2QL6A

Human nicotinamide riboside kinase (nrk1)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
191
structure length
179
Chain Sequence
b'KTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nicotinamide riboside kinase 1
publication title Crystal structure of human nicotinamide riboside kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
total genus 51
structure length 179
sequence length 191
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.7.1.173: Nicotinate riboside kinase.
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ql6A00
1S8FA 4LBZA 2A5FA 2AXPA 3LXXA 1BO6A 2D2FA 1BMFA 1KI9A 4FMCB 5FOVA 3T12A 4BLTA 1DS6A 2FPMA 1EG7A 5IF9A 1MKYA 4Q4HB 4MA4A 1VCOA 4HLUC 1KTVA 4V0KA 3QOFA 5JECA 3C8UA 3HYRA 4HUTA 3GEEA 1Z5ZA 3KQKA 2OO7A 3KKPA 5EUMA 2ZI9A 4EAQA 1PUJA 1TF2A 3A1WA 4JLOA 3TGPA 3UWKA 2J46A 4PO9A 4WIAA 4F4CA 2C9OA 4ZDIA 1GFIA 4M1SA 1N5KA 3FHOA 2C04A 2OUKA 4Q03A 1Z6GA 1JECA 4RFSA 2ZIAA 2AHOA 1ESMA 1YR6A 1FW6A 3DHWC 2KBEA 2RGNC 2PJRA 3RS5A 3QF4B 1KI6A 1NY5A 1XTQA 4KXFB 1HYQA 5LPNA 3GLIE 5JJIA 3OAAD 5G41A 1G8YA 1Z0AA 3EZ7A 1KO8A 3T5DA 3TW4A 3OFND 1PV4A 3EIQA 1P2UA 4QNRA 3VX4A 1X86B 1Z3IX 5EXSA 2ZI7A 4PSKA 4UNPA 2BMDA 1RRFA 1OXSC 5BWMA 1WB9A 2VL7A 4TWZA 4DSTA 2JLWA 1JI0A 1T91A 3BD9A 4Q9LA 3TUIC 3PEWA 2V9PA 1S4QA 1W0KA 3C41J 2NO9A 4EPWA 4HB0A 3PEYA 2G1JA 5M04A 3OAAA 5KNCA 4CEJB 1UBCA 3GLFB 5BYKA 3U5ZB 4F38A 1JR3E 3M6AA 3OFNA 3ECCA 4NL4H 2IUTA 2JLSA 3ZIAA 2XZOA 4ESVA 2WHXA 4L16A 1KAGA 4V0ME 2CLCX 3KUDA 1OYYA 4ERNA 4B2IA 2OAQ1 1YZTA 1YQTA 3M1IA 1GVNB 1NBME 4TLEA 3AKYA 3NBFA 3ADCA 3ZQJA 1VG9B 2GAOA 3SE0A 5AJWA 4E5UA 2WMNB 2Q3FA 5JSZA 4HB2A 5A0FA 5AUOB 5IDVA 1X1SA 4QJ5A 2A5GA 1EESA 1G8FA 3M4YA 1C9KA 1HH4A 1CULC 5CLQA 2PCJA 2BBTA 1P62B 5C18A 4IVQA 5C4GB 1N25A 5LBIA 4AKGA 4KAXA 4ZO4A 2IWHA 2VTKA 3K0AA 3LAWA 3F3YA 5L3QA 3U61B 1P4SA 3GMTA 1QHHA 1RVDA 1KY2A 5FTLA 4R2IA 1E0AA 4DLWA 4M9ZA 4ON9A 1CR2A 4DCSA 1IN7A 2IS6A 4R9UC 1E0KA 2ZPTX 1VHTA 4AWXA 4KVAA 1E1QD 2R6FA 1P5ZB 4IFBA 2QG6A 3TUJC 4D0NA 1U0HC 3G5UA 1Z83A 4JVSB 2RKOA 2VP0A 4C0KA 4IOKA 2FNAA 3C4JA 4AIIA 3C5HA 4B74A 4DLZA 3TVDA 2C2HA 3LW7A 1XTIA 4LOAA 4MRNA 1G64A 1I4TD 3GLGB 3DPUA 4Q1CA 4HAVA 2MSDB 1E1QA 3PCRB 4LJ4A 5IK2D 3EWAA 4B75A 3QKSB 3WYAA 3U44B 1XXHB 1LV7A 3B9QA 4A36A 1OFHA 3D6TB 1E2LA 3IQWA 3WP0A 2XJ4A 1JPNA 3IHLA 2WOOA 1N0UA 3B1VA 4QGHA 3SYKA 3T1VA 5KTYA 4CGZA 4OK5A 4P4SB 5G3YA 1J2JA 4TYWA 2ZRLA 2JJ1D 5C2JB 2QP9X 1E0SA 3QJYA 2AL7A 1MH1A 5IK2A 3U3RA 1UKYA 4E07A 1PUIA 2JDIA 5CDFA 1QVRA 2J3EA 1WA5A 1RJ9B 3DMNA 4Y0AA 3U3JA 2ZTSA 2ZE5A 2JA1A 4D0LB 5JCPA 4EJSA 2QN6A 3L43A 2PLFA 2V7QD 4A0RA 2EFHB 4W9MC 1OH5A 4LZZA 1T3HA 4GOXA 5HKKD 2HT1A 1GL6A 4DSOA 1CJVC 2RGNA 5J4YA 4QG7A 2JJ1A 1XCGB 3VMFA 1CTQA 2ZR7A 1PZNA 1BH2A 1GM5A 3NBYC 2HCBA 1NSTA 4PO1A 4P4UA 3WXMA 1KIMA 1UKVY 4BPBA 3IDQA 1G6OA 1SVIA 1Q20A 4RD4A 1OFTA 2XSZD 1E4YA 2P65A 2I1QA 4FMDF 2V7QA 1JAHA 3V00A 3K9HA 1VKJA 1X1RA 4RKFA 5HKKA 2CVHA 3AQ4A 1G7SA 2FEOA 4IOMA 4C0LA 2Q6TA 3ICQB 4II7A 2VHUA 4LWZA 3QVVA 1YHNA 4F92B 3GLFE 5CLLA 1XPOA 1EK0A 2ZS9A 4Q18A 1NF3A 2OILA 4OQNA 4TZ0A 4B47A 2J87A 5K8IA 2JLUA 1H8HD 1Z0FA 4OL0A 2XSZA 4URYR 2OBLA 3A36A 2FJUA 2DCUA 3OZXA 2BKEA 3KQNA 1F3OA 2QTVB 1RIFA 1RYHA 2X8AA 3I8XA 3AGPA 1PLLA 4LJ7A 1J99A 4NCHA 1GKUB 4YMVA 4A9AA 2WPDD 2RHMA 2QTHA 2KB0A 1EX6A 4XJXA 4Q1DA 4MYCA 4RCYA 1DEKA 4XVUA 3BERA 4RFSB 4UNQA 4C7OA 1A2BA 2BM1A 1LFDB 3MUFA 5ANRB 3ZLJA 2ZS7A 1DTSA 2DY1A 1H8HA 3K0CA 3OIWA 3EC1A 4NH0A 3X1WA 2J0UA 1LF5A 4V03A 3X2SA 4GNKA 1XTRA 5KSOA 1IN6A 2RB4A 1AKEA 1YZLA 1CKEA 2D3WA 3AH8A 1KAOA 2UZIR 3GLIA 2YHSA 2WPDA 2XNDD 3TE6A 1M7HA 2DFLA 3F5FA 1OIWA 1JR3D 1K6MA 2FU5C 3MWKA 5AR1A 4ASUD 4HAXA 3N2IA 4URWR 3I72A 3HPQA 4NONA 1AZTA 1W4BA 3Q3JB 1ZM9A 2L0XA 1PJRA 1U94A 3QE0A 1HTWA 1X8JA 3VKGA 2WJYA 2FZ4A 3L8YA 1KO7A 1XJCA 3PEUA 4MKFA 4JT2A 2HDNB 5EQTA 3GJ3A 1NBMD 3IUYA 3K0SA 2EQBA 4Q5IA 2REOA 4M1MA 3I61A 3KL4A 2XNDA 5CITA 2GZHA 2GVZC 3ZH9B 2J0QA 5L8VA 2G83A 2OV2A 4PSVA 2GBLC 1AQYA 1ELOA 2VHTA 4ASUA 4D0GA 4D2IA 4CEIA 1GNQA 3PG5A 1AS0A 4V0MA 2IYVA 4A82A 2EYQA 3CZPA 1XZPA 1W4AA 1GDDA 4N1AA 5E7MA 2WSSD 1FX0A 3WYGA 2F1IA 3GJ5A 3Q9LA 4JLMA 5GJBA 1IXRC 3OE7D 1NBMA 2CK3A 3CH4B 5JSZB 3KQLA 2C77A 2BJWA 1F2TA 1Q3HA 2CNWD 2VIIA 1XXHE 4TMKA 5EE9A 5HE9A 4BZQA 1W4CA 1EWQA 2BBSA 2JEOA 2JJ8A 2KE5A 1G19A 3T15A 3CNOA 4I1OA 2W6JD 2ZANA 3C16C 5LD2B 1JXMA 4DLUA 2ATXA 3IPXA 1XNJA 1MR3F 4R71A 5JS8A 1XMVA 1GWNA 2WSSA 1ETUA 4KYIB 2BCJQ 3K0AB 4MRRA 4F7WA 5L3QB 2CCGA 1GOTA 2NGRA 2IEZA 5IHPA 3OE7A 3NG1A 4HI0E 2QAGB 3DM9B 2QMEA 2P6RA 1SXJC 2CNWA 1AKYA 4LYJA 5FTMA 4D26A 3U44A 2ZU6A 2ASEA 5FBWB 1OW3B 4FINA 1NP6A 2DFKB 2GCPA 1V43A 2QY9A 4WXRA 1YJ5A 2ZE7A 3TVTA 4YLGA 4ILEA 1KJYA 5JBQA 3AB3A 1J8YF 4HAZA 4LHVA 1W2GA 4NYIR 3UKDA 2EFDB 2W6JA 3X1XA 4PQFA 4FCVA 3IQXA 3I92A 3AVWA 1P9RA 3B1XA 4MYHA 2BM0A 3CKLA 2ZQ5A 1YR7A 1L4YA 2VSFA 2X2EA 3NDPA 3BORA 3ZJYA 1NLYA 2CHQA 2DWQA 1KSJA 3CO5A 3EAQA 4I1SA 1KMHA 4JL5A 4RCZA 3FVQA 4BLOA 2REXB 1YZUA 1K5GA 4IRUB 3KQHA 4CZ2A 4NYJR 1Z28A 2V4ZA 4L9SA 1UJ2A 1AGPA 3ZS9A 2Z6VA 2EFGA 4MKHA 4P31A 3LNCA 2VHCA 5TARA 3NWJA 4KITB 5A4JA 1IY1A 2AK3A 2GHIA 3VX3A 3O8DA 3V4RA 5F3WB 3GCGA 3X1ZA 2ZRGA 4JZKA 5FBRB 4QBFA 5EP1A 1R2QA 1XDBA 2P2LA 3KB1A 4A8JC 1J7KA 1TU3A 1XMJA 1XTKA 2V3CC 4EFMA 1EFCA 1FMLA 2HT6A 4V0OA 4QM7A 1M2OB 1XZQA 4CW7A 4DCNA 2DHRA 1IONA 4QGGA 1D6JA 2W0MA 2XZLA 3UANA 3CWQA 1JEEA 1S0UA 5TB5A 1OB2A 1BYIA 4P33A 2GXUA 1QHYA 1VPLA 5FOSA 2RH5A 1KSFX 4E22A 4Z8XA 2F9MA 3SFVA 2ERYA 1W36D 1BIFA 2WIAA 4TLBA 4EJSB 3VR5A 4PHTA 1H8ED 5JEDA 1C4OA 2KSQA 3TW8B 1F5NA 1G3RA 1GILA 1ZU4A 2RGDA 3KQUA 5EUQB 1P60A 1E9RA 4A92A 1NNEA 3MJRA 4IOJA 3A1VA 4DB4A 2I3BA 3TAUA 1VECA 3KB2A 3RABA 2B7CA 5GVRA 1VG0B 1CF4A 1T9HA 4ZPXA 1MRSA 3K09C 3JVVA 5E95A 2LWIA 5FPYA 4Z51A 4HSEA 1IJEA 4D4JA 1H8EA 2EWWA 3U4QA 1N2CE 5DN6D 1J70A 5SZIA 3UATA 1TX4B 3T1QA 1GAJA 1YRBA 3MGCA 4TQ9A 4YC7A 1CEEA 2VP6A 2GVDC 4OYHA 2ZI4A 3A8TA 4IDQA 1ZC3A 4X8MA 5DGXA 4BLQA 3BB1A 1E79D 4DDUA 3X1YA 5DYIA 2AFIE 4KHZA 3FGNA 3U6KA 3AF1A 3GP8A 3R9WA 2ZXUA 1DARA 4CEJA 4TL8A 3IGFA 5KHOC 3FMOB 3R9XA 3WMGA 5JZVA 1KI8A 2MSCB 3SJAA 2O0KA 5DN6A 1NJFA 5DI9A 4ZDKA 2CCJA 5F98A 3WBJA 2QZ4A 5L3RA 4UNNA 4LHXA 2ONJA 4DDWA 3KJGA 3PR1A 4ZI3A 2PCLA 5BW8A 3VTKA 1ZAKA 3A58B 4C7OB 2IF2A 2ZE8A 4QBIA 1OB5A 2H18A 5J5CA 3EPJA 3HR8A 4BE7B 3ADKA 1OH7A 2XAUA 2J0UB 4D4LA 4CT5A 1Q3TA 4YDHB 5SZJA 1G9XA 3P1JA 4GZMA 4M9XA 1SQ5A 4MRSA 4DXAA 3SNHA 4KFSA 4KVGA 1ZRHA 4HZUA 3LWNA 1G21E 3GLIB 1KDPA 3JZAA 3WBKA 1JBKA 4BWYA 1DAKA 3MD0A 3MWJA 4UQOA 3K9LA 1N6OA 4O25A 4NCJA 1OXVA 1TEXA 1S9HA 2AX4A 2VPPA 5CB8A 5KYKA 1ZD8A 3L82B 2W00A 4G5RA 1P9NA 4NDZA 3IEUA 1AJEA 3BGWA 3U2QA 4H1UA 3CRQA 3QPVA 1ZW6A 1XWIA 2OFXA 4OI4A 4C3ZA 3B1YA 3W3AA 2F1HA 3ZVRA 1R0ZA 1UDXA 4BLPA 2OFWA 2NO1A 1WP9A 2RGGA 4DZZA 4JLVA 5H1YA 3W34A 3RHFA 1ZP6A 3NH6A 4Q7KA 3EARA 1R0WA 3GLHA 4GOKA 2VSXA 4CEIB 2WWWA 4DLTA 5KSZA 2WKRA 2ZRDA 3QBVA 2J7PD 2Q3HA 3FHTA 2NO7A 1FX0B 3B9PA 4HEJA 2AWNA 2ODWA 1LW7A 2WWGA 3NBZC 3RVBA 1Z6AA 1U9IC 1F2TB 4FWIB 4PXAA 4Y0VA 3JZMA 2GJKA 1FL9A 1WXQA 1YZQA 3IKJA 2IXFA 1L8QA 3R20A 1UPTA 2O52A 1X6VA 3IBYA 1E2NA 2ZRFA 3C15C 2GAAA 3PUYA 5J4KA 1NJGA 2DFTA 4HAWA 2PMKA 2J7PA 4EDHA 1A5TA 3WNDA 4YMUA 2YKGA 1E32A 2FOLA 1RRPA 3QXJA 1XD8A 2ZJ5A 3SQXA 2VRWA 1ZCAA 3FWYA 4P3YA 2E1RA 4M53A 1CR1A 2GRJA 4PHHA 1IM2A 3KX2A 4R2HA 4P4SA 4TLAA 4NMMA 2YC2C 2GCNA 3CIOA 5F2EA 1E99A 1KO1A 1JXOA 1UFQA 4L9WA 4BFSA 1MV5A 2YWFA 4O3MA 3CRRA 2Q21A 2H7VA 1IY0A 3A37A 3FMFA 3GJ4A 4A2WA 2A78A 4C30A 3KZ1E 1Q1EA 4TMWA 4QXAA 4B3CA 4BEBA 1MOZA 3CX6A 3I8SA 4F93B 4BGDA 4A0GA 1IHUA 3EC2A 4YDSA 4XTRA 2F1RA 1KSGA 3CW2A 3PJRA 4NCNA 3B1ZA 3LQQA 4KLNA 4I81A 3P27A 4LC0A 1EFRD 3FHCB 1VMAA 2ZSAA 1KMHB 1ZBDA 2GZDA 1Z0KA 3QPWA 5TY0A 3QI2A 4JYCA 1QHNA 1BMFD 2XB4A 2YWHA 3KTAA 1JPJA 4BECA 1W7AA 4RSGA 4Z54A 3FTQA 1Z08A 3B2EA 2GESA 4MDEA 4MGZR 4GFDA 3SYLA 4FMCF 3IO3A 4Q1EA 3AF4A 3K0EA 2JGNA 5SZKB 3THOA 3W9YA 3PEVA 2IYWA 4IJMA 3F8TA 2FG5A 3HR7A 3RWMB 1I2MA 5EXTA 3T1TA 2ECKA 4UXIA 5KPDA 1YZKA 1ZJ6A 2MMCA 2PZGA 1HUQA 3AVQA 4JSTA 2JLZA 2GETA 3AVVA 1EFRA 4XH9B 2YZ2A 5SZHB 1XMIA 2IEYA 4NYMQ 3RSOA 5FTNA 3CBQA 2ZJ2A 2QP4A 2WMOB 2GNOA 4NPHA 4K81B 2Z4SA 1LNZA 5FL3A 3EZFA 3SHWA 1M8PA 4E09A 1IY2A 2C98A 1FFHA 2W6ID 5HR5A 2BBWA 1XTSA 3FYHA 4WOPA 1P2SA 3LW8A 4EPVA 1WBBA 4XWOA 3TAHA 5D3MA 2Q3MA 1S1CA 4RZ2A 1M1YE 1WRBA 2HF9A 3K9NA 1NY6A 1TADA 2GEVA 2RGEA 3AF2A 3IEVA 3CM0A 2A3RA 4DIDA 3PUXA 1QHSA 2AD5A 2F43A 4W7SA 1LVGA 1L7VC 3SI7A 3WHLA 1NVWQ 2QM7A 4OQFA 1T5LA 2IYLD 2P3SA 4QBHA 1OT3A 2DFNA 4PPNA 5FBLB 1ZM3A 2W6IA 3GEHA 1K8RA 4G5QA 1W0KD 1G17A 3TSWA 4LGMA 5BXQC 4UXHA 1M7BA 1TEVA 2NPIA 1W36B 1X3SA 4GDFA 1DAIA 3ZIAD 4C0AC 1U98A 2QGZA 3U4QB 2DWPA 1E2FA 3OF5A 1HURA 1DO2A 1Z6YA 3DZDA 1GRNA 1U8ZA 1ZINA 3E2IA 4ZIRA 5L3SA 3E70C 2O8DA 1KO5A 1Z6XA 1JQLB 3BBPA 4IHQA 5H70A 3NC0C 5DHFA 1E1RD 4NCIA 2QGNA 2QSZA 3G82C 2VBCA 4DHEA 3NTUA 3IO5A 4JL6A 1HEIA 2IXGA 3IILA 3WMEA 3EPHA 4WXPA 2G0NA 1YVDA 3NVAA 3CNNA 4JL8A 3SDZA 3RANA 5EZ5A 5KPJA 1YZGA 4X8HA 2PT7A 1W2HA 4KCGA 1EFUA 2D62A 1E1RA 2BIFA 2OXCA 4KV9A 1W5TA 1QHIA 3AVPA 4MGKR 4CEHA 2GILA 4AYTA 1XRJA 1FNNA 5JHGB 3B82A 1T4GA 2O8BA 2QQ0A 2HYIC 5FI1B 1NRJB 3O8BA 3BH6A 2ZRKA 1QG2A 4JBYA 2KWIA 1SZPA 1RYFA 4KO8A 4HZUB 5CYPA 1DO0A 3BE4A 3QKUA 2WVJA 2DR3A 5HTKA 1M6NA 1Z29A 3BWDD 3LX5A 1Z47A 1DAFA 3BFKA 5GJVC 3K70D 2WBLC 2R62A 5AJYA 4AD8A 4FD2A 5FR2A 1WMSA 4XD7D 1I2DA 3MRSA 3TKLA 3ETLA 2QAGA 3MCAA 3REGA 1LTQA 3A4NA 4PC1A 4AY2A 4XTCS 3TQFA 4I4LA 5AJXA 3V9PA 1BOFA 3W90A 5BYJA 3LQRA 4B3XA 4WW0A 1II9A 4HAUA 1YU9A 5DE3A 4EKDA 1IN8A 3AVOA 4B33A 3AVTA 1VCMA 3SJBA 3GLHB 3LD9A 1XX6A 3SHFA 1OH8A 1UM8A 2VQSA 3RRYA 2OE2A 4FCWA 2YWGA 3ZVNA 4XD7A 1RFLA 4J0QA 3T06B 2B8WA 4CYMA 5AUPB 3LA6A 4O2RA 3D3QA 2IX3A 1MO6A 3TUZC 3Q85A 3GPLA 4Q66C 1G4AE 4GRAA 3QKTA 1D5CA 5HCIA 4GT1A 2RGAA 4Q1FA 4EFLA 2EFCB 4JLDA 2NG1A 4LYAA 5FBQB 2PZFA 4AC9A 3LLMA 2QMUA 3SOPA 3WNBA 1CXZA 4LV5B 2BEKA 1E2MA 2JDID 2QBYA 2R6DA 3NXSA 2G3YA 1E69A 4V0LA 1DE0A 1FTSA 2W83A 3WY9A 4L15A 2Q9AA 1G3IA 3PENA 1KI1A 1A7JA 1CBUA 3CZQA 2PJZA 3AP2A 3B13B 5AWFC 2WTUA 1XB2A 1E9DA 3RWOA 3SEAA 4B44A 1UEIA 3U6BA 4DEYA 3HYTA 2BJVA 4HLUA 4ZCMA 1PLJA 4JMPA 3OIUA 2V1XA 3AKEA 3I4LA 5DNYB 5EE0A 3SFZA 4G0NA 2NIPA 2NOAA 2FSGA 2ZRJA 4YXWD 5JHHB 4NTZA 1JQJC 4JVLA 4EPRA 1UBFA 1Q12A 2OBMA 2V8OA 4OHYA 2QNRA 4YQFA 3LH5A 3ZVMA 5B64A 2NO0A 4I1UA 1GSIA 3B8HA 4M1KA 4DLXA 4H1VA 2EWVA 3AP3A 4OHVA 2CLDX 3FMPB 1HE8B 1QBKC 5BN3A 2XOKD 1N6NA 3LY5A 3SU8A 2O8CA 1ODFA 2CEAA 4QL3A 2XZPA 1RRCA 3KTAB 4B48A 2HCJB 1RE0A 2FPLA 3FKSA 4WVFA 5FTKA 2ZSDA 4YXWA 4LC1A 3CPJB 5KSPA 2GK6A 3THYA 1SVOA 2CCKA 3NKVA 4TYQA 1E96A 3B6EA 4JKIA 3K0FB 3QF7A 2WKPA 2QRNA 2R6CA 1WQ1R 2BEJA 4C0SA 2IYSA 2YV5A 3B60A 4A4DA 3H1TA 2A5JA 2VF7A 2SHKA 1A82A 2XOKA 4TZ6A 4OQLA 4CIDA 1QVAA 5J4VA 5EP3A 2B8TA 4M0LA 3CWZA 4IEIA 4BZPA 2W2TA 5FFMA 4C4PA 5EJEA 2Z43A 1US8A 2GZAA 2GF9A 3RS4A 3ADBA 2F3TA 1FP7A 2H5EA 3LO5A 3LFUA 1IQPA 4GP7A 1XD2A 2R9VA 2YINC 4L4UA 5D3MB 4M8NE 2ZSEA 4PFSA 2QRZA 5JRJA 4WZ6A 3T35A 4E03A 2IL1A 1FQKA 521PA 2CVFA 3RC3A 2ANBA 4OHZA 3TR5A 4P32A 1T8TA 2G0TA 2F43B 3N2EA 3AVXA 5JJLA 3MMPA 2F9LA 1EXMA 2C9CA 1OV4A 2JAQA 4IOLA 5EXPA 2QL6A 1LF0A 3BAFA 1HT2E 1SGWA 1YKSA 2QSYA 3SBEA 4TMTA 5B2ZA 1QZXA 3SC3A 3TQCA 3I3SR 3P26A 4AK9A 3U60B 2WKQA 3TK1A 4POAA 3BRWD 4EIWA 2OLJA 3PUZA 2QUZA 3U3MA 4Q9KA 4ZIRB 1WCV1 3U7EB 5L3SB 1TL7C 4GPTA 4DLSA 2O8DB 2Q0HA 4XWKA 2YOHA 2VEDA 3P32A 1P6XA 5DHAA 3BFVA 1E2PA 1UKZA 3HWSA 4AG5A 2ZVPX 5H68A 4BFZA 1P3JA 4PPFA 5AK0A 3ICEA 1CR4A 4JLKA 4DLVA 1XJQA 4EPYA 1NMXA 1ZUNB 4OK3A 2ZRAA 2ZYUX 3EPKA 1RRGA 3VAAA 3R9IA 3VR2A 2CK3D 3LDAA 4FIDA 1AM4D 3GEIA 3UXMA 3VNVA 2F6RA 3GLHE 1GUAA 4QKQA 2A9KA 4GOJA 2QT0A 4BZXA 4W5HA 1TPZA 1EGAA 3WYFA 5KSYA 1LY1A 2KBFA 2OAP1 2X77A 2Z4RA 2VP9A 5BN5A 4B6FA 4A1FA 2QMOA 1ZIOA 1EWRA 4CEHB 4M1OA 5JLJA 1XEFA 3AGQA 5FTJA 2O8EB 2ZSFA 2AKAB 3VKHA 4PZZA 1H65A 1G20E 2O8BB 3UPUA 4DCUA 1YE8A 2BVNA 3DEFA 2ZJAA 1TQDA 3QEJA 5KUTA 1EX7A 4QOSA 1DAHA 3CRMA 2O0JA 4ACAA 1XBTA 1GL9B 1Z2CA 1N5IA 3L0IB 4XOIA 3GFOA 1OXXK 2ZJBA 1VIYA 2X1VA 3BB4A 5E4FA 2AR7A 1ONBA 2QENA 2YNMA 4DT1A 5JWOA 2OCPA 1ZD9A 4QC2A 1CS4C 1DVRA 3QPUA 2E9SA 4I1VA 4AYWA 4EQ6A 1OIVA 5JCZA 2QPAA 3AP1A 3RS3A 3AM1A 4RJLA 2IHYA 2F7SA 1F2UA 2FGJA 1Z8FA 4HYYA 2P5SA 2FH5B 2GCOA 2OM2A 3QXHA 1AIPA 5JFGA 1XJ0A 4PZYA 4TQUS 3EZ2A 5TXGA 1SHKA 1U2RA 2Z5FA 4PHFA 3K70B 2D7DA 3L0PA 4Q7LA 4Q1BA 3NBXX 4NU0A 2AK2A 4TN1A 3H4MA 1G6HA 3P4YA 2GWHA 1U0LA 2XJ9A 5CM8B 3K9GA 1ZM4A 2J45A 3CPHA 1VYVA 4WBSA 4RD2A 3PFIA 4ESHA 3C7KA 3M0EA 3LV8A 1N5JA 1TMKA 2JLQA 2O5VA 5DISB 1LB1B 1QHXA 4DIEA 5GADl 2FSFA 4JVNA 2VHJA 2QBYB 2PZEA 4KFRA 3KJEA 2YOFA 3K53A 2BMJA 1T3SA 2G6BA 4ZCIA 3ZVLA 3QXSA 3EIHA 2C5LA 1NLFA 3RYTC 5TV2A 3QIAA 2VO1A 4LJ5A 3WHKA 1DG3A 2J5XA 1HY3A 1L4UA 4F91B 2ZEJA 3AUYA 4URXR 4AKIA 5F9FA 1T6NA 5JS7A 3TNFA 1OE0A 4LV8B 4EUNA 4CT4B 1QHGA 5FOTA 1RW4A 2V1UA 3PV0A 1R8SA 1W5SA 4DBLC 5D3QA 3R8CA 4HUQA 1ZIPA 3SR0A 1NMZA 4BFYA 2CL7X 2A7QA 2QAJA 3HP1A 3W6NA 3QY0A 2PL3A 4JKYA 1OHHA 1E2JA 1XMSA 4XVQA 4TLDA 2O8CB 2QPTA 1G3UA 2AXNA 4EFNA 1SVSA 2FE4A 5EE5B 3U3KA 2WAXA 1LS1A 5J40A 4FXPA 1G3QA 1KNQA 4TTPA 3GQBA 1W46A 4D81A 1WE2A 1NVVQ 3THYB 2ORIA 5JRZA 4TYNA 5FH9A 1GG2A 4M1YA 2Y8EA 3H84A 3Q5DA 1G18A 4PQRA 1X8KA 1FPMA 2X2FA 4BLRA 4TL6A 1P75A 1FUUA 2ZREA 1E9BA 1VYUA 821PA 1MT0A 1SVLA 2IWRA 4JT4A 4TLCA 2OCYC 1IN5A 1QDEA 1BYUA 1GZSA 1KKMA 4BASA 4CVNA 4LYHA 4GL2A 4Q7JB 5C4MA 2HF8A 1US8B 1FNMA 3DKPA 4XSHA 2A30A 1KK1A 1A4RA 1O3YA 1Q44A 1XD2B 2GBLA 1Z6TA 2QQEA 2P6NA 3QKRA 4LJYA 4RD1A 4ZCLA 2PEZA 1KOFA 2FA9A 3RLFA 1E2HA 2EW1A 3CUEF 4LHZA 2OSBA 2VHQA 5KDOA 3S1AA 3QSYA 2QE7D 1VHLA 5JJKA 2A2ZA 1U81A 1ZC4A 2CE7A 3O8RA 3NEJA 1SHZA 3ONWA 1SXJD 5FOXA 1IAQA 4S35A 2CBZA 4EPTA 3EWSA 1ZUHA 4NHOA 2QMHA 2ZROA 3SJCA 2RHDA 2W0SA 2Z0MA 4LJ8A 3FOZA 3TRFA 1RPZA 1AQUA 4ARZA 3CNLA 4XVRA 4M22A 3QG1A 4PANA 1ZNWA 1KK0A 2UKDA 4B71A 4Q9JA 3E1SA 2QE7A 1E2IA 2Z83A 5CYOA 4MRPA 1SXJA 3AVUA 1DADA 3QEOA 3PXGA 4PPQA 5DI3A 4JS0A 3ZQ6A 3LVRE 5KOYA 1UKEA 1JAIA 1IOZA 1W1WA 2N1BA 4MUAA 1J8MF 2CHGA 2N42A 3DVLA 1G7RA 4Q02A 4BFTA 3AVYA 2HXYA 2P67A 1TQ2A 3OEHD 4URZR 1VIAA 4Z8YA 4AYXA 2R2AA 3A1SA 2B92A 2ZJ8A 1E2QA 2BOVA 4URVR 1Q1ZA 5KNDA 1X8LA 4DLYA 4D6PA 4N0DA 2GK7A 4HLCA 3K1JA 1Z0IA 1NG1A 4JLJA 4LHWA 1Q21A 2C95A 2DWOA 1KK2A 2HJGA 4LHYA 5B57C 3SQWA 2DPXA 3CF6R 4AI6A 4DSNA 4JBXA 3B1WA 5DSZA 5E7JA 1E9SA 1G41A 3FKQA 3OEHA 4GI7A 4PC7A 2IYRA 3TJZA 1N6IA 2V6IA 1UADA 4MKIA 4IDHA 1NKTA 1U0JA 5LB4A 1ZM2A 3QG5A 3CH5A 3QNUA 1GTVA 4HLQB 4YMSA 4KFTA 5LB2A 1NN5A 1OKKD 1R6BX 2TMKA 4A8JA 2GJ9A 3AF3A 3AKDA 3NH9A 1R5OA 1T5IA 1KY3A 2BDTA 6Q21A 1NKSA 1E9EA 3MWLA 4DT1B 2PBRA 1D2MA 4PAQA 2IF0A 3HPRA 3NDBB 1XTJA 4EQ6B 4Q00A 3I73A 3BB3A 1P2VA 1DOAA 3VNUA 1F2UB 2GCOB 3B7GA 4N0EA 5FPHA 3W6OA 1IBRA 4BEJA 1OKKA 4Q4AA 1R4AA 3B5JA 5TMPA 2CE2X 4K46A 1HV8A 2C8VA 3Q72A 1N0VC 3W5IA 3ADDA 3EZ6A 4PC3A 3RS2A 3O47A 5A5GA 3U7FB 1TQ6A 1HE1C 2WWHA 2XITA 4M9QA 3U3OA 5J4HA 1D2EA 3CONA 4R98A 1N0WA 1M7GA 3DO6A 1BS1A 4TSFD 2WJIA 4US2R 4B34A 1VCIA 1DAGA 3PUVA 3NEYA 4CRWB 2D4HA 2GDJA 3GFPA 4JJZA 2A5DA 2EYUA 3BS4A 2GJAA 1TUIA 3Q5EA 3LVQE 3K09A 3ZZ0A 2R6AA 2MMGA 2VLIA 4GBMA 4NP6A 2IS1A 2QROA 2ORWA 2HXSA 2CL0X 4W5WA 5CJ2A 1GKYA 4B3DA 4QNMA 1AZSC 4IKEA 2Q9BA 3K0FA 3TLXA 4TMZA 4PHGA 1RC8A 2ZU0C 2BKUA 5GJWC 1F48A 4QHYA 4TSFA 1CJUC 2ZR9A 1R10A 4JJKA 5DO9A 2OZEA 1CU1A 3D8BA 5IT5A 1NVUQ 1G4UR 2NZJA 3ASZA 5EP4A 5H8WA 2VF8A 1GRRA 1I4DD 4IDOA 2XTNA 4GMDA 5FUXA 4C0QC 3VKWA 1E6CA 3CR7A 5K8LA 1KI4A 4TL9A 2ZJZA 3EA0A 2IS2A 2OG2A 3BIFA 2XB2A 1ZCBA 1CIPA 2ZRIA 1W49A 4HUQB 1G7CA 4OQMA 2AFHE 4M21A 3WP1B 2JLYA 1KI3A 2OLKA 3VU9B 2ZRNA 2NPFA 4IDPA 2CL6X 3UG6A 4B3GA 2OESA 2PX0A 4MQBA 3TSOA 1NVVR 1W44A 4ITRC 5HE8A 2E87A 2C78A 4MGIR 3ZD6A 4LSGA 3PUWA 2J0VA 5GVSA 2B7BA 2IXEA 2IS4A 3SBDA 2H1LA 2IYQA 3EZ9A 4Q1AA 1Q22A 4LBWA 4ZKDA 2CXXA 4ZKEA 3X1DA 1NVXQ 1XEXA 3FMIA 3UK6A 4DVGA 1R5NA 4PC2A 3VR6A 5E7IA 2IC5A 4U7DA 4EJSC 1U90A 4RVCA 1DAMA 3EX7C 2G77B 5FUWA 5CM9C 5AUNB 3ND8A 3KFXA 3EIEA 5CK4A 4GMXA 2QT1A 4YMTA 4Q01A 1XFAA 1KDRA 3OIYA 3LBHA 2QA5A 4B2PA 4OK6A 1G5PA 4OI2A 3ZYCA 2O8FA 3OESA 4UNSA 2JLXA 1DPFA 1TQ4A 3IPYA 2J59A 3QKRB 5G40A 3TMKA 3DMDA 2F55A 1Z07A 1NIJA 4KU4A 1CJTC 2ZRPA 2OT3B 2AWOA 4UJ3A 4OI1A 4V02A 1SVWA 1CRPA 3NHBA 4LK2A 4KJZA 3S1AB 1N6HA 2GEDA 5TDHA 1Z22A 2BV3A 5BQ5A 1OPXA 2DYKA 2O8EA 2WIBA 1U9IA 2WV9A 3OEED 4B2LA 3Q7PA 5FPKA 1TAGA 2WJHA 1N6LA 4L5BA 1WBDA 3I62A 2VP4A 4FWTA 1Z63A 4C9BA 4OQXA 4A0HA 4Q47A 4ARZB 1G7TA 2AKYA 1E9FA 4ZDWA 1YR9A 4DCVA 2HYDA 4Q21A 4IXMA 1NG9A 3K8YA 2JATA 3TR0A 1XPRA 2IW3A 1S1MA 3SZRA 3T61A 2J0SA 2OCAA 2QORA 3LLUA 2JLRA 1OF1A 3REFA 1II8A 2ZR0A 1SXJB 2WAYA 2ZITA 5FBVB 3OEEA 5DI3B 3WRXC 2ANCA 2XXAA 1ZNXA 4G3XA 4DB2A 2ZYWX 5G53C 4D80A 4TL7A 3K0CC 5P21A 2NO6A 3SYNA 3ZZTA 5G3ZA 2WJGA 1UBGA 1B0UA 5FL7D 4MITA 3O8CA 2XNSA 4DJTA 2V55B 4KLZA 2BC9A 1SKQA 1UEJA 1OSNA 1ANKA 1GIAA 4LUCA 3A1UA 1G1MA 4HDQB 2QEQA 3BH0A 1TF7A 5HZHA 2ZUBA 2I1VB 2HEIA 4XIGS 1E2GA 3L8ZA 3GD7A 4PSAA 5FL7A 1ZNYA 3RRNA 4IVPA 4B35A 3CPEA 3QUSA 4OJKA 2YOGA 2EU8A 4PPGA 4A8JB 4LDJA 3DKVA 1KZGB 4JBWA 3RS7A 2OBNA 4NYIQ 3PVSA 4HLDA 2BMFA 1KYIA 3B85A 3Q7QA 4UXJA 4F4JA 3KXIA 4DSUA 4WA7A 1GNPA 2YC4C 4DKXA 3MWYW 5DH9A 1G8HA 3KKMA 1EFTA 3BFXA 2A5YB 4O2LA 1COWD 2WWXA 1CLUA 2FF7A 4Q4AB 1GKIA 3FKSD 2GA8A 3IIJA 3KKNA 1GP2A 4KODA 1TF5A 1RKBA 3ZDQA 2J9RA 4HDOB 1CJKC 4NYJQ 3F0TA 3T1OA 1NLZA 1MABA 1QRAA 3C5CA 2ZJYA 4LJAA 3NHAA 2H17A 2WJVA 4QJ4A 2FGKA 4PTLA 4OHWA 3UMRA 2GKSA 2YVUA 1L2TA 3RDPA 5F9HA 4US0R 2OXRA 4WAUA 2IYXA 4RD3A 5K8TA 2FEMA 4TYPA 1VG1A 3A6PC 1COWA 2G88A 3NIBA 4M4SA 1P61B 1KK3A 4QGAA 5FOWA 2ZETA 2H92A 2CHVA 2REBA 4BLSA 4UNRA 4M1WA 2OCBA 1M34E 3VHXA 2EVWX 2NMVA 3KFVA 3DM5A 2UZ3A 2DB3A 4D4KA 3DDCA 4NYMR 1D9XA 3IHWA 4TMVA 1CR0A 4QHSA 3P4XA 3KJHA 4KBFA 4TQAA 2ZAMA 4C2UA 2XX3A 4DWJA 3DL0A 1OXUA 2ATVA 2CMKA 3RC8A 3EA5A 3FFAA 2XEXA 3PITA 4G1UC 1A1VA 1OH6A 1FP6A 2FX3A 3AEZA 3FDIA 3OIVA 4DC9A 4KFUA 1E0JA 2H8KA 2UVQA 2XGJA 1RZ3A 4JLPA 1GL7A 3THXA 1S96A 1AS3A 2WWYA 4IEEA 4D82A 1N6KA 4C0HA 5UKDA 4B32A 1XEWX 1NN3A 3L2OB 4RZUA 4Q9HA 1QG4A 4EPXA 1G5RA 3SS8A 5KO2A 2O0HA 3R8FA 4Q4JA 3ZGXA 2PT5A 2IYTA 4FMDB 3THWA 3D7MA 1N5LA 3VR4A 1D8TA 3VR3A 1T8UA 3WRYC 1AS2A 4NZYA 4BRUA 2R8RA 2IYYA 8OHMA 1PVOA 3ZS8A 1ZD1A 1FTNA 2QI9C 5KU1A 3L0OA 1XEXB 3VHLB 1W4RA 4XWAA 5BN4A 2D7CA 2PX3A 3BJIC 1Y3AA 4W5JA 4NKRA 4H9GA 1DG1G 1SXJE 2J41A 4BRWA 4PO8A 3H0KA 3EASA 2IHBA 2LKCA 2ZI6A 3HDTA 5DLQC 3FB4A 1MRNA 1VYTA 4QRHA 1XCPA 2R6GA 1E2EA 2HLDD 4BQSA 221PA 4Q4LA 4PX9A 4KSCA 4DLRA 1KMQA 721PA 4QJ3A 1JJ7A 4TTRA 4A0FA 2BBOA 4Z1MD 1V5WA 1EFHA 1W48A 4U02A 3B78A 1F6BA 2QPOA 4ZV4A 1KI6B 2C9YA 1KDTA 1MO3A 3KXLA 4IVRA 4RD0A 1Q1QA 1VCNA 1R7RA 2AD1A 2W58A 3HU2A 4BFXA 2O8FB 1FUKA 1SKYB 3SN6A 3UWOA 4ZDJA 2P0EA 4G5OA 1VTKA 2GXAA 3HU3A 4QM6A 4FCTA 2IA5A 2C99A 1W36C 1ZVQA 3FE2A 3TH5A 4AKEA 1P7CA 3QXCA 2FDCA 2HLDA 4N3NA 5L3VA 4FMBB 4Z1MA 1E2DA 1E3MA 1N6PA 5FI0B 3WMFA 2FN4A 2W2XA 1KO4A 2VSOA 1JR6A 3ND9A 4JLNA 4US1R 4RD6A 3LX8A 4MYUA 1KJWA 4TTQA 5AJZA 2MSEB 3U7GA 1XPUA 1CP2A 1YR8A 2JIZD 2IUSA 5HZKA 1W0JD 2JCSA 1P72A 4IFEA 2JASA 1R8QA 2ODBA 4C2TA 5J47A 5B58C 5JWHA 2WWIA 3I32A 3U7HB 3MFYA 1JR3A 4DRZA 3MSXA 1PLKA 4C0JA 3EW9A 2WSMA 3DOFA 3DZ8A 1CJMA 4M2LA 1E9CA 4A6XA 1II8B 3N5CA 5FPTA 2FZLA 2IBMA 3GLGE 3KUCA 2XXAB 4I99A 2CLSA 2FPKA 5EXXA 2JIZA 4A15A 1W0JA 4HDCA 1KI2A 4LY6A 2DBYA 2NZ8A 4GP6A 4V0NA 2YWEA 3EXAA 3QVUA 1HQYE 2FFBA 2GXQA 4WZAE 1DAEA 3KJIA 4MKGA 3BK7A 5GJCA 1UF9A 2C96A 2NQ2C 1NMYA 2ZE6A 4FW9A 3A4LA 4QGFA 2HJVA 2PH1A 1S3SA 4URUR 2ZI5A 3D31A 1I4LD 1BKDR 1E94E 3IIMA 3QENA 1Z0JA 1NN0A 4UKDA 2ODNA 2IUUA 1QHHB 5FR1A 2ZYTX 3PIRA 2GJSA 2B6HA 4KI0A 1IJFA 5KDDA 1ZM7A 3H2YA 4HZIA 2V54A 3T34A 1A2KC 1XU4A 4B76A 1Q57A 2KI5A 4LPSA 2QU8A 2VYFA 2RGCA 4DDVA 1U8YA 4HATA 1FZQA 3MAAC 5EP2A 2WZQA 2GTPA 2Q9CA 3I1FA 4KBGA 4MRVA 4P0TA 1UBEA 5C46F 2FSHA 4OKSA 1GNRA 4B6EA 4IW3B 2ZUDA 3DOEA 3GJXC 2WOJA 1AK2A 2GJ8A 1G16A 3GJ6A 3TIFA 4Q19A 3Q8XB 2ZUCA 3QXXA 3LRPA 2IYZA 3CLVA 5DIFA 5KDLA 4BFVA 1NN1A 1Z06A 1OHHD 1Q0UA 1XP8A 2RGXA 4X8LA 2BWJA 1JJVA 3R7WA 5CIQA 4QHTA 4CDGA 1ZNZA 5IRCD 2PEYA 2QTFA 3HJNA 3CF2A 1YZNA 3IBGA 5CK5A 4B73A 4ZI2A 4G5GA 3CX8A 2WICA 5EE3A 1MABB 3CX7A 3J81k 3KKOA 5JI3E 3SJZA 1D9ZA 2ERXA 4BFWA 4IDNA 3CRVA 1CRQA 2CDNA 3W8NA 4NBSA 2CJWA 4PC6A 3VU9A 1S3GA 2ZI3A 4B3FX 1JNYA 1KZ7B 4S2EA 1U99A 3W8RA 1E4VA 1ESNA 1G3MA 4G01B 4L8GA 1MO4A 1SVKA 1E98A 2K5UA 2XTMA 4Q4HA 4MDFA 3IIKA 5J4LA 2VP2A 2VP5A 1O87A 1ZU5A 1KDOA 4RFVA 4M9SA 4TMXA 1Y63A 2V6JA 2AN9A 2B21A 1G5TA 1VDZA 4LYFA 4MGYR 5FUYA 1OIXA 2IT1A 3CR8A 1HA3A 4PZLA 1R0XA 1U8AA 2FV8A 3H86A 4KSBA 4PAOA 4LV6A 4OBEA 2R65A 4G5SA 3RRZA 1R5BA 2EFEB 1VG8A 1ZUIA 2OFOA 4PAMA 1IXZA 3AF0A 4JSYA 1UDWA 4D4MA 4YMWA 2J1LA 3FFBA 1SULA 1SKYE 4A6PA 4RY2A 1Z0DA 1S2MA 4X8OA 3QF4A 4XSGA 3KKQA 2J7KA 3BOSA 2JJ2D 4LJ9A 2BMEA 2YYZA 3THXB 2RMKA 3AKCA 3LBIA 3GJ8A 2FWRA 2LCFA 5EE1A 1JALA 1YRAA 5HCNA 2ODEA 3CF0A 3KDSE 4AKHA 2OEPA 1P9WA 4NE2A 1B23P 1XEWY 4U5XA 4Q48A 3RAPR 4TT3D 1KKLA 1LS6A 1QF9A 4U00A 3EPLA 3AV0B 4GSYA 1XCMA 4Q4JB 1AGRA 4DEXA 2GF0A 1DBSA 3OHMA 621PA 3THWB 4C0BA 1OYWA 2JJ2A 2KJQA 2WJJA 4LX0A 3GLFA 2ZRBA 2F3RA 5ELXA 2D06A 4HB3A 2W2VA 3ASYA 5DYGA 4A2QA 4FN5A 3A1TA 3ZD7A 3N70A 4LBYA 5JI2E 3GJ7A 2WM9B 2PMDA 3P20A 3VFDA 2C03A 5EZ6B 4TT3A 4AG6A 1NL3A 2ZYVX 2ZRHA 3TBKA 1IN4A 1JEDA 3PQCA 4R7ZA 1E79A 121PA 3UIEA 5JMTA 4YONB 2H16A 2RCNA 1TNDA 2FFAA 1ZYUA 5JWRA 2WWFA 4RKEA 3I5YA 4O0MA 3ZZUA 2RGBA 3L0SA 3MG9A 1GRQA 2XTZA 1F60A 4FI3C 3QQ5A 3BC1A 4OI0A 3NC1C 3W5JA 4DUGD 1N6RA 4OJQA 4BUJA 2FFQA 2P6UA 4M1TA 2P5TB 2G9NA 1KJZA 4JLAA 1NIPA 4P4TA 5KNBA 4LRWA 5FOUA 1MO5A 1OFUX 3LXRA 2GEUA 4MYTA 1AA9A 4OHXA 5E3HA 1XF9A 1T0JB 2H57A 4JYBA 1NI3A 1E2KA 1OXTA 5FPSA 4A2PA 2OHFA 3C14C 3RS0A 1K5DA 3EG5A 5HPYB 4DUGA 2PLRA 4UJ5A 3JVUA 3E5HA 3CRW1 4B3BA 2X19A 3KXKA 1HT1E 2GXSA 3T5GA 3UMFA 4TYYA 1SVMA 4D25A 3AUXA 1FOEB 1KI7A 2IK8A 2RAPA 4IXNA 4QFMA 5AJVB 2I4IA 3I5XA 4PR0A 2FSIA 5JEEA 1OLOA 4HB4A 4LBVA 3GLGA 4F4IA 5FUVA 1WDTA 1FMJA 2ZJOA 2R44A 4JIMA 3GJ0A 2HUPA 3VR1A 2VH5R 4ABYA 3QKSA 2D2EA 1DELA 2ZVQX 2VA8A 1XXHA 4AURA 1TUEA 1P73A 4DCTA 1KNXA 1G8GA 3CB4A 5LD2C 2BHRA 1KSHA 2BCGY 2ZM5A 1HQCA 2QP3A 1M74A 3BH7A 4CF7A 2JLVA 3VQTA 3FPAA 2FMXA 5CDFE 2ZSBA 1T0HB 5LDDC 1IXSB 2QAGC 2YJTD 5K8UA 5CIWA 4Q7MB 4BFUA 2LKDA 1S9DA 1OJLA 2FFHA 1WF3A 3BXZA 3QBTA 1W47A 1TU4A 1G291 3G0HA 1RJ9A 1FQJA 4NCKA 2HV8A 4KYUA 2QM8A 4LCBA 3W6PA 2F1JA 4RZ3A 3TSZA 1OFIA 2D74A 1T3LA 4GZLA 2ZRCA 1II0A 5AUQA 3RNLA 1KHTA 5CB6A 3K70C 4DDTA 1R0YA 3HU1A 4JVMA 4LJ6A 3WNCA 5CJPA 2ZAOA 2ONKA 3A4MA 5B30A 4RZXA 4PQYA 1ZMXA 1XD9A 4Q9IA 3UMSA 421PA 2ORVA 2ZRMA 4LPKA 1GITA 3MJHA 3RRMA 1KGDA 1N3BA 3W3ZB 2N46A 3R7WB 4B43A 1TTTA 1E9AA 4LI0A 2G1KA 1Z2AA 3RSLA 5TVKA 1G8PA 4MUBA 3MLEA 1J90A 1NSFA 1JB1A 1Q1BA 4QBGB 3LBNA 2NTYC 3UG7A 4ACBA 2IYUA 4JLBA 5C1BA 3GFTA 1UAAA 1C1YA 4MH0R 4HAYA 3V4FA 4K8OA 2ZS8A 1AN0A 1P2TA 1D2NA 2CJWB 4WZBE
chains in the Genus database with same CATH superfamily
2E37A 2VZ9A 4GVPA 1UBTS 3OQIA 1YCGA 3E27A 1JH8A 2A5FA 1EDEA 3WDKA 3LXXA 1R5JA 3IMKA 4Y2SA 1YS1X 1BMFA 2CZCA 4GQAA 4BLTA 2XCRB 2IZ0A 1GGJA 3T12A 3G9QA 3WK8A 1EG7A 3I2GA 5IF9A 2I2XB 1MKYA 5K3FB 1L8AA 3D8TA 3MCZA 3AI7A 3I01M 3JZFA 1MO2A 4K6FA 4RPCA 4EYSA 3S28A 3LL7A 3PPIA 2DQ4A 2IYEA 2OCGA 2JCYA 1OLSA 5CH3A 3GEEA 4QDUA 5FFFA 4D9EA 5ICMA 1M6EX 1TAUA 2OO7A 3KKPA 2WUVA 2ZI9A 1TF2A 3CRZA 3LP6A 2XCOA 4EAQA 3TZKA 4HN4B 2GD1O 1M34B 3P9XA 3RU7A 4PO9A 5COBA 5FCDA 1LH0A 3AJ8A 3SP1A 2C9OA 2PAAA 3ZI0A 4JI1B 4ZDIA 1R0BA 4EW1A 2OR3A 1N5KA 3E3MA 2WT4A 3FHOA 3GGJA 4Q03A 2UV8A 4FE4A 1M2EA 1NJ6A 4DJJA 4FN4A 5A05A 2HADA 5ALMA 1I0ZA 3DHWC 5I4BA 2I7XA 1QRDA 4D41A 4KVFA 4RV4A 4GE0A 1XTQA 3GLIE 1HYQA 2WHQA 3H75A 4RMHA 4QGSA 4WJLA 5JJIA 5KNCD 2B1GA 4OLHA 2B98A 2YY5A 3TW4A 1PV4A 4QNRA 5ITSA 2BFEB 2LTAA 3NUZA 3I9MA 1TO1E 1B0PA 3ROXA 1C8LA 4YRTA 4EB8A 4R1MA 4PSKA 5EHQA 4UNPA 1CQXA 2PKQP 1Y1SA 4J4HA 2UXBB 1KEVA 2VL7A 2ATCA 2JZCA 2BY4A 3FNGA 4N7RA 3M6FA 4BO2A 1DQNA 3BD9A 5AESA 1LQUA 4A91A 2Z8YM 3KE8A 1VKZA 1QKIA 2BP7B 2W2MA 2V9PA 3GAFA 1OWMA 1S4QA 4RW0A 3QGMA 1PBTA 3C41J 3F46A 4Y30A 5AM1A 4NJMB 4ZYTA 3PEYA 2G1JA 2VDUE 4JOSA 5M04A 3OAAA 3GUUA 3BMQB 1FFWA 1P6UA 1UBCA 4RPKA 4ZVQA 2NQ8A 4F38A 4DDVA 1N9GA 3EDCA 3M6AA 4LXGA 3ZIAA 3CVYA 4ESVA 3DQPA 4I50B 2WFLB 3V46A 1ACMA 2AR9A 1Z75A 1A8HA 2XA1A 5CHEA 4Q6BA 4ICIA 3H17A 2MCFA 4XFJA 4AAYA 1GAXA 1C14A 1VGVA 3DGEC 3G0IA 2HM7A 1P45A 1TZ2A 2GCGA 5DK4A 1YZTA 2RI6A 4GEKA 1VJRA 2QGFA 3TRHA 3OMLA 1EGQA 3MRVA 4PTYA 1AQLA 4G4JA 4TLEA 2BPOA 4EARA 5BSUA 3UTDA 4JUFA 2I4LA 1NXXA 3KOWA 1C7IA 5TEVA 4GZ5A 2GAOA 2NUPA 4B4DA 4CM4B 5TQJA 3BGIA 1SMKA 2WMNB 1NOKA 5AUOB 1CSEE 4QYIB 4QJ5A 5I7RA 4HR7A 3M4YA 3Q9NA 1C9KA 1ST2A 4NU8X 3TNDA 1SXHA 4RGBA 1Z15A 1ORTA 4L0QA 4RM3A 2PCJA 5ULLA 2X8WA 2BBTA 4C6HA 1MFPA 2CXUA 3D59A 1Q2XA 1Z4KA 1OV6A 1W85A 3EIWA 2C5FA 1PNOA 4Q37A 3QLUA 1CZKA 1I0LA 1DKMA 1N25A 1U5BB 1IHYA 4G0UA 4AKGA 3KYCA 4UBNA 3PQ2A 5L3QA 3F3YA 3UOGA 2QXYA 3E8XA 4FYPA 1IQ0A 4X0EA 3STUA 5HOEA 4PS0A 1D1SA 2OGTA 3HWX1 3CNHA 1LQ2A 3KYJB 2QD4A 4MVJD 4N12A 3Q5GA 4DA9A 4DN6A 3EQ8A 5ES4B 5LP6B 3OQOA 4R2IA 1GZ4A 1PCXA 3ML1A 4QTTB 3QU9A 2H63A 4JUBA 4ON9A 5THKA 1E0AA 1L8OA 1VHTA 2VVTA 1L7BA 2Y9MB 3PA6A 1AHPA 2ID7A 1EX9A 2Q5CA 2B6NA 4NNOA 4D0NA 2B36A 1XLWA 1G60A 3M6LA 4PLZA 1A27A 4R8VA 2JF0A 5ESWA 5H7XA 2K7FA 1U0HC 1ZJZA 1EVJA 3Q40A 3U7QA 4LF6B 5CFOA 3C4JA 4YAEA 3UC5A 4WXEA 1VZ3A 3VPDA 1BJRE 4JI3B 4JASB 4AIIA 5J43A 3FCXA 8GPBA 3N0VA 1KPGA 3A6EA 5ECDA 2XVYA 5AOVA 4FDUA 1JSXA 4O2BF 2BHSA 1R15A 3QNWA 1DINA 2G08A 4O2AF 4KQ6A 2IBTA 3LYUA 1GG5A 1P7ZA 4B0OA 1U0SY 5CDYA 1I4TD 3GLGB 1KGSA 2IZOA 3DPUA 4GX2A 3IA7A 2GGSA 3L6DA 4EA6A 3DV0B 1MXHA 2VQDA 2DQZA 3HVIA 4LJ4A 3DDHA 1EWTA 3WYAA 3EIFA 1WZEA 1XXHB 3B9QA 2IOYA 5IXYA 3D6TB 3U5ZB 1MJGA 4WZAB 3OOYA 4WHMA 3GVCA 3X3HA 1F3LA 1Y5MA 4F60A 1U7XA 5K0NA 1HDIA 3IHLA 4G4SO 3UVEA 3SQOA 2C3UA 5LSAA 1Y8RB 2OFPA 4BCBA 3I9NA 3QRWA 1AD2A 2RHBA 4UE3S 4YO7A 1IJKA 3RFXA 3SM3A 4OK5A 4CETA 4L57A 5IJ0B 1B4DA 3GLTA 5A5FA 5L95A 3EUAA 3SIWA 2IKSA 4EYEA 1E0SA 2GH1A 4ZXFA 3ESYA 1SK9A 1MH1A 2PYZA 5IK2A 3E7XA 4JB0A 3W6ZA 3U3RA 4TTVA 3S5UA 1UKYA 1P74A 1PUIA 2O7QA 2AQKA 2AYZA 4K6GA 5CDFA 2ES4A 1SG9A 2J3EA 1WA5A 4OB7A 3RIEA 1MNQA 1AQIA 4CHTA 2IXDA 4HN2A 3WIDA 2RIRA 3ORRA 1G4HA 4RGQA 3L43A 3I30X 3QU7A 1DEAA 2EFHB 2AI2A 3ANTA 3L4EA 2JGDB 4XLLA 1ZK2A 2QL7A 3UFBA 1FVHA 4YJGA 2JJ1A 1XCGB 2DY0A 3LF1A 1QC5B 5CG2A 1PZNA 1LXCA 5LYJA 3HZHA 5BSRA 3D8RA 3C3MA 3NBYC 4FB5A 3AF6A 1GM5A 2HJRA 1NSTA 3ZY2A 1M6WA 1ZJJA 2BFWA 4G9GA 2I6TA 4P4UA 3VR6H 1IUNA 5CTAA 1YA6A 2AZTA 1RI2A 4V2IA 2Z30A 5EMLA 2YIMA 1ODSA 5BNTA 2XSZD 2ATEA 1E4YA 3WMWA 4RK7A 1HTTA 3V00A 4E3WA 1VKJA 4JQYA 5IAEA 1BDBA 4NV3A 2CVHA 3G0OA 3ONDA 2VG8A 3P5SA 4EGCB 2Q6TA 2VJMA 3RT9A 3OQIB 4II7A 4OU5A 3RPEA 4LWZA 3O95A 1UOPA 4N03A 4F92B 1SC6A 3GLFE 5LDHA 5JTUA 4LXTA 4YBRA 3ROTA 1XPOA 1EK0A 3O91A 5HDBB 3DLHA 2OILA 2C2GA 3HADA 4OQNA 5F76A 2OA0A 4B47A 4TZ0A 2HDHA 2J87A 4O63O 4MJ7A 2JLUA 3AUSA 4DCGA 1Z0FA 4OL0A 4QULA 2VC2B 3VDRA 1OLSB 2DCUA 4IHJF 1SRQA 1F3OA 3UO8B 4LJ7A 4D7AA 1J99A 4HGZA 1GU7A 1S2IA 4RTNA 4YMVA 4A9AA 5A62A 4H3VA 1NV8A 2G04A 3UQYS 2B34A 1JIKA 3ROFA 3HCRA 2RHMA 5ALKA 2QTHA 4ZMRA 2NT4A 3IQEA 1UWLA 2HPAA 3H1PA 4Q1DA 2OY0A 4UAUA 1AGXA 4C7OA 3NXKA 4RC9A 3KZOA 4CMAA 1LFDB 5AHRA 3MUFA 2A94A 4BO0A 3ZLJA 2F4VB 3GPBA 1V3UA 1H8HA 3AQIA 3PPYA 1N2GA 4TVOA 4DQKA 5ADVA 3R3YA 2JA2A 4IGEA 4V03A 3X2SA 1MT3A 1XTRA 3Q7EA 1N3YA 1IN6A 2QLFA 2X41A 3ESQA 1YZLA 3QUQA 4O4HB 2V4MA 3C48A 5F5XA 3R8XA 5DF1A 1Y4ZA 2UZIR 1B8NA 2HJ9A 2WPDA 2XNDD 2CUNA 2YHSA 3TE6A 5JYCA 3QMVA 2BUCA 1GKLA 1QTRA 1K6MA 1VL5A 3I2YX 4HAXA 4PZAA 4URWR 1AF4A 1Z82A 4KR9A 1NUPA 3LUBA 3TE7A 1DTWA 3ENKA 1W4BA 2W2OA 1ZM9A 3AUFA 1ADJA 2JFFA 2JGEA 3QE0A 2FTKE 5JBNA 5JAZA 1XNHA 2A92A 2FZ4A 2NSJA 3IP1A 1RAEA 1XJCA 3WGNA 4F2WA 5EQTA 2VS1A 5IYZF 3FGOA 4PG6A 1NBMD 4CMHA 1U0OC 1NNLA 2EQBA 2JKVA 3OWHA 1SOWA 1W93A 1E58A 1AC5A 5IJ9A 1WEKA 3ICCA 3A4VA 3GCDA 4NU5A 5L8VA 3ANMA 1MAAA 5IJWA 1D2AA 1MGOA 1ZGZA 1NASA 2G83A 2GBLC 1AQYA 1ELOA 4ASUA 2AJTA 4UVHA 4EHKA 1SKAA 5KTTA 1OWPA 4PLHA 4V0MA 5KEIA 5TJ9A 5AXCA 4CL2A 3P9PA 4KQKA 4CF4A 3PFHA 1GDDA 1MDFA 2WJ3A 3H4IA 3JQ8B 1MFZA 3OCUA 3OX4A 3QEKA 2NUPB 5KJEA 3A1NA 1QIKA 2F9FA 4FEYA 1XZKA 3V8BA 2IOFK 3HXKA 3DDUA 2BJWA 1M1ZA 2D1TA 4X1YA 4KJXA 4WY5A 4LDAA 4Y6OA 3WR5A 4WASA 3MTDA 4P2BA 1EWQA 2IKQA 2KE5A 1G19A 4NARA 1TECE 1M2JA 2PX4A 3C1UA 1W85B 3T1NA 1U9ZA 2CBGA 2GN4A 4WI1A 4DBVO 2Q3JA 1BX0A 5C7YA 1CG6A 3KYCB 1XMVA 1D0VA 3HFGA 5G4LA 1ETUA 2YV2A 3G7UA 4KYIB 4MICA 4MGHA 4MRRA 4BVFA 5L3QB 5H3HA 3EPPA 3DM9B 4HQ0A 5TF0A 2P6RA 1SXJC 3P4UA 3ZWBA 5FTMA 1CUHA 4EGJA 1BXGA 1BNCA 2ASEA 1OW3B 1NP6A 4KOAA 4YRDA 1O96A 1NVKA 3MZ0A 3FAKA 4K9RA 4WXRA 2G40A 1KJYA 1ZMRA 3L8GA 4ILEA 3UKDA 1LDBA 1QLHA 4LISA 3FUCA 3F6RA 1Z12A 2M6SA 3GLRA 3H5LA 4BFLA 3D2BA 3V6MA 1FY2A 4FCVA 1T0BA 4B7ZA 1SQSA 3J7AC 3U7QB 4I1IA 5ALPA 3OZEA 421PA 1YI0A 1NQTA 3KU1A 2CY0A 3DLAA 1LLDA 1L4YA 1O6ZA 1WUKS 3NDPA 4N5HX 4N8DA 1BRTA 3BORA 4RV5A 2V0GA 1HOTA 1NGSA 2O20A 1KSJA 3QE9Y 4RCZA 2PQ6A 3GGOA 2WUGA 1K92A 1YZUA 1KY5A 1F4VA 2V4ZA 5EZYA 1RJGA 1L1QA 2Z6VA 3NFYA 4MKHA 4Y6PA 4BB6A 1SC4A 2VHCA 5TARA 3TZCA 4KITB 1NQUA 1BDHA 1QP4A 1B93A 1IY1A 3HCDA 2ZJ3A 1MQAA 3O8DA 4BB0A 3GCGA 2JCBA 3NP7A 4YV0A 3C1TA 5I51A 2M6KA 1FSSA 1ZISA 3PCXA 2P2LA 4QBFA 4WGGA 3KPVA 4M49A 4NS4A 3SAJA 5AKXA 5SICE 2CFCA 2D2IA 1XTKA 3IAS6 3UB2A 2V3CC 1E5XA 3DOIA 1E77A 3L18A 5IDXA 3NBAA 2HT6A 3K5PA 3BA1A 2WKWA 4V0OA 4KPEC 1G5HA 2EP7A 5DNAA 1XZQA 4QGGA 2W0MA 3QX3A 2XQIA 1JEEA 3SSAA 1IZ8A 1BYIA 1NW9B 2GXUA 2YH2A 3K9QO 5FOSA 2RH5A 4TUYF 4E22A 5KC9A 1H22A 2RD2A 4IFTA 1DLJA 3GFFA 4QDOA 3TKAA 5TGZA 2J85A 3CKYA 1GCOA 2ERYA 4H17A 5T4FA 4CR8A 2C3PA 2WIAA 4CR7A 5LLDA 1X13A 3IQHX 3O7MA 4EF6A 3VR5A 4TZKA 1X77A 1AV7A 4GS5A 2DF8A 4MUFA 2DR2A 1OLXA 4HFNA 3QV2A 5EGNA 1ZHHA 3KR1A 2B2NA 1G3RA 1NQXA 1SELA 1ZU4A 3DDWA 2JI6A 4RHXA 3KQUA 4GPAA 1P60A 1QQAA 3PR2B 3MJRA 4KLCA 3CFYA 5BSMA 4IOJA 3A1VA 4DB4A 4MXDA 2C7PA 4UMEA 2XMDA 5LYJB 4KR6A 1IBCA 4RVGA 4U2GA 3W4JA 4DANA 2O9JA 1CHDA 1ISMA 1CF4A 1T9HA 1Z0UA 2WU3A 4GM4A 1YL6A 4ZPXA 2C3OA 3JVVA 1UAGA 3QV1A 1I3MA 4N0QA 4ZU6X 5J59A 5I48A 2GZ3A 3GFQA 2Z4TA 4FFLA 2AJ8A 2WTAA 4MIYA 5DM70 3T7EA 4HQOA 1N2CE 2HL6A 4N47A 1J70A 2F17A 5IWCA 1PT7A 3U0VA 1VLQA 2OD2A 4I5FA 3D0OA 2VJMB 2VUTA 5G0WA 5ADUS 1VGQA 4R8KA 3LXUX 1NVDA 2VP6A 3HZOA 4OYHA 3TI9A 2CMGA 2IX9A 3OHSX 3PBKA 4IDQA 1H23A 1F2DA 1E79D 3NW9A 3PUJA 1C5KA 2AFIE 3X1YA 4J9VA 2QRVA 5LYYA 4EGFA 4PFQA 2ETVA 2QT9A 4TL8A 3IGFA 4PFKA 5KHOC 2WU0A 1P1JA 5JZVA 5L6MB 3STYA 3QFTA 4QXPA 2ZIEA 2B3TA 1YRWA 2O8NA 2V7VA 2XE4A 2I8CA 1COZA 1U9JA 1UMKA 2XODA 2XRMA 1BH6A 2CCJA 3JATA 3OBIA 5AKLA 4CJXA 4ZDKA 2BF7A 3IA2A 3KQSA 3NB0A 4N5NA 5F98A 3OURA 1EB8A 5KCZA 4KBYA 1YTUA 5L3RA 1QSGA 1O08A 1VSQA 3FW1A 4LHXA 4WOJA 2FKAA 3EF0A 3KJGA 3UJNA 1ZAKA 4YEDA 3ABOB 4MVJG 2IF2A 4JCCA 4C7OB 4Z9BA 3LDHA 3NGLA 3DC2A 4BE7B 3IH5A 2G63A 1QMPA 2H6EA 4YJFA 1K66A 4ZARA 4D4LA 3P1JA 4GZMA 3WWPA 4ZQEA 2PWBA 4X3CA 4KVGA 4TN5A 3AWIA 4TWJA 5IARA 4DIFA 3WSVA 1ZRHA 4HGRA 4YQEA 3K20A 3LQFA 3LY7A 1G21E 2ZWVA 4ZT6A 5KWJA 1ZG3A 1PFGA 1KDPA 3UKOA 3WBKA 4RHTA 3ADPA 4BWYA 2VUSA 4RKWA 4YYEA 4CKEA 3MWJA 4BNUA 3FGZA 1N6OA 2DKNA 5EIWA 3OUUA 1S9HA 2C4TA 4XIFA 5CB8A 5E9AA 2OXTA 1ZD8A 1IY8A 2W00A 5T8KA 3WNZA 4NDZA 4YJ3A 5FNZA 3U2QA 3OLQA 3QPVA 2YXEA 4L74A 3DD5A 4AZTA 3O75A 3LXMA 1R0ZA 1XR3A 3DMHA 4L0DA 5IJZA 1NX6A 2NO1A 3IC5A 4QEZA 5IJ9B 2C4NA 3AONB 4G4SP 3NBUA 1DHRA 4IWYA 4JLVA 2DSNA 4Q3EA 5CVJA 5FYQA 3TD2A 2H31A 1GUFA 3DJFA 3WLMA 3EARA 1R0WA 2AIRA 3ZW8A 2OG1A 2VSXA 4GOKA 2WWWA 5EIEA 5I5EA 5IX8A 1O6BA 2WKRA 3MUNA 3QBVA 4PCUA 3MXTA 2Q3HA 4DM7A 3W1EA 1E7SA 4FDLA 3CKKA 4AUMA 2C7BA 1JHDA 3JY6A 2P27A 3V1LA 2M9MA 4HEJA 4DFDA 1L5LA 4FZJA 4R05A 3LT0A 2PRJA 1FDOA 3RYCA 2XF8A 4L5JA 1DXOA 5U4QA 1Z5VA 3LHDA 4PXAA 4FWIB 2BEWB 4X1YB 4B83A 1FL9A 4CLEA 3F71A 2X6RA 2AZMA 1L8QA 4NECA 1UPTA 2O52A 2G09A 3CCFA 3C15C 4LKRA 1B16A 2C00A 2CVPA 2GAAA 3PUYA 3QX9A 1NJGA 4YAGA 4P4NA 4ZJUA 3WZ2A 4K28A 3EUFA 4HAWA 3B5IA 4EDHA 5DHPA 3WNDA 4YMUA 2YKGA 1M6HA 2Y2VA 2ZJ5A 2IQIA 2WEKA 1YUBA 5BT9A 3R7NA 3T7IA 1KARA 1ZCAA 1ECFA 2IY9A 2C82A 5B1HA 2AS0A 1YKFA 4Y2HA 2EJVA 3UT0A 1GGFA 2F48A 1UBNA 4RAQA 3KKZA 3U7JA 1XHEA 1BXGB 3CIOA 1GUBA 1E99A 3GX1A 4JOBA 4OOEA 5F2EA 5FNVA 1O96B 4MLDA 2GF2A 3LSTA 2YWFA 1F17A 3IOCA 4NBVA 4E4YA 1G5FA 4P0PB 5I47A 5C7IO 2VJAA 2H7VA 4CKWA 5TPWA 3TINA 4E30A 1HMYA 1MG0A 4JBNA 2O5CA 2QVCA 3D6AA 4QXAA 3S2FA 4BEBA 2MHCA 5BSKA 3I8SA 3CLTC 4IZOA 4NS1A 1IHUA 1Q1NA 4B7XA 2F1RA 2FEXA 3CW2A 3A9CA 3D6HA 4MS3A 3GLQA 1ZHOA 4HJRA 3B1ZA 2R751 4H0NA 4KLNA 4YP1A 1MB3A 4FC6A 1NW6A 3SMQA 2WVHA 1ZBDA 3CGWA 3QPWA 3TX6A 1AMNA 2Z6UA 4KHPB 1V35A 3BREA 5EAIA 2IYAA 7MHTA 2XE8A 3CUSA 4P8RA 1BMFD 1MB2A 2YWHA 5EZYB 1JPJA 4BECA 3ULKA 3A9UA 3H2IA 3KYBA 1GFSA 4YUYA 2A5LA 1W9MA 2GESA 3ESCA 1V6CA 5TPZD 5EHGA 3PNKA 1F1JA 1CY6A 4GFDA 4HDSA 4MGEA 4F9EA 3IO3A 4KR3A 1I7LA 3EGWA 3THOA 1NF2A 3W9YA 4IJMA 1YCDA 3F8TA 3R3SA 4HUJA 1FU4A 1ZA1A 5BV7A 4PYIA 4UXIA 5CNJA 3NMUF 5B37A 3WB9A 1F6WA 2PZGA 3MJVA 1HUQA 1UK8A 2GETA 1P2GA 4FW8A 4KMOA 4EW6A 2OCKA 1ATIA 1W25A 3O3NB 3RSOA 3CBQA 1RHKA 1MHPA 2CFSA 2AG0A 1SBYA 2GNOA 3L02A 2H7YA 2CDRA 4K81B 4K9QA 5KTPA 2ISCA 2H9AA 1VOTA 1JHVA 1M83A 1M8PA 2CD9A 3E35A 1YGYA 2C98A 4IH1A 2BKVA 2RDMA 2WE8A 4MR9B 4UE6A 2NUTA 1J09A 3ODGA 4DAEA 2PUTA 1N1EA 5HQ3A 2BBWA 3FYHA 1TU0A 2YMQA 3B2QA 1FNCA 4EPVA 4LE1A 1QMGA 2QRLA 4BX0A 2Q3MA 4WCFA 5GPBA 5IKMA 1U4NA 3PNVA 3DOOA 1M1YE 1WRBA 2VXYA 5CXXA 3VH3A 2RGEA 3EQ9A 5JXJA 1X14A 1OLXB 3JQRA 1B6TA 1SXGA 3AF2A 3M1LA 1RCUA 3K1AA 1YRYE 4WOKA 1C8BA 1QHSA 2F43A 3MQ2A 4W7SA 1LVGA 1JDSA 4BVEA 4NBRA 2VZLA 3JQAA 1YJ8A 2P9YA 3L7OA 1RAHA 4PPNA 3E22A 3Q0EA 1X80A 3N8NA 2OK8A 5FBLB 4B5LA 4UPDA 1K8RA 1MC1A 1ZVJA 3OZCA 4CTMA 5DP2A 4XM0A 1TEVA 4Z7OB 3NHLA 1V3TA 2NPIA 5C1IA 3L6UA 4RTKA 4E5YA 1X3SA 4QQFA 3RQSA 1XKXA 3ZIAD 4C0AC 4EOGA 1WU7A 3CNQS 1U98A 2DWPA 2V7WA 1T5TA 3OF5A 1DO2A 1I33A 2CEKA 3AO0B 3FFXA 3FYDA 3PU6A 5CD9A 1F7UA 1YDEA 4KH1A 3EVGA 3WGIA 1KO5A 1Z6XA 4OX9Y 5H70A 5DHFA 7REQA 2QSZA 1QK5A 3G1WA 3GF4A 3GDFA 2IOFA 2P77A 2RAUA 3KYDA 4L3OA 3JS5A 4JL6A 4P4GA 1IVYA 2IXGA 4QWMA 5F1OA 4KQ2A 1SC1A 1V48A 3ZZ1A 3MTEA 5HM6A 2XIJA 2W6ZA 1NR5A 3KSZO 4Y2VA 4EITA 2HR1A 1AU9A 2SECE 3G5LA 3O4GA 1RCFA 4N6OA 1YZGA 2PGLA 3PX2A 5KPJA 2KS6A 3OT1A 3IX7A 3ETDA 3F49S 2QW1A 4WK4B 2PT7A 7ADHA 5SY4A 4FK8A 1OX4A 4HDRB 2OTCA 2O2XA 1W2HA 3GZNA 3JATB 4HX9A 4KCGA 4QGBA 5AHKA 4E5NA 4YT8A 1JEOA 1YVEI 4HWSA 1KFBB 4ZC1A 5MGNA 1R16A 4G0OA 5U9CA 5DHRA 5HIMA 2WJWA 1PS8A 4HVTA 2GILA 3EVBA 3TRDA 2EJBA 4G26A 3L3BA 5ELMA 2X9GA 4LZWA 1CRWG 4GPEA 1ADCA 3BCUA 3CU5A 4QUIA 3WYDA 1GARA 5HNKA 3QELB 2O5RA 2QQ0A 2XMRA 3MEQA 5FI1B 4B8ZA 1TKRA 3NKFA 4L8WB 3ANLA 1DJPA 1WB5A 3BH6A 2ZRKA 4HQFA 1TAHA 3DEIA 4JBYA 4ES6A 2Q2NA 3L7AA 2YVLA 4P34A 1U7PA 2PQ0A 2ZLBA 4CKZA 4YUZA 4TVBA 4B1FA 3ORYA 3QUTA 3WC4A 2RJ3A 4KO8A 1S6YA 1LQTA 1C3EA 2QYTA 5HTKA 1HFKA 1VPVA 1Z29A 4CKEB 1M1UA 1RHQA 1EJBA 3ZE1B 4I8IA 3K70D 3BD7A 4EZEA 4G23A 4JJAA 4OL9A 4DRXA 2G7MC 2R62A 5AJYA 3BGDA 4FD2A 2ORED 5FR2A 1XKLA 4G1EB 4P9NA 3SVTA 2VRBA 4XD7D 1YL5A 3MRSA 5KTOA 3VPGA 3JD1A 3P96A 2COUA 3REGA 5I3ZA 1B42A 1CNEA 3A4NA 4MUYA 5FBKA 3R3XA 3DNPA 2EP5A 3TQFA 4XYLA 1TQHA 5AJXA 8ABPA 4JR2A 4C4ZA 5A3VA 4KPGA 4JYPA 1BOFA 3EVDA 4FWBA 4R69A 4YP6A 5BYJA 4GE3A 4PINA 4ALNA 2Y0DA 4NBTA 2QN7A 1I1QB 3ABQB 2QVYX 2R84A 3FRJA 4QDZA 5DE3A 4EKDA 1ZRMA 1VCMA 1JWLA 1S3FA 5I8ZA 4LJKA 4MQ6A 3SJBA 3ZQUA 1HE5A 2E5FA 3LD9A 4DEYA 5CEFA 5HOQA 1UM8A 4DADA 4X54A 3KZMA 4AQYB 3R5TA 3UT5A 2YWGA 3SZ3A 4F8JA 3HVHA 1ZR4A 3T06B 3TLEA 3R09A 4W1PA 4CYMA 3DYBA 5FA5A 4L9RA 3SS7X 4REMA 4ONEA 2BGTA 3TQSA 3NAGA 1ULZA 3ZBUA 4GRAA 1G0OA 1P4AA 3QKTA 3GAMA 4Q1FA 5AW9A 2B69A 3W0LB 2EFCB 3E23A 4JLDA 4MW1A 2NG1A 2AN1A 4LYAA 4B6GA 1WDMA 3L7BA 3DLBA 4ZAWA 3RM3A 3WYCA 3KLNA 3CPSA 3OZRA 3SOPA 1Y6RA 3MRXA 1CXZA 4LV5B 4DNXA 1OZFA 1E2MA 1GGMA 2FDRA 3L7NA 2GUWA 3MGKA 4EG7A 2R6DA 4PRYA 3VA7A 2G3YA 1V1RA 2GBPA 1ETHA 2L19A 1XRMA 3LY8A 2W83A 1JZQA 3P2KA 3SF8A 4DIKA 3R6WA 1D6NA 5G1OA 3ZY6A 1K6XA 4NULA 4CV0A 4B44A 4GOOD 2EX0A 5AD1A 3HYTA 3E58A 2HU2A 3FZYA 3D0RA 4JC5A 5FNVB 3ITEA 2ERCA 3OIUA 2QRGA 1FMCA 5DIZA 3Q98A 4NOJA 3JAKB 2AQIA 3EHDA 3R77A 2VF5X 5BRNA 3G9TA 1WKCA 5TPWB 2WKSA 3SFZA 1EZ1A 1XVIA 2NOAA 3K1TA 1SK8A 2FSGA 2ZRJA 4NBUA 4YXWD 3K7EA 5JHHB 4NTZA 2AHRA 3T7SA 3F2IA 4EPRA 2OBMA 4C4OA 3SHWA 4JNCA 2P30A 1J2YA 2H1VA 1C8KA 3LH5A 5B64A 3ZVMA 4MDYA 3HU5A 2QTWB 3MINA 4F9GA 4I1UA 4RHYA 2PUDA 1SUDA 2EFYA 1FYVA 4MS3B 4ZANA 4H1VA 4KQXA 3DTVD 3R7SA 4MARA 3VNAA 3PYLA 1W5BA 1D04A 2W6QA 1U7TA 2XOKD 2XHEA 2X5JO 1UXJA 2CEAA 3INTA 4MS4A 4H7EA 1RRCA 2Q4EA 3I3OA 4FZ3A 2HCJB 4WWHA 3VZDA 1I13A 1Q84A 1VE6A 3WMRA 2GK6A 2VUIB 4HDSB 3OTWA 4NMHA 3E18A 3IVGA 1E96A 2DVMA 1ISJA 4Q3OA 5JAUA 2Z9DA 3K0FB 3SX0A 2ZG6A 3MBIA 2WKPA 3LS2A 4DMHA 2HRRA 1WQ1R 2WE7A 3OF2A 2C20A 2FP4A 1UPUA 4C0SA 2VJOA 2P4QA 3JWJA 4A4DA 3MT0A 4PLVA 4AF8A 2DETA 4OQLA 1J2UA 1IHDA 2RCYA 3C7DB 1U0EA 4IEIA 4BZPA 3EGOA 3NT2A 4TTTS 5FFMA 1XALA 1EEHA 2FLKA 1DC5A 4NOLA 3WRVA 5EJEA 2QK4A 3K0KA 5SYMA 4I66A 5EYPA 3L7LA 4YT4A 3LO5A 2H5EA 1H4TA 2QUIA 3D2CA 1NVAA 1IQPA 2W5UA 2FYTA 4LY0A 4OD0A 1XD2A 2C88A 5ALDA 3SZOA 1JQEA 4WCFB 3T5MA 3LKBA 2ZSEA 3WKDA 4EG4A 1EUQA 1K8XB 1F8XA 1JFLA 1SUWA 1TM1E 2Q49A 4WZ6A 4XZ3A 2PU7A 4NBLA 3T8YA 1P1HA 1ZSNA 3W5AA 3W9BA 2AG1A 1ICIA 4P92A 5IC5A 4CTOA 3K1AB 4RHUA 3TR5A 5A3RA 4YIKA 1QR6A 4C7JA 2F43B 3AVXA 1I7SB 2F9LA 4BKPA 2HTEA 1Y7PA 5AVSA 5DNCA 3FWNA 3N3BC 1T8YA 2QL6A 1X80B 2YIVX 3A11A 1LF0A 3E22B 4MVXA 1NX9A 3SICE 4E70A 2I6FA 3KDPA 2AZ4A 1QIFA 3M83A 1SWVA 3SC3A 3I3SR 4AK9A 1QGDA 5CBPA 3U60B 1I7PA 3ZWVA 3NV7A 1BE6A 4POAA 4L4ZA 4ZD6A 4GF5A 3PUZA 2ZB7A 2XGOA 4C3VA 2XYHA 1ND5A 4UTRA 5GAJA 3U7EB 1VL1A 2Q0HA 2YOHA 2W11A 4UCXA 3NVDA 2R8ZA 4J2OA 1P6XA 4KE7A 4PSCA 3BFVA 3N05A 5DHAA 5H5JA 3SIXA 7REQB 3K6RA 5K03A 3KYDB 1FLAA 1LC3A 3NANA 1PDOA 3MRTA 4GH5A 2SICE 4U9HS 2BKAA 4PPFA 1PVVA 3AU8A 3QPDA 1XJQA 4EPYA 4ENSA 1UKAA 3D6NB 4OK3A 1SN7A 4X00A 1RRGA 1E3EA 3TLYA 1Z4OA 1WUYA 2B4YA 3OT1B 3VR2A 1AM4D 3P2EA 2F6RA 2DT5A 4M0CA 1Z73A 3GLHE 3MD9A 1Q7GA 2H5JA 4H6VA 1CQZA 1OX4B 5G0UA 4QKQA 1RXVA 4BZXA 3GZNB 4W5HA 1DBWA 2YZNA 1LY1A 2VP9A 1E89A 2ETXA 1MJHA 3N28A 1Z68A 2WNIA 4L72A 5CNKA 5CT4A 4ZV7A 1EWRA 3V8NA 3SSOA 5JLJA 3T9BA 5AIAA 3AGQA 4AX8A 2O8EB 3A06A 4OJTA 1H65A 1G20E 4PZZA 4FSXA 1U9CA 4P82A 3TTYA 4DCUA 1P8AA 4DMLA 3UPUA 3VPFA 1U7ZA 2BVNA 3C97A 3DEFA 2XDAA 3QEJA 4Q3BA 3KVOA 1QFSA 4GQBA 1T9AA 4XA8A 3B9BA 1GL9B 4KH0A 2A1IA 3HDJA 3ENWA 1GPMA 5EHIA 2WQ7A 2V03A 3NAZA 1PGJA 2D2VA 4MCHA 7YASA 5FWXA 1ZOPA 3CLRC 1VB5A 2MINA 4XCVA 4DRXB 2GFIA 3H5RA 4EENA 4GKKB 2HI0A 2AC4A 3ZJUA 3S2IA 4BNTA 4AYWA 3HKDA 2E9SA 3QPUA 4I1VA 5CEJA 2E5LB 5JCZA 2YJ5A 3AP1A 4RJLA 2RC5A 3F1LA 2ZBFA 2P5SA 2JAWA 1C0EA 4AO6A 2V6MA 4KGDA 1WPGA 3JYNA 3FTCA 3QLEA 4C4SA 3FJYA 1GRCA 3U31A 1U2RA 4IFIA 3IVRA 3IIIA 2V96A 1ZEJA 4AJ4A 2VQEB 4PHFA 3OQNA 5F7XA 3T0GA 3BEOA 3NTRA 5HILA 4DA0A 2LDBA 3NBXX 1ML4A 1G1AA 2AK2A 2ESRA 5GZ1A 3I0ZA 3UT5B 5FEUA 2GWHA 4UFOA 1U0LA 1QQ5A 4UUNA 1TQ8A 4B85A 4WA8A 1X74A 3ENQA 1JFSA 1BXRA 2XGMA 3HA7A 1JV2B 1KEWA 2DBRA 3PFIA 4Z4FA 4ESHA 4WBNA 1PX2A 3UJ6A 4CQJA 4LE0A 3IDOA 4O4LA 3W5HA 3LBFA 2Q5HA 2FSFA 1JRLA 4JVNA 2J6IA 3ZHCA 4IX9A 1FTQA 3RTEA 2QBYB 2QVXX 1KMMA 1V1RB 1FP4A 1T3SA 2QJRA 3B3GA 5LJLA 2W98A 4YB8A 3SF8B 4ED9A 1FJGB 3CNEA 2C5LA 3CLUC 3OIFA 1RYDA 1ECBA 3RYTC 3W2TA 3QIAA 4W8OA 3RVJA 4R41A 1Y1QA 2C9MA 4DLPA 1DG3A 4ENUA 1V95A 1CY4A 2J3JA 4LF8B 2HQBA 2ZIFA 1POWA 3IPRA 3KAKA 4IKPA 3RO7A 2Z2ZA 1OE0A 2C42A 1HNNA 4EUNA 4D97A 1QHGA 1UT5A 2E89A 1U11A 2FY8A 1EB9A 5LLTA 2A4MA 1RW4A 4L8YA 4LXIA 5K09A 2FWMX 1NF8A 5IZCA 5GP1A 2NP6A 1W5SA 1UJCA 4DBLC 1ID8A 3EE6A 5JMOA 1FSGA 3R3HA 4QUBA 5IZ4A 3SR0A 3VHQA 1GNVA 1HF3A 3MINB 3ZGLA 1E3TA 2A7QA 3MTIA 3TI7A 2VDQB 3GWGA 2D5LA 4S3MA 4ND5A 4QPNA 1VPWA 1GTL1 1XROA 3DBLA 1OWNA 1E2JA 3HUFA 1FDSA 4P54A 4XXHA 1OYVA 3PGMA 2VWQA 2X7XA 4MS4B 1RXYA 5EE5B 4RXTA 1RQRA 5IVKA 2OAGA 1KNQA 1GQRA 3IP7A 1JPUA 4D81A 1YV9A 3NJRA 4P6VF 3ROKA 3LDUA 5FH9A 4K6HA 1NXTA 1GG2A 1IEVA 2YYSA 4M1YA 1E1LA 4DJ5X 2Y8EA 5BNZA 2I9PA 3Q5DA 4YJ2A 1G18A 2FP4B 3FJOA 2Z8XA 2FI1A 1FPMA 1GCGA 1K89A 2G9ZA 2JFZA 2X2FA 1L4HA 4IDBA 4TL6A 5AKIA 1AUQA 4F84A 3CT4A 1WTCA 4INZA 2OCYC 4KK3A 5BV0A 5C8DA 3TQIA 1GZSA 4OLBA 1CB7A 3C8MA 4NBKA 4TOIA 4U2CA 1WVIA 1RTTA 1MAUA 1VRCA 1SEPA 4MYRA 4BATA 5C4MA 3BZUA 5EUBA 1V4BA 1C9JA 1DKRA 2Q3CA 4UZEA 5EYPB 3Q8LA 1MW9X 1Z26A 2V7PA 4JH0A 3UMVA 1XD2B 1KZYC 1O3YA 1Q44A 4LJYA 4OYLA 3KO8A 3MTQA 3E3NA 1KOFA 7AT1A 2EW1A 3RUPA 4MAMA 3OFKA 4PICA 1GAWA 2HGSA 2W2LA 3V4LA 1BMDA 1YVRA 2PNFA 2QBYA 3C7AA 5KDOA 3JD2A 3B9RA 2IHJA 4K3VA 3S1AA 4G0VA 1Y3FE 4I9NA 4NZMA 3T7TA 1JA0A 1I7QB 4N6GA 1TAQA 4BNFA 3R6DA 1GYQA 1SXJD 2WJZB 2YFQA