1AK9A

Subtilisin mutant 8321
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYCGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPCASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPAKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large increases in general stability for subtilisin BPN' through incremental changes in the free energy of unfolding.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Serine protease
molecule keywords SUBTILISIN 8321
total genus 100
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ak9A00
1CNMA 1GTL1 1KDZA 1A2QA 1SCNE 1ST3A 1XF1A 3LXUX 5FFNA 3VSBA 1GNVA 3DDZX 1C9MA 4AKSA 1SBIA 1Y3BE 3BPSA 1AK9A 4FONA 4B5LA 3PRKE 2DP4E 1P8JA 2Z57A 5AVJA 3DWEX 1CSEE 1V5IA 3DE1X 3DYBA 3WIVA 1OYVA 4I0WB 1GT91 1TK2A 2SECE 2Z2ZA 1S2NA 3DE3X 1BJRE 3GT3A 4DJ5X 1MPTA 4LVNA 1IAVA 1S02A 1SVNA 1TM1E 2Z2YA 4HX2A 2TECE 5AMXA 5ARCA 4NMXB 1GA1A 2ID8A 1IC6A 1YJAA 1TO1E 1WMFA 3CNQS 5ARDA 1JEAA 1SPBS 1PJ8A 4NE7A 1KDVA 3WHIA 5AQEA 2PMWB 1Y3CE 3DE0X 1TM3E 1EGQA 3LPDA 4WOCA 1TO2E 2W2NA 5K7SA 3DVQX 4H6VA 1AH2A 5FAXA 4RYDA 1TMGE 3UNXA 3QTLA 1MEEA 2SNIE 3DW3X 1BE8A 1TM4E 1KDYA 3Q5GA 1ZVKA 1ST2A 3I30X 3TECE 1WMDA 3LPCA 1SH7A 1AQNA 2G4VA 2Z56A 1SCBA 3QFHA 2W2PA 3DE7X 3BX1A 4C3VA 4H6WA 5B1EA 1HT3A 3LPAA 4OV6B 3A3NA 1SELA 3F49S 3GCXA 1V6CA 1P7WA 1Y9ZA 1ZVJA 1Y3DE 4DZTA 5JXHA 3DE4X 5JXIA 2DUJA 2ST1A 2XRMA 5JMOA 2IY9A 5SICE 1UBNA 3L1KA 2SBTA 2XTJA 1SUBA 1SCJA 3ZXYA 1BE6A 2ZRQA 1WVMA 2W2MA 1GCIA 1LW6E 5I9SA 1AF4A 1PEKE 1SIOA 3WQBA 1GNSA 4Z2AA 1T1GA 1T1EA 1SBHA 1YJBA 3P5BA 4OMCA 4WOBA 5CW1A 5FBZA 3VYVA 1NDUA 1SCDA 4LVOA 2DQKA 1AV7A 1Y1KE 1C9JA 1WSDA 2Z30A 2Z58A 1THMA 4M1ZA 1SIUA 4AKTA 2HPZA 4BWGA 4NE9A 1YU6A 2V8BA 3Q40A 3HJRA 3F7OA 3H42B 1R0RE 1AU9A 1SBCA 1SUAA 1EA7A 1R6VA 3AJ8A 1TECE 3AJ9A 4DWWA 4ZOQI 5JXGA 1R64A 1Y4DE 2P4EA 4K8RB 1C3LA 1SN7A 5AVKA 3SQOA 3I37X 4HVLA 2QTWB 2PQ2A 3EDYA 2ZWOA 3A3OA 2E1PA 2PRKA 4H6XA 2WUWE 3AFGA 4KG7A 4YN3A 1P7VA 4OMDA 1KE1A 1SUDA 2B6NA 1KE2A 4ZARA 3DE2X 1PTKA 1Y3FE 4J94A 1PFGA 1AVTA 3DVRX 1Y48E 3QMPA 5JXJA 2W2OA 1Y34E 3I34X 2ZWPA 1GTJ1 3EIFA 2Z2XA 1YJCA 3I2YX 2ID4A 4JP8A 2HD4A 4CFZA 2PKCA 3BGOS 2PWBA 2X8JA 4MZDA 4C3UA 2WWTA 1Q5PA 1SUEA 3CO0S 3GCWA 4GI3A 1DBIA 3DW1X 3DVSX 3F7MA 1GTG1 1Y4AE 1SUPA 1BH6A 4CFYA 2W2QA 1SUCA 3ZXXA 1BFUA 1S01A 3VHQA 3VV2A 3VV3A 4CG0A 1GA6A 2PWAA 2WUVA 1TM7E 2X8JB 3D9QX 3DE5X 1Y33E 3WIUA 1T1IA 3SICE 5ARBA 1BFKA 1NLUA 2IXTA 1SCAA 1C9NA 3EE6A 4KPGA 5B1DA 4KB5A 2SICE 2GKOA 1OYOA 3T41A 3VTAA 2WV7A 3D43A 3DE6X 1SIBE 2PYZA 3A3PA 3GT4A 3PTLA 3TI9A 3OSZA 1NDQA 1SBNE 1VSBA 1WMEA 1DUIA 3TI7A 1OT5A 1SBTA 1TM5E 1GA4A
chains in the Genus database with same CATH superfamily
3BHIA 5JW6A 3H87A 5B30A 3DM9B 1W1UA 3F9IA 2Z4SA 4D6YA 1FU4A 4HAOA 1K3TA 2DFPA 3IEKA 2FG5A 3CUWA 4LXHA 3ZY5A 3O3NB 2C59A 2HEIA 3NANA 1UPUA 2NUPA 2WNSA 1V5IA 4Z9AA 4R69A 3IODA 1RYNA 5EXTA 2XCOA 3T52A 5B4TA 4FXOA 4CDRA 3KK0A 2YJGA 4OFBA 4URYR 4X71A 5A6VA 4JXXA 1Z36A 4F3TA 1XVAA 4CXMA 1MUUA 3OOWA 1TO1E 2B92A 4R8VA 4CW7A 5EWMB 1SKBA 1IXZA 1H8EA 1Z37A 2HNKA 4ND4A 1ZX1A 3E9QA 2RE8A 1RC8A 4P0PB 1UPCA 1LDYA 2FMKA 4IZ6A 3U3RA 1C1YA 3M4JA 3QLUA 4HB0A 1ZD1A 2XT6A 1NJFA 4XWKA 3PXDA 4GXNA 3EIWA 1QLJA 1ZCFA 5DX0A 3C8DA 8ADHA 9MHTA 1W5AA 2AJCA 3CSSA 4MKXA 3I52A 3B1FA 3SYTA 4N7MA 1EK1A 5BWMA 2I7VA 1I3KA 1DTWB 3V7NA 1XX6A 2W37A 2I6UA 1X7WA 1FLAA 1HDZA 3MJVA 1Q16A 4ZAWA 3FMGA 5C8ZA 4Q3CA 4OV6B 3DF9A 5HUHA 1YVDA 4UW9A 4Y0NA 1Y8AA 5F5LA 1WE2A 1V41E 2KBFA 3X1ZA 3WRVA 1DAGA 4LXQA 5JLJA 4IIYA 2C3OA 1G6OA 4R84A 1PVOA 3JD4A 4WXHA 1M67A 1FTWA 1YQTA 1WY7A 5I7RA 5BR8B 3L6BA 4HBZA 1PFWA 1OVMA 4JODA 1F14A 1U9ZA 3C5WP 5CK5A 3ZGNA 4IHAA 5FPTA 1LX6A 2CW5A 3M6VA 3RBVA 3L8DA 3GLHE 3RHZA 3SYRA 3WGJA 1ND5A 5KAMA 4F4IA 3I1IA 2C2GA 4H7JA 1IEQA 1P1KA 4OYLA 4O2AA 4RAQA 4RK1A 3RSCA 3ISJA 2G06A 1R74A 4M86A 4U0JA 4NF2A 2R11A 1BS2A 1FW8A 1D1QA 5LXTF 4E2ZA 1C0KA 2QE6A 2QTLA 1W36D 5B53A 3PRJA 3WADA 5FEUA 2Y6UA 1KY3A 5KIAA 4ZPJA 3NYIA 4PM4A 2HYIC 3K8QA 3OPYB 4DC0A 3M49A 4KQ2A 1VHQA 4FBLA 1O6BA 3OHMA 1E9CA 1XA3A 2CKDA 1QJ4A 3L07A 4N7JA 1X77A 1KVUA 2ZBFA 3BEOA 3B1KA 2V7QD 3K32A 1M1UA 2W2OA 2W98A 4UUBA 4ZI3A 2XUKA 2WYWA 4L9AA 3SS9X 1HNXB 3R9XA 3FTEA 2AFRA 3LIPA 2A5LA 3P7MA 4JDUA 1RE1A 1T3GA 1M6WA 3FPAA 3OX3A 2RHRA 3PP8A 2YKGA 1E60A 3KVVA 4QYMA 1JJVA 2LGJA 3A6GA 3OFNA 1K7FB 4PG6A 3E05A 4JL6A 3VR0A 4EGFA 4D5EA 5F77A 4AL4A 2P2DA 4MR8A 5DGIA 2LV8A 2ZYGA 2OCLA 1W6UA 4D9MA 621PA 1JWAB 3CB4A 1N77A 1BU8A 2Q1UA 4I5GA 5L3SB 3S0JA 2QU7A 2EP8A 1V5GA 1TUBB 2O0KA 1Z2NX 3EIXA 5HKLA 1GQFA 1U8YA 5B1HA 4UASA 3JZDA 4I1IA 3LMKA 1G1MA 3WMWA 1M54A 2DECA 1CV2A 1RMYA 1J8QA 1RYDA 2PSHA 3O7WA 3ZV5A 4XJXA 5HKAA 4FDVA 4C7VA 4CKEA 3QEKA 4I1OA 1B74A 2EHJA 1EFHA 2P69A 2K5UA 4X97A 5JFTA 3H1AA 3H9CA 4MKIA 4OXIA 1JI0A 3L7YA 1FFWA 5CFMA 5I7SA 3VDQA 4JBHA 2JLAA 2R6AA 3QEMA 5HUQA 3KPVA 1KI9A 1YK0A 4QOIA 1EINA 1QG2A 2NO9A 3IAFA 2FW6A 2VHWA 3DPUA 1QHYA 2OOSA 4HH0A 2JHAA 3V1KA 3R75A 4E1AA 5CM9C 1G41A 2R0QC 2J4FA 4S05A 3HXQA 1E1KA 3NWBA 4RSGA 4ALIA 2ZIAA 4BU0A 2ZU0C 4KXFB 3PTZA 1M6YA 1YZFA 4A6XA 3LH5A 3KSRA 3KTOA 1K0UA 3LQ1A 4G09A 2X14A 3QWFA 3U61B 1KO1A 3OBIA 4FHEA 1RQ2A 4D9FA 1WXWA 1UXGA 1I1OA 2CVOA 3G68A 3TTVA 1Z4OA 2IQIA 2D2VA 3NAMA 1EP2B 3OZXA 2O5RA 3HDTA 3IVAA 1ULBA 3MRSA 1MAAA 5ABPA 6AT1A 4YIHA 3CLHA 1O6FA 4ZREA 4CF7A 1I0ZA 1USVA 3ZVNA 4PGAA 1OFUX 1XXHA 2XZPA 3WLJA 4EGCB 1AQJA 3HVHA 3BX1A 5DWVA 4YR7A 3IIEA 3EXHB 2H5LA 4IMPA 1ILEA 1L5LA 2WKQA 2Z5FA 4M0MA 3MOGA 5F35A 5T57A 4KIWA 2M98A 3GLIE 1DRJA 1YOVB 2NV6A 3HUTA 2DCUA 3NU1A 5A6SA 4XW2A 4CLOA 3T7RA 4BMNA 1Q84A 5FUXA 2BVNA 3FNEA 1M34A 3W78A 1WMSA 4PBTA 3T3PB 2H16A 2V03A 4Q12A 4FEAA 2A0KA 3SSOA 2AMFA 2HPVA 4C4SA 2DFKB 1BNCA 2FZEA 2R6HA 4FFRA 4GAEA 1WB4A 3CINA 1F8UA 1I4WA 3P8ZA 1VBMA 4OREX 2FWAA 4TKLA 4X54A 1K4KA 2ZJYA 2IYZA 1N5IA 4Y0AA 1IVSA 2DWCA 2HL6A 4AVYA 3KJZA 4LSMA 1AK2A 1TYZA 2UUAB 4K9RA 5KZMB 1IYZA 4JS0A 4Q1CA 5T8KA 4ITUA 3ZK9A 1PGNA 1QWOA 1RI5A 1RQLA 2WJVA 1SD5A 2PY6A 3RUHA 3B6EA 1A9YA 2EIHA 3ZLTA 2B4KA 4JWTA 1G8HA 4AW9A 1T15A 2W70A 2GRUA 4KO1S 1RBMA 4CIXA 4MEAA 1L7DA 3U4QB 2QI9F 4U2KA 5CYOA 3IP8A 4BMOB 1SKQA 5CJ2A 2CVFA 1WM1A 3RANA 3BRWD 1HLFA 2ZYVX 1U0JA 2G1UA 1ZL0A 3F2VA 3FFWA 2QN8A 1QGUB 5G0UA 4EJ6A 4YRGA 1OGYA 3NYRA 4FMDF 2O2EA 1YIDA 3B3FA 2EWWA 1NN0A 2JH9A 3ROMA 5DGHA 1JFTA 3DBOB 3U3OA 5JYEA 2YVLA 1BJKA 3REQA 3UJ3X 1IZ0A 2Q4TA 3D6VA 5MDHA 5AXDA 3I76A 3LKDA 5EWMA 3AV0B 1Q11A 3P2IA 1U3UA 2VJKA 3P9KA 4EY8A 1YRLA 3F6EX 4K9SA 1M5TA 1MQ9A 1VKOA 4N3GA 4LUCA 3PIDA 1H0KA 1VJGA 5ALTA 1KJJA 4LMRA 3SDBA 4GOOD 3SJCA 1ECCA 1ZIPA 3NGLA 1UZNA 1Z5OA 4I4TA 3MS2A 3VKVA 5GJCA 1UFKA 1XCLA 2I6SA 2W6IA 4LXXA 3PJFA 4MV3A 2FU5C 1VRVA 1UWCA 5JVDB 2Q4BA 3MILA 1QK3A 2Z98A 4AKSA 5FL7A 1DS6A 3DNMA 2IUTA 2X5OA 4FYPA 1PYOA 1I9GA 3KZKA 2D2XA 4QWMA 3QELA 3WWCA 2Z2KA 1Z39A 2B5OA 1G5QA 2Q07A 3K8OE 4ZRDA 3R7WA 4AZ3A 9GPBA 1RPAA 2JK1A 3PXGA 4CR6A 2HW8A 5CH8A 2CDCA 1US8A 2J7PD 2O3QA 1VXRA 3GLSA 3HACA 2ADFA 1XAHA 2NIPA 3EW9A 3QKRA 1FRQA 3BL8A 1K89A 5HGJA 1PR6A 2RAFA 4ZA2A 3RJTA 3HK2A 4HYTA 3HEMA 3IUBA 1B8NA 1T8SA 2C95A 2BEJA 5AXBA 4OTZA 1A27A 4P36A 1F6DA 4WOCA 2R6DA 4DF3A 5C7YA 4Q0MA 2QK4A 2XVAA 5FO0A 3RVPA 2F3PA 1DP4A 4RSHA 2NVWA 3BA6A 3MCWA 2Q5JA 2FQXA 3F46A 3QWHA 1FSSA 2J3QA 3HU3A 3KYCB 4GLLA 2DHCA 3R8XA 3WICA 1UAGA 4OQPA 2O0HA 3TDKA 4DBVO 3I5UA 2WSSD 1CJTC 2ZRJA 3EVBA 5EINA 4KACA 3NJ8A 1XEWY 1UJ4A 2IYPA 5JARA 1GQOA 5JAMA 1LCIA 1D2MA 1T13A 2FQ1A 3CRRA 4GGMX 4GOND 5FFFA 3TQRA 4DEVA 3FGOA 3DBIA 3RC1A 1A8SA 1P6UA 1EUDB 1RADA 2GPWA 3ANYB 1S8AA 5CTJA 3O93A 5BUZA 2F3UA 2H1SA 5A3JA 5ICGA 4WUVA 1BGVA 1LBQA 1N2GA 2DZDA 2PUTA 3FZNA 4EKGA 1GGFA 1D0VA 2NXJA 5I4KA 2M6RA 7REQB 4CTJA 3L0IB 2X5XA 2I4MA 1ZGAA 3CA8A 3EYWA 4QNRA 4ZXFA 5CHEA 1V11B 1NMZA 2IZ1A 3NHBA 3MW8A 4L4YA 4ZI7A 1EM8B 3FPKA 3ZV7A 4OHXA 5J2TF 1XLTC 1TQHA 1MTZA 2GLXA 4DQDA 5K0LA 4MV1A 3P4UA 4RJ2A 2ZI6A 4KN8A 1JTEA 3CPSA 3E9EA 4YV2A 3RADC 4QZVA 1X1AA 1DT3A 1UOQA 3X2SA 4PS1A 3CPEA 2C2YA 4BKOA 1U31A 3ELWA 4Y0VA 1MRSA 4H6XA 3AEQA 1UWKA 1C8LA 1EX7A 3GRVA 2Y0CA 4L8VA 2HU7A 4EM6A 3P0IA 5M5BA 2I3AA 2ZZMA 3LS2A 4RKRA 4KQ9A 4LRQA 3GD5A 1C2TA 2F4NA 1VE9A 3BE4A 4AMVA 5DSZA 5BN4B 4EHFA 4MH0R 2PUAA 1RNLA 3DAOA 3DMGA 1X9HA 3EX7C 1P91A 1HE2A 4GWGA 1FC0A 3OO1A 1II8A 1FDRA 2XWSA 2I34A 2PZBA 3IXQA 2OLJA 4D4JA 2O3RA 3WYGA 3OZUA 1HKHA 3RRFA 2Z0MA 3K9BA 4RK5A 3WG9A 1UM9B 2OSVA 1AMOA 3JVEA 1USUA 4IJMA 1TJNA 5DNAA 2ATVA 4RKYA 3JVUA 2Z6UA 1T9HA 4EYKA 1WETA 2Q50A 1XPOA 1BMQA 3LUPA 1GQQA 5IYZB 1RHQA 2R65A 2P9BA 1M1XB 4RZSA 1VPVA 1JEOA 1Z7EA 4MGKR 4GO1A 1PGOA 1Q7TA 4J1NA 5KJ6A 1EDOA 2XJ9A 1EGMB 5C8YA 1QIFA 2OV6A 4OIFA 2H4JA 3HR4A 3L7AA 3RWBA 4Q16A 1NVAA 5EXPA 4KR6A 1G8YA 2VJDA 3ZY3A 4QDJA 4YUZA 3EXIB 3R5FA 1KI7A 1RTTA 1ZNZA 3QF4A 2FZWA 3EGDB 2P67A 4KQHA 4ILKA 1SAYA 3EMDA 2NTVA 3P4YA 1LPNA 1SR8A 4N5HX 2NPIA 2QR3A 1OMOA 1D2HA 3A28A 5C53B 1VLQA 2ZYIA 3FM9A 2X86A 1QS0B 1M0EA 3I09A 1LSUA 4YNBA 2PA0A 3O8QA 5TGZA 1P81A 1OGIA 4EKNB 1QAMA 5T6MA 3R3VA 4AXBA 3FDJA 3SU8A 1L7XA 4CM9A 2XDWA 2IEYA 3GLUA 4G8CA 2FGKA 3RYHA 3IAAA 4IINA 2VP4A 1L5SA 1S5PA 1SK8A 3H8SA 4A8JB 5INTA 5L4NA 3H6GA 2HK6A 2VZ8A 1EESA 1GZHB 2HK7A 2IPNA 2REQB 3G49A 1U2RA 1H65A 4CHGA 3U40A 3UUFA 4D74A 2G0NA 2H0AA 3TQCA 3AY3A 2BF4A 2JGAA 3JQCA 4TGLA 3RRXA 5AI0A 3EQ8A 4BVAA 3BFVA 4RHXA 1RWNA 1BE6A 3L8HA 4IFBA 2Q3DA 3WLFA 4YK7A 2IUYA 1I4DD 2PNJA 4DKXA 5JPCA 4JEUA 3GRUA 5T41A 4KV7A 3UQZA 2RGBA 1E6UA 5DN6A 3B12A 2PUCA 4MIKA 1MJHA 4QXOA 4RESA 4M9RA 3ZTTA 5KDOA 2BEUA 4R2JA 2QTRA 1QXSA 2B0CA 2JGJA 1X14A 2RGCA 2A78A 3C6ZA 2XKJE 1OLUA 4M4SA 5A0FA 2XB2A 1U4SA 3T7KA 1KRHA 2FXVA 3ELUA 3O2NA 4PV7A 4RV5A 3WYBA 1QBKC 3OA0A 1TZJA 4JN6B 1XP8A 3OFND 4MYSA 5B6PA 1OW3B 4HI0E 1ZD5A 2FMUA 5I8WA 1WIWA 3ELBA 1Z4PX 5AXCA 1U9IC 2NU8B 1M0WA 1GUDA 2UZ1A 1JZQA 4D4LA 2BT4A 4FDUA 1PTKA 4N3CA 4ETMA 4W9RA 3TFQA 2EKLA 3KSBC 1JQBA 1LTKA 2YFHA 1VG9B 2VZEA 4QEZA 4RJIA 5E2AA 1J8FA 1LTQA 5E6RA 4DMLA 4KLNA 1N2XA 4BLOA 4TT8A 4WDQA 3F7MA 3PSHA 3KUDA 1GRVA 1QPGA 2GK3A 4PLFA 4UCWA 2VP9A 5SZHB 1QVAA 3ZV3A 1G3QA 1MXFA 5KTYA 3O3CA 5EOVA 1J0AA 2I67A 3VMMA 2X8JB 3AOGA 2GD6A 2GX6A 1UJCA 5DYIA 2P0EA 3MHPA 1ZRSA 1A88A 1HOTA 1R50A 2GPAA 3AXSA 3FUWA 1ARZA 1LJ8A 3QFCA 4FJ0A 4L72A 3RSOA 2PUJA 3PRHA 3ORHA 1N2JA 3A6ZA 1MEJA 1Q77A 2NPFA 1I9CA 2ZIEA 3SCZA 2CBXA 2XZTA 5BY2A 2UZIR 3USZA 2XMGA 4CQJA 1Y9JA 3IR5A 4KR0A 2YBDA 4BFLA 1U2PA 1Y6QA 4IXTA 1R12A 5EZ5A 4DMMA 2YYZA 4EK9A 5DNCA 1NC1A 1VYTA 4G1EB 4W5OA 2YHIA 3C1OA 1CLEA 1JKJB 1P18A 3GNSA 4JJKA 1CFZA 2HPHA 4G37A 1U8ZA 1UDCA 5IYZF 3IKTA 10MHA 3GL9A 1JG1A 4AROA 2AIRA 2ZYSA 3F5QA 2OQVA 4ZYZA 2XGGA 3L0PA 4UDOA 8MHTA 1R0WA 4Q21A 4C7BA 1JDVA 1NBMD 4WNIA 1USKA 4JXJA 4KODA 5IYZA 2CLCX 5GJWC 5A7GA 1QNFA 4L5IA 4YUAA 4R7TA 5CBPB 1N0UA 3G2JA 1CULC 1E5LA 4XE5A 5T7BA 3TUIC 4XRGA 3V34A 3UYKA 2WTBA 2H54A 3U26A 1U2DC 3PNPA 3SJZA 1UZUA 3P2KA 3USES 4PZAA 3RUDA 4EMTA 3JRWA 3GJTA 3RI3A 1ZI8A 1OLSB 4ZTBA 2FWPA 4XTCS 2Y0PA 3EXHC 5K8VA 2YJNA 4MQUA 3WK7A 3JQAA 2BZGA 1NF8A 1P6XA 4PEVA 1X80A 3UQYS 4CQMB 4DA4A 2C1ZA 2R1UA 2YWJA 2FPPB 2AX3A 1IMOA 2JD0A 2Y1XA 3JVIA 4HEA6 2J3EA 4UM9D 4F38A 4BNHA 5A03A 1XDSA 3NVKI 1LD3A 2CUKA 2P3QA 2HMAA 3D8HA 4CTNA 2NAFA 3KYDB 2FDRA 2WKWA 5DWQA 3EBOA 2ZSEA 4MV9A 5CW1A 3GRFA 4ZI5A 1T5HX 3ZWPA 3AMVA 2SCUA 3H1EA 1XOIA 4N0PA 3CS3A 1NUTA 3U7QB 2D8MA 2M9MA 4W5JA 4WXPA 4YGYA 3LU1A 3QKRB 5HZKA 1N9GA 3CUSA 3JQBA 3PZRA 4I81A 5HNKA 2P75A 2G36A 5DK6A 5G40A 2CVPA 1P7ZA 2EGHA 3E2MA 4M98A 4YIKA 5EKXA 5AVOA 3T5GA 3TLAA 3VJMA 2ZIFA 1SUIA 4ZCSA 4CHTA 1RP7A 3JQRA 2O1EA 1V3UA 4QFMA 1U2GC 2AFVA 2ZR8A 4RDIA 4XWYA 1QYDA 4YO8A 5ALIA 4BPRA 2MU1A 1RWXA 1JH8A 1E7MA 3LPLA 4QQFA 1K9SA 3S2EA 5JZSA 2GXAA 1P2TA 2J9ZB 2JAHA 3GGPA 3ML1A 4YT2A 2ZZKA 5KVVA 5CLQA 1X2BA 4RSRA 5F4BA 3V4OA 1U2EA 3H4IA 3W5VA 3X1KA 4C04A 1U5AA 3PLAE 2QQEA 3JALB 1SMKA 3MOSA 1NTOA 4FHGA 4GI3A 1R9GA 2JAOA 3U7EB 2QAIA 5CVUA 2WDZA 2WKRA 4YRKA 1MJNA 1CTQA 3KPUA 5K01A 2HTFA 2FWNA 2D2EA 1SXJE 5EAIA 3SICE 2V7UA 2GJAA 4OMUA 5AJZA 2QTGA 3S55A 2XVXA 5K09A 1DRKA 4M1OA 4Y2YA 3QLJA 4WOJA 4YHHB 4EFKA 3D6AA 4IDPA 3E6AA 5FTNA 4JCCA 2RGYA 4RA9B 5KAPA 1MU0A 2QUJA 2UVDA 4BZQA 4RK7A 1VLJA 2ATXA 4IILA 3SHTA 3LUJA 1H4TA 4REQA 1NUUA 2ZEJA 1UDBA 2RB5A 3UHFA 1JIXA 2VPZA 3H2GA 4QUAA 1KH2A 2GN0A 5JDCC 3FGNA 1M2EA 2VTKA 3Q6IA 4EF6A 1O54A 4ZVPA 2C9DA 2XECA 1SHJA 3IQEA 1NG9A 2QQGA 3F6SA 4HZUB 4NCIA 4A10A 4FCCA 1AKTA 3NUGA 4YV0A 4G5OA 2UUOA 3C6MA 4D4GA 4BVHA 2G5TA 4G23A 4M8SA 2V54A 4PSAA 2C7GA 2I4OA 3TOSA 4QHYA 2UAGA 2PA3A 3K4PA 2IY7A 5C52B 1H2HA 2CMHA 1JEAA 3I01M 4KJXA 1KAHA 2IXAA 5TX7A 2CVQA 4ESHA 5IWCA 3VR1A 2Z8XA 3IXMA 4HXEB 4DCMA 3DDCA 1N6RA 4BN5A 1C7ZA 4FHZA 5E7MA 4NIMA 1OPRA 2P2YA 2CSXA 1J09A 1M34B 1Y82A 4PGFA 3NYQA 5B7GA 3ZQJA 4LBWA 4F3NA 3VZDA 9ATCA 2N0SA 2Q2OA 3ZU2A 3NKLA 1P62B 1ZGHA 3IQWA 1NIJA 1YR8A 2QVXX 4X45A 4BNUA 3VHXB 3W3AD 1KJZA 5CCEA 5SYAA 3K6RA 4NV0A 2ORYA 2C97A 2W4QA 3DLTA 4N0MA 4W1QA 1YC5A 2L18A 3TQOA 3SQMA 4B82A 2CT8A 3B6MA 1J0DA 2MSKA 3IDZA 3WY9A 1R4NB 1GV0A 2BWJA 1NF2A 3RJ9A 3DHWC 1OXBB 3N8IA 1EJ2A 2VUHB 4L28A 3ZU3A 4HVCA 1C9EA 5TLSA 4NXNB 1RC0A 1K0FA 1A9XB 2DPHA 3WQQA 2CLOB 3OOYA 2HM7A 4MUKA 2IU6A 4URVR 2JBWA 4YPFA 1IIBA 4FMPA 4NS1A 5LYJF 2PDAA 1JYEA 1ZNWA 2HCRA 3KR1A 3QHQA 4Q6WA 1Z0AA 4R3NA 3VPXA 1AZWA 1G8JA 2CKMA 2O2HA 4HDQB 2Q1YA 3WYNA 5GTDA 4JGGA 1YS2X 2AG6A 2HAEA 2IA5A 3NONA 1XWWA 4LHVA 4P4LA 3T7EA 1L6IA 5EE1A 1JN0A 3PJRA 2E48A 4OBBA 4HB4A 4AZSA 1JQ3A 5T8KC 1L8XA 1NE7A 1GXSA 1R4NA 5JCOA 1YOBA 3DTTA 5CD1A 3S7ZA 2H4FA 4HAVA 4ZOLF 3DCIA 3IULA 4X20B 1QKJA 1KZ4A 4YRBA 4TYWA 1QRDA 4D9KA 4NJEB 1KJIA 4IDAA 4ZOLB 1UR5A 1XXLA 3FUVA 3OEYA 4EQ6A 2O3UA 3IV9A 4AJKA 1CWUA 1AA9A 4RVCA 2BUAA 6REQA 121PA 3JV7A 3ZXUB 2NQ8A 1DMSA 1F2VA 1YS4A 1ZDMA 1UQUA 2HWYA 1H2BA 1JBQA 1H9AA 5AR1A 2WWVD 3REFA 3CU5A 4UTRA 2A5YB 2AD1A 5CYPA 2WF9A 1Y4AE 5TT1A 3SHOA 4BNWA 4CFYA 1EBUA 2JIZD 1XZPA 2ETVA 2JJMA 1RWVA 4AC9A 3ICVA 4TV9A 2DERA 1H1DA 1HZZA 1VLLA 2J33A 1GG2A 3KPJA 4B17A 4QGBA 2VXYA 1DC8A 5KREA 3N0VA 4A36A 3VHXA 3EVAA 1FNDA 1V25A 4JR1A 1OB2A 1WMEA 1WDTA 1THTA 2P65A 3D6FA 5IDQA 5CW2A 2NTYC 3QITA 1LNQA 2JCVA 2AUNA 4KBYA 4RS3A 1FEZA 2R47A 4G0UA 3WV4A 3E5HA 1DAFA 1KNXA 2VC2B 3IPYA 4P3NA 1CIPA 1JJBA 2EEPA 3EVDA 3IX7A 4FS3A 3A14A 1A2BA 5FP0A 3O03A 3U5TA 1HNZB 3PNMA 2MDTA 1LEHA 3T7TA 4HAYA 4KPFC 5DULA 4ZZ2A 1ORHA 1FYDA 3ICCA 3HBJA 3A2LA 1W49A 3GEIA 3HR7A 5IDYA 1M6NA 3IB3A 3KKMA 3SXUB 1DGQA 2FUNB 3K5IA 3CH6A 3U81A 2R8BA 2GGSA 2O2CA 1JDPA 2H1HA 5TRTA 1XYGA 2B1GA 1H3FA 3G9XA 3B53X 3WGGA 1B0UA 1H5QA 4RIIA 2V0CA 1AS0A 3I9FA 2DG2A 3SS7X 2CHUA 2KE5A 3NTXA 4U7WA 5LUBA 1WUKS 4D43A 1TO6A 1S2IA 2AZTA 1VPWA 4BO1A 2IELA 2VYQA 1CZNA 4TLMB 3QBTA 1OI3A 2P41A 3EDQA 4G5FA 4BUCA 2IYUA 3NFRA 1TZMA 1SZPA 3IDOA 1ZN2A 3V8MA 4GLOA 5DNUA 4G1CA 2B9EA 3GJXC 3HM2A 1ZSVA 5FWYB 2ZFUA 3HXPA 3IAXA 3M33A 4PQGA 3TRHA 3RYIB 2C94A 4D9IA 1T10A 2E5FA 1QP7A 1AKMA 1G42A 2DKFA 2V7BA 5EQJB 4ZVOA 5LDHA 3TNFA 4F9FA 1T9CA 2WUFA 1XTIA 5FWXA 2W2LA 4GOXA 3QPBA 4B4VA 1RQ7A 4FHFA 4IXNA 3ZS9A 3B48A 4IWXA 4LDJA 3I0NA 4R1UA 2C82A 3C7AA 5COAA 5BSTA 1P5RA 5FBQB 5JNSA 1N9GB 2QAJA 1YDFA 3ZK8A 4W5QA 1J2JA 3DJYA 3Q9LA 1JGTA 3BFKA 4LHXA 1AV7A 3AF4A 2O1SA 4MVCA 2C5SA 3ZZTA 5EXXA 4XPIA 3ENQA 1W59A 3FVWA 3KP1A 4E2YA 1VMIA 1VL1A 4EG0A 5KINB 2D1QA 2PKQP 2F3RA 5FUVA 421PA 1KI3A 5KYUB 2C5BA 4AP5A 2R00A 4DWWA 3ELYA 2OXCA 3WXMA 1BVRA 3LCUA 1DHTA 5JBQA 2YWGA 2ZJ1A 1KETA 3QE0A 1BSVA 2QTBA 2PX5A 3PQ4A 1T5TA 1KE2A 3CRQA 3JYOA 3ZXIA 2NU6A 4KXMA 1EFLA 4D96A 4KXUA 3CNOA 3EWIA 1WHSB 3QMPA 2C77A 3A4MA 5J4KA 2B36A 4AJLA 1RSZA 3NI2A 4C21A 1Y5MA 2FUG1 1I80A 4CCYA 3JRXA 1HFEL 4JZKA 1T4CB 2GNOA 4ARAA 1MKYA 1SUEA 1VJ0A 2JVJA 4PXAA 4BRZA 2O5CA 1JG6A 3SZGA 1UADA 3TKYA 2BR3A 1QYVA 1DOZA 1G5RA 3GZNB 2FSUA 2RH9B 1ZM4A 2V74B 2E4AA 4MW4A 4N8DA 1ZBDA 5DI3A 5G4KA 5GJVC 5CDHA 3AP2A 5LR6A 3Q8LA 3AEYA 3BICA 1E3TA 3TLZA 4JUAA 1RYHA 2Z43A 4QXMA 4V2IA 4BLPA 2WU1A 4HHEA 3NHRA 4MWEA 4YMIA 4N3NA 3X2FA 4ROSA 3BG5A 2ZUBA 1I13A 4ZQGA 4IDEA 3W8FA 1JEYB 1R6BX 3I9V6 4W5HA 4RV9A 4LGMA 2NZWA 3LC2O 2J9YB 3E2IA 3UFBA 3DFMA 4BLWA 3H5AA 3U9LA 4ZKDA 4LKRA 2ZB4A 1NYTA 7ADHA 2RHLA 1R1DA 4GH5A 1Z6TA 5A2GA 4EA6A 4YA6A 2QF7A 4KSBA 4L95C 4PO8A 1YGPA 3IHTA 5I8PA 4L8YA 5ENZA 1ICIA 1K6IA 1UMBA 1RHKA 1YKGA 1S8FA 2TECE 1TVCA 2BHNA 1YR9A 5JJCA 2V7EA 2DH6A 2NYAA 3DZHA 4PGMA 4PVDA 3MRTA 4XB1A 5D8DA 2VQEB 2G1PA 3U3DA 4GC5A 2HU5A 4GF5A 1EGQA 1ITZA 1E79A 1M2OB 2C3UA 3D7NA 3TCNA 1DHRA 3KJFA 3TBFA 3O47A 1XELA 4BLSA 2RAPA 2O19A 1EVKA 2PAAA 2RHBA 2PSJA 3UXEA 4DM7A 2NZVG 2ZT8A 4POOA 1B8UA 4DAEA 5L40A 1RHRA 3L4BA 3LPCA 4N12A 2NT3A 2NV0A 3CX8A 3KXPA 5J43A 1D03A 4F4UA 4PC3A 1UMDB 3D6UA 4FP9A 1G3RA 1P39A 4RIHA 5ESDA 3SNHA 3RLIA 3RDPA 1CR6A 1PT5A 1XQ9A 3N0RA 2ST1A 1AGYA 4UPDA 3FWZA 1LV8A 1PLJA 2ID7A 1EPUA 3ANSA 4PCAA 1AY0A 2PD3A 2IYOA 2FY8A 2EAUA 4P38A 4Q9IA 1QR6A 3A36A 1DQPA 3LL7A 4KNWA 3PWZA 4O63O 1PR2A 3I2HA 1DMRA 3TZQA 4IH9A 5MF6A 1T43A 1M33A 2OB1A 1XV5A 4HEQA 1QOPB 2JD1A 4L8LA 4BWYA 1B16A 2QY6A 1UL1X 1GZ7A 3K2QA 3DB2A 1L1QA 1LU9A 1G21B 3I1JA 3FXAA 3R6DA 4BQRA 1U8EA 1XFDA 2Z30A 4YAGA 4R2IA 5B2FA 1IL0A 1P4JA 5CVEA 4KO2S 4OU4A 3QVGB 1I2MA 2PH5A 4Z9XA 2DHRA 4F3RA 1S3GA 1WEHA 2OMKA 2HPZA 2R6ZA 2VHJA 4KKXB 4BN0A 4JUBA 3ZIAD 2I2AA 5B37A 3GH3A 5KEIA 3O8CA 4M38A 2D2FA 13PKA 4XIFA 3FBGA 2O2DA 3A9VA 3OTGA 1R64A 2JW5A 2JEOA 3Q7SA 2C1EA 2ZS8A 4QUJA 1UZLA 1T5BA 2C7RA 1U0GA 4UVEA 4PSVA 1ORRA 4GLJA 4NU8X 4MINA 2HCJB 4RORA 2ZU6A 1JQJC 4TKUA 3U7QA 3JR7A 3EIEA 3H2YA 2XUZA 1FP7A 4LRXA 5TQ2A 3C4VA 2H7YA 4TYNA 2QIPA 4GQAA 1GVHA 2XDYA 2AK3A 3J7TA 2DULA 2N42A 1M2WA 2AWOA 3GJ7A 4KWEA 5KJEA 1YB2A 1L3IA 5GM1A 1TDJA 2INGX 4DTIA 2CHEA 2X8BA 1ZAYA 2B8NA 1C3XA 2XADA 4HAZA 3CNNA 3IQXA 2PSEA 2JFWA 4PAWA 3CUUA 1EFRA 3D2LA 4FGWA 2AVDA 3UMJA 3IERA 4O3FA 4CG0A 2EJWA 3IQDB 5DCUA 1ONSA 2PBFA 5K3BA 2J0UA 3F6PA 3FFAA 2PZMA 4E70A 2I2DA 2R4UA 4XLLA 2HUNA 3SZUA 2PL5A 2IYNA 4GBJA 1XPUA 3IA7A 1KU0A 1PTJC 3FVQA 5KI6A 1CZHA 2Z04A 5FTJA 3WBBA 2Q4OA 2KLHA 4YP7A 3E7XA 4JVNA 3BIJA 2REXB 2QLNA 4H1VA 3L8ZA 4PYOA 1F2DA 1E9FA 4R40A 1EX1A 5FOVA 4F4HA 1B6TA 3M5DA 3TSZA 3U3ZA 1N6KA 1SC6A 2P2SA 3NTOA 4H35A 1RAHA 2HIGA 1YQUA 2Z2ZA 5FBRB 2QS9A 4KO8A 2IYLD 5DBHX 5GZ3A 2D6FA 3E15A 3AP3A 5C34B 4FYIA 4AY4A 1D4OA 4BQQA 4G3XA 3OZFA 2IHZA 1B1CA 4PPQA 4JLKA 3S40A 1V9CA 1D9ZA 5E8RA 2JFGA 5CFRA 2ZSUA 4LBYA 5ENDA 2F55A 4N9QA 1MEEA 2PFGA 3DW3X 4YS6A 1H4SA 3NEYA 2AD5A 5GV8A 4IIDA 2VTVA 3HB5X 4G1VA 3VDRA 2DTDA 1JIKA 2RSLA 1HE8B 3WKBA 3ZNPA 4JT9A 4TROA 1KNQA 1XZHA 2X0NA 3B8EA 1EVQA 2REBA 1FQJA 1V47A 3MT8A 1EQUA 3T9CA 3O4RA 5ALJA 4EAAA 3QYJA 5CB4B 2DHQA 4X7RA 3OP1A 4FS8A 1C3OB 1SZDA 2ZRDA 4HAWA 4IHJA 4PX2A 2OY0A 2IXBA 3OD1A 5K3OA 3HCRA 1CRZA 1O94A 1NBIA 3R6LA 1QKKA 2LDBA 3JQ7A 4ZQEA 2H57A 4WMLA 1H0HA 3SBOA 5FWAA 5E4YA 1Z6PA 1JS1X 3BFJA 5EJ9A 2GA8A 4XLTA 2EZ4A 3SLGA 1U99A 1K08A 1R18A 4IBOA 4KTVE 4MYUA 4D57A 1E3SA 1XZ8A 2B7BA 3H83A 4Y6OA 1PV2A 4U6QA 1P0QA 1RP1A 1TTTA 1GCOA 1LY1A 2QMEA 1AQUA 2G8LA 1YZ3A 4MMZB 4TTQA 3HCCA 2C5GA 2CWWA 2J9XB 4G5YA 3KCQA 4TM8A 2GJ8A 1CD5A 5IC4A 2DLCX 4HY3A 4LDRA 4ZT6A 1JU4A 2XMZA 2WZCA 4DR6B 4IJWA 4MVYA 5AP9A 1EDEA 3DLIA 1A4XA 3EQZA 3PHHA 3X1WA 3HBFA 5FDFA 4LDPA 4GPD1 3HDGA 1Z2PX 3SBXA 2GSWA 3CXRA 3TOXA 1EM8A 1M73E 4OAPA 1M34E 2PL1A 4MO2A 1RIFA 4GDFA 4BNVA 4DLTA 2WC1A 4IOLA 6Q21A 1KWGA 1CC1S 2I2WA 4Y7DA 1I5RA 1VZ3A 3I9KA 1YBHA 3Q11A 4N4AA 1O1YA 2Z5VA 4Q93A 1NKVA 4IGAA 4K6FA 3W4JA 2ZKIA 4P08A 4YASA 1Y8QA 2BISA 4IEIA 5KWJA 4E5SA 2JGFA 2RBEA 3ESAA 4LFAB 2JK0A 5EXSA 5C1OA 3Q8MA 2VJLA 3OM9A 4D3SA 4O2AF 4I5EA 3AG5A 1SCAA 2WOJA 1L1FA 1XWFA 3EXG1 4OF4A 4IIBA 3E0QA 3MWDA 1JIVA 2ZYDA 3PTLA 2CL5A 3VTFA 5KX5F 1HEYA 1OLUB 5AIAA 2GLUA 3OJOA 2F67A 5HFJA 1YBVA 2R66A 4B7AA 4TM7A 4C43A 1CUYA 2B3TA 3BGWA 1GGMA 3PVZA 4TLDA 4GX0A 5CT4A 4MRSA 1AUQA 1F06A 1YR7A 4I4TB 1FDVA 1XK7A 2FWIA 3SAJA 2R25B 4EHJA 2KSQA 3B85A 1Q1EA 3BKXA 2W6JA 3L77A 3OZGA 1T8WA 1S3SA 1P73A 1P80A 3EGDA 4C7MA 1F0KA 1T2FA 2B2XA 4JYPA 2G7ZA 4Q9NA 1LK0A 1SVNA 3OETA 5AW8A 3F6CA 1HDYA 4DXHA 1GNRA 1HDGO 2N1BA 5HIAA 3IRUA 3TZKA 4DSAA 3DWFA 4YJHA 2Q29A 2SCUB 1KEKA 1SWWA 3MJ4A 3I1YA 4P5DA 3LC7O 3VNVA 3JD2A 3ZQ6A 3CIOA 3LDAA 4K1LA 1RU3A 3DMHA 3E0XA 3LRTA 1PBTA 1HTWA 1E5DA 5G4KB 1EDDA 3C3XA 4RY2A 4U7FA 5IAAA 2HK8A 2HN9A 4MQLA 3R74A 3SOPA 2GN8A 5FWYA 3WOHA 2P9CA 2ZETA 2AQKA 4JXKA 4Z1OA 1Y8RB 2OOKA 4F8YA 3FSRA 3OQVA 3LPAA 2AI3A 2IWRA 1USGA 3AG6A 4ZEXA 2WW8A 3TR0A 3C39A 3WLLA 5JXIA 2A2ZA 5AI9A 1PYGA 1B8PA 5BORA 3A58B 3P96A 1VCHA 3SJBA 4D2IA 1JEQA 3D31A 5HSGA 1CZUA 3IBGA 1VKRA 1Z34A 2CNOA 1FLDA 2ZBUA 4JJAA 1L4FA 5JZBA 1SIOA 1Z82A 1GHTA 5A9RA 5HWSA 5SY6A 1CJCA 1ZC3A 4MR7B 2N9UA 5DNDA 3T7SA 3GN1A 1HG0A 1M6EX 1JUDA 3NIWA 3DF7A 2WFMA 4M1ZA 3MT7A 5HRUA 4ZYUA 5GGXA 2JAXA 1N2CE 3P9PA 2OHJA 3DDSA 3FYDA 3M7IA 4UVHA 2R751 1E0SA 1W4BA 4Z1MD 3PHJA 1MA3A 3LX5A 4RL6A 2JB9A 3RAJA 1SBCA 1IG3A 1ML3A 2QXTA 1OASA 3JQ7B 3MBOA 1I4LD 2QKYA 4MQMA 5EUBA 4A15A 1H2AS 2YYAA 3C87A 1VKZA 4A3SA 1ZIOA 1XQXA 2PYDA 2B30A 4M1SA 4BCCA 3RAFC 2V3WA 1HSOA 4I4IA 2FZCA 3MS7A 3WMFA 3F5SA 5CB4A 5EPUA 3AJDA 1A96A 2R4QA 1Y9EA 2WIKA 3GW8A 1TLLA 2QD5A 1Y63A 3I34X 1QE0A 1SVLA 3WS7A 2H9AA 3QI2A 5U4XA 4U7HA 1HA3A 1NAIA 3AEKA 2WMYA 2YXDA 1IDOA 3HB7A 2FMFA 3RGWS 5HQTA 1TQ8A 2EJBA 3RROA 5K9ZA 5DBGA 3UWSA 3AIOA 1VECA 4C4PA 4RD0A 4DYVA 2NUBA 3KJEA 2ES4A 4Z9YA 3S3TA 3WDSA 1JLLA 1OY1A 2VBCA 4ZI2A 1HORA 3EE6A 3T41A 2ZYRA 3HMQA 3O1LA 1VE3A 4CKZA 3IMCA 2ZUFA 3PF8A 2A30A 4CE6A 1RLMA 3EUAA 1PR5A 1X1EA 3PCRB 3U56A 2FAXA 2PR7A 4GECA 3TI9A 5HGXA 2WT8A 1Z26A 1H2XA 4D82A 2PLRA 4LQLA 3ER6A 4RH0A 3PNBA 3AJEA 4DMHA 2G5PA 2AA3A 2D06A 3WHPA 5FTWA 1SD1A 1FDOA 2P2ZA 3RUEA 5TC4A 1EXDA 3NBZC 5IVIA 3TEMA 4K9MA 5AICA 4JLOA 3WRYC 2IP2A 1NWCA 3D3WA 4OEHA 4RK4A 2VQ3A 4L75A 5CIWA 1D2RA 1DQYA 3DD5A 3HYRA 4J8PA 3F2IA 1IM2A 4YAJA 5L45A 4K26A 2VYND 4UTVA 3IJPA 1N6PA 4AMGA 3SX0A 2W9XA 5C3UA 2CFOA 1QFZA 5E0OA 1T4DA 2PU7A 3FRJA 2O3TA 1ZOPA 3T4EA 2VYVD 2GHTA 3QVKA 3FWHA 1L7EA 2P77A 3RHTA 4WN9A 4ECEA 1ODFA 1SPBS 1NUPA 4H6PA 2BJWA 4Q9AA 2HREA 4H59A 3SC3A 3D7LA 1Z8HA 4RANA 4RNDB 4I6GA 5I9BA 1TO2E 1TCUA 3I9NA 1BQEA 2O8EB 4Y67A 1D07A 1L5MA 4RIEA 1CVLA 1FTGA 3F90A 1DB3A 3DR5A 1DXOA 5LD2C 2UYHA 3NWOA 3LQKA 3O1HB 5JZVA 2V98A 3E18A 4F9EA 1JKXA 5JYBA 5JNRA 2QAGB 1L4YA 1OU0A 4WN9B 1P7WA 1UZAA 1QPBA 1XZAA 2H8GA 3PA6A 4J0KA 2HRRA 3KVNA 4Y1GA 3VC7A 1SKMA 3WISA 3NJ4A 1E79D 1RQPA 2GHQA 1POWA 2G77B 2WU3A 4YQZA 1XLUA 2ZJAA 2H59A 3IPCA 1CQJA 3NBUA 1T1EA 1SBHA 1YJBA 1JPJA 2EG5A 4IF4A 4QGAA 1JDJA 4DJJA 3ZJUA 1DIGA 4EHNA 3NXSA 4OXQA 4BBAA 1JNXX 1AB5A 2YR0A 4H7HA 4V0KA 1CF9A 1WOYA 2HIMA 4LWOA 1N9ZA 3HKEA 2C2KA 5JWHA 1QF7A 4BUZA 1O3YA 1DOAA 1T2UA 2PK3A 3GDWA 1VMKA 3QX9A 4MHSA 1DKQA 1T9GR 2YWRA 3ZW8A 4TWBA 3OM8A 1GDDA 1Q1NA 3SEFA 3IP5A 2OKGA 3KKQA 2VWGA 2C5AA 3SYMA 4EDFA 5JNTA 1BWQA 1NM5C 4ZZIA 3MNFA 1D2GA 3F1LA 3UYLA 5JHHB 4P0QB 2NNLD 2QZJA 5FH9A 5AM5A 4OKNA 2NWQA 4HDAA 4KG7A 1BGXT 4NZNA 3WLQA 2QW8A 5IEJA 4AY2A 4OMDA 2G80A 2MSDB 3K9GA 1X7YA 2JRCA 3WLKX 2BTEA 1PFGA 4DLUA 3JAWA 1MMFB 5FXMA 5TE9A 2EBFX 1RS0A 5K3AA 5LYJA 2LCQA 4L5BA 2X4IA 4KFTA 4LDZA 5JATA 3RRMA 2GLTA 4UNNA 4E09A 5KC8A 1NQAO 1FSGA 3FSGD 1KMHA 2WJYA 2OB2A 4FD3A 1JR3D 1QIJA 4MDFA 1E4VA 2P4UA 5G2OA 2AF3C 2R7LA 4QPZA 4RXTA 4ZHQF 2BKVA 2E5LB 3MGCA 4QULA 4JUFA 4KQXA 3H9BA 4JYZA 4EDHA 1MO3A 1S9DA 2Y8EA 3H1GA 4EL5A 2V0GA 3ADBA 2WJWA 4JJ6A 3B1WA 2WU4A 1T0IA 4RTMA 3KM0A 1XUOA 1II8B 1I4EB 4OUDA 3BRSA 3K5HA 2ARKA 3I58A 4NAUA 3FF1A 4X94A 3TM4A 1WZNA 2P8JA 2Q3HA 1UK8A 1UT6A 3W2IA 5FV4A 4KDEA 2NPOA 5A4IS 1EFTA 1C1HA 1T0BA 4LC0A 1ZN9A 4TTSA 3L4SO 5DM1A 3OUUA 4ENUA 3AH8A 2WIAA 4MGHA 4F1JA 5EHXA 5C8VA 3D4NA 4B73A 1XGKA 3OZSA 4IXMA 3TNJA 3AEQB 5JEDA 3P9SA 4LNAA 1ZVMA 2E85A 3I39X 4BJ5A 4B5LA 1ZWLA 2A9QA 1TCAA 4KXYA 1CB7A 2BHRA 4I9NA 3SJUA 2Q6VA 1OC2A 3QPAA 2SHKA 4R0NA 4FI3C 4BIIA 2XZLA 3HNOA 4BQPA 2FEMA 1JPUA 1I4OA 2JJ1A 5ENVA 4OOFA 3RIXA 4EB6B 2A59A 1E2NA 4LW8A 3F67A 5KTSA 5AESA 4CEIB 1V3TA 5D7BA 5JH7A 3PIIA 4DNOA 4V38A 2G9NA 5LZ9A 1BRTA 4FW9A 3A26A 4QLBA 1LQTA 2OGWA 3HGMA 4IIUA 4UU8A 2YWCA 4YEDA 3F3YA 5H80A 2FX5A 4Q3OA 4D8VA 1GPWB 4JI2B 2ZTMA 5AKHA 2FQWA 4ZYTA 3U3MA 3OX1A 2Y0BA 3ED5A 5EMJA 2PSSA 4WVLA 3RT1A 1SVSA 5AUNB 3NT2A 1XRQA 1ZK3A 1H1LB 1Z9BA 5DPMA 5F2OA 1L7PA 5HE9A 5IPFA 3R8CA 1C4KA 4QWWA 4LECA 1UBEA 1SKYE 1FLNA 3H84A 3L4BC 2O5VA 4P98A 5FV7A 3TFOA 4H9GA 5L7TA 3HDHA 4TKZA 3NAQA 2AHRA 1Y9ZA 3AKEA 2D7JA 3GRRA 1FFDA 4MS4B 3BK2A 5KPJA 4U9UA 1ZEJA 3GHHA 4AG5A 2OXRA 2C2WA 3OLXA 2XB8A 1ZM7A 2FHSA 5DYNA 2JLBA 4CKXA 1E77A 2ZYWX 2GVDC 3MJRA 3TZBA 1FCJA 2AUMA 2WB2A 3SK0A 3K30A 1Y7HA 3T12A 2A0WA 1E3WB 4OHOA 4QL3A 1MNQA 5IZCA 1R6UA 2R84A 1U3WA 2ONJA 4KQEA 2PLAA 4AD8A 3BD9A 4FYWA 2H2WA 3ZE2B 3PFCA 1Y5RA 4KZPA 3EA0A 4ESEA 2KWIA 2FG7C 2OV8A 2AW5A 1UJ2A 4QAQA 4MW9A 1D6NA 5EI5A 3ZHVA 2HFJA 1E9RA 4YCCA 2A5GA 1WNFA 3C8MA 5H3CA 4X62B 3GLFB 1E61A 2FMIA 1BO6A 2QJTA 1NT4A 2WRZA 3P9NA 3SKYA 5LP1A 1HO3A 4GPTA 2A1UA 4M0UA 4QU5A 4A6DA 3IURA 1NSTA 2ZDGA 5JAHA 2YJ4A 3KLOA 3WNDA 4MVJI 4U2GA 1AQ6A 1KDPA 3HO1A 4QYIA 4LJ7A 4LSZA 1Y48E 3G23A 5K0CA 5BQOA 2FG6C 1C30B 1SXIA 1ZGBA 2JJQA 4UAJA 3GJ5A 2WOOA 3J80A 4BEJA 2BFWA 2QE7D 1LLCA 1SY7A 1JIJA 4AUNA 5C51B 4YPOA 1CUHA 1HL7A 2CDNA 3KV3O 5EERA 1L5NA 4FQ7A 4EGJA 8LDHA 4PN3A 4E94A 1JLLB 2WUEA 2QGZA 5EC8A 1CQWA 5DHQA 3WB2A 2CLLB 4RSMA 2X7HA 4JC0A 4V39A 1USWA 3CY6A 3KOXA 3T7CA 1GZ5A 1PW7A 1GG9A 3L7NA 2YNMA 4RH3A 5I5EA 2G25A 1G4UR 1XZCA 1KMHB 2SICE 4X6UA 4AUMA 2PVSA 1E92A 2YC2C 2OP0A 3KYIB 3AZOA 1PJLA 4NOLA 1E3QA 4A0SA 3EWAA 1I3NA 4FLEA 4LRYA 1UKYA 4GSLA 1E1YA 1KZYC 4LYHA 3TTUA 1X7YB 4UVDA 1JEJA 3BSSA 3H4TA 1MAWA 4O4LF 1FQKA 5K6AC 3G2MA 2X5KO 4BQSA 1XCBA 1KFCB 3C3EA 3ZD9A 4NBNA 3W7VA 1FRFS 5TT0A 1T5LA 3P19A 1T5IA 2FFAA 1Q7BA 4G85A 4YRQA 5JSYA 5D5PA 3IJ5A 2VRBA 3L0DA 5THQA 3WIBA 4FHDA 5HUJA 2MMCA 1A5AB 3GAZA 4PYKA 2J67A 2YHIB 5AVJA 3Q3CA 5EL0A 1GKUB 4LNUB 2IE8A 2CLMB 4LNHA 5HCUA 1F5SA 4YXWD 3KC2A 3LDGA 4MRAA 3AY0A 3FGZA 1Y3CE 4HWKA 5K2OA 4BLTA 1X7WB 2FPMA 1X80B 3FDZA 5LLTA 2ZRBA 4KLRA 4M1TA 2JFZA 3QVSA 1M8GA 4NEHB 4XDHA 3SR3A 4WY2A 5ERXA 4JP2A 4L73A 1VOTA 2F1KA 3ZHQA 3VDXA 1VQ1A 1ULTA 2RGNA 4MMXB 5ER9A 5AJYA 4OHPA 2WF8A 5EA2A 2Z9DA 4MIOA 4PRKA 3S81A 4XPZA 5F1YA 4EG4A 2JLCA 2VTEA 6REQB 4E13A 5BQ3A 1YBAA 3KAKA 4CV2A 2JVIA 4O08A 3PFWO 4ZMRA 5KTMA 1OIXA 3A4TA 4QTZA 3KSZO 1QZXA 3PQ3A 4HWGA 3GLIB 1YRQA 3RTDA 4FNMA 1BE1A 1PQPA 1W0JD 2W4MA 5FOTA 3OC0A 4K1XA 1T3HA 1MR3F 2XHEA 3KOZA 5LA6A 2D4HA 1FJXA 2CDRA 3EG9A 1NJ6A 1NSFA 3KOMA 3OPNA 5IK2A 3AR9A 2QRVA 1V2HE 1XL1A 1D6JA 4QU9A 3PTAA 5JS1A 2R7NA 3IR6A 3VR5D 3W3AA 5AM2A 4BEWA 5K1ZA 3W2HA 2BE7A 5DV9A 1QH8A 1CY8A 2FW7A 2O7NA 1ORVA 4QICA 4Z3DA 1Q1ZA 1PJQA 2B1IA 3PQ2A 3N28A 4POAA 2HI0A 1YQEA 5CNKA 3O8NA 2CJXA 4YBRA 1T1SA 3ZWNA 1U5BB 2PQ2A 3E4DA 2K2QB 3PSAA 3EGVA 3HADA 1DPFA 2JCYA 1U0OC 4HGRA 4ROTA 1GV1A 2BMJA 2VSFA 3L7CA 2QMHA 4NCHA 4TS1A 4X41A 3NR2A 3C16C 1W36B 2GRAA 3T3EA 1YJ5A 3OQJA 1TAGA 2AZMA 4J91A 2FPPA 1X7HA 3FHCB 3HLKA 3OJWA 3MWDB 4DLZA 2A33A 1EWRA 4MRPA 1FL9A 3GWGA 5F2EA 2G82A 1FFGA 2POQX 3IELA 5AM1A 5DBIA 4NHOA 3FTQA 2BGGA 4GHWA 3PD7A 4URFA 1E1QD 1LI4A 2ZB2A 4X85A 3ZKWB 4CDGA 5REQB 3U16A 1E4YA 2XQGA 2PO5A 2Y3IA 4UUNA 5AYVA 5IN5A 5CITA 1MC4A 5KHOC 2GM4A 1M6HA 2WWIA 2FFHA 3VJRA 1EWTA 2P0YA 4GVLA 3N2KB 4U3JB 3AI3A 1DC3A 7YASA 4UE2A 3A3PA 2HV9A 1W34A 2HRBA 3HRKA 2JJ2A 1RHJA 3G9ZA 4H3HB 3OU7A 4RPKA 4D45A 3RPEA 1OQAA 4QPPA 4TKVB 2JKZA 2BGUA 2EFGA 3FSEA 3CUEF 3C7DB 3L7KA 3OG9A 5L9AA 1CJKC 1WPRA 5LP6B 1RVDA 1NBOA 3OWHA 1KY5A 3O5AA 4I55A 1KAOA 1LPAB 2JLZA 2IYSA 4J0CA 3R3YA 1JKJA 1LH0A 3E9MA 4ITVA 3GPDG 4XX0B 4EJMA 1ZINA 2HRZA 1TF5A 3S2UA 4UJ5A 4QTUB 1CFJA 2NUTA 3UWMA 4Y2XA 5JDCA 2HLDD 5CLLA 3D7RA 3BUSA 4DR4B 1ADCA 2AG5A 3WBJA 1OKKD 3VC3A 5KS2A 4RHFA 4ZVRA 3FETA 3N8HA 1GU1A 2W2NA 2XQIA 5C32A 1L8OA 2OO7A 1Y6RA 4DVJA 3C1TA 4PQYA 1KKLA 4RMNA 2QD2A 2D54A 3HHPA 4TYPA 4IHJB 4G84A 2UYYA 4LVUA 4AMYA 4X65B 2C78A 2O8FB 1DXQA 1WUHS 3A6EA 3PFIA 1OFIA 5EJMA 5DXFA 3R9IA 1JR6A 1TVEA 1NQOA 2YWEA 1I3OA 3IA2A 3EQ2A 1V48A 3BWEA 1N1EA 2JA2A 2ZTLA 3PFNA 4X1OA 5T4BA 4DCPA 1A2KC 1E1NA 2X0RA 3KU4A 3IOCA 4PCVA 1EAMA 2GM9A 2V7GA 3SOZA 3TXYA 2C9OA 1YB4A 4AB1A 3ZHTA 5KOHA 1ZJZA 2OAQ1 3OLCX 3FOCA 5BWNA 2XDQA 3CFYA 4IGEA 1SCJA 1NVBA 2JGKA 3I2KA 1D0SA 1DFHA 5FUQA 3ITKA 4BNLA 1YZNA 3WE7A 2E2WA 4CG2A 3G1TA 2EFEB 2IYTA 2ZJ0A 5FCDA 4YXFA 4EG8A 4QBGB 3ED1A 3S2ZA 1VLZA 4F93B 1KOGA 1YS9A 2FETA 3QVLA 4Q7MB 4PICA 5GONF 2WAXA 4WA8A 3AKYA 3G13A 3PUHA 1JX6A 3N7AA 4D3YA 1GY8A 4D0GA 1CS0A 1ACMA 2QORA 5FL3A 1FFHA 2E18A 2LP4Y 4Q3DA 3ROPA 1QVRA 4WGGA 3OKPA 2F1IA 4WOKA 5KNBD 1NPDA 3D7MA 1A7KA 2ZYTX 3BCRA 3FBTA 2TS1A 4D8UA 3K71B 3FFXA 4IHKA 2G08A 4Q4DA 4FINA 2R79A 4PCLA 5ADHA 3P9CA 2WU8A 1QUFA 1TMOA 2CN1A 3VZRA 2Q5QA 4HS4A 3I45A 3P2YA 3WGOA 1N5KA 3EISA 1VMAA 4LHWA 5LQNA 3GEMA 2WHYA 3CZ9A 5CDUA 2JHCA 1EXVA 4JKIA 5HYVA 3RABA 3GXBA 1J1ZA 1ZVVA 4HXGA 2ZXEA 4K3VA 2B78A 4OATA 4KE7A 1LB1B 3OT4A 5CX1B 4RCYA 3UUEA 1NP6A 2GZDA 4PIVA 3FOEC 4URHA 5LQRA 4O0LA 1VIMA 3CF2A 5DBEX 3ZH9B 5ICMA 3SSAA 2WFAA 2PRJA 1XMVA 1E32A 1Y4ZA 1SBNE 4DQVA 4FJ2A 1NJ8A 3DEHA 1DCTA 5K0GA 4Q3EA 2I2BA 5TPZA 2V7WA 2JIOA 3H8WA 1UBNA 3C70A 2QVZX 3ZIUA 4JI8B 3FMFA 3P27A 1YIOA 1JHQA 4M53A 2C2HA 1WU8A 4CM9D 1GNVA 1VP3A 3DWGA 5DYWA 5DGDA 1G66A 1UC5B 4R1PA 1CY2A 3R7WB 1T26A 1TTQB 1Z2EA 1I5OA 3CMMA 4HPWA 3F8TA 3PRKE 3WWDA 1P8JA 1T35A 3QE2A 5GM2A 2J9GA 5BSMA 3FDZB 4LV5B 2J41A 3Q2IA 1E6CA 3H3XA 3KLNA 2WSLA 2AG8A 4K2AA 4UKDA 4H16A 4OHFA 4DBZA 3SGLA 2XE8A 2G9RA 2ZUCA 3ZH2A 1NBWB 1TX4B 3LVQE 1WD7A 3RK4A 3OUZA 2E89A 5D01A 4ED9A 3K6SB 4GC9A 2J48A 2ODNA 1T8PA 2H5IA 2P6PA 2V0NA 1Z4LA 2HZ7A 3PS9A 2Q0QA 3QU2A 2OD7A 4LDNA 5ESRA 3W1EA 2YWBA 3DLAA 3H0EA 1LI5A 4LYDA 1MGOA 5A6SB 4ER6A 5BR7A 2BSAA 2NO5A 3P32A 4Q24A 2MYNA 4WBNF 5B7NA 1H5UA 4IXWA 5E2IA 3UUWA 1PNOA 2QTCA 2HLDA 4ME6A 1C8BA 1DBQA 3F9RA 3FZYA 5FBKA 3UK2A 2ZZNA 2DKOA 4B6FA 3ZD7A 4C7OB 4B6JA 3NDJA 1B6RA 5DVZA 1YMQA 2CMFA 3MLEA 2FZGA 3HJUA 4M54A 1QIMA 4NK5A 3DMFA 4Q7EA 5K3FB 3R7FA 3UW1A 4ALLA 4B6OA 4DG8A 1MJGA 3OMLA 5IDWA 3RS0A 1A5TA 1EFUA 2XVZA 3TOZA 1Q0TA 1WY5A 1Q0LA 1XMPA 3FLBA 3K6JA 4A0GA 2VZLA 1MDBA 1VYHA 1EDBA 1T6YA 3E81A 3F47A 3KALA 3OWXA 4NULA 1U1IA 2CXTA 3HC7A 2YFQA 1JXOA 2WAOA 4NFLA 2QX9A 4UUMA 3WL7A 3KQWA 5IM5A 1H8HD 2PMDA 3KG2A 1UT5A 4OP1A 5IXSA 2J5BA 2LZ0A 4U9HS 1INLA 1ICEA 3ZD8A 2IUSA 4G5QA 4HFJA 3V8EA 4ARIA 3S2YA 3G1UA 4OK6A 3FUXA 3H18A 4INAA 4XSVA 5CDSA 2ZXUA 4YY3B 2EZ8A 3LSYA 3LZDA 3SC4A 2XPCA 4FCVA 4FHCA 3SFTA 1PWEA 2FFQA 3OLWA 3SPXA 4MI6A 5JRJA 3OMWA 3RC7A 2Q27A 2WG1A 4M83A 1CRLA 3GLGB 4BE4A 3ENWA 1XZLA 2YN2A 2G5CA 4LHYA 2OBXA 4ZMBA 1V35A 3I3OA 5B57C 1AMNA 4P4SB 4C6TA 1CXZA 1CR0A 3LP8A 3AGPA 4O1MA 3DBVO 3WQHA 5C81A 4LYYA 5CPBA 1BVUA 1N3YA 1L5OA 3HZOA 5JT1A 3EFEA 4I19A 4YCMA 2HADA 4H1UA 4J16C 1ZI6A 3H5NA 1VSQA 4K9OA 3HCFA 4QFBA 4TZKA 5AHRA 1IZ8A 4DLSA 4RHCA 1BMFA 5IVHA 5JCXA 1P33A 1XWIA 1VBKA 4MW6A 4ZC1A 3B38A 1TM7E 1E2BA 3T3HA 2F43B 4N0QA 1IN8A 3D3EA 2J09A 1E0DA 3IEPA 3FI0A 5F73A 2E3JA 2YXNA 3GUCA 2II6A 3FMOB 3QKIA 4GGOA 4R9UC 3MWEA 3CZMA 3ANXA 5J1SB 2WWYA 1QRSA 1IK6A 3ILYA 1J0CA 1SBTA 1CUJA 4B4WA 4B3GA 1QLHA 1B15A 1XKQA 2PAFA 3SC2A 1SUFA 4G9GA 4AO7A 2DF8A 2CCGA 3VNSA 1EU1A 2OQ2A 5K8UA 2AR7A 3DR3A 1W75A 4DVGA 4F4DA 5CVVA 3SE0A 5JQGF 1A9XA 3GVIA 1J07A 1P8AA 3DE1X 3ZTWA 5CEFA 1P77A 2EJCA 4YP0A 4MA0A 3D3WB 4I50A 2W6OA 4N40A 2ANBA 3FNHA 4KDFA 2VR1A 3D8UA 1FP6A 4PFSA 5CYGA 2WWGA 2B4RO 3TPFA 1XVLA 2GHIA 4IUYA 5FPKA 3F6RA 3VH4A 3MCVA 1OD6A 2WJ6A 4XYLA 4YYZA 3VYSB 2I54A 2AMVA 2I0FA 2MSWA 3D8TA 2W2LD 2E87A 1FNNA 5FTMA 2BCEA 1MVNA 3HKDA 4O8CA 2D5IA 1TK9A 5KSPA 3VVBA 4W9MC 4U3JA 1ZJ5A 4NLLA 3SX4A 2YIJA 1W5EA 1XA0A 3UJHA 4F6LA 3AVPA 3CVXA 2F48A 2WWWA 3AYXB 3UUGA 1GLVA 4JFAA 3ZCQA 3JYQA 3OF3A 1H05A 2F6RA 4KQMA 4RKWA 2I4LA 4KI0A 5IBQA 1Y1PA 3QRWA 4HGOA 4HRVA 4HZGA 1V8ZA 3A1FA 4PNPA 2DWQA 3IB6A 1A8QA 4CF3A 4FMCF 4MLDA 5EJ5A 1MW8X 4IKPA 3A25A 1EDZA 5JZ9A 3T1QA 3BZUA 4YJFB 3L79A 1RYFA 4Q9JA 3JSXA 4ER0A 4WFJA 4AMBA 3CWCA 4BP3A 3RNLA 4HYEA 4YMUA 2O5EA 1FYFA 5KQGA 3MJFA 3C1AA 4NQRA 2H08A 4WCVA 5AOCA 1WW8A 3NT4A 4PQFA 1HQDA 5KBYA 4YMVA 1MB0A 2VN8A 3JAWB 3PNKA 4LI3X 3Q9UA 4L7VA 1KOJA 5HF5A 3WLNA 1KERA 1TIPA 2IUEA 4NWIA 4RVSA 3M9LA 1YASA 4G5XA 2O4CA 4TXNA 2CL0X 5EYPB 4A8JC 5ITZA 5A5VA 2ZT7A 4NI5A 5EXDA 1C9DB 1I7DA 2E1PA 2QXUA 1BMFD 5F3WB 1YGYA 2JFXA 3ZHSA 1CDEA 1CF4A 3L3BA 4M46A 2EKZA 4TSRA 4S24A 2WIJA 1Q1GA 2B3DA 4K87A 1E2MA 4TMWA 2W71A 2XYGA 3JATA 4O1HA 4P3XA 3OMXA 2F43A 1HE5A 5FLEX 1TK3A 4MP8A 2JARA 2RBGA 3ZVLA 2HZBA 1IWBB 5JMPA 4E32A 1LFAA 4FYJA 3Q3IA 4JITA 5C8DA 3NHSA 4H0CA 1GUYA 1Y42X 2YY7A 1NZJA 2O8DB 2IDZA 3FJOA 4O2BB 4Q1AA 2IDKA 1Y1SA 2QNIA 2A3NA 3FRIA 1AV6A 4NFHA 4ZJYA 1GGVA 2AOUB 3T6KA 3AETB 1SZCA 1NVXQ 1LDNA 1V95A 4RPLA 3UOAB 3IT2A 2PZFA 1NRWA 4DLAA 1Y1LA 2FMHA 4P5PA 2XTAA 2COEA 2ZIGA 2QD4A 4QBIA 4CT5A 1S3FA 3STHA 4FTWA 4XASA 4Q3LA 4TXHA 1HH4A 3QLTA 3ETGA 2FQYA 1CUVA 1Z68A 3L6CA 3VDMA 4DILA 5CP8A 5BSFA 1XVIA 4TV9F 5C4IA 1Z2CA 3R20A 1TA4A 5ALPA 2XH8A 3RLFA 4EPRA 2FSFA 2P9EA 3AINA 2BYTA 3E8MA 4ZALA 4R4JA 4A2CA 3K9NA 1IHXA 3EARA 4R8LA 1SIWA 2QY9A 1IFXA 4TWJA 1KP3A 4YRTA 4MCHA 3U49A 1E1RA 1KO5A 3L0BA 3Q87B 4A5OA 3EXEB 2H29A 2IS1A 5ALGA 5DMXA 3GT0A 3HU2A 5I7HA 2XUDA 3V6MA 3LCMA 2XW6A 3ROEA 1VG8A 4CCAA 2XCSB 3H2JA 4TOIA 2ZRCA 1G9TA 1FYWA 5A71A 5LNK1 5K7SA 1PG0A 1CHNA 4U2BA 2OFPA 4XOIA 3U2QA 1XZMA 2QD1A 3R24A 4XGIA 1PJAA 2GYUA 2O0LA 1KGDA 2P2NA 2B2CA 3IJRA 4JVMA 4QJIA 4CIAA 3UXYA 5JJIA 1WMDA 2GHRA 3QIVA 3WL6A 5EP4A 1MZPA 2QM8A 5HA5A 1BZYA 1EXMA 2LCFA 2RGRA 4MV5A 4UMEA 4TYQA 3GHYA 2ZSFA 3QFHA 4RPCA 4NSNA 2FRVA 3HFSA 3HP1A 4IY1A 3ESBA 5C5EA 1ZOOA 2H92A 1HFKA 2WZDA 4K7JA 5EJ7A 3A1WA 5ALYA 1NPYA 2X5NA 4NDNE 3KAJA 4XLZA 3W04A 5A62A 1ZLYA 3DZJA 4EG6A 1ESEA 4Q4HA 2V7PA 4YTEA 3OFJA 3VZBA 1XRMA 1MOZA 4WESB 4F8JA 5J5VA 2GETA 4UBNA 3W8RA 4BFXA 5I7UA 3K31A 2WHEA 2X9QA 4MOWA 5F9HA 3VPCA 3ORYA 3KTAA 4Z4EA 2AOXA 1CUUA 1L4GA 5CYFA 4ZYXA 5BWLA 2IPXA 2OCYC 1JBEA 5EUCA 4WQMA 2GBFA 3DD1A 3IEXA 1QTQA 2P4SA 1BH2A 1CPYA 2RIPA 3CX4A 2A9RA 1EG7A 3DYVA 1FNMA 2YV4A 1IBCA 1B6SA 2CLFB 4OQ4A 3UA3A 1FQWA 1GZ6A 3HXOA 4WTOA 2YV3A 3IFSA 4RKFA 4HDKA 1X9IA 3KQVA 1JRLA 3GEPA 3STWA 4HVLA 3ZHYA 4HNTA 1WPXA 3TINA 4OPMA 1F17A 2O7VA 2ZK7A 1Z0DA 1QAQA 2TSYB 4GIBA 4BAUA 1AOXA 3GFSA 1KRXA 3IOBA 4LCJA 2C8VA 3ADCA 1OH8A 2I4NA 1AKNA 4GD3Q 2NUAA 1GPJA 2X77A 3VR4D 4R1SA 3DVRX 3MAGA 2ID9A 1UPFA 2IVFA 3ESDA 1UBHS 2G1KA 5EVCA 1ZIDA 5CXSA 3TUJC 1JFLA 4QOGA 4R2MA 2W6NA 1F38A 1HYEA 2Z8YA 4F8EA 1KDRA 3IOYA 1Z0KA 3L93A 3O90A 4LXTA 4RJKA 4YMWA 3TLJA 4MUEA 3PT5A 3FOWA 1IPFA 3ND6A 3R3UA 4MQEB 4OP2A 2B8TA 5DBFA 2BAGA 2ZRIA 1DX9A 3D9QX 3JVVA 2OHFA 4NL4H 5FLKA 3UT5B 1BWRA 3M4ZA 3W3ZB 3S1SA 2CNLA 1MX5A 2GPSA 2HIHA 1ZCJA 3DZFA 4G4IA 1U9IA 3F8WA 1KJYA 2AOUA 4Q3KA 4U7GA 4Y2GA 2JCSA 4INPA 5BWBA 2Z3WA 3I4FA 5KTKA 2HCBA 2QHXA 1COZA 4CEHB 1GGNA 2ZBQA 4Z9FA 1YHNA 2DC1A 4AS3A 2O3SA 1QHFA 5H1YA 1H6CA 2R5NA 3AU9A 4RD3A 2HBZA 4JB2A 3PFHA 3VHRA 1EZZA 3FLEA 2Q3EA 2YXEA 2NTJA 1ESNA 4IQ0A 4FNGA 5NULA 9LDBA 5E3HA 3MTDA 1JKFA 1X94A 1E6KA 1QHSA 3Q3HA 3SEAA 1A04A 4IUBS 1ZLXA 2P0AA 3R44A 5I4BA 5FAXA 4PZPA 2EBHX 1VJ5A 2EJTA 2Z2YA 3OT1A 3STXA 2V6MA 4MRVA 4JELA 4H7IA 3YASA 1ECBA 3VOTA 2CJWB 2EOAA 3HH8A 3N2LA 5A4MS 3P2EA 1U3TA 1GARA 2Z9CA 2ZIVB 4NOMA 3LZ6A 3V9PA 3KXLA 1E5QA 1N2HA 1V7ZA 2OWDA 3GAAA 3LHKA 4IIJA 4WASA 5FFMA 1CUCA 2GF9A 2M6LA 5ALRA 4D0SA 5SZIA 5IKMA 1E2EA 3WKAA 4GVXA 6PFKA 1EVEA 1NMEA 1Z5VA 3J81k 1MH1A 3QYAA 4YWHA 3WB0A 4HDRA 5A2QA 4OLBA 2ODEA 2GK6A 1Z6XA 1KK1A 5DCLA 2CCJA 1KDTA 2B7LA 1G64A 2HNBA 3OQPA 1ZSYA 3DZIA 2J7KA 5F1KA 4MGYR 1DG3A 5CD9A 3W1VA 2IOFK 4DYHA 1S4MA 3BJIC 3TYXA 4CI9A 2ISQA 3EZ6A 1Z0IA 1JWBB 2IHTA 4NYMQ 3UOWA 1DKUA 2BD0A 2I1LA 4IMRA 4QOJA 1WPGA 3HXKA 4JUDX 1XCJA 1HE3A 2Z3ZA 1H6DA 3I4LA 3LCRA 4HTFA 4TMZA 5CCBA 2CL6X 2JF0A 1OWLA 4L5AA 1ATZA 2X0KA 3VZQA 3ZN2A 2UZ1B 5C1DA 4UAUA 2X8WA 2Z1MA 1BKSB 3EJWA 4BNTA 1JILA 1NMQA 4BX9A 3P97A 5TMBA 4GXRA 4MR7A 3I5MA 3WQSB 3ZJVA 1BW9A 1QO9A 2YTZA 3MVEA 3I23A 4ZJZA 1J5XA 2A1TR 1X15A 2FZLA 4DBLE 1NLFA 2PZGA 3QF7A 3CLRD 4QREA 4OAOA 3M4XA 4XVCA 4YB8A 1B7GO 2UZ3A 3I04M 4QOHA 5C4GB 1K7CA 4WBNB 4DHEA 4J0HA 2VQSA 1JMYA 2F17A 1G5TA 4EBFA 3EIUA 4D80A 4J94A 1UC9A 4JQOA 5I9TA 5EMKA 1RXEA 2WAMA 3KZOA 1XVTA 1N4DA 2P9QA 5GOZA 4LF4B 5COQA 2HJRA 2FRDA 2NU7A 3AR5A 1TF7A 1TIBA 3BE5A 3CSUA 3DOFA 3JQBC 3LTEA 2BI7A 3QBEA 3SD7A 3I32A 5JD4A 3UFXA 5L53A 1SXJB 5ERYA 2N3ZA 4D9NA 4GKKB 4MO9A 1YA6A 1ZH6A 2VDMB 3VO1A 5G41A 3ZDFA 2JIPA 5EIHA 4E3WA 1A82A 5DYYA 1N92A 2HJGA 3NHWA 3WGNA 4C7XA 2X15A 3IQGX 1S3IA 2Q1TA 3NCTA 2ZIZA 3O9VA 1TLFA 4PSUA 1WP4A 3EODA 3QZUA 1IOLA 1CR4A 3VA7A 1XD2B 4BVGA 3UAWA 3C3CA 4MIYA 3HZRA 3VSBA 4DV1B 4WZBA 3R7BA 1JLSA 3JR3A 1BXKA 4OSEA 3T4PA 1PW5A 4HD8A 3NHAA 1T6ZA 2R1VA 4BLVA 2C57A 4GSYA 3AWIA 3MXOA 2PD6A 1VDZA 4J75A 4Q7JB 3TRIA 1O97C 4B4KA 3H1FA 3ERCA 1U8FO 1JDBB 1FFBA 4N01A 5JO9A 4B2LA 4F1KA 5I9IA 2O2SA 3ZI0A 1WB6A 1IN6A 3JY6A 4Q47A 1OFUA 2X58A 2ECPA 3CNQS 1E1MA 2HU2A 5A02A 4II2A 3RFCA 3KXIA 4DLRA 3EPRA 3NP7A 3H1TA 1F4PA 3W5DA 5F21A 2WY2D 2HSJA 4ZI7B 2QVGA 3BK1A 5DI3B 5FTLA 3LWBA 1GZDA 3RG2A 3WRXA 4JHXA 2G0AA 4DUZB 4ID9A 3KWLA 3DCJA 4YJDA 4QBHA 5HP4A 1J2UA 3KO8A 1DEHA 2W7TA 2IXEA 2UYOA 1MD9A 4P7FA 5DGXA 4BU1A 4I6EA 1JU9A 5AW2A 4FI3F 1P1RA 1UJBA 3PJGA 3TWOA 4RVNA 3DOJA 2WVJA 2PGDA 5DTMA 2VJBA 2R86A 4NAVA 4BMCA 4OGKA 3IPRA 1GPUA 1FS6A 1K6JA 1WVMA 1RJEA 3BD7A 3GIDA 3LHIA 1AF4A 2LWIA 4IGKA 2WJ3A 3LZCA 2B25A 1AS2A 3OQ1A 3OT5A 2PQMA 2XCIA 3U31A 5IANA 4CGZA 2XKBA 3G0GA 2QJRA 4ND2A 3GQVA 2CWDA 4RGBA 5D1HA 1GQRA 4LF8B 3A1EA 3LYLA 1NG1A 2BI4A 3KX2A 3N05A 3AF2A 4LZAA 2CV1A 1L2TA 4RZHA 3KB2A 1UUFA 3N2IA 3VH2A 1IQRA 1JXMA 1ZJ6A 4B6QA 1JAIA 3A9RA 5AUPB 5K0FA 1NHWA 3EQ9A 4DCOA 2JFVA 2H17A 4ZCQA 4LJ5A 4NKRA 4DMUB 3WKCA 3ZDXB 1UPXA 4YT5A 1O95C 1EK2A 4YX9A 5L51A 1SC9A 3W2GA 4WXMA 3JS5A 2H1OA 4P7BA 4QUBA 1OXSC 4UZSA 5M3BA 4YDQA 5AVXA 4GRDA 4TWIA 2J8ZA 1CB0A 2ZJBA 2CV0A 3IE0A 2WJJA 4OU5A 1KYTA 1NM5A 2WT4A 5DRYA 1LBEA 5MN6A 3UCFA 2GEJA 3AI2A 2E37A 4HGQA 2PZEA 2BFCA 2FMTA 2JGIA 1SCUB 1Y3IA 4UATA 2Q5HA 4F56A 2BBSA 3IEUA 4LMBA 4H7FA 2GCOB 3DKKA 4R81A 5JROA 3W5CA 3AVUA 2FEAA 4BO6A 5H4HA 3OCJA 4YMTA 5DP1A 1S01A 3D5QA 4NNPA 1L4LA 4WX2B 3DDUA 4ETIA 2JEZA 3IBSA 4JT4A 4BCDA 2ABWA 3GA0A 5HJ5A 3P0RA 1QQBA 1IUPA 3PD0A 5EG5A 3V2GA 4BC0A 4KK3A 3BRWA 4F12A 5J23A 3OOSA 4NCBA 2OK7A 1OR8A 2BRUC 4HEHA 2R48A 3MT9A 4UQOA 2WJPA 4YVFA 4CKBA 5EJ4A 1G20E 3A1VA 3TSOA 1YZUA 1FF9A 2EF1A 4J2HA 4UHDA 4P4GA 1C9YA 3TR6A 3ZUGA 2JHFA 3A4LA 1JDUA 1NV8A 2PGXA 4HUQB 1G5HA 2VRCD 3EQ7A 5IAKA 3U62A 4EMUA 3AONB 1BJTA 2ZUTA 2C3YA 3PCTA 3QVMA 4JI0B 1C0PA 2XAAA 1NWHA 2M1ZA 2Z4TA 3BL6A 3ENVA 3H3FA 4PGGA 4URWR 1CBUA 1OZGA 1Z35A 4ILEA 3WAGA 3L5OA 3OH8A 4CTOA 2F9LA 2RKWA 1J1IA 4EGQA 1PNQA 3F96A 4EY5A 5BWOA 2CBGA 2FKNA 2VDLB 1NR1A 4GSKA 4KNVA 1YJQA 4QNNA 4U4AA 1SQFA 3WRYA 2WPDA 2WPNA 3M5CA 4G01B 3VPHA 1FUKA 4BQEA 5BT8A 2C7PA 3COVA 3KIPA 1EJ6A 1IB6A 4FPXA 1XXHB 5GJBA 1QANA 1PKXA 2OCGA 2Y66A 2AXNA 4D8TA 4B4UA 5KB3A 1DJMA 1B76A 3T1HB 3D3NA 3JPYA 2GPYA 4U2CA 5J5CA 1E3DA 3IAM1 2EU8A 4KLCA 2ZBRA 3SLKA 3K0KA 2QAGC 3AI1A 3LHSA 1IEXA 4IX9A 3SM9A 4JXZA 5JSUA 4KI7A 4YACA 1FW6A 2GR9A 3FDFA 4O25A 2VT6A 2O1WA 4FKZA 1LWOA 3HUFA 4YALA 5GADl 1UBOS 4BNNA 1KHHA 1YVRA 3WOVA 5B12A 2QTHA 4I8IA 5LVAA 2YZMA 2NU9A 4YRMA 5JOQA 1JFRA 1N0HA 2ILTA 4QM6A 1V8DA 5DOZA 4IS3A 4W5TA 1GOTA 2IP1A 3ZCSA 1M2FA 2J07A 1L5HA 5BSUA 2ODTX 5D00A 2OLEA 5IT0A 1E6LA 1GRQA 2C07A 3W5SA 2DAPA 3PNYA 5F4ZA 1ZJYA 4W99A 1RR6A 3BMOB 1DAKA 2F3SA 3IPLA 3K1AA 4R2XA 3VGJA 1QB8A 2IF2A 4PWZA 4G65A 5C2JB 2J45A 1HQKA 3NDBB 2P7IA 1MH9A 4R8RA 3A2KA 3L0YA 1H9CA 3JSAA 5BOSB 1NL3A 2NLOA 3LL4A 5DHAA 5JNWA 2P40A 3O0DA 2VXOA 4B81A 1PZFA 5J63A 3THXA 4MIEA 1U3VA 4IP0A 3FPCA 4QVKA 4K3UA 4TQGA 4EF5A 4RA6B 3O2JA 1EWKA 1XKTA 2DTXA 4K9PA 3KQLA 4MR8B 5E4TA 1CQZA 5CVTA 1QRUA 2O52A 1JPNA 3LECA 2O2XA 3JZFA 2YUIA 1T3TA 4PX9A 1RMQA 2CFCA 1W2HA 1F1JA 2PLFA 3T1TA 4EKIA 1W94A 1Y34E 3PXCX 3CF6R 5DIZA 3UICA 3WZMA 3BTUA 3AB8A 2QLFA 3RTEA 1QHNA 4DSNA 1O9HA 4F5WA 4Y6QA 5BVHA 1F2UA 1RZRD 3FKSA 3H7AA 1QONA 1RKQA 4GLFA 3DCYA 5KOYA 5IAJA 2M1XA 1TUEA 3M1YA 1Z07A 1F2UB 4IFEA 1K63A 4O2LA 1QQ5A 4LJAA 5BSKA 4TL6A 1L3CA 2CXQA 2C0QA 3HA7A 3L6DA 4KQJA 3HCOA 5ECYA 1KSGA 1E94E 1Q91A 3CKKA 3EB9A 5TB5A 3SVTA 2H2GA 1ZUWA 4MQEA 3U3XA 2DB3A 3BQMB 2X1HA 1KBOA 1YNOA 3BAFA 5A9TA 2EDCA 3IE1A 3D59A 4WZBE 1KYQA 1W2GA 2A0YA 1A77A 5CDYA 1EFCA 1Q7EA 3W2TA 1VJDA 5EQFA 3TDNA 3WSTA 3MTGA 4L0MA 1N32B 1UBGA 1QYWA 3STUA 1QTNA 4R9VA 2D1SA 1VTKA 1OBHA 1T2AA 3LDFA 2XNDD 3IYLW 2H51A 3MZ0A 5B55A 3T61A 5U1PA 1L8LA 4MUGA 2IDJA 2QB5A 3CBQA 1JG3A 4JLNA 4OQEA 4P86A 3UWDA 1YL5A 3WL8A 1RBZA 1VBNA 2BE9A 2NSDA 4B3IA 3Q8XB 3GBVA 5ANRB 2W58A 2BP7A 4FOSA 4Z4IA 4REQB 1M2NA 1IAVA 5L3QA 3BMNA 3ECSA 3OURA 3MERA 2QSUA 1H9BA 4AWBA 4G4JA 1DBWA 2PUHA 2WD7B 4CV1A 4H18A 5AVTA 3MAJA 3MMPA 3VKHA 1RHUA 1S7CA 3L84A 3BHMA 2A5DA 3ZQUA 3ILVA 3NRCA 2CLIB 3MTEA