWA 4HB3A 3K0EA 4KSBA 4JL6A 2ZJBA 2IYRA 1E0JA 5TV2A 3LW8A 5JRZA 2O0JA 4QM7A 3AVYA 1VPLA 2ZI7A 4OI0A 4GOJA 1HE1C 4YXWD 4E22A 3SJZA 4PX9A 3A1SA 1DAKA 2IF2A 5D3MA 4G5QA 1U2RA 2F3RA 3CF0A 4M1WA 3UATA 2VIIA 2G0NA 2IYUA 4FCTA 5JWOA 4Q4AB 2HXSA 3ADKA 4DCNA 5GVRA 1IJEA 1G19A 1MV5A 2YC4C 3L2OB 1Z2CA 5HE9A 3CRQA 1UPTA 2A5YB 3TLXA 4TZ6A 4Q7LA 4TWZA 1SVWA 1U98A 4RCZA 2ZRGA 1ZW6A 5FBQB 3C5HA 4LHWA 2QUZA 3K70D 2QENA 1W5SA 1J7KA 5FTLA 4JVLA 5EXPA 3ZIAA 1E9RA 1YZQA 1DBSA 2DFLA 2G83A 1YR9A 4JLPA 4KCGA 4DLSA 2FH5B 4TQAA 5DHFA 2C8VA 4B32A 2HCBA 5SZKB 3BAFA 3DM5A 1NRJB 3CUEF 1ETUA 4Q1BA 3REGA 3QKTA 4CT5A 5KSPA 4IOMA 2HT6A 2RHMA 2IS6A 1U99A 3U3RA 1RRGA 5L8VA 2OFOA 3P20A 1W5TA 1E9DA 5HZHA 4HDQB 2AXPA 5G40A 4CT4B 4HI0E 1CJTC 2XSZA 5AR1A 4Q1AA 3OEHD 1LVGA 2CNWD 2JJ1A 3KQNA 2C99A 1EWQA 5EE0A 1SZPA 5B57C 1XJ0A 2C98A 3I62A 5CM8B 3GJ5A 4CVNA 3NDBB 2C03A 1T0HB 5FR2A 1IY1A 4TL7A 4M9SA 1CRQA 2VA8A 4OYHA 2V1XA 4XVQA 3KQHA 2ZRPA 5DNYB 2G9NA 2I3BA 5EJEA 5A0FA 5HR5A 1KGDA 3C15C 2EFHB 3NBXX 3WYGA 1Q57A 1VYUA 1SVLA 1NN3A 1XCGB 1KKMA 3JVVA 4K81B 2GESA 3GFTA 3PV0A 3SOPA 5CIWA 4B3DA 5JLJA 4TQUS 3PUVA 3CB4A 2A3RA 4A82A 5CLLA 3VU9B 1OIWA 3FKSA 1OW3B 4P0TA 1Z6TA 2C04A 3SU8A 3TR0A 3LWNA 2KSQA 3BORA 3T5DA 4CEJA 1G9XA 3B1YA 1E1QA 3QQ5A 1E9CA 2V9PA 2F9MA 5A5GA 5FOTA 3SYKA 5KPJA 2KBFA 2QM7A 2GCOB 2JIZD 1F2TB 2QL6A 4V0ME 1T8UA 1Q44A 1T3LA 4GP7A 4B2PA 1EX6A 4Q9JA 1KI2A 1Z8FA 1NBMA 3I4LA 4PO1A 3KXKA 3VKWA 2HJVA 3K0CC 3W9YA 1VTKA 4HAWA 2W2TA 1UKYA 5EXSA 1WRBA 4PTLA 1P2VA 2O0KA 4GSYA 2WJGA 4KBGA 4PC2A 2YYZA 4Q66C 1MO5A 2GK6A 1G16A 1N6IA 3A37A 4XIGS 1U90A 5J5CA 3LD9A 1XEWY 2ZYWX 3CLVA 4TT3D 1Q12A 4H1UA 2ODNA 3QPVA 4Y0AA 3LY5A 1D6JA 4WW0A 3SE0A 3GP8A 1E2JA 1R8QA 3LVRE 3UK6A 2WSMA 1XTJA 2E9SA 4I1SA 4P4TA 1OF1A 2ZTSA 1TQ4A 5GVSA 3ZD7A 3THWA 1J70A 1XBTA 1S96A 2XJ4A 4ZKDA 3IIKA 1ZUHA 4LCBA 4M9ZA 1US8A 3Q8XB 2YVUA 1KDTA 4V03A 1GOTA 1E1RD 2PZEA 2PX3A 3OESA 4NCHA 4ZO4A 4DEYA 1I2MA 4PC3A 2GRJA 1GL9B 2GKSA 5FL7D 3PITA 1RYHA 1TEVA 4PQYA 4FI3C 2ANBA 3VQTA 2XXAA 5JI3E 1JALA 2UZIR 1COWA 1V43A 3HU3A 1KI7A 1NVVQ 3CX8A 1GSIA 2RGXA 4Q21A 1B23P 1KMQA 1X8KA 4C0AC 3RS0A 2QQ0A 2IYZA 3THXA 2XB2A 3WHLA 4XTRA 4D80A 2WOJA 2QP4A 4LI0A 4Q9IA 2Z0MA 2IS4A 2X77A 4IEIA 1VG9B 3CNNA 1KSFX 4JS0A 3KZ1E 3KKQA 1U0JA 4ZCIA 4QHTA 2X2EA 4C7OB 4C0LA 2PX0A 4Z8YA 1NP6A 4KAXA 4PHFA 2VP0A 3U3OA 3QNUA 1CRPA 1T91A 2YWGA 3WBJA 4E07A 1SKQA 4LHYA 1OKKA 4ZI2A 4URVR 3ZQJA 1HYQA 2B7CA 3E1SA 2GK7A 4FCVA 3LX5A 2HYIC 1Z63A 2GNOA 1XJCA 2OLKA 2ZJ8A 4JT4A 3IPXA 1VCIA 5L3QB 1HE8B 1XZPA 2BMEA 3B85A 1C4OA 3DVLA 1M7HA 3H2YA 4MGYR 3WHKA 3I8SA 2FZLA 4C0KA 2PZFA 3MWYW 4Z54A 5K8IA 5HCNA 1GILA 1J99A 1Q1BA 2R9VA 1VECA 4Q19A 4CGZA 3I32A 4KO8A 4PC1A 5B2ZA 2O52A 4RD3A 3ZVNA 1EFRD 1W2HA 2GJ8A 3QPWA 2GJ9A 3CONA 3K70C 2V6JA 3U3JA 2QG6A 1KJWA 2DYKA 4LUCA 1N2CE 3QKUA 1W36B 4MDEA 4JLBA 4A2PA 3GLIE 4BQSA 4IJMA 1X6VA 1AKEA 1KDOA 3LX8A 4XWOA 1OB2A 5JRJA 3EPKA 1XMSA 1IN8A 4R71A 5EXTA 2BJVA 1KAGA 1H65A 1NNEA 5DSZA 2NO9A 1XD9A 3UWOA 1YZLA 4C30A 1Z06A 1Z83A 3K0AB 4LJ4A 3SHFA 1EFHA 2PMKA 4YLGA 1R6BX 3B2EA 2OHFA 2WJIA 5HPYB 3BFVA 4JLNA 3GJXC 1GTVA 3RYTC 1OT3A 4O25A 2CK3D 4B2IA 3BB1A 3MAAC 2ATXA 5DI9A 1I4TD 3UIEA 2CHVA 3LQQA 1CBUA 4QBFA 3UMSA 2J9RA 4US1R 5AJWA 1FPMA 4BUJA 3VKHA 4LRWA 5EE3A 2IYSA 4AKEA 2WMNB 3I61A 2O8DB 2AX4A 2R6AA 2VLIA 4NBSA 2GWHA 3E70C 5JWRA 1TAGA 2CHQA 2VHJA 3MJHA 2QGNA 3QKSA 3CRVA 4XOIA 2NGRA 4M8NE 4GMDA 1XPUA 4Q7KA 4BECA 3TUZC 3RABA 4Z1MA 1MKYA 2OT3B 2YKGA 3CPJB 4IOLA 2Q0HA 2Z4SA 1KI4A 1NMYA 1G3QA 2FEOA 2VRWA 2ERYA 2ZI3A 1VHLA 2Q3MA 3UKDA 1AGRA 1BMFD 1VCOA 4PHGA 3LBHA 2H8KA 4IDPA 5TDHA 2ZYUX 3NBZC 4Q47A 4YXWA 1Z47A 1GWNA 4OHYA 3BWDD 3WXMA 1CXZA 3I5YA 1XTSA 1UBCA 2BJWA 1KMHA 1XCPA 2BMDA 2HF9A 2VO1A 4R2IA 4B74A 5BN3A 1YZGA 1W4RA 2NO6A 2QMEA 1E2PA 3SS8A 3TE6A 4EPXA 4EPWA 2RAPA 1ZIPA 1O3YA 2EFEB 4CDGA 1XNJA 4A36A 1IXZA 4JJKA 2OSBA 1EFUA 4LJ7A 1PZNA 1R0ZA 1W44A 1E96A 2FWRA 1JAHA 1AQYA 3H84A 1M6NA 1OPXA 4M53A 2A9KA 1CJVC 3AH8A 4QHYA 4UNSA 1QHGA 3B9QA 2QTVB 2BWJA 2J7PD 1HQCA 4ZDWA 2IC5A 4G5GA 3SI7A 1Y3AA 3ZZUA 5EE9A 4E5UA 2ODWA 4MRPA 3MMPA 2O8FA 1K5DA 1NSFA 2P0EA 1MO6A 3Q7PA 2GAAA 3CX6A 4IDNA 4TMXA 4O2RA 3AVVA 3MUFA 4QGHA 1UM8A 2YWEA 4GFDA 4ABYA 3WNBA 1U8YA 2A5GA 3OEHA 3GEIA 2CNWA 4LBYA 1NSTA 2IUUA 5F9FA 4CEIB 4L8GA 2FGKA 5KNCA 4O3MA 2R6GA 4DCVA 3GLFE 1QHSA 3K09C 2DWOA 1YJ5A 2WJVA 1R5BA 4FWTA 5H68A 5SZIA 2AWNA 4BLOA 2FGJA 2RCNA 4Q9HA 1FX0A 5FOSA 5EUQB 1J2JA 1XD2A 2SHKA 4X8OA 4DKXA 4HATA 1OXXK 3OIUA 4IFBA 4C0HA 1YZKA 1YRAA 3IO3A 3EZFA 2QY9A 4BFVA 4EQ6B 3PXGA 1ZU4A 2DY1A 4UJ3A 4OI1A 2W6JD 2CE2X 4FMDF 1UEIA 2WWIA 3DPUA 2P6NA 3AVOA 4FXPA 4JSYA 1DAIA 2YJTD 4C4PA 3GJ3A 1XDBA 2BDTA 4NYIR 3RDPA 2QAGC 2ZE7A 2IEYA 5KOYA 5AWFC 3OFND 4QXAA 3DOFA 2VP6A 2QI9C 3BE4A 2CCJA 4AY2A 1NIJA 1Z0IA 2D74A 1ZD8A 3EW9A 2OESA 5L3SA 2VBCA 1G4AE 4OQXA 3LH5A 3NHAA 3O8BA 4ON9A 3T61A 2VHUA 1HT2E 2JIZA 4HB2A 2O8BA 1JQJC 2XB4A 4OHWA 2RKOA 4UXHA 4UQOA 1OJLA 4AURA 1FMJA 3KQKA 3U7GA 2RHDA 1R8SA 1E2IA 2BMFA 4Q02A 5L3VA 4B34A 3QY0A 4BFWA 2C5LA 2IYLD 3TSOA 2AN9A 4TT3A 1DVRA 2QP9X 4A6XA 2X1VA 2V7QD 3IEVA 2JLUA 4BWYA 1HTWA 1P4SA 2HDNB 1CJUC 3PFIA 2FU5C 4WIAA 1GNQA 1VYTA 3X1WA 1NJFA 3N70A 4F92B 4IRUB 3SC3A 2A2ZA 2DFTA 5JEEA 2BM1A 3GPLA 3U4QA 4N1AA 2OFXA 1X1SA 3REFA 3KQUA 3SQWA 1E1RA 4LV6A 2IYVA 3GFOA 3EWAA 3DKPA 3PEYA 1IJFA 1WP9A 2P5TB 2HLDD 3EZ2A 4JMPA 1ESMA 5FL7A 5GJWC 3NXSA 3OHMA 3G82C 1Z3IX 4PR0A 2CJWB 1I4LD 4YQFA 2MMCA
chains in the Genus database with same CATH superfamily
2HK7A 2XF8A 4K9OA 4PLHA 3VHRA 1KQNA 1K88A 4YX9A 5FHRA 4FHCA 5SYNA 1YFLA 1J0BA 1EE2A 4RLSA 5F2EA 1GYRA 1NF9A 4EGFA 2VHTA 3GEBA 3MXTA 4J9VA 4KQCA 2X5NA 3KJHA 3FETA 2GN2A 1IHOA 2EL9A 3F0TA 3VNRA 1ZNQO 2NXEA 4CLRB 1OX4B 5EZYF 1U0TA 4JL5A 2ZZNA 3OPYB 3NWJA 3MXOA 2HQBA 4RSMA 1E2KA 4V0MA 4CM8A 2JFWA 4RTKA 3O7MA 4JYCA 1QM5A 1M7BA 2E6KA 4KMRA 2BGNA 1TCBA 3O8RA 4CFYA 5J43A 1ZH0A 2WNHA 4IGIA 1F2DA 4JVOA 1B8OA 1P9OA 4FEEA 5E2IA 1U5BB 4P5DA 1NUSA 2XE7A 3OM0A 1C1YA 3ND5A 4MTLA 3ZK7A 2PKQO 3PIDA 4MDYA 1E7QA 2VDNB 4HSEA 4F6RA 4ETIA 1BVRA 1SIWA 2GK3A 4J9UE 5CTAA 5J23A 2O54A 2GNAA 3SYRA 3C24A 1M7GA 1YGPA 1ZPDA 4PS1A 4D4LA 3INNA 3EWIA 2Q0SA 3ZXYA 4DKJA 1ULBA 2ZE5A 1UQRA 2IPXA 2UZ0A 2VP5A 3AINA 4U1RA 1QC5A 5CFRA 5F76A 2BFPA 1DV1A 3D4BA 4KI7A 4FE3A 1XMOB 3B7WA 1CR6A 2ZE6A 1VJ5A 3QKWA 4HAXA 2PRZA 3BXFA 2OQIA 1SVSA 2FZKA 3P5SA 1F0KA 4HWKA 1O7JA 1AM4D 5TQ2B 4CM6A 3P26A 5LLSA 4OX9B 1EFRA 5FPHA 2DY0A 2R1UA 2YUIA 4F3TA 1QIMA 4OHFA 3MTJA 5C37A 1WKCA 5BOSB 1QB7A 1P3DA 1MGPA 3MJRA 1DBRA 2D1SA 5BNIA 1M0SA 1M74A 1AHNA 1Y1RA 1H9BA 2FX3A 2G4VA 1T15A 2HYDA 2XZTA 3MIIA 2AN4A 4Y1GA 4HNQA 5EZ5A 1BJTA 3RC3A 4E6PA 1R6UA 2QWXA 1T4MA 1O97C 3MYRA 2XDAA 4TRNA 2D7CA 3TMKA 3USCS 3W5JA 1P75A 3FN4A 4ND6A 4GICA 3AF6A 5KO2A 3DTVA 3JQRA 2OV2A 3WG9A 2NXJA 3V7YA 5H3CA 1JJVA 3NWPA 2JIBA 2D2VA 4U7JA 4MUJA 2JFFA 2WIDA 4MNTA 3OZUA 2IYXA 2FKAA 4DNOA 3JYLA 4AJIA 1KYIA 2W2NA 3CRRA 2EX0A 2V6BA 5FJJA 4DXHA 2OWDA 5LQSA 3H83A 3RTBA 4F9TA 1X42A 1ESNA 2CK3A 3G88A 4JUFA 5AVVA 1YH3A 4QG7A 3SR0A 4EG5A 1CQIA 2NQ2C 5LB4A 5K5EA 4E4YA 3EPHA 4R2LA 1V47A 3SX0A 1D04A 1KYQA 1U7TA 3LC1O 5EPUA 3VHXA 3B3FA 2VEDA 2VBGA 4MQBA 5BSVA 5AQ1A 2O05A 2Z09A 1DRJA 1E2HA 1PQYA 3GCZA 5DF1A 3QH4A 2HH9A 3DOHA 3ND6A 4EHLA 4CF6A 3MJCA 3OIYA 4H3SA 1U1GA 3MGBA 4WZBB 4F12A 1EJ2A 4TL8A 3I1FA 1VI2A 2DAPA 2IHVA 2PEZA 1T9HA 1AK9A 2FI1A 3AOEA 4MW1A 4B43A 5K4HA 3F5DA 3NHMA 3QPCA 1RAHA 5JI2E 2R84A 3A9SA 3RSLA 4GOXA 3PQCA 4D5GA 5B37A 1KZ6A 3ZS8A 3HBNA 3FY4A 4LZZA 3W5HA 2ZS8A 4WXPA 3HXQA 4KXUA 1NJGA 3HA3A 5D8DA 3QBDA 4K87A 2BFBB 3WYBA 3M34A 4J94A 4CW7A 2QBYB 2ZIXB 4B8ZA 4Q82A 3IHTA 3TZHA 1A8SA 3FPGA 2DQSA 2JBAA 4HAYA 5THQA 4YBZA 3AI3A 1FXUA 1ZMTA 3E5MA 3EEIA 3M1LA 3OJFA 2IH2A 4MUEA 3IT0A 5K9ZA 2IBSA 3D2BA 1T3TA 2JD2A 1HMYA 4N54A 3FPAA 5ITWA 4B2YA 1QYVA 5ALEA 4OSEA 2WTXA 3P1JA 5CX1A 4BP1A 3HXTA 4HXGA 2XKKA 1IL0A 2AK3A 2FMKA 2DH5A 3DDUA 1SY7A 5D5QA 1E0AA 1AA9A 2ILTA 3DMGA 1WW8A 3MFYA 4RKFA 1YZNA 3D8HA 4LY3A 3UF0A 1EB8A 1LF0A 3MINB 4JK3A 1Z0UA 4JI5B 5A3JA 4WLNA 1DAPA 1QWOA 4MS3B 1E69A 4LF6B 1NR5A 2VQ6A 3D02A 3EDRA 1ZNZA 4B40A 1QX3A 1NYLA 2HC9A 5KTKA 3H1FA 2VHQA 2EQBA 4AROA 4EYQA 5JROA 1BX3A 1JW9B 2VHVA 4JVMA 4IIHA 1I4OA 4WHMA 2CLCX 5A4KA 2ZUDA 3G17A 1UL1X 2WFAA 2YFKA 3VH4A 4BWGA 3G0BA 1RYFA 4ALJA 1AO0A 2HJRA 3HUUA 1DG3A 3RYCA 1C0KA 3DLCA 1P2DA 1OTXA 2X0RA 3R5XA 4IQ4A 1DAHA 3EZLA 3GT7A 3OJLA 1E2GA 4J7XA 2PRKA 4TSFD 4E0BA 3A27A 3TLBA 3TD9A 2DF8A 5JS8A 1OLSA 3PUJA 5K3CA 8GPBA 3GLVA 4MEAA 4Q15A 4KLZA 3U6BA 1RI2A 2X58A 1M8PA 2O6LA 4NLLA 5IK2D 2ROQA 4ZVOA 1XTUA 3FWKA 1WEKA 2NXWA 1J0DA 1O94D 2PT6A 3I2KA 3KAPA 3V8RA 4D3FA 4ENWA 3W5SA 5KMGA 4OKNA 5A4MS 3OZDA 4GM4A 2FZWA 3TJRA 1CUUA 5J2TA 1XQXA 5C1BA 1WXEA 2IRWA 2RAVA 1YOVB 2GN4A 5FPTA 4KZPA 4J8PA 4ZQGA 4YUWA 2BRUC 3B12A 3CM0A 2P1ZA 4QULA 1B0PA 1QNLA 3LT5A 1BJKA 2L42A 3DS8A 1QIHA 4FMCB 4O02B 3N2IA 4KV9A 4OJMX 1DT3A 4V0QA 3V6MA 4BMZA 2XUIA 3H5IA 5TS3A 4G1MB 1FS4A 1XNGA 3NAQA 4RM2A 5JUWA 1I7SB 1Y4AE 4R1UA 2E21A 4MYSA 1W5EA 2V58A 1BDIA 5G1PA 1YULA 3SE7A 1DXYA 4N03A 4CTMA 4WEOA 1S2IA 4BPBA 1BHJA 1Q50A 1NE7A 3ZI0A 1ZA2A 1W94A 3CZQA 3D3WA 3T15A 3VVLA 1TYBE 1EFTA 1N9KA 1OXKB 3RI3A 3ZTTA 2RK4A 2VJLA 3VNBA 3KSAC 1U6IA 5E2BA 3WJ1A 1M54A 1TZ2A 3C97A 2ABWA 2Q5HA 1UDAA 1WCIB 2PGDA 1IQUA 4U9HS 3W2HA 4MAAA 2WT9A 3C4VA 2DZDA 1OA1A 4ZHQB 1R4NB 1W2GA 1Z0FA 3PXAA 1A88A 4DV3B 4MW5A 1NQUA 3DXYA 1DAOA 2WZCA 1SEPA 3OLVA 5GJVC 2AD5A 3B60A 4AVYA 4EO4A 1FTYA 3DJFA 3T1HB 5JCOA 1EVZA 3IOYA 5IM4A 4WFQA 2GXQA 1UBUS 1GZVA 3LGSA 3PFWO 1T34A 2FAXA 1D8AA 3QXCA 2FV8A 4RNCA 5KZMB 3P9RA 3OEYA 2RGGA 3R7DA 4OSPA 3KQLA 2PA0A 2PK3A 4ZQEA 1LUAA 2FFQA 3OD1A 4G4GA 4Q4LA 2QR3A 4NFHA 2WKSA 3I37X 3C16C 1SCKA 2VWHA 1DKRA 4ZRDA 1KO8A 1EDDA 4XCVA 4GKBA 2VJOA 1MAAA 1XLVA 2FPSA 5LMNB 2GX6A 2O8FB 3BXZA 3JPWA 4MZDA 4ZV4A 4EF4A 3R9XB 4X66B 2XB8A 1I3MA 1JH9A 1GV0A 1AKNA 4JYPA 4PTZA 3V4VB 5DMHA 5LUBA 3KWFA 1LD3A 5M3BA 1FRQA 4F56A 5AVTA 3I73A 1H66A 4UUPA 1NUQA 5B6IA 1PZFA 4W99A 4ZK6A 2EGUA 3F4LA 1O9HA 3GCGA 4QEKA 4AL4A 2FP3A 2WSBA 1U9IC 2L0XA 4NBTA 2ODBA 1YS9A 2P90A 4IICA 4E5MA 1U0RA 2R6FA 4K0KB 1KFJB 4O33A 3JZDA 2Q3HA 1P7PA 1KNXA 1Z5VA 3ZBUA 1S2LA 4WNCA 3ZZ0A 2QVBA 1V48A 1V8DA 2DR2A 2QEQA 4C0QC 2F1RA 1UBHS 2XLBA 1K7XB 1S3IA 4H1HA 4WLEA 3ZLBA 4YAUA 5MF6A 1ESCA 1N0VC 4LNHA 4DS3A 2PY6A 1AUVA 2Q8PA 5JALA 3ICWA 2VNKA 3IVCA 1DKQA 5LA6B 2CDRA 1UFQA 2ZSHA 4OXKA 2FWJA 1Z5NA 2DLDA 3PJRA 3TEMA 1XTTA 4NL4H 3JQ8B 4QOJA 2I7TA 4DQKA 2Y71A 3VYWA 4CODB 1UBSB 1BMQA 3LPCA 4Q9NA 4URUR 3PQ6A 1ONPA 2R48A 4KIGA 3OQHA 3HM9A 4BPRA 3R9KA 1V8OA 3JVIA 3ZLUA 4WKPA 4AMGA 4IJUA 4S2EA 4WFJA 5AVQA 1I0ZA 3TLKA 4O0MA 2NSDA 1XIVA 2VF4X 5DHAA 3I6IA 4NCIA 1Z2PX 1V16B 1XOIA 4H7DA 1M6VA 3A58B 3WMWA 3KETA 3Q3IA 1SQ0A 5ULLA 4LE0A 1IZ8A 2I22A 2CT8A 3ORFA 4OH7A 4KI0A 2M1XA 1BDBA 2BHTA 2OZKA 1MOQA 2IBTA 5TJHA 1Z4JA 1ZY2A 2XUQA 2BPOA 4JBWA 4QNMA 5HUHA 1N6RA 3T35A 1PHRA 1W0KD 3BRWD 2GJAA 5ALGA 4YRIA 1L8LA 1T4DA 4TN5A 5IMBA 4ENRA 4XFKA 1TF5A 2Q3FA 2WYVA 5ARCA 5CFPA 1M1UA 3FMOB 1QYDA 3L7AA 4HLCA 1Z3CA 1XZJA 1LCIA 2BGGA 4LXHA 3GLGB 3C14C 3EQ7A 4MV0A 1NY6A 1ADYA 1OILA 3IPAA 4W5TA 2IZ5A 4LGYA 3A1FA 1Q3HA 1Y6RA 1DJMA 1W1IA 3IHKA 3RRZA 2ZRHA 3LKBA 4L5IA 4B3HA 3O2SB 2NZ2A 4QTUB 2CB0A 3H4TA 3GMDA 4NV1A 4QLAA 3RH0A 1AXRA 1S7GA 2VBFA 4RACA 1KU0A 4X1IB 4HXYA 1UOQA 2IIVA 3COSA 3UH1A 5LYJF 1Z5GA 2JS7A 4QICA 4Z9FA 1JXMA 4JJ4A 1ZIOA 1A8UA 4ZKEA 5HE8A 1IYZA 1OYWA 4NNOA 2IU3A 3SLGA 2V55B 3USES 1G5TA 1K66A 2BN4A 1QOPB 1UEXC 2ZJ1A 4LMAA 2NQTA 4MV5A 1O96A 1ZVQA 3E53A 1QYIA 4KJZA 2IHZA 2POCA 3KOXA 4IDCA 2WIAA 5K8JB 5LXTA 1JIIA 3G6KA 3C3MA 3HKBA 5DBEX 2XDWA 1QIEA 3ZH9B 5CLQA 3OECA 3OETA 4F71A 3JQGA 3TECE 1FPQA 1RACA 3B1KA 5B7QA 3L07A 4GI5A 2WYOA 2PMDA 4F97A 1L8XA 3GZTB 4GECA 4IOJA 4KVFA 3DPIA 4BEWA 3B53X 2WTUA 5BN4B 1E3QA 3MTDA 4OAOA 3NU1A 4ARIA 3EGXA 4F11A 1UODA 2VZ0A 3ZWPA 3PC3A 1W36D 1N32B 4C06A 4QO7A 2BEWA 4P3KA 2OG1A 4J91A 4OK5A 3UAYA 4I1PA 4DZTA 1ZM7A 2XT0A 4YUAA 1VG0B 3ZN2A 4D9GA 3RJTA 1FNDA 2VRCD 4NCNA 2HDOA 3WBKA 1QKIA 2JFVA 5DNCA 3M5WA 3ASUA 1DJNA 3WKBA 4HAVA 1XLTA 2YJZA 3UVEA 4EY4A 3RLFA 2WWYA 1AS2A 1IVSA 2QV7A 2HA2A 3GJ4A 5GIOE 1CY6A 2FPWA 1LU9A 3MOSA 5AHKA 4NE2A 4BU1A 4QPNA 5CB4F 5JATA 3SHWA 1NL3A 3F74A 5TXGA 2OXIA 2Q4TA 3LKVA 4O5AA 5TGTA 3B9RA 2UXDB 1NLFA 5F7JA 3KSMA 1NQVA 2AF4C 3AEXA 3DP9A 4TYYA 4B7UA 1CY2A 1DO8A 1EQUA 2AMVA 1RXYA 3QWBA 2NIPA 5BSWA 3SP1A 3QVGA 1WOMA 1D2RA 3FOBA 3PGKA 4B3GA 3LPDA 2FUNB 3FROA 1SVUA 3GDWA 3JTMA 1OV4A 4RPLA 4XJTA 1LPOA 3H5AA 2XWSA 5DJ5A 2DETA 3L05A 3QFHA 5AUNB 1VIDA 2Z2ZA 2X4LA 1N7GA 5MHTA 1CZUA 2CXUA 4MQEB 4TL6A 2NMVA 2E49A 3FRJA 1QHFA 2FZGA 4KYVA 2G25A 4BU0A 4PNEA 2A59A 1GGKA 3SZGA 5E1OA 2WJ6A 4FN5A 3AEYA 3L41A 4S1NA 3K15A 3ROXA 4F1JA 2OXRA 1TUBB 3IQIX 4ARZA 3GY0A 1FYWA 2OOSA 2XOKD 4N7RA 3LF2A 3TG2A 1F8GA 4RTSA 1E4VA 2OHGA 2QTCA 3CLSC 3OZRA 3Q72A 4B7XA 2VHZA 3H4IA 5B7GA 4RE6A 1G291 5AUQA 3O95A 2VRBA 2BHSA 4TSFA 1LI5A 1WE2A 2NVOA 5CB6A 2BGTA 4QVKA 1E3JA 3ZLTA 5L6MB 1A8HA 2GVDC 2HV9A 3HKCA 1AUQA 1NPDA 2JH9A 4CR7A 5IK2A 4DV1B 3NHJA 5JY1A 1E3EA 3ZY3A 1O94A 1B7GO 1OH6A 4NEQA 3SHVA 1TCCA 2QJOA 5AK4A 4BO7A 1PFGA 3T7DA 5K6TA 5DISB 4BUCA 5BUZA 1ADFA 1NASA 2VJMA 4NCJA 5DXJA 1Z34A 3KOUA 3TQQA 5JXHA 4JX9A 4EHBA 3Q2OA 2ZW9A 4HVAA 4J6FA 1VXRA 4UZSA 4YJ2B 4X65B 1KAOA 1TQ2A 3FPLA 2QN2A 1LBHA 1UK8A 3Q3JB 1FDOA 4JBLA 1YL6A 4K9PA 4GP9A 1I3OA 5K0SA 4A26A 4U0JA 4EG0A 3JARB 1HXHA 4JU8A 1AS0A 1IY8A 3CT4A 3OAAD 3W8RA 2YYAA 3GOQA 3KVVA 3WGQA 2FFBA 4C4XA 2PIDA 3EIHA 3HR4A 1E4EB 1TRHA 3PFHA 3D31A 1L5ZA 1Z0DA 2I2AA 3LOPA 4U9UA 1CUWA 4A2CA 4BZPA 5EHNA 4HYTA 2B8WA 3ECCA 2P9ZA 4P4LA 1C30A 1KI6B 1T9AA 2F4NA 2C2GA 3Q3GE 3VTFA 4D9FA 4QVGA 3ADBA 4LJ8A 3CWQA 5EXXA 1W25A 1KO5A 1QONA 821PA 2KI5A 5ILOA 4L02A 2P5SA 3BRQA 4O2BA 1W88A 2OHJA 4TKVB 3BPSA 2OCGA 3BD7A 5A7HA 3OQ6A 1NHGA 2FMFA 2R44A 3SFVA 5FJIA 1VE1A 3Q0TA 1XCBA 3LT2A 2HWYA 1P0PA 1T8TA 2IT1A 2WKPA 2ZSEA 3O1IC 3ZCSA 5K3EA 4QHSA 3K1AA 3W3ZB 1UPCA 1C7QA 1DZIA 1SQSA 1DLIA 4YV0A 3X44A 4BLUA 2FOIA 3R9IA 3H9CA 4JP5A 4R1OA 1FQOA 4ZYWA 1PEYA 2PGXA 3DBOB 4ADSG 3KUKA 4R2HA 1I3KA 1S5PA 1N6OA 1LPMA 1Z0KA 4KQ1A 3H97A 3K8ZA 5AK6A 1R0SA 1V7CA 4RIEA 2FRXA 5CFQA 1UT5A 4MINA 4ZEWA 1H5NA 1ABEA 1M6EX 4AS2A 5JWOA 1X7WB 2ZBVA 3DDWA 4F06A 1N1GA 1N5JA 1R6DA 2C9CA 3BCSA 3K5IA 1W85B 3KLNA 1ZJJA 4EJSC 4OK6A 5MN5A 1KKLA 2EBFX 3VU9A 3ZXUB 2FWIA 1ID1A 1KWGA 2Z9DA 1I3CA 2NO4A 4H0FA 4JLUA 3UT5B 4L6IA 5B55A 4NS1A 1UBRS 5J1TB 5DW0A 3KSZO 2OD2A 4JKIA 1K2WA 4URZR 2RGNC 2WF9A 3PE4A 5TEVA 1E60A 3PNKA 2JIRA 2X2PA 1SCIA 1KS9A 2OBYA 3BIJA 3T7AA 4F4CA 4R9RA 2D5CA 1LK7A 1R0LA 3L77A 5AKZA 1NHWA 5EXDA 1JEAA 5IXYA 4TT8A 2I71A 3QSGA 2FUEA 4RS3A 1L5LA 4AC9A 2GA8A 3UAVA 1E1CA 3FAKA 4XI9A 1ZONA 5ALZA 4DV2B 2W71A 4NI5A 2H57A 2ACKA 1WDLA 1UF9A 1C7EA 4I3FA 3MA0A 5DHRA 5LQRA 1O1YA 1CZNA 2WV9A 2P0AA 1YDFA 4YC7A 3T38A 1NBME 1CV2A 1LK0A 1PNVA 3BMQB 3PNOA 4P4SB 5JSKA 5LP1A 2Z43A 2Q6OA 4IHKA 1WF6A 2PS0A 4HTAA 1K8XB 3PEWA 2GD6A 2Y92A 1SA0B 2XI4A 3LZ6A 2O0HA 4KACA 3GFSA 3T1VA 2FW1A 3MG9A 3V1UA 2P69A 3FYCA 4QUEA 3UHFA 2QY6A 3MMZA 2WM2A 3OX2A 3QOXA 2QT1A 4AWBA 1ZKDA 1T8WA 3LVFO 2XNSA 4LV5B 4YFVA 1DMSA 3TSZA 4BNDA 3TQHA 5K03A 3WOHA 4MRVA 3ED5A 4BYMA 3K6SA 1U6KA 2G82A 3PFGA 1VSTA 3P0JA 4UUMA 2PFSA 2QVZX 3AIMA 1EJ6A 2SKDA 2WIKA 3QU7A 5LMZA 1F06A 1UFRA 1B8PA 2UUBB 4EA7A 1CUHA 4I1VA 4MVWA 3D8BA 1FW6A 3OP4A 3WYDA 1XRNA 2A92A 2EBWA 4HLNA 3TSWA 4CIYA 1KEEB 4YFYA 4EAAA 1OTYA 3V8BA 3BYZA 5EHZA 2A9VA 2PO7A 2VAWA 4OIMA 1JDVA 5K2OA 2ZJ5A 2C88A 1WXGA 1VLQA 5BMVB 1I5EA 1W0KA 2CDAA 2MMGA 3BRWA 5KTTA 4MUBA 4R1QA 1YACA 1GFIA 3LGXA 1RNLA 1T3GA 3OE1A 1Z7GA 4MKIA 4X61A 5CG1A 3RUHA 5IZCA 3HY4A 1LZLA 2IHTA 3EXHC 3IUNA 3L82B 1QH8B 1TZCA 2P6PA 4IINA 3C1AA 4X1KA 3QTTA 3O4RA 2HRQA 1PK8A 3KUXA 5DBHX 4FFMA 2OQVA 2P1RA 5ICMA 2XOEA 4OLFA 4P0PB 1P73A 1TE2A 2ZYVX 3BXHA 4OD0A 1YB5A 1XKQA 2NSJA 2WICA 2Y1EA 1CF9A 1W46A 3DE7X 4ZVQA 1XNQB 3E84A 4MWOA 4QBGB 3FNQA 5IEBA 1R64A 1NF2A 1QK4A 3QJYA 1T9GS 1XDDA 1M1YE 1D9XA 3BSSA 3ACDA 1TA9A 3I6ZA 3QBTA 3K35A 1E0KA 2DWQA 4PU0A 3TW8B 3ZWBA 1O9GA 1T6NA 3ETNA 1S9HA 4N76A 4EB0A 2CGEA 1M34B 5KJCA 4C5AA 4XGKA 4N7MA 1Y89A 3KHTA 5CX4A 4COKA 1BKYA 2HA7A 4OATA 1JLKA 2IOQA 1B73A 2ZUBA 3G2IA 4FONA 3ZTYA 1A04A 5CA0F 1QVAA 4AO6A 4MWTA 3S68A 3N58A 3ROTA 4FW9A 5ELXA 3FIUA 1T0PA 1JI0A 2C2BA 2DFKB 4FI3F 4L22A 3IX7A 5JH7B 3OHSX 4YCAA 3TQSA 4FB5A 2R1VB 3IVRA 5AVXA 2O0LA 4Q4JA 3OBIA 1ODLA 2FZVA 2W5UA 5EPEA 5B53A 3EQZA 5T4EA 5B58T 1SRRA 3FF1A 4EBBA 2VTKA 4X00A 5AJYA 4Z3KA 5DRYA 3OIWA 3REQA 2BCEA 3WS7A 3QNMA 1YKGA 1P72A 1ZMRA 5C32A 1PL0A 1CCWA 1AVTA 3IR6A 1US8B 5A7GA 4NU5A 3RD5A 4Y9DA 4DCUA 3F4KA 1U5AA 1QRTA 2AC7A 4ZOAA 3LIIA 4FEAA 3KQWA 3SQMA 4KMMA 2F64A 3MCVA 5K6AC 3DTNA 5LLDA 1X86B 2AFHE 2QD4A 3EX7C 2VRCA 3TBFA 2O2CA 3K8OE 3A0UA 1N2JA 2RHJA 1G5HA 2PT9A 2B8NA 3KKNA 3OCYA 4Q5IA 3RSOA 3WTBA 2C7OA 4X41A 2QLTA 4YT4A 1E2MA 3DHWC 3CEHA 1PV1A 3VFDA 1FTGA 1MC1A 1FQKA 2A5FA 3KU1A 4O2AB 4YV1A 5IAAA 1BGVA 4OP1A 3AVUA 3HA7A 3I2FA 1ZVJA 3VR6H 1J8VA 4ARAA 5I3ZA 1TOAA 2Z5GA 4YY3B 5CA1A 2YC2C 4AF8A 3T1OA 5EC8A 3TZEA 4FYPA 1NC1A 3DBLB 4H31A 2EQ5A 2AWOA 3NH6A 3H19A 4HZUB 3VNQA 5BO5A 3FI9A 4NEHB 4ZWNA 2GHIA 1T1SA 2VAPA 3HBAA 4ZAYA 4IXTA 3AHDA 2BHLA 3C4JA 3G0IA 2E55A 3EVBA 5F52A 2D0DA 2X15A 3T94A 1MU0A 2H0AA 4DRXB 2Y1DA 2O3UA 3GRRA 2AB0A 3QF4B 4R0NA 4JKOA 2X4IA 1Y5LA 1WXDA 1KWKA 2GI4A 3CJRA 2BGKA 3OQ1A 5J2UB 3VPAA 4AN1A 2VUHB 2WHRA 3TNYA 3WL3A 2INGX 4MKHA 4IIJB 2J0QA 5T41A 1PTJC 3H75A 4WKBA 4PIVA 1JKJB 2XOKA 4C20A 1N7IA 4DV7B 3NNDA 3PYLA 3SKVA 1U04A 2P2ZA 3M6XA 3H11A 4RA6B 3FNBA 5FOXA 2JEOA 3T4XA 4H27A 2R5FA 4LWQA 1V96A 3UWKA 3IP7A 2AZDA 2LPMA 2ZREA 4NK4A 2RJ3A 2R3SA 1JQKA 3CF6R 2NLOA 3T0IA 3GCXA 3ZYZA 5HKAA 1YB1A 2GRAA 4E5DA 4J76A 5LR6A 4HDMA 1L4EA 5C3UA 1PO7A 2FFAA 1CY1A 5G02A 2Z6UA 1ZNWA 4HL6A 4CR6A 4NOMA 1L5HA 2BFDA 4PGHA 1G98A 4DSUA 1HR0B 1T3SA 1VL1A 2PKCA 5ICFA 3LCRA 4BQFA 1JR3E 5JXJA 4XRRA 3ZDQA 3QEAZ 2C7PA 4INPA 1I7NA 4BE4A 3G1TA 4AZ3A 1C3OA 2YXEA 5LYJA 5LQKA 2A0WA 3O8OB 1QYCA 3ISVA 4TXLA 5TMPA 1YMUA 2GK4A 2O8NA 1MQ8B 4GKAA 2Q99A 2EEPA 1OFUX 3AHCA 4NOLA 4OIFA 4UHBA 2QDKA 4MOWA 5A02A 2ACVA 2CD9A 3OAAA 4E1BA 2W8BA 1RWXA 5T6MA 4J3JA 3IDQA 4WK0B 1IZ9A 4PVDA 2QUAA 3MNFA 2D2XA 4LDJA 4V0NA 1TLFA 1TU3A 2QTVA 4JJFA 1KARA 1NOKA 2ADMA 3GFPA 4NMHA 4UBKA 2H1OA 1PUJA 2B69A 3CPEA 2DX7A 3K9QO 2ZSFA 4RMNA 3QG1A 3D0RA 3G3EA 1N2GA 2B7LA 1QFZA 4RD2A 3AJDA 4KO8A 4L3VA 1ST2A 3IE0A 3STYA 1JIKA 2XHZA 5FUYA 3UB3A 3UFXB 3VYUB 3RTDA 1R12A 3NZEA 2ZT6A 2C5GA 4HZIA 1T0JB 2BUBA 3RSQA 4CEIA 2Y2UA 2FCRA 1CETA 4IHJB 2FB9A 2YHUA 1OB5A 3VC2A 4BXOB 4OHMA 3KPVA 2RIPA 4ZOCA 3TFOA 4HUQB 3KUUA 1UFOA 4MA0A 1NQWA 2FMXA 2W6ID 2AD1A 3H1TA 3MK31 5JSYA 1ZOLA 2AMJA 2LW7A 1UJ4A 3C5WP 2LCQA 4MUMA 2IU6A 1A2KC 1JDUA 4RMHA 2VH5R 3ILHA 3OHPA 5G3ZA 3LECA 2NVWA 4EQ6A 1TTTA 2BKUA 1JVSA 1EE9A 1WB6A 2HUPA 3GYBA 2AVDA 2Q9AA 3DKKA 5L7WA 4FD3A 1LV8A 1G3MA 1ONBA 4HNHA 1JR3D 4WPGA 1KBZA 1E9BA 4XIJA 3IGFA 1W1UA 5JS2A 3MLBA 2O5EA 1JLHA 5JMPA 1XXHE 1T4BA 3F3YA 2FEKA 3AETB 1H6AA 3AL3A 4MMYB 5LBTA 3OZVA 4KYTA 5AKJA 4FQ5A 4RDCA 1UC9A 2J3IA 1P4HA 3DVQX 3C3XA 5EWLB 2AYYA 2FN9A 3A11A 4PPQA 5JHHB 3R8CA 4D42A 3KTOA 3K70B 2FPPA 1H2XA 2COEA 2NG1A 4P1ZA 2LR0A 2ZKIA 3FHCB 5DTIA 1XQWA 4MVJE 3QWFA 5ALWA 3KK0A 4O08A 3LOQA 4I2NA 2R00C 4DHEA 1ODJA 4S2UA 3VR1A 3DV9A 2MR5A 4RUKA 3TS1A 4W9MC 3TTVA 3NWEA 3PWKA 2R7NA 3GVPA 4GC9A 4KDEA 1X77A 2IZ0A 3UT0A 3ZX5A 2IL1A 1RRCA 1QAQA 5TE9A 5IJ9B 1X38A 3F67A 3AUKA 3PHCA 3SHOA 3SM3A 2AJDA 4LXQA 4M9CA 3MPUA 4GI2A 1R8JA 4X7MA 3M1IA 1JHDA 4N5DA 4QXOA 1OH7A 3B82A 4Q1EA 2ZZKA 2QN6A 3QWIA 5EINA 1IIRA 4PSAA 5DLQC 2VT6A 3UA4A 2CHGA 3HVIA 3AEUB 3BIWA 4NPAA 3B1XA 4BV8A 3CG4A 3ADCA 2COUA 3VUEA 3C6MA 4M9XA 2H1FA 1Q0TA 1R0YA 4XSGA 3NRCA 1FMFA 1AZTA 2GZ3A 2PZGA 3BXEA 4IM7A 5AW2A 1HURA 4FILA 1XU9A 3NM5A 3F7TA 2JH8A 3ETLA 1ODFA 2G80A 3WLHA 4DMHA 3CF4A 5AXDA 3G2MA 4F4IA 2HIHA 1XD2B 5CDUA 4E5PA 2CLHB 4J0QA 1J06A 4GQBA 1U7ZA 3D1JA 2VC2B 4CTNA 5DFAA 4RQAA 2GJSA 3D6TB 1KBQA 3ZIDA 4JBYA 3U7FB 1CX9B 1Y1LA 2A94A 2Y1FA 3AG6A 3BGDA 2PNJA 1CP2A 3QTBA 3T7RA 3C39A 3IP5A 2EGGA 4ZEOA 1YB4A 4FDTA 3TTUA 3K6JA 1DOZA 1NQXA 1U2EA 2PX5A 4U39A 1OE0A 5H02A 1RMYA 4BVBA 3PZBA 4DR1B 4IH9A 2IA5A 1PQ4A 1I32A 2W2XA 2QG9A 2A35A 3HR7A 1K89A 1Y6GA 4JZKA 4A8TA 2QSYA 5IAEA 3SJCA 4Z7JA 4B6PA 4ZI7B 3OX1A 2YJ5A 1YB2A 1NT4A 3QIAA 4MVJD 3WLAA 1IXSB 5KUTA 2NU9B 3CCCA 2FJUA 3QSYA 4GX5A 5HIJA 4TLLB 3FOFC 4F2PA 3NV7A 4V3CA 4DT1A 5A05A 4KR7A 1JECA 1VL2A 2Q3DA 3FFBA 5FWYA 3DW3X 3GPBA 3TJMA 3OLCX 3QVOA 1Q0UA 1XJWA 4QUGA 1MOPA 2O7QA 4D3SA 2RMKA 1N6HA 1YASA 2PGLA 1C41A 5KREA 1I1OA 3JASB 4U2KA 4G41A 4WSOA 2YMMA 3L6CA 1GZDA 2ID7A 3LY8A 3QX3A 1H9CA 1BEUB 4BTLA 3ZHOA 2C07A 3N9IA 3ADOA 1EK6A 3FYDA 4CV2A 5FV4A 5FOVA 1OFTA 3IAAA 3OZWA 1DKLA 3BFPA 2YX1A 3CRMA 3WMXA 5E7JA 3B1WA 5KI6A 4AQYB 2IBMA 2R6DA 3EFEA 3EQ8A 2OZEA 2AZXA 2QAJA 4PRYA 1JV2B 1C9JA 1SXJC 1XZGA 1ZGBA 2WD7B 2ZM5A 1L0BA 4DG5A 3BC1A 3I42A 4Q9LA 3TNFA 5I3CA 2CFIA 3VM6A 1UWLA 1JT2A 2I1VB 4HADA 1VJGA 3RASA 3FPCA 4CMJA 2QIOA 1JVNA 3IQDB 4HBGA 3RT9A 1OBVA 1W4AA 1YCDA 2OXEA 1FUUA 1P9WA 2PT5A 2E87A 4EB8A 1D1PA 3TRHA 4QSHA 1Z35A 3JVDA 5IBRA 2VDQB 4BTEA 3IE2A 5LCXA 2ES4A 1CERA 2P2CA 1UKBA 1GPAA 1KJQA 3KRTA 2IY9A 4UHJA 5FUMA 1JHVA 3DH0A 5HDBB 4BJ1A 5AW6A 4YQEA 2XYGA 1Y3FE 1ZL0A 2DERA 3VNUA 1NU6A 2GQ0A 3CJQA 1OLOA 3TO5A 2MINB 2YZ7A 2HO5A 3E7FA 3NBKA 4I99A 5CVUA 4B48A 5E6SA 1XV5A 4WAUA 1GNTA 2JK0A 5DYYA 3VDMA 1GRCA 1MD9A 5IH7A 1HV8A 3HO6A 3IUQA 3PXUA 4Q01A 4XSHA 5AVKA 1BHO1 3RIXA 4EG8A 3MERA 2E5WA 1NA5A 5F1PA 5CK5A 5BVHB 3P9IA 4KWEA 1PS8A 1YAHA 4DQUA 1J90A 2JJ2D 3JYPA 5FWNA 2ICAA 2BUAA 2ZRIA 1L7OA 2XA1A 3VZCA 4CM8B 5JASA 5M2QA 2HX1A 5C52B 4DV0B 2X13A 3DPSA 3ID6C 5KNBD 3RAFC 3GEGA 2FETA 1IXYA 4FT4A 5JIBA 4ZCMA 3IKTA 3C6BA 3PWTA 1J1IA 3CH4B 1YBVA 2V97A 3HPRA 2XYRA 4GMFA 4GPBA 2CF5A 3PGLA 4F38A 3JWJA 2X1LA 5D00A 4JB3A 3F2IA 1ZVVA 1JNYA 1GAQA 1HNNA 2QUIA 4K6HA 3T4UA 5NLLA 5CVTA 1I94B 3ZGYA 1OSNA 1J2YA 1QC5B 5LP6F 1THZA 2LDXA 4HXEB 2Y76A 5FWDA 2D0IA 3BE5A 3V42A 3ZHBA 3G0HA 4WCVA 3GCWA 2G1KA 1U80A 2VSYA 4CM1A 2HUNA 5AI6A 3TCNA 3GGOA 4O0LA 4Y2TA 4ZYTA 1JJBA 3OT5A 5M7EA 1Q6YA 4JYMA 3PJGA 1L4YA 4M22A 2ENWA 3NBMA 1PFUA 1XK6A 4WOCA 3UUFA 4FKZA 5IKMA 5L9AA 4LE2A 5CT9A 2AI1A 4ZEMA 1BO6A 1Q17A 3A3PA 1WZIA 2AFHA 3PUZA 4GQAA 2JCGA 2ZJ3A 2Y4OA 2MYNA 5IBQA 3QU2A 1GEEA 1PJTA 4BN5A 1STOA 2HSJA 2R1ZA 2WKWA 1WMAA 4KR6A 3KFVA 1QHEA 5E4FA 4FOTA 3QBEA 1QZZA 1J0CA 3DTVB 4HQLA 2ZITA 4U6QA 4GNKA 2YFYA 4ER5A 2JLAA 4YRNA 2UUOA 3ZE6A 1T6XA 3RJ5A 3F97A 2X3UA 3EF0A 3DKRA 1B6GA 4DRYA 1C1XA 4MR8A 4YBRA 2XY4A 3OJ0A 4UTOA 1XQ1A 2Y6VA 2ZVJA 1H6DA 1BTOA 3MTQA 2QF7A 2X3FA 3GRUA 1FSFA 4PVCA 4E51A 4EY5A 1CQIB 2DPYA 2BBSA 3GL9A 3KKPA 1PFYA 4LSZA 5HFAA 5CA0A 5C51B 5MFPA 3EVNA 3IJRA 4JWKA 3VHXB 2YV3A 4ILEA 1VI6A 3ZCQA 1NM5A 1D0SA 1ULZA 3TQOA 3ROFA 1VJTA 1MNQA 1ZRNA 2ODEA 4GSKA 1NMQA 1BE0A 3OM1A 2GEDA 5FQOA 2BMWA 4D9KA 1WMSA 2H00A 3BDVA 2XEDA 3H9BA 2F90A 1IHDA 5JNUA 2QL7A 1P5FA 1VP9A 2RI0A 4Y98A 1L7DA 4N5MA 3RSHA 1H1DA 1QTIA 3WKAA 1VGQA 1VSQA 5CR9A 4C2AA 5EJ9A 4HG2A 1WB5A 2C59A 2DR0A 1E0SA 2J0UA 4X63A 3RRJA 3S70A 3SEAA 1KH2A 4PG7A 3GD5A 2P0YA 4LMRA 3UJHA 4DLVA 5JU6A 4FEGA 2OVBA 4NZYA 5LQAA 1ZUIA 4NY1A 3OM8A 4JQOA 4MK4A 3T5CA 2W6IA 3KJIA 3RKSA 4EECA 4G2NA 2A8YA 2JBAB 4BMXA 3VOBA 1EB9A 1H8HD 4DC0A 1R16A 1JPNA 1XAHA 3T5GA 1J5EB 4DZZA 3L6BA 3QLUC