3PXCX

Impact of brca1 brct domain missense substitutions on phospho-peptide recognition: r1699q
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
211
structure length
206
Chain Sequence
b'RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCEQTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Breast cancer type 1 susceptibility protein
publication title Impact of BRCA1 BRCT Domain Missense Substitutions on Phosphopeptide Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 62
structure length 206
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxcX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3pxcX01
4XPZA 3SHVA 3II6X 2R1ZA 1WF6A 4BU0A 2JW5A 3L41A 4U4AA 2COEA 3QVGA 2XNKA 3K0KA 4XQ0A 3AL3A 4BU1A 2EBUA 2EBWA 2ETXA 3UENA 4IGKA 4JLUA 2K6GA 3UEOA 3K05A 2VXCA 3T7KA 3PC8A 3SZMA 1OQAA 1Z56C 2L42A 2VXBA 2HTFA 2K7FA 3COJA 3EF1A 3HUEA 3PXCX 1JNXX 3K15A 2EP8A 2LE0A 3EF0A 3HUFA 3L40A 4ID3A 3AL2A 3PC7A 2E2WA 1T2VA 3L46A 4IFIA 2XNHA 3T7IA 3JVEA 3K16A 1T2UA 5ECGC 1T15A 1Y98A 3OLCX 2COKA 2DUNA 2INGX 1CDZA 4Y2GA 1T29A 4OFBA 3U3ZA 1KZYC 2COUA 2D8MA 3PXDA 1L7BA 3PD7A 4Y18A 3PXEA 3KTFA 2NTEA 1L0BA 4BMDA 2AZMA 1N5OX 3T1NA 3T7JA 2WT8A 4N40A 4BMCA 3FA2A 2M2IA 3SHTA 3I0MA 3PA6A 1GZHB 1IN1A 3PXBA 3SQDA 3PC6A 2ADOA 3QVGB 3PC8C 3PXAA 1IMOA 3I0NA 3K0HA
chains in the Genus database with same CATH superfamily
1AH2A 2CLIB 3FWHA 1ONNA 1A5AB 2F1JA 3C15C 4NXNB 1YR7A 3TVYA 2JKYA 4PNHA 2XDWA 1QKKA 3FFXA 4IIDA 4Y7CA 1YJCA 1PFQA 1M7GA 2JEOA 4RIGA 2JGDA 4HPWA 1DAGA 3A7DA 4P83A 1DOZA 2PM8A 4PF1A 3ED1A 1E4VA 4IXDA 3AVWA 1GPWB 1IRXA 1SCKA 2NSLA 1IPFA 5EN4A 4EMSA 5B4TA 3MGKA 5AM4A 4Q34A 4C0LA 3HQ4O 4DLXA 4BGVA 4Z51A 2QAJA 5CB4B 5JSHA 1NPTO 3ANYB 1YZUA 3LIIA 1ISFA 4ZOLB 1O87A 3UA3A 4LDQA 1K66A 4FE7A 3KJHA 5T3UA 3UW1A 1GM5A 4LGCA 3DO5A 2P3QA 3FWKA 4PZAA 4TKUA 4QXMA 1FMFA 1X7ZB 5DNAA 2TECE 2V1XA 3PPYA 5A7GA 3TMAA 2BFBA 5TIIA 4H6WA 4I50B 2XGGA 1ZUIA 1XI2A 3E58A 5EUBA 3EVDA 4ZAGA 3G7SA 5AIAA 1LW6E 1UZUA 4B33A 4F5WA 3EQ2A 2TYSB 5ARCA 3OT1B 1CU1A 4PHCA 2ATEA 2PV0A 3MRSA 1Y89A 1U31A 1S3GA 1Z17A 4OJYA 4S0XA 3PGMA 3TQTA 3W8RA 4FYKA 3W8EA 1EI9A 1RFLA 4DCUA 3S1SA 2Z9CA 1XQWA 3IKLA 4O29A 3TLEA 1NVEA 5AVWA 4UUBA 3ZK7A 5EZYF 1Y7PA 4B6FA 2C7RA 4AJNA 4D8UA 1JQKA 4Y9UA 1VE6A 3NWOA 2CMDA 2ZYSA 4Q05A 4X93A 4BNNA 5B2EA 3GLHE 3QX7A 4DR7B 2YN2A 1TF2A 1GP2A 1UBSB 2XWBF 5L6MB 1N2XA 1R9NA 2ZRFA 2XB2A 2OZPA 2QJOA 3M3PA 2NO0A 4MLPA 3TMYA 5C52B 4NWIA 2Q2NA 3OEHA 3THRA 4BKOA 3L92A 3MGGA 3OFND 5T8KA 4FS8A 5JLAA 5KSPA 5IYZA 2JDIA 2YHBA 5KC8A 3O9ZA 2JLWA 1JQ5A 1XTKA 3TX6A 1JHZA 4DSTA 2I9PA 1B14A 1YZYA 4F8EA 4AG6A 4BYMA 1GYPA 3DHNA 5D1NA 4ZAXA 1UDWA 1VDZA 3TM5A 5CYGA 4XIIA 5F2NA 1RP1A 5HBGA 3MJ4A 4MV9A 1YFZA 1GZDA 1SIOA 3PIDA 4OQYA 4UHHA 1TC2A 1Y3CE 1H2YA 2NVOA 4B84A 2JI6A 3PC2A 4G4SO 1OFUX 3RYFB 1Z18A 4I4TB 2ZIUB 1GPYA 3Q3HA 4JQSA 4UD6A 1DOAA 3MWGA 2ZG6A 3WY9A 2XF8A 3GVCA 1NI5A 3PKJA 4F12A 3DKIA 4W8OA 5CTAA 3HBJA 3TB4A 1CYDA 4EI9A 3QW4B 2CUNA 1BDBA 1JBEA 2EG9A 3P97A 4P36A 3PCTA 4IZOA 4WNYA 4PCAA 3S7ZA 4A0FA 2EJWA 1SK8A 5IEBA 5BMVA 4XWWA 4LS3A 1XQYA 3AF4A 1S4MA 3MJSA 1VTKA 3DBRA 2YVQA 4NV3A 4XB1A 5FOVA 5FUBA 2DPYA 4ZKDA 3H04A 2O8BB 4AJJA 2HIHA 2HUPA 4H3VA 1Y42X 1U5CA 2YJ4A 3FFBA 1EVLA 2HF2A 5A0VA 2P6OA 3B78A 3HH8A 4RL6A 1ZPDA 2PMFA 5KVSA 3U7IA 3ZKAA 2JI9A 3DZ8A 1XZGA 3KHTA 1E5VA 3W1EA 2IU3A 3WOHA 3UHPA 2K4MA 3CZ9A 5HTKA 3LGXA 2IHNA 4BMXA 2NXJA 2KHZA 3AWDA 4M0UA 3ZWBA 1JR3A 1MAUA 3NM5A 1YZGA 1RYFA 1E1NA 2XRMA 3QE4A 4H1UA 1O58A 3F4KA 2HIGA 2ZRNA 1MUUA 3HKBB 4O2BB 1FS5A 1JVSA 1ZNZA 2GZRA 1T6YA 4KSCA 5SYAA 5BWNA 1YVUA 1T2CA 4OXRA 3AL3A 5B53A 2FUG1 4KLAA 4MVJF 3SEQA 3MWKA 4M1KA 3P0HA 1YTUA 1B23P 3ACBA 3NCTA 4C88A 1AO0A 2F17A 1CUFA 1O2DA 4CL0A 1KKMA 3CLRC 4HLQB 5F77A 2PQMA 1N3LA 4ZYVA 4FSDA 2R6DA 3G5LA 3GZTB 4IVPA 3ZX5A 4GLBA 2A9JA 4BKRA 5CFPA 5K8CA 421PA 3TFWA 2JFXA 1CYEA 4M3NA 1I10A 3EAFA 2GXQA 1O94A 5DFAA 4KIWA 3RKSA 4J0IA 3TLKA 2DHCA 4H2DA 4M89A 1RAAA 4NQRA 3LWDA 2AUMA 1FVOA 1BCSB 1I80A 1QOQB 2VEDA 1OPRA 2WLSA 4HAIA 5I7AA 3OE7A 2HTFA 4YJ3B 3PCXA 1G55A 4G5SA 3ESDA 1QQ5A 2ZE7A 4WACA 1JHUA 1XDDA 2R97A 4KUEA 1Y6QA 4PZCA 3RYTC 3R09A 1U9YA 3SQXA 3SJZA 4EPTA 1EUCB 2ZSHA 1TT5B 1FTNA 1WU8A 3T4PA 1PGQA 4D0GA 5B6PA 4X61A 1MN6A 4RCVA 2VJBA 3DAHA 1P2GA 4YRQA 2FMHA 1R50A 5CFLA 2BR5A 1Q84A 2CYCA 1PFVA 1CY4A 1VPLA 1ISGA 2CUZA 4K05A 1ABEA 4O5AA 3LLUA 1K2WA 2I80A 2E2WA 3PR3A 5BSMA 1C2YA 4YHHB 1TQHA 1ETHA 1K9VF 2CXRA 5JAHA 3FKSA 1RYDA 1H2XA 3N3AC 1ODFA 1S89A 3EH2A 2A84A 1I3LA 3TOCA 1UBKS 3VVBA 4CUZA 4QDOA 4EEXA 1FDOA 1NP3A 5E7IA 4Y2GA 5F33A 4EY7A 2A5FA 2NZ8A 3F4LA 3EZ9A 4OY3A 4HEHA 1RXEA 3RVMA 3V8VA 4A0SA 4MR7A 5AKEA 2AG8A 2HU7A 3NBAA 5CEEA 3RUAA 4YJGB 2JS7A 2IYPA 5TF0A 1I7NA 4EA6A 3B70A 5EWLA 3A1WA 2GPBA 5P21A 2YC2C 4YRBA 5H70A 1ATZA 1RC1A 4MCJA 2CXPA 1EXWA 2ZIFA 4WK6A 1P73A 4DCOA 4RJJA 5C0OE 4P4NA 2H5IA 3WFJA 1XGKA 4HNHA 4EJSC 4BC1A 3NS7A 1LF0A 2FUCA 2OFWA 2FFRA 1UBCA 2FZLA 2YWEA 3ND6A 4XTCS 1M7BA 2BW0A 5IWCA 2YRFA 5C7IO 3DW3X 1KK3A 2OXFA 3R3VA 4Z0NA 3A6HA 5SYNA 3REQA 4F06A 3W9BA 1DAOA 2I54A 4ZO6A 3TDMA 3GDWA 3RC3A 1D4AA 4DLLA 1SU6A 1BXRA 2VLBA 3IIIA 1DJPA 3U7QA 1I2AA 1KI1A 3BFVA 3ZEAA 4YMVA 4YT4A 2V7VA 1RYBA 4J75A 2QGFA 1KRXA 4FGWA 1ZOLA 1PR0A 1VA5A 1YDWA 2GSWA 2QV7A 1BYUA 1E79A 1K9SA 1E3LA 2WDZA 4HEQA 4XFDA 3U81A 3W5JA 3WLIA 4NNPA 3ZQJA 4EVSA 4Q7LA 5JYEA 1RW4A 2H1FA 4DOMA 3ICVA 3OA2A 1NMZA 4OMDA 3FMVA 1KBQA 4N0MA 3O47A 1PS0A 1V5GA 1QH9A 4TPKA 4BNVA 3SWWA 5BUCA 3CA8A 3FVRA 1FUIA 3P96A 3WRXC 3B6JA 2FZKA 3WP1B 1PGOA 2K87A 3DR3A 4EA8A 4Z4IA 4QTTB 3NANA 1RWNA 1P2FA 1XR3A 4F4IA 4KSBA 3RC9A 2C4WA 5EGSA 4BKUA 4ESHA 3SF0A 1DARA 1WPQA 4B1FA 1R66A 1YONA 3OD5A 4KPGA 5B30A 4YAFA 5LXTF 1WXIA 4TKZA 3SX4A 1PNTA 4U7WA 1F0PA 2JAWA 4OYHA 1BXGB 2X0NA 3O8DA 1VSUA 3PQ6A 2FSVC 3ROPA 3EGXA 1TUGA 1T6NA 1K97A 1N7HA 5AKHA 1WOYA 1HPLA 1ECBA 2JGIA 3EZLA 5FWNA 3S2GA 2BHSA 4BLRA 3NV9A 2HEGA 1Q0QA 2D3TA 2IU6A 2B8TA 3CMMA 4JJZA 2ODAA 1UBNA 2A14A 1JB1A 3PFWO 4B3HA 4B7AA 1Q83A 3MMSA 4GVPA 1VL1A 3L0SA 3ESYA 2PX6A 1O4WA 1VLZA 1MQAA 4RZUA 1G98A 1DBQA 1KZ7B 3M2PA 1FRZA 1KF0A 4UOQA 1U2ZA 4JUFA 1ONOA 1R0BA 4P32A 1Z6GA 3L7OA 5KNDH 1YVEI 5A3RA 4EYGA 4IY1A 3WK9A 3JQGB 3NC1C 5F78A 3SX2A 1HE2A 1ND5A 2F64A 2R1UA 1M76A 5JMWA 4BLSA 2A9RA 4M8SA 4GVXA 3L8HA 4QELA 3R7WB 3SEAA 2PR7A 1CJCA 1JR2A 4JMLA 2HGZA 2QN1A 1FDWA 4O2LA 1S1CA 4OQPA 4QAJA 2LCFA 4KKVA 2QAGB 1F2VA 4UTOA 2AMJA 2HWXA 1EU1A 2PMEA 1ST2A 4NATA 3KK0A 2VTBB 4BWFB 2A9QA 5C5IA 3JYLA 4XSGA 2PUEA 4CMGA 1NURA 3TLGA 4OX9Y 2G07A 2PZKA 1B1CA 4A26A 3D4NA 3L1UA 4MV0A 4P9NA 3PU6A 2Z3ZA 3QI2A 4C4PA 2NSYA 3RFVA 3VDMA 1UBFA 3ZHUA 3HDTA 1XMQB 1DP4A 1K8XB 2PUHA 3FNIA 1SKQA 5CAEB 3UYLA 1LDNA 1VPTA 2XRFA 2YWHA 3M3HA 3Q0EA 3WRYA 2GNOA 1CZOA 1T4CB 2QUAA 3UOAB 1AA9A 5JD6A 2YWJA 4G23A 4URXR 2VOEA 4WPGA 1MJ5A 1UPXA 3ZHQA 3ZS8A 1G38A 2YN4A 1MO2A 3P9SA 4A36A 3RYCA 4V3BA 1M1YB 1K2VN 3QU4A 3QLVA 1QO9A 2P9YA 1P74A 4WASA 4EZIA 2P5TB 3OJCA 4JLPA 2AMLA 3AF2A 3T3NA 1TF7A 1VKJA 2BM9A 3B6KA 5J2UA 2C5SA 1TM1E 3HCAA 4HWSA 1OLXA 2RGXA 2VSOA 1A76A 3QF7A 2HB6A 3ESCA 4R7ZA 3D4PA 4X92A 1SBNE 1QV9A 2MHCA 3REFA 3COPA 3L7BA 4WI1A 2B0JA 2BM8A 1NR1A 2Q5EA 1CQIB 3GJ7A 2COEA 1R4AA 3Q6IA 4HZUB 3V7FA 2CKMA 4V1CI 3T9AA 4ECEA 1D9ZA 3OG9A 2BRUA 1FE8A 3EXAA 3KUCA 3I2FA 5IDXA 1LLUA 3NUQA 1R5JA 4X6UA 3W3ZB 5DN6D 1NP7A 1ZM7A 2WD8A 1EFKA 1N77A 4BGEA 4CN9A 4OTZA 4Q19A 3CVYA 4WFIA 1DJQA 2IH4A 1UFRA 5T57A 4HB3A 4EFLA 4EL5A 3DL0A 1DTSA 3EQ7A 1TAQA 1A77A 5H4HA 3MMNA 3ONWA 2I4OA 4R31A 5DE3A 4A91A 4KK4A 1QIGA 3MOGA 4MS3B 1CJVC 2B9VA 4QVIA 1D8TA 2WUGA 3EX7C 4GD3Q 3T5AA 5KAMA 1U2DA 3DT6A 3IUEA 2RH8A 4W8GA 3KC2A 5EQFA 5LU8A 1NBMD 5K2OA 3E5HA 1OTYA 1PR2A 2DULA 5FBKA 4RNDB 3NTXA 5K4HA 3TTXA 3TNJA 4PRZA 1M5UA 1HXHA 5C32A 2E5FA 3H9GA 3ZG6A 4DVGA 2YQ5A 2GHIA 2QNRA 3H1FA 4FZJA 5BR7A 5CNMA 5B4UA 1Z13A 3AEQB 1C8BA 2VJCA 4WZAE 4LYDA 2DFLA 3B9QA 4PSDA 5BRJA 2PGOA 1IEWA 2DWCA 1NSTA 1DV2A 4KE9A 4DMKA 1AQJA 3DCJA 2WHEA 2V6JA 1X1SA 3DH0A 1UJCA 2V6MA 5ILGA 3KSZO 2NTJA 1UBMS 4C0QC 1LZLA 4HGPA 3TSZA 3L7KA 3WLNA 4BO9A 4YCCA 4S04A 1FFGA 2DU8A 4TZ6A 4B71A 4MA4A 1E3JA 2IYUA 3SF8A 4C0XA 3L79A 1T2UA 5CVUA 4UOEA 3IR7A 4M0PA 3PVZA 1QPBA 1HF3A 3HBLA 4BNJA 1UBLS 3ZV3A 3NHUA 5EZYB 3ZYCA 3Q8KA 4ND8B 5FPHA 4P34A 4YAIA 4F3NA 2H4YA 3MS7A 4UEWA 2QRQA 1ZN9A 5F76A 3GR6A 4YP7A 2AC4A 2DOKA 1IL0A 3Q0IA 2JEZA 5CB8A 2AMFA 4U7JA 1OFTA 1XD2B 5CX1B 3INGA 3UV7A 1V16A 1DWPA 3ZBUA 4E15A 3DVLA 5HHTA 4WLFA 2ATVA 2ESRA 1RZ3A 1TKBA 2ZRAA 1E2MA 3G49A 3IO5A 3OOYA 4EA7A 1AKYA 4LY6A 4ZIRA 1GRCA 4GRAA 4TVKA 5I7FA 1DTWA 4KRGA 1C81A 3WQBA 2DYKA 5DK4A 4X1OA 3PEEA 4BJ3A 4CMIB 2XNSA 1LS1A 3VKWA 3N7TA 3VZRA 4BVFA 3CQ9A 3H9CA 5BW6B 1TOAA 3WIEA 4B76A 3GLGE 1N6KA 3Q3IA 3VVMA 4RHEA 3MCVA 4ENUA 1GZHB 2E4ZA 5GV7A 2IYRA 1DXHA 3EMKA 4MQ6A 2OGSA 4TTQA 3TW8A 3DZBA 4RIHA 3KE9A 5AW7A 2APJA 1HT3A 4EI8A 3TE7A 4GBMA 2QSZA 4GSYA 3QU9A 5JDIC 1RM3A 2ZJOA 1R6TA 3DE6X 1RJ9B 5I9MA 1CJMA 3L7DA 3RJ5A 2O5VA 5BW5A 3U13A 2NU6B 2V3VA 1EQAA 4N0DA 2W6ID 4YWHA 1HRKA 2FHSA 1U0GA 1I14A 3EODA 2JW5A 2AR0A 2VJYA 2HJHA 4E31A 2VHUA 1AQIA 1JHOA 3KEOA 2YY5A 1M6EX 1M2VA 3M5WA 4NDAA 3F9IA 2XQIA 4X6YA 4YUWA 4QWMA 2JIZD 4B6OA 5FFNA 3WNCA 2OZVA 3NH6A 4XQ0A 4RVDA 3VU9A 2C88A 4C05A 3W5CA 4JJGA 4CEJA 5BSVA 4EW1A 2JLZA 4HPXB 3WQRA 5LQJA 1D1SA 5JH7F 3WSTA 1JZQA 1O6CA 3W8DA 4EAAA 2CMHA 1DFHA 2R47A 2E89A 2YWGA 2XJ9A 4RADA 3ZWYA 2DBRA 3OIDA 5F7XA 4BPBA 1Z4QA 5ALSA 4KIGA 1GKLA 4OM8A 3K30A 2CLMB 2TMDA 3GBSA 3ZDEA 4WK2B 1FU7A 1B43A 3CLRD 2O1SA 4EKDA 5B7NA 1NN5A 4X8OA 3VKHA 4FZRA 4AN1A 2JJ8A 1YI0A 3IDFA 1ZVQA 3INYA 4YRZA 1MV5A 1ZIXA 2HW8A 4F4DA 4V2IA 3IV6A 3LC7O 3AJ9A 1N3YA 1X8XA 4D8XA 1X7HA 2NU8B 4RJIA 1SVNA 5FFFA 3AUSA 2J45A 5T41A 1FFXB 1KEPA 2YZ2A 3B2QA 1SPXA 2VK1A 2ZVQX 4KDFA 4KIJA 5DCYA 4RLSA 5DZSA 1EK1A 2VHQA 2N47A 3BPSA 5LZ8A 1UOEA 1A4IA 4GZLA 1D1QA 2X5NA 1QH0A 3K5IA 3OPQA 4F1KA 1Y1PA 4KSYA 3V2HA 2H1LA 3IAHA 2QRZA 5LA6A 3MRVA 2A59A 2VUIB 3ZE1B 1XRRA 4OA8A 4MUFA 3W04A 1EKXA 5HJ7A 3MLBA 3BGIA 3U09A 2ID9A 4R7GA 4LUCA 2V7QA 1ANKA 1RACA 2AC2A 2CFOA 2FW1A 2IX9A 4LJLA 1I2MA 2XUZA 1BE1A 4MMYB 2RGEA 1XTUA 2ZRGA 4FCWA 4C4XA 3PQEA 4WESA 1KAEA 1UXOA 2YDXA 4WOBA 5LC1A 1B8NA 3G2PA 5CLIA 4H27A 1RRPA 5FOQA 1ICIA 5KWEA 4F9EA 4TMVA 4FU0A 4FI3C 1HYGA 1P2SA 5EJ6A 4UXJA 2GPNA 1LX7A 3TW4A 3GEBA 1E0SA 2H8GA 2WWHA 1IRIA 1BW9B 1QO0A 3FDZB 4FHZA 4QUBA 5CLHA 3BQ9A 3V2GA 2YHIB 3KU1A 4HDOB 3GFBA 5A9SB 2XT6A 5TSDA 4YCBA 1WKVA 4UAVA 1X2BA 1MC4A 3ITDA 5JG7A 3HMQA 2C8LA 4CTOA 2Q9BA 1JAHA 1OC4A 4EHAA 1BJKA 4JS0A 5AJWA 1YJBA 4XJTA 4INOA 4WBXC 4JY7A 3P5SA 1P9LA 3KQOA 2OLJA 1HLGA 2NTNA 5EEHA 1L5OA 3JD2A 3CCFA 4X00A 4ENSA 1Z0ZA 2WA2A 2YCBA 4M76B 4YYEA 4PSVA 4XW2A 3RTBA 1U8TA 3DZDA 2I1QA 4TYMA 4P3YA 2PL9A 5DP2A 1SUWA 2R8ZA 4OF4A 5FQNA 3KZMA 3NWPA 4DA8A 2WEKA 4WJZA 4XUGB 4F5ZA 2X4IA 1RWWA 3AB7A 5AVTA 3CF2A 1OH8A 3CJTA 5AICA 3HU1A 4FFBB 4IHJA 4NS1A 5TGDA 2QD2A 3QZUA 3TOVA 5BUQA 1E20A 2GYWA 4EENA 4G8JA 1KMCA 4ED9A 2F1OA 3DC2A 1CY8A 2CF6A 5FJIA 2IX3A 3C3BA 4ZQFA 1HDRA 2G5CA 2BEJA 5F4ZA 5HZMA 1MAWA 4AIIA 1LV7A 3SS9X 4TVSA 5K0SA 3H17A 3EWIA 1EFUA 4I6JA 1O0CA 1ZZGA 2KE5A 1YZQA 4EABA 4BZPA 2GAOA 1K6XA 1CR1A 2FPLA 2I8LA 2JIMA 3BJZA 4BVAA 2J9FB 1KR2A 2IPAB 3UG6A 2HY7A 6LDHA 5J40A 3W4JA 4E1VA 2XE4A 4MI9A 5CM9C 3UUWA 2DBQA 3DVQX 1FMLA 3OEEA 1KFBB 1M83A 2B92A 2QVCA 3FZYA 3TL6A 3KR1A 2ROQA 5COAA 3KD2A 3F97A 1SC6A 1R8XA 2J30A 2YINC 3CF4G 3PVSA 3VUFA 1KQ3A 4UDNA 5GIPE 4ZPJA 3ZVLA 1LWNA 2W2NA 3VPBA 1C9MA 1HDGO 2JAXA 4UE6A 4EY6A 2NO9A 4MJ7A 1HI9A 2IWHA 3LYUA 4N7JA 1KXJA 3ZI0A 4HQNA 2WPNA 3AW9A 3PHIA 1U99A 4IIJB 2ZR8A 3QQPA 4PEVA 2H52A 2GBGA 4ASUD 2I3AA 3A6JA 1ZGAA 4XE5A 5LXTB 4JBGA 2OHGA 3T1YB 1XYGA 2E1RA 4JA2A 4H6PA 1FYXA 1KJNA 2C5GA 2ZIEA 3JQBC 2OTCA 1K7YA 1AN9A 2PMWB 1WW3A 3IQHX 3K6SA 2JBAA 2G0AA 2PL5A 2LCQA 4F93B 1C4XA 4FOTA 3SPXA 3WIOA 1SBHA 3DOUA 5FUVA 2WP8J 3OF3A 5DLPA 1HDYA 1NJ2A 3DLIA 1E3MA 3SC4A 1TA4A 3HY3A 2BT4A 3M4ZA 3FR8A 4EX6A 4RFLA 3QEBZ 2PPVA 2GUWA 5KMGB 5AVKA 1BG6A 1LD3A 2HO4A 4BRSA 1JKIA 2MYNA 3G8YA 3QF4B 3ROTA 3WMRA 3G0CA 1VIAA 4RD1A 2JHPA 3ZPXA 3ZQ4A 4XRGA 4LFAB 4NYIR 1FYEA 1AB5A 2PUJA 3E22A 5JAIA 4ZFNA 1S2LA 3KLPX 4E4RA 4U00A 1UDXA 5JFOA 2XGOA 1XVTA 1WD7A 5HCUA 1OTHA 1PT6A 2AD5A 2AQ8A 2X9VA 3RK1A 4MW4A 3IMCA 4BN0A 4CCAA 4CM5A 3C3CA 4TTTS 2OXCA 3OAAD 4C3UA 5CB0A 2G1KA 2QVGA 3EBLA 2DFPA 3IQGX 6ADHA 4ZT7A 1FC0A 5K7SA 4U9IS 2YN0A 3IUJA 3RC8A 1B0PA 3FVWA 3M82A 4ZV4A 3SC2B 3R5SA 5IAAA 4OAPA 1F6DA 2DKFA 4I1YA 2YZ7A 4YRNA 2VF5X 3ELUA 4I0WB 1GAJA 4GOLD 2JZNA 2IEGA 3ABOB 1IMOA 1RWXA 4V0QA 4BO8A 4D4LA 5HTOA 4RFSA 3JSXA 2NYUA 1Y34E 3E4DA 1FMCA 2FUG6 3MFYA 4UPVA 5DNVA 3BK1A 1QK3A 1U3DA 3EGIA 2AD1A 1IN8A 4GXQA 2ZFUA 1TYBE 3CLTC 4CG3A 4DIFA 1S9HA 3BXFA 4CETA 5ADWA 5IH7A 3UMYA 5J23A 3C8MA 2O23A 1YBAA 4EZBA 3I39X 5TB5A 4DW8A 1GQOA 1L5HB 2GAIA 4DLUA 3M5CA 2A2ZA 3VR0A 1TLTA 4HN9A 5CCXA 1Z5NA 3UWDA 5CP8A 5AI8A 5ELLA 2BWJA 1G6OA 1UFOA 3NC4A 3U26A 3QX3A 2R6ZA 4LXTA 1IDN1 2ZI6A 1LJ8A 4J0JA 5LYYA 1GARA 1X74A 5J9FA 1BVHA 2F3RA 1GL7A 3OFSA 5DLEA 1Y3FE 3LUHA 3TMKA 4DZRA 3LIPA 3BFJA 3I9JA 3O8LA 2EV9A 3CR8A 1NNI1 4MPDA 4AAYA 2QZJA 5IAEA 1N9GB 2VPTA 3QXSA 3WDMA 5JMOA 2QTVB 4NJOA 3BSSA 5CVDA 3P2KA 4FONA 5EUQB 5FI3A 5KNBA 2GHQA 3NT4A 1R0KA 4LBYA 3O8QB 4EW6A 1C5KA 3PENA 3UJ9A 3WBJA 1VBFA 4TV8B 1XZ8A 1Y37A 4PC3A 1A97A 4R51A 4DJFC 2E55A 4A5OA 1V5FA 4DS3A 4X65B 3FZGA 3IBCA 3ZGVA 2PKWA 1OTXA 1TU3A 1LLQA 1PGNA 3HUEA 5C4MA 4DZZA 4W1QA 1EDDA 1FJGB 4TQAA 2JLYA 2BUBA 3UOGA 3ZW8A 4S1PA 5DYWA 3UJAA 2LIPA 4U7PB 2JK1A 3LHKA 3H9QA 1RKUA 2CVOA 5AOAA 4YRCA 4CVNA 4R54A 2Z8ZA 3VZDA 4E88A 2I6QA 3H84A 3L46A 2RH9B 4LNUB 5FADA 2C54A 4UBOA 4CIWA 1GTVA 4PPFA 5B1YA 3T3EA 1SVKA 5K0TA 3QW2A 4XJXA 1JIJA 2HH9A 4MQBA 1M3SA 1SKMA 2WM9B 2QPLA 4KOAA 2FDXA 1G5IA 5EJ2A 3HCNA 2WYUA 4F60A 2O8DA 2WAAA 4CMCA 4QNRA 1VOTA 3L0DA 1M1UA 3ZY4A 5DSZA 2BKEA 4QTYA 3THYA 1RTTA 1JG4A 1W73A 1C7EA 1KO4A 3HV0A 3GJQA 1NM5A 3PQFA 4KVZA 3EE6A 4Y18A 1CSEE 3OJOA 4YJHB 5J5VA 3TSYA 3VTZA 4C6RA 5I3CA 3LPAA 2HJVA 2DPMA 3G2IA 1CUGA 1MDBA 2ZBFA 3LFHA 4ARSA 2UZ3A 1NW6A 1TM5E 4ZI3A 4O63O 3HYNA 4DEYA 1P3JA 1XJWA 1DB3A 1TVKB 4X3CA 3F7NA 4DMGA 3NTVA 3DEFA 3IEMA 1YOVA 2V55B 2VPWA 5AJUA 2BFAA 3O90A 3BIWA 5IM5A 3IBSA 2AOVA 2G5GX 1H66A 2EKPA 4LKOA 4RD2A 5DHAA 3TVDA 1NDUA 2VNSA 4NBVA 4AW9A 5L9AA 4KQCA 5K6AC 2V96A 5LMNB 4IDOA 3BFKA 3RBXA 2NYAA 3RFCA 1O97D 2JI4A 3D6MA 3VO1A 2GAAA 3D6VA 4E32A 4KREA 2O1WA 4I46A 3KJXA 2Q2OA 1KVQA 3WX0A 1DELA 1LDMA 4L4ZA 3NOXA 2PSDA 2PMDA 2G83A 2WU3A 3FY4A 1G2PA 2P4SA 3CH5A 3URMA 4C5AA 3H5IA 2J6BA 5EIAA 4XB2A 5JC1A 3DV2A 3WWCA 1JYSA 4RK0A 4P3XA 2PGIA 3CRQA 4MJ3A 4AZSA 4KIFA 1WNTA 3LSTA 2B6NA 3OU6A 3Q5DA 4LSZA 2IU4A 3MGAA 1RS0A 2O2JA 2H4WA 2HTEA 2OV4A 5C81A 5MN4A 3F71A 3IHWA 4OK3A 1FFHA 2RARA 3SM9A 1H2EA 2VP0A 1YE3A 4HDAA 1TIPA 3OUTA 2C2GA 2MR6A 2CMKA 5LWHA 3WHIA 1JIKA 2FEXA 3L6EA 5AVYA 2AQHA 3FMPB 3RFUA 5IC4A 4D4IA 3P4XA 2PSSA 1R8SA 4NPAA 1Y9EA 3ILXA 1ILWA 3GT0A 2YW9A 2JFNA 1JHQA 4GSKA 5A5VA 3CVJA 5ILOA 5BUSA 1QX4A 1TTQB 3N3BC 4DC1A 3OWOA 1RVV1 1XJQA 3VJMA 1F06A 2J5BA 3WTBA 1BGVA 2XZOA 1T0IA 1FCJA 2J33A 3ZK8A 5CLLA 2QRLA 3LDUA 3JX9A 3WC4A 3N8DA 4NPHA 2F48A 2IYFA 4UJ5A 1E4EB 3IAEA 1GGHA 1S4QA 2Q3HA 3RGGA 1UK6A 1WZIA 2CNWD 2GJAA 4RK6A 2XYQA 5EIXA 1E3SA 4QDUA 2F8MA 3GZNB 4RK1A 1GG2A 2A9OA 3BD7A 3ITNA 1V5WA 3H97A 3HKDA 5JAOA 4IGIA 1ISHA 1BVRA 2ECFA 1YK1A 4G0XA 2GETA 1TAUA 3GDOA 3AR4A 2J7KA 3PDHA 3P9QA 1HE1C 1QLJA 3QHAA 3UJCA 3RIHA 1TYDE 2E1PA 2RHJA 1O6BA 2GVNA 3MUOA 3LGSA 2CEAA 3NDIA 3GAFA 5D87A 3FZQA 3OCWA 3R23A 5J2TB 1H1TA 1D6SA 3OHPA 2BFNA 4PGHA 2CFRA 1U0TA 1NFFA 1PWHA 2PAFA 1YDGA 5AMXA 4D6PA 5CFQA 5KJ1A 1P45A 4Q9AA 4JI7B 4CUJA 4NEGA 1DIHA 2HDHA 5J4KA 2XTNA 4XA8A 3IPYA 3OZXA 1CWUA 4PTLA 1E1QA 2WJ6A 1W5BA 4K6HA 1WSWA 4QRDA 5B55A 3TOZA 4M9CA 5FTMA 4DR2B 2PLFA 4ZC8A 1RIFA 3DVAB 3MSCA 4L9WA 4O4LA 4D9HA 3FYUB 2R6AA 2F3QA 2WM2A 4DBLC 4YV1A 4L57A 4N4AA 3JASA 1XTRA 2ICAA 2AVNA 2X5XA 2RHHA 3TTYA 1H0HA 1TU4A 2JHCA 4N9WA 1XT6A 4XM1A 3PR2B 4IXNA 3R7FA 2BTOA 3H6HA 3T1VA 3EBOA 1SG9A 2Y1EA 3QWFA 4K9MA 3WYEA 2RK6A 4ZQGA 2OXTA 4BO7A 3CLKA 2YJ6A 3GRVA 4R16A 3TK1A 4FB4A 2CV2A 1ZW6A 1IHUA 1YS6A 2DC1A 1J2EA 1A4RA 1RLMA 2G67A 1X1CA 2NZYA 1ZOPA 2E49A 2O3SA 2PMCA 3GCXA 3PL5A 5CGZA 5BQFA 1M67A 1SXJB 2JHFA 3UT6A 4DWOA 4WQMA 1VXOA 5DGXA 3IEVA 1X7YB 4II2A 2XODA 3OEYA 4JBNA 3JWGA 1PL7A 3VMFA 4JVLA 4M88A 5AJTA 5HCNA 2D54A 2GFIA 4Y6PA 3ND8A 4CKXA 2AS0A 3KOOA 1NZDA 2ZYIA 1UC4B 4HATA 3CJQA 1YH3A 4ZGBA 2JJ1A 4HVTA 4AI6A 2FEKA 4AO6A 3KYDA 4LZAA 4FHCA 4NYJR 5JY1A 3O03A 3BE5A 3UPTA 2YQZA 3C3KA 5KYUB 3WK4A 3JZDA 1QH8B 3BMQB 1KI3A 4OH1A 4X20B 4WJKB 1KI6A 1Z07A 2J9XB 2XD4A 3NYRA 1X77A 5LMUB 3O8RA 1UKYA 2HPZA 3IIJA 4UUPA 3KT3A 3HL4A 3ZWOA 2VDPB 5DN9A 1QUFA 4MICA 4B74A 4G3XA 1ENPA 1W88A 4FEGA 4IVQA 4DB4A 4NARA 4RVFA 2W8BA 3KHKA 3QKUA 4EG1A 4WNAB 2WD9A 2HDNB 4G56A 2FW0A 4PZEA 1REQB 2QPOA 3Q7EA 1NXVA 2VJQA 5CJ2A 1NW3A 1NR5A 2ZULA 5B3JA 3OIGA 4QOGA 3EN0A 1PZXA 5B3AA 4BLVA 4R0NA 2R8YA 1SA0B 1USUA 3QH4A 2PSHA 2V8BA 4HWRA 1FX0B 1BXKA 1T8UA 3KQKA 4CKWB 2OHHA 3SQMA 5I7EA 4DARA 2CZCA 3PUYA 4FMDF 3PT5A 5HKAA 5COQA 5FNVA 4X90A 3VC2A 1DDGA 3ER6A 4D3XA 3NT5A 5JCOA 1NZJA 3FUXA 4QHTA 5JSZB 1ACMA 2OZKA 1UJMA 1TQDA 1NXTA 4XSVA 1QGUA 4E22A 3RRYA 2COKA 3GGJA 1Q7EA 2DUWA 4MWOA 4NJMA 1ZGCA 3RODA 621PA 1E8NA 1MO3A 2R66A 1OLSB 2H0AA 3E18A 1JPUA 3P0FA 4XZ3A 2ZYWX 1F7VA 2WM8A 2J09A 1JB9A 2AFIB 3N6RA 4FDMA 2X5JO 2VUHB 4GI5A 4D3YA 4X1IB 1FA9A 1OZHA 1C1YA 1TVEA 1PS9A 2D7CA 3I2JA 5SYMA 4MLDA 4MW1A 3USZA 1AV6A 4JP2A 2C95A 3M0EA 4MKXA 3OLQA 1XALA 3I58A 5DM1A 4CU5A 1KS9A 1SG6A 5BQOA 4YN3A 3AVTA 1USWA 1TA9A 2VBCA 2H1SA 3DDCA 4IQGA 1JDBB 1SCIA 4PY2A 4AURA 1LNQA 1YE5A 1RHKA 1ZFNA 3SYKA 3VVLA 4BFCA 3WDKA 1H2ZA 5IKPA 4P7BA 1M2NA 1PQWA 2FQQA 3F96A 5CT8A 2UXDB 2A1IA 5KEIA 2ZZNA 1X9GA 3JVIA 2Q6IA 4F2DA 4HYEA 5CA1A 1DPGA 3AV3A 1EDBA 2IHUA 1OB2A 5H68A 1FW6A 1J4AA 1Z3IX 2VDWA 2GX6A 2QYHA 1YRYE 3W9YA 1SRQA 1DC3A 5HZKA 1GYQA 4P3PA 1EFPA 5JVDA 5JARA 1T8PA 1P0PA 1E1CB 2BFPA 3CNQS 3D3QA 3GW8A 5FUWA 4CFYA 3RW9A 4CMKA 1SMKA 2ECQA 3W5AA 2ZUTA 4FZ5A 1FFCA 4MIKA 1QANA 1OJ7A 1C3OA 1OBHA 2CVFA 2V5UA 1YZHA 4G1CA 3PDCA 1VJTA 4ZEOA 3WYNA 1TMYA 3ZD6A 1NUTA 2HA7A 4R2JA 2VZ9A 4IWYA 4EG7A 4J90A 3WSWA 4D6YA 1G41A 2O2HA 1KMHB 3MJRA 5HJ5A 3J81A 1EE1A 5IKMA 5BR4A 2FV8A 2VDQB 2X5OA 4ON9A 1OFUA 2H92A 3GJ4A 1VCHA 5HDQA 4JAVC 1YZVA 1YULA 5D3MB 2RSLA 3CH7A 4MUNA 2EX4A 5C8YF 1BDIA 1OT5A 4IUYA 4YAJA 4LWZA 4TLEA 4QLBA 3SVTA 3ACCA 4MX8A 5EP3A 2NO4A 4C20A 1DG9A 2DLNA 5E6SB 1I6MA 2GR9A 3N5KA 2EP7A 1VHQA 2ZSIA 2Q1UA 1U3FA 2MINA 3K0AA 3RVDA 3JQPA 1XDBA 1L7QA 2FSGA 2HHJA 4HT3B 1M75A 1UDAA 3NOQA 4KV9A 4RDXA 1W1WA 1T24A 1UFQA 3R2JA 1YQGA 3CZRA 2QE7A 4W4TA 4XIFA 2FEOA 5F4BA 5CIQA 1A8HA 2OPBA 3AG5A 1LRLA 4CCYB 1F0KA 4IMJB 1SU4A 1P39A 3FIUA 5L3SA 4WLNA 2RKOA 1WDMA 5SZKB 3JD3A 1VJDA 3RG8A 1WCV1 3AHGA 3C3WA 2QMEA 3TE6A 5C18A 2IKQA 3M89A 3DMNA 2BHTA 2DG2A 4IIBA 7REQB 1J21A 2NXCA 4TYYA 5C8VA 2ZTUA 1ISJA 3BB4A 5ALVA 2PUDA 1I6WA 4A0RA 3F6RA 4ESVA 1XKLA 2PD4A 2PRIA 3F3SA 1JEJA 3KB1A 4U7TB 4V0MA 3LOQA 4CF4A 4A15A 4XWOA 1TD1A 4WFKA 5KYXA 4MMXB 5KUTA 3RVBA 1VFNA 5A71A 5YASA 2YJNA 3WG9A 1HM5A 1VMAA 2HNKA 3ENQA 1WETA 4LIPD 4N01A 4P38A 3GEPA 4NZNA 5AK4A 1PKXA 4GGPA 4KOEC 2Q0HA 1GL6A 3H8WA 3PXDA 4OYRA 4UXHA 2XQGA 2IEAA 5CXQA 1QRDA 2IEBA 4XX1A 2VG8A 2FPKA 1L7DA 2RB5A 2P6PA 2R25B 3EMVA 4TYQA 5TEWA 1N6PA 1WZEA 1ONSA 2WSYB 2NGRA 3B3FA 2VT6A 4OXYA 4LXUA 1Q14A 3DCYA 3IC5A 4UEJA 4E5KA 1XHEA 2ZM5A 1IWPB 3PUWA 1OJLA 5KPDA 2DQSA 4QUJA 5F5NA 4CKEB 3G1TA 4F9TA 3IB3A 2VC2B 1YNSA 2GUGA 3MAAC 3NT2A 5KNDD 5EKXA 4EKEA 2OCIA 5JNTA 1KIAA 3H4MA 3GT7A 2PUAA 1LBIA 1C1DB 4NBKA 3ORFA 4TROA 3KZCA 1QZUA 3A36A 2YQ4A 3EFBA 4G25A 1QIIA 3AJ8A 4K9DA 5DXJA 2V4MA 5CPFA 3WQHA 5LBUA 1QFMA 4LF8B 4DLNA 1F60A 4QDJA 4LYFA 4DRYA 1O94C 3BRWA 3R4CA 5BQPA 2C9YA 4LRUA 4DLVA 3I0NA 4G85A 3IPLA 4NU0A 4PFKA 2YMPA 3WHLA 4DFDA 3N9IA 4BNUA 2C2XA 3I92A 4PLCA 1IXYA 2J4DA 4J6FA 1JT2A 2HK6A 4TL8A 5ALIA 3NALA 3EIEA 1NVUQ 4TWJA 3R7LA 3TVTA 1LRKA 4V0RA 1IBLB 3I53A 1O89A 2J0SA 1MZPA 1CVRA 4NTZA 4Q4HB 5CK4A 4CM8A 4KDCA 3CX7A 5K8TA 4X9XA 1L4YA 4ZYXA 4QQKA 4ZYTA 3IAM1 3BB1A 2B99A 5BT8A 2FA9A 4Z1MD 5BV0A 5KOJB 3LTNC 1KYVA 2H7YA 3BAZA 1PL0A 2QT9A 1E2NA 1KDYA 3N6VA 1JHYA 1SEPA 2HDOA 1W4RA 1NRWA 4TTSA 2BKVA 2YMQA 4N3CA 1L6IA 1E96A 4JJ8A 2LRHA 1I4OA 1QK5A 4LJSA 4RMGA 5AI4A 3I6BA 4I66A 1VIDA 1EVJA 1VKNA 1MABB 4PTYA 1NVVR 2A9FA 4Q37A 1NBWB 4G5XA 4TV9A 1V9CA 2O5CA 1QBKC 2WMYA 9LDBA 2QTWB 3GVHA 2FJ0A 3AVQA 4H1TA 3LUAA 5F9HA 4Z4GA 3WGGA 3ONNA 5AKKA 1XK7A 1VA4A 1WZUA 1X7GA 1YQUA 2H18A 3UHAA 1DUIA 2HJRA 2HT6A 1E66A 4AROA 4JUDX 4BNIA 3FHLA 3U3KA 1IG0A 4YCNA 1U5BA 3L0IB 3UGQA 2K7FA 4N5HX 1KEKA 3RTGA 1QU3A 5EMMA 1EP9A 1OC2A 1HYQA 1J8VA 1UFKA 2FW8A 2QZ9A 3D4LA 5AI6A 5BNWA 3KAPA 4UZSA 3VH1A 4JR2A 1G2QA 2IOFA 1MO4A 2L19A 3GG9A 1OREA 4PC2A 2NG1A 3GELA 4TLAA 1AN0A 4O02B 2R1TB 1IATA 3H99A 1K63A 4IUDS 3N76A 3TQRA 3VJLA 2HRDA 4OQEA 4JZKA 4R9RA 3WDLA 3RGWS 1BJTA 3OM0A 5H5JA 5LQUA 1SH7A 2ZB2A 2GAJA 3WHPA 3TDNA 5T7BA 4X41A 4AZVA 2VOJA 3GJXC 4LRSB 5CMLA 3R7DA 5LD2C 3OQIB 1ZSYA 3G23A 4BO1A 1ODLA 1K89A 1SUAA 1NMEA 2BFWA 2BFEA 2F43B 1T5IA 3W2TA 3SVLA 5E4FA 2PGLA 2SKCA 1QC5A 3IIKA 4M8NE 2FR0A 1T29A 3FBWA 1DE0A 2OKGA 2IZZA 4L8YA 1KE1A 4FNAA 3UAOA 2R8PA 5B12A 2ZDGA 2CYAA 3LQQA 3S29A 1HURA 1O8CA 3WFIA 3WK7A 3DEHA 3ZHCA 1NA5A 1D2AA 2FK8A 2IYAA 3UJ8A 2P2DA 1KZ6A 4WKCA 1VYVA 4CLEA 3LXXA 4EO4A 3ER9A 3PB3A 3WL6A 5KNBH 2X14A 2A0UA 4NE9A 4Y0AA 5L3RA 2X22A 1XRSB 1YUMA 3ZVRA 1IEXA 3DYIA 3T1NA 3FVQA 3JY6A 2BR3A 5C7LO 3O3OB 2VDVE 3CF6R 5CFOA 2QJRA 2BZ1A 4FXOA 1E3DA 3TQQA 2XQJA 4BMCA 2B4RO 3BS4A 1FFAA 3RV4A 1U7ZA 3KUDA 4DCJA 1JPJA 3VGJA 4P81A 1J0AA 2X4DA 3JQ9A 2BOVA 3R7BA 3Q3EA 3UHFA 4G0QA 1OXMA 2CE7A 1NF8A 3KZKA 4GVLA 3NFYA 4Q6BA 4B40A 2Z6UA 1I51A 4EW3A 4X3OA 3EDMA 4LMBA 3L0BA 4Z9YA 3RH0A 3LUGA 4K87A 1TO6A 1ZR2A 1MB4A 2A5DA 3H1GA 3V4RA 2A4MA 3I01A 1UINA 4AJHA 4RZ3A 3TL2A 4F2PA 4YJ2A 3FRIA 5AJXA 2EHDA 1ZEMA 2IXFA 3F6EX 1GTG1 3JYHA 4HSGA 4RCZA 1Q7TA 3MTEA 4PGMA 5DT2A 4GQBA 4CKBA 1D2CA 1TTTA 4FSXA 4WTOA 4EARA 1J0XO 4JENA 2B21A 4RF3A 3Q7RA 1DQSA 1XWFA 2WSSD 4HNSA 1WMFA 1NNSA 3DOOA 4QXRA 5HMMA 5K0ZA 5HIJA 4DILA 5CB4A 4OAQA 2BMDA 2KQUA 2O0LA 4ZOLA 4AX4A 3QVLA 1SBTA 3IMEA 3HYRA 4JNKA 3GLSA 4TLBA 2XCQA 5H80A 4BLQA 2J7PD 3AKEA 3V8NA 2P4QA 2ORIA 1SC3A 3RU9A 3TRIA 4ZCMA 2C9OA 1X7ZA 4MVXA 4L2IB 1VBNA 1WLSA 1RXSA 2PSJA 4NK5A 3DD1A 1QE3A 2Q5JA 4I50A 4LXGA 2O0HA 1P7YA 1T8TA 1QHFA 4REMA 4CIAA 1XDZA 5IDQA 4PBRA 3LQKA 1XJ0A 3GJYA 3HVIA 1DXQA 1ZIPA 4NNJA 4RAOA 4RPKA 1KK2A 1PSDA 3AM4A 1NUPA 2W6CX 3OT1A 1GU7A 1OXVA 3VNQA 4AX8A 2JFZA 1CUVA 1GGVA 1VI5A 1NJSA 5JNVA 1T3HA 2D2VA 4J1QA 4O4IF 1YAJA 3BTOA 1GR0A 3T7AA 4XDGA 2GA8A 1EIZA 2ALJA 3O4IA 1H8HA 1L7RA 1SVOA 2XV1A 5AKLA 2WD7B 5EXTA 2X7HA 3E3LA 4HRXA 1J07A 3ILHA 2YV4A 3F90A 3P94A 2V97A 3RYIB 2N75A 3WYGA 1R10A 2Y1CA 2J32A 2PLRA 4QYXA 2H29A 2PH3A 3ZDYB 3EHEA 3HA2A 1QB8A 3IH5A 3ZC3A 1TJ3A 4DBVO 1GSIA 2G5PA 1RPJA 2GCEA 3EEOA 1N1MA 4JYAB 4UQLA 2Y9PB 4NAVA 4F8JA 1E1KA 5D3ZA 3WNVA 1FUEA 5KU7A 1ZONA 3G0OA 4R84A 4DIKA 1SKYB 2MYPA 3HJTA 3NX4A 4FUQA 5EJMA 2QT0A 2O0KA 3L4SO 3PVCA 3P52A 4DG5A 4RSHA 1T2EA 3VPGA 4EY5A 4RPHA 5GPBA 4HVLA 1SD2A 5EJIA 2VDRB 5EMKA 4X97A 1DKMA 1LY1A 1UEXC 1N5LA 1N2CE 1OPXA 2ZCUA 1OZGA 2ZIXB 4MIYA 4MV5A 3JYPA 4I4TA 4R0VA 2IV7A 1FYWA 3GA5A 2VP2A 2CL7X 3G6KA 2WTBA 5C9ZA 2MWMA 3H65A 2QI9C 5LR6A 3C6MA 1GSAA 1IEQA 3KYBA 2MSNA 3HKEA 4GIBA 1VP9A 3ZE8A 5TXGA 1RSZA 3AONB 5IG2A 1SZPA 1W5TA 1JN0A 2VHWA 3N2YA 4ZU1X 1VI6A 2IIPA 3BCRA 1L0BA 1LLFA 4UHDA 3L82B 4GP6A 2PT7A 3P0EA 4OHRA 1FDSA 3CE6A 4O4JF 5DKFA 2E85A 1TUEA 2I55A 5GONF 3ZVNA 1AJEA 4MWEA 2OA0A 4J1TC 1FTQA 1A4UA 2AE1A 2BRUC 3OZIA 4X60A 1OVGA 1VE7A 1L1FA 1ZRSA 1X9IA 3HXLA 1Q12A 4MSUA 3IRVA 1U80A 3JQ6A 4PX3A 1Q0RA 1W4LA 3L77A 3VOTA 2UYOA 1PLJA 1KR5A 1Q1EA 1XKTA 3H2HA 3MXTA 3P2JA 4BRZA 1I33A 3A9RA 3DE2X 1K4YA 1EMDA 1SHKA 2B3DA 1RWVA 2ZSDA 3PXBA 4KR3A 1IHDA 3EVZA 4INJA 3VA7A 3BL6A 4D79A 1C7FA 3KWMA 5DM70 1EFRA 4RVGA 2XOKA 3EVBA 4FKBA 4XGKA 1XZNA 4KVFA 4JJKA 1S2OA 1UKVY 3P2YA 5BSRA 4D4GA 4C6HA 1T8YA 1TK3A 4Q6WA 4W7HA 1JLKA 4JBLA 3HKBA 4N7BA 3HDQA 2BI4A 1ECJA 2JARA 2BE7A 3WMEA 2RHRA 2F3TA 3UICA 3PPIA 2WZBA 3A04A 3CLSD 3VKFA 3D2LA 1BOFA 2ORYA 1KVUA 2Y66A 4CIVA 4D92A 4OJTA 1KI8A 3Q15C 3BD6A 3QY9A 2V6BA 4QFDA 2BCJQ 4J3NA 4OKIA 3Q3CA 4C4TA 5L7YA 4N5MA 3ZU5A 5K0BA 1RM4A 2IWRA 1KYTA 3K0SA 2GEUA 1BRMA 1G6KA 1SC1A 1U1CA 3H9EO 2BIFA 1DL5A 2WVHA 4MHOA 3GLHB 1OXKB 5DOZA 5JAUA 3HJGA 1LDEA 3A9UA 3K31A 4LK2A 3E03A 5D3KA 1E59A 1YGYA 2QQ5A 2VYCA 3GJSA 3UMSA 4K1LA 2HRBA 2Q5OA 3DHYA 4YJ3A 3T1TA 1PN3A 2R8EA 3FX2A 3OEHD 3KKEA 2JDID 5T5QA 4PN7A 5DTRA 7ABPA 1TT5A 3SXPA 4MITA 1D0VA 2A86A 3U19A 1XNGA 5E1DA 1M1NB 1F2UB 1LLCA 3KTDA 1K0FA 2JKVA 3H3JA 5DH9A 4G5OA 2AN1A 4M0EA 3DWGA 5TGTA 3B13B 2BBTA 3C4VA 4P5DA 1UK9A 4YI5A 1ZKDA 2J5RA 4EYEA 2W37A 2XZPA 1FLDA 1AMOA 2PYIA 1Y6GA 1JLMA 3PWSA 3OP4A 1T2AA 3H2IA 2EBHX 1RJDA 5D51S 2VHEA 3ML1A 2ZRHA 3LXMA 3QWAA 2D2FA 4R2KA 1DDOA 5FL7D 1UBJS 3CLHA 2OORA 3NVDA 5ICGA 3CVVA 1P5JA 1T3SA 2H31A 4UFNA 1AM4D 1Q74A 2F4NA 1T5LA 1GCIA 5ECGC 3N6XA 3AINA 4QAQA 2OG2A 4C06A 3DFKA 2SCUB 2WIAA 1LEHA 2BZGA 2HRRA 2NWQA 4YJGA 1KIFA 2RAUA 2WNIA 4BLOA 4FWTA 2GD0A 5EMHA 1KJJA 3I8SA 5EXDA 4HO1X 5JSUA 3HADA 2PU5A 4QTXA 2BM1A 1P4HA 3BMCA 4GPEA 4KO8A 4IMIB 3KQYA 4CWAA 1E32A 3JZMA 3I6MA 4HGYA 4WY5A 5GMOA 3G2LA 3V8MA 2EKQA 1RLIA 4PU0A 3ZY3A 1IZ7A 3GRUA 1KQFA 3OKFA 3F74A 1QF7A 3P9IA 4QGFA 3U3JA 3CFYA 1GUBA 1NBIA 1WO8A 3IVXA 1K4MA 4J2OA 3TRKA 1RJWA 5DNCA 4RYDA 2UYYA 1JXOA 4DV0B 1GRVA 4JX9A 4DDTA 1H9AA 1R00A 3QJ5A 1IN7A 1SHUX 2I62A 4FGJA 4LZJA 5FTLA 4KYIB 1HNWB 4FN4A 2D1SA 4FHGA 5DT9A 2NUBA 4LSWA 4D02A 1SOAA 1XSEA 2Q3LA 3FFTA 2VDKB 3H0CA 5C80A 1Y3DE 5GOZA 2MSWA 1MAAA 1WPRA 1P62B 2C03A 2C58A 3EY9A 3IEIA 4JUIA 5KVAA 1ULBA 1ESEA 2OV1A 5F73A 4YRPA 3IE1A 3WADA 5F23A 1FS6A 3O83A 4UVGA 1CY1A 2Y68A 1P6XA 4BQPA 3FRJA 2H48A 3RSFA 1O94D 1C2TA 4G36A 3Q2OA 2YHAA 3O2SB 1TKCA 1U7OA 1H0KA 4AP6A 4CF5A 2O3JA 2W2VA 3E82A 5E0OA 1Z45A 4WZBE 4KR6A 3KVOA 3OE7D 3IIMA 4NFLA 4KG7A 3PHJA 3RUCA 3KE8A 3QLTA 2W42A 3P2EA 2PUTA 4BMNA 2B25A 3LVBA 1BH2A 2IS1A 2G8NA 3SS8A 1E94E 3SBEA 2CT8A 5KJCA 1PGJA 1BXGA 1TCCA 1UCFA 1V7QA 4FT4A 1RKVA 4G1FA 3RC1A 2B8JA 5E1OA 1FYDA 5KOHB 3TZBA 2A5GA 5J4LA 1ZGHA 3Q3VA 4C21A 1L5YA 2C04A 3A4NA 2LZ0A 3U2QA 2AW5A 2I66A 1FP1D 2HKIA 2HNAA 3KZVA 3ASYA 3HP1A 3H1BA 3SIPA 1E1DA 2XUJA 4FQ7A 4HB2A 1IONA 3FOBA 4XD7D 4PLGA 2I2WA 1Q91A 2A67A 5GY7A 5KDDA 3FGOA 4NMMA 3KUUA 3LNTA 4JITA 1RR6A 1SXGA 2IUFA 2WSBA 2Y1WA 4KZKA 5C1OA 1SZDA 2E37A 4IGAA 4OUKX 1Z2EA 5ICCA 4ZT4A 2XCIA 3IILA 1U65A 3PTZA 3F49S 3HB1A 2IODA 3AYZB 2PEYA 4BNYA 1PYGA 2BBSA 2GF2A 2C2WA 4A6EA 4DLZA 4COKA 4I55F 2HDWA 2YIMA 2FW9A 4RY0A 4YPOA 4BNDA 4XWKA 1U2QA 5L8VA 4CLOB 3H1AA 4UBIA 4Z3OA 1E2DA 3C5WP 2YXBA 2I1LA 3ADBA 5CA0F 1HFWA 3R7WA 3O9VA 1SBYA 2Z08A 3IPCA 4DLKA 4F8YA 1AOXA 1N3BA 1RI3A 1C3JA 1YZ3A 4RPJA 2QAGA 1DKQA 1JQJC 1NJFA 2ZB4A 1FP6A 3CKLA 5TRTA 2ON6A 3OQBA 4PHFA 3SIWA 4WJLA 2VTBA 1AK1A 1S2MA 3IDZA 3N2IA 3ECCA 4MPJA 2VSYA 3P1JA 5TMDA 2BFFB 1QHXA 1PKEA 2GPYA 3V9PA 1G8PA 1PJTA 4FFVA 1L7BA 1LDYA 4YPVA 3IMKA 1ZIDA 1L5VA 2I0FA 4DABA 4F9GA 1XWIA 3PQDA 1LK7A 1H6AA 4R6XA 3F6CA 1PD0A 3VHLB 5BUZA 5IZ4A 5I7UA 1NPDA 5CAEA 1N5MA 2R6JA 1E79D 4JX8A 1T4CA 4B4KA 1UMKA 7YASA 2H3HA 3I1FA 4E6EA 5IULC 3I5XA 1WEKA 3O2QB 2HZBA 4G0PA 3RBZA 1N5DA 2NAPA 4DBLE 1M1YA 3PJEA 4LGYA 4Y6SA 2AXEA 5EESA 1GUYA 4QDTA 4Y3UA 4DUZB 1CT9A 2ENWA 3R6LA 2WKSA 5CCBA 4HAOA 4DY6A 1OBFO 1ADFA 5KJFA 1YMVA 3LL4A 4KO4S 2NNWB 3T15A 3QPUA 4JHLA 3Q7TA 1XMPA 5KYYB 1QQ7A 3CIOA 3LCRA 4LV6A 2PWPA 1THZA 1E58A 1V8OA 1UMCB 1LC3A 3L06A 1CQIA 5E9AA 1I9CA 3MHTA 1US8A 3G5MA 2KX7A 3L02A 1AQUA 4HZUA 3TIGA 1TK9A 3H8VA 5MN6A 1N4DA 1D04A 1FJHA 2C96A 4Q4AB 1H2RS 3RSGA 1RZVA 1W5AA 2EL7A 1WHSB 4LVNA 3PTAA 3LVQE 4JBWA 1U7WA 2I4TA 4R9SA 3UAYA 2P90A 2WKPA 2YXPX 4YRFA 4BFWA 2QVLA 2JCYA 5FO1A 4MUGA 2BFCB 1RPTA 1TKAA 1YS1X 2VKQA 2Y1LA 2Q4EA 3FDIA 3HEBA 1MA0A 1TCAA 4UXIA 5U1PA 4AF7A 2G06A 3AY7A 3CNLA 4B45A 3DGFC 4DHWA 3OZVA 3CVXA 1U1FA 4AWAA 2F55A 2HRQA 3S5UA 5JXWA 3N0VA 2D2XA 1DCMA 1OV6A 2GS9A 3BXGA 4J1SA 4IRMA 3LDGA 1MPTA 1AZTA 5JXJA 1L7VC 3KZ1E 4NBLA 5C8DA 2Z58A 1Z34A 3MYYA 2FGKA 3GVIA 2WK1A 3T5PA 1E7RA 1PEAA 1F48A 1C80A 2TRSB 5E7MA 3W2FA 3DE1X 2HA4A 1E4OA 3RKRA 4XGQA 1ZM2A 3UCFA 4ND6A 5FTKA 4W63A 4PNEA 1C0PA 3L8CA 4RTJA 3D31A 3DLAA 3EK2A 3AEQA 3OOHA 1R7RA 3KNZA 4YGXB 4DXHA 4U0KA 4AJEA 2ZUEA 4G65A 5KI6A 5EIEA 1W4AA 2EEZA 4FNGA 3WR5A 4JB0A 3A06A 4LBWA 3EW7A 2JGLA 4L76A 3VNBA 1DBWA 2OYCA 1BZYA 3P2IA 1CZLA 5TLSA 3GLKA 2BC9A 3K9WA 5DHRA 3IBGA 4GBGA 4Q5IA 4DCVA 4DV5B 1WOMA 2HQ1A 1RXUA 4R8KA 2DRIA 1B3RA 1ZD5A 4CZ2A 3FB4A 2EERA 1EGHA 1KP3A 2H85A 1J97A 2D0DA 2H4FA 2Q21A 3ELYA 3WGLA 3E48A 2XYGA 1DKPA 4WN3A 5AHKA 3MNFA 2KLHA 5EZYA 4ND8A 4AXBA 1J25A 4MDHA 2EKBA 2CXXA 3JQ8A 2ZJBA 3A31A 1XZKA 2O7RA 4R69A 2CW5A 3CLUC 2QROA 4GKKB 2QQEA 3AEKA 3IAS1 5AW2A 3NXSA 1RZRD 1VL0A 2BGJA 2FPUA 3DFMA 1Z8NA 4HB0A 1CERA 2XX3A 1L4KA 1GDHA 2C31A 3CB2A 2YCLA 5CH8A 4RKWA 4Z99A 1CUWA 2ZRIA 1P1CA 4F3CA 4FWIB 1BVUA 1Y9DA 3P0IA 4QPNA 4CMIA 4C7JA 4F3TA 2MR5A 1Z7GA 4LZWA 3UJPA 1DMRA 3GGDA 1P72A 4N6NA 5JQWA 4JIMA 3ELBA 3ACDA 4PXAA 5DMXA 2I71A 2O7SA 4DN6A 3OSUA 3K9LA 2J1LA 4HNQA 4Z4FA 1S0UA 9ATCA 3WJ7A 4DQVA 1GTRA 2FMIA 4M86A 4E5DA 1ULTA 5EJAA 2OYSA 1ZN7A 4RHFA 3NIGB 1JSLA 1XRJA 3PD1A 4GEKA 1YFJA 1CUUA 4WINA 3IIEA 1H6DA 2RGAA 3OKPA 1RJ9A 4OSEA 3CRVA 3E7PA 2NU6A 5I7WA 3JVVA 2P2CA 4KU4A 4CQLB 3QVGB 1S1MA 1ZK1A 2A9VA 4MYSA 3IAM6 4O4JB 4HPJB 1OZAA 4PZLA 3G82C 3S68A 4CW7A 5K4GA 3F7MA 1J33A 2EHJA 4JT8A 3KAJA 3A4MA 4B5LA 1P44A 1R0ZA 2VWHA 4XIYA 4AJ9A 3I28A 5IZCA 3A9VA 3SZLA 2IYLD 3M83A 4UDYX 1PZNA 2Z56A 3IP6A 2IV2X 3S2FA 1F4LA 3H9UA 4R2HA 2EDCA 1X80B 4C7OB 1GCOA 3OX1A 4X54A 1MX3A 4BGIA 3R5KA 1P0IA 1A72A 2VHJA 2VRCA 3CHYA 3PNMA 5CCEA 1Z0IA 1M33A 4E5UA 3L5KA 1EVEA 3E7XA 3ORQA 4ZYZA 5A2QA 3VH3A 3OZDA 4CUKA 1DKLA 4BY9E 1LVUA 2O5EA 3CEPB 4M9RA 2RGNC 3L8MA 4DR4B 4IYJA 4MVJA 5L6LB 5IN4A 6AT1A 4Y2UA 1FX1A 2QRKA 2NU8A 3TBHA 1FFYA 1AMNA 3CRW1 1FFXA 3PQ5A 1X6VA 3RSHA 2HQRA 1QTIA 2PVPA 4CIDA 2Z5LA 4DTIA 1B1AA 1N0UA 4PYIA 5FUYA 1SHTX 4DSUA 2QRJA 2BL4A 1VCNA 4PQEA 1G2OA 2BKLA 4Z7JA 3S44A 4UJ3A 2UVQA 4WKNA 3BGSA 3S27A 2CDBA 4AK9A 2CB9A 3U39A 3QWBA 1K0UA 1P3Y1 2KMLA 2VWQA 4MYRA 5FLXA 4MYDA 1YBFA 1EBFA 4A7PA 5C46F 1E18A 1U2SA 4GZ6A 4H4EA 4ONEA 3KQTA 1SOUA 7GPBA 3DTVD 1QVZA 2C4UA 3DBOB 3ZI4A 4EUSA 4KAFA 3B1ZA 2D1YA 4CQNA 3AL2A 3GT3A 4I4IA 4LWQA 2PPLA 5CNJA 3UUGA 3IA7A 4XI9A 4Q01A 1BDMA 1R0RE 4RD6A 3H87A 3MJHA 3VPCA 1IZ9A 3LPCA 4KE7A 4LHEA 3GLGB 3HCOA 3KYIB 4OXIA 3HN7A 3B1KA 5LYJF 3U4CA 3QUBA 2J48A 3MTJA 3OFNA 4G67A 4GLLA 4ZI7B 3BSWA 1P1BA 3Q8XB 2RHWA 4RA6B 5EP2A 4B7ZA 2P1ZA 3FDZA 1GA1A 2YHIA 2J0VA 5A9SA 2BHLA 5ALZA 1QMGA 4UEOA 4H0CA 3ICPA 5K6RA 1F9AA 4NYJQ 3RIXA 3FTFA 1A27A 1H1DA 1VJRA 3OJXA 4PAQA 1Z35A 3G1WA 3N2NA 4C01A 5BRNA 3GPLA 1J2YA 1PTJA 3IP9A 4H35A 5I9SA 2GZMA 4L51A 5IJZA 1JR3E 1P60A 4QBGB 4LDPA 2I2AA 4UM8B 5FOUA 5KWIA 3NNDA 2OBNA 4OUDB 1U0HC 1R0CA 5K8VA 4BXOA 1N33B 1XVVA 1KHHA 4WH0A 4W5OA 1NQWA 4N0QA 2DBVO 3I1YA 3QYPA 1B76A 1I13A 3HN2A 1ISPA 1EFAA 1NI4B 2QPTA 3KPWA 4DAEA 3ENWA 2NU7B 4LXYA 5P8WA 1XNHA 1CHDA 1DC4A 1B42A 1E61A 1WQ1R 1IAQA 2YV1A 3EXEB 3IUMA 4I8XA 4IMPA 2F00A 2VSXA 4XQGA 3UWPA 1SU7A 4PYJA 4FFBA 5I5EA 4BE7B 1BJRE 3AR9A 1HQCA 1SXPA 3A9SA 1C7QA 1D4OA 2EJCA 4IF4A 2JGDB 3PUJA 3H2BA 5KPJA 3UGJA 1IIBA 4BKQA 5HOQA 3HR8A 1UPBA 4JCOA 4PW0A 5AR1A 2KI5A 4M8LA 4TXHA 1XZDA 3UAXA 4Q82A 4QXOA 3RAFC 1SBQA 3TIIA 1D2EA 3TJRA 1F20A 1KETA 1TM3E 4PAOA 4ER5A 5ED4A 4DSNA 1CPYA 4G2TA 4I6GA 1RKXA 4P3NA 3C7CB 3DOHA 1DRWA 1PLLA 2KLBA 2W2MA 2J9FA 3CNNA 3O4JA 4L27A 4TT8A 4OQLA 3UMJA 4NI5A 2CV1A 4JQCA 1LS6A 1URPA 2HF7A 3OFKA 4CLRA 5MDHA 1W29A 4N3BA 5FI1B 1PUXA 3LKVA 3PXXA 3E9EA 3T7EA 1RM5A 4FUTA 3EOBI 5DGDA 1TAGA 1NXWA 1G8MA 2IPLA 1BROA 1Y80A 2MSCB 2XDQA 1O54A 5KZMB 1LPAB 5JQGF 2AH5A 2YW2A 3DAFA 3EFHA 4TRRA 2FHPA 2XUQA 4K6OA 3DV0B 2H00A 3G2JA 4YQEA 2Z6AA 3JS5A 4BO4A 4EJ0A 3I1IA 2W2XA 4EPWA 3A26A 1QWOA 2VHXA 2EIXA 1SCJA 2VNIA 3QKIA 2HLHA 4IZIA 1IULA 1KSHA 2F1RA 2JJ2A 2WT9A 3AV0B 3C6ZA 4IIJA 2QW8A 1FUKA 3FGNA 3U9TA 1ZCJA 1HE4A 2WJZB 2WUFA 4IR7A 1MR3F 2J85A 4L78A 1ZMXA 2Z57A 4OGGA 5LXTA 5NULA 5ADVA 3C41J 4JLBA 1RZRA 3DBHB 1PX2A 1W19A 4YRLA 4ETIA 1IZYA 4UTZA 2R7KA 2NIPA 1Z74A 2AK2A 1DNPA 1GQSA 1K5HA 2F3SA 4L75A 3ZDRA 2AFHB 2W6NA 2ZRMA 5K51A 1X87A 3N74A 5FOWA 3D43A 2Q7DA 4JU9A 2OGZA 1COWA 4M0MA 3WIBA 4HI0E 1YIOA 3QE2A 4LN1A 3U40A 3NHSA 4EUHA 1C9KA 1J23A 3VR3D 1J20A 4QGSA 2DTXA 3N0TA 3ANXA 4L5AA 1KOJA 1RXWA 1OV4A 2X0RA 3D7NA 3FFWA 1G42A 3JYNA 5KMGA 3QEOA 4YBZA 5F21A 1DMSA 1P2TA 3QF4A 4P93A 1W30A 3QKWA 3BCUA 3N0RA 4M1TA 2HMUA 1JU4A 2R751 2WHQA 4JBIA 2Q3FA 3R0IA 4MRVA 4RTQA 3FUWA 2R79A 3FLAA 3CZMA 4I55B 4ZVPA 4E46A 3GJRA 5BMVB 1VJGA 1Y4UA 3FUCA 1FRQA 3BH0A 4ER6A 1KBZA 1BSVA 1ZXXA 3FCSB 4MYTA 4Z9BA 3Q6MA 2PMBA 4I3FA 3V1NA 2FG7C 2ZIVB 3O38A 3WWOA 4YY3B 1C7IA 4QWWA 3EDYA 3H11B 3PA8A 5DM2A 5CA0B 3SC2A 1TW2A 4AUMA 1ODSA 3C3JA 3AZQA 3M7IA 1PW7A 3B9BA 4PIPA 2F3UA 1FNNA 2WVJA 1SJ9A 2OCKA 1TE2A 3EJ6A 1RIIA 1II8B 1L4BA 2QM3A 3D1VA 1NU6A 4KQMA 4LXXA 4BMPB 2C9ZA 1EAYA 3JR7A 4BEBA 5MN5A 3S99A 4GL2A 1NMYA 1QYRA 2QMYA 1BKSB 1SCDA 2PRJA 3CEHA 4QDZA 4EW2A 1J8FA 3CUUA 2O8FA 2RGRA 2CD9A 1E2PA 2G80A 2VUTA 3CPJB 4DM7A 4K28A 3CR3C 3E5NA 1QFJA 1L5HA 4OFZA 3VO2A 5BYJA 1KTIA 3UFXB 2GMWA 3F6BX 3T9BA 1IHPA 1PL6A 3WGTA 5B3JC 2ZB3A 3KETA 2C4KA 2OO3A 5U9CA 1CEQA 1XOIA 5FUMA 5HCIA 1NC1A 1K8YB 1TF5A 3K2QA 2WVGA 4NF2A 3DBLB 2YYZA 2QMUA 4RLQA 3BH7A 4NOJA 5F64A 1TTPB 3UO8B 1IJFA 1S8FA 4XQ9A 2BKXA 3SQLA 3UQYS 5IBCA 1U9ZA 3UAWA 1FP4B 2HYDA 1N9GA 3AUYA 3QEJA 1OX4B 1E9EA 4Q48A 2QUBA 2FUNB 4PTZA 1ZEJA 1XHLA 3EPPA 3ZWMA 2ZANA 1XZQA 3O8QA 2VZLA 3PQCA 5KNCD 1WG8A 4CPDA 4F5YA 4XYBA 4TV8A 5ILQA 2PYZA 2JFFA 3IQDB 3AHFA 5HUQA 2DT8A 2GVDC 4HK4A 2VHTA 1E9RA 1RYYA 4M37A 3QPDA 5AK3A 5BP7A 3HXMA 4PPQA 3V3KA 2JHGA 2QD4A 4KITB 5JNSA 3KKNA 1GG9A 3RS3A 3Q85A 1LXCA 4GRIA 3PQ4A 1MA3A 2D62A 1AKWA 3ZU2A 1OXXK 4FFMA 3ZDQA 3I09A 3SAJA 3CKYA 3CVOA 3JALB 1DXOA 3EGOA 4JYCA 3M33A 3K6RA 3UKOA 4D8TA 4B7UA 5DBGA 5FOTA 4WCVA 3EVEA 4ERNA 4AS1A 3O8CA 2IEIA 4LNUA 3QBTA 1IUNA 1FMTA 3CUWA 4JA0A 1QFYA 4HL6A 4Q3CA 3IQZA 4JCCA 4ND3A 2VZ0A 4HXFB 3K4HA 5DBHX 3U9SA 2JIPA 3AEZA 3EJWA 4D4JA 1MC8A 4OQMA 1M34E 4YJDA 2VJAA 3O3MB 1YS2X 4MJLA 5E7JA 1G4AE 4RY2A 3TAUA 3V6MA 4CYMA 4ZEVA 2R4QA 1ZR4A 1TQ8A 2Q3EA 3LWZA 1MBZA 3AB8A 4YIHA 5A5FA 2YZMA 4XGRA 5EWLB 4BAGA 2ZJYA 3CV3A 3F8TA 3HUDA 3X2FA 5LKRA 5L40A 1FSGA 3OZGA 1NVAA 3LDHA 5F3DA 2UYQA 5TF4A 2BDUA 2Y6UA 2G71A 4J9UE 4W5HA 2CJXA 4QRIA 3PGJA 2PNJA 2HPAA 1MRZA 1QIHA 2VH2A 2XIJA 4URWR 1O08A 3ZVMA 1TVKA 3PI6A 5LP6C 1P1FA 5IJ9A 4GI7A 1PVVA 1GZ7A 3B9RA 3FYDA 1WY7A 3LUPA 1BAPA 3VHRA 3NPAA 2ODWA 1ZZEA 1OXUA 4O0MA 1HLPA 4PWYA 4XDZA 4FDTA 1XCLA 2IPOA 4ODIA 4F56A 4UFPA 1YRWA 2P4UA 1NR7A 5FA6A 1QUEA 1WBBA 3W8NA 3NG1A 5HFNA 4FYYA 2FFJA 3KWJA 3I2GA 4LYHA 3GFGA 3WDSA 2I87A 1P19A 2BMJA 4OGKA 5FV7A 3JZIA 7AT1A 1I94B 1O8BA 2RG1A 2X42A 4EY3A 2O6LA 4DTCA 1CUYA 3OU2A 1FMJA 4RF5A 2DJIA 3CR7A 3DLPX 4RXMA 3VYTB 2AKEA 4Q3DA 4HEJA 2GPWA 4GKJB 4NX2A 3BWVA 1OAOC 1KI2A 4M1EA 3CTPA 3JARA 3V4OA 2QX8A 4A10A 3AUTA 2Y76A 3W0LB 4CV0A 1K8QA 4GMDA 3HJCA 4AY2A 2FN3A 4ZZ0A 2CLOB 1RAGA 2GZSA 5KNBD 1XTJA 1K6MA 3HNPA 3D0RA 2QX9A 1MEEA 3VDRA 3CINA 4HC4A 1ZSVA 3ZU6A 2VBIA 2YWDA 1QF9A 1RRVA 1WB6A 2FR1A 4F85A 1OHHD 3RSCA 1NOKA 4ZI2A 1Z22A 4DJTA 1AF7A 1W0CA 1QIDA 2PZAA 4LV5B 3K0KA 3WMWA 4E08A 3HU5A 1QYXA 2VHYA 5B58T 4EYOA 3KVRA 5CFZA 5J63A 4N5IX 2GBLA 4GMXA 3U3DA 3ZHTA 4GZ3A 4TMXA 2HCBA 2BFOA 4DQLA 2BGWA 4PZ0A 4DR3B 4AVYA 1KYIA 1VP3A 3R20A 4L6AA 1QFXA 1G17A 1NTRA 3G9ZA 2X9GA 1IHOA 2K6GA 3K1TA 3L1IA 5C1IA 1IC6A 1U0BB 3BIOA 4KMMA 1V6SA 2NXNA 4NBTA 4NCBA 3BGVA 4WY2A 1O9BA 1SULA 4LE0A 2XQVA 1WULS 1E4EA 2JBHA 1CXZA 2ZT6A 1CDOA 5IT4A 2PL1A 3FAZA 4LDZA 5LQCA 1PG2A 3N07A 4KC0A 4XARA 2PSFA 2Z04A 1J8DA 3L0PA 4BLTA 2AZXA 4WY8A 3PLAE 1R8YA 3GZNA 4L9SA 2GF0A 3UUEA 3C1TA 2OP0A 4LOAA 1N75A 1A5ZA 3MPUA 3OM9A 3RRFA 2ZWVA 3GLFE 3QV2A 5DSTA 1XAHA 3AFNA 2QR5A 3NP7A 1AQ6A 2CZGA 2IP2A 3EYAA 4H7DA 4LA4A 5FBWB 2NUPB 1KPIA 2GFQA 3GG2A 4U5QA 3RIGA 1AXRA 4WLOA 3U3MA 1XLTA 2NUTB 2FJUA 1IQPA 3FPLA 4JXKA 1Q44A 2ABWA 2X4GA 5J2TA 3PIIA 4HX5A 1BX0A 3GHYA 1NBAA 2ZI9A 1BEZA 1WHTB 3NBKA 4P7FA 4A0QA 2JZOA 1O0BA 4RV5A 2CDNA 4DV6B 1DX6A 2ZI3A 2KM1A 4OOFA 3HVUA 4XQEA 4ZAVA 4R81A 1K75A 1DHRA 4H15A 3S7TA 4P5PA 2JG3A 5EFZA 3C70A 3CISA 3SZUA 4BBJA 2J4CA 2NZXA 2WJPA 5G4LA 5HZHA 3MWYW 1CUAA 2RKBA 3DVAA 3FUUA 3HO1A 1R88A 3FYUA 3LC1O 3NAZA 3F3MA 5JFTA 2R6HA 4WXMA 2WNHA 4N39A 1B2RA 2R00C 3QUAA 4D9KA 3V6LA 5LYJB 3HVHA 1DAPA 1M2FA 4K8OA 4Q3LA 5ALQA 1I9GA 1OA1A 1PFKA 3KQLA 3B5JA 1J0DA 3ONVA 4NOKA 1IU9A 3NEAA 4UHEA 3FKQA 2IOQA 3AT1A 3I04A 4EVIA 3K8YA 3ODGA 1NDQA 1EG2A 3MCTA 4H9GA 2NP6A 5J2UB 4AZTA 4LW8A 3EA0A 2C9MA 5AVUA 2C84A 3N2GB 3FB1A 4W5RA 4AUEA 1KJYA 3CTMA 4ND7A 4PNZA 3X0DA 1SXJA 1UPTA 1FFDA 3OX3A 3EIQA 2VFAA 1YDEA 1X7YA 1KZ9A 2G0TA 1E7SA 4GE0A 2JCGA 3T6KA 1HUQA 2BMVA 2I8AA 5F2KA 1V1MB 2WYOA 3QBJA 3LY7A 1Z6AA 4TS4A 2WFMA 4B44A 4KO1S 4RORA 1SVLA 1UK8A 4TRMA 3EHDA 5AJZA 2ETVA 5DGTA 4F1WA 2VN8A 2Y1FA 2FTKE 1M7HA 3QEKA 3QYJA 4LHSA 1W46A 3EXIA 4V24A 3RS0A 4DIEA 3C48A 3NHKA 2AF4C 4OQDA 1CZNA 1V6AA 2W6IA 4HP8A 4G9GA 2DWUA 3H6GA 1GFSA 3IP7A 2WYVA 4WEOA 4IFBA 5BT9A 1DAEA 5KYUA 1F0YA 4NS4A 1QH8A 4X20A 3T35A 1CD5A 2XH8A 4P0PB 1EFLA 2D4AA 5CVEA 5SV2A 3LZDA 2YUTA 2ZIAA 1EBBA 4I5IA 5KVQA 5LB2A 4KQFA 3X1YA 3GFRA 4YUYA 3DMGA 3KFXA 4HBGA 1M5RA 1DLIA 1V7CA 3KCQA 1C8LA 5JZBA 2QXUA 1SC4A 3M4JA 4FI3F 4UHCA 4Z7OB 1O9GA 3K70D 1UZAA 4K40A 3B12A 3LY5A 3VUEA 3HKCB 3MBKA 4WNAA 3UENA 4J2HA 3MHPA 2PIAA 3IUQA 1REQA 2Q1TA 4AU1A 4FX5A 5FBRB 2EJVA 1E5XA 1OWPA 5DXAA 3ER8A 1SA0A 1G7RA 3A6GA 4YH1A 2CGEA 1DAHA 3SR3A 3PNLA 4O8CA 1FX0A 1XK6A 5F5XA 2PXXA 4HGNA 4CKWA 5JFGA 4BQRA 2W83A 5JPIA 4ZOCA 1EFTA 3NGLA 3U4DA 3VR4A 5JRZA 5JJKA 1WEHA 3F2IA 2O7VA 4ZYLA 5LQKA 5AUOB 2FN7A 1EJ2A 4GH5A 1EHIA 1JSZA 3UXYA 3O21A 5C5DA 4V0OA 1MPXA 4PRKA 1E64A 3SF8B 1XCGB 2LR0A 1CJUC 2PAAA 3IAS6 4FZVA 2NU9B 5JSZA 1W75A 4E51A 1LQ2A 1NQXA 3AC0A 4V0NA 4YLEA 4XFKA 2OE2A 3ICQB 3RVQA 1W35A 1E1QD 3BGDA 5K3SA 3VSEA 4L5CA 3ZXYA 2Q29A 5K8LA 2J4FA 1QPGA 5JALA 3EZFA 4EOGA 1K08A 1OLSA 3AEUA 2F67A 3JQ9C 3DDZX 4GKAA 5BR8B 2IZ5A 1E2QA 4Q1FA 4HTFB 1SNYA 2EP5A 2IFTA 1V16B 2OT3B 3DTVB 4JP3A 1Z63A 2DR2A 1Q1QA 4B2IA 4BGDA 3THSA 1NVWQ 5M04A 1ML3A 4ZIRB 4AQYB 1V3UA 1HE8B 1N92A 2IHZA 3HDGA 5DHPA 4B85A 1VMIA 2CJWA 2FWJA 4RH3A 5HF8A 1GTMA 4MQ4A 3U44B 5AXCA 1VHTA 2QLLA 2ENUA 2Q6VA 3BOSA 1TMKA 2V7BA 2ZCVA 3M6MD 3Q11A 4NESA 3W06A 2XAUA 1ESZA 3OKCA 1KI7A 3E15A 4HN4B 4UHFA 2GDZA 3RV3A 5TJ9A 5CDFA 2QMHA 3CRRA 1Z5UA 4QEZA 3TW8B 2WU8A 3KTAB 2FCRA 2VSQA 3H9BA 3SYNA 5AW1A 1DS6A 5A3QA 5KCMA 1GILA 4EJ2A 2VCYA 3IQIX 4TTIA 4JV5B 4JI1B 4YWJA 2QDXA 3QMMA 8AT1A 5CLQA 1SFRA 1YB1A 3H5LA 1II0A 4JB8A 3OY7A 3IB6A 4OLAA 1P5ZB 1Q1BA 2JJ1D 3HCEA 4EHLA 4WKGA 1E1CA 3L05A 3L84A 4RXUA 4HADA 3IEKA 5E8JA 1XRLA 1NVXQ 3NHWA 4H1WA 2VIIA 3KQHA 3WWZA 3Q88A 3PWKA 1XNJA 4ZTUB 4MGHA 3T41A 4LYEA 2G82A 3IDSA 3VU9B 1SVSA 3S6JA 4AMVA 1JJBA 2GN2A 2IW3A 4H1HA 3TEMA 1SWWA 2HV8A 2ZSFA 4LFBB 1KMHA 4IRUB 4DIBA 4D56A 1U7UA 1POWA 3II6X 3TW0A 1GUFA 2M1ZA 1JDUA 4H3SA 1UOQA 4LF5B 1LBTA 4XXHA 4DY4A 4ZTZB 1U0JA 5AWFC 5D3MA 4BAZA 3D2CA 5CVVA 2IBTA 1Z2DA 3DO8A 1W2WB 4KUHA 5GGYA 1ID8A 1ZUNA 2B5WA 1HNNA 3NO4A 1RXCA 5LJLA 1NUQA 1YKGA 9GPBA 1CJBA 3MWEB 2DJ5A 3KOUA 4R8MA 4TWRA 5HDBB 4Q7KA 4ALIA 5E6SA 4YROA 3SJUA 1QRTA 1KHTA 4OB8A 1QQBA 1BE8A 1U1GA 2R4UA 1DBIA 1C9YA 1MTZA 2IKSA 2VT7A 5G1NA 4G0YA 2G9QA 1FFEA 1QS0B 2IPNA 5E9WA 3WGZA 3NYWA 1LVGA 4HSEA 4OP2A 4P53A 4YDRA 3RHZA 5H59A 3P32A 1Z4MA 2BTQB 3PK0A 1RCFA 1HQYE 2MYTA 3NBXX 5CXXA 2HQBA 1OX6A 1JFLA 1R5NA 3NOVA 4ZT3A 2GWRA 2OQVA 4CCYA 5JYBA 3O3NB 1KOGA 3X1WA 3LPMA 2MTBA 1JAIA 1WP9A 3FZNA 5H7XA 5A7HA 5U4XA 1NRXA 2C7PA 1TPYA 3H5RA 1YMUA 4B6QA 9LDTA 3CGGA 5DI9A 2WKWA 5AK5A 3OWHA 3LE8A 4D9CA 1Y1LA 7REQA 5L3QB 4TL6A 3SXJA 2XD9A 5CBKA 4Q0MA 5GJBA 1P81A 3LPNA 3TECE 1N2SA 1BNCA 3OCCA 1L7PA 4WESB 4BE4A 1AGPA 3PNVA 1MXFA 1A2QA 1KA9H 2XQFA 1RWOA 4X95A 1QIJA 3OJWA 4I1VA 5IMBA 5DU2A 1GA4A 1ZUWA 3QJYA 4WA8A 4I5DA 4DWVA 4MA5A 1SD1A 3UA4A 5AKGA 2B7CA 4PHGA 1YJ5A 2CL5A 2PBZA 1PV2A 2R11A 1H9BA 1NUUA 2VJMA 3O73A 5IBQA 2ZE6A 3AI3A 1KO8A 1WVMA 2E4WA 4J3FA 5DX8A 1CIVA 4YUZA 4JXZA 3ZJTA 1S7GA 2E4VA 1W59A 1ST3A 2BUCA 2DKNA 2H57A 1JAXA 4LHZA 4AY3A 4EIWA 1KY3A 4RJLA 5FNZA 1QP4A 4BEJA 1J9GA 1X8JA 1KYXA 4LRQA 3GFSA 2V5VA 3HP7A 3IKJA 4UVDA 3OD1A 4QBKA 4X7MA 3D3WB 1ZWKA 2FE1A 1V11B 3OX2A 4IDBA 2E6UX 4HAZA 3MYRA 1W85A 2PH7A 3RVNA 3PUIA 3DF9A 3Q12A 1W5SA 2DX7A 1TO1E 1IM5A 3C4JA 2QTLA 1JEQB 4I9GA 4RVCA 1C1DA 5F35A 1TM7E 1PRYA 4LJYA 4L5YA 3KU4A 5LOVB 4MVJI 5HR5A 4BFSA 3V7UA 3OAAA 4G8BA 2XCLA 3MLEA 4AJ4A 4BO6A 3S8YA 1F1JA 2ZVJA 3AFHA 3EDOA 2QT1A 2UUAB 4ENWA 4JB2A 5LIPA 4NE2A 1YVDA 1WUIS 4PNPA 3V4LA 4S2UA 1UZLA 1MHTA 4MV1A 5FWXB 4I2NA 1E0KA 3B1YA 1NY6A