4OV6B

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
294
structure length
281
Chain Sequence
SIPWNLERITPPSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 281
sequence length 294
chains with identical sequence E
ec nomenclature ec 3.4.21.-:
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4ov6B00
1SCJA 4H6VA 1KE2A 4HVLA 1SUAA 2Z58A 1OYVA 3DE0X 1SBIA 3DE2X 3F49S 2WV7A 5AMXA 3DE7X 4J94A 1SCDA 4CFYA 3SQOA 3LXUX 1KDYA 1LW6E 4OMDA 1CNMA 1WMEA 4C3VA 1Y3FE 1TM4E 1AF4A 2WWTA 2ID4A 5JXJA 2Z56A 5FBZA 3AJ9A 1NDUA 1SBNE 3ZXXA 2ZWOA 1NLUA 1ST3A 2HD4A 3DVRX 1XF1A 3T41A 2XRMA 3BX1A 2WUWE 1GTG1 3VV2A 1SUPA 4FONA 3VSBA 1C9JA 1WMDA 3CNQS 1BE6A 1TMGE 1WMFA 2E1PA 3P5BA 1HT3A 2IXTA 4HX2A 3H42B 2ZRQA 4GI3A 3OSZA 1C9NA 3QMPA 1IAVA 1SBTA 4YN3A 1SIUA 1DUIA 3I37X 3WQBA 3I2YX 1S2NA 4NE7A 1SUBA 3EDYA 2SBTA 1PEKE 3AJ8A 1BFKA 1GA6A 4NMXB 1SELA 2X8JA 4DJ5X 1ST2A 3DE4X 3TECE 1S02A 2V8BA 2DQKA 1SPBS 3WHIA 5AVKA 3WIVA 1Q5PA 1SUEA 1YJCA 1V5IA 4OMCA 1ZVJA 1P8JA 1TM5E 4K8RB 2XTJA 1PJ8A 1Y34E 3D9QX 3A3NA 1VSBA 1Y3DE 1BJRE 3F7OA 1SIBE 1ZVKA 4JP8A 2Z2ZA 3Q40A 3I34X 2SNIE 5I9SA 2ID8A 1Y3CE 2W2MA 1TO2E 1OYOA 2WUVA 2W2OA 5ARCA 1A2QA 5SICE 3GT4A 5K7SA 4I0WB 1GNVA 3LPAA 2G4VA 1OT5A 1CSEE 3DE1X 3VHQA 3QTLA 3PRKE 3F7MA 2W2PA 4LVOA 1MPTA 1KDVA 1GNSA 4C3UA 3A3PA 1SCNE 1AVTA 3L1KA 3SICE 2DUJA 2PKCA 1EA7A 1SIOA 3EE6A 5ARBA 4WOCA 5ARDA 2HPZA 3DDZX 1V6CA 3GCXA 3A3OA 1GA4A 4BWGA 2SICE 2P4EA 2QTWB 1GTL1 1AV7A 1THMA 1T1EA 1GA1A 5JXIA 2Z2XA 4ZOQI 5JXHA 4WOBA 4OV6B 3BGOS 5JMOA 2PYZA 4AKSA 1BE8A 2PMWB 3DW1X 4B5LA 1S01A 3DWEX 3EIFA 2GKOA 1WSDA 2PWAA 1P7WA 3DE5X 2IY9A 3AFGA 2PRKA 4AKTA 1R64A 4KPGA 5FAXA 4MZDA 1PTKA 2PQ2A 1NDQA 3BPSA 3VTAA 2ZWPA 1SUCA 1YJBA 1Y9ZA 1GCIA 4Z2AA 2Z57A 5CW1A 3TI7A 1C9MA 1R6VA 3LPCA 1AU9A 3DVSX 3CO0S 5AQEA 1JEAA 3PTLA 3D43A 1SH7A 1YU6A 1AK9A 1GTJ1 3ZXYA 1Y33E 2TECE 5B1DA 1DBIA 1TM7E 1IC6A 3QFHA 3DE6X 3GT3A 5B1EA 3LPDA 5JXGA 1Y48E 3Q5GA 3DE3X 1SCAA 1Y4AE 2Z2YA 5AVJA 3VYVA 4H6XA 1Y1KE 3UNXA 2PWBA 4CFZA 1P7VA 1SCBA 2B6NA 4ZARA 4H6WA 1MEEA 3DVQX 4CG0A 1PFGA 3GCWA 2W2NA 1TM1E 2SECE 1SBCA 1AH2A 3DW3X 1TECE 2Z30A 1SUDA 4NE9A 1SVNA 2ST1A 1TM3E 1WVMA 1T1GA 1T1IA 4DWWA 1TO1E 3VV3A 4KG7A 1TK2A 1KDZA 3DYBA 4LVNA 2W2QA 3I30X 1YJAA 1SBHA 3TI9A 1Y3BE 1C3LA 4KB5A 1BH6A 4RYDA 1GT91 1BFUA 1UBNA 3HJRA 1Y4DE 4M1ZA 1KE1A 4DZTA 1EGQA 1R0RE 2X8JB 3WIUA 1AQNA 1SN7A 5FFNA 2DP4E
chains in the Genus database with same CATH superfamily
1RQGA 2BGTA 2H1SA 3JYQA 1L7PA 3WMXA 4BQSA 5EXXA 3A6JA 1I3LA 3HBMA 3PR2B 4G01B 2C7RA 1QX4A 3WLFA 5WRFA 4RTRA 1CUUA 1XKQA 4D8YA 1E66A 3ZCXA 4ZV7A 1FVOA 3BFJA 1QOPB 3KHKA 4UNIA 4OSEA 5F9MA 5KX5B 4WUVA 4TPKA 5LKAA 4XM0A 4DRXB 3Q3JB 1M7BA 2ZDQA 3O0TA 5INTA 5HNKA 2O9JA 3A04A 3TFOA 5DOVA 4Y1RA 1AA9A 3TOXA 3LXUX 4N5MA 1EP2B 4LNUB 2O0JA 3CUSA 3HKBA 2DXIA 2C2YA 1SMKA 4CF6A 4FR5A 2Y0DA 1JTFA 5JXJA 5KNLA 2ZCJA 1JKJA 1SOVA 3A6FA 1XTUA 3OMWA 5CK5A 3S2UA 4QHTA 5IAEA 1TQDA 4PV7A 4F9FA 4YCNA 2G5GX 4AM8A 1JIXA 1T2VA 2BHLA 3UFXA 4ZIRA 4AP6A 2FG6C 3BVPA 1LDYA 1H2AS 1P2UA 4CVNA 5MF6A 1Y1TA 3ZXXA 1BGWA 1EX7A 2X1MA 2BGNA 3AR6A 3G8BA 3NIFB 1PWXA 3Q7IA 4K6MA 3DKRA 3EIQA 5ESXA 3FCOA 2QUBA 5E8JA 1C8VB 3DVRX 3ETJA 5I9IA 4G23A 2B61A 4E2WA 5JNWA 4ND5A 2H1RA 3IVXA 2GVNA 4HYTA 3T5AA 4RZQA 1YQTA 4RK0A 1BQEA 1CY7A 1IN8A 1G66A 1NMEA 3HABA 4FYJA 4CU2A 5I7FA 1W34A 1ZNYA 3BWEA 3WAJA 2EFGA 2G5CA 3QKUA 3ZNOA 1EP1B 1YVRA 3HU3A 1UCFA 2HCJB 3O8QB 2IPMA 1RJ9A 1JS1X 1S6YA 2NZYA 4RFVA 5HK8A 2XBUA 3T7IA 1PK9A 1Q74A 2I3AA 2O2CA 1VL8A 4A2PA 2V65A 2W90A 3Q7SA 4ZI7F 2ZJ0A 2PT7A 3ZJ4A 4XD2A 2HGZA 3G9QA 4WH0A 3SK0A 1JHXA 1Q92A 3GT7A 1E1CB 4M9CA 1PFWA 4PC7A 4RXTA 5GONF 1ZIPA 3K6JA 1IPFA 1L7DA 4G63A 4BL5A 1FYFA 4RXMA 4ZI3A 5HKLA 1K97A 3MT7A 4G1UC 5CHYA 4Q4AA 4BRZA 2MMCA 2I29A 1QM5A 3WLTA 5I47A 2WA1A 4LHEA 4EGFA 3L7NA 3GRZA 3HR7A 1IY2A 2HMUA 2QW1A 1IOZA 2PZFA 4Q02A 4RHYA 1SUSA 3I2YX 5AK6A 1IY0A 2I78A 3H75A 4JL6A 4BAGA 4IP0A 2TSYB 2GVDC 3X1KA 3LHFA 3HYNA 4H1UA 1RRMA 4J3JA 2QENA 2BISA 3QPAA 3FVTA 4J9VA 1Z4OA 4OXNA 1TVKA 4QEKA 3BHIA 3JQ7A 2UUCB 1C80A 1ODKA 1EWRA 4FNAA 2NZXA 3THSA 3RYCA 3EVEA 5BOVA 5DRTA 2DULA 3PI6A 4DHWA 3RTAA 3UPUA 1N8NA 1ODCA 1GUZA 2HBRA 1J22A 3OZCA 3PLNA 4JB0A 4RWZA 5FTMA 3RVBA 4IWYA 2HL6A 4H60A 3CZRA 3E7FA 4IIBA 5BSMA 2WHPB 2C2XA 3FRHA 5TXGA 3TAHA 1XLTC 4UNNA 5GJWC 2VQEB 3OX2A 1B8OA 2H1WA 1ZH6A 3GEIA 2VBCA 3SS7X 3OCJA 4ESOA 1YDGA 4NBTA 1RWVA 5JO0A 3T1QA 1OT3A 1GRRA 1Q1EA 5AXAA 4C2UA 5K4AA 5EZYF 1OBFO 1X2EA 2QQFA 3BSSA 1PFUA 1GEGA 1Y1PA 4BO9A 3QVVA 2BPOA 1BAPA 4EKYA 1FFBA 2GFQA 3V4FA 4CKWB 4Z0TA 3ZKAA 2Z5LA 5L53A 4LF6B 2AN1A 3VISA 1Z2PX 4B32A 2YJNA 2QW8A 4POOA 2JIQA 2AEMA 3I9JA 1Q14A 1FL9A 5HRCA 3GWZA 5ALRA 4GC5A 1DG9A 3SKYA 5C46F 3WYEA 1SC4A 2Y4OA 2ESRA 4P34A 1H8HA 2DUNA 2W6IA 3HVIA 4LHZA 2I4LA 4GBJA 3TG8A 3F2VA 1KBOA 2FN9A 3CTPA 1C9EA 2ZJ2A 3DXZA 2TMGA 3MGAA 3TCNA 3UK6A 2CB0A 2G88A 1KMHA 5I7UA 3CUKA 4Z1MA 1PKEA 3BQMB 2CV2A 1Z5PA 2JRCA 2GM3A 1U28C 4R2HA 2BFEB 3PNOA 1DCTA 4DMLA 1A8QA 2BHSA 2QZSA 3F6SA 1OWLA 1BHQ1 1FC0A 2W2OA 3PVCA 4J1NA 2Q49A 3CC8A 2HWUA 2W48A 1K3UB 3WYFA 3V6MA 4DG9A 3RQIA 1XRJA 2VRBA 3F46A 1IWPB 3L4EA 2CLLB 3TIFA 3EBPA 4OJTA 1NVDA 4GHWA 1I4LD 1UBEA 4WCDA 4BFUA 4CIYA 2YWBA 5H3CA 2GO1A 1OFUA 1UUFA 2QV7A 5KYWB 1DWPA 2BHNA 1Y8QA 2Z43A 4YV1A 2WMNB 1IDN1 3CY6A 3PEEA 2EGUA 1WB6A 1XXHE 3OWXA 4QXRA 4KTTE 1J39A 1GZSA 1GQYA 2AZMA 4V0LA 1U9ZA 2IIBA 1RYBA 3FX2A 1C4WA 3KYIB 4BWFB 2MDTA 1EVLA 4I66A 3JAWA 3OQMA 3HO1A 3RS0A 3C8MA 4HLCA 5DCYA 1P7CA 2X3UA 1XT6A 2WEKA 1H2YA 3DZKA 4PZ9A 1XLTA 5AHWA 4I55F 3WB2A 4MVJM 5TEWA 1FFWA 2O7QA 3BB3A 1CY8A 1KMIY 3UAYA 4L07A 1ADCA 5IS2A 1VC2A 4NCNA 4BLOA 1M74A 2PT6A 2C2ZA 3A10A 3H9BA 1G5IA 3PC8C 3QOWA 1ESNA 2HLDA 1Z68A 3MOSA 5JAZA 1L4MA 3WI7A 4NI5A 3L1KA 2J07A 3ITEA 3R6DA 521PA 3MB8A 5JQWA 4DJFC 3GRCA 2PPVA 1BXRA 3M4ZA 4HYEA 4QSMA 2F4NA 2Q5OA 3OJOA 4UEKA 5D3MB 2I6XA 1EK2A 1NQWA 5CLLA 5EKUA 3SNKA 4BKRA 5EHGA 2G7ZA 4JBIA 4IEIA 3ESQA 4J43A 1MAUA 3KV3O 2JJ2A 2D3TA 4XD7A 3SLRA 6REQA 2RD2A 3TQHA 4RHUA 4KZPA 5EKSA 4BGUA 5JARA 1JDJA 2ZR7A 4JOCA 1G1MA 4ISBA 4G36A 4E30A 5JIBA 3M3HA 2FWAA 5LQAA 3RYIA 1RM3A 3GEMA 1UZAA 2JIPA 5DGTA 1AKEA 2PRYA 3FSGD 1U28A 2JHCA 3ICCA 4ZO4A 1AO3A 5HCNA 1PGOA 2RGDA 1KFBB 4I2NA 1HYQA 1CUAA 3FYUC 4EB3A 1BEZA 3KZNA 5A6SA 1F48A 4PYIA 3IUNA 1JA9A 2X8WA 1GY8A 3QU5A 5L40A 1YQDA 3G0DA 4LYFA 4IM7A 3JQCA 1LX7A 1JRLA 3TDKA 4QM7A 2C03A 4CN9A 2C2MA 3JTEA 4TTPA 3KQWA 2AVDA 2CXNA 1QV6A 2R1ZA 2NYVA 4UM5A 1X9HA 3TNLA 1CUDA 1Q11A 4TTQA 3EGIA 1NRJB 2XNDD 2P5YA 2VCYA 4KLNA 1NT4A 2C4KA 2BV3A 4PBRA 2OO7A 2W98A 4KFRA 5ELXA 1EDDA 5TX7A 1WY7A 5CDFE 3WQSB 2FKAA 5JRZA 1P72A 1ZCFA 1WS6A 3A1NA 2Q28A 2BZ1A 4M36A 4Z7NB 5EHZA 1KMMA 4OV6B 3VKFA 3PFIA 5C37A 4PFSA 3L0ZA 2C2BA 3AUAA 2MU1A 4PG5A 4S0XA 2VUSA 4R84A 2GUWA 4D7AA 1T4BA 3IEMA 1W0KD 3R20A 1P3JA 3WLOA 1Z36A 2BTQA 2PS0A 4GGMX 3VKUA 1PWEA 5E7MA 4QWWA 4US0R 2WD7B 2G0NA 1T24A 3PC8A 4QYIB 4TX1A 1XZQA 3ABOB 4Y1EA 2C9MA 3TH5A 1GZ6A 1IG0A 2QLBA 1FUEA 3VZCA 4A0SA 1E89A 4OQMA 1FXUA 3O31A 2G28A 1F17A 1D6NA 3FOAA 4HGPA 3B3GA 4UBKA 1KYVA 1EAYA 3KV1A 4XRRA 1QR6A 4DPLA 5K0FA 4PPQA 1T15A 4JT9A 3OT1A 1WP9A 2I2WA 1JU9A 1TKRA 2CNOA 2X9VA 3QNWA 4O2AB 4ZP1A 5F7OA 3WLPA 3H0KA 2V96A 3ZGNA 2VYND 1OYYA 4HDNA 3FDIA 4ZT5A 3VR5H 4EG7A 1I5OA 2QRZA 4I1IA 4G0NA 4DJJA 2NTVA 3REFA 4IW3B 1ADJA 2AW5A 2NSDA 4JOQA 4AKTA 4B5KA 1QLHA 3QWFA 3M7IA 3BD9A 3RUHA 4MZDA 1B0PA 1X7ZB 1QHHA 2D1SA 5BVHA 2V7WA 4HQFA 3ZGLA 3DOFA 4Y6RA 3EF1A 2ATVA 5FCDA 4ZCLA 3HUTA 5A02A 1U8FO 1XNJA 1UXIA 2JI8A 2OSBA 4YMWA 2F3PA 3QVXA 1E6WA 4YRIA 1JR2A 2Q1WA 1NLMA 5JYEA 1PFQA 1NVUQ 1BVHA 1AC5A 3PXEA 5HKKA 1M7GA 3FYUA 5L6LB 2HQBA 2ZIAA 4UEOA 4CTOA 8GPBA 3IIMA 3K71B 3C6QA 2OWEA 4YJFA 1XNGA 1RRPA 5JI3E 4CCWA 2V7GA 3B70A 3BTUA 1XLUA 1PNVA 4M49A 5JG7A 1MO3A 3E53A 2IV7A 2ZAIA 2HQRA 5KDDA 5C51B 5F5XA 2X76A 4OA8A 1M8FA 1YI0A 3HCOA 4TXNA 3FKQA 4C0HA 4CM9A 3LUPA 1XPOA 1E9VA 2GR9A 4N4AA 2Q1XA 4EYQA 1R4NB 2N46A 5JNTA 3VKGA 1Z22A 1S96A 1UM9B 3ER6A 4BPRA 4P80A 3EPJA 4QJ4A 2IBMA 3TFQA 3A6GA 3H1GA 1F2TA 4Y7CA 2IDZA 3K1AA 1W4BA 5DULA 5AXDA 5D5QA 4HL6A 3RYHB 3DCIA 1IWOA 4RTSA 1ACJA 2AMFA 1USWA 4XSHA 1XRPA 1Y42X 4NMLA 3ETDA 4OP1A 1UKBA 5GPBA 3W3AH 3HCRA 2C20A 4KL8S 4TTAA 2J5RA 4RD1A 5SY6A 5LL6P 2VTKA 4UM9D 4FWTA 1IC6A 1TK3A 2ZSEA 4GGOA 4MRSA 2NM0A 2FSHA 3L4JA 1RIFA 3I3SR 3ZIDA 3PX3A 4IIVA 3M34A 4YV2A 2JD2A 3L6DA 4R2XA 4X65B 2IYLD 5CVUA 4CEIB 2CB9A 1M0WA 4M6WA 4CQLB 1P0MA 1XJQA 4ZT3A 1R0YA 5JNVA 3DMPA 1JEQB 1QE5A 2XODA 3NDRA 4FCCA 2QTBA 4G4SO 4MGEA 3SIRA 3AGPA 3ZW7A 1GDDA 3R3HA 4I14A 2JLUA 4MV9A 2AVNA 2ZUUA 3H7AA 2YYZA 4YONB 3F9IA 2C0CA 2HWWA 1XD2A 4U2FA 3ST7A 3B9RA 1ZHOA 4JI2B 3PGKA 2WJ4A 3H1AA 3L07A 4FBMA 1AUQA 3H9EO 3EIXA 4RA9B 3ABQB 4N0EA 4RULA 1KK3A 1WJGA 1KZ6A 1C41A 2PZGA 2RMKA 1WXGA 3PLAE 3FN4A 1WV1A 4I4NA 2GD6A 2G63A 5KVCA 3WWOA 4ZGGA 5K8UA 1RAEA 2X23A 4W6ZA 3D7RA 1XPRA 2YMPA 3BRQA 2FPRA 2BI7A 3NIBA 4BO2A 1U5BB 4TGLA 1MEEA 5K3CA 3AVXA 3IPYA 2QT0A 1KU0A 2XB6A 1VG0B 1JXMA 1PFGA 3ASZA 3JQAA 3NBXX 1XXLA 1Z35A 4MWBA 2QB5A 4WGFA 4YB8A 1FPMA 1TZJA 5AOAA 5AVZA 4IL5A 2F3RA 4NZPA 4YMTA 2VJLA 5CB8A 5DISB 1CU1A 3FSEA 4EI8A 2ZBUA 4OUKX 2AE2A 2C5AA 3OG9A 4R5MA 4U7PB 4M8KA 4XAQA 4ZQCB 2ADFA 3AL0C 3KYJB 5IBCA 4J1TC 4UUQA 4Z53A 3BMNA 1VKJA 1SHZA 5CA0F 5K6AC 3LBNA 3EPLA 5BYJA 1V8OA 1X15A 3O93A 1SUDA 4YROA 3AINA 4DCMA 2YKGA 4JGIA 2DLCX 1SVNA 1U2RA 4DQ0A 3TTTA 1QG4A 1MX9A 2V6JA 2Z2KA 2QP4A 5KSYA 1ZH4A 4KXXA 3K5WA 2E1RA 3DZDA 4YV0A 2V7PA 4AJHA 2DKOA 4QYMA 2AUNA 2Z6QA 1CFJA 2QRGA 3UA3A 3LFUA 1IUOA 4EELA 1NBMD 2CF5A 1IEWA 2WIKA 1YO6A 1Y9JA 2VDKB 5HQ3B 3C39A 4NCIA 3ZUGA 5AVYA 3LF2A 1WZNA 2WWXA 3GFQA 3IGFA 4X66B 2GAJA 2XUOA 4TVOA 1FMFA 1E0KA 3QGMA 4G9BA 3TLYA 2ZB4A 3NX4A 1GXSA 2QA5A 2FUCA 3SDBA 1UBNA 3A4IA 4Q0MA 4Z3OA 2CKDA 1KEZA 3ZQ4A 4OBWA 1NQOA 2QPLA 3B36A 4H77A 4V0RA 2IX3A 2X8JB 3EXIB 3BGDA 2ODNA 3OJLA 4RO0A 4JXJA 3UUEA 2EKZA 1UMDB 2J33A 1CQZA 4IRMA 3V1UA 2XCSB 3A27A 3RG2A 4IHAA 1N6RA 1QVAA 1AUXA 1X1TA 2CVZA 2Q62A 3CFYA 3LQKA 4TWJA 3QEMA 3N76A 4X85A 1XHEA 1CE8A 4MJLA 4NEHB 1QTQA 3RIMA 3H2KA 4CTJA 2HXGA 4DMCA 4UU1A 2WV7A 2HU8A 1ZESA 2NX2A 4EY6A 3U6KA 4MQ5A 1ISSA 3LT0A 2EOAA 2PSSA 3CSUA 1QGOA 1W85A 2BMWA 1J99A 3CEHA 5CYPA 1YR7A 3SZ3A 4BB6A 3SQOA 1MJ5A 2IH2A 3GH1A 1FRFS 1YS6A 2C29D 2EV9A 2HA4A 1EUDB 2PANA 3COPA 4IH1A 4M0FA 4J4BA 1HQKA 1QH8B 4YMSA 3VYUB 5J1SB 1QFYA 1TTPB 2IIPA 4II7A 3RS4A 3UMFA 2Y6UA 1Z5OA 2ID4A 1HSZA 3L1VA 4J1TA 3K9HA 5JI2E 4C7BA 4BWYA 2WTEA 1XFDA 5K6AA 1H85A 1U9IC 1NVWQ 1V3UA 2MINB 2FW8A 2X40A 3C4VA 2IHZA 4OK5A 4X62B 2G7MC 4Q4CA 2IOFA 5JUWA 3AVTA 4M0KA 3KFVA 1SBNE 2Z4TA 4FQ5A 4MZXA 2GWHA 1V5EA 1R8JA 2O2IA 1FVXA 1M6NA 4LEIA 1L8AA 1XALA 1NW8A 1WUYA 5JR3A 2Z08A 2DFLA 2YYSA 3D2LA 3MCUA 2WHYA 4H1HA 3D3WA 4UE3S 4C04A 1ZU4A 3OQOA 1EDEA 1T10A 3KJFA 4IKEA 1NVMB 1DAOA 3HZHA 3T41A 1VJ5A 1C1HA 4F46A 2OXIA 1QYRA 3HXMA 5K0GA 2XXJA 1NRXA 2OBNA 1E20A 3KB8A 3K6SB 2E87A 3RH0A 2YWDA 1YS9A 4FYXA 5EIBD 3F6BX 1NVVQ 2GRAA 2XYPA 4DF3A 2Q0XA 3P71T 1F2UB 3RRJA 4MQFA 2DR2A 4U7GA 1MPXA 3OD1A 3OLXA 4K9NA 2IXDA 2W2KA 3EFEA 1VG8A 4QU9A 2Y1OA 2ZUDA 1B14A 2C7GA 3L6CA 1D8TA 2LKDA 3BHJA 2VP9A 1TCUA 1OA0A 5G53C 1T34A 2Q7XA 1FP4A 1U90A 3PGJA 4EVSA 3HA5A 3EIWA 4MS4A 3ZJUA 2G1JA 1FFDA 2X42A 4RA6B 3B60A 4AC9A 5J2TA 1I36A 1IATA 1V2HE 2EDCA 2JFWA 2ZW9A 4LV8B 2BMEA 3C3AA 4DV6B 2JF0A 4NCJA 3H2JA 2NPFA 1IEQA 2PY6A 2XH8A 1K6JA 2QU8A 4UMEA 2MYPA 4CKCA 3AG6A 5C1BA 2FPMA 4M7WA 4QBIA 2CGEA 3OPQA 5IX8A 2FU5C 2HF8A 4J1QA 4YRGA 3IBYA 2HSEA 5ESDA 4ATNA 1KVUA 1H1DA 5FBLB 4HDSB 2WG0A 5K51A 1L3CA 3I32A 3OD5A 1CUCA 3QWBA 2B36A 3IALA 5HK9A 3P9YA 2O8FB 4Z0HO 3O1LA 4U9IS 3ZV3A 1H6DA 3C3MA 3E1GA 4YLYA 4XB1A 3SJAA 3EQ9A 3GLGB 1YA8A 1SVLA 1UBKS 4DLNA 3PC3A 1RXSA 1EFVA 3D4NA 4L15A 5HHTA 2WQZA 4TZ0A 1B8NA 1S02A 4QAJA 3ZK7A 2JEYA 3IKTA 2YOGA 1P2DA 1X39A 2OOKA 3BDIA 3WHIA 3HEAA 3O7WA 3GGSA 1U9IA 3UJCA 3OESA 2W70A 4EG6A 1CR1A 5E2AA 2C5HA 1WPRA 2H06A 3FY4A 1W581 3AI3A 4J7XA 4OB8A 5BMVA 2UUPA 4KQJA 5ALMA 2PVPA 2XLCA 4Y30A 4BE9A 1I1OA 1UMBB 4XARA 3WQRA 4KRFA 1NE2A 1CUZA 1IVYA 2QD4A 3JR3A 3FNGA 4KJXA 5ALWA 5SZHB 1GTSA 3TGLA 3C2QA 3KLPX 5FAKA 4Z7JA 5BSVA 2OUIA 4GXNA 3PNQA 4AY4A 4PAGA 2OFPA 5A4MS 1CJSA 2CL5A 4R5HA 2ZZKA 2QU7A 1V9SA 3LLUA 4DC9A 1HE8B 4BB9A 1C1DA 1QNLA 2Y2VA 1SIBE 1G6HA 1G20B 4FS3A 4U4AA 3ADKA 4YASA 1CHDA 3Q40A 1HE1C 1SURA 4RF4A 4CM4B 4KGXA 1KEEA 2WTNA 3STVA 3OOHA 4RZXA 2FY8A 7AT1A 3KDPA 2HQ1A 3UPTA 1CRPA 3HRIA 2UZ1A 4JB2A 4MVWA 4MINA 1F2VA 3EF0A 3ROMA 4BNDA 5JPDA 3HY4A 1TO2E 1V45E 1ZRSA 4BVJA 3U3MA 2BYTA 3IHWA 4ARBA 1KY3A 3CR3C 1S4QA 1O96A 2UYQA 4E7OA 1X9IA 2IHVA 1YC2A 1XWWA 1GRVA 4GO1A 5LP6B 4WK2B 1B2LA 1NX9A 4RJKA 3JD2A 5JCOC 1JHPA 1USIA 1N25A 1VBNA 5CYFA 3L0OA 1VJ0A 1RLMA 4RVGA 1OE0A 4J0EA 1IEVA 1Z5WA 3IOEA 4MB6A 5KTNA 5TDHA 2CCKA 3W9YA 3U3DA 2F1RA 1OT5A 3NTQA 3ULKA 3K9GA 2C3YA 3B78A 3WTCA 2FG5A 4NENB 3JD1A 4BVBA 4E5VA 2XOEA 1Z12A 2CEAA 1LPMA 4JC0A 4X93A 3WS7A 1BX1A 3ZIAD 1TAGA 3EVBA 4QASA 2G3YA 3HBAA 4WXHA 4XWKA 4IJMA 3OZTA 2WWVD 3WGUA 5KOHB 3BZWA 4IG9A 4U6NA 3NEJA 4YK7A 1M8GA 1DFGA 1EFUA 4L2IA 2CZCA 4FE4A 2JL1A 1MP0A 3HRKA 3LC2O 3F98A 4XCQA 5F76A 4ERXA 5FYDA 1OLUA 3A6LA 3AQIA 3BB1A 3DWIA 2IHNA 1MC4A 1NTRA 3SP1A 3DXYA 4DDMA 2Z8YA 3EXG2 4S04A 1QIKA 1NQAO 5L7WA 2VP5A 2Y8EA 3COSA 1A50B 1CB7A 1P33A 4M55A 5LMZA 3AR5A 4ZEXA 2ATCA 1SXJE 2O59A 1V2GA 2DR0A 3O4FA 2ISCA 4PAMA 1FSSA 2X9QA 1SIOA 3I2IA 4LTDA 4EZIA 1PEYA 3CX8A 3OFNA 4FDTA 2WF7A 2DX7A 1UH5A 3OQVA 1BYUA 4RYLA 2B2XA 4OGGA 3VPXA 5CFPA 1HG1A 1GKIA 1XEWY 2XCIA 3GYGA 5DHPA 4JZYA 2VYFA 3INGA 2I76A 4OAQA 3DC7A 1NR5A 2BEWB 2CDRA 3HJTA 2AXNA 1AOXA 3MWEB 3KUXA 3PNMA 3F8SA 2IU4A 4AZ0A 3TQCA 5I7SA 1ISIA 3ML1A 2HUNA 4D4MA 3TRFA 5HP4A 2B7CA 1I32A 3NKFA 5C7LO 5HPYB 3FBGA 1WXDA 4Q7LA 2ZJ7A 4ZMSA 1ENOA 3EQ2A 4R2WA 4ROTA 5D1HA 5C1PA 1T8PA 2A14A 1RCFA 5CRIA 5JCOA 4QTYA 3URMA 1K27A 2QTWB 5JE8A 1YXMA 4ZEVA 2H2WA 5C35A 1PBTA 3WLKX 4B4OA 4DABA 3ADCA 1JSRA 1DZIA 4P7JA 2GM5A 2HMYB 5K0ZA 4DSZA 4JC5A 3BH0A 3LVQE 3NGMA 4OJYA 4N5HX 2ZRAA 5CDGA 3CPHA 2XCRB 2Z4RA 1KY2A 4YPOA 2B8WA 3RRZA 1THGA 1D2NA 2XYVA 3E18A 3FFBA 3IT2A 4GP9A 3WLNA 4J16C 4DQXA 1MOPA 1UXGA 1TUEA 1DG1G 1Z17A 4O5OA 4YMHA 3B82A 5JANA 1P31A 3NPAA 4XYGA 1X7XB 2V9ZA 5IVHA 2DKFA 4NU8X 2BUCA 4IFIA 4CLXA 3C7KA 4UHKA 2WVHA 5ALXA 2GPNA 4JIGA 3D8HA 1T0IA 4PQGA 3KBOA 1N32B 1YJ8A 3AKCA 2GOYA 1C30B 2YWCA 3Q88A 4NPHA 2G9NA 4BJ3A 2JFXA 1CQIA 4V3BA 5K6RA 9LDBA 5EZQA 2JGFA 4E2XA 2OCLA 2F9LA 4FXPA 3ZWPA 1CEYA 3H2ZA 3QPBA 2Z1DA 3LKZA 2ETVA 5T41A 3GP3A 4D6PA 2H8KA 3DPIA 1WVIA 3ISJA 2AQIA 1U3UA 1JVBA 1GZ3A 1T6XA 1V39A 2OLJA 2Q2WA 3M6AA 3OU6A 4TTTS 4KN8A 4YRAA 3KQMA 5KNDA 1Y4ZA 2R85A 4F4FA 2PL9A 4FJ1A 3G9TA 3MG9A 3T3IA 4PFQA 4D9MA 1IQPA 4R3UC 1CETA 2VXYA 3TW4A 5BNTA 5B7NA 1H8EA 2IHJA 1UJ4A 2HMAA 3CWCA 1A8UA 4FGJA 3QXHA 4LY6A 2PT5A 5IC4A 2AS0A 2P11A 1JDTA 2YHAA 4R6WA 1NVGA 3SHTA 2X41A 3TBHA 1MIOB 3GLFB 2RBEA 4KFSA 1RC0A 3PPIA 1Z7GA 3LNCA 2V97A 2PQ0A 2PGOA 3QITA 4GL4A 4UBJA 5GGXA 5T7BA 5TJHA 4YTEA 3LHIA 2GAFA 2PQ2A 3FPSA 1Y5RA 2O0MA 3P20A 1Q0RA 1CNFA 1JKFA 2V55B 3DH0A 1QV7A 4QT4A 4PINA 3TTVA 3IAAA 5EXPA 1COZA 2WTAA 3PUZA 2ZTMA 1JWAB 4ENRA 3PKZA 4EUHA 1I30A 1RSZA 4CMJA 4ETWA 2HJVA 3LA8A 4ZYZA 1RXCA 1ELOA 3HBLA 4QFCA 1KWGA 4LZJA 3KRTA 4P22A 1AKWA 2C82A 2R86A 1JAHA 2ECOA 1IHDA 3BMCA 4GLJA 1IVNA 1OC4A 4Y1GA 5F5LA 3TPCA 5EL0A 3T3DA 1AN9A 1OZFA 3PFKA 2B4TO 3QOXA 4AZ3B 3U61B 1OXMA 4D44A 2R60A 4G41A 4J16A 4Z51A 3KYDB 3TEMA 4FFWA 4RLHA 4KRYA 1HLDA 3OF2A 4EW1A 2UUAB 4XQ9A 3EC2A 2VK1A 1K08A 3I92A 4CCAA 3QJGA 3UAVA 1ZN9A 3A14A 3WGHA 1U3FA 2WKWA 1FDWA 2GXUA 4Q24A 3ZXYA 1V8FA 3ZY3A 5ADVA 3DQQA 3ND9A 4JI8B 1F2DA 1KYWA 3PXXA 3RAGA 4G5HA 1Z7BA 3F0TA 2Z95A 4GKBA 4QHSA 4RPCA 5F12A 2R7MA 4BO4A 3WY9A 3DE6X 3EVTA 3LVFO 1K0FA 4ITVA 2ZSUA 4YDHB 4J9UE 5CCEA 1UJ6A 1H3NA 4BVGA 2FW6A 4MKZA 1C4KA 5KYYB 5HKAA 1V25A 2DPXA 3UMYA 1T5HX 1Y48E 4DG8A 4ZVPA 2PXCA 1K98A 3FOCA 4Y18A 2RAUA 1Y1KE 5EHNA 3GD7A 2GTPA 3O8BA 3H2GA 4LJKA 5HF8A 3KEOA 1A5BB 2B99A 2VA9A 3JVUA 3QX3A 2DY0A 1ZH0A 5IXSA 2E5LB 5K2MA 3KS9A 2B6NA 1GGKA 1CJCA 1E7RA 3NCHA 4KHZA 4OBXA 1IWBB 2Q5CA 4WCVA 3RTBA 4ZARA 4B09A 2BVNA 3H9JA 3IDQA 3G8AA 3N0TA 3RFFA 4CR8A 1N2JA 4M88A 2WZQA 1PG5A 4GSKA 4NHEA 1SVWA 3KK0A 5FOWA 3TRIA 3E82A 4MUKA 2QD1A 1Y7IA 3NBMA 3EDQA 1NJSA 1G5HA 3GCWA 3T8YA 5BY2A 1LK5A 2AXPA 3OSUA 3OZ7A 1EXWA 2XVYA 3IKMB 5MFPA 5FWAA 3FI0A 4MQEB 2LVBA 1OXTA 4FHEA 3L8FA 4CHGA 1F8FA 3L9WA 4Y8VA 4JUCA 3UN1A 5JU6A 3D6AA 4JQYA 3Q7RA 3UAOA 5M34A 1Y81A 4BP9A 4KPUB 3TB4A 3VGPA 4EUEA 5KYUB 1WX1A 3ETNA 4R2MA 2H1FA 4NE9A 1RYDA 1T9AA 5DZSA 4DT1A 2FUEA 3IELA 2XRFA 4ZOCA 4G0PA 5HZGA 2EQAA 1T1IA 4DWWA 2ECFA 3LWDA 4U2DA 2FSVC 4GNKA 3DFUA 1A5ZA 2DU8A 2B35A 2C9OA 4Y0NA 1VCHA 3GFRA 3NWBA 5AW4A 5EY5B 1AZTA 1NXQA 3K1TA 1BQ3A 3OWHA 3PQ7A 2P2ZA 3KKNA 4HMQA 1MV8A 4JGGA 2A67A 4TL9A 3CLRD 3RFUA 3L6OO 1TNDA 4XWGA 1DP4A 3I30X 3U37A 1F4PA 1J00A 3DGFC 4HD8A 5JPCA 4KB5A 1I7SB 1WXXA 1OREA 3BSWA 3MQ4A 4PTYA 3TN7A 4S1VA 4EBBA 2ZB7A 2VNJA 3K8QA 3ISTA 4LOAA 1RM0A 3M4YA 2PUTA 3VSAA 1RHRA 3I6YA 4AJKA 2B0CA 4G4JA 4PSKA 3TR0A 5C8XA 5K8JB 4YMLA 4UBMA 2GKSA 3OE7D 2AV6A 2WW8A 1G7RA 4P81A 1M34E 4HXFB 3WV4A 3LCVB 2RGWA 2HDNB 3UMCA 3BE8A 1PJ4A 1USUA 4XSGA 4RU1A 4AJ4A 4P58A 3K9LA 2D59A 1NLFA 2JIOA 3EOAI 4NH4A 2J9FB 3FCCA 4GZ5A 2B4KA 3FSJX 4IQ0A 3EGXB 5TE9A 4UMDA 3SM9A 4ABYA 2EHDA 3F49S 3EVDA 4QDUA 4XFDA 3MEQA 4MV7A 2FB9A 1NW5A 3MYRA 4NYMQ 5A04A 2DLNA 4DEYA 4OYHA 4RPGA 4YECA 3W5JA 3AQ4A 2DE0X 5HE8A 3R7WB 1I6LA 4MR8A 4WBXC 4EFMA 1FNDA 4YJ3F 3RJ5A 5FBQB 1LW6E 4GI1A 5K9ZA 4L02A 2X7HA 1VE3A 2RJNA 2XITA 2C8LA 2XIJA 2VC2B 2WSMA 3DD1A 1Z6GA 2RAVA 3F3YA 3FDXA 3TMAA 1W0CA 1V4BA 1IQ0A 1YUNA 3RJMA 1TFRA 2W37A 4ND6A 2ERYA 2YL2A 3B6IA 5JVDA 4DR5B 2P2GA 3SEZA 1KY4A 3UWPA 2PXHA 4K88A 3PUHA 1PO7A 1C1XA 5H80A 2FSVA 3VR0A 2WIBA 4BNGA 2BKEA 1D4AA 1SEPA 2BUBA 1GRCA 1NF2A 3OJFA 1RHQA 2C59A 5TMBA 3WMWA 1ZUNA 2QTVB 3ELUA 1OASA 1QH1B 5FV4A 3ADDA 4GL2A 5I7RA 2CXUA 3HJHA 1UIRA 3NWJA 4QVKA 2VVTA 3C48A 4IX1A 5K4HA 2P69A 1A4XA 2GPWA 3AZQA 4EX6A 2JLZA 1R15A 4QGAA 4BB5A 3SHVA 3T1NA 3G9ZA 1QS0B 4K5QA 1XAIA 4L4UA 2ONJA 5FADA 5LQNA 2C5EA 1OHHA 1M73E 1AGNA 1WM1A 2EX4A 1GGEA 2ONCA 2GEDA 2O7VA 3C6MA 3DMHA 3IP3A 5IBRA 3SSNA 3X1YA 3CNQS 3HKBB 1E2PA 4GMXA 8AT1A 1NN3A 1NMZA 5FA8A 4BQOA 1XVLA 1PT7A 4HTAA 1I33A 1XE3A 4UHDA 1JKJB 3RYTC 1GFZA 3WK4A 3U81A 3B1FA 1O87A 2QTCA 3GMDA 1VHDA 1W0JA 4PAWA 3U4CA 1FNSA 5JSKA 1VGQA 1JLHA 4N12A 4UFPA 4JYCA 3O92A 2DH6A 3BIOA 4WKPA 2C7BA 5KWIA 5DNEA 1JHZA 4QO7A 5K8IA 1TJ5A 2Z98A 1IN6A 1QDEA 5EJFA 3LCRA 1UT8A 4JH0A 4Y2RA 1J25A 3BKXA 2PBRA 3TNYA 5JH7F 1UKVY 3HXKA 3Q0TA 3TTSA 3QOYA 1I14A 3VVMA 1AZSC 2GEVA 3E3AA 1FXSA 4MVJH 4O3FA 4PY2A 1N0HA 2JI7A 1CJUC 1K92A 4MW0A 4CDRA 4DIEA 5JJBA 1UDXA 1X1AA 3U7QB 3W04A 5I4IA 4DR2B 3K15A 2NOAA 4PGMA 2SBTA 3L40A 5DP2A 5TQ2A 5EJGA 2X1VA 1KI4A 1QORA 3N2YA 4P4SA 2ES4A 3AJ8A 3O8OA 1Q1BA 1A2KC 3K73O 1N6KA 1TA4A 3GBVA 2RI6A 4EYOA 1P9WA 4AB1A 4FI3C 4ZTZB 2PUEA 4HAOA 4NR0A 2P9QA 1GN9A 4KO3S 4GBED 2VNKA 1FF9A 1E1QD 4MUGA 1O94C 3H86A 4A82A 1N5RA 2BFBA 5L4SA 1SUWA 1FFSA 4NCAA 3W9SA 4Z5XA 1KMNA 4EG8A 2P2NA 1SUEA 5BR8B 1RXUA 2NGRA 2H2FA 2BGLA 2CXHA 1YUMA 1BVYF 1WUJS 2Y4NA 2B1IA 5AJZA 1N4AA 3DMFA 4PC6A 3SE7A 3DKPA 4B71A 4P5DA 1P8JA 3AY0A 3EK2A 5K8CA 1RWQA 4YEDA 1II8B 1R0ZA 4EB0A 1VA4A 1PQWA 2PSEA 1R9NA 3CUYA 2GMWA 3EIEA 3CKMA 1DRUA 1V7QA 4MK4A 3C3XA 2B37A 3I6ZA 4IDQA 1FDUA 4XWYA 2YBDA 9MHTA 2BIFA 3VVCA 5D3KA 5CTAA 2P2SA 1XN4A 4L51A 3QKWA 1DKPA 2QPTA 2R11A 2P7HA 1TVKB 3OCVA 8ADHA 3H16A 4ER7A 2HR1A 1LLDA 4QTXA 1YDEA 4OMUA 3HBFA 3K9QO 3WK5A 2DPLA 3LO5A 4YMVA 2QGNA 1JW9B 3TLGA 3FMGA 4J29A 1LWNA 3JAKB 1QG6A 2MT9A 5LQKA 5M3BA 4W63A 3BN3A 5A03A 7GPBA 4CI9A 3CU5A 2HWKA 2EYQA 2K7ZA 2NTEA 3D4PA 2OXFA 2EFJA 1RWNA 3N0VA 4R2IA 2Y27A 4IIGA 3U13A 5FNVF 3A58B 4IIHA 3D1LA 4BX2A 1QUFA 1ECFA 3L4KA 4EYSA 7REQA 1DC7A 1XZCA 4ZVKA 3ZHQA 4YP9A 4E13A 1A2QA 1JLMA 1OGYA 1QCZA 1QYIA 1EE2A 2AZTA 4MRMA 3A4NA 2ORYA 3LBAA 3SYLA 4ZJZA 4K9PA 1N2EA 1OX4B 2O50A 4NCXA 3EZXA 5E4FA 3X1JA 2H0QA 1ISMA 4N3CA 1YIDA 1K86A 3R5TA 3ZWKA 1SK8A 1GNVA 3L6BA 3TLZA 1A4RA 2NU7B 5FF9A 2B9VA 3CCBA 2V3VA 3DZ8A 3HRHA 2NVUB 4ECAA 2YIJA 1KYYA 1CUFA 2AOVA 2WKSA 3T4PA 1I4OA 1WW3A 5CITA 4W82A 5EE3A 2J48A 1E3MA 3LTEA 1XZ8A 5DX1A 1LSUA 2XE7A 2XDWA 3B85A 2IZOA 4CKBA 1O94A 3C24A 2PGDA 2PQ6A 3NOQA 2AOUB 1LTKA 3COZA 5AK4A 1KJ8A 1E2FA 3UK7A 4F9GA 1KMHB 3E22A 3QG5A 3HKCA 4QUHA 4ZA2A 3MWFA 5LIPA 4KBYA 2JZCA 4EL0A 1D0SA 3HC7A 3I4LA 4LOLA 1WDLA 3KU1A 1G6KA 4KE9A 4NLLA 3WWCA 1H0HA 3S70A 1HYHA 3IUPA 3FWZA 1C7QA 5ALSA 3ZE8A 2AJ8A 2EAUA 3HP7A 3HB9A 3S2ZA 4I99A 3CKLA 4ENWA 1G1AA 1N0UA 2ORIA 3SX0A 2ZDHA 5FTKA 3UV3A 4ARAA 3MWJA 4KSCA 4OQYA 1JJIA 2NZUG 4RM2A 3MJDA 1H2RS 1NNLA 2QYTA 1YQWA 4GZLA 4Z3DA 3SICE 4CGZA 5CDFA 4L4SA 1NBME 3KZVA 2ZIXA 1ULUA 1XF9A 4I81A 5LDGA 3QE3A 3D81A 3IAFA 4GS5A 1Z37A 2OXEA 5L7TA 4KIFA 5HQJA 3EE6A 4O4LF 2Z8ZA 4GLFA 1W36C 2YHBA 3WGKA 2P2DA 4P6VF 4KPYA 3HCPA 2IE8A 5DNYB 1A9YA 5KBYA 4LX0A 3IAS6 1XDWA 3DV2A 1J2EA 2H9IA 1X42A 1A9RA 2G0TA 3EIHA 4QLBA 3JXEA 1XCMA 1OY1A 1G7SA 5IHXA 3FCAA 4UAUA 4YFYA 2GJAA 4EAAA 1TYDE 2DHRA 3ECCA 4X1OA 2X0IA 4L4XA 2PYDA 1GT6A 4K9LA 4MR7A 2B82A 4KQ6A 3ACDA 3BM5A 3GRFA 1C3OB 1M2VA 5AW6A 5E3JA 3Q2OA 2V7QD 3V4PB 2HMWA 3U1TA 4GLBA 4MMZB 4L8WB 2EF0A 5F7JA 3ZWVA 3UJ7A 3SX4A 1TZMA 1ZNWA 2PL5A 2Q46A 3GJ3A 2QG9A 4PZLA 1ZQ9A 3V2UA 5EJ8A 4E11A 2WG2A 2XLBA 4G86A 3O2NA 3MMXA 1M0EA 2IIQA 1MF7A 3C8ZA 4OSOA 3WJ1A 1MX1A 2G6TA 3FA2A 3A36A 3JASA 1HLFA 1ESEA 1MXFA 3CVJA 3R7DA 4KXMA 4LXHA 1E2BA 4AF6A 1PZFA 1OWMA 1PTJC 3BK1A 5G4LA 3RSQA 2HRRA 1UFQA 2OD9A 1W94A 1JXQA 4QUGA 2CDBA 1P2SA 4HYQA 1XHFA 4L9RA 3COJA 3OEEA 3OX4A 4UUMA 1W35A 2CXXA 4N0PA 1C7JA 2BF7A 1Q3TA 2WJYA 2BDEA 4FFMA 5DNCA 4M99A 1ORRA 3SG0A 1QLWA 1RDFA 3IP8A 1VBKA 1D7AA 2A4KA 3MT0A 4TQAA 3AKDA 1WXQA 3UKJA 4NK5A 3B5JA 1HNNA 4CCYA 1XMJA 4DCVA 4JHXA 3VNSA 3AUUA 1T36A 1AB5A 2OY0A 2XOKD 5EE1A 3V3TA 1H5NA 2X9GA 4WXMA 2R79A 3HKEB 3PNLA 5CPBA 1F0KA 3TEJA 3P9NA 4DQUA 4KNYA 4DNFA 1W1IA 4M87A 2CLEB 2OHJA 2QM0A 4OP2A 5AKLA 2M6KA 4X8LA 1XUOA 2QM8A 5BUCA 1Q57A 5TQ0B 4ZAFA 3I1IA 4C4YA 1Y98A 1JWBB 4RXUA 3EWSA 3OLYA 5JQGB 3S40A 3ED1A 3VMFA 4LHWA 3AESA 1CLUA 5IBPA 5C2JB 1XNRB 2KQUA 4C14A 3R3WA 2ZZMA 4BE7B 4H1VA 1KHHA 2QUKA 4LOIA 1VYTA 2XCOA 5A5FA 2I54A 3ELYA 1IZZA 3PYXA 1VHLA 4NABA 1RCTE 5EI5A 4JP1A 3CSDA 2Y93A 4E88A 4ZK2A 2H18A 1JDZA 5E1MA 3UVEA 1GPDG 2VSOA 3MC1A 1BHO1 5HA5A 1T8UA 1U0HC 1Z4PX 1ARZA 2CZGA 3O74A 4EVIA 2YXPX 3ZDAA 2YYAA 2Y9PB 1DO8A 5ALDA 1ONBA 1V1RA 2IYSA 3E0XA 1IBKB 3M5PA 1A9PA 1M83A 1ZH8A 2JS7A 2N1MA 3M9WA 4K3VA 1PN3A 1QK3A 3UHJA 1VJCA 1W4AA 2ZWPA 3UWOA 3W2HA 3L41A 4QD3A 2DFTA 4FIDA 1K6EA 5GZ1A 3CLSD 3TF5A 2D5IA 3MJHA 3CCFA 4FD3A 4ENSA 3MRXA 2E48A 1GKKA 3HB7A 1XVIA 3IEPA 3R6WA 2E4YA 3RV4A 1WDTA 2OG2A 4ZO9A 2HHCA 1XMOB 3TI7A 3H9GA 5J4YA 4FGKA 4U6SA 4DLBA 1HORA 3GXOA 4K7JA 4FFDA 4IR7A 4ZC1A 4ZICA 1PTJA 2WWWA 1N7IA 2ZBGA 3G85A 2CDNA 1E0AA 4XVQA 2WMYA 3QEAZ 1LBTA 1Z8FA 3F90A 4BP8A 3EY4A 5AQEA 4AY6A 3FSRA 1XRLA 2AFRA 2FWBA 3N53A 1CLEA 4U2KA 3VFDA 1WWKA 5KTYA 4KACA 3CINA 3LI2A 1YU6A 5FFFA 1X1BA 1COWD 1DE0A 3RBVA 3SIXA 1NN0A 2G76A 3IB6A 4Z1OA 5HUJA 2CHEA 5COBA 1I2CA 3ZI4A 5J2UA 1RPAA 2XUJA 4AKIA 2CE2X 5IJ9B 4ES6A 3ONNA 2V7XA 1GFIA 1H2XA 3RR2A 2QLFA 2QJWA 1W5AA 1TJYA 2QTHA 1DWOA 1ZD1A 2RHMA 1VI5A 5KMGB 2TS1A 5IVKA 1D6MA 4CM5A 3AIOA 4DUGD 2IOYA 1QTRA 4PLWA 4AYWA 1BFDA 3BZBA 4AECA 3G8CA 1IOWA 1QHEA 2FPIA 3OHMA 4R8MA 4RQUA 1OR8A 1A7UA 2FSIA 4N6OA 1WLYA 2IE0A 2P4HX 2C5LA 2RH9B 1JG3A 3HMQA 2F67A 2AC7A 2H1LA 4BNTA 2JA2A 4DNOA 2DPHA 3AX6A 3LPNA 4RKRA 4UC0A 4DQLA 3IVAA 1ORVA 3RVRA 3SBDA 3SZLA 5HKKD 3UJHA 4EB6B 2HZ7A 1HT2E 5DM0A 5K3AA 3GEPA 1K06A 3M1AA 3E03A 4D4GA 1E9SA 4Z7OB 3Q1LA 2XGSA 2I8LA 4B6JA 4M6WB 4NAHA 1PEAA 3PEVA 4OHFA 1VLLA 3ZNPA 4KYVA 1P19A 2P7IA 3AMVA 2E55A 4UCFA 3SHWA 5ED0A 1AH2A 3R2JA 1MOSA 1G8HA 1H1LB 2NZ8A 2EKBA 5EAIA 1ODFA 2II6A 1CPYA 5B57C 3HJCA 4ZI7B 3IUEA 2H3EA 3OOYA 4BVAA 1GM5A 1P3DA 5JHGB 4P38A 5LBTA 4Z0PA 2ZUBA 1PS0A 5DI3A 3VBEA 3U4QA 3F67A 3PUWA 4QBFA 2ZUTA 4EY4A 1AKVA 1F0NA 1V8PA 4Q47A 5IN5A 2ODQA 2XKBA 2WINI 1ZL0A 4MV8A 3O9VA 4YRTA 4IDGA 1ZGGA 1AS0A 2P3OA 3PA6A 4KBGA 4O4HA 3UQZA 1WDMA 1Q95A 1LBIA 4XFJA 1L4KA 4QBGB 3FNIA 4QNRA 5FL7A 3X3HA 2X2EA 1FRNA 1NMQA 1DAIA 5EJ5A 4TYQA 3RSFA 1SXIA 4JZKA 4MCAA 4EI9A 1NI4B 3NT2A 4ZC8A 3RUFA 3N0WA 2I03A 1Z7YA 1EMDA 3H3FA 3HY3A 1PT6A 3BMNB 3SSOA 3U5TA 1M5TA 1NC3A 3VJMA 3A9SA 4CLOB 1K9SA 4X9XA 3QHPA 3CX3A 2JZNA 3FTCA 4BS9A 3U16A 4DT1B 1Q17A 4D3ZA 3F96A 2JAPA 3P4XA 3PG5A 4DW8A 5IUNC 4RL4A 1QYDA 3UT0A 2J6CA 1GUFA 2O3SA 3MTEA 2GA9A 4OEHA 1EP3B 3TXXA 2L82A 3OTWA 2JFVA 4OREX 5HSGA 3NNSA 1NZJA 3K2QA 3BXPA 5CH8A 5I48A 4NHOA 4H6VA 4UEQA 3WDMA 2JB9A 3RE1A 4ZCMA 4NFHA 2B78A 4UQPA 4JLSA 1NKVA 5AK3A 5M5BA 4QJ5A 2GK3A 2PL3A 3MUFA 4M83A 4MCIA 4Q9HA 5P21A 3FDJA 3KM0A 2X22A 1EWYA 2H0AA 4B4UA 1I9GA 3IP1A 1P0CA 3KZCA 5CJJA 1J9EA 2CUTA 2Q3LA 5EZYB 2VKTA 3MAJA 3VH1A 2VNHA 4FBLA 4BNKA 4O4JA 1V11B 1UIMA 3BF8A 4N8SA 4QUBA 2R9VA 3QKSA 1HE2A 4MQ4A 4TKUA 2NU8B 3SN6A 1L4NA 1Q44A 1JHVA 1ULHA 3K72B 1WMEA 4I9FA 5JSZB 4HDCA 3MF4A 4P36A 1ZD8A 4H3HB 1TYBE 3V9PA 1H6CA 2QI9F 2FLKA 3CWZA 5B12A 5EJ9A 2H51A 4G26A 1J09A 4E3ZA 3QLEA 3CLUC 2XYHA 1B41A 5I6DA 2Z3ZA 4PC1A 4TTIA 4QRIA 1Y8RA 4DV0B 2HIGA 5EKDA 2AFIE 1FS5A 3RRYA 1CJVC 1QAQA 2AZ4A 4LTMA 3T5DA 3GOQA 3EZ6A 2XEXA 4HEHA 2RHDA 4UVEA 2J1LA 3BXEA 3IHLA 5HF9A 4JU9A 1O6GA 4H9GA 3L8DA 4P4UA 1CY6A 5LDHA 1G64A 1L9KA 1EX6A 2IC5A 3U3KA 2FWPA 3IEVA 1LQUA 1YB6A 1ISRA 4LDQA 1BSVA 1FZQA 1K89A 2PRZA 3RI3A 3R5FA 1IQUA 3HZZA 1XEXA 2IK8A 3NTUA 2OQVA 2CHVA 3VSBA 4K0KB 1QJCA 3LQ4A 1W87A 3QFSA 2BFWA 3RS2A 1CUIA 4AY2A 2WOJA 3T12A 1H2BA 1A4UA 3ZGXA 1PGPA 4KNWA 2R8OA 3K0EA 2I3DA 2ZR8A 2ZULA 5JALA 4DCOA 2GAAA 5KO2A 1NN5A 4Z8XA 1NUSA 4C0AC 4LG1A 3M83A 1R4MB 4GKVA 1NUQA 5K4GA 3T5GA 1CR0A 3BK7A 4LSWA 2PH1A 3O21A 1OI2A 3TO5A 1O54A 3G68A 3RTDA 3D4LA 2R2AA 5EP2A 1G0NA 5AW3A 2GN9A 2H29A 3AH8A 1OU4A 1CF4A 1VFPA 2Z5FA 2UVPA 1ONPA 3ICWA 4TN1A 3Q10A 1UKAA 1YS1X 5FL3A 4HZUB 2FPPB 2A5YB 5JTUA 3W3AD 1XDUA 4I55B 3UJAA 3HA2A 2GPBA 4H4EA 2A9JA 1SXJC 3D3WB 1GAQA 4JBHA 1T0UA 4ZRMA 1IMOA 1DO0A 2H7VA 5F1YA 3NGLA 5FWDA 2A0KA 4HS4A 1I01A 1EH5A 1K0UA 3FF4A 2B2NA 4K40A 4Y9SA 1XCJA 3TIIA 2WVAA 4KO1S 1ULZA 3HP1A 3VPSA 3SVZA 4QC2A 3ZLJA 3L93A 3EAGA 4FFNA 2HQSA 4N5DA 3A28A 5AYVA 3NEYA 4DSOA 3MWDB 4TTJA 2PDAA 1DRWA 4DVGA 1JE1A 4N82A 4Q4JA 3QUQA 4EH1A 5GV8A 4A8TA 1PV2A 3TR5A 1ZYUA 3R74A 2F2TA 2EVWX 3E9QA 2XUKA 3LFTA 4JQOA 2JLRA 3ZW9A 1DEXA 2DPGA 3DHWC 3FBTA 2V8BA 3AI7A 4LHYA 1QF9A 3LIIA 2HHLA 2XGGA 4G4IA 1E1RD 2P9YA 2FDRA 4KSYA 5CNKA 5IDYA 5ICSA 1R8YA 3JVVA 2YV5A 4UTXA 4BP1A 5CIWA 1RR6A 1N0VC 3AFNA 5IM5A 4U5QA 5B2ZA 3R8CA 3A1FA 1VZ3A 4GR4A 2QMYA 3LXMA 3RIGA 3TQOA 3RC8A 2OHFA 1HOXA 3QVWA 1A2BA 1Y34E 1RRFA 1SXGA 2PBZA 1G2PA 3Q4GA 3THWA 1S2MA 5E6RB 3C8UA 1LDGA 1WXIA 1GU7A 2CLIB 3CF4A 4MQLA 1VSQA 1NJ2A 1U0OC 4OGFA 4BEWA 3GLIE 4S2EA 1P4SA 4HJRA 2FX2A 4JP8A 3KLMX 3R7SA 1E77A 1LFAA 3AI1A 3LRTA 2A5DA 1L5ZA 2GCGA 1EFVB 4IMPA 2PL1A 1YJXA 4QNNA 1YB1A 1QZUA 3QVKA 2CNBA 3FWYA 1YDFA 1KRXA 5TPZA 4LWPA 5K5EA 4QQNA 1EXDA 3ONWA 4QJBA 3K2IA 5KCMA 3ES9A 4OXIA 3T3EA 4P35A 1VG9B 2A94A 2MCFA 2IV2X 2KWIA 2W2TA 3OBIA 4M8NE 5BMVB 3W5DA 2P91A 3LH5A 1KJZA 1P74A 4PYJA 4BJ1A 2G09A 3M9XA 4QUEA 1OILA 2FRVA 3W2FA 4HNUA 1Z6TA 2FQQA 1SXJA 2LDBA 3JQ6A 4G5OA 1G5TA 1Q0UA 3V4LA 1L5OA 2Q27A 1B6RA 1W88B 3DOJA 5JNUA 4D9BA 1EUYA 1T9GS 2AC4A 4H7FA 4XR4A 2EWWA 2WJVA 3GN1A 4GZMA 4IF4A 3I28A 4E21A 5LZ9A 4XEUA 1J49A 4GYWA 1RJFA 3JQ9C 3LPAA 1EBFA 4U3JB 2PJDA 3G7NA 5BSHA 2W5UA 1CS0A 2NLOA 1P6XA 1VLVA 4NULA 1LI4A 1FRVA 5EOVA 5HGJA 4JNCA 3W8FA 3ZLVA 4CPDA 5FORA 4CKEB 5A5DA 1MT0A 4LSZA 4EG4A 3I5UA 3EG9B 4BV2A 1TJ4A 1EHCA 3R6LA 5F52A 4D9JA 3QLUC 3TLKA 221PA 5KWSA 1WZEA 3ENKA 3WGMA 4M1OA 1W5FA 5A0VA 5TRTA 5A5EA 1P0PA 2BGMA 3O94A 3F7MA 4LVCA 1ZD9A 3WWYA 5TGZA 2VBIA 4IS3A 2ADOA 1OI4A 1EM6A 2ZJZA 3QUSA 1O0SA 1XZBA 3X1ZA 2WJWA 1YK1A 3R3ZA 5LD2C 1KI7A 4K81B 3ZGYA 1YDHA 3WO0A 4B44A 3A1TA 1WTCA 4JBWA 5ALOA 2OFFA 1RPZA 3RTEA 1Z4MA 4L8GA 1REQB 2GD2A 1YRBA 4RENA 4EHJA 1H94A 3ONFA 1GFSA 3ORRA 4JBLA 4G1FA 2B20A 2WM3A 2P1RA 2MHCA 5JD5A 4QGGA 4IIFA 2FDXA 4HWKA 4Q3BA 5E6UA 2HEIA 1P2TA 2BSQA 5JZMA 2IY7A 2V9CA 1NJ6A 1GP2A 1QRUA 4WHMA 4UTNA 4FCWA 1EJBA 1MW9X 3NM5A 5DCLA 5GONA 4CM8A 1XTSA 2OB2A 5J4VA 1Y8ZA 2EBHX 1K2VN 4UVIA 2PH5A 1R0WA 2XE4A 3MMSA 4FFBA 4IG4A 4F6LA 4Y2QA 1CZUA 4KXVA 2PUDA 2VJYA 4GZ3A 3IODA 5JS7A 3IS3A 1YB4A 2GILA 1DT3A 5B58C 3LL7A 2RC5A 4D82A 4ZO6A 3PIIA 4E5KA 4U7WA 2JHPA 3IQZA 3P2KA 1K68A 2JHGA 1OLUB 4M1EA 1GQSA 1Z56C 5EJ4A 3U4MA 3ED5A 3KDAA 2OZVA 2I7CA 4G5RA 4CLHA 1BXKA 4AICA 5LZ2A 1J9ZA 1JFRA 3CRW1 5AI8A 3ZUPA 5I7HA 3L7MA 2PKWA 2RCYA 3PBKA 5G4KA 1F3LA 3U4IA 4A7PA 3TQQA 3P9PA 4EITA 1Z28A 1HEIA 1E1YA 4N76A 5CA1F 1ZL2A 4OGLA 3NATA 2E4XA 5TMDA 3EY9A 2O1WA 3PGA1 5KYGA 2EX0A 3KQPA 4RH0A 3OQ6A 2PMCA 3JQ9A 1QHFA 1E0JA 1AV7A 2HBQA 1O08A 2HV9A 2EL7A 3B5IA 2MYNA 4LZAA 3L8MA 4MVCA 1PS8A 4I3GA 4ADSG 5HIKA 1GA1A 1U1GA 1G3UA 4QE3A 2GN6A 3VRHA 5LP1A 4PM4A 2QT1A 4Z4IA 2C88A 4K1XA 2GHIA 2KB0A 1FDSA 3QLUA 5JXIA 1U2GC 2AD1A 1J0DA 4GECA 4D9HA 1YCFA 2WKQA 4GRAA 3KQLA 5LXTF 3CXUA 4PO1A 4UNQA 2HT1A 2O48X 4ZN6A 1OLSB 2P9FA 1LS1A 2JK1A 2LKCA 3C3JA 1RD4A 2BKUA 4ZU3A 4BYMA 4CGYA 5JY6A 4BFXA 3ZHSA 4NPCA 3BKWA 3LUDA 5ABPA 4CIVA 1L8XA 1LPNA 3BEOA 3NYIA 1BWRA 3GY0A 2BH2A 1WHTB 3SC3A 2Q7DA 4AI6A 1HETA 4XB2A 1B8PA 1LB1B 3UB4A 3ZVNA 1TD1A 3JPYA 3J7TA 4G9EA 2NO9A 4AF7A 4CQJA 4ZOLA 2C98A 4P7KA 2J09A 3BMOA 4Q1AA 1AF7A 1Z29A 4O4IA 2OGZA 4P5EA 5BRNA 1Z0IA 1VZ2A 5LMNB 4REOA 1VSVA 3OOJA 2JIRA 3IAUA 4DHEA 4UVDA 1ABBA 1OXBB 2JLWA 3EJ6A 2CVFA 3L8ZA 3VYRB 4IXTA 4I7EA 3LT2A 2W11A 3LSTA 5BN5B 3WP0A 3Q8MA 1RWPA 1WU8A 2QDXA 5DSZA 1JX6A 2PT9A 2VT6A 4TV9B 2O6LA 4PX9A 4AT1A 3QFFA 4HZGA 2PLWA 4YAIA 3SC2B 4L8FA 4Z2YA 4Z7QB 4KPGA 4M98A 1N5JA 3LMKA 5FAXA 4DYVA 3KR9A 5B3JC 3VC7A 2CHQA 1VLQA 1QLJA 2J7KA 3GK3A 4J7AA 2XAAA 3W8DA 3H5VA 4J4HA 1RXIA 4D8WA 1TT5B 1SIWA 3STTA 4F2HA 2XZOA 5J4LA 1Q20A 4YP1A 3SHOA 3HY6A 3TSWA 3RKSA 3ROKA 1PJLA 4HAIA 2O1XA 2XRYA 2XUIA 4G2TA 1KWKA 1QF7A 2RONA 3WFIA 2PH7A 2FMHA 1QHXA 1WULS 3IPAA 2ZI4A 3FWKA 3W0LB 4YPVA 3B52X 4EG3A 4CEHB 1N3IA 3CA8A 2ZAOA 4GI2A 4MHSA 4L74A 4JI0B 2Q0SA 1KBQA 3IQGX 4QTUB 2VXOA 3N2GA 1ZITA 5GY7A 3S4YA 3SKVA 2GN0A 2Y1FA 3GFPA 4C76A 1Z0UA 1RTTA 3PNSA 4OLAA 2Z83A 3QWIA 3EEQA 5ADWA 4FTWA 5E9JA 3T9EA 1ZUD1 2IELA 1PDWA 4KAXA 2IZ0A 3A2MA 3OKCA 4QWMA 1U2GA 2MR6A 1WL8A 2IGTA 1JG6A 1WHSA 1PJZA 1E5VA 3DJYA 4I5EA 1JR6A 5JJIA 3O90A 5IH3A 1XDGA 3DBLA 3FJ1A 4ZHQF 1V4VA 2OYSA 4HYYA 4XIFA 2R6JA 13PKA 3OHPA 1BGXT 2FP4B 4DLWA 3HLYA 4QOJA 4WBNB 1QH0A 2NXEA 2OCDA 4JQZA 4D25A 5AIBA 3H8WA 3CNEA 4LKOA 4P93A 5HFJA 1LW7A 1OAAA 1OI3A 3MPOA 2EJWA 1RQNA 4Q7EA 4LV5B 3AEUB 4YX9A 4Y3UA 4R3NA 4E31A 1LY1A 4PEVA 1MX5A 4Q19A 4QXPA 4X95A 4EGJA 4RD2A 2AW3A 3EGWA 3AV3A 4ZHSA 4F4CA 4ZPJA 2ZRIA 3FYCA 4B3DA 4JN6B 2A9VA 1P2VA 4Y2TA 4L5YA 1MHTA 3OIUA 3F9RA 2JJ1D 2VHEA 5H70A 4MPDA 3BMCB 4LNHA 5JXGA 3DMTC 4E5NA 4W7IA 3ZHTA 5KJ1A 5K7SA 2HXSA 3PIDA 3BDVA 4BMPB 2OHGA 2PTHA 4F5WA 1HQYE 2HOQA 2ISQA 3GG2A 3BCRA 4IPTA 2W8ZA 2P8SA 3QV2A 5MHTA 5KU1A 2YMLA 2P0EA 3GAAA 4CFZA 5A4DA 3KXIA 5JLAA 1VL0A 3NM6B 3O47A 4H7JA 4NOJA 6Q21A 2XY4A 4KFCA 2E4ZA 4KYUA 5B3JA 1XVVA 2NYAA 2WQ7A 2D6FA 4OQFA 4CQMB 5F73A 3H84A 4CMAA 2M6SA 1GKUB 4HEQA 4NICA 3BTVA 3ET4A 3VOTA 1YZTA 1O9BA 1BHJA 2V59A 1KSFX 4IDAA 3GZNB 3C15C 3VR6H 2PVSA 3BCUA 4IHJF 1TM1E 2OZLB 3ZHVA 1ECPA 1RWXA 1M34A 1A8HA 1DJQA 5KPJA 1XNQB 3B48A 3DB1A 2AN5A 1KGDA 4HO1X 4R2JA 1YJ5A 4MYCA 4O2BB 1YVDA 4WCFC 3Q9LA 4BNZA 1HNXB 1FJGB 2W83A 3JAMA 2F3UA 1WCV1 3NETA 3K09C 1PG2A 3TFWA 2CUNA 2FRXA 1CR2A 1RBZA 3D4BA 1U7ZA 4JX9A 4ZANA 3RSOA 5EIEA 2P65A 2B1GA 4BV3A 2F59A 1A5SB 3RB8A 4ZDKA 3Q6IA 1AZLA 1D0IA 3LDHA 2Y1XA 2O0HA 2VNIA 1LSOA 2FFRA 2A35A 4XWAA 1GADO 1P8AA 2BTOA 3K16A 4CEJA 1MVOA 4L4RA 3NR2A 3OQNA 1HT1E 2PUBA 3ZG6A 4BFZA 1FFEA 1RLIA 5I8PA 3GDHA 3FYSA 4AN4A 2AOTB 3DMGA 3OX1A 1YIOA 1H4QA 4Y9DA 1P1IA 2HCBA 2QRKA 4S1WA 3RDPA 1KQPA 2IZZA 2QJTA 5AUPB 5IASA 4I5FA 1M1YE 5KX5F 5AM0A 3R44A 2L42A 4EVRA 2Q4DA 5G0TA 4LW8A 2CE7A 4ALJA 2HGSA 4C6TA 2P3LA 5DHSA 4Z8YA 1UFOA 1UJNA 3CZMA 1XRQA 2YN4A 4MUXA 4MI6A 4V03A 5HFAA 4BN5A 4M1MA 1EPUA 4KMOA 5KWJA 3EYWA 1BEUB 4DBVO 1A69A 5AVUA 2ZUFA 3DMTA 1RQLA 4OU5A 5FULA 1N8KA 5BPHA 1R0RE 4J91A 2WY2D 3RSZA 4LF8B 1NSFA 1HYEA 4R9RA 1CQJB 1GQ2A 2AMVA 4UKDA 1J8VA 1QHYA 4HEJA 1L8QA 3A9VA 3R41A 5E8RA 3TX2A 2I71A 1SCJA 4D0SA 4GWGA 5K45A 5DM70 2RE8A 1JG4A 2Z3WA 2GEBA 5IVIA 3KCNA 1QO9A 3DM9B 3EVFA 4DIUA 2J67A 3P97A 1N2GA 3HBNA 1W0KA 2NVOA 1Q6YA 3OM8A 4TSRA 2WFMA 3IRUA 3ESCA 1FNNA 2JKVA 4RFSB 5BWCA 4TV8F 1XAHA 4YY3B 3NP7A 3QIVA 3QLTA 3JD4A 1FBNA 4XDYA 3WL6A 4DYDA 3O4JA 3U62A 3V55A 2CJXA 2B25A 5JSQA 1MO2A 2NXWA 7YASA 4X44A 1CNMA 4NU5A 4A6PA 1JHRA 4C3VA 4WCFA 1U6KA 3TUZC 1N57A 1AKRA 3CIFA 3IIKA 5JAPA 5IANA 1P1HA 3VH3A 1F0YA 1D03A 2R8BA 5AD1A 3EDOA 3DL4A 3K09A 3GGCA 5KQLA 1OJLA 1E1LA 3CRQA 2ZJFA 2IH4A 4KQCA 1IH8A 1DOHA 3CM0A 4PRZA 1TCCA 2HJSA 2POCA 5IVDA 1LKZA 2JIBA 1GLGA 1I6WA 1UDRA 3UMGA 3MB5A 1WNFA 4RQTA 2P6MA 4G24A 3W34A 2ZWOA 5DIFA 4IGEA 5L3QA 5LQSA 1H3FA 1JR3D 5HIMA 3ROZA 2B2CA 1CUHA 3CZPA 3KVOA 4DCCA 1W47A 2QP3A 3N2KB 1QZXA 5AXBA 3CYFA 2P3SA 2QLTA 3OZEA 5EYPA 4HQRA 4FONA 4D45A 1SK9A 5L9AA 4YRSA 1UF9A 1TKBA 4D43A 4UUAA 4KR6A 3D2CA 2QBYB 4DA8A 4LYDA 1YL7A 2B0JA 1UMKA 2AIRA 2C1ZA 2E5WA 1KH2A 2XUAA 3DM5A 3G9XA 4L16A 5FJJA 3STXA 4BNWA 1SD1A 1U0RA 1CNEA 1K66A 2D0IA 2QJRA 3L8EA 4LBZA 1SKMA 1UOPA 2JFOA 2Q6VA 4TMXA 4TRJA 2QTAA 4A0GA 4I4CA 2AYZA 4KFTA 2E9SA 4PANA 3RUDA 1RM5A 4FUTA 1J0BA 2FMTA 4N9QA 1XA0A 2FZLA 1FLVA 3P5BA 5JVDB 1NATA 4HX2A 1E8MA 4GMGA 4CTKA 3N2ZB 2FVXA 2QG4A 3R0QA 1MTOA 2ZRQA 5HILA 4ZYUA 2FPLA 2CFOA 4XYBA 1C9NA 4ZMRA 1PFVA 1R00A 1W75A 2I33A 1RBQA 3OQIA 4F3RA 2GTIA 4XGQA 1C50A 3UJ9A 4IWNA 5FUMA 4IGAA 1XHLA 1SZCA 1BWSA 1R12A 3QK7A 1A71A 1QWSA 2VJMB 3N8NA 1KAQA 4GEKA 4NE7A 5AJVB 3V32A 5K8TA 2CFSA 5JNRA 5FRDA 3SZMA 3NB0A 4YBRA 4G5XA 2X6RA 3F7NA 4QPJC 1P60A 1DINA 3JD0A 4S2UA 3ZE2B 3U7GA 4NMXB 3D3KA 1PJTA 5AJWA 2A2ZA 2JLXA 3GVIA 2LTAA 2MIIA 4UVGA 2NTYC 1VE6A 3O26A 3OZAA 4XGIA 4EA9A 5CD1A 3I12A 2J7PD 1MEOA 2HN9A 2F64A 3MINB 3SEAA 5JJCA 1WUHS 4KDFA 3CW2A 3RWOA 4EO9A 4EIWA 2AWNA 4ZTBA 4OKNA 4LBVA 3WKCA 4L5BA 3ILHA 4PLHA 4QDJA 4QJIA 3FDZB 5AJXA 4D46A 2JW5A 3FTDA 1TTTA 1P44A 1YJCA 2VDWB 1Y89A 4II2A 1LXCA 1V5IA 1ZJYA 4ZZIA 4US1R 1CVLA 5ES3A 5JMPA 1B8UA 1XMIA 1PGJA 4KYIB 4BMYA 1AIPA 5IDWA 1YZVA 2Q5HA 4O6VA 3Q9UA 4KLZA 4EK9A 1IY9A 4MKHA 4XQCA 5I01A 3SQWA 3IOBA 1KOJA 5M2QA 3EZYA 5J5AA 3ZYCA 1KJYA 4JXKA 4LZZA 3QOFA 5H02A 3BGSA 3M1LA 1E2KA 3F3SA 4M7RA 2Q3FA 3PE6A 2XWJI 4A8JB 4A1OA 5HYVA 4FW8A 4C06A 2HK9A 1SKYB 4Z86A 2QRQA 2H4HA 2HO5A 2JH9A 4R69A 3SX2A 4XWOA 3RO7A 4CETA 4FZJA 5J4KA 2HT6A 2JARA 2YFHA 3A1VA 1T0PA 2P30A 5JDCC 2ZREA 2FW9A 5CG1A 4MUJA 1KDPA 1DQRA 1GKLA 4LV6A 2H92A 1T5SA 2YINC 2FNAA 1TYCA 2BFBB 2HNKA 3H11A 3MSCA 3P7MA 4GRDA 4O29A 3ZGZA 1FDVA 2Q5LA 3LL4A 4HATA 1MH1A 3VNBA 2VIIA 4KC0A 3WRVA 3DV0A 2OC4A 4WKCA 1NBHA 2J9XB 4HDMA 4LWOA 5AM1A 3SI7A 3VOSA 4WLFA 3LYLA 5BW4A 2W42A 2IITA 3I0ZA 5AM2A 2ONZA 4DV2B 3U3RA 3KB6A 1I6MA 2C4VA 4XTCS 3GT4A 1FU7A 4JBXA 4F6RB 1ZN2A 5CK4A 4A26A 1DMSA 1FTSA 1WR8A 2FWRA 1VIYA 3CURA 5EIBC 3T7RA 4L78A 5TQVA 1NBAA 1XI2A 2AXQA 3ESAA 2PHZA 3HWX1 3EOBI 1KJIA 2OPHA 1XZHA 5I45A 4LZOA 4Y2XA 3JALB 4EJSA 4BO5A 4MV0A 4QGBA 5AK5A 4R8SA 5CMLA 2YZKA 5LU9A 4LS3A 2I6QA 3R7AA 2I6GA 1X1QA 4KITB 5AHRA 1UJMA 1NVAA 4QYWA 5CXQA 1ZM9A 3FD8A 4IXNA 4JJ6A 4L0QA 1VLHA 1VP9A 3DDWA 3E58A 3AYZB 4LCEA 4PQEA 5CLJA 2ZZNA 5AHOA 2LZ0A 4DG5A 3OLCX 4XQEA 1YRLA 1C8BA 5DF1A 1G21E 1YVEI 3AF2A 3GPBA 3PF8A 4FX5A 4EKGA 4H7HA 3FZGA 3LGSA 5JXWA 1E94E 5DNDA 4HAYA 821PA 2FDCA 7REQB 1J4AA 3ASVA 1SCNE 3A3KA 4L3OA 5KKCA 2Q6LA 1E96A 1X86B 5CLIA 4YWHA 5DNAA 3ZX4A 1NKSA 1UDCA 1XJWA 1AB6A 1E9AA 3IULA 5DWQA 5JHHB 1U9JA 2FR0A 4LBYA 1G9TA 2F3QA 2YIVX 3HNPA 3OCYA 1BA2A 1U02A 3EFBA 4L5IA 3NC0C 4HT3B 4D98A 4ODIA 1NF3A 3SXPA 1YRHA 1A4IA 5ALGA 5AIAA 5LN1A 3ADBA 1BYIA 4I4TF 4MS1B 4HVAA 2C4NA 2OBFA 4BHTA 1KTIA 2NP7A 3ELDA 4WZAB 5IMSA 1FX0A 5JDCA 1A9TA 3P1JA 4G84A 1NFQA 4DCGA 2B4RO 1W52X 2CMGA 4EQ6A 4KXNA 4X64B 2DOKA 1JECA 2JCYA 5DVZA 3FLEA 4X5OA 5JY1A 1YNSA 4PLCA 2WE8A 1VTKA 3X43A 1S8FA 9LDTA 4OI4A 1II0A 5ILOA 1AKNA 2CXRA 5FEMA 3RANA 1XQ1A 3GRAA 2QVYX 1T5IA 1R8QA 1RBYA 2EFEB 2VDLB 3I5AA 3QVSA 3X2FA 5F3WB 5F35A 3QJYA 2QZ9A 2RIRA 1L5FA 2VPWA 5AVSA 1JFVA 1QXSA 5D85A 3PUYA 1P4GA 3ZGOA 2FN4A 4M9ZA 5CFOA 4ITUA 5JZVA 1QIMA 3ZU6A 3IRVA 3BS4A 1K6IA 2PEYA 4UUNA 3ZJYA 1C3EA 5HJ7A 2CYCA 1I1NA 3FHJA 5LMCA 2V3CC 5FO1A 4PCAA 2FG7C 3PR3A 4MS3B 5BWMA 2KS6A 2YVUA 3C3YA 1A97A 5AW1A 3PEFA 2ZS7A 5G0SA 2ZIXB 3HWSA 3IV9A 3ABRB 1UPCA 3O8CA 1KC1A 3JRNA 4NWIA 1THMA 3K5IA 4IVQA 4C6SA 2AC2A 1W93A 2WJPA 1RAIA 4H17A 4JLUA 5K0EA 3W7BA 1DG3A 3A1SA 3MERA 1MOQA 4Z4GA 3KWFA 3E61A 1EK5A 1R5OA 3OZIA 4ZOQI 2OLKA 3LO8A 1KDTA 3R0ZA 1WPQA 3Q7QA 4DCNA 4MV1A 4F5DA 5U9CA 3RC1A 4D3FA 2OZEA 2XAUA 3DEJA 3KT0A 5HFNA 1RP7A 1WKBA 3NHZA 3OQPA 5GVRA 2RHCA 2V74B 5HCIA 4KJZA 3AB3A 3KNZA 1MRNA 4TSFD 3UJ8A 1V47A 2C77A 2W6MA 3DL0A 3QF7A 3OQBA 3ZE9A 4B83A 1R9JA 4GOLD 1SZJG 4LZLA 4OP3A 1M2VB 2QMOA 3K94A 3R0VA 1Z0AA 2EBUA 4LDPA 4OFBA 1V8DA 3GRPA 4OYYA 1PJRA 2WZDA 4DIMA 2GK7A 4JI3B 1ZJ6A 3ZN2A 2YWRA 1ZCZA 4TMFA 4LJ5A 3UKOA 5AKJA 5LQRA 4P0QB 3IUMA 1MQAA 2G36A 4KDEA 2Y1LA 5HJ5A 3PFFA 2WD8A 1PHPA 1RI5A 1E79A 2F8TA 3K1YA 4MUHA 3G1TA 5GWXA 3V4SA 3W5VA 2GX6A 2TYSB 1O8CA 3HH8A 4KVFA 3WL3A 2AKAB 4V0MA 4R1LA 1NOJA 3IXQA 1AMUA 1Q3HA 3G8DA 2P9BA 5JW6A 1DAPA 1JEYB 5ER6A 2GYVA 4UFNA 5T6MA 3PSHA 4ZV9A 4N9WA 2VS1A 1YZHA 4UVHA 2QM7A 2H4WA 2ZYWX 3CN9A 2GBLC 5CEFA 2AN3A 4EYEA 1HZJA 2X4DA 4P3OA 3FUVA 1NW7A 4LPKA 1UZUA 3BPSA 4R2LA 1A7AA 3W4IA 3NW9A 3R5XA 2MMGA 2DHDA 3NEPX 4NSNA 2WJJA 4QOFA 2E18A 4FP9A 3I9V1 4HLUC 4HY3A 3EBOA 4IQ4A 4K9MA 4TKLA 1ACMA 4TLBA 5FBWB 4AW9A 1T9KA 2W0MA 4RE6A 2WWRA 3AM3A 4G0YA 4YP6A 2C1EA 1W8DA 4JX8A 3E8XA 2HPHA 4BO8A 3PKJA 2BGGA 2VZ8A 1EWKA 1OFGA 2RGAA 4WVFA 1RI1A 2J0UA 5BV0A 4GOMD 4LXTA 1NPYA 5CW1A 3AU9A 5BUQA 1BVRA 1FXWF 3WL4A 4WNAB 1IXSB 4HAZA 4QOEA 5KWVA 4KX3A 4HWPA 3X1DA 2JGJA 3WADA 3VPBA 1HFJA 3DVSX 1KZYC 1TA9A 3DOOA 3NAZA 3ZDCA 2CVPA 4TQGA 3NTVA 3U3XA 1K2WA 1DGQA 1O3YA 1PAUA 3I52A 1HH4A 4GVXA 2JNWA 3CEPB 4A0RA 1ZRHA 3GLVA 2CVQA 5E7IA 1E2EA 1N3BA 3I4CA 2IYOA 4A2CA 1TMYA 4IVNA 2IYAA 4OJMX 1O6BA 3E9DA 4RSMA 3RU2A 3WIEA 5DM60 4HUJA 1TM7E 3V34A 3BERA 4RM3A 3UMRA 2Z5VA 5KYKA 4PBTA 5F2OA 3QVJA 3LFHA 4LJ4A 3K6RA 4MNTA 2JBWA 2WUFA 5LYJA 3GT3A 3W06A 3U6BA 5D87A 5KC8A 1P73A 2E5FA 4FGUA 3AHIA 2A9QA 5H83A 3ZCQA 3H5NA 1Z6PA 4H18A 2XF8A 1CDZA 2GZRA 1U5AA 4QULA 4YJ3B 2B94A 1XDZA 3G2JA 1R6XA 5ALPA 1F4VA 4E32A 4C7KA 4KMSA 3DE3X 5FOUA 3GAFA 3GP5A 1KIFA 1P45A 1L1FA 5C18A 3CVXA 1YI8A 1PYOA 4LUCA 5AVJA 1I24A 4XUGB 1DKNA 5LBIA 2YWJA 5FV7A 5DFAA 6ABPA 2JEOA 2AQ8A 3DBRA 4MGIR 3ZKWB 2PX0A 5HRAA 5CLFA 1KFJB 2WJ3A 4JVMA 2VR1A 5FLKA 3EUFA 4B3XA 4CBVA 2H63A 1LNSA 4KO8A 4RSRA 3H8SA 1RFLA 5B7GA 3CE9A 2I4IA 1ZD5A 3RG8A 3UMJA 3DLHA 4L8LA 1TZCA 4OQLA 3HHEA 2YYYA 3KJZA 1KY5A 4IGKA 2GBLA 3TZBA 4FDAA 4FZ5A 4ZVSA 4DPKA 4HXGA 1YS2X 1UXJA 1NX6A 3TAUA 3HSKA 3SM3A 1UOQA 1XN1A 2OLEA 3KJIA 1EUCB 3NYQA 3F71A 3ON5A 3C98A 1MB4A 4WK0B 4DAOA 5BW8A 1N2IA 3PQDA 4HLUA 1OX5A 1NOKA 2XWPA 5AQ1A 3T1HB 3FPFA 1BU5A 2QWXA 4QKQA 1JPJA 4P4TA 3DW3X 2FZGA 5GVSA 1H9BA 4Q7KA 4G4GA 3HKDB 3UFBA 3WRYC 3RJZA 1BMDA 2P6NA 4I5DA 1P75A 1H93A 5EEGA 5F64A 1O9GA 1WPGA 2WFLA 1JNYA 3SCZA 2J5XA 4UEJA 5ALVA 1B6SA 4ZT7A 5ILGA 2HSGA 4XRGA 4R1QA 2P0YA 4IJ6A 3GHYA 5KSOA 1QP0A 3VZRA 4HEA6 1X8XA 1Q7EA 4RHCA 1CIVA 3TKAA 5TR9A 2GZMA 2P62A 3R3XA 4AZTA 3TOZA 5I7EA 1KDZA 2I8AA 2W00A 4KYTA 3FPEA 4AMUA 2X14A 3VHXA 2GJ9A 4ZVUA 4ND3A 4CN8A 2JH3A 2C4WA 1G6OA 3SYMA 2NVBA 1GGNA 2WUEA 1FDIA 2WV9A 5IABA 4P0PB 1NC1A 2X86A 1UK9A 5KOYA 2NV2B 5GINE 3L0IB 3S28A 4EA7A 1L7MA 1I2AA 1PJAA 1XV5A 1H2WA 2VHXA 4P3KA 2JGDA 5A05A 4GOKA 3SBXA 1JJFA 1J5EB 4LYEA 2PKQO 4MX8A 1Y82A 1AKMA 4DLKA 1MO4A 4FFLA 1XTVA 4RH3A 2AFIA 3K05A 4DBZA 3I45A 2A7QA 2CBXA 4QPCA 3BBLA 3LY7A 1EFRD 4BQIA 2RHGB 5H9VA 5THXA 1RWBA 1A9QA 3VO2A 2QD3A 3HCAA 1UWLA 3Q5DA 3R1IA 1EZZA 4XM2A 3RHZA 5BNIA 1G19A 3PYMA 4H1WA 5BORA 2BFCB 4LF7B 4YAJA 5IARA 2O8CA 3JWIA 2Z58A 1OBCA 4NATA 4F3KA 2UVQA 1GTZA 1YUBA 4PGGA 4HRYA 4OI0A 3IIEA 1JLRA 3LBIA 4M9XA 3FZEA 3SYNA 3IFSA 4PIVA 1NN1A 2VDPB 4E2ZA 3NHBA 2X19A 1IXZA 1YKSA 3G79A 5A4KA 3FPCA 5CVJA 4R1PA 3IPRA 3D0KA 4AJPA 2CMDA 2ZTHA 4GOJA 4O8CA 5H0IA 3NI2A 2J9RA 3FOBA 3PWSA 3W77A 3M0EA 4HN9A 2JBAA 4Q3AA 1U0FA 2DQYA 2JLVA 2W8BB 2WF5A 4JR0A 4S12A 5T4HA 1VI6A 1SUFA 3C3PA 3ROFA