4OV6B

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
294
structure length
281
Chain Sequence
b'SIPWNLERITPPSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
molecule tags Hydrolase/protein binding
source organism Homo sapiens
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
total genus 92
structure length 281
sequence length 294
chains with identical sequence E
ec nomenclature ec 3.4.21.-:
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4ov6B00
1S2NA 1GTL1 1Q5PA 1Y3DE 2SBTA 2ZRQA 4YN3A 1T1IA 3DE7X 1KDZA 3WIUA 5K7SA 1OT5A 1SPBS 2PWAA 1S02A 2GKOA 3T41A 1SBNE 5B1DA 1SIBE 1GA6A 5ARCA 5CW1A 2W2MA 1Y34E 3VSBA 1BFUA 1SUPA 2W2NA 3EIFA 1KDYA 1SCAA 2SICE 3I30X 3WHIA 4C3VA 1AH2A 1CSEE 1P7VA 1NLUA 1T1GA 2Z56A 3D43A 4CG0A 2WUWE 4H6XA 4KG7A 1WMDA 3SICE 5FBZA 3TECE 1EGQA 4OV6B 3BPSA 1P8JA 1AK9A 1T1EA 2Z2XA 2W2PA 4MZDA 2WWTA 1A2QA 3BX1A 5I9SA 1GNVA 1SUAA 1Y3CE 1VSBA 1R6VA 2ZWOA 1Y48E 1MEEA 3HJRA 2WUVA 4CFYA 3H42B 1TM7E 1ST3A 2HPZA 1GNSA 2SNIE 1OYVA 5AVJA 2DQKA 2WV7A 4J94A 3DE0X 2E1PA 1TM5E 2PYZA 1R64A 2PKCA 1SCNE 1WMEA 1AQNA 1SIOA 4H6WA 1ZVJA 3DW1X 3LPDA 2XRMA 2Z30A 2IXTA 5JXGA 1Y4DE 4ZARA 4B5LA 1SBHA 3DDZX 2TECE 1SUBA 1Y3BE 1TM4E 2PMWB 3CO0S 3Q5GA 3DE4X 3QTLA 3LPAA 1KE1A 5B1EA 3ZXXA 3VV2A 1AU9A 4K8RB 1GT91 1SN7A 3DW3X 1V6CA 3AJ8A 4DZTA 1GA1A 2SECE 3PRKE 1SIUA 4FONA 2ID8A 2ID4A 1MPTA 1SCJA 2PWBA 5FAXA 5JXIA 3WQBA 1AVTA 1SCDA 1SELA 2QTWB 3BGOS 1KDVA 3EE6A 1PEKE 1IAVA 3F7MA 1BE8A 3DE3X 3VHQA 1Y33E 1YJCA 1ZVKA 2Z2YA 1TM3E 1JEAA 1SH7A 3GCWA 3DVSX 4H6VA 4JP8A 1IC6A 3I2YX 4BWGA 3D9QX 3F7OA 5FFNA 1PJ8A 3A3PA 4OMDA 1SVNA 2HD4A 1WSDA 1SUCA 1DBIA 1AV7A 3P5BA 3AFGA 3GT4A 5JXJA 1HT3A 4LVOA 1C9MA 1GTJ1 3DVRX 5ARDA 1TMGE 3A3OA 1P7WA 3I34X 1NDQA 3DWEX 5AMXA 3DE6X 3DE2X 4C3UA 3DYBA 4HVLA 5ARBA 1PTKA 1Y4AE 3CNQS 1SCBA 1OYOA 1TM1E 2DP4E 3I37X 4HX2A 4AKTA 4Z2AA 1EA7A 1XF1A 2W2QA 3QMPA 4NE9A 4OMCA 1GA4A 1ST2A 1Y1KE 1NDUA 2Z2ZA 1TO2E 1YJBA 1KE2A 1PFGA 1DUIA 3WIVA 1GTG1 2W2OA 1UBNA 1YU6A 2ST1A 3PTLA 3VYVA 1C9NA 3LPCA 4NE7A 2P4EA 4KB5A 1BE6A 1LW6E 3EDYA 1Y9ZA 4I0WB 4RYDA 2PRKA 4ZOQI 1THMA 1R0RE 1BJRE 1SBIA 2DUJA 5JXHA 1TO1E 1TK2A 1BH6A 2B6NA 4WOBA 1SBCA 1V5IA 2X8JB 1WMFA 3Q40A 3ZXYA 4GI3A 5SICE 4DJ5X 2V8BA 3AJ9A 4LVNA 3GT3A 3OSZA 3LXUX 4M1ZA 5AVKA 2PQ2A 3SQOA 3DVQX 3UNXA 3VTAA 5JMOA 2XTJA 1SBTA 1SUEA 2Z58A 4AKSA 4CFZA 1WVMA 3QFHA 3GCXA 1S01A 1C3LA 1CNMA 4KPGA 1AF4A 1Y3FE 3VV3A 4DWWA 2Z57A 4WOCA 1BFKA 1TECE 1C9JA 3DE1X 1SUDA 3F49S 4NMXB 5AQEA 3TI9A 2G4VA 3L1KA 2X8JA 3TI7A 2ZWPA 1YJAA 1GCIA 3A3NA 2IY9A 3DE5X
chains in the Genus database with same CATH superfamily
1X38A 2Z8ZA 3O74A 2H9AA 1SFRA 3THRA 1K5GA 2IVFA 5EP2A 5FDFA 2J0UB 5KOJB 5L6LB 1R1DA 2OV1A 2R6ZA 4JQSA 3COPA 2MYUA 4F85A 3BWCA 3OT4A 3RV4A 5LYJA 3WRYC 5CEEA 3NJ8A 3NBFA 1A76A 3NDJA 1PG5A 4PXAA 3RSQA 1GQYA 1GKYA 4BV8A 1WTCA 2WAAA 4XOUA 3L5OA 4KG7A 4GM4A 4KQEA 1S7CA 3QVKA 4BQOA 1BO6A 3WYDA 3H9QA 2HLHA 1K3UB 3ZKAA 2GHIA 1KYTA 2O3TA 2Q49A 2DU8A 2XQFA 1EK0A 3GD7A 4M55A 3UEOA 1ZCJA 4KJZA 3BICA 4EOGA 2VP3A 1SEVA 3WYGA 2OGTA 5KVAA 5F1OA 2PRZA 1WS6A 4OB6A 4BASA 1U8CB 1ST3A 5FUWA 1D9ZA 3BFVA 1PR3A 3UJCA 1JKJB 1CPYA 1W0JD 4BWFB 1ZD8A 1HKUA 1MVOA 2C2YA 4BUJA 4EY3A 3LOQA 1MU0A 4BQIA 3HY6A 2QTHA 1IU9A 5IC5A 3IYLW 2EBHX 3A6HA 1G41A 1XQXA 2P68A 4EGSA 3A2MA 2QW0X 3GUYA 3P7MA 3A04A 1SWVA 2IYLD 3GLGA 1T5LA 1J8MF 2ZXFA 4BFWA 3IULA 2FEOA 3DL0A 3AK4A 3ABZA 4R0NA 3KR9A 3O84A 3IMKA 5HVNA 1GPWB 2ZBVA 4GUAA 4HDMB 5HQJA 3WGGA 2HSEA 2F3PA 2HT1A 1N3IA 1UDAA 3ZHZA 4R8VA 3LA8A 3I6YA 1O6GA 3NYRA 3G5AA 4JI1B 2JIMA 4P81A 4WXHA 4AS1A 2C2MA 4RV5A 3OJEA 4MQLA 3MTQA 5KSPA 1WHSA 1FB5A 1E1RD 2JJ8A 3QPCA 2IBTA 1VE6A 1P9OA 3R7WB 2B5VA 3HBNA 3R5TA 4J0JA 4DA4A 1PE0A 2W6JA 2CMDA 3LDHA 4ZV9A 1JG2A 3LT5A 3OQHA 3WR5A 3KQNA 2HLDD 4F4HA 4QPCA 2VT6A 3OEYA 5KWVA 4DKJA 3QFFA 1UM9A 2W2XA 4EHNA 1LFAA 3FMVA 3KQMA 4RD4A 3U37A 3HA2A 1E3DA 1FTQA 3IKMB 1E94E 4IRUB 4Q4HA 3WC4A 4P4LA 4X71A 4YRLA 5CLGA 1O4VA 1T35A 4ZOAA 5AD1A 3D3QA 1K89A 1O96A 3T9EA 4FW9A 1J0AA 4EHKA 3OJXA 1DMSA 2IHBA 3EA5A 2P4EA 5I7HA 5JJ5A 5AOBA 5TMEA 3EW7A 3TQFA 2XE8A 5FOSA 2AG5A 1JEQA 3NIGB 1KR5A 2FAXA 3K1TA 5DP1A 1EA5A 2IYEA 5K51A 1CUDA 1VB3A 3GT3A 1NN5A 3BTSA 2RGNA 1B8PA 4O6VA 4LJSA 1U8EA 1U1CA 2XTJA 1C41A 4N12A 4WCFA 5B58C 2H5EA 1F0PA 1Q0QA 5FWXA 2BKAA 2QX4A 2C82A 4X20A 4II7A 4BQSA 4BYGA 2XXAA 1LXCA 1PGQA 2X6TA 4S1PA 3DDUA 3ZLTA 3QKSB 3BS4A 4GR4A 2CLOB 3D81A 3L7OA 4JLAA 4S3MA 5E95A 2G0TA 3P9YA 5FR1A 3RYHA 3ZYCA 2X23A 2AN1A 1P7CA 2CJYA 5CLJA 5FPKA 3R8CA 1E7SA 2ZRBA 2DQZA 3LBIA 2RB5A 3P9CA 4B34A 1VKNA 4HAWA 4CLOA 1Z6ZA 1KWGA 5CA1A 4MDEA 4L16A 2RK3A 1DC6A 2H4JA 3A6KA 1QLJA 1G9TA 1VJ5A 5EEGA 4EKIA 4FW8A 5AHXA 4GKKB 3V32A 2LXNA 2PKWA 1ZWLA 1YO6A 3RKUA 3AVUA 2A2ZA 3O9MA 1GZ6A 1UBEA 3VTFA 3MT0A 4ADSG 4B1FA 4LSGA 1TLTA 1TIBA 2Q6IA 4RPLA 4C14A 5IYZF 3PUZA 1KVSA 2A9FA 2C61A 4MCAA 1PEAA 3V1LA 3SWWA 2ZB4A 1G6Q1 1J0XO 4OL0A 3WFIA 3PEUA 4Q4DA 4XZ3A 2B1QA 1VL1A 2IQ5A 3ZK9A 5JW6A 4JYZA 4GYJA 4YO8A 1OFUA 1G5FA 2QDXA 3O73A 4BX8A 2JI4A 5CB4F 1XA3A 4GMKA 1TKRA 3JQAD 1F2UA 4FYMA 4J1TA 3X43A 3SX0A 1QRSA 2B4KA 1VC2A 2COUA 3C3AA 1C7EA 4KFUA 4UM8B 2VA9A 4KYVA 1L8OA 4EVSA 4NG4A 4UNSA 3PC4A 4MEAA 4LYGA 1W85B 2XKAA 1DKRA 4M7OA 1IJBA 3GFGA 1CP3A 3ZWCA 3DKVA 1X9GA 4Z3OA 2PJZA 1L5WA 1JDJA 1QHHB 3I72A 2P0AA 1Z2OX 2ATIA 3EFBA 4FQ8A 1P2UA 2K7ZA 1X1SA 1JHXA 2WF9A 2YNMD 2RCYA 3GUCA 4NOJA 4HTAA 3W0LB 2RGEA 4O2BB 3BGOS 4WXYB 3FZEA 4IJ5A 1IWPB 3WFJA 3CWQA 4J4HA 3CJTA 3TS1A 1NNEA 2GDJA 4P4SA 1HYHA 1WVIA 4BNKA 2P6PA 1LPOA 2PUWA 1IZ7A 1QONA 4QNRA 2K6GA 4R2LA 3UG7A 3W3AD 3RSGA 3B1ZA 3KZKA 1E2LA 5AT1A 1K4YA 3H4MA 1SU4A 4J3NA 1AF7A 1B3BA 1C8BA 4GE3A 1JSLA 2QM0A 5FWYB 1V4NA 1FQWA 4JYMA 3VTKA 4JT4A 4GEGA 2EKQA 5AM2A 1KZ1A 4IEEA 3AJEA 1NUAA 2W58A 4AUMA 2BRUA 3LDAA 1XTKA 2IXEA 1YVEI 2DFNA 1JEEA 1BQEA 3QE3A 4FNAA 1O5IA 2I2FA 2VHYA 3P4XA 1JE1A 2OCLA 4U0JA 1LF5A 4OU4A 4R1TA 3I9OA 1QGZA 1L5YA 3KOMA 1XB2A 3LK7A 1KKMA 5CD1A 1CW2B 2H1FA 2QL5A 4MYSA 4BMDA 2WJAA 2Y93A 3RBVA 3WLTA 2XGJA 5JAUA 1EUDA 2O1XA 3EIOA 1GGHA 3GJTA 3PVCA 5DXAA 3TLYA 3WBFA 4C04A 4HX9A 1PNVA 2AXQA 4NC9A 2BDEA 3KQUA 2ASEA 3QJ5A 5L4NA 1R9JA 3DP7A 2ZPTX 5DYTA 2Z2JA 5CDHA 3VAYA 3N6VA 4PNPA 1S4QA 3FPJA 4C7VA 4FHDA 4DUZB 5PGMA 2ZWVA 2A1TS 2GAOA 3QK7A 2CL6X 2B3DA 1TLLA 2IHTA 3NONA 4WLNA 1EYZA 2PMDA 2QTZA 5CFLA 4KVFA 1GAEO 3V4LA 5HJ2A 3SQNA 4OXYA 4MV9A 4C0KA 2ZTLA 2XUJA 3I1FA 2Q29A 3DNPA 1P2VA 5AXBA 4D81A 5I3ZA 5K8TA 4BRSA 3GG9A 3AFHA 3V8BA 2ZRQA 3DE7X 4EJ2A 5CDSA 1EDZA 1W0CA 1XT6A 2FPIB 3DVAA 3UMVA 2LRHA 3SHVA 2C83A 2J3KA 3GL9A 1Q74A 4JMLA 4NDZA 3UMMA 3GLIE 3CEHA 4IINA 4FCVA 4ZTZB 2LBPA 1PDOA 2OBFA 1MJ5A 5HPYB 1X9HA 4RQUA 1YQTA 2HA0A 4LJ5A 4DMKA 1Z0FA 5BN5B 4WVLA 4JUCA 4MUIA 4BVLA 4CMIB 3NHFA 3ORQA 3VR5D 4YAFA 1UC8A 2ZATA 4FQ7A 4FZVA 1JBKA 2VWGA 3D64A 1Z6QA 3DOOA 3OG9A 1RRGA 2AC7A 2WNHA 2WZQA 4DA0A 3ZGZA 2FR1A 3HKEB 3TRFA 4I9HA 1GV1A 3EEBA 1ORTA 3MZ0A 4L4ZA 1U90A 3PGJA 4RSHA 3DCYA 3R23A 3SN6A 2W48A 5KC8A 5HRUA 1PNRA 5HDBB 3R3XA 4R9NA 4Y0VA 2FW1A 2FZ4A 2RGYA 3KVRA 1M8JA 3PFGA 4J03A 5TF0A 3U7RA 2CXSA 1QE0A 3M3HA 3IC5A 4FFSA 4X1IA 1KIFA 1RKBA 1WSWA 3QKIA 4ITUA 1XDDA 2KYRA 4J4BA 4R4JA 3MHTA 3LECA 6LDHA 1XZDA 2VUTA 1RJFA 3AHIA 1VXRA 3E48A 5DE3A 3TLCA 5DNDA 4PBSA 4TTJA 2GK7A 3HPQA 4MW6A 1NQVA 3K9WA 4L5BA 4EO7A 3GH1A 2YWDA 1MENA 2YN0A 1PL8A 2QTWB 5DU2A 1EZ1A 3SEAA 3VR3A 4M0CA 2D5CA 4CR8A 1AGYA 4QU8A 1DQRA 3PWZA 4EY5A 4ZMSA 2G5PA 2ALJA 2YR0A 1ONBA 5A5VA 1F8GA 1O96B 4L7QA 5D5PA 3R9IA 2VVTA 4Q3LA 5B3AA 5K0TA 4MYCA 2UU9B 1EVKA 4F2HA 3CZPA 2JL1A 1TXGA 4RTSA 1S1CA 1O57A 1UDCA 2GFHA 1K97A 2GCOA 2RI1A 2W2TA 2QN1A 3DH0A 3G13A 3L1JA 3P45A 3BL6A 4O1MA 4PFJA 2X6QA 4NU5A 1DXYA 1N4DA 4YMIA 1FJXA 1E96A 4C29A 1Z4NA 2TRSB 3SE0A 3N2IA 2BWJA 1VJTA 2G4CA 3GYGA 3ZHYA 1U8AA 5FH9A 1SR8A 4EQ6A 2Z9CA 1IONA 2EL9A 1YQ9A 1JDNA 2C3PA 4IGIA 4BEWA 1CUGA 1U3CA 1N6PA 3NBYC 4PO9A 4U9IS 1KP2A 4WWHA 4DHEA 2H63A 2VNAA 3QITA 4WFJA 4O1HA 1NASA 1Z0ZA 1EJ2A 1E0JA 1YKGA 4FI3F 4TM8A 2FMHA 1YB5A 3P2OA 4YCCA 5BMVB 3QMMA 3SX2A 1QYXA 3IP5A 3F46A 3IHKA 3LQ1A 3UJHA 5TDHA 5K8JB 1JG3A 1CCWA 4QTZA 4URFA 3D4LA 3KEOA 3U7GA 3G5LA 1M73E 4ZAGA 2YXPX 3OZGA 4BB5A 4D3DA 1NW6A 3ZWYA 1P80A 4ZA2A 3MAGA 1E2NA 2YJZA 2NNLD 2Q5JA 1Y9AA 4O4HB 3GN1A 1CT9A 2Q1WA 3EGCA 1YMUA 1V8FA 4CMJA 4IUYA 1CNEA 4PZDA 2ZTSA 2VI5A 4UMEA 1QO0D 4A73A 2GN2A 3HJNA 4FIDA 3L7AA 4IMIB 3GT0A 2XMBA 5G4KA 3TSZA 3A3YA 2H2FA 3UBMA 1E6KA 3RVKA 4HLCA 4KRXA 4YFVA 4I1SA 4HB3A 1U6JA 2N46A 4JIGA 2JKVA 1P4JA 3HB7A 5F4ZA 4BFVA 1E2EA 1YDGA 5KJEA 2BFPA 1S9DA 3TM5A 4DXDA 4ZI3A 1ATIA 1KO7A 3FUVA 3IBYA 3MMZA 5TJHA 2A30A 1ZYUA 3BHIA 5IHXA 2PBFA 4YI3A 4MW9A 3ER6A 1XAIA 3UUFA 1SOMA 4FKMA 1LPNA 4PSAA 3AM3A 3R2JA 3IP6A 4HWGA 3F97A 4QFBA 4XWAA 2QNBA 3CH5A 3P32A 2OQRA 4PPNA 4UDNA 5TSDA 1JTVA 1X7XA 3LW7A 1VJRA 2HN9A 4FZ5A 2HHHB 1G3MA 2GZ2A 3OOHA 1RZRD 2ONCA 3K70C 2F4VB 2PV0A 4MRNA 5P21A 1IHUA 1X3SA 1HT2E 2AQHA 2XGMA 3TW8B 3QYFA 2XYGA 5DOZA 1O0SA 3Q3IA 4C5BA 3Q9SA 5BQOA 4FHZA 3Q41A 2JGLA 2A9OA 1UJBA 1G64A 3OC6A 4C4AA 2VHCA 4NPCA 3T7EA 4M9RA 2F8MA 4REQA 5ALOA 5I9BA 4UHHA 4JQYA 3PRJA 5CXSA 4M54A 4AC9A 2VLBA 1LQUA 4ZAWA 1KQFA 3DUFB 5FLEX 1XCLA 4LOKA 3AX6A 4LRXA 2A84A 1DTWA 1VKHA 3K1AB 5A71A 2EP5A 3X1ZA 4DTIA 5L3VA 4C4OA 1KI6B 1B6GA 2ZBGA 4LJRA 2Q6OA 4YMSA 5EZYB 4M4SA 3EIWA 4GNRA 5BURA 4KQWA 4EA7A 5LQCA 5K0CA 4PIVA 1SIUA 4BNTA 3FD8A 2VTBA 4D4LA 3FNHA 1SQSA 4OHVA 1A9QA 3MTDA 2J0EA 1OWOA 4PTZA 1IN8A 2PL3A 4PF1A 1JPJA 5HG0A 4HWPA 3F7MA 2IOYA 4Q9AA 3Q8MA 1X6VA 4IQ8A 1T25A 1ZLXA 3T3MB 4BWGA 3U4AA 4S1VA 3E18A 2YQ5A 3WHPA 3CZ4A 4XLLA 4AJ9A 3QVWA 1NA5A 5JSHA 4V24A 1W1UA 4UVIA 5ESDA 5ABPA 3FSGA 3VO9A 4BXOB 3Q88A 3E0QA 2Z4RA 3KSAC 2WYIA 1D2HA 2H48A 2I29A 1BU5A 5FOWA 3KXIA 5DV9A 2OGWA 4PAWA 1FFXA 2H5JA 2NZWA 5ECDA 1QV6A 1CLUA 2HM7A 1Z7GA 1XI2A 1GQFA 1L8QA 1P81A 1XRQA 4MQBA 3CLTD 4OK5A 2X0RA 4LMRA 4NBVA 5IARA 4C0WA 1U2ZA 3D7KA 2C7GA 2J5BA 3BKWA 4BO2A 1T4GA 3URKA 3BXGA 3BSYA 1G8FA 2YWBA 3SXJA 3E9CA 4DV6B 3HK2A 4P3NA 2JIQA 3OCVA 2AZMA 4FYIA 4QUJA 4TSKA 4MUNA 2YJGA 1WP9A 2ZSUA 4MRMB 4OHBA 2PZLA 4BQRA 4WADA 2PZKA 4A1FA 3UWKA 3I0MA 4K1LA 4L08A 4NZMA 5HJ7A 5JXHA 2BI7A 3GZJA 4DHWA 2G17A 3KG2A 4BVKA 2WKRA 4QE3A 5C18A 1N3BA 3MTIA 5EUBA 1BSVA 1WABA 2ODBA 1NBMD 2P3QA 4H18A 2FZVA 1GL9B 4DE5A 3DHWC 2PGXA 3WLOA 3LV8A 2VFAA 3CF4A 3LWBA 2HF9A 3QKTA 4OYRA 3D1LA 2AFHA 2PD3A 3DFFA 3ZKWA 1RE1A 2W4IA 2CGEA 5FO0A 3RS9A 1BN7A 1AZSC 1BE0A 3AR8A 3H1FA 2RJNA 1B15A 3ND6A 3EOZA 3EARA 3PCRB 4MV0A 3I1IA 1D1PA 1R4MB 1OYWA 3C5WP 4XUCA 5HE8A 1XEWY 3F6YA 3O2JA 4LGMA 3T1HB 2V74B 2C9BA 2G09A 1CV2A 4N7JA 1HFKA 2NX2A 3B3FA 4LAFA 1VE5A 3KTFA 4IXWA 4MOWA 4AVYA 4BWVA 4MWEA 2I4NA 2WD7B 4BMXA 2REXB 3DLPX 1P8JA 3JRXA 2PQ0A 3EVTA 2H5LA 4QM7A 5JHHB 1U99A 2B20A 4KEAA 1YFLA 4A91A 5CB6A 5EHZA 5AI9A 4G1FA 2CD7A 5KYTA 3G2IA 3F4KA 4B31A 4RPHA 2ECQA 3QPUA 2QV0A 4MRSA 1W88B 3W5UA 3TNDA 2Q3JA 2ZYIA 3GEGA 5EIHA 3ICWA 3TIXB 4FYXA 1T3GA 3PENA 1PLJA 2RBEA 3G8BA 3D4PA 1FSGA 1H65A 2IYFA 3KQLA 1FLVA 3G7UA 1O58A 4OOEA 5LN1A 4OAPA 1QQ6A 2NUTB 4FNOA 3ZCUA 1NHGA 3KDAA 4X62B 4WZAE 3RHZA 2G06A 3ILSA 4HBGA 5ICEA 1XAJA 1XKTA 2YV3A 1E3WA 3KUKA 4WCFC 2GESA 4AF8A 3M0EA 1X8XA 4BX0A 1ZN8A 4C1BA 1W44A 2P4SA 4DC1A 1JMYA 4LOLA 1WBJB 2CY0A 4AJJA 2D2EA 3NTQA 2ONZA 1XZFA 1CWUA 3ABQB 2F1OA 1DCMA 1GYPA 4DDHA 4YRGA 3KKKA 4MCJA 1K6EA 4Q9IA 4I3GA 1YVPA 1OIWA 3NGXA 1TDJA 3QKRB 2HD4A 3KCQA 2XJ9A 2ZDQA 3BK2A 3VMMA 4MUXA 4D98A 4H3SA 3ZH9B 5A4DA 2OZLB 4PVDA 1WZUA 1J25A 2GVNA 1Q1QA 1TMGE 3U3JA 5CFNA 3HYNA 2Q4OA 2JFZA 3GO4A 3OQPA 2FJUA 4H60A 2AR7A 4FXOA 4JUDX 4MR8A 4TQGA 1K06A 3FKJA 1D5CA 3H87A 5ARBA 5JQGB 2RC5A 4NYJQ 1MNQA 2H1VA 4QYTA 4YBZA 5BQ3A 2ZFUA 4BLUA 5CYGA 5A1JA 3O2SB 3DMTA 3SJ7A 3COYA 4AWAA 5ENDA 1KY3A 4X8LA 5EE0A 2X0JA 5JSQA 1H66A 1US8A 1SY7A 1NONA 3N76A 1GQRA 1Z35A 4QXAA 3WG9A 5C8YF 3P9RA 2B6NA 5E8RA 3K5IA 3C6BA 4ASUD 3CV3A 3A6PC 4I46A 1I2CA 5IKEA 1JYFA 3TTYA 2HV9A 5BW5A 1SHUX 4OQPA 4OAOA 1MFPA 2JLXA 4KCGA 1RJ9A 2EQBA 1IK4A 2ODQA 2O1EA 4EG6A 3L77A 4KPGA 2XZLA 2D1RA 4R2XA 2HNAA 2IEAA 3PXEA 1JLHA 2H4XA 3A1FA 3INRA 3WRXC 4HMOA 3KT8A 3WMWA 3W1WA 1J2TA 3OZDA 4C3VA 1X15A 2IA5A 1X92A 4LGYA 3ZWAA 3HN6A 4G67A 3ZZTA 1VYHA 1GTSA 1R12A 2ETXA 4G5FA 2B8WA 4C06A 4JYBA 4E5NA 1BVYF 5ULLA 3RR2A 4KQXA 2C2XA 1MAHA 3RLIA 5F4BA 1MZPA 1EP9A 1JNYA 1AKWA 1HDRA 4QYWA 4KRFA 3E9YA 4UE3S 4Q02A 3OX1A 4RZXA 3RSFA 1CB7A 3UG6A 4N9WA 3UK0A 3GDGA 3HRIA 3D6AA 3GJ0A 2Z2XA 1L5FA 1FVHA 5JVDF 3TXYA 3NHSA 4U39A 1NJFA 3WKDA 1OHHD 4HC4A 1ZMRA 3O3CA 4V02A 5LQKA 1TM7E 1XMQB 4J3JA 3KPVA 4Q3EA 3QNMA 1MKYA 5HX7A 2JD2A 2YV4A 5B64A 3L7JA 1XE3A 4NG5A 3JATB 1R64A 2JFFA 2VK2A 3NV7A 4YR9A 1PEDA 1VECA 3LPDA 1PFVA 4MVYA 4JJGA 4DAOA 2V98A 4HPJB 1ZSVA 1J99A 5A0FA 3MUEA 1EFVA 1KOFA 1P8AA 1PX0A 4G4JA 2RGWA 1LV7A 2A7XA 2RCNA 1RE0A 1U94A 1F0YA 2IZ5A 3AHFA 3HE3A 1D1SA 4OYLA 1XZHA 5TPWB 4Q7QA 2RGCA 3DHNA 1JG6A 1Y1RA 2BLNA 2PU5A 2B1GA 4KWEA 3FW1A 3RHSA 4YI5A 2YN2A 1M0TA 3U7JA 2NU9B 1NUHA 4XQGA 3EYWA 1EFAA 3L93A 1NQ5A 3EQ9A 2I9KA 3LQFA 2WJIA 3FIJA 2FGJA 4YXWA 3VOBA 2XCRB 5A5DA 1KMNA 3HP1A 3NUQA 4FYHA 5EIXA 2G5TA 4OPMA 1QZTA 4IMRA 3ILYA 1H9CA 1MA0A 3ISTA 2JJYA 3A3PA 2XA9A 3NB0A 1HE4A 4NY1A 4AECA 1RAHA 1E92A 4CCWA 5ICGA 4AKGA 3FUXA 1PJBA 4BL5A 2PKYX 1NYQA 3ZIDA 2XJ4A 4JVSB 3VR4D 5JEEA 4DADA 2QUZA 3S44A 3E7DA 3V4ZA 4L7VA 3BK1A 2JLCA 4FFPA 5JWHA 4AZ3B 1ZGAA 4NFSA 3W5JA 3EEOA 4GC5A 1SB9A 2NZVG 4YVFA 1CJMA 4TGLA 1IYZA 1N25A 5COQA 1PT9A 3U3RA 4C43A 3QUAA 4YJGA 3LPNA 3VNVA 1UZUA 4OI0A 1VBFA 1RYZA 2G0AA 4DV1B 2WSSA 3HBLA 5DNUA 2WU8A 1V1MB 1DO0A 3I64A 3PTLA 1PZNA 3RWBA 2VPTA 4DF3A 5ADWA 1HX7A 2FRDA 3MAAC 2VWHA 4PC3A 1M76A 3ZHBA 3IR7A 2UZ1A 4HT3B 3DR3A 1E4EB 4K88A 2VSYA 4J8PA 1DMRA 5DBOA 3PJGA 4AL4A 5CVCA 2I4OA 3IAUA 4ZVRA 3SXUA 2EV9A 4ZVLA 2X0EA 2NUPA 5BNZA 1CX9B 3SS8A 3QP9A 2HSJA 3KR2A 3L1HA 4KXLA 4D3YA 4J91A 2CXTA 2R751 5IMBA 5AKHA 5C1BA 1JXAA 3AR5A 3PI7A 1C9JA 5IF9A 1VA4A 2H11A 3STYA 3V80A 2GBIA 4CM8B 1KDZA 1PBNA 2QV7A 2PJRA 1FP4A 3ZCQA 4F9FA 1G8HA 5G1PA 4EW3A 1GQQA 3LUDA 4OFBA 1BXZA 1EFCA 4XDZA 3VKFA 1DBRA 1RRVA 1T9ZA 2XT6A 4AB1A 4B3DA 3V33A 1XEWX 3O4RA 5FNVB 4Z8XA 1VIDA 4CMGA 1ID1A 1XKQA 3H6KA 3HL0A 1VHLA 4QXPA 1HK7A 5JZBA 4C7OB 2QTGA 3PFIA 1UKEA 2HK8A 2ZWMA 3WJ2A 1J5PA 1ZOSA 4ZOCA 3D7LA 1EFPB 1YJQA 1A98A 2F1RA 2PRIA 2FMIA 2ZYDA 3I2HA 4MR7B 2IV7A 3BX1A 1P1HA 5FBVB 2WZCA 1YD7A 3FWPA 1YV9A 5T4FA 1Y3CE 5E6RA 1WCYA 2OFXA 4ZREA 2H1OA 4C87A 1H85A 2ZROA 4BOYA 4BX3A 4RJLA 1GHTA 1PS0A 1QHYA 3VC1A 4QBTA 1BS1A 2WD8A 4FZJA 5SY9A 1VPWA 2Y0PA 4ENVA 4TLLB 5IXYA 1D2EA 1LY1A 4PYKA 3WK8A 2QUKA 5LR6A 3AERA 2QZ4A 3R41A 1PX2A 1DAMA 2PGIA 2ACKA 3DW1X 2P91A 2QLLA 3F74A 1M6NA 3B13B 4JX8A 1TF5A 4PSUA 4B3IA 4KPEC 2A7QA 1ZJWA 4KIFA 4MUEA 5TEWA 3R3ZA 4UZSA 4WK0B 1SU7A 3G9XA 4YRKA 4HWSA 2OZLA 4V0ME 3DW3X 2DRIA 3S5UA 3ZHXA 2HK6A 4GLOA 3PYXA 1EX7A 3GLGE 1RPNA 1NJ2A 4DL9A 2O48X 4C6SA 2IIVA 1RZUA 3ZVKA 4HPXB 4HTFA 4S0XA 4OLFA 1FSZA 2UYOA 1YB2A 3I92A 3R0VA 4Q82A 3DKRA 4YB8A 4FHFA 3OPVA 1ZXXA 4YYEA 4RMJA 3GJ4A 3T7IA 4J0GA 3W9UA 1IZZA 1AKRA 1VL5A 2XYHA 3QHQA 3TNLA 4I6EA 5EWMB 4D96A 5EJMA 4Q66C 5LZ7A 5LDDC 3PX3A 2JHCA 2PBRA 1Z9BA 2UKDA 3R9KA 3CNHA 2N42A 4NOLA 3LGSA 4JSRA 4AZ0A 1NXTA 4Z4GA 1U2RA 1CRQA 3AEQA 1JIKA 1PV2A 4MS4A 4CIAA 1IUKA 4HAOA 3TBFA 4Z4IA 1RQ7A 1Y4AE 1JZQA 2QW8A 2H07A 3TMYA 3TB4A 1TZCA 5EFZA 2WLTA 3UV6A 1EFDN 2W2OA 1OWMA 3Q1KA 4TYYA 1NXOA 2GK4A 2VYVD 4G85A 2PUCA 4OCZA 3R3UA 4M7WA 2J6IA 2R48A 3QF7A 1NI3A 4E2XA 9ATCA 1CDOA 1Z88A 1U0GA 3D59A 3H5IA 4M86A 3T06B 5I01A 4JU9A 2D7CA 2YXEA 2DYKA 1EM8A 4GXNA 3B6JA 4FFDA 3SDSA 1G8PA 1QHFA 3SQOA 4E31A 3CY6A 1AHIA 5AK6A 4G5HA 4RGBA 3TM4A 5C52B 3K09C 4DJTA 3ZVLA 3E6AA 4MWTA 4L8GA 3UKDA 1ECPA 1DAHA 2VT2A 4R8RA 1SRRA 1XYYA 4KL8S 4LPSA 2Z57A 3LHDA 5JZVA 2PSEA 3LMKA 2IZZA 3RYIA 3RAFC 1T2DA 3RVOA 3AR4A 1PVOA 2D0DA 3V6LA 2CNDA 2X7HA 4DLNA 2CWWA 1ZBQA 1SO8A 3L4KA 5A4IS 3TX2A 4ZZ0A 5JS2A 3T1VA 3T41A 3UAGA 4FDAA 2XRYA 5J3JA 2O0LA 3AVVA 5AI8A 5A3RA 3BA6A 4K1XA 3A1UA 3DFKA 5CNIA 2C42A 3C15C 1B23P 2CUTA 3NCHA 5F7OA 2KX7A 1RXSA 3C2QA 4LK2A 4B3XA 3NH6A 1NLFA 2I66A 3BORA 4FSXA 3OZ7A 4WVFA 3UJ8A 1HRKA 2FPPB 5A9TA 2IRWA 5F77A 2Q8NA 2H51A 1YFKA 3F7TA 4DA7A 5ICSA 2GEDA 3C6YA 2QN7A 2HXGA 3NRJA 1Y98A 4DA8A 4P98A 1S8OA 1ENPA 1T8WA 3MJRA 2LDBA 1QIMA 2VR1A 2GKSA 3LQKA 4JOBA 4F5EA 2DHQA 2V9CA 1PHRA 4YBRA 5ALWA 3UJ6A 4D44A 5B57C 1V37A 1GZDA 3GK3A 3IHLA 4O4IA 4ENRA 4NK4A 3VHXB 4C89A 4FZRA 4WZZA 3QX8A 4RQTA 4MVCA 4RHEA 5G4KB 4KGDA 2CBGA 2C7OA 3AGQA 4ZRMA 1OR8A 4RH0A 2XYPA 5K0GA 1JZSA 2JZOA 1WPRA 4DLKA 1BTOA 1XHLA 2G9VA 2RJ3A 4IXMA 5JMTA 4IDHA 1ULUA 2YMPA 4G0OA 1IQUA 3WBJA 1TUBA 2C5LA 4HQ0A 3QUBA 1TYAE 3LUGA 2Q0QA 5HOQA 1JB1A 1O4WA 3PVSA 1V1RA 1GPNA 3DBOB 1QGYA 1QFXA 3G3EA 3PQ3A 3ZNPA 1E2KA 2Q0SA 3DVAB 3Q0IA 4X45A 1QZ3A 1P7ZA 4BGIA 4UUQA 1KS2A 4OX9Y 1Q57A 5GZ1A 4EPRA 3E61A 1Q1EA 1V7ZA 2ZSIA 4OYYA 4D0NA 4D9IA 5B6PA 3ROZA 1JHZA 3SZOA 4DQLA 2I3GA 4MLZA 4ATNA 3GGPA 1KZ9A 4MKGA 3AY6A 1F48A 2OGUA 3EOBI 3INTA 3OT1B 4F6RA 1HT3A 3CF6R 1ZESA 3U3KA 1AGRA 1L9XA 3T5DA 2L17A 5BWMA 1WXGA 2WY2D 2Q5LA 4KQ9A 4C4TA 3PEWA 1DX9A 3B1XA 3HJGA 1XCJA 3FYTA 1BA2A 1T0PA 3DMPA 4AZ0B 5CX4A 4EI8A 3IR5A 5AVOA 5TQVA 2B4RO 2WTAA 1YA4A 2A67A 2IU4A 3WJ1A 2FN4A 4GR9A 3AY0A 3HKBB 5FADA 5LZ4A 2J7PA 1TUIA 3Q87B 4NMLA 5A4MS 1C50A 3UMSA 5AO9A 2PMEA 2XMZA 1XQ9A 4O2AF 2W71A 3DR5A 3N7TA 1TB4A 3B2EA 4AXXA 5G1NA 1D6MA 4E5MA 4JN6B 5JALA 2XT0A 1PWXA 3MC1A 3X2EA 2YJTD 5IABA 3E9NA 2IL1A 2X5XA 3VC2A 5DIFA 4DCMA 1PL7A 4CMIA 2X9NA 1Z5NA 1NF2A 4MQ5A 2CW5A 1VKZA 1TC2A 2J9FB 1N2GA 2IW3A 1COZA 1Y1SA 1V2HE 2QTBA 3DAHA 3QXJA 2GN4A 2JASA 2VCHA 4IV5A 3GLSA 4JP1A 4L9RA 2OQIA 1TO6A 5CH5A 5F5XA 1TQHA 4YP9A 3VUFA 3D7SA 4ACBA 3G2KA 3EVBA 1VG8A 3SQWA 5DM2A 5JWRA 1JFRA 3WJAA 1M0SA 2BGRA 5KYUB 4JBYA 5FPPA 4ZJZA 4PN3A 1R9MA 1W46A 3TR0A 1CQIA 1QGED 2W43A 2IUFA 3RKRA 4CTKA 2DUWA 4JAVC 3KALA 4Z7QB 1X1EA 5IBPA 2Y1DA 1KEWA 3E7WA 3AONB 2YFKA 3PF9A 4FM9A 2HJHA 4PLFA 4H1HA 1CSEE 5SZJA 1GNLA 1T1GA 1X7XB 3HB0A 2FWNA 2IYPA 3O38A 1WR8A 3OZBA 3TGWA 4AUKA 4BZPA 3VVCA 3D6VA 2A78A 2I76A 3CVJA 4LSMA 4NBTA 1YCHA 2G63A 2I2BA 4PLPA 3ZLBA 5AESA 2BCGY 1L3BA 4PSVA 4RHTA 3QU9A 3PC2A 1QF9A 4K26A 3T4EA 3P9XA 4CWAA 2Y9MB 1BQ3A 2GVDC 1J7JA 4ETIA 3M89A 4ZU3A 3BUSA 5T5QA 2HX1A 3T1OA 4BTEA 1FFBA 2G28A 2WKQA 5MF6A 3SOZA 2E1RA 2YN4A 1U3DA 1PCXA 1Z4OA 2DTDA 3TB6A 4CR6A 5DTIA 4PE5B 4X5OA 4E07A 2OV6A 2H59A 2KPOA 2QMYA 1JFFA 3FF1A 3FGOA 1QKIA 2JFWA 1RWKA 2XQIA 3QY0A 3BJEA 4II2A 4BGEA 4EPXA 4QHYA 2XRMA 3JRNA 3HY3A 3R77A 4QXRA 4ZYXA 1QU2A 3NCTA 2R0QC 1XTVA 2BE7A 5KYGA 2XUDA 2XPCA 1TU4A 4QOFA 2P2NA 3C87A 1P61B 4ETMA 3HZRA 2WM9B 2GB4A 3KD2A 4G5YA 3BMOB 3CA8A 5D5QA 4D43A 1ESZA 4BNHA 4UBNA 1QRTA 3AIIA 4OKIA 1RI1A 3HKCA 2VWPA 1PW5A 2EP8A 2VJLA 3C8MA 4CPDA 3R5XA 5HQTA 3NV9A 3GCWA 5LDGA 4FFBB 4U3JB 4BO8A 3FHTA 2WFZA 3G8YA 1N8NA 4WMLA 2RONA 2D1FA 2ZXEA 2ZTUA 1CF4A 2VF7A 1R0BA 4G8DA 4UHJA 3SF8A 1E20A 4YDRA 2P40A 3LX6A 4R69A 4BP1A 4KR0A 1EVYA 4Q3CA 2ONKA 3ABSB 3U48A 1H0KA 3A26A 1GCGA 1MO2A 4A26A 5LZ9A 2WHEA 2OK8A 1VDZA 2PLFA 3EUAA 3QOXA 1JAXA 2EJTA 4LCEA 1EFHA 1FP1D 3PWTA 5DTRA 4E12A 4F46A 3TPCA 4FKBA 1XSEA 3ETHA 4E70A 2A0XA 2M98A 3T7KA 1RKUA 3LCVB 5BN3A 2BRUC 3IQXA 3JQ6A 3BEOA 4MS3B 1HQCA 4QXQA 1Y1KE 3E4CA 4UTRA 3IIKA 5KYYB 3IUSA 2RHRA 4ND8B 3E9QA 3GVCA 2PX4A 3PNQA 4QELA 6PFKA 2P7IA 2Z8YM 3OI7A 4PYLA 5DSTA 3UUWA 4CCYB 5M5BA 4G0UA 3UMCA 1HURA 4HFNA 3JQ8B 2BVNA 2BONA 1GTMA 4HV4A 1EFLA 5J23A 1JFTA 3CGGA 2QP3A 3QV2A 3ZWKA 1Q19A 1ZM9A 1Z37A 2GUGA 3X1DA 1Q91A 3W6ZA 3B3AA 4CZ2A 4R1LA 3MMSA 2QIPA 5CDFE 3QG5A 4W9RA 1NX6A 1R9NA 4WK4B 3A8TA 2QY6A 3EDRA 4URWR 1Z07A 2IQIA 4Z86A 3WLPA 4J2HA 4KU4A 4MI9A 3TK1A 4UNRA 3HXMA 4OX9B 1UQUA 3PEYA 1EFUA 1QDEA 1K5HA 2IHJA 3Q2IA 4DB4A 1YHNA 4J9VA 4MWOA 2QMZA 1NL3A 3H11B 3H9CA 1OPRA 1G291 1I3OA 4X97A 2B37A 2DULA 5IZCA 1AJEA 4YGYA 5IDQA 4OHOA 4DV2B 1QU3A 4FLFA 3GLFE 2B9EA 1O94C 4PPGA 1ZKDA 3FSRA 1Z2AA 2M6SA 1BU8A 3WSTA 4AN4A 4YUXA 5C32A 4KZKA 3CLHA 1GP2A 3LT2A 1IXYA 5DP2A 4YP0A 2WG2A 4RS3A 3HCBA 3ZN2A 3JD4A 5LOVF 5J2TF 2C5EA 2D0OB 3QQ5A 3IEKA 3ZCRA 4EQ6B 5DHAA 2IC5A 5EAIA 4HXFB 4XWGA 1MIOB 4B79A 2QPOA 1M67A 8MHTA 3GNSA 2W4MA 4U7TB 4JJFA 2CNOA 5FA5A 1W5BA 4O4JF 1KSGA 5ICFA 3LY9A 3WBKA 3DV9A 4FFNA 4ALNA 3QBEA 5ALDA 1P5HA 4I4CA 1GPLA 4M89A 2Q3HA 3T95A 2F43B 1KK3A 1MEEA 4N01A 3H5NA 3LX4A 4ABTA 2BIFA 4Z0PA 1C4KA 1CY7A 1M1YA 4NBUA 5C35A 3L07A 1ZNWA 1Y8AA 2WPDD 1UFKA 1J8VA 5SYNA 1XN4A 4HEHA 1X74A 4ZC8A 1J49A 5EJFA 1EDEA 1LSJA 3FPBA 3MCWA 2UXBB 4D3ZA 3P97A 1QQBA 5DF1A 5JNRA 2FUKA 4OHKA 1EUYA 5ALYA 1TIPA 5FEUA 4GL4A 5IANA 1QFSA 3CUVA 3OM8A 1TLFA 1Z4KA 2I7XA 3D0RA 3AT1A 1P4HA 4K8RB 3KKNA 1VE3A 4FFOA 5B1YA 2BTQB 4KIUA 3RDPA 3LTNC 1E8NA 4F1WA 4PG5A 3OU7A 4P4NA 3FTQA 1JHPA 4OGLA 5LB2A 5I4BA 2XNDA 2QTCA 5EJGA 4B73A 5E1OA 2Y1GA 3KC2A 1W0JA 4PYOA 3L4JA 3ZDCA 2DPHA 1I3CA 4NZ9A 4GX0A 1TU3A 2NZJA 1KJQA 3T3PB 2AK2A 2A3RA 4MGKR 1Q2XA 3HYRA 4QU5A 3WMEA 4L8LA 2EJUA 1HDXA 2ZJ5A 1RLUA 1QIIA 3QPBA 3HNOA 3KSRA 4QGHA 1LU9A 3UAWA 2EYQA 2B8NA 4Z7OB 3SYRA 1I4EB 2QRKA 1Z33A 2YZ7A 4AMUA 4BMCA 5HYVA 2A5LA 2G67A 2ZUWA 3DGFC 4JL8A 3AOEA 1TJNA 1RI5A 6AT1A 2HHCA 3QBVA 5JR3A 1T4CA 1EUCA 1YTLA 1DADA 5H3CA 4IIVA 4E6PA 4F7DA 2IXDA 4F11A 2AMYA 3SOPA 4IQGA 1UOOA 3L6UA 3FXAA 4F6CA 2GF9A 2ZVQX 1U6KA 5L3SB 1H69A 1E99A 1RVV1 4EHBA 3M4YA 4P7JA 5JJLA 1NW7A 1TYZA 5KX5A 2GD6A 3T5GA 5LYJF 4RYDA 3IUJA 2LVBA 2WJJA 4CLRB 3HUEA 3OOEA 5IHPA 1JYEA 3H75A 3UGQA 4YQYA 3PE6A 4BHTA 4DS3A 2BPOA 4PZ0A 5AVRA 4CIBA 1XVVA 1SXJC 5I6DA 3K96A 1N7JA 4GD3Q 4HB4A 3HJAA 3B9QA 5L7WA 1M5RA 1ZH6A 3NFRA 2CWDA 5I5EA 1P2TA 1XD2A 1EPUA 3HUUA 3L3BA 4FE7A 4QGBA 4QARA 2BGWA 1QDLB 3GLQA 5IJZA 1NUQA 4BP3A 4TV9A 4JGGA 2C29D 2J0SA 2VNJA 4NAVA 3HN2A 4WI1A 4C2BA 5KQSA 1KGSA 1PGNA 2I6FA 4DNOA 1XA0A 1MAVA 2QG9A 1RC1A 3N2KA 1L1FA 2WWGA 1GY8A 1EBUA 1GL6A 4LYAA 3H2SA 5H7XA 5K6TA 1SCAA 4RM3A 1R37A 2RAFA 4PS0A 2RGDA 3RUAA 3IPCA 2OKCA 3FF4A 1PU2A 2BMFA 1GAWA 2XVYA 4BMSA 3U80A 1F0KA 1SQ5A 4FGJA 2PBZA 2R1TA 2X8AA 3G8AA 1XN1A 1EK6A 2AE1A 3R5KA 5DCWA 5HK9A 1TZ2A 1U1DA 3E70C 3G5TA 2CUKA 2Y0CA 3LNTA 1WMAA 1SXJB 5DTEA 1KH1A 1ODSA 3E82A 5ALUA 1QNFA 4BFSA 3G9QA 1Y42X 3PKZA 4Q9DA 3OFKA 4URVR 1DRKA 3TE6A 1CC1S 3ODPA 1R7RA 2W93A 4KTVE 5F78A 4BY9E 3VPXA 4NR0A 4I4IA 3HDGA 5EJ2A 3GFVA 5JBQA 3OUUA 2BEJA 3HEAA 1EWKA 1RJGA 1Y7HA 1IH8A 1LF0A 3AJDA 4US1R 4W82A 1ZICA 1WQ1R 4QSHA 1SBZA 4FUTA 5DBEX 1Z5OA 2N0SA 1A71A 3AHJA 4HDSB 4UXHA 1NUTA 1TT7A 1UT5A 2XGSA 3NFYA 5DNWA 3RROA 5KNBD 5KNCA 4LBWA 4B2LA 1HEYA 3RVSA 5HBRA 1IHYA 1X7HA 1M33A 4KN9S 1T4MA 3ZHRA 1CUFA 3COVA 3W8RA 3A1EA 4MVJA 2OXRA 1GUZA 5FNVA 4TV9F 4J0QA 1NMYA 4N5LA 5LD2C 4IO0A 4FBGA 3HYLA 5T6BA 2QM8A 5INTA 4CF6A 5JY6A 2GN0A 1XDBA 3AZQA 4W5WA 3UHPA 4LOAA 3HLYA 3T1QA 3R0ZA 5IC4A 3TCKA 3FZYA 3TLKA 4KSCA 2P5SA 4LC1A 4BO0A 4EYQA 1KF0A 4MCHA 1QHGA 2HO5A 4MJ7A 2F3TA 3DPIA 4UVEA 3UAYA 1CYDA 2O3QA 4TZ0A 4JLSA 4OQYA 1JHYA 4BFZA 3BRWD 4CN9A 4AO7A 2Q1UA 1EHIA 2Y9PB 4FD2A 3L7DA 3K0SA 3LY7A 1L1RA 1QBGA 2IUYA 3COZA 4FEGA 1XQVA 4BC1A 3T5BA 1NG1A 3SI7A 4LV5B 4DCJA 1W93A 3DYBA 4FB4A 4JUIA 5IFKA 1GYRA 2JARA 1KMMA 5AK5A 3IAFA 1E1DA 3NR2A 4OMCA 4YMLA 5FOQA 3ZCXA 1CP2A 4R3WA 5BYJA 2OQVA 2PSSA 4KLRA 2BELA 2J3QA 6NULA 3MEQA 4YAUA 4R5MA 4P08A 1RAFA 1II8B 1YDMA 1KU0A 2J9GA 3OZIA 3PGMA 1IN1A 1XWWA 1Z62A 3UYKA 4ETWA 2YWFA 1SUWA 3MS2A 1VHDA 2O8VA 1EBFA 3ASUA 4RUKA 3ASVA 1IBLB 4HLDA 1C1XB 3CKKA 4O2LA 3PJDA 4YJHB 1Y7IA 1ZM2A 2WVHA 3TL2A 3IT3A 1CEYA 5BUSA 2XBLA 1Y3FE 1M72A 1JWAB 1RNLA 1I5OA 1T0HB 3BE5A 3GELA 3H83A 3B6ZA 4J2OA 1D4ZA 1IIBA 1MA3A 2RC6A 2C4KA 2SCUB 2VYFA 5FIUA 4L95C 5DCLA 4CMEC 3ZY3A 3RAGA 1J8QA 2DFPA 2MTBA 3EGWA 2OY0A 2QRHA 3O1HB 2VK8A 5I7EA 1S02A 3I2GA 1DQPA 4J76A 5JNUA 2OG1A 4CEHA 3NUGA 2ECOA 5M2QA 1RLTA 4QYIB 4X54A 4BKPA 4N76A 3FOWA 2HGZA 3M4JA 4HYTA 1LBEA 3WWZA 1JH9A 3SIXA 1KEEB 1V35A 2NXJA 4PC6A 3T5PA 3FIUA 3D6MA 4PFSA 4Q1FA 3KQKA 4UUPA 3VPFA 4LWOA 2FHPA 3B5IA 4GKVA 1ISGA 4AJEA 1N1GA 1GL7A 4F72A 5T3UA 2OHIA 1M1UA 4A2PA 2EX1A 4PIPA 5EPEA 2IPMA 4DANA 5AXDA 3FYUC 4LE1A 4KBGA 2L0XA 4QUEA 4F6LA 1OI2A 3ZJYA 2ZIFA 1GQSA 1ECJA 3EVEA 4DIMA 4YH1A 1DWUA 2UVQA 2ZREA 3GQVA 1U0EA 4S1WA 4Y2QA 1P75A 1Z5WA 1Y9DA 2BMDA 4BV2A 1VIMA 3DO8A 5J4VA 1WZEA 5DN6A 3OWHA 1R3UA 3BK7A 3EQZA 1H0RA 4IXTA 4NYIR 4UTZA 4D8TA 3B1FA 5ES4B 2I4LA 3FGNA 4AMVA 2N1MA 4IX9A 1A8HA 1DDGA 4GLJA 4IIFA 3VYSB 5JTUA 3RYCA 2WV9A 5GIPE 3CO0S 1XNRB 1R0XA 2LKCA 3LWZA 1P44A 4JY7A 4YAJA 4EHLA 1TCAA 5HTOA 3MJCA 1I3KA 2FOLA 4FKZA 3KK0A 4X3CA 5ALLA 4BC0A 1H0SA 4V2IA 4ZAYA 5KTTA 2PUFA 1PUXA 3BCUA 3UK6A 1FUUA 2DPYA 3MWYW 2FFAA 4B3BA 1N2IA 5GWXA 3EQ7A 4ALIA 1L3IA 4MKHA 4PAQA 4E7OA 3MTGA 4JZKA 2F67A 5EMHA 4RL6A 5LUBA 3TQTA 5LP6B 2UUCB 2YVQA 5TQ2A 3RC8A 4DDWA 1J4AA 1MF7A 3H2GA 3COWA 2C58A 3U6BA 4N47A 3L6RA 2C5BA 1N5LA 5JPIA 3R6LA 3KVNA 3RK4A 4ZIRA 1RXVA 1Z12A 3H9GA 3DA8A 4RDIA 4M83A 3KKQA 4RX1A 1USWA 5FB3A 1NMEA 5MDHA 3RH0A 3SM3A 4PG6A 4UTVA 2EDCA 3N8KA 2ENWA 4YRJA 2VDVE 1HMPA 4NCKA 4AMYA 4BO6A 5DLEA 4Z2AA 2DF8A 5GV8A 4J4TA 1YK1A 3JZDA 3MF4A 2AFVA 4EG3A 5HJ5A 1BCRB 1NR7A 2Q2OA 2WR8A 3BH0A 4LXTA 2XDQA 1JDZA 2ADFA 4DMLA 1W52X 3AERB 1D8TA 1Y8RB 1TAQA 2C9DA 4EA6A 4YRSA 1F2TB 2OC9A 1Q3KA 2DPMA 2PGNA 1E1CA 1I10A 2HC9A 4EY6A 3O83A 2H2AA 3ET4A 4PFKA 3TLJA 3W1EA 3W8NA 1O9HA 1CIJA 3M83A 2GI4A 4NULA 5GZ6A 3U13A 1RADA 1YI8A 4RVCA 3BL5A 4WXRA 1L6IA 2NPOA 1UFQA 4CM3A 3KM0A 2CK3D 4M1WA 1RWVA 4MULA 5DLDA 3RS4A 3JR7A 3S2SA 4MR9B 4XAQA 1KDRA 1EU1A 3LYLA 1YBMA 1SJ9A 4I3FA 4Q1CA 1KI1A 1HDCA 1U5BB 3G7NA 3GLKA 2AOWA 1BXRA 1MAAA 2YIJA 3IAEA 4U5XA 5KNCD 4JR1A 2PJDA 4NEQA 1W8IA 4MWSA 4PQRA 4ZVQA 3L8EA 1O2DA 3OMWA 4MKZA 1EP3B 1E6UA 1GFIA 2IIPA 2K87A 3KQOA 3PR1A 4UVGA 5IYZB 1PW7A 2W2MA 4J0HA 4KIWA 4W99A 2PUHA 3UAOA 4UAUA 2ZUUA 1VBKA 4B7ZA 1ACJA 7GPBA 2QWXA 5I3CA 1DUVG 2AKYA 2YL2A 3ANTA 4FDVA 1KYWA 1YQGA 4MV8A 3EDQA 5ERGB 3UHAA 4F5DA 1GZ7A 4W5HA 1WRBA 3M34A 3IOCA 4Y18A 2F62A 1ZK1A 3ETDA 4IOLA 2OB1A 4I66A 4L0CA 4OSEA 1ULSA 1VCIA 1OMOA 1MHPA 3KOUA 1GTVA 3M5CA 3RFUA 1BW9B 2ODTX 5ALNA 3T12A 4BNDB 3G8DA 3RRFA 1JT2A 3GLHB 4NLLA 2OCYC 1YONA 3P5SA 3UXMA 4A0HA 2F17A 1SIOA 4KP7A 1NDHA 2J7KA 3TIFA 3HNRA 2HIGA 2DKNA 2XB2A 3ZV3A 2D3TA 4X20B 1OASA 4ZVOA 5CHEA 3I32A 4POAA 3ZEAA 2YHIA 3RYCB 4FSDA 2PMBA 3Q7TA 2EW2A 3GDHA 4TL9A 1RM5A 4G8JA 2W6PA 2WZDA 5AYVA 4EHDA 5EIBD 5CG2A 2C96A 2EKDA 2HMTA 1U5AA 1TUEA 1PT6A 3OESA 1H22A 3ROPA 4G0ZA 3GJ8A 1M8GA 5LZ2A 5MFPA 4XARA 2WJYA 4ZCSA 1BROA 3EY9A 1DP4A 1W25A 1YUMA 1ECFA 4R2KA 4CQJA 5CFZA 1JQ5A 1TE2A 2A88A 4KX3A 3KJXA 1F2VA 2ZI7A 3STUA 4MMYB 1IEWA 2OWEA 4UU0A 3KBBA 4B80A 2XWSA 4ZO9A 1P1CA 3GRVA 3QVJA 1K7YA 3V4SA 3W2GA 4EO4A 1WZNA 5EERA 3ETJA 4ZGWA 1H2ZA 1YK0A 2UAGA 3RBXA 5EJ9A 5J2TB 1SCBA 1V2GA 1LK0A 1E1MA 3FCXA 4HS4A 3OQ6A 3B7WA 3G2NA 3K0EA 4D4MA 1XMVA 3OD5A 4DLRA 5AR1A 3ADBA 3E7FA 1S2OA 5KKNB 5HP4A 3RS5A 2X4DA 4EGFA 3QKRA 1FW6A 1ZMTA 3HXOA 2H7XA 2Q3BA 2ZBQA 3AESA 1V26A 2EAUA 3MYYA 5DJ5A 5IVKA 4ZQGA 2CCGA 1THMA 3IOYA 2HB6A 2XOKA 4Q6BA 1K98A 2AF4C 3N8IA 4RXUA 4BMYA 2ZWIA 1BDHA 1XXHA 3ESDA 8AT1A 1E98A 3TVYA 4X65B 1ULBA 4MITA 4AQ7A 4CTMA 2V7QA 1W76A 4ZVVA 1HDOA 1A5AB 1XNHA 2BEVA 3QW4B 4HMQA 3NHBA 3SF8B 3GNTA 5LB4A 4EBBA 5TQJA 5ALQA 3PC8C 2AI2A 3TAXA 3MG9A 5DULA 2ENUA 1UWCA 5IBQA 2IY9A 4FGUA 3QU4A 5DGTA 4EEXA 2CC2A 4HDOB 3IKTA 2Q27A 3O03A 1L4EA 2O1WA 1U7PA 4MYUA 5AOCA 5CDFA 5GJBA 5K3AA 2XOKD 1NSYA 1G5RA 2HMWA 3QUSA 3BA1A 3BQNB 2QGZA 3CPSA 3C5EA 9LDBA 3NHJA 2PU7A 1XNJA 2IHNA 1XZLA 3BH6A 4FFMA 4Z49A 4B3JA 2Y3IA 4PHGA 3VKWA 1G3UA 3BYZA 4CI0B 821PA 2PMFA 4EB0A 3G1UA 2CJXA 4MI3A 4LWZA 3RHFA 3E81A 4QNNA 5DO9A 5A9SA 2N3ZA 2O0MA 3AUJB 3I0NA 4D0GA 4XGKA 2HDOA 4KO4S 1Z4PX 5SZKB 5M34A 1M34E 4C9BA 2IZOA 3P0FA 4B6SA 4XW2A 1O08A 4M1TA 1NIJA 5A3QA 4HDRA 4YK7A 2AN5A 4R71A 5HWSA 2V7QD 3FLAA 4M3NA 1HO3A 4IDDA 1NBME 3X1YA 1NOKA 3QI2A 5F3WB 2ZYUX 3KAPA 2CLCX 3CZAA 2I7DA 2NU6B 3KLNA 3T52A 3ZDZB 1KHTA 3H11A 3HACA 4IGAA 3UB2A 3ZWNA 5FT9A 1E79A 2FEWB 2GO1A 2X8BA 3BGDA 1TKAA 2QN2A 3PQ6A 1NYLA 4LA4A 5KJ6A 2BFCB 4KNYA 1BEZA 4QX6A 5E0OA 3KV1A 4DG8A 5JSZB 2PK3A 4NOKA 2WNSA 3D6TB 4JYAB 4B3CA 5AM0A 1KO1A 1V6CA 2Z2IA 4C0HA 3NTUA 4E08A 3HZHA 4UE2A 1BX3A 4R2WA 2GWHA 2QP9X 1SCDA 4OLAA 1CQIB 1N2OA 2BHTA 2FHSA 4GUDA 5DGXA 2BGKA 2D1SA 4WKNA 2VXYA 4NP6A 1PG0A 3M6VA 3QGMA 3NHAA 4CLXA 2VT7A 4QJ5A 2HJRA 5JG7A 4DBVO 1UKBA 3MLEA 2IYWA 4FEYA 1CERA 4TXLA 3VNSA 5BSWA 5BVGB 2YV2A 2Z1NA 3RK1A 1EG7A 5EKDA 2QX6A 5C5CA 2LKDA 4WDQA 2BBOA 3FVTA 5J40A 3B3QA 4KOEC 3WLJA 4RKEA 1LW7A 1RC8A 3W8EA 4Q21A 1C4XA 1AV6A 1MRSA 3MJDA 3LWDA 4EPWA 3GGJA 1R50A 2GH1A 2P1DA 2ZCUA 2QJTA 3H0KA 2QMEA 4X1YB 1O77A 3WS7A 5JAOA 1PZEA 5AW5A 1X80A 3K3PA 1HGXA 3H05A 1OX4B 3L7IA 4NFYA 1WDWB 1OOEA 1UMKA 2FSPA 3NTOA 3SE7A 3M1LA 4YQFA 5F35A 1RXCA 3EVAA 4MVJG 2OGSA 3DXZA 4OXKA 1H2WA 3I6MA 3NWBA 2E6UX 1C9KA 4OG2A 3FGZA 3RIEA 2ARKA 4GAEA 3FDFA 3F9CA 3VNRA 3I83A 5HRAA 4JNCA 3G2HA 3PIIA 1SKBA 4P0TA 5FBLB 5A7GA 3VJRA 2PVPA 3PPWA 1ZH4A 3JVEA 3OIDA 1SKYE 1XP8A 3WNVA 2X1LA 4MHOA 3A6EA 1AZWA 3NORA 2GMWA 3HCPA 1WVMA 3VI4B 3W7AA 4EHFA 3W7BA 4KN6A 3C7TA 4QQKA 2Q4DA 3R3WA 1NVKA 1VYUA 3I6ZA 4QQFA 4RFSB 5GONB 1F7VA 3K09A 1SK8A 4KFSA 3PB3A 2VDQB 1AUXA 1VJ1A 5DBFA 2AG0A 2I2AA 1K3TA 1E1YA 1O5TA 1ADGA 2UZ1B 3QIVA 4X1KB 1I32A 4Q7KA 3Q0EA 4DR7B 3OU2A 1L7XA 3PC8A 1M6YA 4H6PA 1NUSA 3ZZMA 5EMKA 1H2YA 3HFSA 4UCWA 4D9NA 3BG5A 3PFNA 5FKJA 5CDUA 1MBZA 3LCCA 1NP3A 5E7QA 2BV3A 3FNEA 2OCDA 1PLKA 4WGFA 1AH2A 1RJWA 2WYWA 3N75A 1CUJA 3CEJA 1H6CA 4K9OA 4CEIB 4QGGA 4N3AA 1CFJA 4WTOA 2HU8A 2G83A 4I7EA 4MVXA 3RCBA 1HBJA 2YC4C 2IPOA 1ODJA 4NVRA 3OSUA 1IRIA 4CR7A 3ZK8A 5G0SA 2JNWA 4DEVA 4QT0A 1LQTA 1Q7EA 2GCOB 3R24A 5HM8A 3FN4A 4NYJR 2PRSA 1P0QA 4PYNA 1LC0A 2YMLA 4IFEA 3CRW1 4B8ZA 2DQKA 1QGOA 1OA0A 2QHXA 1WUIS 5E7IA 4D3XA 1YIDA 4WA7A 2JVJA 2FPXA 3E0XA 4TUYF 2PANA 3CUYA 3OA0A 3NM5A 3F98A 4GSYA 3NHUA 4RK7A 1G5HA 1W34A 2WI8A 2O2GA 4JR2A 1VFPA 4I9GA 4P8RA 3I5YA 4BO7A 2XUIA 2ZJZA 1E1LA 2PX6A 1XELA 4HFJA 2AEFA 3TRHA 4TMKA 4QECA 1JWLA 2GAFA 3H99A 2I80A 4TQ9A 2DUNA 4R51A 4KGZA 4BLQA 1N57A 2E49A 1U2PA 2Q2VA 4RK1A 3EISA 2W0SA 5K3SA 1KDVA 3QM1A 3R6GA 3ZGXA 4DGQA 2YJ5A 1YR7A 3EPHA 4P4UA 2H06A 2ZKIA 4KV7A 2ILTA 3UICA 2XCTB 4UXJA 3CUKA 2V59A 2VAWA 3GJ7A 4G9GA 2VZ9A 3CN9A 3U4IA 2WJ6A 4CGZA 5H3LA 3W9SA 3CC8A 5J47A 1FLNA 4BQNA 2MSNA 1VPTA 1F4PA 1MT3A 3VR0A 1N1EA 4XVHA 4S12A 4F04A 4FDLA 5BN5A 3KZMA 1IBKB 3V55A 2R1VA 3UANA 3QEJA 1ZRHA 4TMXA 4CM9A 4TXJA 1NKSA 4MVJD 1ZC3A 1PTKA 5EC8A 1UMCA 3T9CA 2P3LA 1FRVA 3A9UA 4P3KA 4DRYA 2X9QA 1NT2A 2WWIA 3F2VA 3QXGA 3JAKB 2RG1A 4P54A 3W2TA 2ZPAA 3AG6A 3MELA 1RHJA 3QEBZ 5ICCA 1BJTA 2EW1A 3I39X 2CXPA 1P3JA 4O2AA 1RKXA 1WULS 2WAYA 1ND6A 3FTPA 1NVVQ 3A1SA 4IW3B 4TYQA 4QASA 2Q6KA 5BV7A 4OKSA 4WOBA 3C3CA 1Q0SA 1C8LA 2NVWA 5EZYA 2IXFA 1G21A 2H85A 5CG1A 1P1JA 1K8XB 2IXBA 3PS9A 3VZBA 5FFMA 3P96A 1JG4A 3HJCA 1ZI8A 1XTRA 1IHDA 1PJ2A 2OUKA 3IR6A 3P9PA 4RVUA 2VZ8A 3A4VA 4JDPA 5D85A 2WMOB 3AB8A 4HG2A 3GP3A 4KUEA 1UANA 4PIMA 3V46A 4PCAA 4GP7A 3HGMA 1SM4A 2IK8A 3O8OA 2XLBA 5F51A 5SZHB 5JAZA 4Q0MA 1O9GA 3IEXA 3NKFA 4D45A 4D5EA 1WUHS 1FTNA 1EG2A 4NBRA 4ITRC 3U9LA 2UZIR 2XWJI 5KNDH 1MX5A 2H0AA 5ARCA 3ZDDA 1SVUA 1BMQA 2EFDB 2W11A 5IN4A 2EZUA 3NYWA 4KFTA 3AF3A 4LY9A 2ACVA 2XVXA 3H5OA 3LP6A 4JJKA 4R40A 4UNPA 1MQ9A 3EBPA 4XIFA 2YW2A 3HI4A 1EUCB 5FUYA 5B7NA 2OBLA 3HU2A 4BVHA 1SC1A 4CT4B 3PVZA 2GZHA 5A03A 4JC5A 5LNK6 3I73A 1TAUA 2DHCA 4NDNE 4BMZA 1DV2A 1JILA 2I22A 5BVGA 1P2FA 3NEYA 1FPQA 3L0YA 5HM6A 4QWMA 2DE0X 4R5HA 4QU9A 2VP4A 1MB0A 1GJRA 4WXMA 4AYWA 2B8TA 3EPLA 1GEGA 5IJ0B 3AETB 1THGA 3K0BA 4OY3A 3LO8A 1EDOA 1U0BB 3EASA 4G65A 3LSTA 3C7DB 1AE1A 4WUVA 2QVXX 3CEAA 5LOVB 1KAGA 3B5JA 2FN9A 2IVZA 2W6IA 3H86A 1GDHA 3PDCA 2J87A 3KJIA 1EB9A 2JCYA 3OPMA 2JI8A 5GVRA 3FOBA 5BSTA 5KNDA 3T5AA 4FOOA 2Q4TA 4M0DA 3CHYA 3QYJA 1EXMA 2J9ZB 4EYKA 1KJZA 3I45A 1T1RA 3H2YA 4TPKA 1GSOA 4FN5A 4XR9A 2NUTA 4PLZA 4BNJA 1L7MA 4I99A 4LJLA 3DEHA 5JXIA 4KPUA 1R5NA 1SBYA 1XTQA 5EHIA 1SD2A 4OI1A 4CE6A 5IS2A 2XD9A 3IMEA 1Z83A 2ISSD 1GOTA 3DZJA 4KBYA 5JQGF 1LCIA 1M2OB 1VLQA 2VRCA 1T29A 3IVRA 3KV3O 1UBMS 3N53A 3N9IA 1VMEA 4M1KA 4UM5A 4EZBA 5HUQA 3F1LA 4B82A 1W5EA 1C9YA 3F7OA 1ZNYA 2W8ZA 1RMYA 3CLKA 3F4LA 2HSGA 2FSHA 2XAAA 5FWXB 3T61A 4YJFB 1PFQA 3AFOA 3R44A 1SA0B 2FW9A 2FLWA 4EEKA 1JQBA 2PAAA 2XAUA 3BEDA 4GDMA 2YRWA 4MO2A 3RYTC 4A6DA 2VPYA 1KYXA 5CLQA 4UREA 2XD4A 4UHDA 1UBHS 2BW0A 5KTRA 1QYDA 4P22A 3K5WA 2X5NA 4IVRA 2GYVA 1LLQA 4QM6A 4E46A 4HDKB 4W5TA 4REQB 4U00A 3OF2A 3KEFA 4WFIA 4AZVA 3GZNA 4MVJP 4WX2B 2CXHA 1C8VB 3ZU3A 4AMGA 1BA3A 1DX6A 3IH5A 5T4HA 4WESA 3WRYA 4A6PA 4P33A 1SXGA 4MWCA 4M76B 4BZQA 2RHLA 1WUJS 3DQPA 1O87A 1XRJA 4HO1X 2YC2C 3LGAA 1V1MA 2FETA 1RVDA 2FPUA 3F5QA 1YZYA 4IF4A 2XUFA 3SZGA 1YS7A 1T24A 3VSEA 4JBIA 2ZUBA 4QEKA 4Q3OA 1MB3A 4EJ0A 3L02A 4XYEA 5AJVB 2BY4A 3DHYA 1XF9A 3IP3A 4R98A 3GJ6A 3MLBA 1QHSA 2CHEA 1LI7A 3R1IA 4Z4QA 3HVHA 1XQ1A 1UM9B 5FRDA 3EPJA 3CVVA 1SCUA 1SUEA 2C5SA 3VU3A 2O0HA 1NQOA 4Z4FA 2PZMA 4OQEA 4QD3A 2XMGA 3NJ4A 4LCBA 4M0FA 4NMMA 5CB4A 3NHMA 3DBRB 3PXXA 1PR6A 4TRNA 3WL6A 3PDHA 4CT5A 2GXQA 4KQ2A 4R7TA 3F8SA 1EFTA 2X8JA 3OKPA 1ZIPA 5DOVA 4KMRA 2QM7A 1OBCA 4NNJA 3DHEA 4RIIA 4TOIA 3ZQ4A 1T3HA 3E1KA 4ZRDA 3W05A 3HC7A 5CBKA 1DJPA 3P0IA 5G41A 3X0DA 4QPNA 1MFZA 1ZNXA 3MUNA 3PJRA 2FG5A 1BDMA 2A8YA 1A5TA 1JQDA 2WUEA 3GUVA 2QN8A 3VO1A 1RQGA 1K6JA 5EINA 4E4RA 3PITA 3S2FA 1JPVA 4AM8A 3N0XA 3N8NA 5B2EA 3FBWA 1IN6A 1P7VA 1NLUA 1CF9A 1Q16A 1XZ8A 3IEMA 1GG2A 1WCXA 2B99A 1C7FA 3UTCA 1REQA 4JLMA 1IIRA 3JQGA 3K9BA 1JE0A 1ZH2A 4DG5A 4JJ7A 3BPSA 4UMVA 1AKVA 2CLHB 4MZDA 1PYDA 1UCFA 1GQ2A 1KEPA 1VRVA 1ORRA 3HXTA 1CUXA 3O3MB 4P32A 4X8MA 2E2WA 3QFSA 4ZHQA 1CZRA 1DT3A 2H54A 2ZVPX 3I1YA 1ES9A 1NXSA 5FQOA 4XYLA 3ZNNA 4B3FX 3KT0A 4ZI7B 1YR9A 3SFTA 4HQ6A 1AKQA 4L85A 1BDIA 4R9RA 3A06A 3H5RA 3NHKA 2B30A 1BOFA 4UU7A 3P4UA 3C85A 4R3UC 2JFVA 4YIKA 4CMHA 4K9QA 3VZQA 1VE7A 4HQNA 5K4AA 5U4QA 4DCUA 3D1VA 3LLCA 4URYR 4KN8A 3T35A 5KU7A 2VTBB 3SNKA 3VV2A 5E6SA 3HSYA 5J2UF 3W2FA 3MOIA 1D0IA 4P7BA 1VYTA 3BJRA 2VJPA 4XR4A 4Q9HA 2KS6A 2FVYA 3LNCA 4IUCS 3UZUA 5KVSA 2O2DA 2V5AA 2YWRA 4WNYA 2GZ3A 4C7JA 1C0EA 4ZKDA 4Z1MA 4U2KA 2AEEA 2EHDA 2QIOA 2EBUA 4DRZA 2ORVA 3L8HA 4G0QA 3BF7A 5K4GA 5LP6A 2X8WA 2PKQO 2O23A 1KZYC 3TJMA 1V7PC 4JJ6A 2AD5A 3TQOA 2NYVA 3C8ZA 4A3SA 2AT1A 1WMSA 2RI6A 1Q21A 3H2JA 1K1EA 2MT9A 3OEWA 1JDBC 4HZGA 2M6KA 4BLTA 4GOXA 3ZDAA 2HTFA 1ZZEA 3DMNA 4GGPA 4ND8A 1E9AA 3H97A 4K6CA 1EX1A 2IYTA 1H4TA 2R8ZA 1GRVA 5L3RA 5LQNA 4L02A 4KQ6A 5BORA 3PIRA 2CFIA 4PZCA 4BLVA 5JZMA 1HL3A 1P73A 3K6RA 2AFIB 1CQXA 1KMHA 4G1EB 3PYLA 1GITA 4ZYVA 1TAGA 1ZM4A 2WNIA 3OFND 3RF6A 2FSIA 4UQLA 1W4BA 3MCTA 2P27A 2MMCA 4BP9A 1EWYA 3WLLA 1B1CA 2QAGC 4MUKA 1E5XA 3VNBA 3WTBA 3ZHSA 2H08A 1NMZA 4GLLA 1EA7A 2EKPA 3OX2A 4F4FA 3KXKA 1XXLA 4WA8A 1CRZA 1E61A 2IKQA 5BRAA 4DY4A 2APJA 1AQLA 1E5LA 2C07A 2HYDA 2D5AA 1KIAA 2C03A 3IX7A 4P4SB 4PXYA 1ONSA 2JIZD 1N2CB 4HEA6 4RLQA 5IJXA 3OZFA 1Y9ZA 4KQCA 2X0FA 3FNFA 3KE8A 4MXDA 4GGOA 2DT5A 3QPWA 3G0HA 3MAJA 4Q48A 3OCUA 2JAHA 1YA8A 3I28A 1Z6TA 4IDGA 5HFJA 3V3KA 3L18A 3L0DA 5G3YA 3W78A 1V5EA 3D5EA 2Q9AA 3EEYA 4L4XA 4DTCA 4F84A 3AP3A 4MP6A 1SC4A 3EUWA 3S7TA 3S8MA 3SC4A 1JIQA 3GAMA 4PGGA 3JASB 1GO2A 1R74A 3K16A 5FTJA 3SYTA 4B5KA 1THZA 3AOGA 1HQYE 3DWGA 5IVIA 1W48A 4MAMA 1NM5A 3NI2A 1CDEA 2ZJ2A 4WBNA 1WE2A 1JWBB 3DE5X 4IJMA 3LK6A 2I91A 2E85A 3AKZA 1JV2B 4UDYX 1II8A 2H4HA 4BVEA 2OMKA 2FPWA 4G8BA 4IGEA 2ZS9A 2WTBA 4KAJA 4RKYA 3DFZA 3WX0A 3O9ZA 2ZVJA 2E18A 3S1AB 2FPKA 1U0FA 3WL5A 1IL0A 1E2MA 3V2IA 3D43A 2D8AA 3VR6D 2PL9A 1E59A 2BHSA 3SICE 2IGBA 2G40A 2YZKA 5LMCA 1UPTA 1VLHA 1NQAO 3B1KA 1ZS9A 5L3QB 2AA3A 1QFMA 2OHOA 5E8JA 4G5QA 4M88A 2XVMA 4X6LA 4E09A 4RXMA 5DVZA 4ZU6X 2WUVA 1WXIA 3D3WB 1IM2A 4DNFA 5I7RA 4HNSA 4Y1RA 1VFNA 4W8OA 1EXVA 3EC2A 4QTUB 2C9YA 4EM6A 2LUOA 5EIBC 2Q21A 2NO6A 1PLLA 2DGDA 5FA6A 3WAJA 4BCCA 1N33B 3OFJA 4L76A 2OAQ1 1TVKA 5EMMA 1YDFA 3IEIA 3KZXA 4X3OA 2O3JA 5AVUA 3K0FA 5J1TB 5F7ZA 2WQ6A 3KOXA 4D9KA 2FFBA 1U8ZA 5CCEA 3U1BA 4I9UA 4MVJI 4DFDA 4NEHB 4X90A 4XTCS 5CCBA 1WOYA 3A4TA 1TM4E 1N5DA 4ZCMA 2AXPA 3G9ZA 2ZBFA 3ONFA 4IRMA 4Q4JB 1XEAA 2B4AA 5ECGC 1J24A 3DLIA 3R6WA 3BMXA 2VF2A 5JCZA 2ZTHA 4WHMA 5GM1A 1OHHA 1E4EA 4MW1A 2ID4A 2RHDA 2VOJA 4MRVA 3E8XA 3OE4A 1A4UA 1HM5A 2HIHA 3DL7A 3OCXA 1R6UA 4WLEA 4C88A 4KX5A 3VR6A 4IDAA 1C7JA 1XAGA 1YZQA 3EBLA 4R83A 4KR7A 1VB5A 2NSJA 4UCQA 4DYDA 2GETA 2IEIA 4ND7A 2FZGA 4ERXA 1XNQB 1IXKA 1UZAA 4GXQA 3W5SA 1NVAA 2GLTA 1DSSG 2AN4A 2QRPA 3HWWA 3JY6A 5CT4A 2R6HA 5H1YA 3ZE1B 4Y6LA 3D2LA 4MV7A 1QIFA 3Q3EA 2G88A 2DY1A 4RM2A 1U2SA 1USUA 3ZV6A 3CF4G 4QTTB 1CJVC 2B0JA 2IF2A 1G9SA 1QR2A 1YQWA 3FY4A 4YRRA 3JWIA 3PD7A 4DQDA 4K46A 5KYVA 4F5YA 3Q6MA 3LRPA 2ERXA 4N3NA 3RIXA 2GD2A 3ULKA 4QZVA 5KQRA 1O0CA 1Y3AA 1EVLA 2DAPA 1ADFA 3R3JA 1RTKA 5B5SA 5IT0A 5DT2A 2BFEB 3UJ9A 1O6FA 1KPGA 1P9LA 1Q1NA 3HKBA 1FU7A 1K5DA 4E13A 1JEYA 1GWNA 3NVAA 6REQB 4NS4A 3GXBA 5I7WA 1ETUA 1BWSA 1H93A 2Q6LA 2Q9BA 3X3HA 2BFWA 1VZ2A 3MRTA 4NZOA 4J7AA 5AI5A 3UXEA 5HOEA 1BE1A 2BUCA 2AD1A 3P9SA 3E9DA 4GU5A 3TJZA 2HSWA 1X1DA 2ZQ5A 1XLVA 3BWDD 1HETA 1Z0JA 3IBCA 2F3QA 4FMDB 2JAXA 4XWTA 4L9WA 3F7NA 2XADA 1Z82A 4XX0B 3S6JA 2CUZA 3CRNA 1FMLA 1VMDA 3VPBA 3BULA 1JJ7A 3U3MA 3D02A 2BFEA 4RKRA 1N1MA 1HEIA 4CKEA 2QRVB 4YV2A 2PTHA 2ORIA 4N03A 3SHFA 2G3YA 1ZIOA 3E03A 1D7AA 4ZI7A 2DMRA 2B5WA 3G9TA 1NKVA 2FB9A 2SICE 2AV6A 2DPXA 3C3MA 3VBCA 1JU4A 2TSYB 3KPJA 2A0KA 2CUNA 3DONA 3KYIB 3PNBA 1C0LA 4MK4A 1DAOA 2FPSA 3O8LA 2HIMA 3K0CA 5KNBA 3FETA 4QPPA 5I47A 1SOAA 4XYMA 3NKLA 3RC1A 3NBKA 3FH0A 4EKGA 2VDLB 2ZUCA 3U4QB 4KI7A 2PRJA 4H17A 3CUWA 4WINA 5DHPA 4C08A 5JS7A 3LUJA 2OBMA 4L27A 2PNJA 1KKUA 1V6SA 3U7EB 3SKVA 3TTXA 3ZW8A 1E2JA 4GRAA 4BNYA 3M8KA 4Z51A 5LQAA 2JHGA 1RI3A 3HU1A 3MTJA 4J94A 1B8OA 1H8ED 5BOSA 4LZAA 4G07A 1SHKA 3PL5A 5HZMA 1UWVA 4GP6A 3JVDA 1DI0A 4QQ8A 1S1MA 3GFTA 2G1PA 1E9VA 2AX3A 3BXHA 4ZARA 3HDQA 4KITB 1IHOA 1X2BA 1E18A 1ZIDA 2D2IA 3ZOKA 3MGCA 3NHLA 1KJWA 3NAGA 3I2IA 4MI1A 5JNSA 1S2LA 1UBKS 1DXOA 1W85A 2BGGA 2QZPA 3FWNA 1OVMA 4P83A 3TEJA 4G6ZA 2B5OA 4HSGA 1UM8A 1YAJA 5DT9A 2C4NA 2O57A 2QAIA 3WZLA 1HNNA 1U3TA 2O5RA 1L2TA 1SH7A 5J9FA 3SZMA 5IPFA 4BBPA 3S5JA 2W4QA 4D8XA 1FTGA 2GD1O 4NCJA 4QO7A 1GGJA 4WKBA 5DK6A 2ETVA 1KBZA 3EXEB 4XSGA 4B7XA 1W49A 3GT4A 3FOAA 3IV6A 4DMHA 2JGKA 3C24A 3DHVA 3TLGB 1RXUA 3OP4A 1HQDA 4FYYA 3G49A 5GP1A 2VQEB 5I51A 1POXA 2CEKA 4ARSA 2HUNA 5ALXA 4ES6A 3RYFA 5KHAA 2Z8YA 2V7VA 2CKMA 2QJWA 5KOHA 3ZDFA 1Q17A 2TMKA 3CR3C 2Y8EA 1GZ5A 1BEUB 1VJCA 3A6GA 3ENKA 1TJ5A 3M9XA 3NT2A 5HIKA 1J1ZA 4R8KA 1HYGA 4WBNB 3IGFA 4A92A 5JCOA 1A5ZA 4QXOA 1IPFA 1K2VN 5D7NA 1NVWQ 1ANKA 2HI0A 3USZA 3AWDA 4TTVA 4N0MA 3K73O 4Y7CA 4M0PA 4R9UC 1OKKD 2OZVA 3BGVA 3C3JA 3ORYA 4C05A 5BYKA 2GM4A 5FYDA 1YGYA 4EEZA 1FFWA 1YRAA 2Q4BA 2PT5A 2REBA 2BFFA 4L6CA 4TMZA 3OLZA 2EJCA 2FW0A 2MR5A 3C6KA 3JD2A 3TTUA 3WMGA 2VN8A 3SXPA 2GPNA 3AZPA 4WPGA 3BFXA 4INAA 3LCJA 1QIJA 3BSSA 1FS4A 5IH7A 4GYKA 5J5VA 4YUWA 4GFDA 2UYHA 1E2IA 3HUFA 3KUDA 4YN3A 3H0EA 3NHPA 4B6QA 4EARA 3V2GA 2CMFA 2B25A 3B20A 4RGYA 4KYTA 4PV7A 3GJXC 4ZQFA 5KYUA 5TS3A 4B0PA 1BFUA 2XZTA 5ALJA 3RRYA 2P9TA 1RQ2A 4RVHA 1T36B 2LE0A 4DLTA 2QRNA 2M2IA 1M7HA 1KOJA 4MYDA 1ZJ6A 2Z56A 1H4VB 3E2PA 4WERA 4EELA 3KELA 5B36A 1OXBB 3KP1A 3LFTA 3MJTA 2W2KB 5DNVA 3BAZA 2JKYA 4D82A 1VSVA 4N5MA 4KLZA 1VHJA 4W6ZA 1N6IA 4XEUA 4OP3A 3WQRA 2FR0A 1OY1A 1K6MA 1G6KA 1KI7A 2SKCA 4D4HA 4DDTA 2XHEA 1U1GA 1F6DA 4EAQA 5IJ9B 1BDBA 4BO5A 3D5TA 2CJWB 2NO4A 2QAJA 1N7HA 5KX5F 3IT2A 1A8IA 1UPUA 2DETA 1V4BA 2O2JA 5CBPB 3KFXA 1X7DA 1P1BA 3E5HA 4IDOA 5DGCA 1OBOA 1AXGA 4HNUA 1X1QA 5KMGA 1DDOA 3MCAA 3V8QA 2ZJ8A 3HYSA 4GH5A 3ETLA 2R5FA 1NV9A 2O4CA 1KE1A 2XECA 3SVTA 4G2TA 5HTKA 2OB2A 1GT91 4ETNA 3QVMA 3F5MA 1NATA 3V4RA 5B6JA 3EGDB 2WDZA 1YOBA 3FTDA 3N28A 4H1VA 3O2QB 2GEVA 3F8WA 2JANA 3N2YA 4H31A 5A5FA 2GARA 3JATA 3A4LA 4INJA 3DE3X 4AXBA 1RR6A 3IAAA 4CM7A 4JP8A 2FX5A 1T9BA 1U2DC 4Z9AA 1ZD1A 2X9LA 2Q41A 4IVPA 3RK0A 1YVUA 3WGVA 4OMDA 3MB5A 1WSDA 1L7DA 5B3JC 1SUCA 3JAKA 5GONA 2CV2A 4JGIA 3TDNA 5IFLA 4RDXA 4FEEA 2PZEA 2QX7A 1NLZA 1C30B 3VKVA 4LQDA 4IMJB 3PQCA 2B4QA 1BMFA 4HGOA 5D00A 2ZUVA 2R00A 2F48A 1G4UR 3QOYA 1RYHA 3W90A 5A4KA 2EQAA 3VGPA 3ZNQA 3UCXA 1NX9A 3DEAA 4IS2A 4IOMA 1UH5A 1N9GA 4G4GA 2QLMA 4K6MA 3X2SA 1V9SA 5EMLA 4BLPA 4JQCA 2RFLA 4BJ1A 1IAQA 3B8EA 5COBA 4EDFA 1YKFA 1WCWA 4Q19A 2Q5EA 3FOEC 4FMPA 3HY4A 4CV0A 3TOVA 1KSFX 1NPTO 2DBVO 2XB4A 3BE8A 3F5DA 1BG6A 3JAWB 4U8GA 4UUOA 3WGLA 3NIBA 2ZUSA 1GR0A 1FFGA 3M6WA 1QG2A 1DEHA 4I1OA 4FEAA 3K9NA 1VGRA 2OL4A 4M36A 5DTJA 3EWIA 2WICA 4Z2YA 3X1WA 2V8BA 4BMPB 4LF4B 1ZY2A 3H13A 1P1IA 1ZOLA 3IAS6 2ZB7A 2Y68A 4BJ3A 1XTPA 1RPJA 2WHPB 3QU2A 1WUTA 4HADA 1Z8HA 2HPHA 2LPMA 4HN2A 1KFEB 1CEXA 5AJUA 5DM4A 4MR8B 3ZQUA 4QTYA 4PSDA 4LECA 4B81A 2IH4A 1MX9A 1UOQA 4X95A 1CUVA 3VV3A 1IBRA 1OJ7A 4YRTA 4XGRA 4DEXA 4NATA 4NENA 4TTPA 3ROTA 2C20A 1YJAA 3ZE2B 3NBZC 1G0NA