1RXEA

Arsc complexed with mnb
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
131
structure length
131
Chain Sequence
b'MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLSSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate reductase
publication title The structure of a triple mutant of pI258 arsenate reductase from Staphylococcus aureus and its 5-thio-2-nitrobenzoic acid adduct.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 52
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxeA00
4WT7A 3W9SA 4ETMA 2WRZA 9ABPA 4JA2A 4WWHA 2AYXA 5CNJA 3O74A 5E3JA 3CHYA 3LUKA 4MLDA 4Z4GA 3KKEA 4F06A 7ABPA 4PYRA 5GOTA 3DLBA 1H9CA 4KV7A 3QEMA 1LK0A 3H6GA 4N03A 2PUCA 2R4QA 2CHFA 2PL9A 1YVUA 2JVKA 3N0XA 3OO1A 4RK4A 3F6PA 3CG0A 1DRKA 3NNSA 1YMVA 3GT7A 3CG4A 1APBA 1URPA 3NNDA 5FBKA 1QP0A 1CHNA 4O1HA 3D8UA 2MYPA 3F7NA 5TPWA 2WJWA 2LP4Y 3EODA 4RK6A 1P2FA 2V0NA 4ML3A 3IP9A 4N0PA 3TB6A 1TJYA 3T6KA 1A0OA 3SG0A 1JL3A 4KMRA 2MSLA 1FFWA 3EQ2A 3CFYA 4TLMB 2Q5CA 1FFSA 5GQSA 5JS2A 4KPYA 2RJNA 4KVFA 4MR8A 4IMJB 3DZDA 3SQNA 4S04A 1D1PA 1W9HA 2LBPA 2FLWA 4FE4A 1KRWA 2L19A 2MYTA 1NXOA 4LRQA 4ZPJA 2R25B 4WZZA 1QMPA 3H5WA 3LUCA 4YLEA 3Q9SA 5CNKA 4Z9BA 2VUHB 3RVMA 4MS1A 2BGGA 4KZKA 4DN6A 2ID9A 4RDCA 1M2FA 2FQWA 4LE0A 3ROTA 5CHYA 1DJMA 2CD7A 2WMYA 1HEYA 3FMVA 1L5ZA 1ZAYA 4IMIB 1USGA 2HJ9A 4G0ZA 4MPTA 4H3KB 4PZ0A 3VNAA 1LBIA 4KQCA 5KC9A 5KWSA 4NQRA 1QKKA 4KRFA 3N8IA 2JVJA 1TLFA 2E4YA 4PICA 2MSWA 3JPWA 4WXMA 2WB4A 2E4XA 8ABPA 3C3MA 2YHBA 2R48A 3LUFA 1QO0D 3OM0A 5KQLA 3FFTA 3JY6A 3C6QA 3F6CA 3LUAA 5ABPA 2F8TA 3FFXA 3RVOA 4XXHA 2QW1A 3OM1A 4LDZA 4MAAA 1Z2DA 4LX8A 2TMYA 2YHAA 4GPAA 4G0YA 4EYKA 2P9HA 2E4UA 3O2QB 3R0JA 3URMA 5DLEA 5C5CA 2PE5A 1JH9A 3OMXA 4Z9AA 2FN8A 1QNLA 3D02A 5HSGA 3GL9A 1ZH4A 1U04A 2A9QA 3TMYA 5BQ3A 1OXKB 5IUNC 2FMHA 1USKA 2JBAB 2OQRA 1U8TA 2QZJA 1NXTA 3C3KA 1FQWA 1IIBA 2FSPA 2M98A 3H1EA 3VNBA 3RH0A 1NY5A 3G1WA 1NTRA 4E7OA 1QO0A 3QX9A 2PUDA 4MS1B 2PL1A 1DCKA 2PJUA 1VRVA 2HPHA 4N41A 4RKQA 1UDRA 3QX8A 1TVMA 1CEYA 3KS9A 2O20A 2NZVG 2HSGA 3CRNA 2PKXA 1XHFA 3MMNA 1TM2A 1XHEA 2FMKA 4EYOA 3NNNA 3HJFA 3JPYA 1JDPA 4F3TA 4QPJC 1NXSA 4YP9A 5TQ0B 4F11A 2ZWMA 3OLVA 2JB9A 5EWJB 2CWDA 2XDYA 3JS5A 4G0OA 1ZESA 5B3JA 1GCGA 2PLNA 4OLAA 3HZHA 3EAFA 3A10A 3JVDA 5JNUA 5CNMA 3NHZA 1JYEA 2IYNA 4L4UA 3HK2A 4ETIA 2QV0A 2B4AA 2PMCA 2A9OA 3Q7SA 4S05A 1E2BA 4Z0NA 1ZGZA 3LUGA 4F12A 3HXMA 3KYJB 2PUEA 5CNIA 2LPMA 3GBVA 1USIA 3BBLA 3DLHA 2IKSA 4HNQA 4ZMSA 1A04A 1EWTA 3LFTA 3M6MD 1JBEA 2L17A 3GV0A 1MB0A 1L5YA 1D1QA 1Z16A 2E4WA 3H1FA 3QEKA 3TX6A 1DC8A 1Z15A 4OG2A 3CZ5A 1T34A 1VKRA 1F4VA 3O1JC 2PUBA 3CLKA 3BRQA 3EJWA 4RXUA 2LIVA 1SXGA 3GRCA 1VPWA 2WWVD 3DGEC 3LKBA 5JNSA 1DBQA 3KTOA 4YS6A 3LUDA 5JNVA 1AB6A 2R47A 2WY2D 3TO5A 5BR1A 2H0AA 3OLXA 3FGZA 4MQFB 4EYGA 4YWHA 5JNRA 1ABEA 3C97A 5FWYB 1M2EA 1CYEA 1MAVA 4TLLB 3RVJA 3NHMA 4Z4EA 1MVOA 2FEPA 4WUTA 3OLZA 3I5AA 4LZLA 2IPMA 4Q6WA 1BDIA 4B09A 4HNSA 2WJAA 4Q6BA 4QICA 2JBAA 4YGXB 4YCSA 3N75A 5JNTA 3QLTA 3B2NA 4QYMA 3QELB 4NV3A 1DG9A 1D4ZA 1YMUA 4TMYA 3L6UA 3N6VA 4EYQA 5HKOA 1JX6A 3H1GA 1NXWA 2IPLA 2FMFA 2RGYA 4D6YA 2DRIA 4YR7A 1TMYA 2LUOA 3KHTA 4H3HB 3LTEA 3MM4A 3OLYA 4LDAA 1U2PA 1JYFA 4G0XA 4RK0A 3ILYA 3A3KA 3KG2A 4RSMA 1D5WA 4JASB 4UHJA 4KK4A 1C0EA 3JTEA 3QLVA 5TQ0A 5JS1A 1JDNA 1D2AA 4OATA 1E6LA 1LBHA 1ZDMA 4RXMA 5EWJA 3ROFA 5IEJA 1FFGA 3DGFC 1JWLA 2IOYA 3M9XA 4RY0A 3SY8A 5KI6A 3OQMA 4XAQA 1QP7A 1P6UA 1Z2EA 3IPAA 5FBHA 4EVSA 3SNKA 4Z4HA 3CU5A 4MQEB 1Z13A 1XWWA 5DGCA 3Q15C 2GBPA 3DBIA 3KJXA 2VK2A 4G0PA 2E4VA 1M5UA 2JCGA 3EULA 1SD5A 1NATA 4RZSA 4W5OA 4JB0A 4OTZA 4OBBA 5C5EA 5IX8A 3MA0A 4DQDA 6ABPA 4JB2A 4EVRA 1LJUA 1EWVA 1SRRA 4EUKA 4N76A 3G85A 4IGAA 2PUAA 3A0UA 3Q7RA 4RXTA 3T38A 1PUXA 1BDHA 3O2JA 2NT4A 4LE2A 2FQYA 3QLUA 3RVNA 2X7XA 1BA2A 4MGEA 4IF4A 3HVRA 1YK1A 2ID7A 2MYUA 5IBQA 3E3MA 1U0SY 4MR9B 4RWEA 4Y9TA 5IC5A 1BDJA 4W5NA 4DADA 3RVPA 4D6XA 4MQFA 2GI4A 5JNWA 3K4HA 1Z17A 5TQ2B 3MYYA 4W5RA 3OQOA 3CZCA 2L2QA 1JFTA 1JF8A 1VLZA 2MYNA 3O1HB 4G86A 4XLTA 1Z12A 1ZH2A 5FWYA 5BRJA 4NCBA 2NZUG 1DBWA 2L18A 4PEVA 2ZAYA 3CTPA 1PEYA 3O75A 5FWXB 1RZRD 4ZYLA 2N9UA 4RU1A 1NXVA 3N53A 5EWMB 1ZHHA 3BRSA 3IPCA 3H5LA 4ZMRA 1KRXA 2I6FA 2E4ZA 1ABFA 3QELA 4GNRA 3LKVA 1AB5A 3RVRA 1Y1LA 1Z18A 4Z99A 3GA5A 1RXIA 3LUJA 1DRJA 2AYZA 2B1JA 2FTKE 2GWRA 3HUTA 2FMIA 3QLVC 4IRXA 5IEBA 4KNYA 3A0RB 4HYEA 1BVHA 2FLKA 1U2QA 4XARA 3HS3A 3KYIB 5BRAA 3F73A 2PUGA 4UHKA 1SXIA 4CBVA 4G0MA 4Z4FA 4KQ9A 4W5QA 1ZN2A 4RKRA 1RZRA 1GUDA 3ILHA 3I42A 4MS4B 4F8JA 1K68A 1Z26A 1DCMA 3IP6A 4L85A 4RY8A 5KQPA 1A2OA 1ISRA 1YS7A 4RK1A 1GCAA 3T8YA 3N0RA 5ED4A 4MRMA 4WXEA 4Z4CA 4KFCA 4EVQA 3KCNA 1EHCA 2VUIB 3RVKA 4MQEA 4YV7A 3O1IC 1QQAA 5EWLB 2P4UA 2NUBA 4OLBA 3EDCA 3IP5A 1ZY2A 4RK5A 1B00A 5F64A 2QR3A 3E61A 3OO0A 2QSJA 1DCFA 3HEBA 3P9YA 5HM6A 5DCLA 3QLUC 1JFVA 4MS3B 3H5IA 2FEWB 4MR7A 3RVSA 5T3YA 1QQBA 1Z25A 4M88A 3HUUA 1PHRA 2PAFA 3TD9A 2HQRA 1BAPA 1ZGGA 1GUBA 3H5TA 1ISSA 4JAVC 3MF4A 4YO7A 4FB4A 4W5TA 4FE7A 4MR9A 2JVIA 1PNRA 4JOQA 3S99A 2J48A 3H6HA 3IP7A 1QPZA 2FW0A 2QU7A 3CKMA 3OMWA 5TQJA 2W42A 2HQOA 2FEKA 2IPNA 1JHZA 4PE5B 4N0QA 1R8JA 1ZITA 2OENG 4HNRA 5TQ2A 1MB3A 2NT3A 2CHEA 1QP4A 5IUKC 5IUJC 2RJOA 3NBMA 3C3WA 4G0QA 4MLCA 1C4WA 3FFWA 3RQIA 1YK0A 3O21A 4MRMB 3L49A 2QXYA 1KGSA 1S8NA 4KREA 5HQJA 3M9WA 2JK1A 3OLWA 2FN9A 3HDGA 3LOPA 3H5OA 2VYCA 3HSYA 5FWXA 3KSMA 1RNLA 5DTEA 5EWMA 1GLGA 4Z4IA 4RS3A 2QVGA 1MIHA 3H5VA 1EFAA 3QEMB 1K66A 5B3JC 4XFKA 1YTUA 4RY9A 4P1ZA 1YS6A 3H75A 4RK7A 4MR7B 5TPZD 3QK7A 1DP4A 2IDMA 1ZVVA 2RDMA 5KQMA 3KLNA 2A9PA 2PUFA 3EQZA 3EGCA 4E7PA 3JVIA 5TPWB 3UK0A 1WETA 3I45A 1I3CA 4Q7EA 3HO1A 1W25A 1EWKA 1E6KA 1F51E 1PNTA 4ETNA 2MSKA 3HDVA 3RVLA 3IDOA 1LJLA 4MS4A 3I09A 4NICA 3SAJA 2GKGA 3GYBA 4IILA 4MR8B 4XASA 3LUHA 4G97A 6CHYA 3SM9A 1OXBB 1SXHA 3HM9A 1E6MA 2FQXA 5TPZA 1DC7A 3UKJA 1EAYA 3MQ4A 5EWLA 1PEAA 3LMKA 1M5TA 3N0WA 1FSPA 3HCWA 4O5AA 3CS3A 1DZ3A 1RPJA 3K9CA 1J56A 3T95A 5KQGA 3OQNA 3HV2A 3Q41A 4MYRA 4MS3A 1JLKA 2FXIA 4P98A 3O2SB 4TN5A 2QVCA 4RV5A 5DKFA 1NXXA 4H60A 1P6QA 5IULC 2A9RA 1DBPA 4D74A 4ZJPA 4YRZA 1RXEA 1YIOA 2FVYA 2JRLA 4O1IA 4LE1A 3KLOA 2FKAA 2H3HA 1KMIY 5D2CA 2M1ZA 1JFSA 3UUGA 3BILA 2F8SA 4EGSA 3FDFA 3GWGA 3CNBA 2KYRA 4EY3A 4N47A 4QYWA 5T7BA 4JP1A 2HQBA 5KC8A 3Q7TA 3BREA 3GBPA 1P8AA 2GX6A 1NXPA 3MIZA 5PNTA 3RVQA 4KK3A 2IPAB 4NCAA 5I4CA 5TE9A
chains in the Genus database with same CATH superfamily
3MRSA 1ZUWA 2VJQA 5CM2Z 4U9IS 4DKJA 3FYDA 5ECDA 1ML4A 3UGKA 2GD2A 3LECA 4BTVA 1B15A 1Z07A 4J75A 2ZG6A 3K1ZA 5TC4A 2HQSA 5FI0B 4YAUA 1NLZA 3OQHA 3RHSA 4E2WA 5A5FA 2OXTA 3JALB 2IIBA 5I3CA 3PHHA 3LDGA 3ZY6A 2XUDA 3VR4D 2QNBA 3G8BA 4M86A 4R8RA 5AXCA 3M82A 1FZQA 1X1DA 5DXJA 4AKIA 4EA6A 3GT7A 3ZDRA 2OVFA 2J5RA 4IJMA 3GLIE 1V11A 2ASVA 3OBIA 4KE8A 3IEKA 1LW6E 4OM7A 1EA5A 4IICA 4G8JA 4ECAA 1E3LA 4RIFA 3R8XA 1UP4A 1ZN9A 4G1FA 4GVXA 1V3UA 3IHWA 4GUDA 4HDMA 1XK7A 4YUXA 1QNFA 2Z2XA 4AWBA 5DN6D 1JL3A 2BWJA 3EUWA 3PPIA 4P5EA 3C7KA 1SXQA 3R0VA 5JJLA 1AH2A 1SXJC 4AF7A 2OBLA 1WHSA 5DX8A 1FFSA 1J90A 1OUMA 1JLMA 2BFMA 3Q10A 3CLRC 4JX8A 1GQOA 5HBGA 4UTNA 1K3UB 3DR3A 2ZRCA 3JV7A 3PCTA 3VBCA 4ZYWA 1D2EA 3GEGA 1N9GA 3UJAA 4S04A 3DOCA 2FR8C 1T15A 2BMAA 3LOUA 4IQ8A 1K8XB 2QUKA 1IB0A 1FFYA 1A9SA 1HT1E 4KWHA 2CY0A 2JFZA 4GX5A 4W8GA 3SK0A 2Y8EA 4FGUA 4HTAA 3L6DA 4JLBA 3B20A 3I04M 4RDCA 1HETA 4V2IA 4NBKA 3TCKA 5CFPA 4FGSA 3RYHA 2ECKA 3B82A 1UBEA 2GFHA 2BE9A 3ELUA 3PUIA 3FNEA 3BX1A 4XUCA 5JJ5A 1RMYA 4KMMA 2IHJA 4WZBE 1E94E 4DTIA 1EM8A 1QGED 3TUIC 2WWIA 3EVTA 3AR9A 4LRYA 1UT8A 2XVYA 3MG9A 4KQCA 4LS3A 2V1UA 2JLCA 2IV3A 2WV7A 4IHKA 4N0MA 5AJTA 1CY6A 4LQ4A 4NDNE 4ZYYA 4NPAA 2FZEA 3KD3A 3A9WA 4OP3A 3VKGA 3WYFA 1NU6A 1VHQA 2FK7A 3DVAB 3FYUB 4UAUA 2G40A 2PZ8A 1PD1A 1ZAKA 3CRRA 2CMDA 4BNXA 4RJKA 5AI4A 3EE6A 1NT2A 4MVJD 3ZHSA 2JFWA 2CB0A 2OV2A 4QHYA 5THKA 2CXNA 1A9OA 3LCVB 2YHAA 2PY6A 4DA8A 2WIDA 3R3SA 4GPAA 1KMQA 2WFLA 1TJNA 1MIOB 3CGGA 3OMXA 2RONA 3IUSA 1N0IA 1RQGA 2GZRA 4DV1B 4RULA 1XZ8A 1F2TA 1NMZA 1XXHE 2QXUA 3C3KA 3R2JA 4PGAA 4FFSA 3ZKAA 4PNZA 3H1EA 4PX3A 1BWQA 2GHRA 3FOBA 3KX2A 3N2KB 4FDUA 4YLYA 2QTHA 2CF6A 3HDTA 4DUGA 2PTGA 3RUAA 5FBVB 1UZAA 1EIWA 1E63A 1XA3A 4MS1B 1L8XA 1JHDA 4LFBB 4MLPA 5M3BA 1XNRB 4BQQA 4EPXA 3NT5A 1ELOA 1AF4A 4OHXA 1H05A 2PKXA 4HY3A 5BWOA 4YRAA 4B4WA 3ZGOA 1DFGA 2WR8A 4RUKA 1OREA 2DERA 1NFRA 4YMUA 1FMLA 3KXDA 1AUXA 2W71A 3OTOB 2FW1A 2PRIA 1I3LA 3ECAA 1PFQA 1TJPB 3JSXA 4MRSA 4ZYTA 2SBTA 3KSBC 2H9YA 4YP7A 1MJFA 2H51A 3ZLBA 2P5YA 3KOWA 1QGYA 1YOVB 5DIFA 5JCOA 3M1YA 5CNMA 4H6WA 4UMEA 3C3CA 4UVHA 5U1PA 3L8EA 1WQ4A 2LR0A 2P8JA 4FFRA 2EJCA 3C39A 2H16A 1A88A 4FN4A 3ANTA 1M76A 1BX1A 1PN3A 3PL5A 1PJRA 2R1ZA 4DIUA 5L3SB 5L4NA 1WXQA 1Y7HA 4YMHA 1T3LA 1R4MA 3DLCA 1RXVA 4DLXA 3MJFA 1TT5B 1XU9A 4PRZA 4O25A 1ORVA 5AW9A 1NULA 1T36A 1LX7A 2OTCA 3ORHA 4G23A 4ZYXA 1WJGA 2XZOA 1SBQA 5IMSA 2VDKB 3DXZA 2A1TS 2ACEA 3RGGA 5FBZA 3GK3A 1RABA 3KZVA 2H7CA 4FGLA 4N3CA 1OC4A 1UDXA 3EFEA 4QOHA 4B6GA 3FYTA 1P44A 3H04A 4JYCA 3KTDA 1G3MA 2O4UX 4KACA 4U7GA 5EC8A 1E5LA 1SELA 3A26A 4AXBA 1HRKA 1JT2A 2WC1A 3OAAD 4I55F 4KAJA 1H5QA 4HQ6A 3WLHA 4HGNA 2IW3A 3UKDA 1IOWA 1W0CA 5FTJA 3LDFA 3ADDA 4I8DA 4MUAA 3N2GB 1CX9B 3OQ1A 4UFOA 5ALZA 2QLTA 2BCEA 1V39A 3AKCA 2PLRA 1LLQA 1M6YA 2FSFA 2QI9C 5AI5A 4WXRA 4BUJA 1YFLA 1X1AA 3DOJA 3AZQA 1XSEA 4Q00A 1L4NA 1CS0B 1KDTA 1Y9EA 5C7YA 5JXJA 3C6XA 5KX5A 3ZEAA 3S2IA 4Z4EA 3UMBA 3RK4A 4YFVA 2VWPA 3CBQA 1QVVA 3SDZA 2OCIA 3QVTA 4B3RB 2R11A 4D3SA 1FTSA 2I7CA 2WJAA 1T8UA 1SC9A 2HDNB 2OGTA 2ZZKA 4DMUB 3ZVNA 1WXIA 2XDAA 3DBVO 2JLAA 3DBLB 1Q5PA 2R5WA 3NDJA 4BTEA 5TDHA 3QELB 4A5OA 4UOZA 4YIKA 2EZ4A 1DHTA 1PIWA 4WNAB 1RKVA 5IJ0B 3PT5A 4Q7JB 5AJWA 4PZYA 1TVEA 3WZMA 2C97A 4Q4CA 3AIMA 3RU7A 1P0CA 2GJ8A 1TMYA 4NQZA 1XF1A 4Y1FA 3RPEA 3BMXA 3TFQA 4YR7A 4XSGA 4HN4B 1F14A 3ZXXA 3BH7A 4HAZA 1UDAA 3SDSA 1Z4OA 1JB1A 3TZQA 4UU0A 1UC8A 3NHKA 2ANCA 5IW8A 5E1OA 2J7KA 4KDRA 4FW9A 2VP2A 1MO2A 1KIAA 5ITWA 1R8QA 2FW7A 4BFCA 4OHKA 2H8KA 5K51A 2P27A 5TF4A 2BJWA 3EBLA 2AC4A 4I81A 2WP8J 4TSRA 1EDBA 1R4NA 3D4LA 1N1EA 2BEUB 3DZCA 4ICIA 2R8OA 4QYXA 4BQPA 4ENTA 1K5DA 3BICA 4WECA 4C7BA 2LE0A 1G9XA 1MO6A 3K0CA 2PMDA 1RE0A 3IP3A 1S3SA 3LZCA 1T0BA 2JBHA 4MWTA 4NWIA 1I2ZA 4LHYA 3T94A 1A98A 2P2CA 1XFAA 1GU7A 4I4IA 4HAVA 4KG7A 2WZQA 2B5WA 2D7CA 3P0FA 3TTUA 3VZRA 2VTBB 3ODGA 2ZRFA 3TNLA 1PZHA 2E5WA 3MBKA 2VKTA 1HT2E 1G3QA 3U3KA 4OUKX 1Z4LA 3S5JA 3EOBI 3T38A 1I3OA 5BW5A 3QOWA 2V8OA 4KMOA 3V33A 2CSXA 1U0JA 2JJQA 4BWFB 2NT4A 3TQHA 1QCDA 3F8WA 5BMVF 2Q50A 3M34A 1JHXA 1UK6A 1YONA 4H1VA 4ZT4A 3G9XA 4B8WA 4O59O 1EFDN 1OKKD 1FTNA 1U9ZA 1OT5A 2AV6A 2WHPA 3PV0A 3PF9A 2X86A 4RS4A 4A8TA 3S1SA 4D82A 3BD7A 4F5EA 1K4KA 1ZMOA 3ILSA 1Z5VA 3GMDA 3OE4A 4LY9A 4YH1A 2TMDA 3CTMA 4XD2A 4DADA 3AM1A 1OE0A 4LC0A 2GUGA 5B55A 4B2YA 1COWD 2HBQA 3HFGA 3K4HA 1Z82A 2Q4TA 4W5RA 3OQOA 3CZCA 1MR3F 1Z45A 1JYSA 3DDZX 1UPCA 4R1OA 5HA5A 1I9CA 4QQRA 3KBOA 2K6GA 2RHJA 3L18A 3R3JA 2X0RA 3SC2B 4PEVA 4PGHA 3JWEA 1UKVY 5A9TA 4HQRA 4D4KA 1LI5A 5LDHA 1VBKA 3BC1A 2Z04A 5LQMA 2H11A 1Q0HA 2FSGA 3G2KA 4J9UE 5ERGB 2IUYA 1UAAA 3RRYA 3EZNA 3DOUA 4PQFA 2C94A 5A62A 4OMUA 2YJNA 3MD0A 4ZMRA 2Z2KA 3H5LA 3HH8A 3HWX1 4GP9A 3WG9A 2WIFA 1I1OA 4PQEA 3X1DA 4F96A 1KFEB 3E2IA 2O7RA 3W5SA 5CJ2A 4BPBA 2AYZA 4R1LA 1IPEA 2F7SA 2R97A 1ADJA 2YWGA 2XYVA 1AS3A 3OJFA 1G7CA 1PKXA 3O93A 5DX1A 3SYKA 5AOCA 1NJGA 2WTMA 2GBLC 2OXFA 4JA0A 4TQ9A 3UICA 5ESWA 2WEKA 2H5EA 3IP1A 4G0MA 1FDIA 4RGQA 1ZN2A 3MN1A 3N74A 3K4PA 3H4TA 3A1EA 4TRMA 3W8DA 3B48A 1J22A 1H8ED 4ALKA 1YZNA 4LPKA 2IS1A 4N6OA 1V8ZA 2DKOA 2Y0PA 2ZKLA 1WZCA 3G0CA 3R3VA 1GR1A 2FPOA 4FW8A 1EX6A 4MRMA 4F56A 3OF3A 4OI2A 5FFNA 4D3ZA 4Z4CA 1NHGA 1YR2A 2FZ4A 3N1UA 3WLTA 5KOJB 1Q3HA 3RJMA 4DJ5X 5C32A 2IBMA 3PA6A 3O1IC 3KJIA 4UVGA 2AKYA 5EWLB 2W9XA 3BSWA 2DBVO 3KJZA 1E98A 4LYFA 4H7JA 1KHHA 1I7PA 4UTVA 3QVMA 1U9IA 2IYPA 2PHZA 2QR3A 4E13A 4Q9NA 1HE3A 4FMDB 3P9YA 4DR6B 3AX6A 1M6WA 3WSVA 1YJ5A 2C59A 4N01A 4B6PA 4BO8A 2FN3A 4BNYA 2H4XA 2NADA 4GVLA 3U31A 1YJBA 4BWGA 1RYDA 3CIFA 4HN2A 4MR7A 4EB6A 2P79A 2RBGA 1Z25A 2QVBA 3GCWA 3C3YA 2ACVA 4UMFA 5HIJA 3UENA 4M88A 4F45A 1PHRA 2G1PA 2DKNA 2WJZB 1T9GR 3NHRA 3TK1A 1KEEA 4JODA 2AGVA 3ESCA 1ISSA 3U3OA 1FLDA 4W5TA 3I6QA 1OBCA 1G20B 3AEUB 3F90A 3K6RA 1IZ0A 3BXZA 1R15A 4U2BA 1QG2A 1S3FA 1TUBB 2JI8A 2NXEA 3MPOA 4UDXX 2OHGA 2W42A 5FQOA 2B0CA 1O77A 2FPPB 4FMDF 1VMEA 1ZITA 2APJA 2HDOA 3U09A 1R9JA 1MCZA 1M6VB 5C52B 4EJSB 4ESOA 3RIXA 3SN6A 1M7BA 3WMEA 4LZPA 1E2MA 3I6BA 4ZHQB 3HC7A 1JH8A 5T57A 3K7EA 4Q24A 3KSAC 3GPLA 3CUTA 3GR6A 1P4HA 5FNVA 1O5IA 1LBEA 3ZTWA 2EWWA 5E0OA 4FONA 1XPRA 4Y7CA 1V37A 3KSMA 3P0EA 2ZM5A 3FMIA 5G02A 4LY6A 4ZEWA 1TX4B 3I0MA 1C50A 5FOTA 4DLLA 3KO8A 1VJRA 3IJ5A 2EV9A 1Q1NA 2EATA 1MG0A 4IF6A 4P5DA 5B3JC 4X65B 1EFAA 2ODBA 3IQXA 3TXYA 1PFYA 4HSEA 4OFZA 4IDQA 5A9SA 1UBGA 4US2R 1GRRA 1IM5A 3IV7A 3MBIA 4IKPA 4XH9B 5FPTA 2Z1DA 3VR6A 2C95A 4A8JB 1S9DA 2HJWA 3I6IA 1I4OA 2OAP1 4CKBA 4DV3B 2ZYSA 5T4HA 3MB8A 5T67A 3HFSA 2Q5HA 1XWIA 2NQ8A 2IY8A 4BNWA 1UMDA 1GPLA 4ZHQF 2R85A 4E30A 1IONA 3P9PA 5IG2A 4R1UA 1RLJA 4Q7EA 1P5JA 1PJQA 2GSDA 1YHYA 3DZ8A 1E6KA 1GKLA 1GT6A 3ETEA 4AL4A 1KKMA 2CUKA 3D4OA 1QS0B 4RVSA 2Q7DA 1C8VB 4EECA 2XCSB 2JKYA 4K9LA 1BX3A 1W5EA 5B2EA 2WWFA 5AJXA 4Z3DA 4XVUA 1FFBA 4AKHA 3CR3C 3G5LA 5C81A 4MKIA 3N8DA 3TM5A 4IHQA 1F12A 4N3NA 1S3GA 5LP6C 1OLSB 1SXJA 2WJ3A 3DWIA 3DT8A 2B8WA 4R3UC 1L5FA 3UKJA 5IYZA 1W76A 5JPIA 1ZGCA 1CD5A 1WW8A 3H1TA 3N0WA 4ZT7A 2PX8A 3HB1A 4JBYA 1CUZA 721PA 4KX5A 3IUEA 4YC7A 1XZKA 2FR8A 4HJRA 3O83A 1NF2A 3LIPA 3T3NA 1MX5A 3KALA 2B20A 3T95A 3VOTA 4WBNA 4RV5A 3FRIA 5CTAA 4RD0A 3K73O 4QAQA 4BRSA 2GPWA 3E35A 1E60A 2BEWB 1V16B 4HL6A 1DS6A 5T4BA 3N2LA 1SXPA 1KDOA 3EOZA 1SA0B 3R6LA 1D8TA 2QJWA 2IEZA 1DQYA 3A4IA 1CKEA 3TR5A 5C5IA 5ITZB 1GG8A 3AEKB 2H3HA 1KMIY 2AMYA 1TUEA 2IEYA 5BMOA 3HABA 1RWVA 2F8LA 3NTLA 3TMKA 4AJLA 3MTBA 4YXWA 3VNRA 4M2LA 1IMJA 5BWBA 1WSAA 2M6SA 4C6SA 1YTLA 1CZRA 2G9VA 1NUUA 4F5YA 2JJ2A 1XZNA 3DKKA 3BE4A 1AIPA 3HVHA 2AXNA 3LWBA 3NH6A 3UQYS 2CMHA 3GBPA 4RZ3A 3ROZA 3IR5A 2RE8A 4OJMX 5L7TA 3DDOA 1J99A 2I7DA 2WYOA 1U7UA 3KWJA 5CH5A 1DJLA 1ZK3A 4UQOA 4OQFA 1N6LA 2X2OA 3AV3A 3GLFE 4FMCF 1JALA 1WQ1R 4DMGA 2QX9A 3DFKA 9ABPA 2AYXA 4NIMA 3RYCA 5HIKA 2EWMA 3CSSA 2FPWA 1Q15A 2D54A 5IPFA 3KKEA 4F06A 7ABPA 3WJ2A 2WK1A 2NZJA 3EJ6A 4MKFA 4NABA 4PPFA 5DTMA 3UJ7A 3E2PA 3L6EA 1IRXA 4Q9HA 5IF9A 4BKOA 4Y2GA 1GKUB 2ZWAA 1RAGA 4IM7A 3TZKA 1CEXA 2ONKA 3RK0A 3F3MA 1E79D 2AHOA 4C30A 1M54A 1Z4JA 3O4GA 2X1HA 1BVRA 2OV3A 1WLYA 3B53X 3D6VA 3NPAA 1L5KA 3RC7A 2ZAMA 3NI2A 4Y6OA 1NR7A 5CB4F 1W48A 3LD9A 2VRCD 2VHXA 4RK6A 2EW1A 3VYTB 2BJVA 2JDIA 2XNKA 1T35A 1A4UA 4CKCA 2V0NA 3U7HB 2HPAA 1XQYA 4PFKA 1ADGA 4BB9A 1QCZA 3QLJA 1A0OA 1JEDA 4GX1A 1CY4A 3EZFA 3L04A 4JYPA 5EY5B 2OM2A 4BKUA 2CJXA 3CUYA 3NXSA 5HKBA 5JCXA 3DBRB 3OZSA 1DC5A 3CXUA 4NBRA 5GPBA 2WT4A 4G2TA 4B5KA 1CCWA 3UWOA 4CR6A 1JKJA 1WZIA 4DGQA 3I9LA 2D7JA 1XTRA 4HLNA 4JC4A 4K88A 4JSTA 1QFMA 4ITVA 1RJEA 3P97A 5HIMA 3SVTA 1NXOA 3B70A 5IVKA 4PNHA 4ZOBA 4GM4A 4AB1A 5NLLA 1VJGA 2D13A 2PWZA 1C7ZA 4WK0B 4EGCB 5F5LA 2BZ1A 2VNHA 3OIFA 3C4JA 1O8CA 2KBFA 4FNOA 3KSRA 4BVLA 4NYIR 3G0HA 4Y6LA 3EGOA 1WMSA 2CV2A 3GFRA 2GESA 5KSZA 1LPBB 5CHYA 1T1GA 4C0AC 1X1RA 3LG2A 4JBWA 3L7MA 4TUYB 1HYQA 1KETA 4PSCA 4H15A 5KC9A 1UQUA 3BF8A 1LBIA 3O2NA 5D7NA 5F3RA 3U4MA 3EEIA 3HP1A 4WHMA 1IWOA 4F3NA 4ZPJA 1DG3A 2GBIA 3S27A 4PICA 1MXFA 3OETA 1RVDA 2MIIA 3FGOA 3IVGA 3BHJA 3OIYA 4WCVA 4L9SA 2FCAA 3VFDA 4BHTA 4GH5A 3MTEA 2RK4A 1FXWF 2VVTA 1FW8A 4HD8A 2F55A 3QE2A 1GTL1 2Z5LA 3F6CA 2ZYVX 4G1BA 1N6OA 3RVOA 4Y2HA 2QPAA 2A0XA 3IS3A 4REQB 2YVUA 4L1KA 3NIFB 4GDFA 1NVWQ 4Y6SA 3X3HA 2R1TA 4TLDA 1CYDA 4G07A 1EBBA 1G9TA 4TUYF 5HDQA 1YL7A 4X7MA 1V47A 1JHVA 1OLOA 5AVZA 1BS2A 4JLDA 4N6GA 4P4GA 2X4GA 4HDCA 3SIPA 4PSUA 3A70A 4PFQA 3ZEIA 5BWLA 3AR7A 3NJ8A 4PCAA 1PX2A 2PUVA 3FHCB 4FCWA 3CW2A 1XTUA 4LC1A 4HH1A 4LTNA 3U7JA 4EG5A 4WOJA 1QC5B 3CSDA 3KS9A 4QU8A 2WTAA 2HSGA 2JCBA 3D3NA 2HNKA 2QQFA 4WA8A 5JD4A 1X14A 2PO7A 3FI0A 3NNNA 1ZXXA 3IR7A 3ZN2A 4GSKA 3QV2A 2YYAA 2AOWA 1K98A 1NBAA 2NSDA 3FRHA 3G0DA 1O6CA 4JOBA 3TKAA 4BQOA 1QB7A 2ONZA 1GG5A 3E5NA 4QFBA 3RSFA 3X1WA 1AKVA 4N7BA 2DWQA 2SNIE 3LS2A 2WSMA 1Z7EA 3K2IA 3KAKA 1OIVA 2Z9BA 1EKXA 3VPBA 5BVHA 2XBMA 1UBKS 1JYEA 5AKYA 1EEXB 1GGNA 1RMQA 5ES3A 1MD9A 4BVKA 4M36A 4EPRA 2QN7A 5LQAA 1ZL0A 3THWA 3L0IB 4MA4A 4S05A 2QLLA 1PGPA 1JXQA 3KELA 2AJ8A 3LUGA 1E2BA 4BRZA 5JYBA 4IJKA 2XRZA 3G5AA 4Q34A 1XEXB 4YPVA 2ZBPA 3OEHD 4BP9A 1EVIA 3KJNA 4OP1A 4BNVA 1JI0A 4HZUB 4UNRA 2ZUEA 3TLCA 1II9A 3PT9A 2JIQA 3QE4A 1IY1A 4X1YA 4R98A 3WA7A 3AK4A 2GEKA 1AO3A 1TL7C 1U7DA 2FWJA 3KTFA 4C1BA 3CLHA 5DBFA 1BHO1 1GGEA 4Q4JA 1Y7LA 3NRCA 1W4AA 4P4TA 3TX6A 2YYYA 5AIBA 2OZLA 3VKVA 1NPDA 2IBTA 3KL4A 1T13A 3KC2A 1DX4A 2CLCX 1WD5A 4JQYA 1PWYE 2JANA 3BRQA 1E32A 4OXNA 4MDFA 5ESDA 4HQFA 2FJUA 3L4JA 3UY4A 5IN4A 1IOZA 1R8XA 3FCAA 5K03A 5DOVA 2C29D 1C0KA 2BKEA 3UHJA 3DM5A 3DYBA 3LAWA 3SSMA 2GYUA 2BHRA 5BYKA 3IUQA 4YR9A 3NV9A 5EI5A 2OZPA 3NJ4A 5FWYB 3MCTA 1FJGB 3A2MA 3A6KA 1FDUA 2PGDA 3IDQA 1JG3A 3H16A 2UZAA 4PNEA 2IPMA 2I0FA 1C1XA 1R5NA 2ZRAA 4HK4A 1B0ZA 2GN1A 3BWYA 3L8MA 4HNAA 4LY3A 3L82B 4X93A 5H3CA 2FMTA 3O82A 1JLSA 1O94C 3ZQUA 3BL8A 5GONB 5JAOA 4G2NA 3UWMA 2C4KA 4UBNA 4RELA 2H9AA 4DMKA 1HNZB 2WDPA 2GK7A 1X7DA 3AINA 1HDYA 2C5GA 2C8LA 1JXAA 4JVLA 4PG7A 4JT4A 4FX2A 3OZCA 4JHXA 4YRJA 4BEWA 4EHFA 3WWOA 2VHZA 3PQ4A 4R0NA 1U2PA 2W90A 2CJWA 1RKBA 1QWOA 3A3KA 3KG2A 1N9ZA 2Z2IA 2BMDA 4HRYA 4KK4A 3W5DA 1UH5A 2QD4A 3EGDB 4P54A 4DCPA 2CC2A 10MHA 5JS1A 3EVGA 3GQBA 4HBZA 3HU2A 1CR4A 1N8NA 1OIXA 2JI7A 3DOEA 4IOJA 1YDWA 4RMNA 4Z86A 5IM5A 3E5MA 3V7FA 5E4FA 1Q83A 1QHFA 2IOYA 1UKBA 2GBLA 4OAQA 5CVJA 1FU7A 1Z6TA 3GPIA 1PU2A 5GONF 4U8HA 2B6NA 2GCIA 2W6PA 2JARA 3BJRA 2DFTA 4YASA 5JIBA 1NVUQ 1EX9A 4ED9A 4CMCA 1A3CA 3HCPA 1LY1A 2P2GA 1Z0UA 3HP4A 1Q16A 3QG5A 1PYGA 3SXUB 5JYEA 4ROSA 4JB0A 4I9HA 1EGHA 1KHTA 4HXYA 3EF1A 4OI1A 3U44B 3TOSA 6ABPA 4JB2A 1NLUA 2AF4C 2K5UA 5KNBH 3WBFA 2WIBA 3PUVA 4BNUA 1U0BB 1CR1A 3L1UA 3W5CA 4NE2A 3JTMA 4M0KA 1E69A 1PUXA 4ZVUA 2FRDC 3UXMA 4BVGA 5FUMA 1RW4A 3MQFA 3GAFA 4BAZA 2G06A 3FA2A 1VI2A 5SYNA 4IF4A 3D8TA 4C4TA 3HVRA 1V5GA 2MYUA 2KPOA 2OC4A 3FJYA 5IBQA 3U4AA 3UYKA 1U02A 2NTNA 4UCQA 3ZDBA 5JROA 1PX0A 3MRXA 4JDPA 3GLGB 3WWPA 4QJIA 4H9GA 5AUPB 2HCFA 1UZLA 3PJRA 5CVCA 2GRUA 2ZYAA 3ZDEA 2YYSA 2QMYA 3PNQA 5CLGA 1N2XA 3GDWA 5L4SA 3BN3A 5EHZA 3FF4A 4P3KA 2QPLA 4CF5A 4YBRA 5JCJA 4RW0A 4MIKA 1P4RA 4L2IA 5E3IA 4G86A 5CT6A 1O9BA 1W4BA 3FVQA 5D84A 4NCBA 2FY8A 2ZR7A 4W9NC 2A78A 4MOWA 1KH2A 2DTDA 1DB3A 3CTPA 3UANA 1D1SA 3EFBA 5JE8A 3OEEA 5FWXB 421PA 4K46A 3N87A 4GXTA 4BNTA 1EJ0A 4JCOA 4TZ0A 4U00A 3D6TB 2IV2X 2BBTA 4EO4A 5CYGA 1M2VA 2CFRA 2D1RA 1W5BA 3HN2A 1NV8A 4G1MB 4PQRA 4QYIB 4R8MA 5EXXA 5H68A 4AUKA 4B74A 2WIJA 4DMLA 2Q6IA 2R8BA 4KLCA 3G23A 1PJCA 1MXHA 3LUJA 4IDPA 5B3JA 2GWRA 1R6BX 5C4GB 4JJ4A 2VKQA 3PVSA 1NX6A 4J07A 3VR1A 5JUWA 1SH7A 1EX1A 3U0BA 4RJJA 2RH9B 4EHBA 4BNHA 1W1IA 1UM9A 2NWQA 4D97A 3NO4A 4KRYA 4EB3A 1CZHA 5KTPA 1QFZA 1PG0A 1J25A 1L7VC 1Y4UA 2BDUA 3TBKA 1M10A 3TL6A 5BUSA 5BURA 3ZIDA 1QMGA 3A4YA 1E2NA 1KVRA 3AKEA 1YCHA 3QU9A 1YS7A 1M6EX 3T8YA 1YE5A 5BNZA 2RHLA 4BN0A 4U2EA 5GJBA 3T3IA 2WD8A 2AHRA 4EYEA 2A3RA 4N9QA 3TBFA 3PEVA 1RWNA 1R27A 1KMMA 1TAHA 4HUQA 4M0UA 3PEEA 1S3IA 1KXJA 3NBUA 3ZWPA 3R7NA 3FOEC 3UCXA 1RM5A 1FIUA 4RA9A 1CE8A 2BSQA 5LP6A 1GL3A 2QNRA 1Y37A 2XCOA 2D1FA 3R7FA 3ZVRA 2YOHA 3G2NA 5HM6A 4XIGS 4MS3B 2P11A 2Y6UA 4A23A 2J33A 5BN4B 3RVSA 4N39A 1QQBA 2CD9A 3NHWA 1KYQA 4M9ZA 2DECA 2ZZMA 3T34A 3VSBA 1VPVA 4RESA 1UC9A 3MB5A 3OPMA 3AFOA 2DPYA 4CKZA 2XKAA 3U4IA 5AKIA 3TW6A 5FI1B 3RRXA 2UYCA 4A36A 4AG6A 4CMKA 3QBDA 2VNAA 1PNRA 3ZS8A 3FCOA 3BGDA 2HSEA 2QGFA 2OAEA 3ITNA 1Z7BA 3EZ7A 1KK0A 5TQJA 4URZR 3RYIB 2YICA 4ER5A 1EDDA 4FI3F 4J43A 4LF8B 3BCSA 4H1WA 3L0ZA 3NETA 1EFKA 1WNFA 2Y0CA 3IIMA 1C3OB 4BAUA 3C3WA 4QQFA 3DDSA 3LF1A 1V4BA 1CUSA 1P1CA 4MW7A 4TV9B 4WRRA 3CWZA 3FNHA 5TNXA 3RU3A 4L0QA 3D6JA 3P0JA 2X0DA 1X0XA 2PD3A 1FLAA 3FCXA 4JL8A 5EXTA 3R1IA 4E5NA 3E84A 5HM8A 1PWEA 1QLWA 3MPUA 3WOHA 5TQVA 4LYDA 3QG1A 1V9LA 1AQLA 1IEWA 3F9RA 3L84A 1TVCA 5DTEA 5I7EA 5BOSB 4RS3A 2FMUA 1U0LA 3R76A 4WESA 3V8VA 2C9MA 4ZAZA 1A96A 2C07A 3ZJUA 5CDHA 1Z0KA 1ZSVA 1UPFA 2EJTA 1Q0PA 2OCPA 4K3UA 5E9QA 4K5QA 4LGCA 2EP7A 1BDMA 2EFGA 3VRHA 3JQBC 1MJGA 2EKPA 1AKTA 2C9DA 4UXHA 1DC3A 3TFWA 3OPYB 3JQ9C 1TKBA 2A9PA 1OT3A 2UYYA 4HEJA 3QPUA 4TV9F 5AVKA 4E7PA 1T6YA 1HT3A 1UXOA 4IHJB 3S28A 4IWYA 3T1NA 3WNBA 3HO1A 4YPFA 3DPIA 3O4RA 3QVSA 3W5BA 4OMCA 2O59A 1CQIA 3RVLA 4DYVA 1DWPA 3IDOA 4GEKA 2I67A 3BMQA 1D1TA 3UVEA 1WAMA 1TEHA 2EYQA 1SBCA 4UM8B 3SJBA 1ZVMA 1Z33A 2PRZA 4NICA 5E0KB 3ZU6A 4EHHA 5FWDA 5L40A 5TS3A 3ZGVA 1M1ZA 5JJCA 1ZJWA 5JLAA 3R5TA 1UFRA 3DTYA 4GLFA 1GV1A 1E92A 2HMYB 2Y1EA 4LCEA 4RHFA 4W7HA 4WKGA 5TPZA 4KXLA 3G7UA 5K4AA 2REOA 1PEAA 5K05A 3IB3A 2OO3A 1VBMA 4UE3S 4BEBA 3HR8A 4TXHA 2C57A 3TLBA 1DZ3A 2RD2A 4IHJF 2M6RA 3RTGA 3OQNA 3GN1A 4N0EA 3IA7A 221PA 1MORA 1OOEA 4NJEA 5IBRA 3ZPXA 5B3LA 1DWUA 4F4JA 5ECWA 5JW6A 4GE3A 1QAMA 4YJFB 5ALMA 3HJRA 4ESVA 1JDSA 5IULC 2A9RA 1S4MA 2WG2A 3GJTA 5DHTA 4KKXB 2XVZA 4EB0A 1HT0A 5FL3A 1RJ9B 5GMOA 4B43A 1JGTA 3FTPA 4ZO9A 4LYEA 4CFSA 5COBA 4E32A 2PZAA 3F6BX 4XWGA 3FZQA 5F1OA 4DA0A 1JFSA 3HRHA 3ZUPA 4BP3A 4CCYB 3I5YA 4EMTA 4DLSA 3JX9A 2DY1A 1VKOA 2ZYWX 4N47A 4DF3A 3FETA 4GYWA 4XVHA 4DQXA 4W6ZA 1EQ2A 2DG2A 4KH0A 2VUSA 4CV0A 3N2EA 2J9FA 4MUXA 5LB2A 3RVQA 2D2VA 5AHWA 5CFRA 4C0JA 3K0FB 5A4JA 3W90A 1C4XA 3BTSA 1N5OX 2IU4A 3LOQA 1DKLA 5CT9A 1O96A 5F4ZA 3K9FC 2HW8A 4E4YA 2HJSA 1HPLA 1XYYA 1YFZA 2RAUA 2W11A 3CRQA 4OOFA 4OGFA 4TKUB 3VYVA 1XCOA 4BFVA 2BZGA 3DC2A 3OT5A 3D4BA 2QUAA 4H0NA 1GA4A 2HMSA 1YQUA 4GWGA 2Y99A 3GLKA 3EXEB 3L7IA 1NQOA 2YMMA 2AEEA 5ICEA 5C37A 1XP8A 3H6GA 4DLNA 1SFRA 1V3TA 3OH8A 4CKWA 2C83A 3HXQA 2DT8A 5T4FA 3HZOA 3ETJA 5KJFA 2GH1A 5BV1A 2H2FA 7AT1A 3NNDA 3UJHA 2B7LA 4B2LA 1ZIDA 2CWWA 2HI0A 3HA2A 3KLBA 4MJXA 5HK8A 2AZTA 1P2FA 3WYNA 1O97C 4KC0A 4MEAA 1TJYA 4F0JA 2MSLA 4R9SA 3QVUA 2Q5CA 3DUFA 4HQLA 4KPYA 1G291 5TX7A 3LNTA 3GDOA 2O8FB 4YQEA 2J3HA 5CYOA 1C9NA 1GIAA 2C7QA 1SD2A 2DH6A 1TU0A 3CKLA 4RJIA 2EW8A 2GXQA 1SG0A 1UBNA 1Y8QB 3BXGA 4LPSA 4OBEA 1M1NB 3SYTA 4KLZA 4DWOA 3VPAA 3OKFA 2I78A 1ODTC 2WU3A 4Y9RA 1HFEL 4TL7A 1E9FA 2ZIAA 4KZKA 1XKTA 2FUEA 4K81B 4YECA 3TZBA 4HNTA 1XUOA 2QT9A 4O4HA 4XSHA 5ILOA 1BJTA 3VNSA 1M8KA 5TJ9A 1D8AA 3ZGYA 4GOXA 3THXA 4LMBA 1ZOLA 4FJ0A 1UKZA 2PGJA 3DMTC 2FUNB 3GLHB 4FZ3A 4Q0MA 1Y1RA 2OYCA 4NV1A 4A6DA 2YWCA 3CZ4A 4PZ0A 4UPDA 3OJOA 5CLQA 1PVDA 3REQB 3UTCA 3VHXA 4NQRA 3I39X 4G01B 3PDIB 2XMZA 4R51A 4UW9A 2K7FA 3ZWAA 3QUBA 4QRHA 4XUGB 1T3GA 4BMPB 5HJ2A 3G8DA 521PA 2VDVE 3F9CA 3MCUA 2LWIA 1T3ZA 4PU0A 5CT4A 4ARZA 5CB8A 3S70A 3T7DA 1SXJE 4MRVA 4B6RA 1DMSA 3JARB 3QMPA 4DSAA 2DWUA 5DLYA 1OFVA 4KQEA 3QU7A 5INTA 4RNDB 3FOFC 3MCVA 4CT4B 3HKEA 4BVFA 5CFQA 3M0EA 4L27A 3AW8A 1FNBA 1ZBQA 4MUIA 3LY7A 3P0IA 4PX5A 1E9VA 3BWBA 1KSGA 3UJBA 4IQ4A 5FAKA 2E4UA 2ODNA 4B6FA 1Y1SA 1ITZA 4NOLA 3OIUA 2Y76A 4B3JA 1ZH4A 1TQDA 4ADSG 3BJIC 1N8KA 1WEHA 2XUFA 2H4HA 3C24A 3OA2A 4MW4A 4XPIA 1BWRA 5FI5A 3QUAA 1F0KA 4UVIA 2E1PA 3IUPA 4Z8XA 3KB2A 2H2HA 3LFHA 13PKA 4QBGB 1D2MA 1GQYA 1A8IA 1LU9A 1ZL2A 2XOXA 3ZHUA 5K1ZA 5DM1A 1L4LA 2XQGA 3B9RA 3HKBA 3P2IA 4KRGA 4MV9A 1O94A 2KJQA 1UDRA 3JASA 3OJLA 1OSNA 3FYUC 4ZZ3A 4J1SA 4WZAB 5ES4B 3WDKA 4CL0A 1F06A 4DDWA 3A32A 2OOKA 1OH5A 3MVEA 3HRIA 1Y6ZA 3W06A 1UOPA 2WI8A 4DQLA 5JRZA 3M2TA 3GIWA 2ZAGA 4MPRA 1YZUA 3ZHYA 5CBPB 1DPGA 1NMEA 1Z6GA 4R84A 1H2BA 4CCWA 4IYRA 5M29A 2PYZA 4Q7KA 2A4KA 5FPYA 3LQFA 3VR3A 5JAHA 1F38A 2O07A 1GCGA 2ZBRA 4QPNA 2O52A 3EAFA 3EZ9A 4OI4A 2XDQA 3QOYA 1T0UA 3NBFA 4HS9A 4JP5A 2QOEA 2XXAB 5COQA 1RI2A 1ZICA 2AFIB 4D3FA 2HFJA 4DMCA 3Q2KA 2O1WA 1P7YA 2UZ1B 4A27A 1Q1GA 3KJEA 5AM2A 2BFCB 1OI2A 1SOWA 4FJ2A 3ZHVA 1PTJC 4I5IA 4IDDA 4GI3A 1VL1A 1VSUA 2AQHA 4LBYA 3VM6A 1MB9A 4B17A 5IFKA 3DZKA 3QPAA 3E4DA 4Y0NA 2WJVA 5KNBD 2JCSA 4PHHA 4OGGA 1A4IA 1J0CA 1THZA 2D5AA 3WKEA 2GR9A 3QKSA 4PYKA 1YJCA 4V02A 3COYA 3V3TA 3K1AA 2R8ZA 1UFQA 4KXYA 3UGQA 4JLPA 1DHRA 5LZ9A 4GZ3A 3TQIA 2DM6A 1BCRA 2D8AA 2DHEA 3IHTA 3QUQA 4FTWA 1JBEA 4I4TB 1JU9A 2NNWB 2O6LA 5ALJA 1LDYA 3B8EA 4LSWA 3R9XB 4QSMA 3H65A 5JYCA 1EBUA 2FRDA 3AY7A 3LXMA 4MGHA 2F00A 3QVXA 1IXYA 1CDDA 3OUUA 5LLTA 3KVRA 1PZNA 2ZBVA 1PP4A 2ZVPX 3BIWA 3HYSA 4HRAA 3G6WA 4IIBA 4DBLE 4DMMA 5JR3A 2JJ8A 5CB0A 2UZIR 1J8FA 1Z6ZA 2EFDB 3HJHA 2C00A 2DPMA 3KUXA 3TVDA 3UT6A 4B48A 4ZOQI 4RTKA 2WMDA 3DM9B 3DV0B 5CFNA 2Q41A 2L69A 3IURA 5K8TA 3COSA 4G37A 5JS6A 2F8MA 4KUGA 3HJAA 1CYEA 4PSVA 4XWTA 1GSAA 1WPGA 1WO8A 4G24A 2WYVA 3HLKA 4L5YA 4MK4A 3IXQA 1I3NA 1IQUA 4O1MA 3EIWA 1LDGA 3QTBA 5HZKA 2QS9A 3ENKA 3LPMA 4N8EA 2BAGA 2HMTA 4C7MA 3Q7QA 5AM1A 3HCFA 5J47A 2VDLB 1IJKA 2Z9DA 2HM7A 4W9NA 4Y98A 4YGXB 1NBMD 1RHQA 2F3QA 1VI5A 3R7DA 4HOYA 4OQDA 4EUHA 4KI7A 4X7RA 4YRCA 3WGKA 4CQMA 1ZGAA 1G8MA 1USWA 5E38A 1AKNA 3UIEA 3DV9A 1BHJA 1T4CA 2CL7X 1NXWA 3L0YA 1DVRA 2IDKA 1CFZA 1T1RA 1W0KD 4D6YA 4F86A 1H0SA 3LTEA 4BV3A 1YR1A 1TKCA 4KN8A 3AEZA 2FZVA 4W5JA 3R9KA 3TOZA 1O95C 1DUSA 2O0JA 2BVNA 2PKQO 1PJBA 1T9KA 1G6Q1 4JASB 1RXYA 3RFXA 3VVLA 3UPDA 4R2IA 3TSCA 3WICA 4LSGA 1UOEA 3B1JA 3EIEA 1QOPB 1U9JA 3QKIA 3V8NA 3C48A 1CVIA 3U0VA 3Q0EA 4RY0A 2QLFA 4R2KA 4WW0A 4XAQA 5KB3A 1XHLA 1OA1A 3EG5A 2X1MA 3F8SA 4LFAB 4HAWA 2YWEA 2YJTD 1V45E 3N7TA 3AU8A 4JL6A 3L9WA 4X0EA 2GBPA 3UATA 3KJXA 4ND3A 3F5SA 2OCDA 2RHMA 1R2QA 4HAXA 3HN7A 2VK8A 1MC5A 4AAYA 2QY6A 3ZVLA 4AJPA 1N0HA 2IYZA 4F93B 1EUZA 3N2ZB 1JW9B 3Q8WA 4K6FA 4PONA 4RCYA 2ZUVA 4TKZA 4P0QB 2GM3A 3NTVA 3JQEA 3ZBUA 3MNFA 1PZMA 1UADA 3A1DA 3CEHA 1L5LA 3EMKA 4RQTA 2INGX 1JG6A 2PU7A 1AUPA 1NVFA 3ZWMA 3TNFA 5C8YB 1BU8A 1J7KA 1V1RA 3E7XA 4PZAA 4GRDA 4R41A 5HJEA 3EUAA 3PEWA 1BDHA 1BE1A 5BNWA 1KNXA 2QRJA 3R4VA 5EMNA 2BP7A 3A1FA 5BQ5A 1KPGA 1R6DA 4HX2A 4MGEA 2HWKA 4FYYA 3MWEB 3KB1A 4MHOA 3IOEA 3U4QB 3MRVA 3DL4A 1Q0SA 3E3MA 3P9SA 1GA6A 3WLIA 1X0VA 2E55A 3EN0A 1JG1A 3M1AA 2OFWA 1N2CE 4TV8B 4DXAA 5G40A 5LWHA 2RHHA 2C5HA 1S7GA 3BKWA 4DLVA 1TYCA 3ASVA 3UMRA 3ZNQA 4EKYA 1XP5A 2OV8A 1BFUA 2GYWA 3EIOA 1K27A 1QIKA 2Y4NA 2PG3A 3BF7A 4GBGA 1G1MA 3DO5A 3F2VA 4QOFA 4EPWA 5C8YF 5CDTA 1OB2A 5J5VA 1H5NA 2QE7D 4GGOA 5DE3A 5CCBA 1C3EA 4NBUA 1ZVKA 4C7VA 4DMHA 1NNEA 1Q19A 4QQ8A 5DF1A 1T29A 4HRXA 4DT1B 3F96A 4BZQA 3RAGA 5I51A 2C3PA 1VRCA 2OVBA 1J6UA 1RZRD 1I6LA 2N9UA 5EWMB 4FLFA 2C58A 2GN9A 1AF7A 3BGVA 4J7CA 4NONA 3BRSA 1GKIA 2QX8A 1CUFA 3HVJA 2IC5A 3SOZA 4LF5B 5AW3A 1LSUA 1J8QA 4IVNA 4HLDA 4UU7A 4Q7QA 4TV8F 1B73A 1NMYA 5A5GA 1VSVA 2JIDA 3UWKA 1FSFA 4I99A 5LUAA 4RMJA 2XYQA 1XRJA 2FTKE 4DGSA 5IEBA 2FMIA 1F48A 3PQ5A 3KYDB 3PC8C 2IXEA 2GEDA 1AKYA 1FFXA 1Z2CA 1ZQ9A 4X3CA 2XKJE 1Y5IA 3R6GA 5IKMA 1Z88A 3U9LA 5BUZA 2VFAA 3JQBA 3LVBA 1SCIA 2UZ0A 1G7RA 1J97A 1U11A 2WAYA 4WZBB 4BCBA 1GDDA 3JQ9A 3CX8A 3VO9A 1N2IA 3PICA 4FNAA 4KQ9A 1YB2A 1JDJA 1GZDA 1H9BA 3ILHA 2D5CA 5KQPA 3OM9A 3I2GA 5G1PA 2ZB7A 3LRPA 1SQ5A 3IDAA 4JLOA 2ZUWA 2I80A 3IKVA 3AEYA 2C8JA 4RPLA 3SM3A 3S2YA 1Q12A 4PZUA 4EVQA 5BN3B 4R2LA 2Y05A 2I34A 2JLRA 4BP8A 1V5WA 3H8SA 1AZTA 3FPGA 5JJIA 2IP1A 3SF8A 2JFPA 1Y8RB 1QQAA 3CZQA 4IIDA 4NMHA 4LOLA 4QJ3A 1OFGA 5LN1A 1KY2A 2GZDA 2R66A 1SBYA 2D59A 1R6AA 3D5TA 3GP3A 1FUYB 2G9NA 1P2VA 4C6TA 5I3ZA 4V0KA 3KQQA 3DFFA 2IYRA 2CUNA 1SKQA 2BTQB 3VO8A 1XXHB 1YVRA 2D4HA 4M83A 1PJ3A 2WF5A 1L9XA 4II7A 4R1PA 5B6JA 1MOQA 3GUUA 1L4KA 4NSNA 1GPWB 4MI3A 5K6TA 4IEFB 1B93A 1B3RA 1ZGGA 2FPUA 3O3CA 3QXHA 4QXPA 4Q02A 1NHWA 4RVCA 3WX0A 2VCYA 4YA6A 4PLHA 3AVTA 1LD3A 1ZEJA 2BEKA 2ETVA 2IU3A 1V1MB 3IEXA 5JVDF 5LXTB 2YDXA 3VMMA 3S8EA 3WLMA 3IP7A 5B4UA 1KXZA 1YZLA 2NSHA 4IRUB 1QPZA 4V1CB 2IUSA 2B83A 2QROA 3IVRA 2DKFA 1F8UA 1NPTO 1R8JA 3NEJA 5JAUA 3LT5A 1FTGA 4NK4A 2CHEA 2Q6LA 3ORYA 4NECA 5AKLA 3NBMA 4GI7A 4HNUA 2VP6A 4BECA 2AJLI 1X1BA 4GX2A 4DSTA 5CTJA 1MOZA 1YK0A 1ECBA 2E5FA 5LBUA 3ZU3A 2C2ZA 1H0KA 5AP9A 2LNDA 4WZ6A 1K8ZB 1LFDB 4R1SA 3IV9A 2IGBA 1MVLA 3H5OA 1YMQA 4OJKA 1CRQA 2AOUA 3QWBA 3QYAA 1CTQA 1PUJA 1MENA 1RRGA 2C61A 5FUXA 5H02A 1F8FA 1P7ZA 2F3PA 1HGXA 1NRJB 2QUBA 3QY0A 1EWQA 5LXTF 1CY1A 3QEMB 4W7IA 2CLKB 3LSYA 3UJCA 2XF2A 3BGSA 1S8OA 2KB0A 2K87A 1IAVA 3RSZA 3HG7A 3BOSA 1W4LA 3PEUA 1T91A 4QBIA 3W34A 1KBZA 1RYMA 1YCFA 2CK3A 4MNTA 4EFMA 1ZVVA 1DZIA 3OLQA 4NU5A 2EOAA 2P2YA 1SVNA 3IUYA 2HEGA 3I5UA 1RQNA 3CW9A 4NNPA 4LRWA 4C08A 4D9IA 3N9IA 4H17A 5K0BA 1PNTA 3I2HA 4ETNA 3QLEA 3HUDA 4L9AA 3MAGA 3TF5A 4UREA 3DFUA 4X8LA 2O0HA 3EC7A 1AS2A 1E3WB 1VE1A 3HMKA 3MUEA 3BD9A 3LPCA 1H0RA 3OE1A 4ID3A 2FX5A 1X1SA 3HBJA 1XTSA 2C2WA 4XASA 4BL5A 3LU1A 4ZVRA 5T5QA 3UOGA 3EWSA 1GHTA 4EHJA 1C9KA 3P26A 5I5EA 1RC8A 1IXSB 3T9FA 1DC7A 4RA6B 4HDKB 2A59A 4LMAA 4BB5A 2NXCA 2YX1A 1W5FA 3DVRX 2X9VA 3EVCA 4IIUA 4U7TB 4EATA 2A0KA 3RM3A 1P74A 3JALA 4OL9A 5I7HA 3ICEA 2P65A 1ZJ4A 3ZZ0A 3RT7A 5LNK6 3I9V6 4NU8X 4NPHA 5B12A 5IVIA 4OKIA 4HDAA 4P98A 2QVCA 3K9QO 2UUBB 1Y89A 3FVRA 4HFMA 1L5WA 3AW9A 3TKLA 3DMRA 1PS8A 2JFHA 4UFNA 4P2GA 2XNHA 4HQOA 1CZNA 1SKAA 5K3FB 1RLIA 3DMTA 4LE1A 1MKYA 1PBNA 2KS6A 1XPJA 1VTKA 3RNOA 1KFJB 3IH5A 4WADA 4BMXA 1U28C 3Q85A 2XQFA 4F4IA 1M73E 1WDLA 4NCIA 3WADA 4UEOA 1YB1A 1H0HA 1Y5NA 1X7GA 3AUXA 3FUTA 3V4FA 3FDFA 4EGSA 3L4KA 3NONA 3V3KA 3FN4A 3ZX5A 2J09A 2Q1TA 3KKKA 2ZJAA 3J81k 4C0BA 4YUYA 1NPYA 5IC6A 2XF8A 1GZVA 1V2HE 3E82A 4Y9SA 3H1BA 3GXBA 1MABB 4K26A 5I4CA 1GRCA 5IKOA 1XD8A 1SURA 4LDRA 4QGBA 4Y2XA 5I4BA 4HQKA 4OXXA 1RI3A 4EFKA 4P58A 4Z1MA 4OHZA 4EAQA 2Q8PA 3AF1A 1QF6A 3IAM1 2O2IA 3L2OB 3QKUA 1UL1X 4XQ0A 2B1QA 3WMFA 1JQLB 4YMGA 4MUMA 1D6JA 1CNMA 2I4OA 3LYAA 2QRHA 3DXFA 4H4EA 4YRFA 3V2IA 4KXVA 4QU5A 2NP7A 4HN9A 4BMZA 1UAGA 5J2TA 2FE1A 1L5VA 3U39A 1YACA 1Z37A 1RQRA 2PL9A 2ZRNA 1SBHA 4MEJA 1GYQA 3TAHA 2O2DA 2GXSA 3ZY4A 5FBKA 4S1VA 3FYUA 1CHNA 2QT1A 4MTCA 2I71A 3FMGA 1MQSA 4PC7A 4NE9A 1EAMA 2JGMA 3BZWA 1XJ0A 5LIPA 4KXFB 1N4DA 4RLFA 1SOMA 2C0QA 1P8JA 1DAMA 2P9TA 1G7SA 2GHIA 1RVV1 4LJ8A 4YUWA 1T3SA 3DEHA 4DLBA 4GGMX 3NIBA 3KQKA 2WM2A 4D0LB 3ZH2A 3F2IA 4GT1A 4JYBA 3VVMA 3LQQA 4NG5A 2EKLA 4FEAA 3MFYA 1QDLB 1W9HA 5C8XA 4IDBA 1P39A 1DAHA 1ZKDA 1YBFA 4O0LA 2WM3A 3E1GA 4KPUA 2QAIA 1NNUA 2CVZA 1XZBA 3CB2A 3AEQB 4MS1A 1XR3A 2YQ4A 1M34E 3UMVA 1PTJA 3CMMA 1ZZGA 5TLSA 2QJTA 2OBMA 3NTRA 1YNOA 1YCGA 3DMFA 1S2MA 1Y1QA 3ZJVA 3K05A 1ZAYA 1WTAA 1SUSA 2WSSA 1USGA 3HUEA 4G0ZA 4H16A 2QL5A 3O4VA 3WHPA 1Y63A 1GUYA 5HF5A 5BT9A 4F4HA 1I9GA 5B6PA 4I6GA 4L74A 2WB4A 1ZUIA 2QUJA 4IGKA 3MWGA 5DBIA 1W36D 2ZYGA 2IUUA 1XYVA 2WSLA 1YOVA 3D4IA 4H7DA 4N1AA 5BPHA 5LJIA 3AYXB 2HO4A 2NUTA 4LJ6A 1X7ZA 4G8BA 4JD5A 3FFXA 4I55A 3PFNA 2JCVA 4B76A 2IF0A 4G56A 4Y0AA 4KVGA 2TMYA 5EINA 3GAMA 1P7PA 4G0YA 2PE5A 2CEKA 2NU9B 5CGQB 4NMLA 2AW3A 2FZ5A 1ADBA 2X9LA 3GL9A 1KP3A 2G70A 3IQGX 1CF2O 1ZI9A 3USES 5L3QB 3WGYA 1U8TA 3CMCO 3JATB 4TGLA 5GM1A 4G4IA 2P5TB 1QZUA 3ENWA 4OGLA 4BNLA 4RTMA 3LO5A 3U7GA 1PTKA 2PWBA 1DTWB 1DCKA 1ID8A 3GMSA 4EY6A 4Z9XA 4WFKA 2XCQA 2Q21A 3QX8A 4Q93A 1YH3A 2HIAA 3STHA 1YZKA 5I8WA 2H0QA 1R0XA 2PT9A 3VU1A 1PJTA 2BIFA 2OK7A 1EIZA 3KYCB 3QVOA 4PO1A 4TWBA 3TCNA 1WMDA 4BNKA 4PYLA 4B3DA 4MI9A 5CXSA 2D2IA 1P3Y1 2XUKA 1O95A 1XN4A 4TZKA 1SBIA 2QORA 1E0SA 3BA6A 3ZCTA 4DR1B 1O9GA 4ABYA 1O03A 4AJEA 4GDMA 4EK9A 2E9SA 2CXRA 3DMGA 1JU4A 3FKSD 5JNUA 1NDHA 1JR4A 3K1YA 4S35A 3HA3A 2UU9B 2CLFB 2VDWB 3PFKA 2OCLA 5DWQA 4ZRNA 2QZSA 5A02A 5I7SA 3LDAA 1A8QA 1OX6A 4YACA 2WPDD 4L5IA 2ZRJA 1I5EA 2A9OA 3IUBA 2PNJA 3DBLA 3GBSA 4L57A 4B3BA 3PC2A 1RXUA 2OKGA 4B71A 1XVLA 3ZC3A 1FNCA 4R05A 5CUQA 2J3LA 1AMUA 1I8TA 5H4HA 2GILA 1UM8A 2BM1A 2AXQA 3C5CA 2F9LA 5DK6A 2P3OA 4PS0A 3OPVA 3EIHA 1T34A 1T4MA 1A9TA 3H9GA 1AK2A 3UB3A 4DQ0A 1A7AA 4M46A 1BHQ1 2ISCA 4XR4A 3DDHA 3W0LB 1HOTA 1DCTA 1TXGA 3ROXA 2HO5A 3DT6A 3E9RA 1PRYA 3WTCA 2QPOA 1TJ5A 5ADVA 1XJ5A 3KLMX 5BMVA 2Z30A 3VO1A 3GW8A 3LBNA 4MB6A 1YBHA 1F4LA 3ZXSA 3LL7A 3ERCA 6GPBA 1YJ8A 2FEMA 1U3TA 2BEUA 1BROA 3L6BA 4U2DA 4WLEA 1E8DA 3X2EA 2Y6VA 2A94A 3CW8X 4XSVA 2VJMB 3IJEB 2Z5GA 1YD7A 5EQJB 2HU8A 1G2QA 1V95A 2I87A 1K2WA 3DHNA 4TLAA 1E2UA 3WK9A 1MAVA 2FSHA 2Q0SA 3T7CA 2AE2A 2Q6TA 3C98A 3JYOA 4L7QA 2HJGA 5TGZA 3ABOB 4MO9A 1RU3A 2NO0A 2QTVB 3DVQX 1T5DX 3QZUA 4NNOA 2VA8A 4Q18A 4EABA 5KKCA 3PLRA 1A1VA 4LN1A 2IYWA 2PXCA 3AHIA 1C1DB 3FJOA 2HA7A 3L8ZA 4TL9A 2HNAA 3WZLA 2XOKA 1UBSB 3N75A 3HKDB 2KI5A 4IH1A 4LKOA 2XQKA 1FTWA 5LMCA 4NV3A 2G9UA 2O2ZA 1KJYA 1SUPA 4GOND 1TYBE 3FR7A 4B47A 3PNMA 5KVAA 2PX2A 2YNMD 5BQOA 4MUYA 4L3VA 4TN1A 1T26A 2DRIA 1BMDA 2X3YA 1OH7A 4JYMA 2P8SA 1W7AA 1QE0A 2I4LA 2VJPA 3NYQA 2WUGA 4L6AA 1RC1A 4U2CA 1E1DA 1UUFA 3ZU4A 4R6WA 3LCRA 4P3YA 1LF5A 2G1UA 4G5SA 2IQIA 5DHQA 1JNXX 1GFWA 3PC8A 5TQ0A 3X2SA 2XUIA 2ENWA 2NV2B 3CNOA 4NOKA 3RJZA 3AB8A 3SY8A 3CXRA 4UC0A 5JXHA 3OPQA 3SQDA 3T7EA 3IPAA 5FBHA 5HCNA 1YR3A 1UJMA 2XWQA 5A7HA 3SNKA 2V45A 3G2HA 1ZIXA 3CU5A 1ZNXA 1ISFA 2QTAA 4D8YA 4DR2B 1US8B 1XWWA 2Q5JA 2XAAA 2HF7A 2VWHA 1OMOA 4YYEA 4G0PA 5L9AA 5EJMA 1IL0A 1XN1A 3FBTA 1I7LA 1M5UA 4RLQA 4JI1B 2PJZA 1I6KA 1PHPA 2JGJA 1HTWA 1KPHA 2ZS9A 2WD7B 4MWCA 4DV5B 2CLHB 1FVFA 1PG2A 2VJDA 3JD2A 2VP0A 2JFQA 4DA7A 2W4MA 1QLHA 1EHYA 2XTAA 3ZK7A 4EBBA 4WE3A 4D80A 4BYGA 5IM4F 1ODFA 2FA9A 3GLFB 3FX2A 3SPXA 4N3GA 2XEXA 1E2JA 1DOAA 5SICE 2LCQA 1D7OA 2DF8A 2BM0A 2VUTA 3Q6NA 2YCBA 1VMAA 2ZRDA 3DONA 2F3UA 4NV0A 4O0MA 1YK1A 3NYRA 4KITB 1C9DB 1DAPA 4L4YA 2XODA 5AI6A 4DR7B 5KWIA 1W19A 4C0SA 4E3ZA 1YS2X 2VH2A 3K0BA 5IDVA 1IOVA 3ANXA 3U3ZA 1Q7GA 4TYPA 4XLZA 5KDLA 3KUKA 3R3WA 3EZ6A 2RI0A 4IIFA 2NU8B 4JT9A 4MQFA 4J7AA 4NBTA 2BSXA 3ZQ6A 5KOJA 1V5FA 2YFHA 4UMVA 1I51A 1I5OA 5FOWA 1NXQA 5JC1A 4C0WA 4H7FA 4JXZA 3R7AA 3PQ7A 1K08A 2MYNA 4JLKA 1QHIA 4WKBA 5KYYA 3ZLTA 4GZ5A 4IQGA 1UMCB 2R8PA 4HB4A 2R0QC 2FR0A 1YJAA 3K3PA 3TTYA 3O75A 1MC1A 3RYFA 3ZWYA 4ZYLA 1IMOA 1NVMB 1E9DA 2JHGA 4OY3A 1ZHHA 1KJIA 3SBOA 5DXFA 3V1LA 1KPIA 1UINA 1ZIOA 2A35A 1Z2PX 4WN3A 4FZ5A 3CZPA 4YROA 3RVRA 3V2UA 1M2GA 3PJFA 5JSKA 3ND7A 1G20A 4G5GA 1ESCA 1UBUS 2ERXA 3LJKA 3QLVC 4P3XA 4C4SA 1BXGB 4H6VA 3SHOA 4TXNA 2I2CA 1U2QA 3P8ZA 4DEVA 2B1IA 2HJRA 1ESEA 4Y18A 2YR0A 4S12A 3NGXA 2IXDA 4IJQA 3MGAA 1M6VA 2YWDA 1U9CA 2RBEA 2H4WA 1XCPA 4J3NA 4EFLA 2VI5A 1ONNA 4GM0A 4RY8A 4L85A 5HWSA 1H1DA 5DYIA 3OESA 5KNCD 5A6VA 2FPIB 1K7CA 3H86A 5KYWB 3V7UA 1L1FA 5JTUA 1R0YA 2KWIA 1M1YE 1YRLA 2XLCA 3LW7A 3OOWA 5HZHA 4K28A 3CVWA 1O54A 2FJ0A 3DR5A 4ZAGA 3ZHOA 4QXMA 1EFLA 3PCRB 4Z0HO 3KFVA 2HDHA 3CZRA 5IWAB 3NATA 5HF9A 4BFSA 3ROEA 2EF1A 3WMRA 1IVSA 1PLKA 2FEWB 3REFA 4MIEA 2P1ZA 3OC6A 3JYHA 3PG5A 1Y3HA 2B7CA 2QSUA 2AJDA 3GJXC 3KRTA 4ZCLA 4H0CA 4J0HA 2C0CA 3QEOA 3H11B 4R1TA 4AXXA 2ZT6A 3PXUA 4UU1A 3H5TA 1X15A 1Q7TA 2XW6A 4TS1A 4IS3A 3WNCA 4YDSA 1X3LA 1Y6JA 2QP3A 4F38A 9ATCA 1RAIA 3QE3A 4QYSA 1QS0A 1G8JA 4HYYA 2QK4A 1DDIA 5AKEA 2IP2A 3RJ5A 2XT0A 2YHSA 4R3NA 3VYSB 1NY6A 1O2DA 1U28A 2QKYA 3IJRA 1UDBA 3GPDG 2OCKA 2ZUCA 3KP1A 3PKZA 1HDEA 4JBGA 1SUWA 3W77A 2GPAA 2D2XA 4FI3C 2ZEJA 4LHEA 4N54A 5F21A 5FLKA 4MDHA 3DCYA 1JHRA 4NZYA 1M6NA 2NPOA 3LO8A 4G0QA 4QGHA 4UD6A 3DB2A 4PLCA 2C7PA 5GV8A 1TKRA 4BX0A 4CPDA 3STUA 2FN4A 5JV5A 4KCGA 1DIHA 1NN0A 4OF4A 4P36A 4V0NA 4AW9A 4UCXA 1W35A 4BE7B 1XC7A 3OLWA 1P61B 4KO8A 3RTDA 3T41A 5F2NA 2GJSA 1WBDA 2WJPA 4E4TA 3FBGA 2B3TA 1RNLA 2VYFA 5AK0A 3KXLA 3ZWKA 1W73A 1JS1X 1D9XA 1V16A 2JD2A 3PFIA 3RTBA 5AHKA 2PZLA 2YUIA 1KQOA 4RY9A 4P1ZA 5J4LA 1DNPA 2J3EA 3I23A 1AZWA 1O1YA 2CUZA 2YY5A 1RM0A 3FDXA 3MMXA 4F2HA 1BMFA 1SZJG 2UXCB 2V8BA 3D0RA 3WWCA 1J23A 2Q8QA 2P30A 1IHYA 3EARA 3S4YA 2V0GA 3BWVA 3HU3A 4ZCIA 5JISA 1UCFA 4LXIA 3KPUA 1SUEA 1ICIA 2V6JA 1GPKA 2WUDA 3A4TA 1JSCA 3FM9A 5FA6A 2MSKA 3RBAA 5EJ6A 1XNHA 4B3FX 1JE0A 2YW9A 2HWWA 5ICSA 1BXKA 1HQKA 3PLNA 4UXJA 5CB4A 1WHSB 4NXMB 4EA9A 3ZD7A 3RWBA 1JTFA 1GV0A 1P62B 3GYBA 4IILA 5AW7A 1TYDE 1FRZA 1RYZA 4MP8A 2ZRGA 2DWOA 1JAXA 2IP4A 3CT6A 3RRJA 5JXGA 4HVAA 2BMJA 4TZ6A 2EARA 3JQ8A 5SYAA 4ZAWA 4ZICA 3EXAA 2JPDA 2HH9A 2BFBA 2DULA 1FFEA 3PUWA 2YCLA 2VP9A 1M5TA 2FZKA 2ASEA 2V7EA 4G5RA 3GJ0A 4NJMA 4TRNA 5GY7A 1FYEA 3CS3A 2C98A 2QLBA 1KFKB 1VKJA 2C82A 1KQ3A 1W85A 1Q84A 2GSWA 3HV2A 3WDMA 4K8RB 4FS8A 5EJ9A 4TN5A 3REOA 1GAJA 3BWDD 3F71A 4OV6B 1QKIA 1L5HA 2BZSA 4LOJA 4U7PB 4OU4A 1Q11A 3Q1LA 3NOXA 1ORIA 2DBRA 5CD1A 4KPEC 4X60A 2FETA 1TZBA 2VT2A 3ND5A 1FNMA 2VS1A 3TRIA 1Y6QA 1Z5OA 2E87A 3PPVA 3QHQA 5BN5B 3FIUA 2B94A 3LHIA 4MLZA 1X38A 2R5NA 3DQQA 5IBCA 1A95A 2YZMA 3ETDA 2PPLA 4MCJA 4XYMA 5AVSA 5LDDC 1DAEA 1TTTA 1OX5A 2E0IA 3B6IA 3RS3A 2WQZA 4D9BA 1XVIA 2IF2A 3TPCA 1MJ5A 2VYVD 3T15A 1B76A 1WXFA 3GEEA 1FXWA 2R9VA 2WFLB 3IEMA 1NOKA 1B8UA 2EQAA 5CBKA 3PGKA 4WT7A 1M75A 3S0JA 5GJVC 3S8YA 5K0TA 1KI2A 2PSDA 4PZ9A 1E2FA 1XBTA 2CZGA 3MIIA 3W1VA 1F2TB 2P0EA 1Z0AA 2Y67A 3C4QA 3DYIA 4UNNA 4IQ0A 4ENRA 4OXRA 5E3JA 4F6RB 1AUOA 2PZGA 1ECGA 3KNZA 3V00A 1FP6A 1NW4A 3CLUC 2KSQA 4KQJA 1QDUA 4TUYA 1U0OC 5EVCA 2B99A 5B1EA 2RGUA 1F1JA 1MJHA 3GHHA 3FPHA 2EXXA 4BFYA 2GPTA 1TUIA 4N03A 4F2GA 2IYXA 2XUOA 4GI1A 4I19A 2NV6A 1C41A 3UAWA 2XVXA 5EPOA 1WULS 2FI1A 5EJGA 5LQDA 4GMDA 3AGQA 3TTVA 2O8CB 3D3WA 2VO1A 4DG8A 3V8EA 1I5RA 4II3A 4NZNA 3VC2A 4B4VA 1KY3A 5F78A 2MYPA 4TTQA 2FUCA 2K4MA 1NUHA 4J2HA 1YR8A 5DI9A 4NP6A 3RRNA 2HJVA 2WBLC 3GD7A 3JVVA 4K3VA 3T6KA 2D3TA 4UKDA 1CQPA 4OFWA 1T5TA 4QXRA 3U4GA 1IPHA 4JEHA 5E2BA 2XNDD 3OZAA 1QQTA 3ZH9B 2BI7A 3NTQA 1IHPA 4I5GA 4KV9A 3H42B 2BYTA 4TWZA 4E0BA 2I2XB 1NN5A 2JIPA 3FCEA 2WWRA 4AZ3A 2VF5X 2G4VA 3AJRA 1I14A 1R4MB 1SPBS 3NU1A 4L16A 4LRQA 1QMPA 4WZZA 3I53A 5FBRB 4V2UA 1L7DA 1TI7A 4PTLA 4RHTA 4JEUA 4QXOA 4IIVA 2YFQA 2E2WA 2J87A 2B21A 5CG2A 1HUQA 4NE7A 1I10A 1QC5A 5SYMA 4ZCMA 4K86A 1P29A 1WCV1 1Z0IA 5C31A 4B4UA 3HEMA 1E66A 2Q0HA 3I8OA 3U1BA 1WY5A 2O8EA 2J3KA 3DL2A 1Q74A 4AJIA 2AOXA 3WGOA 3IILA 1Q6YA 5EL0A 3P27A 4W1RA 4H3KB 4EGFA 2GZSA 5KWSA 1L6IA 2PRSA 3F5DA 1GGHA 4YREA 3VR5H 2J5XA 3DV2A 1MEOA 2JKVA 2VF7A 1T8WA 3AM5A 3QM1A 1FY2A 4ZT5A 1U8CB 3LUFA 1KU0A 2PRJA 3JQAD 1K5PA 4CI9A 1D2NA 2EQBA 4U6NA 2EDAA 4IJVA 2OHHA 3JRXA 4W82A 5AVQA 1KE1A 2ZXEA 4Q3CA 2AXPA 3OM1A 5EIHA 5B1YA 2R7AA 3DA8A 4I46A 4CM9A 2J9YB 3OT4A 1DT3A 1D09A 3M81A 2ZJ3A 4RTJA 2OG2A 2VHEA 5LYJA 2RGEA 4DV4B 1Q1ZA 3JAKB 5FYDA 3DLPX 1YL5A 1CB0A 2I65A 1B7GO 4BV8A 3GU3A 4DIDA 1U04A 4DRYA 3ET4A 2J0UA 5AKHA 4XGRA 3AY3A 3M33A 2AB0A 3P9CA 3RARA 1XQWA 2CLIB 1KEUA 3G1UA 1CIPA 4KVZA 2M9MA 4RKYA 4DEXA 1GU0A 4QPZA 3Q11A 3HADA 1QO0A 1KP2A 2A84A 1IG3A 3KKZA 5BYBA 2MSEB 3C87A 1GQFA 3PC3A 4C2BA 4HQNA 5GV7A 4EHKA 4YQYA 3CNNA 2OFFA 4JP3A 1UPBA 2JHPA 3BSFA 1G5IA 2COEA 2OBBA 3OZVA 4OP2A 1TM2A 4KN9S 3PBKA 4YT5A 1H2ZA 1LWOA 2XI4A 2E7ZA 1W47A 3CEMA 3MYRA 4G26A 5KWEA 4CTKA 3EVNA 2W2XA 4ZAXA 3V8PA 1R64A 3S7ZA 3KQHA 2ZWMA 2QAGB 4LJKA 4E15A 3BFVA 5CFLA 1XG5A 2D1TA 3UHAA 2BH9A 5BRNA 1XZQA 2ZU0C 3EPRA 2GS9A 4IJWA 2I62A 4ZGGA 5A4IS 1FCJA 3PVCA 4KDEA 2EZ9A 3RHZA 2DAPA 1G19A 2HJHA 3K9WA 3GYGA 3O5AA 3VDQA 3ZE7A 4RGVA 4D0SA 5K9ZA 2NAFA 1PKEA 2ZRPA 4YRTA 3CINA 1DIGA 4XD7A 4R71A 1TK3A 4ODIA 3KYJB 1PBTA 3WJAA 4AFNA 4UBIA 5BN1A 3W7BA 3K9GA 2HA4A 3NRJA 2DHQA 4ILKA 3TAXA 3LQKA 3UJ8A 1S2IA 2WJYA 2IHUA 1KO1A 3FDJA 4ENWA 4OYLA 2GBCA 1UBTS 1SEVA 4LWZA 1N77A 2Q3CA 5B58C 3HB0A 4Q15A 2J41A 3NCTA 5CAEA 4O4JF 1HORA 4KZPA 2YJZA 1F1BA 1KYTA 4ZI7A 1B26A 1F4VA 2B6HA 1Y3FE 3PX2A 2WHPB 2PQ6A 3CLKA 1UANA 2BLLA 1WBBA 4NMMA 4FHCA 1CQXA 3UGJA 4OSPA 1EUCA 5FOQA 3CEJA 4YCNA 4OHUA 1E1YA 3LKBA 1UOOA 1FOEB 4KFSA 1XNJA 4QVKA 2VLBA 4MX8A 4D3YA 4DCCA 5DASA 2QGNA 4JLJA 4CV2A 1XALA 3H5RA 1WOMA 4WGGA 2PJRA 2QQ5A 3SIXA 3VAYA 3DP7A 3OFKA 1JT9A 1Q2XA 4I1OA 3ZGXA 4BMYA 2PXHA 3FGZA 2O8VA 4BX3A 5A04A 2BDEA 2QL6A 1HDRA 3ZBTA 1W0JD 4B6SA 1G5QA 1NFFA 5ALDA 5JNRA 2DPLA 1ABEA 1JLHA 4ID9A 4OHMA 4DL9A 3F49S 1F8XA 3D0QA 4Q47A 3CWQA 4ZQFA 1UF9A 3BULA 1TIKA 2R44A 2W5UA 1JA1A 4TLLB 3RBXA 1PNQA 5JT1A 4XYGA 2CCGA 2Q3BA 4AROA 3N6RA 3D3KA 1WDTA 3IULA 1YZ3A 3OOYA 5CIYA 2YRXA 3DEJA 2WUWE 1MTZA 2FUG6 3I30X 4Y3UA 4W63A 2FW6A 2GBFA 3VC3A 2ZB2A 1NZJA 2PGLA 3TUJC 1TO2E 5A2GA 3COPA 3QKTA 4MWSA 2O8BB 2VPXA 4RCZA 3B2NA 2N1BA 3BGWA 3G2JA 4QYMA 1L4UA 4ZO8A 1NJ6A 1F2UA 1G18A 1U31A 3N6VA 4QUHA 3SGLA 4BUCA 1LS6A 4YRIA 1XAGA 1MAUA 4KXWA 4ZA2A 4P53A 4JLSA 4F9EA 4XCQA 2CHVA 2F3RA 2I8CA 2J32A 2J4CA 1L7XA 2H0RA 2I91A 2XPCA 4RH1A 4ZV9A 4RK0A 1U0HC 4U6SA 1XE3A 4RPJA 5AICA 1NW7A 3NQ41 5LPNA 1YV9A 3C3BA 4FQ7A 3QI7A 3QLVA 1IN5A 1JDNA 2C1XA 2OZKA 1RQPA 3E1SA 3FKJA 2QUHA 5EWJA 3ZJ5A 2P5UA 1G0OA 8LDHA 4GMKA 2ZCJA 1I0ZA 4HMQA 4IVPA 4QT0A 4W8OA 1QP7A 4OHVA 1VP9A 4CIDA 1BN7A 5K8CA 4EVSA 5JWHA 3P2YA 4FFMA 1DEAA 1IXZA 4FU0A 4Z4HA 1VHTA 1OY1A 2XMRA 4HWPA 3RSQA 1EE2A 4EX7A 3P5SA 1J49A 2H1VA 2IHBA 3QW4B 1KZ7B 4MVYA 5I6DA 3DBIA 4CF4A 4K6CA 3L1JA 1MV8A 5FBQB 4FYKA 1BVYF 1FQOA 1Q7BA 3DNFA 4KOAA 1PR5A 3KKMA 4OTZA 2OPBA 1CSEE 5SY9A 2VF4X 1ID1A 3D8HA 4ZU6X 1KO8A 4U9UA 3W6UA 3ZE6A 4DQDA 4BQEA 5IXJA 1SRRA 1AQUA 1BJKA 1PJSA 2F3TA 2IEIA 5MFPA 4IGAA 1J70A 1IATA 5JSHA 2AG5A 1ECFA 1JKMA 3IC5A 3OQVA