5AWFC

Crystal structure of sufb-sufc-sufd complex from escherichia coli
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
243
Chain Sequence
MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FeS cluster assembly protein SufB
publication title Functional Dynamics Revealed by the Structure of the SufBCD Complex, a Novel ATP-binding Cassette (ABC) Protein That Serves as a Scaffold for Iron-Sulfur Cluster Biogenesis
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein/protein binding
total genus 78
structure length 243
sequence length 243
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5awfC00
2WVJA 4IOJA 2V55B 2ZIAA 1ZD8A 3NH9A 3CKLA 1G7RA 4B2LA 4XSHA 2IS4A 1S4QA 4RKFA 3SR0A 1FTSA 1Q0UA 1T8UA 3E2IA 2ZRDA 3KXIA 4DC9A 2RGAA 4PPNA 4BEBA 1Q1ZA 3C15C 4TTQA 4DDUA 4R2HA 2YWGA 3DVLA 3SHWA 2D62A 2ZJ5A 1NSFA 1KMHB 4IDHA 1NY5A 3RYTC 1NKTA 1GTVA 5B2ZA 4P31A 4I1OA 4L5BA 4WOPA 1CLUA 1HA3A 2ZRFA 5K8IA 2GBLC 1XD2B 3EIEA 5FUWA 4C0HA 1Q57A 1E9AA 4C2UA 2RGXA 3TGPA 3SC3A 3WBJA 4FCTA 2WMNB 3GJ7A 4ZDIA 2A7QA 3NC1C 4CEJB 5FL3A 3IBGA 2QQ0A 2AL7A 3NC0C 2XAUA 3SQXA 4HLUC 2JJ1A 5DHFA 1P2TA 3J81k 1CS4C 2A78A 2I1QA 4KFUA 3TSWA 1KMQA 3FHCB 2HLDA 2GDJA 3LLMA 4HB3A 1G291 4CDGA 4MQBA 4QBHA 1Q20A 1JQLB 1NKSA 4NYIR 5SZKB 3CM0A 2XZOA 2ZRBA 4M9XA 1XNJA 3K53A 4IVQA 3LH5A 3K9GA 4LYHA 4DDTA 4BFVA 1EFRA 1R7RA 2DFLA 2G1KA 3GJ4A 1P62B 3P32A 5HTKA 3I61A 2ZE5A 3M1IA 2A5GA 3UMSA 3WMGA 5AJXA 3P26A 5HCIA 4AG6A 5TDHA 1E2FA 2CLCX 1JNYA 4BLOA 1GKUB 2BDTA 4KJZA 2A2ZA 4JS0A 2O8CA 2ZJBA 1P61B 3KB2A 2A5JA 1MV5A 3LBNA 2PBRA 4B2PA 4JBYA 2W6ID 2QU8A 3CIOA 3O8BA 3CBQA 3TR5A 5ELXA 5FTNA 3QKTA 4QXAA 2GBLA 4BZQA 4JLDA 2OFOA 3BFVA 3B1VA 1DO0A 2ATXA 4WW0A 2VHQA 2O8DA 3SYNA 2QP9X 2QRNA 2RKOA 1QHHB 4AYWA 2KSQA 3WXMA 1KNQA 1W48A 2ZTSA 1ZD1A 2ZRNA 1UBCA 3DL0A 5CYOA 2BEKA 2OUKA 2V1XA 2W0SA 4N3NA 2BCJQ 4MRSA 5FBWB 3AVOA 3W8NA 2QL6A 4TQUS 4ILEA 3KKOA 5LD2C 3OEHA 2REXB 4C2TA 1U2RA 1S9HA 1VPLA 3I72A 3P27A 3ECCA 4BFUA 4MUAA 1QHNA 3CW2A 5D3MA 2WWYA 1P9NA 3BGWA 4JL8A 4NHOA 1R10A 1XP8A 1OH6A 3O47A 1C9KA 3THXA 4EIWA 3RS2A 4OK3A 4KLZA 4B6EA 1SXJC 4B71A 3B82A 5DI3B 2H57A 1OH7A 4MDFA 3QXHA 3PQCA 5JI3E 5H68A 2NMVA 5KNCA 5EE9A 4MRRA 2ZE7A 5DGXA 4F93B 3E5HA 2G88A 2AWOA 2KB0A 5FOSA 1YZKA 3HP1A 1G3RA 4GOXA 3QXSA 4UQOA 1PZNA 3NH6A 1LB1B 4BASA 1A4RA 1OKKD 4B47A 4PAOA 4R2IA 1V5WA 2QPTA 2W83A 2O5VA 1E2LA 3X2SA 1FNNA 4DDWA 1QHXA 2HJVA 3HDTA 3HYTA 2NGRA 3PJRA 1ZCAA 2YZ2A 3Q7QA 3U3MA 3LX8A 1ZNXA 1V43A 3PEYA 5AUNB 4II7A 4XOIA 1HQYE 1ESNA 2F7SA 4NTZA 1U94A 1KSGA 5CB8A 3GJ5A 4ARZA 2JLRA 1Z0IA 4OQNA 3DO6A 4MGIR 4GNKA 1OXXK 3U3RA 4XVQA 3DKVA 5IK2A 2XGJA 1M7BA 1ZU4A 5K8TA 1U8AA 3PG5A 1W36D 1F2TB 2LKDA 1OYWA 4A2QA 4FMDF 1Z6YA 2VQSA 4DLYA 2ZSBA 3U2QA 3FKQA 2J0VA 1D8TA 4YMSA 1L2TA 3RHFA 1SXJA 1XDBA 4JKIA 4EDHA 2KJQA 2VL7A 2PJRA 2J0QA 3WRXC 2IBMA 4OI4A 2ORIA 4TTRA 1KNXA 2BMFA 3KJHA 4CT5A 3E1SA 2OXCA 4LOAA 2ORVA 2RGNC 1NL3A 2CL0X 4M1MA 1TUIA 4IXNA 2OESA 1VCNA 1OSNA 1NMZA 4X8OA 1UBFA 2KI5A 1NG1A 4CVNA 2GESA 4I1SA 1GRRA 1NVVQ 1E0AA 1BKDR 5BN5A 3I5YA 2CMKA 4PXAA 4ZCIA 2Q0HA 1KZGB 1VYUA 1ZINA 5JHGB 4QM6A 2EWVA 3HJNA 3OEED 3QKSA 1D2NA 2PZFA 4LY6A 4N0EA 3FHTA 1YRBA 2WPDA 3ASZA 3IUYA 4F91B 4LBVA 2DR3A 4NDZA 4LZZA 1XTIA 4C0JA 1ONBA 2Z6VA 2A5FA 1JJVA 3CZQA 5HKKA 2J7PD 2GJ8A 3AVYA 5JHHB 3NDBB 4UXIA 1VCMA 1P6XA 2TMKA 3VX3A 4EJSC 4ZCMA 1LF5A 1SVOA 1ZBDA 3PVSA 5JMTA 1US8A 5CM9C 5LD2B 1GZSA 4DSOA 4Z1MD 3Q85A 4GPTA 4DLXA 1GNPA 5KNDA 4HAVA 3GEEA 3SJBA 3FFBA 3V9PA 2AK3A 3AVUA 2F1HA 1WP9A 1T5IA 2ONJA 4IJMA 3K0FA 1A5TA 1D9ZA 1NP6A 1T3SA 4RD4A 4DWJA 2HDNB 2RGNA 3CPHA 1YR7A 2XSZD 4NONA 5EP2A 4PQYA 1X6VA 3SDZA 2UZIR 3EXAA 1E98A 2EYUA 3G5UA 4RD6A 1Q12A 4B3DA 1KO5A 3MD0A 3B5JA 1GWNA 4GZMA 2ZR7A 4IRUB 4LRWA 2ZRKA 1O87A 1RW4A 4IDQA 2EWWA 4GOKA 3UK6A 3T1QA 3TW4A 4C30A 3JVUA 1G64A 1XTSA 3L43A 2BHRA 4Q9HA 4PQFA 4ZDJA 1E2JA 2EW1A 2IYTA 4Q1EA 2PX0A 3IPYA 1Z8FA 4BEJA 3UWKA 4G1UC 1Q44A 3TVDA 2ZJ8A 2AFIE 5FPHA 4HLQB 1TTTA 4P3YA 2OO7A 1ZVQA 1CJUC 2BMEA 3GCGA 1ZUHA 3KQLA 4G01B 4G5QA 2VEDA 2ZYWX 3A1VA 2VO1A 2C04A 3VKGA 2FN4A 2ZJAA 4EJSA 5JS7A 4EQ6B 3TLXA 4DCNA 2JLUA 2WJJA 2DFKB 2JASA 4FINA 3EA0A 3O8RA 4ZDWA 1JR3A 5SZIA 1UJ2A 2QTFA 2IEYA 1NVXQ 2X77A 1GP2A 2P5SA 2N42A 3BIFA 2J9RA 2AKYA 4N1AA 4EPRA 1W4BA 4KITB 3RSLA 4WBSA 3V4FA 5AUQA 621PA 3EARA 1Q3HA 3CRQA 2RCNA 221PA 2WJHA 1JXOA 5FUVA 1ZM4A 2R6CA 3GJ0A 1OXTA 4RFSB 1XXHE 3UG6A 1M8PA 4AC9A 2WSMA 3ZQJA 2Q3HA 4A9AA 3K0FB 4B3FX 3C14C 2QI9C 4G5GA 3FPAA 5BXQC 1PLKA 3KFVA 4F4CA 5DN6A 1XB2A 1PV4A 1QHIA 4KODA 4D2IA 4DLVA 2C78A 4JLPA 2GVZC 1E1RA 4TL9A 4D6PA 5IDVA 2RGGA 5LB4A 2ZYUX 4WAUA 3BWDD 1NVUQ 2ORWA 4BFXA 4DLTA 1J8MF 4KYUA 4QBFA 2R6FA 4XSGA 2F43B 1DEKA 1SGWA 2GVDC 3C7KA 3WYFA 4B6FA 3CPJB 2VP9A 4RCYA 4CEHA 4RFVA 4OHVA 4Q1DA 1LVGA 4XVRA 721PA 1P60A 3U3KA 1YE8A 2WWIA 1Z2CA 5H70A 1FX0A 4QJ4A 4X8HA 5EQTA 1T3LA 4TSFA 3IPXA 1MO3A 4ASUD 1KO7A 3LA6A 1EESA 3C5CA 1ZJ6A 2OV2A 2GF9A 1U98A 4LV6A 4DSUA 4EFLA 3T61A 3ZJYA 1RIFA 4DCVA 1G4AE 1C1YA 3T15A 1XTRA 4OQLA 3QF4A 4JYBA 4QBIA 5JRJA 2AD5A 2P65A 3QXCA 2C9OA 4KFRA 4S35A 5EP4A 2PH1A 3K1JA 1EXMA 3KZ1E 4WA7A 5JEEA 2H18A 2ZU0C 1XMJA 2QE7A 3CLVA 4LHYA 5EE3A 3D3QA 4DZZA 3I62A 3CWZA 3BH7A 4PPQA 2FJUA 1MOZA 1DVRA 2R6AA 4DVGA 3U61B 2G83A 1U90A 1XF9A 4ZDKA 4QL3A 4DB2A 2BBSA 3OZXA 2ZR9A 4MA4A 1JQJC 3OHMA 1HYQA 1YHNA 2JAQA 3NHAA 4LJ4A 1SULA 5EZ5A 4TMXA 2XZLA 3DZ8A 4NKRA 4TSFD 3VR3A 2JLSA 1UBGA 2WWHA 4IEIA 3VKHA 4JVSB 1MRNA 3FGNA 1OW3B 3H1TA 3IQWA 4JLAA 4HUTA 2J3EA 3HU2A 3R7WA 1CXZA 5KTYA 4C0LA 4Q9JA 1JI0A 1CULC 4Q1CA 2FMXA 3ZLJA 2IYLD 4D81A 4LYJA 4Q4HA 3ZZTA 4CEHB 1SZPA 1NY6A 3TBKA 1OFTA 1R0YA 1E69A 2X1VA 1AM4D 2IYVA 5HZHA 2W6JA 1SVMA 2OSBA 1N2CE 2NQ2C 5G41A 4UNNA 1T3HA 1AN0A 2X2FA 3K70B 4IDNA 1KAGA 4UXHA 2P0EA 2R65A 2XJ4A 4P4SA 3RNLA 3U7FB 1OXSC 1Z47A 3KXLA 2RHDA 5FOXA 2VP5A 4BLPA 1QVRA 2JDIA 3GLGA 1ZMXA 4B74A 3F5FA 4HAYA 1XMVA 3LBHA 1SVKA 2FFHA 3GLFE 1YZNA 1X8KA 4D0NA 1COWA 4ZO4A 4MITA 1NVVR 1TU3A 1E79A 3BAFA 5BWMA 1JJ7A 1HTWA 2WWXA 3WNBA 2F9MA 4Q03A 1XCMA 3QJYA 2ZJ2A 2O52A 2YINC 5F2EA 2QM7A 1XXHB 3BH6A 3D31A 5CK5A 2DWQA 4EAQA 3F0TA 3ZVMA 2ZXUA 5AWFC 1TF7A 2CHQA 3MCAA 2GETA 3ZIAD 5J5CA 1W0JD 2XNDA 3ADBA 4B35A 2RAPA 5BYJA 1TEXA 4RZXA 4LJYA 2ZRJA 1RE0A 3KKQA 2ZJZA 1TL7C 3W6NA 3SHFA 2JIZA 3LDAA 4DLZA 1E32A 2D7CA 1E99A 5E7JA 1SKQA 1DARA 1VYVA 4JVMA 5TMPA 2IYQA 1N0WA 4TTPA 5JWOA 4OBEA 4Q1AA 4FWIB 4US1R 1IONA 1AGPA 3TSOA 4PZYA 1LS6A 4LHVA 4CIDA 4O2RA 2FG5A 5JWRA 4Q66C 2B8WA 4D4JA 4WXRA 2Q3MA 2F55A 4YONB 4P4SB 1X1SA 3AGPA 4Q21A 1GUAA 1E96A 1W5TA 5L3RA 4D4MA 1KI2A 1E9SA 5E4FA 421PA 3FTQA 1XTJA 1UF9A 1ZNZA 2GEDA 4M9QA 1XMSA 2C03A 3CB4A 1SHZA 4E07A 3NEYA 4Z8XA 1KZ7B 2V9PA 4KBFA 4V0MA 3ICQB 1VKJA 1JXMA 4K81B 5FTMA 4URYR 2ANBA 2FSHA 2OXRA 2AR7A 2WMOB 1D9XA 3GQBA 4BZXA 3GLFA 4NU0A 1VG9B 3MWJA 4V0LA 4A0FA 4DKXA 5J4KA 1IN8A 1LF0A 1QHYA 2H17A 1KHTA 1NVWQ 3LNCA 4EFMA 2IYXA 1JALA 4OL0A 3NBYC 4URUR 3DOEA 1VG1A 1VMAA 3PFIA 5CIQA 3VHXA 2VSOA 4R98A 1NLZA 1IM2A 1N5IA 1WB9A 3B85A 2FH5B 3BJIC 1F6BA 2IF2A 2IYUA 1JB1A 3EPLA 1KYIA 2G6BA 4JIMA 4FN5A 3KJGA 4IHQA 1PLLA 3TSZA 3QOFA 3AKCA 4I99A 1HQCA 4TLAA 2Q21A 3RS4A 3CO5A 5ANRB 2PL3A 3T12A 4I4LA 4IKEA 3AB3A 3HPQA 3U3JA 2QZ4A 1CR0A 4BRUA 5FPTA 3QBTA 5UKDA 4Q4AA 3CRRA 4ACBA 5J40A 2WKQA 3L0OA 1OH8A 4QOSA 2FFAA 1G41A 3M6AA 1PVOA 3KX2A 1UPTA 1E2KA 1WXQA 2P3SA 4L16A 3CUEF 4BECA 4IOKA 3B6EA 4ZI2A 4JT2A 4UJ5A 3I8SA 2CL6X 4DIDA 3GD7A 2MMGA 2GJSA 1EFTA 4YMWA 3UMRA 1AKEA 4QJ3A 2ANCA 4OI0A 1XTKA 1BMFA 2FGJA 1W0KA 2DYKA 2GILA 1NMYA 4WIAA 5J4VA 5DH9A 4JJKA 3GLFB 3UATA 5HPYB 1XJ0A 4LHWA 3WP1B 3FDIA 4U7DA 2ZI9A 2W2VA 3THYA 2ZSAA 4YC7A 2RGDA 3L2OB 1ZIPA 1I2DA 5G3YA 1XD2A 2WJGA 2J87A 3IEUA 1KOFA 3CF6R 2FDCA 1IJEA 2HJGA 5KDOA 2QA5A 4ESVA 2C98A 3OIVA 2ZSEA 1S8FA 2ZJYA 3FMPB 3ADKA 3PEWA 4PQRA 1KI9A 1R4AA 1IY1A 1RRPA 4V02A 3VHLB 1GAJA 1P72A 4MH0R 2ZJOA 3THOA 5CDFA 5JRZA 3UPUA 3R8FA 1IN4A 3AVWA 1LY1A 2AWNA 2HUPA 2LCFA 2IW3A 2VP4A 3DZDA 4CZ2A 3QVVA 1KDOA 4C0BA 4IVRA 2BC9A 2H8KA 1P4SA 821PA 1N0UA 1W46A 3CRVA 4RD0A 2DHRA 4URWR 5E95A 4YLGA 4AKHA 2IEZA 4IEEA 4JKYA 3BORA 2YWFA 4XJXA 1S96A 4HATA 2ZI6A 4G3XA 5FR1A 2VRWA 1PJRA 4Q4AB 5EZ6B 2CXXA 4TZ6A 2J0UA 2UKDA 4DRZA 1A2BA 5FOUA 5FTJA 3RAPR 5LPNA 1WE2A 4TL6A 1CJVC 1Z08A 1FP6A 3EC2A 1U0HC 4JL6A 5EXTA 5JBQA 4P4UA 3RANA 1ZW6A 1XPOA 3MWLA 3TNFA 1MKYA 3KKMA 4HB0A 3U7GA 2CBZA 3QEOA 5FR2A 3BERA 3QI2A 4Q9KA 2C5LA 1TF2A 4TYYA 2LKCA 1N0VC 5L8VA 5C1BA 4DLUA 1IY0A 3NEJA 4WZBE 2GHIA 5SZJA 2WJVA 2B92A 2GCOB 2ZREA 1ZM3A 4D82A 5GADl 3THYB 1QHHA 3D8BA 4AY2A 2BV3A 4A0GA 2WKRA 4G0NA 3EZ2A 1TX4B 2WV9A 5HE9A 4M8NE 2QT1A 4TMTA 1N6PA 4DLWA 2ZE8A 4RD3A 1RYFA 2W6IA 4Q7MB 3LXRA 2HEIA 2CCJA 1ESMA 1N6IA 1PLJA 1BH2A 4EPYA 4TLEA 3IIJA 1KKMA 4URXR 1MO4A 4I1VA 4PC6A 4L8GA 2OFWA 2VA8A 3C4JA 4M1WA 1OJLA 3NVAA 5TXGA 2IYWA 2I1VB 1ZAKA 1P75A 1Q1QA 1KK3A 4H9GA 1KIMA 4CYMA 1IHUA 1D5CA 3BB3A 3SJCA 2KE5A 4I1UA 5JLJA 5DYIA 1CF4A 2GZDA 4PAQA 5DI3A 3SS8A 1OV4A 3QNUA 4DCTA 2QROA 3D6TB 3T1OA 1VCOA 3DM5A 4KI0A 5CM8B 3T35A 5JS8A 4GP7A 2RMKA 2VHJA 2CJWB 2FSFA 2O0HA 1WCV1 4OK5A 4U02A 2ATVA 2J0UB 1W36C 4TYWA 4RZUA 3CRMA 1ZUIA 3EWSA 2G9NA 1KK0A 4BE7B 5JEDA 3GLHE 4LPKA 3B78A 3MJHA 1KJZA 1K6MA 4DLRA 2CLSA 2CVHA 2CHVA 3MSXA 1FW6A 2CLDX 1I2MA 2ONKA 4M1OA 3KQHA 1W4AA 3CWQA 1N6KA 5GJCA 2JJ2D 5FH9A 5FOWA 2A3RA 3GFPA 2X19A 2ZUBA 4AYTA 1EG7A 3ZVNA 2L0XA 1D6JA 1G7TA 2JA1A 2K5UA 4TMZA 3PUXA 1OKKA 1Z3IX 3B2EA 2ODWA 4PZZA 3I5XA 4B43A 3LLUA 4NE2A 4JLOA 1M1YE 1XTQA 1I4DD 4RVCA 2O0KA 1L8QA 1F2TA 1R0WA 1TQ6A 4ZPXA 1OXVA 5CLQA 2WTUA 4V03A 2F6RA 4W5WA 4A4DA 3KKNA 1LNZA 3TR0A 3BS4A 3W6OA 4OJQA 2IYZA 2IUTA 4NCKA 4MYCA 5LBIA 1HT1E 4C3ZA 3CX7A 3E70C 3IO3A 4M1TA 2ZRGA 4ZKEA 4DXAA 3IDQA 4XTRA 1XZPA 521PA 2KBFA 2CEAA 1G9XA 1K5GA 3B1YA 3FVQA 4L9WA 5DO9A 4Q7KA 1BYIA 4HYYA 4YMVA 1FTNA 1UM8A 4LHZA 4BWYA 1PUIA 4IOMA 3H0KA 1R5OA 4LK2A 1S1MA 3IHLA 5KDDA 2QQEA 5FPYA 1GVNB 3KFXA 1MH1A 1E0JA 2OILA 1RYHA 4M2LA 2ZS9A 2PT5A 5KSOA 2JLWA 2J7KA 4HLDA 2XX3A 1SKYE 4B48A 5IT5A 3ZH9B 3T1VA 2XOKD 3W3AA 2BBOA 3PEUA 3T34A 1G1MA 1OLOA 3RLFA 4B32A 4AKGA 1BIFA 3OEEA 2D2EA 2H92A 1KDRA 3SOPA 1J2JA 1YQTA 3I3SR 5KSPA 1E9DA 3EZ6A 2MSEB 3IIMA 1F5NA 2Z0MA 2MMCA 2IS6A 5TB5A 1FUKA 2QN6A 1HT2E 4Q00A 1IXRC 1DO2A 5KOYA 4ITRC 1YR9A 3B7GA 2J7PA 4W5JA 5C4MA 2ZYTX 2ODEA 4L9SA 3AVQA 4ZCLA 3VX4A 3CX6A 1G4UR 1XU4A 1KGDA 4A1FA 3UXMA 4Z1MA 1E4VA 1NMXA 3ZD7A 4PTLA 4KCGA 4RJLA 1MABB 3AUYA 3N2IA 1W36B 2OHFA 1N6NA 5B57C 4JL5A 1FZQA 2CVFA 2DBYA 2PLFA 4PX9A 5F9FA 3A1WA 5DYGA 2IXEA 1U8YA 2XSZA 4PHFA 2ZE6A 3QQ5A 3AP3A 2KBEA 3C16C 5L3VA 1XZQA 3RRZA 4KO8A 4N0DA 2IYSA 1TQDA 3OE7D 3L82B 4US0R 2BM0A 4JLBA 3F8TA 3BRWD 1TEVA 3NDPA 4C9BA 5B30A 2B21A 4R9UC 3PITA 4IFEA 5FOTA 5FTKA 3RWMB 4EQ6A 3U60B 5CJPA 1KI1A 2AK2A 2CCGA 4GSYA 121PA 3GMTA 3N2EA 2QTVB 1VIYA 1JAHA 1AJEA 4RD2A 1W5SA 2C99A 4GL2A 1NNEA 1FMJA 2YNMA 5KPJA 2QGNA 4A15A 2EFDB 1N6RA 3LX5A 1WMSA 3H2YA 3AQ4A 2O8EB 5A0FA 2Z4SA 3U4QB 2FA9A 4NBSA 1KDPA 4RFSA 4V0NA 3KQNA 2CNWD 2REOA 3B60A 4NCIA 5AUOB 1S3SA 1ZUNB 4IVPA 2PZGA 1N5KA 1FL9A 1RJ9B 2ZRAA 3GFOA 5AK0A 3PXGA 2YOGA 1DAMA 2CL7X 4O2LA 1OHHD 5DHAA 2RB4A 1CJMA 1YVDA 1EGAA 4LJ8A 1SVLA 5C4GB 5AR1A 3M0EA 1U81A 2ZETA 2DCUA 1VDZA 3G0HA 4HUQB 1G8PA 4JLKA 5L3QA 4OJKA 2F43A 1T8TA 4D25A 1TADA 2IXGA 2Q9CA 2O8BB 2O0JA 3VQTA 4E09A 2ODBA 3U7HB 4TYNA 1R2QA 2ZAMA 1NN1A 1T91A 3AF2A 5FTLA 3CZPA 2Z43A 3VNUA 1NJGA 4JBWA 2ZUCA 2GF0A 1Z63A 2NTYC 2OLKA 3PR1A 4Q01A 3W90A 5FBVB 2YC4C 4DCUA 4M53A 3EAQA 1HY3A 2D06A 3ZD6A 1XX6A 2BKUA 1II9A 4PAMA 2OE2A 4ZV4A 1G3UA 3K70C 1UKYA 2RGCA 1RC8A 1E2NA 1IN5A 1N6HA 4QNRA 4ASUA 1SKYB 1SHKA 3NIBA 3PENA 3QIAA 1DELA 1NBMD 4PSKA 4MYTA 1AIPA 2WM9B 4PC1A 5TVKA 3FOZA 2EFGA 4BPBA 4PHHA 3EPHA 4MRNA 4IFBA 4ON9A 4TLBA 3EW9A 3OFND 2VF7A 2ZVPX 3DM9B 1DAFA 1Z29A 1CR4A 3LRPA 3OIWA 3PUZA 1UBEA 2NZJA 3U44B 2VHTA 3RDPA 4OHYA 1XCGB 1FQJA 1OF1A 1K8RA 3DKPA 5KU1A 3X1WA 2D3WA 1Z07A 4V0KA 5HR5A 5JCZA 1P3JA 3NWJA 3TJZA 1GITA 2ZSFA 5EE5B 3VU9A 2PLRA 2FSGA 2UZ3A 4BLSA 5JJKA 3HWSA 1KY3A 5L3QB 3N70A 1CP2A 4FMCB 3AP1A 4PC3A 4F38A 3A37A 3CH4B 4YQFA 1IJFA 5L3SB 2R44A 1ZM2A 2WJYA 1Q3TA 1P73A 4QBGB 4C0QC 5DISB 2G1JA 4AG5A 2C77A 1XPUA 3RC3A 4FWTA 2NZ8A 3QPWA 2R6DA 2FOLA 3R9IA 2XTZA 3Q7PA 2IHYA 2GZAA 3EG5A 2BJWA 2DPXA 2NO7A 1TQ4A 2ODNA 2ZU6A 3QKRA 3V4RA 1CEEA 1E2EA 3TUZC 3FFAA 3RRMA 4TZ0A 4C0AC 3DPUA 4ZIRA 4JLJA 2EU8A 1AK2A 1AS0A 4BFSA 4PC7A 3B1ZA 5JSZB 3NXSA 5E3HA 1IAQA 5B64A 5J4HA 1EFHA 4Y0AA 1IY2A 3BBPA 3PUYA 5GJWC 3SE0A 2P2LA 1G3IA 1Z6GA 2WOJA 2ZRLA 5DI9A 1E2DA 4JLNA 4MUBA 2XEXA 5CJ2A 6Q21A 1XXHA 5BN3A 1S2MA 4QGFA 4MKIA 1ZU5A 3NBZC 3LD9A 1XFAA 4Q47A 2VSXA 2OBNA 4K8OA 5JECA 3MLEA 4URVR 4BGDA 1M7HA 4HDCA 1G21E 3VU9B 4M1KA 4L4UA 4OHZA 1YZGA 2DFNA 4C0KA 3SZRA 3GJ8A 3KTAA 2EVWX 2J1LA 1X86B 1IQPA 3P4YA 3QVUA 2XXAA 1E2QA 2AX4A 1EX6A 4DJTA 2Q9BA 3CNLA 1NF3A 3NBXX 4LCBA 3AVPA 3A1UA 2WSSD 4EPTA 3BB4A 4NH0A 1E2PA 5AJWA 2BEJA 3AEZA 4M0LA 2AKAB 4JSTA 2WIAA 3ZIAA 1OFIA 3VFDA 1W0JA 1B0UA 2YYZA 3A4MA 2QSYA 4JYCA 3U5ZB 3Q3JB 2WIBA 4LYAA 2NIPA 4LBZA 3BK7A 5EXSA 4DT1B 1FP7A 4KXFB 2PMDA 1CR2A 2JEOA 3QKRB 4MYHA 4E5UA 3G82C 3QEJA 3ZS9A 4DUGD 2GXSA 5FPKA 3B9QA 4NYMQ 4PHTA 4ZIRB 4B75A 4MKHA 2OCYC 3K9NA 3BE4A 3ZYCA 4PO9A 2YOFA 4A8JC 1Z0KA 1G8HA 3ZZUA 3MAAC 1X8LA 2FU5C 2FSIA 2OCAA 1G6HA 3GJXC 2C9CA 1TQ2A 3VR5A 4NZYA 5DLQC 4TL7A 4M9ZA 1W4RA 5K8UA 3HR7A 1LV7A 2CE7A 2HXYA 1VCIA 3AH8A 2OEPA 3SI7A 3WNDA 5TY0A 4Y0VA 2O8FB 3AM1A 1XRJA 2B7BA 3TIFA 4X8LA 2R2AA 4KBGA 1F3OA 3CR7A 4PPFA 1H8HD 2F3TA 4RSGA 4OI1A 1HUQA 3WBKA 1F48A 2HF8A 4Q5IA 4P0TA 2Z5FA 1KSJA 3KTAB 1T4GA 2GCPA 3TE6A 3AP2A 2XXAB 2P6RA 4B3CA 1QHSA 2IF0A 3A6PC 3DDCA 1M6NA 2FEMA 1RRCA 2Y8EA 4MDEA 1OIWA 3EA5A 1QG4A 5FBLB 3SYKA 1WF3A 1XWIA 4LJ6A 1KO8A 4KHZA 4NL4H 1CBUA 2WAYA 1N5LA 2IXFA 4DB4A 2J46A 3NG1A 3UKDA 1DE0A 5C2JB 1G5RA 4A8JA 1GRQA 1QHGA 4XD7D 4PANA 1Y3AA 2QUZA 3WP0A 2QMHA 4ZI3A 3FYHA 4AYXA 1EK0A 4HAWA 4BLRA 3TK1A 2ZM5A 4GP6A 1S0UA 3OAAD 2DWPA 1VIAA 3AF4A 3GPLA 1J90A 3SBDA 3AF3A 3A1SA 4A6PA 1J70A 1OIVA 3P1JA 5M04A 2HCJB 2CK3D 1NIJA 4E03A 2R62A 4B3BA 1JPJA 1N5JA 1ETUA 5FI1B 2OAP1 3SFZA 2VP0A 4QG7A 4UNQA 3UG7A 1E9BA 4HEJA 2ZVQX 4D0GA 1J7KA 1OIXA 5EXPA 5FUYA 2DWOA 2OLJA 2FX3A 2NG1A 3K0AA 1II0A 1E4YA 2ERXA 4OYHA 1W4CA 3OIYA 1DTSA 4TL8A 5IHPA 1HE8B 5CLLA 4QGAA 4D80A 4MGZR 2RH5A 1XEWY 1Z83A 4PFSA 2V3CC 4MGYR 5FUXA 1A1VA 1DADA 2WAXA 2VTKA 3A1TA 1MR3F 4A2WA 3MMPA 4XTCS 3WYGA 4FW9A 1OPXA 5K8LA 2ZPTX 1JEDA 2OFXA 4F4IA 3R20A 4BUJA 3H86A 3CX8A 2GEVA 1KK2A 2QPAA 5JFGA 4P33A 4DIEA 4LBWA 5C46F 1AQUA 2NO0A 1CU1A 1KO4A 2G0TA 4QNMA 3D7MA 3EPJA 2FEOA 3TAUA 2IHBA 3WNCA 2G3YA 3S1AB 4Q18A 3IGFA 3EPKA 4A8JB 3THWA 5BW8A 2V1UA 3EX7C 2R6GA 1KI6A 2ZRCA 5B58C 3K8YA 4IXMA 1T9HA 1G8YA 1XEFA 5CK4A 1CIPA 2IUSA 4TLCA 2NO1A 2GZHA 2A9KA 3WMFA 3DMNA 2QY9A 4H1UA 1WA5A 5TARA 3KDSE 3K09C 2GTPA 3BD9A 2XNSA 4W5HA 5P21A 1AGRA 4LJAA 2J0SA 4GT1A 2GCOA 2ZI3A 5GVSA 1H8ED 3CONA 2QNRA 1YJ5A 5HCNA 1DBSA 3BXZA 4KSBA 4LSGA 3T06B 1RPZA 4O0MA 3K0AB 1A2KC 1KSHA 1GSIA 2QAGC 4KVGA 4O25A 4RY2A 1XCPA 3ZZ0A 3AKEA 3FKSD 1AQYA 1E0KA 3QG5A 1CJTC 4HZUB 5G3ZA 3UANA 3IBYA 4LJ7A 3DEFA 3EZ7A 3Q5EA 3SU8A 1QBKC 4BFWA 4TYQA 3RWOA 3DMDA 3DOFA 4EKDA 4BFZA 5JJLA 4LYFA 4KFSA 1DG1G 1UKEA 1Z28A 1NSTA 1ZD9A 3QSYA 3QBVA 3AVTA 4NYJQ 1Z6TA 4OK6A 3SQWA 3QG1A 4C0SA 1WDTA 2CHGA 5EUQB 2IC5A 5KO2A 2SHKA 2CCKA 4D0LB 4V0OA 1XPRA 4Q1FA 3X1ZA 3N5CA 2CJWA 3THWB 3QY0A 3GEHA 3LVRE 2GCNA 4BLTA 2IX3A 1KI6B 1DAIA 4TMVA 1F2UB 3K09A 4LV8B 3B1WA 2V6JA 2JLXA 4BZPA 2QBYA 2B8TA 4Q7JB 3ASYA 4NCJA 3CNOA 3QPVA 4EUNA 5CIWA 1GG2A 1R8SA 4HB2A 1IBRA 5FL7D 3FHOA 3B1XA 4DHEA 3GP8A 4B3GA 3VR1A 3MJRA 3HR8A 4JSYA 3SFVA 2QAGA 3IKJA 2XZPA 4TT3D 2V7QD 5AJYA 2IA5A 1E2GA 4DEYA 3SN6A 4B44A 1P5ZB 1Q22A 4DDVA 2A30A 4TQ9A 3TH5A 4UJ3A 2F1JA 2V6IA 3AKDA 1G8FA 4JVNA 1QZXA 1N6LA 4PR0A 4PSAA 2YV5A 3FE2A 5AJVB 1ZYUA 2JCSA 1P2VA 3FWYA 5FBQB 2JJ2A 1GFIA 1FOEB 4NYMR 4HSEA 3I8XA 1U9IC 2AHOA 2C8VA 3LFUA 4GBMA 2BCGY 2VHUA 3EZFA 3K0EA 3AVXA 4M9SA 3GEIA 3M4YA 5DIFA 4C7OA 2BMDA 1OYYA 2HCBA 1VTKA 4KSCA 5DNYB 1P2UA 4AKEA 3HYRA 4UNSA 1MRSA 1II8B 4L15A 5AJZA 3VTKA 1YR6A 2HYIC 1MT0A 4YMTA 3R9WA 1QF9A 2B7CA 4B3XA 4LGMA 4I81A 4ESHA 2D7DA 2DFTA 4FIDA 2JLYA 2XTNA 4KVAA 1UADA 2GXQA 1GL6A 1AS3A 1E94E 2PEYA 3BB1A 1WRBA 4F4JA 2W2TA 2ECKA 2IWHA 4UXJA 1R8QA 1R5BA 1Y63A 1SVSA 3SEAA 2QBYB 3AVVA 4B76A 2XB2A 3SBEA 2OBLA 3Q5DA 4A92A 1NIPA 2BKEA 2GJAA 2N1BA 2RGBA 1GRNA 3DHWC 2GXUA 4CF7A 4JMPA 3VKWA 2YKGA 2QAGB 2FWRA 2EYQA 2GNOA 2YC2C 2GA8A 2QTHA 1XEXA 1W2GA 2VPPA 4QHYA 4TMKA 2EFHB 1U9IA 1OB2A 1G6OA 1UEJA 3CH5A 1UDXA 1ELOA 2ZSDA 1H65A 2Q3FA 1G3MA 1N3BA 3P20A 2ZR0A 4LDJA 4PPGA 1G8GA 2XOKA 1Z06A 2FPMA 1Z6AA 2W00A 3PCRB 4OQMA 1X8JA 2BVNA 2JJ1D 3ND9A 5JJIA 1E1QA 4C7OB 5KDLA 3FB4A 4HAXA 3WRYC 5KYKA 1S3GA 3VNVA 4WZAE 1L7VC 2IWRA 2HLDD 1MABA 1XMIA 4IDOA 2JGNA 1HE1C 4HLUA 4HZIA 2BBTA 4K46A 3JZAA 3JVVA 4US2R 1WQ1R 1P2SA 4YXWA 1KAOA 3LWNA 2F9LA 1AZTA 3TMKA 4OKSA 1SXJE 2QG6A 4HDQB 4A0HA 3REGA 3VR2A 1P9WA 2BJVA 2FPKA 4KU4A 3T5DA 3GJ6A 4ABYA 3LQQA 1OE0A 5TV2A 5A5GA 2OM2A 2V4ZA 4OQFA 3TKLA 3LW8A 4NMMA 1I4LD 1GNRA 1GL7A 1EFRD 1MO5A 2PCJA 3TW8B 2G77B 1A82A 1W7AA 1T5LA 1E9EA 1UKVY 3CPEA 5EP1A 1W47A 2R8RA 5E7MA 4EPXA 2J59A 3GLHA 4BFYA 2B6HA 2H7VA 3KJEA 4FCWA 1Q21A 2Q9AA 1D2MA 2FE4A 1E9CA 1HURA 1E9RA 2GRJA 2VLIA 4AWXA 5G40A 1HH4A 1SVWA 1XD8A 3QF7A 4E22A 3A4LA 4WVFA 4HAUA 5BQ5A 4AI6A 1E1QD 3OE7A 1XEXB 4GDFA 1GILA 4CEIA 5J4YA 4B73A 4FI3C 2HV8A 3RSOA 2O8EA 1Q1BA 2AXNA 2ZRMA 2O8CB 3U4QA 1YR8A 2V8OA 1OXUA 2C96A 1YKSA 4EFNA 3ZQ6A 3RS5A 1Z5ZA 1A7JA 1KKLA 3VMFA 5IRCD 1N25A 4YXWD 2JLVA 3A4NA 1TUEA 3OEHD 1NBME 4A82A 1RJ9A 1ANKA 2OZEA 4XWAA 1IN7A 1X3SA 1FNMA 1YRAA 4IW3B 1KI7A 2O8DB 3CF0A 2G0NA 3RRNA 1JECA 5J4LA 3T5GA 4LPSA 1K5DA 4HUQA 2NO9A 4XVUA 2CNWA 1T0HB 1VG8A 1VECA 2GWHA 4CGZA 2QSZA 4RD1A 5G53C 2E1RA 4LHXA 3RABA 2O8BA 3WMEA 2W58A 5LB2A 1GKIA 1OHHA 1VHLA 3FMIA 4UKDA 1Z0DA 2NOAA 5D3MB 1KI3A 3U6BA 2GJ9A 2E9SA 4TQAA 5GJVC 4QKQA 3IEVA 3AF1A 2WBLC 1HEIA 3QKUA 3GLHB 1AA9A 3RS7A 3W9YA 3THXB 3TUJC 1G16A 2I4IA 2ZS8A 5BYKA 4MRVA 4P4TA 1ZM9A 4B34A 4NYJR 4BFTA 2VYFA 2QEQA 3W5JA 5KSYA 4NCNA 3K0SA 4BLQA 2IL1A 4BQSA 1Z0JA 2RHMA 5GVRA 3BC1A 4QHSA 3SNHA 1GIAA 4DSTA 3SYLA 2P6UA 5GJBA 4CEIB 3ONWA 4NCHA 1G7SA 5IK2D 5HE8A 3T1TA 1L4YA 8OHMA 2JJ8A 2Z4RA 5KPDA 3P4XA 5CITA 4Q02A 3IHWA 1JR3E 4FMDB 5EE1A 4Z54A 3I92A 3U44A 3HU1A 4LC1A 4AKIA 2ZI5A 3EWAA 3KJIA 2AXPA 4GI7A 4RCZA 1IN6A 4Q4JA 2PCLA 4ARZB 1E6CA 1CRPA 4DEXA 1SXJD 1NBMA 3EC1A 4R7ZA 1W44A 2DY1A 4YDHB 1TNDA 2BM1A 1KJYA 2REBA 1VG0B 2YWHA 4HLCA 1CTQA 3A36A 4MYUA 1KY2A 3OFNA 3CF2A 1J8YF 2QMEA 3LVQE 1KO1A 2JLZA 1XJCA 3TQCA 2BWJA 1E2HA 4MKGA 4Q4LA 4AD8A 4J0QA 1GNQA 4KYIB 3TQFA 5L3SA 1LS1A 4U5XA 2C9YA 3LY5A 2AD1A 5CB6A 3K9LA 2FFBA 3ZVLA 3IQXA 1SXJB 4M4SA 1TF5A 3WYAA 1G19A 4A6XA 1T6NA 1UEIA 1Z0AA 4QGGA 3IILA 2N46A 4D4LA 3VR6A 1DAGA 4A2PA 1NN5A 1CKEA 1UFQA 5JZVA 1UDWA 1G20E 2WPDD 3X1DA 2A5DA 4M21A 3KUCA 4FMCF 1AZSC 4ACAA 4TYPA 3QPUA 4MGKR 4MKFA 3ADCA 2VBCA 3O8CA 5HZKA 1NLYA 3B13B 4JVLA 4HAZA 4ERNA 1TAGA 5HKKD 5FFMA 2IT1A 4GOJA 1ZIOA 2PEZA 4HDOB 3UMFA 5JSZA 4RZ3A 3NBFA 3PV0A 3C5HA 1KDTA 4YMUA 4KLNA 4UNRA 3QKSB 5C18A 2BIFA 4PZLA 1R0XA 1F60A 3KQKA 2GJKA 4AIIA 3QUSA 3FMOB 3MWYW 3ETLA 1GKYA 1KK1A 3OF5A 4B2IA 3VAAA 1NG9A 2WJIA 4Q4JB 4X8MA 5F3WB 3PIRA 1D2EA 3KQUA 2RGEA 2ZS7A 2Q6TA 4NP6A 2OCPA 2HYDA 1US8B 1WBBA 5DSZA 4M1YA 2GEUA 1E2MA 1G3QA 1QDEA 2VHCA 2OCBA 3CR8A 3F3YA 2GXAA 4LI0A 4DBLC 4JJZA 4LJ9A 1FMLA 4LUCA 5FI0B 4KV9A 2HT6A 4HI0E 4LC0A 3C8UA 5A4JA 1U8ZA 2P67A 3LQRA 2MSCB 1FQKA 4DLSA 2BBWA 2WOOA 1BOFA 3ZS8A 1CR1A 2GK7A 3KUDA 3LBIA 2NPFA 1RVDA 1RRFA 1RRGA 3EASA 3LAWA 1KI8A 4G5SA 4URZR 4DT1A 4OHXA 1OFHA 2GKSA 1DAHA 1C4OA 4LWZA 2QP4A 3V00A 2WSSA 2X8AA 4Q9IA 3TUIC 1JPNA 1IXSB 3HPRA 4GMDA 1W2HA 3REFA 5F98A 4JT4A 5H1YA 3MUFA 4JZKA 1JR3D 1TU4A 3WHLA 3KKPA 1W1WA 1IXZA 5JWHA 2KWIA 1T0JB 3BH0A 5AUPB 2HXSA 1G17A 2WWGA 4PO8A 2BOVA 5FBRB 2V54A 2EFCB 2YHSA 1OFUX 2W2XA 4EJSB 3GLGE 1GOTA 1Z0FA 4DUGA 3I73A 5H8WA 2O8FA 3BFKA 1KTVA 5JI2E 1OB5A 4FXPA 5KUTA 5DN6D 2NO6A 1QG2A 1KI4A 4XWOA 1ODFA 4P32A 1EWRA 1AKYA 1E1RD 1YZLA 3AUXA 2YVUA 1MO6A 2C95A 4RZ2A 1NI3A 1L4UA 4AURA 1G18A 2YWEA 3AV0B 3RVBA 4RKEA 3R9XA 4R71A 3CNNA 2IYYA 4CW7A 2H1LA 1H8HA 2GK6A 4QFMA 2F1RA 1X1RA 1TMKA 2H5EA 1E0SA 4FCVA 4AK9A 3C41J 2VF8A 4D26A 4JBXA 3K70D 2ZRPA 1JEEA 1BO6A 3LXXA 1B23P 3GFTA 4TMWA 2FZ4A 4XH9B 4LV5B 5CYPA 2ERYA 3ND8A 2XTMA 1FFHA 2D74A 3OIUA 3NKVA 4Q7LA 4A0RA 2UVQA 4TLDA 1M7GA 2OAQ1 3O8DA 4O3MA 4FMBB 3TVTA 1JBKA 1BYUA 1FX0B 3ZVRA 2QE7D 4S2EA 1ZCBA 4Q9LA 2DB3A 5FPSA 4EPVA 3RC8A 1ZP6A 2FFQA 3LV8A 1DG3A 1YU9A 2PZEA 3MRSA 4POAA 2JATA 1O3YA 1ZC4A 2FZLA 4UNPA 1QRAA 3W34A 4M1SA 3QF4B 2OT3B 4XD7A 2IS1A 1NN3A 3PUVA 4F7WA 1ZC3A 1ZNYA 1NJFA 2F3RA 4LBYA 3SJZA 3W6PA 4QGHA 4V0ME 4Q19A 4XWKA 2CDNA 3OAAA 1G5TA 3K0CC 4QHTA 1XJQA 2ZROA 2D4HA 1DOAA 3QENA 5SZHB 4KAXA 1KSFX 2EQBA 2CK3A 1VHTA 4DSNA 5EUMA 3LW7A 2GAOA 2PX3A 4Z51A 3AGQA 2E87A 4NYIQ 1OH5A 1JR6A 3LO5A 4LJ5A 3EIHA 3UWOA 1R6BX 2PJZA 4QJ5A 1GM5A 3GLIE 4JLMA 2OBMA 2PT7A 2ASEA 3RS3A 3SJAA 2W6JD 3L8ZA 3PUWA 3BFXA 1ZM7A 2XB4A 1N6OA 4B33A 2BMJA 1E3MA 3R7WB 1RKBA 3S1AA 2VIIA 3EZ9A 3ADDA 2A5YB 4H1VA 1XD9A 3Q8XB 4Q4HB 1CRQA 3X1XA 1M2OB 2FNAA 1J99A 4M22A 2FGKA 1WBDA 2JDID 3VR4A 5KNBA 2AFHE 2WKPA 4WZ6A 4EPWA 1E2IA 2AN9A 2NPIA 2GAAA 1CJKC 1P7CA 2WZQA 1M74A 1Q1EA 1Z6XA 3PEVA 2ZYVX 3A58B 2WWFA 1XBTA 1COWD 2WICA 4A36A 5EXXA 2F1IA 1JAIA 1EFUA 1E79D 1XEWX 3X1YA 4PO1A 3TAHA 3K0CA 4OQXA 1U99A 2YJTD 1U0JA 3W5IA 1IOZA 3A8TA 2ZI7A 4CT4B 4GMXA 5EE0A 3ZDQA 2FPLA 1VYTA 2Z83A 4GRAA 3KB1A 2ZANA 5LDDC 2QM8A 3GLGB 1ZNWA 2ZUDA 1EFCA 1EWQA 1FUUA 2QORA 1G7CA 1ZRHA 2VP6A 3Q9LA 3TRFA 4IOLA 4IDPA 3JZMA 1DAEA 4HZUA 4QC2A 2YOHA 1GDDA 4YDSA 3I1FA 3BOSA 4GZLA 4F92B 2XITA 2XNDD 1H8EA 2CE2X 5FOVA 1YZUA 2IK8A 1Z2AA 3B9PA 3Q72A 5J47A 3R8CA 1KJWA 3QXXA 2R9VA 3RS0A 3L8YA 5EP3A 2JIZD 2I3BA 3MGCA 1U0LA 1LW7A 4D4KA 2IYRA 1R5NA 2WHXA 1G5PA 3FKSA 2IUUA 3GLIA 4Q1BA 1YZQA 5KSZA 2HT1A 3L0PA 3HU3A 3IIKA 2ZQ5A 3KXKA 5CDFE 2ZEJA 3K9HA 4WXPA 3QXJA 2J5XA 3WHKA 5JCPA 1M34E 2QRZA 3H84A 4U00A 1E9FA 1UAAA 4G5RA 2J45A 2QP3A 1F2UA 2QPOA 3L0SA 4DCSA 4PHGA 2ZI4A 2P6NA 4JLVA 4W7SA 1OT3A 1DAKA 4W9MC 4HB4A 4LX0A 2ZRHA 3EIQA 1NRJB 4OI2A 2ZAOA 2MSDB 2IS2A 5IF9A 4OHWA 1TPZA 5D3QA 3H4MA 1GL9B 4BRWA 4ZKDA 3W3ZB 2C2HA 1LFDB 1RFLA 3KL4A 5BN4A 4MRPA 4QM7A 3I32A 2QGZA 2QAJA 1LTQA 2ZITA 3IO5A 2WWWA 1R0ZA 3B8HA 3ZGXA 5DE3A 3WY9A 2VH5R 5FL7A 2PMKA 4GFDA 2QENA 3W8RA 3UIEA 2FV8A 2EFEB 3MFYA 2QMUA 4KFTA 1UKZA 1KMHA 2VP2A 1BS1A 4Z8YA 4TT3A 2V7QA 2W0MA 3I4LA 2QMOA 4TN1A 3U3OA 2JLQA 1EX7A 1NN0A 5E7IA 2X2EA 2ZRIA 2QT0A 3AKYA 1AS2A 4PC2A 4TWZA 2P5TB 1SQ5A 2LWIA 1II8A 3CRW1 3RRYA 3MG9A 5F9HA 1S1CA 3GLIB 1HV8A 4G5OA 1FPMA 3GJ3A 1I4TD 3FMFA 3OESA 4CEJA 1PUJA 4CRWB 3L0IB 5KHOC 1NLFA 1DPFA 2D2FA 2H16A 3QE0A 2OG2A 3MWKA 3U6KA 4Q48A 4NPHA 3U7EB 1S9DA 4C4PA 1W49A 2XJ9A 1Z22A 2FF7A 3NHBA 4XIGS 1P9RA 4QRHA 1YZTA 1RZ3A 3NTUA 1SVIA 2J41A 2HF9A 3ICEA 3AF0A 1QVAA 4PSVA 2VSFA 1BMFD 1W0KD 4FD2A 5EJEA 1DS6A
chains in the Genus database with same CATH superfamily
4A03A 3KE9A 3BMOA 1N57A 3L4SO 5B7QA 4MQFA 4RANA 1LPOA 1QV7A 3MWDA 2BTQA 1W5FA 3ZIUA 3PIDA 1L1FA 3Q8KA 1WG8A 5E7QA 4MVJA 3BE5A 5P8WA 1FTSA 4HFNA 1G2PA 2HDWA 2ZRDA 3Q9UA 2AEFA 2RDMA 4A6EA 5DNCA 9LDBA 2FF5A 1M2KA 2B36A 1UINA 2YWGA 4Q16A 1S2LA 1WTAA 1DUIA 1ZLXA 2LV8A 4N0MA 3P9PA 1WOYA 2Q2OA 2WNIA 3V1LA 2WD7A 3FDZB 4ZGBA 3OA0A 5BSUA 2YZKA 1BD3A 3R0IA 3H99A 2V6GA 1EFAA 3MUNA 4IM7A 4JP2A 1XD2B 5ARBA 1XVVA 1E9AA 3DC7A 4V1CA 1ULSA 2GYUA 1G66A 2R5NA 3GVIA 2EW2A 3S40A 4GECA 4DRXB 1OX6A 1P7YA 2FWIA 4DSAA 4ZDIA 4CEJB 1WPGA 3ANXA 3LGAA 3NC0C 3PHGA 4Q7EA 5K0NA 2JJ1A 1KYQA 5DHFA 3B7WA 3V1NA 1CS4C 1VKOA 4C3UA 1M6HA 2GBCA 3LLMA 4HB3A 3KOZA 1G291 5JXJA 2D0IA 1OC2A 2ZTUA 3ZCSA 4B6OA 4EA7A 1Q91A 1F4VA 3D5TA 2FETA 4MWSA 1SC9A 1JQLB 1U8CB 4NYIR 3RYFB 3DJFA 3KDPA 1M2FA 4YLYA 3CM0A 1SUDA 1CIJA 1C9YA 1NPDA 1PJ8A 4J2OA 4M9XA 4YPOA 1U3CA 1XNJA 5HM8A 1WB6A 4IVQA 4D0NA 4JBIA 1H85A 4DA9A 1V48A 3K9GA 1M75A 5BNFA 3X43A 5HG0A 2DFLA 2G1KA 4MQFB 1PCXA 1UCFA 1GNLA 3I61A 3MWDB 5CVTA 4BLWA 2A5GA 1HDEA 2G40A 2O2IA 4LTMA 5HCIA 3T3EA 3UMSA 2CXUA 2HLPA 4D8VA 1H42A 2BDTA 3FF4A 1RBMA 2H31A 3HSKA 3LLCA 4M6WA 3W5SA 4JS0A 1ZONA 4B5LA 4ER6A 1ABBA 3UXEA 2A5JA 3MJFA 2JI7A 4NMXB 2PBRA 4JBYA 3UMCA 1ESCA 2TS1A 5IANA 3AZPA 2AEMA 1WL8A 3QKTA 1O94D 4BOYA 4BZQA 5BWCA 3KJZA 4YUYA 2OFOA 3BFVA 3PRJA 4FGSA 1CQWA 1WULS 2PRIA 4M9CA 3JTMA 4IX1A 2WD7B 3H8SA 1A2QA 3L77A 5F2OA 3TPCA 3ZDFA 2QP9X 1IZ7A 2E89A 4J7UA 1H69A 3FZNA 2UAGA 2WF8A 3KK0A 3WQQA 1RCUA 3DBRB 4RX1A 1ZD1A 1H5NA 4UULA 2QVXX 4FHFA 1BCRA 1ZKDA 2X7JA 2V1XA 2W0SA 1XDGA 2BCJQ 4Q12A 4JC8A 5FBWB 4ALNA 4TQUS 4ILEA 1REQB 1OASA 2W98A 3OEHA 3TGLA 3QLUC 4GC9A 4FYJA 1FDRA 3VNRA 3G88A 4GNRA 1JB9A 1RXEA 1E7MA 4BFUA 3CLRD 1QHNA 4MUAA 2IV7A 1THTA 2B8EA 2QL9A 3FUWA 1R10A 4N8DA 1HYBA 1RBYA 1C8KA 1ULBA 2R96A 4NV0A 4QVKA 4YIKA 3JVDA 4F5WA 2W90A 1CQJA 2BR3A 4EIWA 2FEWB 3SDBA 1C8LA 4OK3A 5CRIA 2OQVA 2JVKA 3CVXA 1SXJC 1P17A 3QH4A 4Z7NB 5FWYA 3PQCA 1XROA 5H68A 3PXCX 2HDOA 4B82A 2C07A 3GAAA 4OU5A 2ZG6A 4BMZA 1OAAA 3HACA 5KYNA 3ZWAA 3ML1A 1UM9A 1VJ1A 1QCDA 2ZB4A 3E5HA 2B61A 4RVDA 1C80A 1FNCA 4D4IA 1QGYA 1R8XA 5G1PA 4G41A 5IM4A 1HYGA 1DFGA 4FNAA 1U3FA 5IDWA 3QXSA 4UQOA 3PGKA 1RAHA 3NH6A 1LB1B 1A4RA 1EIZA 1FX1A 2GDZA 3HZZA 1ML3A 4ENSA 2H4HA 2Q29A 4WOKA 5LDGA 3MJTA 1G5FA 2YYSA 2QPTA 3W5HA 4S1WA 4ZAGA 4CG1A 4BVEA 5KJ6A 3BWCA 1G9SA 2HJVA 4E11A 4YCMA 1JJIA 2NGRA 3AFNA 4RKQA 3Q7QA 4O2AF 1NFQA 4JJEA 3RLIA 2DSTA 3U3MA 3LX6A 3NVKI 5JZMA 2R4UA 1ADYA 3V2GA 4CM8B 1LV8A 1HQYE 3DNFA 2F7SA 1QWSA 1X87A 1MOPA 3PX2A 2W6ZA 2JLRA 3A6LA 1XDSA 3PPXA 1Z0IA 2WHRA 4Y9UA 1PNTA 4WQMA 4YJGA 1OXXK 3U3RA 1JAZA 3G2HA 3F67A 3DKVA 4FNMA 1E92A 3QLUA 4YJDA 4DWWA 5A4DA 2D0PB 1LBIA 1M7BA 2PKEA 5ALIA 3N0VA 1Q3KA 3E9QA 2QUBA 4K9NA 1U8AA 2ZM6B 1BCRB 1F2TB 1U7WA 1HFEL 4IEFB 3WQHA 2SKEA 5A62A 1Z62A 2Z56A 1Z6YA 2GD0A 2VQSA 3QELB 3KHTA 4FFBB 2V59A 4FMDF 1DIRA 2IQIA 1I7QB 3VU0A 2ZSBA 1UP4A 5FBKA 3HZHA 2IV2X 5JZOA 4FD3A 2QJFA 1SXJA 4JKIA 3R5TA 4WUTA 2PSFA 4U63A 2EP5A 2NQ8A 4WE3A 2J0QA 3WRXC 4OI4A 2ORIA 3C43A 4YNBA 4LF9B 1O2DA 3G79A 1VSBA 4AKTA 3MELA 1R37A 2OB2A 3LS2A 2Y1KA 2PWBA 3CNQS 1ADBA 3OWHA 4Z86A 2FYTA 3W04A 4RESA 1DOZA 5FWYB 4HN4B 2EBHX 4IXNA 3T0IA 2IBTA 3D4LA 4P7KA 1P6UA 1VCNA 5E9QA 1BXZA 3FNEA 3TJMA 3QX3A 1Q1AA 2XT6A 4H7DA 1GDHA 3IS3A 3ZCRA 1HLDA 3NBKA 3F7MA 4I5FA 2HPZA 4NG5A 1UM9B 4D9FA 3ZI4A 4DZTA 4AMVA 2F90A 2W2LA 5LQCA 5THXA 1BKDR 3UJPA 4RXTA 3V55A 3ID6C 2I6QA 4RL6A 4F21A 5BN5A 5JAMA 3W3AD 3ZDAA 3OJLA 1V47A 4GBED 5DGDA 2HHLA 5JHGB 4QM6A 1Z73A 1C7IA 1A1SA 1FTWA 1NF9A 1TMYA 2FXIA 1E18A 3GC6A 3FLMA 1D2NA 4L6CA 4EMUA 1G98A 4LSZA 4EBFA 5KCZA 1FU4A 3D3JA 2PT6A 3L4BC 2JNWA 1IH8A 3ASZA 1T13A 4AO6A 1T9AA 1DDGA 3NUQA 2D1SA 2C5SA 1Y8QB 3DMGA 4ZTZB 2P2NA 2XBLA 5HKKA 2J6HA 2WTEA 3BULA 1ZSNA 2TMKA 3KYCB 2EKPA 4IIJA 1LF5A 4YJGB 4M7OA 4DSOA 4HNSA 4P7FA 5GY7A 3Q85A 4KQGA 5CLIA 3PNLA 2CN1A 3BTVA 3GEEA 5KNLA 1RKUA 1UMDA 1WP9A 3PT9A 3WRXA 1DIAA 2J9YB 3NM5A 1D9ZA 3C70A 4BE9A 2IVFA 2PS9A 1KQPA 4FS8A 5KOJA 5LIRA 3DD1A 3L06A 2HDNB 2VUIB 1KTIA 1J6UA 3CPHA 1YR7A 2F3PA 3QVLA 1Z18A 1DJNA 4CCSA 5K2OA 1R6TA 1R0BA 3SDZA 1R3UA 4MPTA 2Q62A 4D99A 1E98A 2EYUA 4IHJF 4UZSA 3WGMA 2ID9A 3W77A 3ILHA 3AR9A 3CUWA 3O0DA 2ZDQA 4X62B 1U9JA 3B5JA 4LSMA 3WIEA 3GFSA 4LRWA 1O87A 1EKXA 1RW4A 3NIFB 2D0DA 1TUGA 4YBZA 4C7VA 3LI2A 4N4AA 3IVMA 1PX2A 2NSLA 4TLLB 4Q9HA 4G84A 3T38A 1G8KA 1L5OA 2IYTA 3BWVA 3HL4A 2DG2A 4NAVA 1DEXA 4QPJC 1JKJB 1Z8FA 4XSVA 4E94A 5BN5B 3MTDA 1RZUA 2XUOA 3UWKA 1Q44A 3L4BA 2ZJ8A 4TV9A 1QORA 7MDHA 5FQOA 1ZVQA 5TEVA 4D3FA 1T8SA 2VEDA 3LYHA 1XDZA 3CTMA 5EXDA 3A1VA 1Q0RA 3TNLA 3UHFA 2C04A 1M2JA 5A2GA 1DOHA 1KA9H 2FG7C 4BO7A 2GRAA 1UJBA 2N47A 2Y77A 3EFBA 4TUYA 3TLXA 3UGQA 2DLNA 2BUBA 2JPDA 2MYPA 4A8TA 2BR4A 4IF6A 2NV6A 3KJNA 3O8RA 1T0UA 2R79A 5DULA 4L6IA 3WLNA 1CDEA 3GZ4A 4OOEA 3FJ1A 1B14A 3I2HA 3OKAA 3BIFA 4EL0A 3T1YB 2AKYA 2JKZA 4WLUA 1W4BA 4MVWA 1EK1A 2JAUA 1Z2PX 3RSLA 1NX9A 5AUQA 5FO0A 4L75A 3F46A 2R6CA 1KS2A 1OXTA 1BGXT 4LOHA 1T25A 4YGXB 4AC9A 3OTQA 2WJZB 3IP8A 4J03A 2B4KA 3C14C 4DV2B 3JQPA 3P9RA 2QI9C 5KOJB 3FPAA 2VNJA 1PLKA 1T1IA 5JAQA 1GAEO 4F4CA 2C4NA 1SUAA 1XB2A 5F64A 3FD8A 4C78A 3QOYA 2Y1EA 2YXBA 4JLPA 1ENPA 2GVZC 1HRKA 2Z57A 2YCLA 4E13A 2B1IA 3BFPA 2ZYUX 2VPWA 1NVUQ 4K9OA 1OYOA 1YRYE 4MJXA 3PRHA 4UM7A 1F12A 4KYUA 3PFWO 2HIGA 4HS4A 4QQRA 4KUEA 1CDZA 3C7KA 4XSGA 2GEKA 5ARCA 1L5KA 3ZWXA 5JAOA 4FZRA 1G20A 5JSUA 3CJTA 3L7AA 5L6LB 3I9LA 3W06A 4WCVA 2CXHA 4TSFA 2D54A 5KYYA 4PHCA 3IFSA 1J7JA 2O50A 4TV9B 4GGMX 1KEKA 4XOUA 2MSLA 1ZJ6A 2OV2A 3FPFA 3NYQA 2JAXA 3UUFA 5HOQA 4D96A 4FJ2A 3GFQA 3ZJYA 4DCVA 1NHWA 1RIFA 4DQVA 1HX7A 1VCHA 3T15A 3PIIA 1M8GA 3QF4A 3UJBA 2AD5A 2X15A 4TUYB 4S35A 2CSXA 2OCIA 4G97A 3ESDA 4FOSA 2PH1A 3ROKA 3K1JA 3VR3D 2XHEA 4FKMA 1EXMA 4WA7A 3MGBA 4MI3A 4ZK2A 2H18A 2PMWB 2FVYA 2QE7A 1YAJA 2L82A 3Q6MA 2HB6A 1IPFA 4QFCA 5CH3A 4O5AA 1DVRA 1LI7A 2OXEA 3ET4A 5K0CA 3U61B 1MJNA 3E05A 2WHQA 1K3TA 4K6OA 2UXCB 3BMNA 2Z8YM 6AT1A 2EX1A 2PX6A 3LT5A 4ZDKA 1WZCA 1PFYA 4LJLA 5K09A 2ZR9A 3M4XA 3ELUA 4ZAXA 1LK0A 5EIBC 5BSVA 5EZ5A 5SICE 3UV3A 3W5CA 4DDMA 3JWPA 2C7BA 3VKFA 4TMXA 2FQWA 4UTXA 2FPGB 1K6IA 3DZ8A 1JLHA 1G63A 3NIGB 4NKRA 1HNXB 1ETHA 3ZJ5A 4IEIA 2WWHA 3D6UA 1TK9A 1UMBB 2NXWA 4JVSB 2VDWB 5E3JA 3H1TA 4FTWA 4BGVA 4BQIA 1UQTA 4XJTA 3IAM1 5JOQA 1M0EA 4YACA 4K6GA 5K3DA 4C0LA 3CCCA 2OP0A 4L07A 1LVUA 2G9ZA 2X0FA 1JJAA 1UPBA 4G0VA 3TLYA 4QFDA 1RLUA 2IYLD 3AM5A 3ZDZB 3CLUC 4ITVA 3SQDA 5DM2A 3TBKA 3LC7O 4W5QA 3X44A 5DGCA 1E69A 5THKA 5AIBA 5JFOA 1AM4D 1B43A 1MUUA 2IYVA 1Z4MA 1JHXA 2O6HA 3N3AC 4KWCA 2FTKE 4EG1A 1W9HA 2OSBA 5KYYB 4WN9A 5DVZA 3TQQA 2NQ2C 1BN6A 3ESXA 1CVRA 3OKFA 3PBKA 5H59A 4F2HA 2XKKA 4DR3B 1L6IA 4UDYX 1T3HA 4YV2A 1T9BA 3FUTA 3N74A 3K70B 3KSDO 4Q9DA 3U0BA 4O4LF 1DCKA 1DBIA 4IAOA 4ISBA 3E8SA 4CCAA 5BRAA 1PWEA 1K7SN 2AR9A 4ZT5A 4CGYA 4MB6A 4DREA 2ECFA 3E0XA 3RRFA 4BLPA 3O95A 4ZAFA 1KETA 2OZLB 2JDIA 2RC6A 5A5DA 3GLGA 1JDNA 1PYGA 2I4NA 4RNDB 16PKA 3ETHA 4BV3A 3KZNA 3PDJA 3QU4A 1J5EB 4TN5A 4GSKA 2HMYB 3LBHA 4F5ZA 2JFYA 1SVKA 4UOQA 4TQGA 2ZWOA 1YZNA 1X8KA 2MYUA 2P4QA 3F9IA 5CT5A 5J2TF 3BMNB 4V3CA 1I30A 4ZO4A 1TIPA 1VXRA 1WPRA 3EUFA 4ZZ1A 1KEWA 2Q6KA 1E79A 4J4BA 2OBBA 4JX8A 2ESRA 5BO5A 3S5JA 3T3PB 1HTWA 5HRUA 1PR6A 4UHJA 4NPCA 2FEXA 2ZJ2A 1QPGA 2O52A 2YINC 3LHFA 3MTAA 5F2EA 3UK0A 3VMMA 2QM7A 1XXHB 3JS5A 4PLCA 1B93A 1D09A 2VATA 4HC4A 3ORFA 3GIDA 1UJ6A 3IQFA 4O02B 1J06A 3S0JA 4Q7QA 4RF2A 3WYNA 4CL2A 2VT7A 5J5CA 1ECLA 3P96A 4E5SA 3BMQA 2N75A 2RKBA 4W8HA 3F6PA 2ECPA 3ASUA 3R24A 2FI1A 4E3WA 3IP5A 2ZRJA 1RE0A 3AINA 1IPEA 1PZEA 3L1JA 2ODPA 3G49A 2C3PA 4HDKA 3SHFA 5KYGA 3NP7A 1E32A 1DARA 4PG6A 4OH7A 1TB4A 4QYWA 2IYQA 4TTPA 1G2IA 4PGMA 2ZSJA 1DC6A 4HAIA 4OBEA 5JWOA 1K89A 4FWIB 4US1R 1Y3BE 4BKRA 1IONA 5AT1A 4KQ6A 4X92A 1AF7A 1LS6A 4F71A 5IPFA 1WPXA 3BPSA 4O2RA 3W2GA 3KSMA 1QIKA 3WLHA 1LPMA 4R2LA 4CIDA 4D4JA 3C98A 5FPQA 4YONB 4QICA 4OB6A 1O54A 3LX4A 3HFSA 3EH1A 3LSTA 2PBFA 2V7GA 4I08A 3FYTA 3JYLA 4PONA 3PEFA 4WJZA 4D92A 2GJ4A 5EG5A 1FEZA 3IODA 1E9SA 4TRRA 4OCZA 3IUEA 3I64A 3OQIA 1IG3A 1UF9A 1XTJA 2O2CA 2YV4A 2B4QA 3HZOA 4CETA 2C03A 3H5OA 2HV9A 3IAS6 1VL6A 3H9JA 4X1YB 4EY7A 3CB4A 3H3FA 3E9YA 4RGVA 5EMNA 1JHUA 3OZGA 1LSSA 4PCLA 4QWWA 1NT2A 1A98A 3A6KA 1H2EA 5FTMA 4DQKA 4G1VA 4FHDA 1QIJA 1D9XA 4ZVTA 1KKUA 4JOSA 3GQBA 3GLFA 4XA8A 3MWJA 4B6PA 4V0LA 2H3EA 4DKXA 4ZYTA 4HWSA 4TRMA 4QRDA 3T4PA 5ALXA 1L4FA 4G86A 4MI9A 2X58A 3QUQA 4URUR 3DOEA 5CIQA 3PGJA 4RGYA 3QUCA 4B7AA 2IY7A 3H2SA 1H6BA 1IM2A 4PFQA 1JSLA 2FH5B 3AR8A 1HKUA 5TGZA 3DNMA 4PYIA 2E6KA 3SSOA 4BCBA 3KZCA 3BDAA 5I3CA 2PXHA 2RBEA 4Y2RA 1H0SA 4IHQA 1MU0A 4ALIA 1PLLA 1EXDA 1SM4A 2B5VA 2P3LA 3NIDB 5IKXA 3M5DA 4GC5A 3CTPA 2QF7A 3GJQA 3NUZA 4GM0A 2B3TA 4BNVA 1R0KA 1SR8A 3AXSA 4MR8B 4N3AA 3UJDA 3P9XA 5CX1B 4F8YA 3I9KA 1JU9A 3H6HA 3E2PA 3IT0A 3QLTA 4YY3B 2Y68A 5ALTA 1AG9A 2WA2A 4CDMA 4IL5A 3WZLA 3HPQA 1BHSA 1OLXB 3AHCA 2I76A 3U3JA 4NE9A 4AMYA 1K6XA 5CD1A 4LZWA 3UFXA 4FWBA 2C20A 4O8ZA 5FPTA 4N48A 1CEXA 3QBTA 4WSOA 3DAFA 2WKQA 1N1GA 4QOSA 1G41A 2H07A 2YVKA 1V7ZA 4PBTA 1UPTA 3V2IA 1KERA 1JVBA 3IQEA 3BMCB 2Z2ZA 3BMXA 3KHKA 3OQIB 3CSSA 3KZOA 1JDBC 3G13A 5TQ2B 2XQIA 3AYXB 3I8SA 3QA3E 3NANA 5K6TA 1PDOA 2GT1A 1C29B 2GJSA 3TIVA 1HYEA 1NP7A 2QYTA 4RENA 2ANCA 3EXHC 4AJJA 4C05A 1WP4A 1W0KA 2DYKA 4X90A 1L4HA 3GQBB 3GLFB 1GL3A 3UATA 1XJ0A 3GRAA 1W94A 4WK6A 1HK7A 2BLLA 4IG4A 4LHWA 5LXTF 1Q92A 1TVKA 3FNHA 4UQLA 1VJGA 3G2JA 1YZYA 3AUFA 3THYA 2XCLA 1T2AA 4YC7A 4TKVA 3KEMA 4DA6A 4ZYLA 5TMDA 4XDZA 1BXGA 5G3YA 3MM4A 4EELA 1I94B 2WJGA 2GHTA 3I34X 3JPYA 3SFTA 3L0DA 1XHFA 3UJ3X 4DLLA 2DKOA 1IJEA 1W34A 2QA5A 4Z9XA 5K3FA 1ATIA 2C98A 3N6XA 4AJ4A 4TXNA 1GTMA 3ADPA 3ZTYA 2VWPA 1RLIA 4UVDA 3IULA 1BXRA 3FMPB 3QHQA 1L1QA 2VS1A 4KLRA 1RRPA 3I9OA 5E1DA 4ALMA 1GAJA 2FLWA 5MN5A 5CDFA 3DLBA 2J09A 1A9PA 4NZMA 1LY1A 4CZ2A 1TVMA 3G1WA 1VL8A 1F1BA 3RQSA 1Y5NA 2QQ5A 2EARA 3G2IA 2J0EA 2WM8A 4NU5A 4RORA 5AMXA 1WMAA 1PR4A 2VVTA 3TTTA 4FLEA 2A1UA 5DTIA 5DV9A 3SBXA 4RD0A 2DHRA 4Z9BA 1ZPDA 3B2NA 5E95A 5G0VA 4CG0A 4D9BA 4EHNA 3O5AA 2UZ4A 2Q27A 4RABA 5KVSA 2ZI6A 3MZ0A 3N87A 5AXDA 4G3XA 4KNVA 3T4XA 2IZ5A 1F51E 4FOPA 1R1DA 4MQ4A 1A2BA 5FTJA 1MGOA 5GOZA 1EBUA 3EXHA 3IQZA 1W87A 1Z08A 2E2WA 4JL6A 5EXTA 4RZQA 4FM9A 3UMBA 1ZW6A 1XPOA 3H16A 3MUOA 5KKCA 2FRDC 1V8BA 2W71A 1M66A 4LNUB 2PRSA 1F8YA 1BDJA 3QI2A 4OEHA 5EMHA 4ZT7A 5FBZA 1KRXA 1N0VC 1I3LA 4E0BA 4DG9A 2QLFA 1KWKA 2VQEB 2OBXA 1XO1A 2WIGA 4DLAA 1MAHA 2WJVA 1KJNA 1S01A 3DL4A 1D6SA 4L5YA 2OGSA 4GH5A 1JU4A 3KR1A 4ND3A 4D82A 1S2DA 2VYNA 1GZ6A 3I8OA 5ALVA 5GADl 3THYB 2PAAA 2YHUA 3DOUA 4AY2A 1PKEA 2BV3A 4L57A 4TKVB 4JBGA 2ORED 2QUAA 4CKEB 3I9MA 5A5EA 5I8PA 2HKIA 1WZIA 1Y37A 4M46A 3KOOA 4M8NE 2FXVA 5BWOA 1ZLYA 3ROQA 3TLEA 4DLWA 3K0KA 5K3FB 1NF8A 1QYWA 4Q7MB 1N9KA 3LXRA 1MZPA 1P0PA 1HZJA 1BXRB 1ESMA 1U0RA 1KZ6A 1JHAA 4B80A 4W5RA 2PXAA 4HFJA 5BY2A 4L8GA 1CUHA 2ZSHA 2VA8A 3C4JA 4G2NA 4B17A 2I99A 2IYWA 2I1VB 2I4OA 3KOUA 3HCCA 3QMVA 5JYEA 4QASA 2E4YA 4H9GA 4E4RA 1IHUA 1Y9AA 5JLJA 4I1UA 2A1UB 3PA8A 4KO1S 4L4YA 5DYIA 3FOEC 1I2AA 2QR2A 3OCWA 3F2VA 4G1EB 1G4HA 4GGOA 4PAQA 4UBLA 1YJXA 1LEHA 5FLEX 4HRVA 3SS8A 3VTFA 2HGSA 3I12A 3DM5A 5JS8A 2CV0A 1SUBA 2HZBA 3L46A 2VHJA 2B8NA 1OVMA 3NHUA 1PP4A 5J5VA 3P97A 4LQCA 1QRSA 2FRDA 3HY4A 2ATVA 4OK5A 4UD2A 2QIPA 3A70A 3AEUA 1DUVG 1DJQA 2ZYRA 3EWSA 4JGBA 3S27A 3EXHB 4X20B 4BE7B 5JCZA 2UXDB 1F9AA 3A3NA 4DYVA 1Y8CA 4I5DA 1P2FA 2VDNB 2XLCA 4ENQA 2Q41A 1YK0A 4D74A 1S4MA 4WXYB 3EZNA 4RM2A 1RXVA 2J67A 3O74A 2V74B 4MUIA 3GFGA 4MA0A 1N6KA 3A3KA 4PYRA 4Q3DA 3L7NA 4B7UA 5E4JA 4YP9A 4MNTA 2R11A 2FOXA 3WNZA 1K7EB 5CFOA 3SEQA 1UKBA 1AF4A 4P34A 5IUKC 3MJCA 3HN2A 4X7PA 3PUXA 1FFSA 3IERA 3PFBA 2BZSA 3B2EA 4M55A 3VZPA 4EHJA 3I5XA 4OX9B 2QS9A 4UVEA 2GBGA 1BROA 3LLUA 4NE2A 4JLOA 2ONZA 1I4DD 3JYQA 1GPBA 2WUGA 3SPXA 3SX2A 1IBSA 1VI6A 4HFRA 4CMJA 3GT3A 1OXVA 4L6AA 1WABA 3RKRA 2WTUA 2QK4A 4X84A 3LFTA 1DFHA 4U2CA 4C03A 2BP7A 2JFOA 3O4IA 2PANA 2GCGA 1KAEA 3KC2A 3TW6A 1Y4AE 2WR8A 3MXTA 2IYZA 3QNWA 2FPIA 4NCKA 3DFZA 4C3ZA 4H1TA 3CX7A 2RIRA 4AWBA 5E1BA 1YGPA 4ZKEA 1PEYA 3ZE9A 2WJ4A 1KE1A 1UDCA 3IDQA 1ISMA 2BPOA 4G8BA 1ATZA 1XZPA 521PA 4BNLA 4Y2GA 1UQRA 1C1HA 1V45E 5F73A 3CBGA 2NUAB 2CEAA 3ZD9A 1FFXA 3RAFC 2AEJA 2YWJA 4ENRA 3UAOA 1BYIA 4RYLA 3NB0A 4YMVA 2PZAA 3J81A 4CMHA 3GFFA 3DLHA 4BWYA 1KZ9A 4HOYA 3T9EA 1IQRA 4IOMA 1UC4B 5COBA 1KH2A 2X1LA 1LSOA 5AW8A 2YIVX 1TJNA 2QQEA 4R7GA 4W5NA 3UAGA 2JHAA 3MCVA 4UAGA 4C89A 4ZXFA 4MR9B 2NVWA 1TTHA 1RYHA 1UBNA 2RHGB 5E6RB 2RK3A 3TW0A 4JJ4A 5KHLB 1DEAA 1EHCA 1U4NA 2P41A 2ALJA 2PT5A 2WT9A 4I66A 1D4AA 5JO0A 4QYSA 3VH3A 2J7KA 4Q05A 4R1SA 4WKCA 2BGGA 5IT5A 2VQ3A 1M2WA 4KBYA 4IILA 4QATA 4X24A 5GZ3A 5DM70 3TGWA 4B32A 1INLA 1T24A 4AKGA 2J3JA 2ZT6A 3LSYA 1L5QA 1KDRA 5KAMA 4F2WA 1YQTA 2LDBA 4OLAA 2EP7A 3H7IA 3EZ6A 2MSEB 3CYFA 3IIMA 2OXTA 2MMCA 3B3GA 5BV7A 1BE8A 3GK3A 1FUKA 4N5LA 2XVZA 1NWCA 3MINA 4M7WA 2YNMC 1ZUNA 4S04A 1IXRC 5KOYA 4ITRC 1DBWA 1P1FA 1YR9A 2J7PA 5C4MA 3UZUA 2PX5A 2ZYTX 3AVQA 3OFJA 4MB0A 2FR1A 4YR9A 2H1VA 3IDAA 4IIDA 3WAKA 5C80A 2FPIB 1JYFA 1NDHA 4AG3A 1E4VA 4G1BA 5M29A 4MVCA 2IDJA 3M34A 2YMPA 1N2EA 4ZOLF 3PTAA 4PTLA 1JFLA 3SKYA 1G59A 4R16A 2GUWA 5FO1A 2NU8A 4BQRA 4OJNA 1N6NA 2CVFA 1E3EA 4NRDA 1JG6A 4GMFA 4EY4A 5F9FA 3C6XA 3QE3A 3A1WA 2O2SA 3DZCA 5DYGA 3OLWA 1FS6A 4DHWA 4HQLA 2IZ0A 3QQ5A 3OZBA 1XKTA 2O7SA 3AP3A 1CHDA 2KBEA 2ZYDA 3TECE 5L3VA 2CXRA 3USCS 3T3OA 4RTLA 1FYXA 1VLVA 4N0DA 2Y4OA 3COZA 4F8EA 3DEHA 5LYYA 2VJQA 1T5OA 5CLGA 5CVEA 1Q7TA 4IZIA 2FZGA 1IOWA 3NDPA 3JQCA 4JI8B 2IX9A 4R9UC 3RWMB 4JOBA 5FTKA 3B20A 1V5FA 1KMNA 5CBPA 4DJAA 2AK2A 1O9GA 4XYBA 5KJCA 2JGDA 4Y0NA 2MSKA 1SBIA 3PQEA 3KVNA 3P2EA 5JAHA 5HDBB 3D2BA 4HQFA 5D3ZA 2W9XA 4CBVA 1AJEA 2HJHA 4BAZA 2C99A 4GL2A 1PFKA 2YNMA 3GMSA 5J59A 5KPJA 1QE5A 2WAOA 5HF9A 1P77A 4Z0HO 1WMSA 2C4WA 3WZ2A 3HJAA 4KW7A 5A0FA 4JFRA 3QRWA 1FVFA 1U0SY 4NBSA 4V0NA 2JIQA 3SS9X 2REOA 3KQNA 1E3WA 2JW5A 3DP9A 5JZBA 1ZUNB 1FBNA 4IVPA 1MFZA 4B6GA 2YJNA 4AQDA 2OZVA 3RK1A 5TRTA 3PXGA 4RTSA 4Z4GA 1UBJS 3A05A 4IBOA 3Q0IA 4O2LA 1OHHD 1I24A 4YCBA 5DHAA 6REQB 1CJMA 1ISFA 1ZXLA 3BHIA 4LJ8A 4OJYA 1FJHA 1ZI8A 4H3KB 5AR1A 2AVDA 1VJTA 2B83A 2DCUA 1H0RA 1UIMA 1XZBA 3EWNA 1AZLA 3ZDRA 1XHEA 3EHDA 3L1IA 4KL8S 4OJKA 3ABIA 3OG9A 4FEEA 4P0PB 1X94A 4AUKA 1YJ8A 2QXYA 3BL8A 5FKJA 4PAGA 2XQGA 3WLMA 4JR1A 1RQGA 1L6RA 1AXGA 1ECJA 4MPRA 1P1RA 3U7HB 2OBYA 3O3NB 4WASA 4YCAA 1R2QA 2ZAMA 4OAOA 1NN1A 1U0NA 2BZ0A 5KIAA 1T91A 1M2NA 3AF2A 4JJFA 4RBNA 2WG0A 1KJIA 4LOLA 3BSSA 5BW6B 2ZUCA 2M1ZA 5IT0A 1ZOPA 3Q41A 3REQA 1Z63A 1LWNA 2OLKA 3PR1A 4Q01A 5B58T 5FBVB 2YC4C 2FWJA 4BNIA 2IYAA 1NR5A 2X9GA 3L41A 2IEGA 3LHKA 4RMNA 3V2UA 2BKUA 1DKOA 2I62A 2XW6A 4PAMA 5CBPB 2EBFX 3L79A 3NTLA 1NAIA 3TEMA 3R3XA 4E7PA 5J2UA 4LVUA 1NQUA 2JGDB 4FDLA 5H0IA 1QGAA 1WUJS 1E2NA 3RC7A 4EUEA 1PS0A 1J09A 2Z5VA 4N5HX 4E21A 3FOFC 1S8OA 3QZUA 3KPJA 2JKVA 3PENA 3O6VA 1JIJA 3BA6A 4EYGA 1NBMD 1XRRA 4MYTA 5TVKA 2A9OA 4FYXA 2UZ1A 1QVVA 4IFBA 3AUAA 3QLJA 2WYIA 1NONA 1P5RA 1LLUA 4BTEA 4EHFA 5B7PA 2FMFA 2ZVPX 1B8VA 2ZB3A 3BUSA 1E3WB 1CR4A 3CJRA 3KQTA 1UBEA 1E5XA 2NZJA 4K2HA 4ND7A 2QZPA 3DKPA 5ECWA 3T7TA 3ORHA 3HWX1 3BQ9A 1M5RA 4WK4B 4BJ1A 1Z07A 1RLTA 3GRPA 3OO1A 1GPUA 4V0KA 1P3JA 3DR5A 2G6TA 4ZVRA 4RDCA 3TJZA 4BTVA 4UTNA 4HQRA 1JDVA 1L5VA 2FSGA 3F5QA 4BIMA 1XZLA 3LDUA 1N2OA 5GZ6A 3VHQA 3VR6D 4UFPA 3KYJB 3WV5A 1HGXA 2AZ4A 4G9GA 3IBTA 2D3TA 1U2SA 4FMCB 3DCNA 4PC3A 4F38A 2XUQA 1L5HB 1MH9A 1RI3A 1VJ0A 2HA7A 4QXRA 4X63A 3ZHSA 4DNOA 2WJYA 3ZJTA 4B1FA 5IYZA 4C0QC 1ZA2A 5DISB 3JQFC 3VPDA 1HLGA 3CVUA 2G1JA 1IIBA 4FWTA 3ED1A 3SZUA 2XDQB 4PWYA 3WGGA 1U2ZA 4OGWA 3AKZA 2FOLA 4N40A 4CN8A 2Y9MB 2DT8A 2XTZA 3DE3X 3IP3A 3Q7PA 4HTAA 4RV4A 1F7UA 5EUBA 4RHXA 4WLVA 4X66B 2XT0A 2DPXA 2NYRA 2F8LA 2PL5A 2Q4BA 5GV7A 1DRUA 2PWAA 2P9CA 3F6CA 1CEEA 3TUZC 5CEFA 1NOJA 5JT1A 5J2UB 4ZC1A 1D2CA 2R66A 1PQ4A 2PX8A 4JLJA 4EYSA 5SY9A 1AK2A 4M0EA 2XYPA 4MS4A 1TZJA 3ZG6A 1Z45A 3B36A 4IP0A 1QB8A 3L9XA 4YRNA 2YDYA 2RARA 3FY4A 3HXLA 3D8SA 5J4HA 3GZTB 3HDYA 3LY8A 1C9DB 4FX5A 2QDKA 2DPHA 4NV1A 5FIUA 1E63A 2UZ1B 3UJCA 1IY2A 3WKEA 4YJ3F 1MQAA 1J2RA 5C8YB 4G1FA 2JGIA 3DLPX 2CZQA 5DI9A 1E2DA 2C4MA 3ELDA 4JLNA 1PR9A 3H5LA 4U2DA 2ZB8A 1BD4A 5ISMA 1S2MA 4D57A 2AN1A 5DOZA 1W5AA 1M1NB 4POOA 1N7JA 3LD9A 4WLEA 1TKBA 4K8OA 4Q3LA 5ULLA 4DILA 1FVHA 5K0BA 4BGDA 3QOWA 1VHQA 2ZIGA 3N2YA 1G21E 3TLGA 1EP3B 3BWBA 4M8IA 4W1RA 4OHZA 2QTTA 2DFNA 4R9VA 4KIJA 3KL2A 5I4CA 2DERA 5AI6A 2VH1A 3CEHA 1X86B 1IQPA 2Z2XA 3JQFA 5B4VA 1PO7A 1A50B 2QV0A 4R8RA 1EX6A 1HORA 1T9ZA 1HTTA 2ZYSA 1A4XA 4LCBA 3A1UA 1GUBA 5IYZB 1AUQA 1Z15A 2P69A 1E2PA 3AEZA 2WQ7A 3OF2A 1DO8A 4KOEC 1KFJB 2AI2A 2HSZA 1O4VA 2WSLA 2FW9A 3ODPA 2X42A 4YA6A 3ZUPA 2YYZA 5KTMA 2WF6A 3ODGA 4YUWA 1HTBA 3C6YA 3OQ1A 4LBZA 4TPKA 4AZVA 5EXSA 3WOVA 1KMMA 3KJFA 2YW9A 4FYWA 2PMDA 4KXFB 2BKXA 5KYUA 3CC8A 3C87A 3MIZA 1EXNA 1EVEA 1Q15A 1W5BA 2DAPA 2AE2A 4L7VA 3UWPA 2EJVA 3H5RA 3OPYB 4NYMQ 4PHTA 1SCNE 3LJKA 1B0AA 4CMKA 3CIFA 1GO2A 1P6QA 4OXYA 3ZYCA 4A8JC 1G8HA 5CT6A 1R4NA 1WD5A 4JEMA 3GEBA 4ZEOA 3S68A 3ZZUA 1KWGA 4EZEA 5A5FA 1SU7A 2OCAA 1TQ2A 1XKQA 1KH1A 4NZYA 3SEZA 3UB2A 3VPCA 4M9ZA 2OK7A 3OLXA 4H27A 1UOEA 3AH8A 1L8AA 4J7XA 1H9AA 5EJIA 3WNDA 1AHPA 2R6ZA 3ZLTA 2O8FB 1XRJA 4HCJA 4RF3A 4D8XA 4KPGA 5AQEA 4CM5A 1KRWA 3TIFA 1USWA 2XCUA 3VKVA 1AXEA 5KX5F 4GR4A 2ZCJA 5L7TA 2O2DA 4KBGA 4J7CA 3CR7A 2OFFA 1JVNA 1IAVA 3WGZA 5I51A 4YCNA 3FZQA 3R6WA 3F1KA 2VK2A 1RAFA 3SHVA 3SJUA 2IRWA 1H1LA 1L7OA 2P2GA 5KKAA 4RPIA 1OYVA 3OZUA 4P0TA 2O7VA 3K72B 2J4DA 2G82A 2V9ZA 3TE6A 3AP2A 3J7TA 3Q5GA 5FEMA 5FEUA 5DNWA 1Z25A 4L5AA 1QKKA 3AJDA 1QHSA 3GN2A 3QMMA 4QPDA 2OD7A 2FUCA 1M6NA 4OSEA 3IV7A 4QXOA 1RRCA 3EXFA 4QX6A 2IHVA 3MWFA 4PYLA 1QG4A 5L53A 1R00A 2QW0X 3Q98A 4CKYA 1O96A 4UBOA 3INGA 2CDRA 2CDAA 1TIBA 1WF3A 1XWIA 5D1NA 4C2BA 1TM4E 1I7PA <