4OV6B

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
294
structure length
281
Chain Sequence
SIPWNLERITPPSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 92
structure length 281
sequence length 294
chains with identical sequence E
ec nomenclature ec 3.4.21.-:
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4ov6B00
1PTKA 2W2MA 2SECE 5JXJA 4J94A 1BE6A 2HD4A 3DE1X 1TM1E 1ZVKA 5JMOA 1TM5E 1BFKA 3UNXA 4AKTA 2TECE 2PMWB 1SPBS 2G4VA 3DVQX 3DE5X 1BH6A 3DW3X 2XRMA 1MEEA 4OMDA 3VV2A 1OYVA 1SBHA 1Y4AE 4CG0A 1SBCA 3L1KA 4H6WA 3T41A 2ST1A 4RYDA 2WWTA 1KDVA 4CFYA 5JXHA 3SICE 1WSDA 3HJRA 3PRKE 4M1ZA 2DP4E 1SIBE 3DE3X 3PTLA 1OT5A 1CNMA 3LXUX 1GT91 2E1PA 1SIOA 3F49S 1Y1KE 1AF4A 1AQNA 1GCIA 4JP8A 1EA7A 1Y3BE 1SUDA 5AVKA 2W2PA 2Z58A 1KE1A 1ZVJA 3TECE 5FAXA 3GT3A 3EIFA 1Y34E 3WHIA 1Q5PA 2HPZA 1Y3CE 1T1IA 3DE6X 1S01A 4YN3A 2DUJA 3DVRX 1Y4DE 3WQBA 5SICE 1BFUA 1TM7E 1Y3DE 2B6NA 5JXGA 1GA6A 1PJ8A 1TO2E 1NDUA 1SN7A 1YJAA 3AJ8A 3TI9A 3DWEX 4GI3A 1JEAA 1SCAA 1Y33E 3D9QX 5AQEA 2QTWB 1SELA 1V5IA 1BE8A 4KG7A 1P7VA 1C3LA 3ZXYA 4OV6B 1WVMA 2SICE 1SUEA 4Z2AA 2IXTA 1THMA 3A3PA 4HX2A 1CSEE 4DJ5X 2Z2XA 1YJCA 3LPDA 4CFZA 1Y48E 4NMXB 2WV7A 2SBTA 1GTL1 1C9JA 3DVSX 4NE7A 1SUCA 5ARCA 1V6CA 1C9NA 4FONA 2W2QA 3H42B 1AH2A 2WUWE 3VYVA 1IC6A 3I37X 1SCNE 2PQ2A 1TECE 1SUBA 1R0RE 4OMCA 3CO0S 1HT3A 5CW1A 3CNQS 2PWBA 4AKSA 1GA1A 4WOCA 3ZXXA 2Z2ZA 3QMPA 4K8RB 3DE2X 4DZTA 2WUVA 2ZWPA 1DUIA 1AV7A 3LPAA 3DE7X 1C9MA 4C3UA 4H6XA 3DE4X 2IY9A 5AVJA 3P5BA 2Z57A 4LVOA 1SBIA 2V8BA 1S2NA 2Z30A 1P7WA 1KDYA 3SQOA 4H6VA 4NE9A 2ZWOA 3BGOS 4C3VA 2ID8A 3BPSA 3LPCA 4KB5A 3VTAA 4ZOQI 3GCWA 1YU6A 2GKOA 5B1DA 2ID4A 1R6VA 1T1EA 1ST3A 2PKCA 3TI7A 3A3NA 1TK2A 4BWGA 3GCXA 1SBNE 1GNVA 5ARBA 1GTJ1 2PYZA 1WMDA 3QTLA 3WIUA 1DBIA 2Z56A 5JXIA 5FFNA 1NLUA 2SNIE 3Q5GA 4KPGA 1SH7A 1GA4A 1TO1E 2W2OA 1PFGA 3EDYA 1KE2A 1SBTA 3GT4A 1R64A 1NDQA 2PWAA 1SVNA 1AK9A 2X8JB 4MZDA 3QFHA 1SIUA 1LW6E 1WMEA 2P4EA 4DWWA 3DE0X 3WIVA 1TM3E 4ZARA 1SUPA 3I30X 3EE6A 3VV3A 3DDZX 2Z2YA 3DYBA 1EGQA 3OSZA 1KDZA 5AMXA 1AU9A 2PRKA 3DW1X 3VHQA 1XF1A 4I0WB 1YJBA 1A2QA 1AVTA 4WOBA 1BJRE 2XTJA 1TM4E 1MPTA 1SUAA 1S02A 5FBZA 1GNSA 5ARDA 3D43A 1VSBA 2ZRQA 2W2NA 1UBNA 4B5LA 1OYOA 1GTG1 1SCDA 3F7OA 4HVLA 1PEKE 3AJ9A 1SCJA 1WMFA 1Y9ZA 5I9SA 3I2YX 5K7SA 2DQKA 2X8JA 1ST2A 3AFGA 3VSBA 1SCBA 3F7MA 3A3OA 3BX1A 1P8JA 1IAVA 5B1EA 1Y3FE 1TMGE 3I34X 1T1GA 3Q40A 4LVNA
chains in the Genus database with same CATH superfamily
1A76A 1SHLA 1H8HD 5F51A 1EP1B 1T9GS 2G9ZA 5KYYB 1WZIA 1H4QA 3TDMA 4YRAA 4EYEA 3K8YA 3QTBA 2I4IA 2QTZA 2RKWA 4FHEA 3U1VA 4IY1A 4WT7A 3W9SA 1EIWA 4RPHA 1OXKB 3RS5A 1F0PA 1OC2A 4W1QA 4ZREA 2PT9A 1BMQA 2J3KA 1XD8A 4DNQA 4DTCA 3UWSA 2J3LA 3DMYA 3QLVA 5I5EA 4URZR 3TZLA 1AKQA 1GWNA 3NKFA 4CCAA 1LBEA 2X14A 4IHJF 1E0JA 1Z0ZA 4Y6GB 4KK4A 1SPBS 1KOLA 3TLYA 1ZJJA 1MABA 3N2GB 1JDSA 1KEWA 3OEED 5H8WA 1UK6A 4X1IA 3V2UA 7ADHA 5FQOA 4BC0A 2P9BA 2VPYA 5DM0A 1QRDA 4CR8A 2BFCB 2LIPA 3K09A 1EUQA 2O19A 5IXYA 4J1NA 3CGWA 1U11A 1P1KA 4B79A 2YVLA 2RHJA 2VDQB 5DOVA 3C14C 5G2OA 4BMYA 1JTVA 3IP3A 5ED0A 1TQ6A 5TGDA 4AWAA 1ZGZA 4HBZA 2QP4A 3DOFA 4EZBA 3IELA 2AC2A 4XTRA 3AUKA 3PYLA 4TT3D 4C5CA 2HX1A 1EM8B 4F71A 1EX9A 1M7GA 1D8AA 2O23A 3PFBA 1U31A 5T3YA 4MVJI 3CEMA 1G3QA 2I3BA 3H0EA 2ILTA 4JUBA 5BR8B 2IH5A 3U7QB 2FW1A 3H9CA 1DKLA 2L17A 4BPRA 5TT1A 2GAAA 1O7JA 4MUJA 4EX7A 5LP6A 2WWTA 3G85A 2NU6A 1XLVA 2ENUA 5K2OA 1KAQA 2IHVA 1JKIA 4FZVA 3B36A 4YRFA 5EOVA 1G59A 5E6SB 3BWYA 4E4YA 2QVCA 3IAXA 1GUAA 4O8CA 5EL0A 2DQZA 4LDNA 3DBHB 2VNHA 4I4TF 1Y3HA 4LHXA 4FHFA 4K6OA 5JSFA 3A36A 3PUWA 1BEZA 3KU1A 1K6MA 4OBBA 4V0LA 4X0EA 3V3KA 1Z36A 3G0DA 1PJTA 1Q6ZA 1JHMA 4KODA 4NOMA 3U62A 3ZWYA 5K4GA 4WHMA 5JNUA 5K0CA 3QMWA 2FW8A 4KKXB 1IXKA 1V71A 1OTHA 4CLOB 1U3CA 4P4LA 3GGCA 1GKKA 2JLRA 4CU2A 1YQEA 1JFVA 4WZAE 2FNAA 2ZWIA 3RS2A 2D3WA 2R11A 4MJ7A 4RA9A 1Y4UA 2OQVA 3LQYA 3WWDA 2R2AA 3FNBA 1ECGA 2KI5A 1ZM4A 4ZO7A 1FUUA 2N47A 3MUNA 4QSHA 4BKOA 5ALOA 4EIWA 5LD2B 1BD3A 5SYNA 3FZGA 4M8IA 3VO8A 4YRCA 4IL5A 2F8SA 2GERA 5GJBA 4YJKA 2PS9A 5KNCH 2BDUA 1JEOA 2X19A 3GJSA 4JVSB 2ALJA 2W2PA 4R9UC 5A2QA 4US0R 2BFBA 3QV2A 4IH4A 4U3JA 1II8B 2ZR7A 2VRBA 4IF6A 5G3YA 2IP1A 4PY2A 1OA0A 1KIAA 4REQB 1JIXA 1DADA 3GEBA 5CYOA 3SS7X 3K9HA 2JCYA 4O3FA 4H7EA 2QX4A 1GL6A 3DNMA 4AZ0B 3TRDA 3G1WA 4ZPJA 1N3IA 2O5RA 5H5JA 4AJOA 3DF9A 4JYBA 2DUJA 3B9RA 1Z2CA 1WB6A 4HB2A 4MVJD 5E9QA 4LJ8A 5HEKA 5TQ2A 3SSOA 1L3BA 1VXOA 1USUA 3E7DA 4RAQA 5LZ5A 2DEUA 3IESA 1PGOA 2WFLB 3HCBA 5EXSA 2P4QA 4I9NA 3PZRA 1RWOA 5SICE 5LDDC 1E59A 2VZLA 1AD2A 3L06A 2W5UA 3ZU2A 5HF6A 1N75A 1TM7E 1REQB 3SYNA 2XIQA 1XO1A 4QGGA 3QEAZ 3SQXA 2FR1A 5GM1A 5JEEA 2B0CA 1MX3A 3GPBA 3RU3A 1U28C 1V11A 2F4NA 4KIFA 1USVA 3NTOA 2IA5A 3JQFA 2VJOA 3DCIA 3Q3IA 1UMCB 2EHJA 1W36D 1MA0A 2ZLBA 3EH1A 2IHNA 1MEJA 3U4IA 4CT5A 2QF7A 3ZTWA 4AU1A 3RIEA 5CA0B 3UBTA 5AW0A 4L9SA 3GRAA 3KSZO 1NW8A 4MQMA 1EEXB 3GUUA 1L7VC 3O3MB 3WLFA 3BF8A 1M2VA 2ZIAA 4J43A 5JCZA 4FHZA 3IB6A 2XUQA 3O8NA 4YQEA 1Z5OA 3FZNA 1U3WA 1L5KA 4XPIA 4EGQA 1E79D 4POOA 4ZHQB 5BSGA 5SZJA 4ECEA 2Z6AA 1GV1A 3NTRA 4HDRB 4XASA 3M83A 1KDPA 2Z9CA 2JLZA 1NR1A 3WL4A 3JQ9A 1YOVA 3FWPA 3QVTA 2Y1XA 4ND1A 5ENZA 3MMNA 2NT4A 2I03A 3QPAA 3OEHD 4YJ3A 1GRCA 3DOUA 3P20A 4XARA 3ZHRA 5IZCA 4OQLA 4EI7A 5JIBA 2FMHA 1U63A 1HYGA 2C9BA 2CFOA 3A3PA 4L95C 2H2FA 2R2GA 4XD7A 2IYFA 4Y1RA 4ZDIA 2Z2XA 2ZYRA 3AZQA 4ANFA 3IPLA 5AVVA 5I7FA 1Z4LA 1DELA 3DVLA 2QD1A 3K31A 3LFTA 1XI2A 4NSNA 3S29A 1GGKA 4C22A 4RY9A 2VI5A 1E6LA 1N5KA 3AP1A 3C1AA 4XE5A 1B26A 3I9LA 1NQAO 4MITA 4OHPA 1ISGA 5EQTA 3S55A 2PZMA 5CD9A 3WZMA 1QGDA 2PU7A 3W5DA 2VXBA 3T5AA 1QRUA 4UTVA 3LSTA 3BSYA 4DNXA 1J2YA 1PNTA 1AXEA 3JWEA 3RSLA 1P39A 4HB3A 1RAHA 1TC2A 2V1XA 5AW6A 1R8QA 5C8VA 3HBJA 3W1VA 1C9NA 3WTCA 5WRFA 2I4OA 1K6EA 2D0PB 5IDWA 1Q92A 3GAZA 4YUYA 4R9RA 2UYHA 4ESVA 2BOVA 5KYTA 2OHHA 3MT8A 3W4KA 2L42A 4JVLA 2Y1GA 3GGPA 2IHJA 1N7HA 2A9OA 2IYTA 4F06A 4YCNA 3DMHA 4XWKA 3ZDXB 1TIKA 3AH8A 3ANNA 2OMKA 2HJGA 3GWGA 4U1RA 1KYVA 3I83A 3NWBA 2EZ9A 1BX3A 4D0RA 1N6KA 4MWOA 4ZDJA 4G0VA 1Z6XA 4I46A 2OB2A 5F1OA 4O02B 3KB2A 4PC6A 2PO7A 4BUJA 3K6SB 4S05A 1QH8B 4HX9A 3IUYA 4FEYA 4QIHA 2H7YA 3WIDA 1W1IA 4AN4A 1E20A 1ZVQA 1I2MA 3AI1A 1S8OA 1Z56C 3CNQS 4MTCA 1JMYA 1LVGA 1E6UA 4C7KA 3EZXA 1QUFA 2M2IA 4JJGA 1KOFA 4QDKA 3A6LA 1SG9A 5ALIA 2QVBA 1RCFA 1L7EA 3WRYA 4U2DA 3L8CA 3HK2A 3D4NA 3VH1A 3LMKA 3I3OA 2X9QA 3IDFA 3SCZA 1RD4A 1X86B 5T8KA 2O1XA 2VWPA 3TXYA 1MGPA 3KJEA 4QBIA 3IMGA 5FOVA 1USIA 5TVKA 3ZXXA 4OCZA 4DJEC 5A02A 1EVJA 3B3JA 3WNVA 1FC0A 1XMOB 3PUVA 5FI3A 1ODTC 1BD4A 2HMSA 3N2KB 2VT6A 4LXTA 2FN3A 2CD9A 1PIWA 2J07A 2OCKA 3LBAA 4MULA 4PHTA 4MRAA 4PXAA 3OPYB 1EVZA 1GZUA 2VJMB 4HNHA 2EQ5A 1ZIOA 4XUCA 3WVNA 4LRSB 3HI6A 4PAMA 2CHFA 4WESB 4ACBA 2JKZA 2A7QA 1M2KA 1ZUHA 1Z5ZA 2Q4DA 3U6BA 3DL4A 2G70A 1P1FA 1UKAA 3EXG1 2HQOA 2HWWA 5J9FA 1E9SA 1C9MA 1HORA 3G7NA 4HNSA 4H6XA 4MV4A 2Y67A 2WC1A 4AX8A 1FQWA 2II6A 1I7QB 5AK3A 5C5IA 1ZJ4A 3MJ4A 2BHLA 3BIWA 1QLHA 4ZI5A 1EFTA 3I5MA 1X7ZA 4JNCA 1UMBB 3P5BA 2RAVA 4G1EB 3K1ZA 4JJFA 1SBIA 4L28A 4XWGA 5AJZA 3P9KA 3TWOA 2F55A 2Y1CA 2H48A 5FPHA 4EJ0A 3N7TA 1AKVA 2INGX 1W0KA 2COEA 1TF7A 2QY6A 4AO6A 2IP4A 1TUIA 2PFSA 4QXPA 1GG2A 2PNJA 4C14A 3DBOB 4LF7B 5GPBA 3G9ZA 5JUWA 5KOHA 4B7ZA 4Y2SA 3KKMA 1Z0AA 1H2BA 5ESDA 1YZNA 3UKJA 3SEFA 3FOEC 3GN1A 4PWZA 2LPMA 5DCUA 1KDYA 5I7EA 2Q5OA 4YYEA 4OFWA 1FPQA 3VHXB 3WLRA 4TVBA 4OXYA 1A71A 4A8TA 4YRLA 3D64A 2HF7A 5EP1A 4FYJA 2D0IA 4MV1A 3GNLA 1RQNA 3R9KA 4CMIB 1U0RA 3VR5H 1CUVA 2X8BA 4QU9A 3SDBA 4I50F 4QBHA 1RAAA 4J29A 1PRYA 4XB1A 3CUWA 3F7TA 2JF0A 4GI5A 1JQJC 3CRQA 5KYXB 4M4SA 1R6VA 2O8BB 1BXGB 3C6BA 3L7IA 4M1WA 4I7EA 1VPWA 3PI6A 3W04A 4H1UA 1E99A 4MYCA 4EHFA 3WKCA 2I2DA 1AK1A 1DBSA 1IIRA 2XHZA 4M8KA 3T0IA 3TI7A 7REQB 2VHQA 4J6FA 1MOPA 4DMGA 5MF6A 2X4GA 4HB0A 4HZIA 5LM3A 4QAJA 3U9SA 3FDFA 2VDPB 3UUWA 1ESNA 4HTFB 1VHWA 1LPBB 4ESOA 2Z4TA 4CIAA 3AUTA 1Z6YA 3CVYA 1YSCA 2EARA 1W93A 4AG3A 4J1QA 4HAUA 1Q15A 1RJ9B 1ZAYA 4RMGA 5A2GA 2B1JA 3LWZA 5TR9A 3VR6A 2ORWA 2R1UA 2CVFA 3OMXA 1XXLA 1QIEA 2WMDA 4Q4HA 3C3JA 2IPLA 4QL3A 1ISIA 1Z15A 2CL5A 3Q5GA 2GAJA 2RBKA 4OAQA 3MTGA 4RHUA 2CXTA 4MQEA 3GUCA 5C80A 2WQ7A 1SXPA 3UN1A 1XCJA 1IZ8A 3LC1O 3CRZA 3UY4A 1V45E 2GZ2A 2FTKE 2C84A 1NV9A 4KAXA 2CFCA 2E4UA 2FEWB 3E6AA 4QGBA 3RANA 5HJ5A 1JTEA 1YTLA 1C1YA 3O8DA 4PRKA 4M37A 2FJPA 2FWJA 1JT2A 1F6BA 3IEKA 3IRUA 4HNAB 4PLVA 4RENA 3EMVA 4RULA 3FM9A 3IBFA 3OLVA 4EJ2A 3FFXA 2PX3A 3DBRB 3IMFA 2E48A 2ZJFA 5JDIA 1RYEA 3ZN2A 2BGIA 1ZOPA 2LDXA 3RAEC 4IUBS 1P6UA 1JZTA 1UOPA 4L07A 4PINA 3GZNB 1EBBA 1Q1BA 4XKJA 1WS6A 1Z3IX 2VF2A 4RY8A 4O4JF 4XGIA 2JGDB 1HURA 3QWFA 3UMSA 1XPUA 3N2EA 1D2GA 3HJUA 2B69A 1RMTA 1TAHA 2QTBA 3TNFA 1GPWB 2JGNA 3AO0B 1N2HA 3DDZX 3CISA 1YA4A 4FCVA 4LXGA 4Z86A 4L6AA 8GPBA 4DLTA 3A6FA 3RYTC 1HL3A 4P6VF 3Q9NA 4FMCB 1J1ZA 1ISFA 4NCXA 5EVJA 2G5CA 2WD7A 4IR7A 4PLGA 1Z6PA 4XJTA 4I6EA 4KGZA 3PC3A 4RMNA 4JYZA 2EYQA 4J49A 4CEIA 3KP1A 1N92A 2EJWA 2CJYA 1LJ8A 3DUFA 2ETXA 4DLSA 1YJBA 3HYNA 4E21A 3ADBA 1AVTA 2DWQA 4WOBA 3TXAA 4ER6A 3QI2A 4A91A 2PV0A 1OC4A 4CJXA 2Q9BA 2H5JA 2GZRA 3C3BA 3DZCA 3K8OE 1CY6A 1TZJA 2FVYA 3T3NA 3K1AA 5JV5A 3R8FA 2AWNA 4XYGA 3A05A 2YIJA 4Q7KA 3U5ZB 4PN7A 1CY4A 3UPTA 1I33A 2ZKLA 1WSAA 3A0UA 3V1LA 3B1ZA 3OUZA 3PDIB 4IXNA 5ARDA 4BV8A 4PX5A 4R71A 2H5IA 3GOHA 3I4FA 3OAAA 3FX2A 3I8XA 1KNXA 3WYAA 4COKA 1H8HA 2JIQA 4XIJA 1P5ZB 2ZI3A 4MW4A 5AVTA 3L7BA 2MYPA 1DC8A 4KL8S 3W3AD 1IEWA 4RZUA 1QHHA 3D3WA 4A2CA 3T1YB 3ZNPA 2C77A 1DPFA 3BXHA 4LCBA 2AOTB 4BLPA 5ER6A 4LJAA 4JYAB 4E7PA 2OOSA 3UOGA 3HR7A 2PNFA 1E9VA 4WZAA 3CNEA 1MIHA 2GWRA 1BVHA 2R4QA 3ABZA 2B2CA 1AKEA 2CBZA 4HYEA 4NP6A 4Y6SA 4X1OA 3SOZA 1JT9A 1K2WA 2IYRA 1XDWA 3L05A 2C2ZA 2UVPA 3IOEA 4HOYA 3TW8A 1RWXA 3GLQA 1K88A 3PXGA 3B9BA 4MUXA 2NU6B 1GQYA 3H6HA 2XA9A 1I4EB 3MQ2A 5BRNA 1WEKA 3NM4A 3NYQA 3JYNA 4OTZA 1BRMA 3ZYZA 1J9EA 4J1TA 2B35A 3AOGA 3BA1A 1DZ3A 1KJ9A 1ZYUA 2V7XA 1F2TA 3IDAA 5JH7F 5EHXA 4QDXA 3P32A 3K9WA 1E3LA 5JDCC 3OEYA 3THXB 1JFFB 3KZVA 1Z25A 1X94A 3MHPA 4Q9KA 1HMPA 4UZSA 4ZVSA 3MB5A 4R7TA 2BFFB 1HEIA 2OFFA 5TQ0B 1L4NA 3GK3A 2IPNA 4FLFA 4WFIA 3H2KA 3GRYA 3EXG2 3MPOA 3KPUA 2R8YA 1U8AA 3CH4B 4XRRA 4YP1A 3VNSA 3GEHA 3DONA 5KPJA 2Z3VA 4RA9B 3RJTA 4PGGA 1AS3A 3VR4H 1W0JD 3CW2A 3PR2B 4EEKA 2Y4NA 3CY6A 2FRXA 3IERA 3NM5A 1SC6A 4O2BB 5JMPA 4HVAA 5I47A 1AUOA 5FULA 1S3SA 3F2VA 1HT1E 3DVQX 2OCDA 3IJPA 2EFYA 1UC8A 1KL7A 1YO6A 1L4BA 2NUAA 4IUCS 2QENA 3K0KA 3E15A 1GN8A 3BL5A 3JV7A 4RGBA 3ZGNA 3CT4A 2ZCJA 1JIUA 1B41A 2BFBB 3BGSA 4FSDA 5GWXA 2VVTA 4DWVA 1MW8X 1NNSA 3OZUA 3KR9A 1E5TA 2R66A 1G0OA 4BTLA 2BM0A 3W8DA 2HIGA 4KWCA 4LQLA 5E2BA 4LG1A 3ZE0B 4CL2A 1WZEA 4XUDA 1EEHA 3S1AA 4XSHA 2VP4A 4CMEA 1VJCA 4N65A 3TQCA 5JFOA 2D8MA 4GLLA 3TQIA 1E3SA 5K6TA 1Z4IA 4F4JA 1XL0A 1AZSC 1UK7A 4JHXA 1Q16A 5FTJA 1JBQA 1T24A 3H84A 1XZKA 2F2TA 3MRTA 1UPAA 4GWKA 2YINC 3TRFA 3GOQA 1KEKA 3OX4A 1DHRA 2ST1A 1NQVA 1YD7A 3W8RA 4ERXA 1WWKA 2HKIA 2COKA 1S3GA 1FTYA 2DCUA 2XB9A 2MMGA 5TGZA 2CHVA 1GL7A 3ET4A 1HETA 3IDSA 4L8GA 5KTPA 2C7PA 4LRXA 1DFGA 1H05A 4PHCA 4BOYA 1NX9A 3L0DA 3KR0A 3RAPR 5DU2A 4DG9A 1GLVA 2JFOA 2VH1A 1ZIDA 2ERCA 2R5FA 4G1VA 2EYUA 3DXZA 3ZE6A 1LFAA 3BF7A 2BI7A 4LYEA 2H0RA 3E1KA 2HMYB 1S5PA 2HZ7A 4REMA 5JG7A 2GBLA 3KSRA 3TQQA 4F9TA 2AV6A 1UFVA 1VGVA 1MOZA 3PHGA 4LYHA 3BRQA 4HHEA 5EJGA 2PUJA 1FFCA 1U6JA 4MVJA 3V4FA 2YV1A 1MCZA 1A4RA 2Q0SA 4BO8A 3IVCA 4DCUA 1K7XB 3E35A 1T5OA 3EIUA 2V1UA 2IZ6A 2XF8A 4GYJA 5AI9A 3ZCXA 2XYVA 3REQB 1E4EB 1N1DA 5D51S 1SUSA 2XEXA 2ISQA 3EVAA 1CY8A 2X2FA 1WUHS 3K94A 4JLPA 2ECOA 4M1YA 2Y9MB 4OYLA 4DBVO 4DMRA 2B4YA 2R751 4JP8A 2Q1YA 4XLLA 5IKOA 3D8TA 3G9TA 4W9RA 3SN6A 5E8RA 5GINE 1B6SA 2R65A 3OY2A 3Q6MA 3W2EA 1JHVA 3AF4A 1DIOB 2ZB4A 1VBMA 3NU1A 4FNMA 1B0ZA 4KTTE 4TPKA 5DWVA 3ZCSA 2YJZA 3ZGXA 3U4QB 2XWJI 4J3JA 2J08A 2IUTA 2VATA 1DIRA 3UJAA 3UJCA 2R5NA 4HB4A 2DSTA 1HG0A 4E0BA 1YONA 3ODGA 4YRRA 2JLAA 2AVNA 5IVKA 4IEFB 1E79A 1DI0A 4UAJA 1ZHHA 4OK3A 3DVRX 3ROPA 3K4HA 1OH6A 2QRHA 3WQBA 1PJCA 1QTNA 2FW9A 3R3XA 2XMQA 4CM6A 4LXHA 3W5JA 1F0KA 2XXJA 4F85A 2JW5A 1MMFB 5JPDA 1T3LA 5DBFA 2HM7A 3GLTA 2C92A 3DKVA 5K2MA 4BLUA 3QXCA 2FWBA 4YP9A 3QSGA 2E4ZA 3QF4A 1VPVA 1PR0A 4HAZA 2HL6A 5CT9A 2X7XA 1PJ8A 3KZCA 3R5TA 1PSZA 4IQ4A 5CLLA 1N3BA 3QYAA 5H1YA 2C7OA 1NX6A 3DHYA 3JQ6A 3LKZA 1J33A 2C07A 1Q1AA 3CPJB 1EVKA 2DFNA 3F47A 4HVTA 4U9UA 2QXTA 3KB8A 1GDHA 3O8QB 1G60A 3UA3A 3X1ZA 1GZDA 3CF0A 4ZI7B 3VOBA 2BBWA 3A3YA 4G8CA 3X44A 1P7PA 1P74A 2VA9A 2ZSIA 5CA0F 5C8XA 5ULLA 3VA7A 2QE6A 1BMFD 3FKQA 1C1XB 2VHYA 5BWNA 1FSGA 1JSZA 5FYDA 4R5HA 4RD4A 4B33A 3Q8MA 4EYGA 4GG1A 4MPPA 5JOQA 1WVMA 2BJWA 1E58A 1NTRA 1UBRS 2IKQA 2GPNA 3ISTA 4M8SA 3VTKA 1QPZA 2G5GX 3CTPA 2CBXA 4X60A 4ZQCB 4ZYUA 5AD1A 1EWQA 4JLKA 3L8HA 3H7IA 1HE8B 3QU4A 2IYUA 4DJ5X 4PCAA 4PS0A 4ZYLA 1G5PA 1R6BX 5BR7A 3FDJA 4D0LB 4F2GA 3RC9A 1HV8A 3T9AA 4B2LA 1V5WA 1X80B 3Q3HA 2IX9A 2ZB3A 4BX3A 1MHPA 5DHTA 3O4IA 2B5WA 3NBZC 1MUUA 3AYZB 4LX0A 3HRKA 1TQ2A 2YQ5A 3T7EA 4K8OA 2WWYA 3BRSA 2Y99A 4C43A 2YV4A 1Y6QA 1GTL1 2IUYA 4X54A 3V4SA 1Q0LA 2AZDA 1JAZA 3INTA 3FPAA 2OXEA 3TMAA 3U4GA 1OU0A 2OK7A 3U7RA 3AONB 4GC5A 4B35A 3DR3A 4I9UA 3ZKWA 3F5FA 1A9OA 1X7ZB 5FF9A 4G1BA 3IGFA 3EYAA 1AH2A 5ICEA 3RRXA 4PG6A 4KPUA 3NP7A 3FR7A 1SCUB 3GRZA 3FLAA 3Q2IA 3T3IA 3HG7A 3OPXA 5BV1A 1AX9A 1U0OC 4KDRA 4BY9E 1U2GC 1CUEA 2CNNA 5EUBA 4EAAA 2A5DA 2BH9A 1C41A 1U8YA 2SHKA 3CO0S 2PKYX 3H9GA 2RHOA 4N6GA 1SKYE 2X9GA 1P73A 1Y5IA 3D2BA 3S2ZA 2H17A 2HADA 4R6XA 1CUAA 2KHZA 1O9HA 4DLZA 3BAFA 4RVUA 3E3OA 4ARUA 2L69A 3GB9A 3GMDA 4R2HA 1MAUA 4LYYA 4BKPA 4Y9TA 1NN5A 3N6VA 2QMUA 1VI5A 4ZC1A 1KSHA 5H70A 1QH9A 1U90A 2PLRA 3DJFA 3LQRA 2EW8A 4AY2A 2FUCA 1E0SA 4OBWA 3HJCA 1YZUA 4TX1A 3BB1A 3GJ4A 1UT5A 2OE2A 3A04A 3S6JA 4C6SA 3D5TA 3EGOA 2X0IA 4DBLC 1ZW1A 3HXLA 3WBKA 3DHVA 3I4LA 2JK0A 5LQMA 4MR7B 3W2FA 3KPYA 3DHWC 5ALLA 2MCFA 3O3NB 1TEHA 2ETVA 1SD1A 5IKPA 2J59A 1AKRA 5JBIA 3BYZA 1QDUA 2YIVX 1VA4A 3URKA 3E9DA 3MTDA 4ODIA 1BU8A 3R76A 3UKOA 1WP9A 1A8IA 1MD9A 2WZDA 1KK1A 3NRJA 3I1IA 2GHTA 5DHFA 2JJ2D 3WGKA 3NRCA 1WVIA 1FYVA 4INAA 3FRIA 3QHQA 3L6UA 3JX9A 4RETA 3UMMA 4DAOA 3VOSA 1U1IA 3DO6A 1LZKA 4Q4HB 1WU7A 4MRMA 3MJHA 4OATA 3FBGA 4QHTA 4ED9A 3C7CB 4MQEB 2FQWA 3F3YA 4RFLA 3A31A 3H1TA 4CIVA 3KZXA 4OOEA 2EFEB 5AVYA 1US8B 2ZSJA 4DM3A 5JYBA 2VPQA 4IGEA 2GPBA 2FU5C 5AI0A 5AK4A 4QULA 5E4FA 4Q9NA 1QIDA 3SKVA 1IUKA 4WKPA 1U7XA 3E7PA 1GUFA 1ZM9A 3KKKA 1KEZA 4G01B 3UG6A 4KO2S 5I7OA 3DDOA 2JFNA 3FKSD 4UD2A 4IIHA 2XTZA 4H18A 3KD3A 5HUHA 5DV9A 4YAEA 2QL5A 3B52X 4YHHB 5EMMA 2G8LA 3F8TA 3OOEA 1JDZA 2DH6A 2GNAA 3OQNA 1X92A 2D0OB 4H6VA 3QENA 4DV4B 1A3CA 4DV3B 5ALEA 1MT3A 5HWSA 3ILXA 2XUOA 4F9GA 4K05A 4FGSA 4L72A 3AEQB 1ONOA 2DF8A 4G4SP 4Q34A 1FRZA 3R5JA 3LPCA 5KBYA 1HKUA 2NN3C 1CS0A 2G4LA 2OY0A 2PFGA 2ZVQX 1K5DA 3CZ4A 3F3KA 1YRYE 4OFXA 4RD1A 3OMLA 3SJCA 5CVUA 1SFRA 4HI0E 3PRHA 4RH1A 1PJSA 3G2JA 5BSRA 4F1KA 3WMRA 1UBJS 1YU6A 2XDAA 1AGYA 2NSDA 2YXLA 3OQPA 4H4EA 4ME6A 3ESRA 3CR7A 4I8XA 4MRNA 4JI5B 1X7GA 4Y2JA 4B4DA 3A4IA 4OGGA 4JDPA 1XZLA 3PEVA 1XZQA 1MAHA 2BHRA 1XZGA 1N0WA 3KT8A 3OICA 5KNDD 3GRKA 4ZVPA 3ZV6A 2Q2OA 5LYJA 2MDTA 3KTFA 2F4VB 4RYLA 2JJQA 4ZT3A 3EZ2A 1VHDA 1Y6GA 1KO4A 1NXPA 1IN7A 4LDJA 2YBEA 3CNOA 4MKHA 1DKNA 3FHJA 3WYGA 2WIDA 4HG2A 2H85A 3C8UA 4XI9A 3SE0A 3VR3A 4LE2A 4CBVA 4EHIA 4KR7A 3R20A 3QE2A 3SR0A 5GONA 3WIUA 4J07A 3SKXA 4C78A 4OK6A 2BGUA 4K26A 1J2JA 3BD7A 4JBGA 1G41A 3NFRA 3DGFC 1EFRD 1NG9A 1EZ4A 4HFNA 2J5BA 3QJGA 4B4OA 2QX7A 3MT7A 1Z5VA 3TDKA 3ITEA 1GNLA 4MAMA 2PL1A 3K9NA 5DMXA 1BOFA 1WQ3A 2AFVA 1QLJA 1SBTA 3DT6A 2P68A 3M6IA 3LX5A 1DC3A 3QUAA 1QVAA 1NY5A 4FC7A 2BGLA 1G5TA 4UJ3A 4WY5A 5EKDA 1OH7A 1GCOA 4DCSA 3OFVA 7AT1A 4NMHA 4WLFA 4LVCA 3L0BA 3IS3A 1NDQA 2AI2A 2EATA 2EGHA 4MS3A 4ER3A 2B1RA 3EXEA 4HDNB 4KR0A 3WGJA 2HJVA 5AVUA 3QQPA 2PGJA 3EJ6A 4L51A 2VPIA 1YVUA 2UVPB 3VAZA 4BNJA 2VJNA 3IPYA 4F04A 3HL4A 3UXYA 4RELA 3MQFA 5DI3B 1XCGB 5ITSA 4EJSA 1EX7A 1JYEA 1T5DX 5LLSA 5DTQA 3T1NA 3AF2A 3GBPA 5HSGA 2HTFA 4HMOA 2YWGA 3ESAA 3W4JA 4NYIQ 1J0AA 4JIGA 1G18A 4P2BA 1MC8A 3SP1A 2PJRA 1F2TB 3TCKA 2Y92A 4CNQA 4OLFA 3QXSA 4JLUA 1KDZA 2FKNA 2Z83A 3H3JA 4D4LA 2XQFA 1RRMA 2G80A 3NX4A 5IAAA 4U7PB 2EHDA 1KORA 4ZOLB 1V43A 2NVWA 4LZWA 4PZ0A 3HDTA 5AOCA 3WHPA 1KU6A 3FGNA 2I3DA 2J46A 1IU9A 1XCOA 5LUBA 2OQRA 4FMCF 4LOKA 4PANA 4CN8A 2FA9A 4GX5A 5DK4A 2HU2A 3JZMA 2X5JO 3JAWB 4HFMA 3T4UA 2NV6A 1SNYA 3OKCA 1PZNA 3IPAA 1RP1A 3EA5A 3RBAA 4QPZA 3ZGYA 2A33A 4WSOA 3DT9A 3EF3A 1RRPA 1QUEA 4OQYA 1NU8A 2AOWA 3FLMA 1Z45A 4S35A 1DAIA 2HLDD 2I78A 3CN7A 3HU2A 3NCTA 4EKYA 4GL4A 1H9CA 3KWLA 2QZZA 2ZE6A 1DXYA 3OLYA 1VPEA 2H2WA 5FBZA 2IF2A 1AO0A 2DUUA 5KNLA 5B58T 4Y0NA 4C9BA 1ECLA 2OHIA 4NECA 3CUYA 1KI3A 4G5FA 4J7XA 2A88A 4TMXA 2W2NA 5AJUA 3Q8KA 3RFVA 3V4RA 3EQ8A 3GEPA 1CUYA 1HXHA 2FPOA 4EUEA 1KFCB 1A4UA 1FS6A 3D6TB 5SY6A 4PAQA 1QGAA 1YUBA 2PS0A 2LRHA 2VHZA 5JO9A 2I2WA 3R9IA 2R4TA 3WGTA 2X2OA 4MDYA 3V1YA 4DYVA 2FDCA 4ALLA 1BKDR 1RYDA 4BP1A 2VHVA 3HO6A 1K9SA 3TM5A 1E3JA 1X1RA 1SCJA 1W0JA 4OQPA 4RPIA 4DCPA 1CG6A 3D7SA 1WW3A 2JIPA 4WKGA 2JLWA 2BKLA 2X8JA 4I5GA 1A8SA 2Q9UA 1TMKA 3JQEA 3SEQA 2FETA 2V0GA 3AU8A 3PUHA 1FSFA 4JY7A 5CX4A 5I8WA 1XV5A 1MX1A 2GWHA 4EABA 2W2TA 3IUEA 1T5LA 3O2NA 4DDKA 3S44A 1YBHA 4GIBA 1IK6A 1VKJA 4LC9A 1EIZA 1R9GA 1PJQA 4DIOA 3H11B 2IYPA 1QIKA 3PWKA 3Q7QA 5F2NA 2H1VA 1H6DA 3D3NA 4FCTA 4R3NA 2XT0A 1T8TA 2C9DA 1J5PA 1P4RA 1SR8A 2GN1A 3DDNA 2OCIA 4Q48A 3ZV4A 3GNTA 3NGMA 2PYIA 1ZPDA 1DBVO 2Q4BA 1T43A 3G9XA 3G88A 1NJ5A 1G3RA 4JOSA 1X8XA 5HM6A 5LL6P 4WKNA 1NXSA 4BV3A 5L95A 4MIEA 1YHYA 3CSDA 1J6UA 3N28A 3DYIA 3M49A 2CXQA 3DE1X 3HMKA 1ZVKA 5J4VA 4JQCA 3SVLA 4YV1A 3R6DA 4GRIA 2HT1A 1R6DA 1OXMA 2BHTA 2TECE 3DT8A 1JWBB 3HP1A 2ZBRA 1WCIA 5T4HA 2PMWB 3I05A 4KN9S 1FMLA 1FRFS 3NQ41 4FKMA 3IHLA 2XJ4A 2NTEA 2I34A 2ZBGA 1ZOSA 1L4LA 4YASA 2A1TR 3A37A 4RHCA 1PDVA 2B94A 4MMZB 5A06A 2I7VA 3W5CA 1YJ8A 4ACAA 1BH6A 1HUQA 1SAYA 4O2BF 4ZO9A 1DWUA 1JJ7A 2Q3MA 3DV0A 1O89A 2DKOA 3M6FA 3LI2A 1KYWA 4PGAA 4A5OA 4PLFA 1IHUA 3HDQA 1EGHA 5F2EA 6CHYA 1VGRA 3AUUA 3NWPA 1YB2A 3WS7A 2A78A 1LEHA 3MFYA 5G1NA 1FA9A 1JR2A 2JGRA 2P62A 2BONA 3LK6A 4HAVA 4S1VA 4EAQA 5IH7A 1LPPA 4R2JA 3I5UA 4B48A 4PSDA 2ZJ5A 4OJYA 4RIFA 4U7TB 1M1NB 5HQ3B 2VAXA 1EESA 4FWIB 3GJZA 1M34B 3ZGVA 1VG0B 2IJGX 1Q0ZA 5AM5A 3LC7O 3VVMA 4O08A 1ICEA 5BSHA 3VPDA 2WMYA 3SFZA 4ENWA 3ZWPA 4RTJA 3N0XA 1OV4A 1XTZA 3LUPA 4H6WA 4PSUA 2P9EA 4Y6QA 2WPDA 3LUCA 3HLYA 1TRHA 4HX5A 2MJLA 4D7AA 1SQ5A 5KEIA 1JHRA 4Y9DA 4CFYA 3QF4B 3HUDA 3ISJA 4K2HA 3AYXB 2GJAA 4LOIA 4P33A 5JZVA 4LDZA 2JLXA 3FSJX 1I1OA 1WM1A 3SICE 1M1YB 2EKZA 2V7BA 1ZBDA 3AM4A 1SXHA 3DAHA 3B1XA 1HZZA 3GXBA 4JGBA 2OAQ1 4UW9A 2OORC 2BEUB 3REOA 4PONA 1CUCA 2BC9A 3PHLA 3TRJA 2F17A 2A0UA 1QO9A 4NZYA 4GLFA 4PHHA 4V0RA 3PTLA 3P9RA 3A2KA 2A59A 4YBRA 2JG3A 1PQYA 2I80A 3QRWA 4R83A 1Y5LA 1U2EA 4ZCLA 2BELA 4PVCA 1I2DA 2VJPA 3E9QA 3R5HA 3TZQA 1NBMD 3HEMA 1CRLA 3MS4A 4ZOCA 1QF6A 4J0QA 3Q9SA 4ZWNA 1KYTA 1XZHA 5CT5A 3MGKA 3OA2A 4WN9B 3DKPA 2O20A 1NXWA 5FLYA 2V03A 3W8NA 3E9MA 3KYDB 3OQ6A 2AN3A 2G72A 2AMVA 3DDSA 5DCWA 5DLYA 5J1TB 1OBHA 4F56A 3GT0A 3VH4A 4EW6A 3KFXA 4G37A 3QITA 4NTZA 4Y67A 4YJ3F 4A23A 4WRRA 1IN5A 1GGHA 3T5GA 1E2GA 4DBLE 1KNQA 4AG5A 1UPXA 2WJVA 1T35A 1V5EA 2B21A 3GT3A 1T4GA 4GP6A 5AICA 4YDSA 4CLXA 2R25B 3B2QA 4JOQA 4DZTA 1U5BA 5EXXA 2B2XA 1N6IA 3OX3A 2EIHA 3ORRA 3PD1A 4HJRA 4J16A 2QRVB 1U80A 3QX7A 2CLKB 3ETNA 4F9EA 1BMFA 3DEZA 4DLKA 5F98A 2RAUA 3DMGA 3THSA 2OCGA 1NW9B 2WZBA 3ONFA 4Y1FA 3ZCPA 1HLPA 3F46A 5LMCA 5LU9A 1I01A 1AHHA 1RQGA 4QNMA 2Q3BA 4HWPA 4DT1B 1WF6A 2IPOA 1IATA 3KNZA 3OC0A 1U0SY 1ZCZA 4CTOA 1OTXA 4YMIA 4IJVA 5M7EA 2UXDB 4NVRA 3SS9X 1UXKA 3KQOA 3W5SA 2I6UA 1P31A 1E1CA 5BQOA 5A9RA 4Z4GA 3W6ZA 2BKAA 1IVSA 2GYUA 1NJ1A 2PL3A 4MTLA 3TD6A 3ZK9A 5K0FA 1OFVA 2D62A 2GYVA 4IJKA 2C9CA 5AHKA 5IPFA 5JS6A 2PU5A 2F9LA 5CAEA 3A27A 2ZYVX 2Z4RA 4NIMA 4BU0A 2WIBA 4F5ZA 4ZIRA 3LV8A 1JPVA 3A58B 4GI3A 3IQEA 1C3OA 4QDJA 2GXAA 2GK3A 1QAQA 2JKYA 2QW0X 2XY4A 3CVVA 1WZ2A 3STHA 2ZE8A 4OK5A 5K3AA 1KP2A 1XG5A 3AI7A 1BX1A 1QPBA 4X5OA 4MGIR 4PLYA 2YC2C 3WHKA 3HE3A 1QPGA 3EGVA 3VPFA 1NC1A 4EHAA 4LRYA 3FOCA 4AI6A 1NBME 4L8YA 4LKRA 1UDBA 2JHAA 3ZHZA 1ZVVA 2FMKA 1P7VA 3H9QA 5BW8A 3H6KA 2W2LD 1QVWA 5CBPA 3R0IA 1XKXA 4G67A 4IIEA 2I66A 4WTOA 1VL5A 3IVAA 2D0DA 1LGYA 3JWJA 1AA9A 2CFSA 2VRCA 1VOTA 3CUKA 4OLJA 3VR4D 4ZCRA 2HWUA 5CNMA 1DRUA 3D5EA 1RYNA 3P1JA 2NP7A 3Q8LA 1KJWA 1FBTA 1XMVA 2XMGA 1E7WA 2WB2A 1YQDA 3CR3C 2DBQA 2IYXA 2JI6A 2QX9A 2XDWA 4N0QA 4PNHA 4U5XA 4EWLA 3OTIA 2CHEA 4IG9A 3HPQA 4LIPD 1VECA 2NXNA 4D9HA 4LGMA 1C4WA 1IHPA 2X77A 4ENTA 1T36A 3K9GA 4D4JA 3IAHA 5DDIP 1Y1TA 4CFZA 4EUSA 4DEXA 1Q74A 4JCCA 1M10A 1GTZA 1NVVQ 4FYKA 1LFDB 4KWHA 4AF6A 1O6GA 4B87A 1QWOA 3RROA 1I51A 2R1TA 3EVFA 3THRA 3QPUA 1C81A 2EG5A 3W9BA 3R2JA 3FB4A 3USZA 1C9JA 3D2CA 5FNVA 5JZSA 4D44A 4D5EA 1PJBA 5BNWA 4KSCA 1YRQA 1E8MA 5DIFA 1EDBA 1SRQA 3QFFA 2VHJA 4OF4A 5JSUA 1YI1A 1YQ9A 4C4TA 1PWHA 3H7AA 4BNWA 4AVYA 4NDZA 2ZPTX 4G86A 4E5VA 5JDCA 4G97A 4YJGA 3T9DA 3PXBA 4ZKEA 1ZRSA 5EUMA 4AY4A 3FXAA 4L2IA 1UJCA 1TYBE 3GX1A 4BUCA 4TRRA 3AGPA 4OMFG 1XMJA 1OZFA 3ICQB 3BCHA 5KOIA 4QHYA 3A9SA 4LNAA 3AUYA 3E9EA 4AJ1A 5ALVA 1T15A 3NEJA 1P81A 3ABQB 3WAGA 2JARA 1OAKA 4EY6A 5H7XA 2GD1O 2I5PO 5DYWA 3EVEA 4AY5A 3A9WA 5B4UA 5FUMA 1MGOA 1E2NA 2R7MA 3KHKA 3N6RA 1CS0B 4R2XA 4DZRA 4YAOA 1OFTA 4YIHA 4UXJA 4O0LA 3FCAA 4URFA 5CH8A 1T4CA 2HZBA 2BEVA 4D3YA 3KJZA 4DCOA 4EPTA 4OIMA 4AUEA 2IXBA 1YH3A 2HSGA 3KT3A 5EYPA 2Q21A 3U26A 1EP9A 2XH8A 4QVKA 5A6VA 3PQ2A 1NGSA 1RT9A 4GAEA 3IXLA 5H80A 4QZVA 1Z33A 2BVNA 3FKSA 1LLDA 2IEGA 4HAXA 5E1DA 1CQIA 1QG4A 3MTJA 1VDZA 1YJXA 1JG7A 2VDNB 4FVTA 1JEQA 4LHYA 1OU4A 4OUDB 3ZD9A 5LYJB 3CYFA 3DP9A 4LZAA 1HF3A 1N6PA 4JL6A 4N5MA 3WLTA 2YRFA 1RLIA 2FW6A 3JAKB 4CLRA 2ZPAA 1TW2A 1UXOA 2PX2A 3CLVA 5A7FA 1UOOA 2O0JA 4IDCA 4B6PA 4KH1A 4QQRA 4C7MA 4KI0A 4UFNA 4DMMA 3FHTA 3QYPA 4L0QA 4CCYB 3E22B 2LBPA 3PCTA 2DZDA 4RCZA 1JKJB 1N9KA 1KETA 1RWQA 2DQ4A 4EF4A 4LFBB 4YRMA 3LUJA 4PZUA 1DL5A 2AG0A 3K73O 4YREA 2J4DA 2R6CA 3PRJA 2AX4A 5ALWA 3DP7A 1N3LA 2WSSD 4E32A 4JKIA 3NPAA 1I1QB 3TJRA 2A0FA 2QAGC 3EZLA 3JQBA 4DQDA 2OR3A 4RK7A 4CM4A 4BO3A 2Z57A 3Q3CA 1ZXBA 4R1MA 4MS3B 3VR0A 2J7PD 2VP3A 2IBTA 1DCTA 4DQUA 1L6IA 5KTYA 2GEDA 2BGGA 2Q6IA 4C0JA 3TIXB 1YA6A 5KKNB 3V9PA 1M2NA 1UBTS 5F12A 1XCMA 2WBLC 3EAQA 3W4IA 2Z8YM 2OG2A 3AC0A 2POCA 2B25A 4MUFA 5CM8B 2YZ2A 4F1JA 1Z2DA 1NNUA 4TQGA 1W4AA 2QLTA 1E64A 1OX4A 2C31A 3T38A 1MQAA 2DFVA 2IKSA 5JS2A 2ZZMA 1TW3A 1EFRA 5D3MA 1G6Q1 3CX7A 1E4OA 4ER0A 3SM3A 1XRPA 3BRWD 4EY7A 3DZHA 3DA8A 1UKCA 3L4SO 3WJAA 1HH4A 2DOKA 5TJ9A 3SBEA 3EYWA 4KPYA 1QZTA 3BBPA 1NF9A 2OBXA 1T34A 3MWGA 3SMQA 1PO7A 2AG5A 2V7VA 3WP0A 3FFAA 3CNLA 3QBEA 3G2HA 3QVJA 3PVZA 4GBGA 3L04A 4KZKA 4QGFA 2YY6A 1UT8A 2KS6A 4YUVA 4B7AA 4G09A 3D4OA 2P9ZA 4JYCA 5CDTA 2ZWMA 5KMGB 1SBNE 4QASA 3IQHX 5EE0A 5TSDA 3SF8B 4P3OA 2I6QA 2ZSBA 2OXCA 2IQIA 3MTBA 3PKIA 4XSGA 1L1QA 1E7YA 4FGWA 4DSOA 3OZWA 2X1HA 3OP1A 2WHPA 4PU0A 4AZTA 3BFKA 3C8HA 3AM3A 3KHSA 4QGSA 2BEWA 4KXUA 3WKEA 3V2IA 1WUIS 2GN6A 2WNIA 3ECCA 5K0SA 2GDZA 3FUUA 1CUZA 1OI3A 4YAGA 2A7XA 3G2OA 2I6SA 3E7WA 1PFGA 4FZJA 1XZAA 2A94A 2A0XA 3TW0A 3DMPA 2XT6A 1U4OA 4UBJA 5AOVA 3PKJA 5JCOC 1QX4A 1XQYA 3O8LA 4UDOA 1HTWA 5CYGA 1WY5A 1JKFA 5F5XA 2TS1A 1H5QA 3F6RA 4BVJA 2GRAA 3ASYA 1Q95A 3QQ5A 2AH5A 5FEMA 1X7YA 4LNHA 3G7SA 1TMYA 2IYQA 3EEFA 2WWXA 4UTOA 5FWXA 2VQFB 3WA6A 2FX5A 3U7JA 4QKQA 4OP1A 1GUYA 2X8JB 2CSUA 1CS4C 2W0SA 3ROFA 3W5BA 3RIXA 1I9GA 1Z39A 1JHXA 1I3KA 3WL3A 4IEEA 2FX2A 1YB6A 2CZQA 2FFBA 2LD4A 5I7HA 2GHIA 1EP2B 2WYOA 3RS9A 3HB5X 2ZS9A 2GF9A 2O48X 3HVIA 4KIUA 4M7PA 1YB5A 4QBKA 4Z7OB 5LQRA 4W5NA 1FTWA 1Y7LA 3P0HA 2RGYA 2DUMA 3UGTA 1T1RA 4UHHA 2GA8A 4QLOA 4IX1A 1P1BA 4KR9A 3ZBQA 1HGXA 3GDHA 4XX0A 4OB6A 3STTA 3Q15C 5L3RA 3KYJB 2C5HA 4OXQA 2PVSA 4M76B 5FOXA 3EGDB 2EKBA 5FOUA 3WBFA 1AB5A 1U7TA 3FCEA 4EHNA 1AT1A 4UQOA 5JHGB 2W0MA 4GOND 5DBEX 1ZUWA 4CKXA 2CW5A 2FWPA 2DLDA 1J8DA 4BXOA 4ZOLF 1AXGA 2UZ0A 1TA4A 1LBSA 3HS3A 5TE9A 3HB4X 1EJ2A 1TQHA 2F62A 3TVDA 2CNLA 2C9ZA 3UM9A 1A2QA 1X7XB 1Y42X 2W2KA 3IKJA 2JIRA 2OM6A 1S2IA 1YBVA 4U8HA 1NXVA 4ZZ1A 4C30A 1TD9A 3DLTA 4HQNA 5M29A 4DS3A 2B8TA 2XDQA 2XTNA 4A5SA 5G0VA 4E09A 3H2BA 2C8LA 3TPFA 2ORVA 2ZYTX 1ZD2P 3PWTA 4RKEA 1KFKB 1CQZA 2F43A 1M6NA 3N2YA 1H42A 3R0ZA 4RWZA 3O9ZA 4UHEA 5LA6B 3TLZA 2NPFA 1IBMB 1NVUQ 4Z9FA 4EATA 4F3RA 4WIAA 5JNWA 1U8TA 5KX5A 3DO8A 3U9TA 2AFIE 1PGJA 3LYHA 4I5DA 1QMPA 2RONA 1JLSA 4WCDA 3IAEA 1GZSA 2PXAA 5J5CA 2PJUA 5ES3A 3I9NA 1PJRA 1W75A 3ROQA 4B6JA 4BQNA 5C8DA 2J7KA 2I1VB 3PGA1 1QRAA 5CRIA 4LY9A 3BWMA 1U02A 4D9MA 5KWIA 2YXPX 4KNVA 1W30A 3GFPA 3KYCA 3MGCA 1N6LA 3E3AA 1U9IA 4MRRA 1QZ3A 5BT9A 5THKA 4FP9A 5C7YA 5K7SA 4RZSA 4DV6B 4WEOA 5K0BA 1NMSA 1IM2A 1P4GA 2XD9A 3ENWA 5DM2A 3AFGA 3LWDA 1BGVA 4XH9B 3ZY2A 4INPA 4E5KA 3QG5A 2VK2A 1P80A 1WB4A 4NG5A 4RVSA 4XVHA 5IUNC 1BDHA 1QR2A 1WL8A 3O7MA 3PZBA 4YLEA 4B2IA 5FUVA 2NTVA 3GT7A 4JNKA 4XQGA 5B1EA 1LSOA 1BXRB 3CA8A 3X1WA 3HLTA 2V59A 1ESMA 4DYDA 1ACLA 1T8YA 1ZJZA 4DMKA 3OCJA 5CB4A 1KJNA 3IUQA 2GZMA 4LWOA 3ZZ0A 3R6WA 1PGQA 2FCRA 2HY7A 4NAUA 4E5UA 4EHJA 2NP6A 1SU4A 3A4NA 3O1HB 2YFKA 1F06A 5BWCA 4TUYA 1DZIA 4F2PA 4Z49A 2REQA 5KYUA 1DG9A 4U7FA 5COAA 2RCYA 1IOZA 3IQWA 3PRYA 4ZOBA 3V8RA 1GTSA 1YI0A 3H5VA 5EIFA 5LZ2A 3AP3A 1C50A 1H2AS 2DWOA 3IAUA 4TS4A 1UC5B 1RVDA 2JNWA 3BMCA 3CVJA 2WYWA 3FBWA 2GQ0A 2HGZA 3T7KA 4R8RA 3CRNA 4KQHA 3FGPA 4BX0A 3KQNA 1V4BA 3QVGB 5DVZA 2XCOA 2Z6VA 2W6NA 5KQLA 1JU4A 4MW7A 1NQUA 3H99A 4EG6A 1LRKA 1EBUA 3NHUA 4MEBA 4RUKA 1KQNA 3CXUA 2D6FA 1IVYA 4L4SA 4PX3A 3HWWA 3GHYA 1N1EA 3ROGA 3KQPA 1V1MB 1R8JA 2ZJ3A 2BSAA 3ZE1B 3H5LA 4NARA 1YL5A 1ZFNA 4GP7A 4RK1A 4Z6KA 3WIBA 4H0NA 2EFHB 1H4VB 1Z4MA 2I4RA 3BMOA 3QHPA 5GTDA 1JFTA 5FWYA 1BS9A 3OY7A 1WB5A 3NGXA 3GLFB 5IYZA 3P4YA 2OB1A 5DP2A 1ARZA 2Y4OA 4BGIA 2ZI5A 1SUIA 1Z0IA 3K53A 1W73A 3AESA 3O2JA 2HNBA 3T61A 4C0BA 5C7OO 4Q4JB 3B1JA 1Z4PX 3CEJA 5J23A 1K7FB 3OKPA 2JHCA 4R81A 4RF2A 1E1CB 2E5FA 3T95A 1OLUB 1ZH0A 4JT8A 4AKGA 2P9JA 1FNDA 3R41A 2EZ4A 3HDVA 5AJXA 3G1UA 3LY8A 3UHAA 4EL0A 1X8KA 2QR3A 3A06A 1NP3A 4JVOA 1L4YA 3R8CA 4NAHA 3TEJA 1YS2X 2FX3A 4DIMA 4A7PA 4MW0A 4FKBA 4U2GA 3DVAA 4PLWA 3DZBA 3X2SA 5LBTA 4JLNA 3LOUA 1WCV1 1AN0A 4AJ2A 3OZSA 4DRZA 2W98A 3NHZA 1YF3A 4AYXA 5I3CA 3KB1A 3COZA 4MWEA 2O0KA 1C3JA 2ODBA 2YVAA 2FQQA 4YO7A 4G07A 4JDUA 2J48A 4TN1A 1G8FA 1HRKA 4P4GA 1V0JA 4JMPA 2ZCUA 2P9FA 1CULC 4EBFA 3KAPA 5F76A 1E2BA 4XGNA 4I14A 3S8YA 4GGOA 1RXEA 1T2FA 3RG2A 2WP8J 1D04A 1IEVA 2XUAA 4QARA 3ZD7A 4XR4A 2EP5A 1FMCA 2V3WA 1RI3A 3JD2A 3U3ZA 3PDWA 3E18A 4DRXB 3TECE 1PDWA 3QE4A 1X14A 5CFMA 4YCBA 1VCOA 2OCBA 2WI8A 3K0CA 2VC2B 1PEDA 1HYBA 5HE9A 3DE6X 2R1TB 3EXHC 3IJRA 1KEUA 1PVDA 3LDAA 1YMUA 3AVUA 1C7QA 1I4LD 1XD2A 2H4ZA 3PTZA 2W2LA 1G1MA 3RG8A 3COYA 3F6EX 3JD1A 1KC1A 1V3UA 1KK2A 1XDGA 3OESA 2HDWA 4NBSA 3AOEA 3UT6A 5BRJA 3OU6A 3OZCA 2JRLA 3WX0A 3ZX5A 3PGKA 5IDXA 1P1CA 4ETIA 2HREA 4TRJA 1IY1A 2OHOA 2XRZA 2LWIA 1XPOA 2HF9A 4AF7A 2DHQA 3KLNA 4GH5A 2PUAA 4MSUA 1VZ3A 4YJGB 3T5BA 4ID3A 4XJSA 3TGLA 3NT4A 4GOLD 4I1YA 5CT8A 3UZUA 1NLZA 1KBOA 1NVEA 2ZUBA 4CQMD 1XLTA 4KQWA 1YJAA 1PG2A 3HKDA 1J20A 1K6IA 3G0BA 3MFQA 4ZRNA 5FHQA 1MIOA 3LL4A 3M5WA 2XADA 1SCAA 1I8TA 1UOEA 5JD5A 4MQFA 2B4QA 2ZSDA 3T4PA 2HPHA 2V9ZA 1GPDG 1DT3A 3UATA 2OQ2A 3E2MA 3QHAA 2VJQA 4TYWA 1YIOA 1WHSA 1JLMA 5IZ4A 1A27A 4TYYA 1T3ZA 5FPQA 3PQFA 5HIMA 1JR4A 4MA4A 4BP9A 4E5NA 3NR2A 3ITNA 3I12A 1J8VA 5EXDA 1UINA 3QVSA 4RGVA 3SZMA 2X2PA 1T4CB 2BY4A 2BEVB 2IZ7A 5EMLA 2R3SA 3R7WB 4WKBA 1P9RA 1SQFA 4BU1A 1A7AA 4XB2A 2B8JA 1AKMA 2RHRA 2XVZA 3LQFA 4HGOA 1NW5A 5DM1A 3BTUA 1C7FA 2WIFA 4EGAA 1WPQA 2A35A 4TQAA 3U3OA 4JYMA 1O57A 3IULA 2O0MA 4BNIA 2JFXA 2X22A 1IZZA 2O2ZA 2OM2A 4DB2A 3U9LA 2C2GA 5HMLA 2PMEA 3EGXB 4PPGA 1JEQB 4MO2A 4ZAYA 2OCXA 4CRWB 1XVLA 4ZCTA 5FDFA 4JBHA 4X8MA 1I7NA 2W90A 1ZC4A 2G7ZA 2P40A 3PQ8A 4QWWA 3S2IA 4Z9AA 1FSZA 2NYRA 3TXXA 4W5QA 2MWMA 1XR3A 3TDNA 1Q3TA 2PCLA 4NDNE 4OL9A 4LHZA 2O4CA 4Y18A 1AGRA 5IWAB 1IJKA 3J7AC 3O92A 1FRQA 4PZZA 3CRVA 1ATZA 2Q6OA 3VZBA 3AJDA 2DFPA 2ZBPA 3OM0A 4UOQA 3WK4A 1SUCA 4DA9A 4DDWA 3N07A 3FZEA 4KXMA 3E0XA 4KBGA 1GFZA 2AKAB 3UTCA 5REQA 2ZRPA 4B6FA 1SU7A 2FPSA 3PLNA 1X77A 3WWOA 4DSAA 1LS6A 3EXAA 5ADVA 2O57A 2NXJA 1W59A 4YR9A 3QEBZ 3BORA 3NP9A 4UDNA 1LZLA 3SWWA 1A9QA 1RYMA 2QZJA 2DM6A 4R51A 4X1YA 4BRSA 4FE4A 2CUZA 5YASA 3GEIA 4MMXB 4IFTA 1EM6A 2CCJA 4FLEA 3S1LA 4ZTBA 1NJGA 4JD5A 3IBYA 2AL7A 3ELDA 1KZ6A 2QPTA 1VE3A 3HBFA 3MTAA 5EQDA 1YIAA 1AE1A 3UK2A 4X97A 4E94A 2G82A 3N0VA 2FPPB 2YWXA 4N9QA 4OP3A 6ABPA 1Y7TA 1Z34A 4LXIA 5DEOA 1G19A 3UCFA 4EHDA 1TQDA 1LQ2A 1XDDA 4NYIR 3NHMA 2WSSA 4OH1A 4OMUA 1N5JA 3OF3A 1JSXA 2MU1A 4ZD6A 3I6ZA 3BXFA 1J70A 3W8EA 3GLHE 1J2UA 1QNFA 4RPGA 1GPJA 9LDBA 2J7PA 2FG5A 3OCXA 1L7MA 4QUGA 5CVVA 3RYCA 4H2DA 4HSGA 4LBWA 4NZPA 1NT2A 1DUIA 1RHRA 4EMBA 1NWCA 1VJGA 1Y80A 1YUNA 3ZWKA 4R9NA 3C3PA 2CUKA 3RSGA 4YAKA 1AV7A 1EWTA 1SHJA 3JALB 2I2BA 3WO0A 4EB8A 2XE6A 2FSFA 5LYJF 1HNNA 1PLKA 2VWHA 4MRVA 4QT4A 1QGYA 4ERNA 3EVTA 4OHVA 5BYKA 1IZ0A 2QM8A 3LFHA 1GZ3A 1V7QA 3FNGA 1OFHA 4R2MA 4JJ6A 4YROA 4WXYB 1DQRA 1CD5A 2H9YA 5FLKA 3ZV3A 5B30A 1VFPA 3IT3A 4BCBA 3ZW7A 3A4MA 3FMIA 2V6IA 3BK2A 3DBVO 4PLZA 4AL4A 3CVOA 4QPCA 1P33A 5JU6A 3ZOKA 1JDJA 2HLNA 4LMPA 4TWZA 4UTNA 1PAUA 5C3MA 3H65A 1GZ6A 1TKAA 4MPTA 4B3SB 4GBED 4KW7A 2V5UA 2PN1A 4NBVA 2VCYA 4NKRA 1PK8A 4UCQA 2OORA 4GNRA 2O2GA 4TM8A 1KI8A 3TZBA 4CVNA 3LIPA 5FTWA 1MJFA 1BYIA 1GYRA 1L1RA 3LRXA 3RS0A 4OQ4A 1SK9A 4MQUA 4TMVA 5C53B 1HLFA 1XAGA 3L8FA 5MHTA 4ZJYA 1G8YA 2JIBA 3PGJA 3OT5A 1TMOA 4D6XA 1QZXA 1QVVA 3ZXUB 2R7NA 1YR3A 5DTMA 3QVXA 1E5LA 2GN8A 4X71A 3SQOA 4D8TA 1SXJD 1YGPA 3SPXA 1YJQA 5BMVA 2O8CB 4RDIA 2D5IA 1LK7A 1ML4A 2H3HA 1MRZA 4DVJA 5KNBH 4TLCA 3KXKA 4Q4CA 3PPYA 1DFHA 2ZVDA 5EJMA 3KYIB 3N87A 4YJDA 2H5LA 3UJ9A 3KLOA 1J1UA 3E5MA 4Z9BA 5K3CA 3AZOA 3SDSA 1KO5A 1LCIA 1TB4A 3AR9A 3UA4A 4F6CA 3LRTA 4ILKA 4WOJA 3ONNA 4UHFA 2BZ1A 2VDLB 4DG5A 3ND9A 1XDBA 4PG5A 4RVGA 1YMQA 5EMHA 3VZRA 1L8LA 1XDSA 5ALZA 2G9RA 4BXOB 4CQLB 1IHDA 2VCEA 1RYFA 2Y66A 1YI8A 4YMVA 1BU5A 1W46A 1QHYA 2JIOA 1L5LA 1Z2EA 1NLMA 3SQLA 3BM5A 3GCXA 3ZHYA 1XXHA 1X1SA 1CHNA 3GFGA 2IEZA 4QELA 5CFNA 2XDQB 2VH2A 3SXJA 2QVZX 2IW1A 2XBUA 3ER6A 2WOOA 3LY9A 2F43B 1E3WA 2W37A 1P9LA 5A6SB 4V0MA 1VMAA 1KEEA 1YCDA 2XGGA 1JHDA 4HYQA 5BQPA 1V5GA 1B6RA 1JW9B 2I1QA 5EHQA 4RVOA 3WB0A 3L7YA 4BO0A 2XZDA 1HI9A 5JAIA 2ZI7A 4MGZR 4KQ1A 3P9SA 2VXOA 4QU0A 4J7AA 1NI5A 3IHKA 3SJUA 4XVRA 2Q7DA 1EWRA 2OG1A 3N39C 2PKQO 2QY9A 4H7JA 1ZGHA 3G2QA 2J6BA 4TTPA 5TRTA 3AKYA 2D7CA 4PZAA 3RAFC 2OO5A 4J8PA 2E5LB 5JJKA 3GAAA 3VMMA 2XRFA 4V0OA 4XDGA 4W1SA 3TR0A 1F3LA 1PW5A 2I55A 1WLSA 1GCGA 2PWAA 3N2IA 4HLQB 9GPBA 2ABWA 1E5QA 5FXMA 5ICFA 1R4MB 4RL4A 5BQ5A 2ZYGA 3O0DA 4IKOA 4BE9A 3MBKA 2IBMA 4HQ0A 3Q10A 4FI3F 3OZBA 2C97A 5J5VA 5KTSA 3I2HA 4HQOA 1NZDA 3I8OA 1YV9A 5K45A 3RRYA 4ND7A 4TMTA 2G0AA 1SUPA 1UBSB 1GRQA 2RGXA 2VEDA 3ZVMA 4RQAA 4C5BA 3ORFA 1E18A 1NA5A 3TTXA 1JE1A 5ECDA 4YP6A 2ET6A 5EXPA 3ZEAA 4A6PA 5TB5A 5HK8A 1P2FA 3T7RA 4ZICA 1RXCA 3M0EA 4KEAA 4B8WA 4DDUA 2HK9A 4HN2A 2FE4A 3P0FA 3ZUPA 4CHGA 4EPRA 1GKUB 1XMSA 1B1CA 5K3EA 4M1OA 3NNSA 3S5UA 3OUUA 4FOPA 2FOLA 2W6JD 2NOAA 1D2MA 3DL0A 1PT6A 2O6LA 4G2NA 5G3ZA 4MXDA 4DCTA 4AS1A 3E7FA 1KQFA 1MO6A 4DXDA 1UADA 2Y77A 1CQWA 4C4ZA 1CETA 1W4CA 3HYRA 4JKYA 4UMFA 3C98A 5AHXA 4EDFA 1EB9A 3MSXA 2AFHE 3NJ4A 4JJZA 2NXEA 4TOIA 4XIGS 4OKSA 3E3NA 1DV2A 3LCCA 4IHAA 4KKVA 3SX4A 1MTZA 1OH8A 3PE4A 3H5OA 4TYNA 4KUEA 3JZIA 1VG1A 2JJMA 1S3FA 1NASA 3B2EA 2J31A 4X93A 5ERXA 1W25A 2QTMA 4JKOA 3BE5A 3IV6A 5ELLA 5JEDA 4L78A 4JA2A 3DM9B 4MWGA 3AHIA 1P19A 2XKKA 1WW8A 1QIMA 1JTFA 1DFIA 4GPTA 4D0NA 4HAIA 4OQFA 2RGNA 5K0JA 5LMNB 3SLGA 4DGSA 2VJCA 3IP6A 4U00A 3TGPA 2ZRQA 3GA5A 5NULA 5LA6F 2V5AA 2YCLA 3BE6A 4RNCA 5TPZD 4ZJUA 1G20A 3IT0A 2QRJA 4CEHA 1J56A 1KAEA 5EHNA 1GTG1 2JD0A 4WNYA 5KJEA 1V47A 3PSHA 2BW0A 2YZKA 4BASA 2IPXA 3FE2A 4M9RA 2DRIA 4DW8A 4M0MA 5L3QB 5LNK6 3FYUA 2J8ZA 4HVLA 3E81A 4ZAVA 3O95A 3DDWA 3KL4A 1X19A 1XVAA 3KZNA 2W58A 4CF3A 3IEIA 4J2TA 3AUXA 2Q9CA 4WH0A 2CFIA 3K0AA 4XFJA 4YI5A 3GLGE 3JR3A 2VAMA 1E1LA 3OD1A 1RQLA 3U13A 2OYSA 3RVOA 3WY9A 1NI4A 1MJHA 4OBEA 1F8YA 3UB2A 3DG9A 3BX1A 1NW3A 2JGMA 3ILVA 4K6FA 5G02A 2XNCA 1FVOA 3H3XA 1UBEA 5F9HA 2ZJ6A 3HQ4O 3TO5A 4D92A 2XD4A 1N5RA 2Q07A 2W2MA 3C8ZA 4G63A 1OWPA 4HADA 2A9FA 4IYJA 4EQ6B 2SECE 4QYTA 5ENVA 2CV0A 3ZWWA 2VJAA 3L0ZA 3N05A 3WRWA 4YXWD 2P35A 5JXJA 2P1ZA 1RWVA 4UEWA 1MX9A 1P45A 2QN2A 3DHEA 4RIGA 5EQJB 2GZAA 3HMQA 3OE1A 3UO8B 3L46A 1ISRA 1BE6A 3AF1A 4IGKA 4RQTA 1ILWA 4ZQEA 3HUUA 3SX0A 1XRLA 5CTAA 3EVBA 3T9BA 5DLPA 3VSDA 1TM5E 2FLKA 2BWJA 4AKTA 1UM8A 1IB0A 4DDTA 3ANLA 1VP3A 1XMPA 5FLEX 5B5SA 4I99A 4PYNA 2ZM6B 1DQYA 2H1HA 2ZFUA 1D2EA 4KXLA 1V2GA 5K3OA 3U44B 5A04A 3BKWA 3ETLA 5CK4A 1A4IA 4D43A 1NMXA 5HS4A 4FCWA 4KE9A 3W06A 2QAGA 2H4FA 2X58A 3AL2A 3BMQB 1SRRA 3PC6A 4N7RA 3L8ZA 3QLUA 2ODWA 3BREA 5B58C 2XZPA 1J4AA 4IDNA 3Q9LA 3PPIA 1W76A 1ZOOA 2P1DA 5EEGA 5JSZA 3LIIA 3BJEA 4P84A 1DKMA 4B81A 5HTOA 4W8GA 3MELA 1T4BA 3VV2A 4CCSA 3VUEA 4LDQA 4PCVA 4CTNA 4QTYA 4JUDX 1L5HA 2X0KA 1USGA 2PUVA 3FPSA 3E05A 1THTA 3L7KA 4WLEA 3CLTD 4XAQA 5FL7D 4ZDWA 3ZDZB 1J5EB 4CF7A 4OP2A 2DPXA 2JRCA 4ZU6X 4CIBA 1PV4A 3AETB 3EG9A 4BTEA 5AM4A 3E4CA 1OBVA 3TQFA 3QWAA 5BWOA 2BMWA 3LDFA 4JELA 5EPUA 1Z17A 2C5SA 5AM1A 1VKNA 4RNDB 3WLJA 2IV7A 5I8PA 5BSTA 5SY4A 1W5AA 3CJTA 5CXQA 1IG0A 1FDVA 2ZRJA 3R6TA 4QUBA 1I1NA 2CYCA 2OYRA 1YZGA 4FDMA 1LDEA 3KKLA 4AWXA 1E6WA 5JASA 4P0QB 1A5AB 1TUGA 1GPLA 3TUZC 1FQKA 1KIMA 2Q4TA 2X4IA 4RSRA 1YR8A 2CDCA 3W2HA 2YASA 1MIOB 1L4UA 2ZJAA 3U1BA 2Z8YA 3BK7A 2Y0BA 4H7KA 2BH2A 3DQPA 3TQHA 5GGYA 1OE0A 3ERCA 4L4YA 4YNBA 1ZHOA 1LBTA 3JQCA 2M1XA 4P7GA 4M0UA 2QQ5A 5AKYA 3CJQA 5C7LO 3PC8A 4JWTA 1CNMA 2HSJA 4HKTA 1P5FA 2LXNA 2FUEA 4MI3A 1CUHA 4LGYA 1UK8A 2VYVD 3EBPA 2FV8A 1XSEA 3U7IA 1SOAA 5AXDA 3SZGA 2CL6X 3VDXA 2SKCA 4F7DA 2IXFA 3OLZA 3O47A 3L1VA 2WQ6A 1EHYA 3R75A 3KQQA 3KQKA 4HZGA 1AF4A 2B8EA 5T4BA 3UFXA 1LPMA 4Q9JA 1SCKA 2FMIA 4H1VA 2QHXA 4DABA 3KHUA 1JE0A 1M67A 3G8YA 4P4UA 5E7QA 1KR5A 3T7IA 3WLHA 1NXTA 4Q39A 5BURA 1R5NA 4EG4A 4LUCA 1QANA 1NG1A 1U7WA 3IMEA 3MTIA 4WZZA 4EA9A 1ONNA 3T52A 1JQLB 5ECGC 2NT3A 2H8KA 2HDOA 1JI3A 4MGKR 5JCOA 3LO8A 3MK31 4ZQHA 1QYVA 3LUDA 4YY3B 1PFUA 4YC7A 3R0XA 1R3DA 1X1EA 4GDMA 3VC7A 3EXIB 3HKBA 2R8XA 4K6MA 3GJRA 4R1LA 3SIWA 4KUHA 4MUKA 1N2XA 2IHKA 3FLBA 4FINA 4P7KA 5K3DA 1ULBA 1CUSA 3K2BA 3L01A 3QNUA 1TGYA 2XX3A 3A1WA 3FLEA 4M9CA 3K9LA 1WXFA 1S9DA 1SGWA 4OAOA 2YWCA 1UPFA 4HWOA 1J00A 3ILHA 1CIPA 2J0EA 2P3LA 2X8WA 4R1TA 3FROA 3A2LA 2GA9A 4UNIA 1SIWA 5ESRA 1DX4A 1IAQA 2BZ0A 5FNVF 5AKEA 3T4EA 3E3LA 1QHIA 3C2QA 1M5TA 4EL5A 5LQCA 1VYTA 1WKVA 1HDXA 5LQUA 5JXGA 3K5HA 2WHEA 5A0TA 5D6NA 4XLZA 4U63A 2RGBA 2BMAA 2CNBA 4CG3A 4EG8A 4GKBA 1YVPA 4JZKA 1LBIA 3AJ8A 2DWUA 3PUYA 1Q3KA 3WLEA 3DWEX 4Q05A 4I1PA 1YS6A 2YW9A 5DASA 2R68A 5CLGA 4YONB 1RPAA 3D8BA 4OBXA 2XA1A 3TMYA 1V5FA 1XDZA 2JAHA 1DAOA 4PWYA 1OQAA 4WOPA 2OPHA 5LN1A 2G25A 2WU8A 1CRWG 1YDFA 2Z5VA 2ZT8A 4NLLA 4YJ2A 4CKEA 1YQWA 1KAMA 1NU6A 1FTSA 2EQAA 1Y9JA 4HQFA 1UAAA 1PS9A 1PVOA 1NUQA 3V2HA 1GQSA 1ZJ6A 3CF4G 1C3LA 4FZ3A 4JT9A 4QFBA 4QXOA 5A5EA 4BNDA 3EQ2A 4IQGA 1U3UA 1OHHD 1JPUA 4B46A 5BN1A 2QIOA 3PXAA 3AT1A 1F38A 3GJ3A 4YLYA 2GETA 4EI2A 1U1GA 5A4FS 3UB4A 3K20A 4XQ0A 1DDIA 4A26A 3HVUA 1U7PA 2JJYA 1CX9B 2OMEA 2H51A 4X1KA 4YMHA 3G23A 4DY6A 3U40A 4DDVA 5I4IA 5JJBA 5ABPA 1SKUA 1YFZA 3OIYA 2B8WA 2WDZA 2AT1A 1JECA 2GXUA 4Q66C 4Z7NB 1D5CA 2BISA 2WA2A 2HF8A 1SBZA 1ZCAA 1XQ9A 1H2HA 2OP1A 3HCNA 3JASB 1HTBA 3A1SA 5BN5B 1QVZA 5IP5A 4H59A 1QQAA 4UHBA 2ZYAA 1H1LA 1T9CA 5CT4A 5DB4A 3GY0A 3ZJ5A 1EQ2A 2YJ3A 3ZLUA 1NHGA 3DNPA 1LSUA 4U0KA 5BV2P 5KQRA 4N39A 2C8KA 4RWEA 1U7OA 5IX8A 2QJOA 4GVLA 3EEYA 4Z4CA 1QH1B 5MN4A 3IUMA 1SB8A 3EXFA 3PI7A 4BZXA 4F4FA 3K72B 2P9TA 3H42B 5K6AA 1PP4A 4X20B 1H4TA 1G0NA 1PYGA 2BPOA 2PQ2A 2PUHA 3UV7A 2VZ0A 4IJ6A 1B73A 4OHMA 5B64A 1XNGA 3KOWA 2J4FA 3BUSA 5C1DA 3M4ZA 4ZCIA 4K6KA 3D6NB 1LUAA 2DMRA 4KQ9A 4AKIA 3DOCA 1VSTA 4DCNA 5A5FA 2FSHA 2QT1A 3MS2A 4KAAA 2BE7A 4HDMA 1Q1ZA 4Y0VA 1LX6A 2VRWA 5TQJA 1KMMA 3KOZA 1K4YA 1WB9A 2G04A 4PYIA 2GTHA 2C1XA 2PD4A 3OD5A 4ZYVA 1V9CA 3BE8A 3OMWA 2PT6A 3V3TA 2PZFA 2JHGA 2PWBA 1BKYA 5TVGA 3HB1A 2QXUA 1E9AA 2O7RA 3OPVA 4YT4A 3H9EO 4ZPXA 2B4TO 4GSKA 4L76A 4PGHA 1ILEA 3EA4A 2NG1A 4O0MA 1T91A 1O94D 1VCIA 3WG9A 1HM5A 4TS3A 1JIQA 2XHEA 1Q0QA 2REXB 1B8OA 2XB6A 3PQ7A 2J6CA 4Y7DA 4BNHA 4UU8A 1BE1A 1Q0UA 3STXA 1ACJA 3MVEA 1ULHA 2H5EA 3TLGB 3GNQA 4JK3A 2HMTA 1UEIA 3AHCA 1V26A 3PDHA 1AKUA 4BIIA 1E63A 3MD9A 5JO0A 1LA2A 1L7OA 3CONA 3LTEA 3TOVA 2H1LA 3D54D 3W78A 3I6IA 1SG0A 1VMDA 1XXHB 1SXJA 1SQ6A 1YC2A 2JGIA 3V1KA 4AROA 3L0OA 3RVKA 3LPAA 1GITA 3M4XA 3OFSA 3FPJA 3O1LA 4OHRA 3FW1A 4UAGA 1Q20A 1VG8A 3TJZA 4BGUA 5IKMA 5B7PA 1S7CA 4G0XA 6AT1A 4P54A 4U6QA 2CLIB 4E13A 4X84A 3TBFA 5IMBA 3LECA 2MOKA 3BIFA 1E3WB 5ICCA 3EW9A 3DE4X 4J0JA 4EW1A 1XNJA 1N0IA 2P3SA 5CCDA 1V8FA 4GX0A 4A6EA 3L18A 1U9YA 3GR6A 4RW0A 3EIWA 1FUKA 5M5BA 2EX4A 5COBA 3ANYB 5B53A 5BN4A 5DX1A 1QCZA 1XTUA 4B7UA 3KKEA 3LKDA 2XA2A 5DX0A 3MT9A 3QFSA 5AUPB 6GPBA 4QEKA 5HF8A 1SU8A 3IPXA 1HYHA 1RAGA 3OC6A 4L8VA 5LOVA 1X3SA 1LNZA 4H77A 3LLUA 4Q1CA 2APJA 4CGZA 2QUAA 4YRQA 3RUHA 4RLQA 1C4OA 4EECA 3UV3A 2JGLA 2Q1XA 2BFEA 3B5EA 4KXQA 2WB4A 3BFPA 3IQFA 1J0XO 1V3TA 4TSFD 3IBGA 4XDHA 4C6HA 2GK6A 3UOAB 1R10A 1QP0A 3G5LA 2P65A 5A3RA 1GAJA 4EKDA 1U0TA 4GMDA 4RIIA 4FDTA 1ZH6A 1NFFA 1CJTC 1XWFA 4QUIA 1R0YA 3PNSA 4L4XA 3S40A 2DTXA 1Q0PA 1J24A 4IPTA 4KLCA 3EPJA 4WLUA 1NKVA 3H1AA 3TBHA 2NUTA 4DR6B 3UW3A 4L5CA 3DB1A 2HJWA 4TXJA 3WWYA 3GDGA 1WMAA 2XOKA 3IJEB 4IFBA 2QBYB 5JHHB 4W5TA 3HDYA 2H65A 3L4BA 4G1CA 5AI4A 5ECYA 4JGIA 1QV7A 2Q3LA 1UL1X 2E1RA 5BP7A 1LI5A 1G3IA 3FZQA 1WF3A 3AEKA 1NBAA 1N6HA 1BROA 2A84A 3BDAA 5LYYA 2NGRA 2W4QA 1MJGM 5C46F 1TEXA 1W36B 1CEEA 4BJ6A 4JN6B 5BUSA 2GPJA 4N7JA 2X3YA 4Y6OA 2FFAA 4V39A 5BNFA 1A97A 3DWIA 3MRVA 1ZM3A 2XF2A 2QVXX 4QPDA 1MENA 1XJQA 2P91A 3JZAA 4QAQA 4A8JB 3UVEA 4GKVA 2WG2A 4IEIA 1P7CA 1JJFA 1CP3A 1Q3HA 3C6QA 3X1DA 1B8VA 1HZJA 5K20A 3RIHA 4WZBE 1P4SA 1NBHA 1P0FA 1TZMA 4I81A 5HCUA 4JI3B 1E3QA 2A30A 3ZZTA 4CMCA 4CDGA 2FMUA 1KQGA 1XAIA 3QUQA 4L27A 1C9YA 1QZUA 1S4QA 1FLVA 3LUBA 4IMIB 2O14A 1WUJS 3K9QO 3L9WA 3L84A 5FWDA 4OUKX 3TKLA 4PG7A 1A95A 5C51B 4U7HA 1B4DA 2R60A 3ZDDA 1Y8RB 4EG3A 3KZKA 1MV8A 4TV8B 3I5YA 1VIMA 4MMYB 1GPH1 3L0IB 1V2HE 1XHLA 2O8VA 2DXIA 2WVJA 2OBYA 5EZSA 5HMMA 2NU8A 2W2OA 1G20B 1JHAA 2W6JA 2OFXA 3UGQA 1OAOC 3FOWA 5GJVC 4RJIA 3FUXA 3ZQJA 1CUXA 4CTMA 1ADBA 2IGBA 4HXFB 1T0BA 2A9JA 2A1UA 4BP3A 4BVEA 2AEEA 3G2MA 4LJSA 1XRMA 2FP4A 1H2EA 1XQ6A 2PH3A 1FXWA 3A6JA 1TF5A 1UH5A 3FYUB 3O82A 4J76A 4ZDKA 1FFYA 2OOKA 2PWZA 3AJEA 3CZAA 2OENG 3ENQA 5G0TA 3IP1A 1T9DA 4MUBA 1W29A 1AK9A 2J0QA 1DKRA 2C5AA 1VBNA 1R4NA 2QLFA 3K0AB 4L3OA 3TSOA 2W00A 3Q0EA 2KYRA 4YJFB 2WYUA 1J25A 4OHXA 3SF0A 2H4XA 1E0AA 4GYWA 1Z2NX 1TJYA 2HA7A 1JDBB 2WF8A 2VBFA 2V7UA 4NPCA 2AXEA 3ZV7A 1CXZA 1HDCA 2UDPA 4B6GA 2AZXA 1OZHA 2PH7A 3D7LA 1N6NA 1JBEA 5I3ZA 3LS2A 5B3LA 4Q9LA 5EE5B 3RDPA 1YQQA 5TPZA 3H5IA 4K6HA 4Q24A 2CNDA 2JLQA 3FTQA 3UYLA 2CLCX 3TSWA 2AJBA 3EPKA 4IRXA 2PS1A 2BMVA 2ZIXB 4YBZA 4AY3A 1YZLA 2CLHB 4DARA 4UNRA 3U56A 1T0JB 1QAMA 1VYUA 4ISBA 2YQZA 3N0RA 4EW2A 1BJKA 2AYZA 3AMVA 1WE2A 1N5OX 1FFSA 3BB4A 4M6WB 1YMVA 3QY9A 3BWDD 4DBZA 5KTOA 2XAAA 5IAOA 4EVSA 4LSGA 1EFLA 2AYXA 4N01A 4KREA 2AEJA 1RQRA 2SKEA 3JTMA 5K0TA 3VNRA 3EIOA 2BSXA 3C5VA 4TUYF 1XELA 1NY6A 4Z9YA 5CB0A 1ODJA 3WMEA 4QC2A 5H16A 3NTXA 1XHEA 2WUFA 4S0ZA 5HILA 5L4LA 1Y4ZA 1XTIA 2IZZA 1JAXA 1TO6A 2PPLA 4FU0A 1O08A 1ZNYA 4TZ0A 1H8ED 2VDVE 2AE2A 3O1IC 3OJLA 1WBJB 1KY4A 1ODCA 3DWFA 4NZZA 4WEQA 5D84A 5ALXA 5DZSA 1PQUA 3VYWA 5GVSA 4J9VA 3ZJYA 5CFZA 5DW3A 4YAUA 1JH8A 1KK3A 1ZY2A 2FMXA 2DUWA 3VYRB 2RHDA 4Q12A 1DC5A 1ECCA 3BBLA 4TWJA 3LF1A 2R8OA 4ZEWA 2ZI6A 4RDHA 1I14A 1L5HB 2XBMA 3ZVLA 2FAXA 3VNQA 1Q0TA 1XK6A 5CIQA 4EGSA 3AJ9A 1CQJA 1P6XA 1Z6TA 1HDIA 1OZAA 1PV2A 1UPBA 1D2HA 3IOCA 4M7WA 3DXXA 1FFGA 4HN9A 2PAAA 4J90A 2D00A 2OILA 3F9CA 3V4LA 3IAM6 5JAQA 3EISA 1YTUA 3ZXSA 3ISVA 5IYZF 2R8EA 3AUSA 1S1MA 3ADPA 3TE6A 5JXWA 2QV7A 1K0UA 4QBFA 4MCAA 2V3CC 1NJ6A 1CKEA 1T2EA 4MS4B 4RKRA 5B55A 4Q47A 1OGJA 3AIKA 1FNSA 5BQ3A 4UBLA 1CJCA 3GEMA 4HZUA 3UANA 1NSTA 1VL1A 4JX9A 1SZDA 1KMNA 1TMGE 3K5PA 5IASA 1PUIA 2NTJA 4MJ3A 1M33A 4LI3X 2UYQA 5GJCA 3LG2A 3G9UA 1WMBA 1O6FA 2H2DA 1W0CA 2QTLA 4J75A 2PMCA 3E48A 4KV9A 3F6SA 3R5XA 4NL4H 1W88A 3A8TA 3IX7A 2B82A 3QELB 5AR1A 1AMUA 1OW3B 3RHZA 3AFIA 4MB2A 4WE3A 3V8EA 5HOEA 5CLQA 2HUPA 2VOEA 1TM1E 5F77A 5FBRB