1AK9A

Subtilisin mutant 8321
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
275
structure length
275
Chain Sequence
b'AQSVPYGVSQIKAPALHSQGYCGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPCASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPAKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN 8321
publication title Large increases in general stability for subtilisin BPN' through incremental changes in the free energy of unfolding.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Serine protease
total genus 100
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ak9A00
3BGOS 1IAVA 1SCJA 1TM3E 2W2PA 2W2NA 2W2MA 5JXIA 4ZARA 3DVSX 1ZVJA 5AVKA 1SPBS 4OMDA 2SBTA 1Y33E 1GNSA 2ZRQA 1SIBE 2PRKA 4HVLA 1AF4A 3A3OA 2V8BA 3TI7A 1TM4E 2Z56A 3Q40A 4KG7A 2G4VA 2ID4A 2PYZA 3VSBA 1XF1A 1S02A 3DE3X 2ST1A 1SIOA 1SIUA 2IY9A 3P5BA 2ZWPA 4AKTA 4ZOQI 1MPTA 4DZTA 3DE2X 4FONA 1Y48E 2Z2XA 1JEAA 4KB5A 3DYBA 1SBHA 1BE6A 1SUPA 1PFGA 1R0RE 4DWWA 2Z2ZA 1SUEA 2WV7A 3T41A 4BWGA 1T1IA 1BH6A 1SUAA 2PWAA 3L1KA 2Z30A 3VV2A 1WMFA 1WMEA 1VSBA 1Y3DE 4MZDA 2WWTA 3DE7X 1PEKE 1ZVKA 3F7MA 1V5IA 3DW1X 2Z57A 1V6CA 2SNIE 2TECE 3UNXA 1Y34E 1GT91 1KDVA 4CFYA 3EE6A 2XRMA 1SBNE 1SUBA 1TECE 1SCNE 1AK9A 1CSEE 5JMOA 2XTJA 3QFHA 4NE9A 1ST2A 3WHIA 1P7VA 1Y9ZA 5AQEA 2SECE 1DBIA 2X8JA 3QMPA 1TO2E 5ARCA 2HPZA 3BPSA 1TMGE 1YJBA 5I9SA 3DE1X 1TM1E 4K8RB 5ARDA 4YN3A 2W2OA 3TI9A 1TO1E 3PRKE 1OYOA 1SELA 2WUWE 3F49S 3CO0S 1IC6A 4HX2A 1OYVA 1SN7A 3SICE 4AKSA 2P4EA 1BFUA 3OSZA 5B1DA 1WSDA 5FFNA 1HT3A 3AFGA 4RYDA 3WIVA 1DUIA 1C3LA 1EGQA 1PTKA 5FAXA 3AJ8A 2Z58A 3D43A 2ZWOA 4H6XA 1GNVA 1AU9A 1YJCA 4LVNA 1THMA 1GTG1 1OT5A 3DE4X 1KE1A 2DQKA 2X8JB 4GI3A 1Y3BE 3SQOA 3EDYA 5JXJA 1AQNA 1T1GA 1GTL1 5B1EA 1SCAA 2B6NA 1C9MA 1YJAA 3LPCA 1EA7A 3DE0X 1P8JA 1SBCA 2GKOA 1ST3A 5JXGA 1GA6A 1NDUA 1KDYA 3AJ9A 1WMDA 1S01A 2PMWB 3Q5GA 1C9JA 1Y3FE 3DE5X 2PQ2A 1LW6E 1Q5PA 1TM5E 1GA1A 1P7WA 1BFKA 1NLUA 3CNQS 4C3VA 3DVRX 1R6VA 5SICE 1GCIA 1GA4A 1Y1KE 3A3PA 3LPAA 4C3UA 3GCXA 3A3NA 3TECE 1A2QA 1AV7A 1SBTA 3I2YX 1CNMA 1SVNA 3BX1A 3H42B 3ZXYA 2DUJA 3DW3X 4OV6B 1KDZA 3QTLA 3PTLA 4CFZA 3DDZX 1AH2A 3I30X 1SCDA 3D9QX 4WOCA 4NE7A 3VYVA 4H6VA 3VHQA 3GCWA 3DE6X 5AMXA 5ARBA 2QTWB 1SCBA 4NMXB 4Z2AA 5JXHA 3LXUX 1KE2A 1BJRE 1UBNA 3DWEX 4B5LA 4LVOA 1GTJ1 4I0WB 4JP8A 3WIUA 1NDQA 1T1EA 3VTAA 1YU6A 3VV3A 4WOBA 3F7OA 4M1ZA 2WUVA 4DJ5X 3GT3A 5K7SA 4CG0A 3HJRA 1Y4AE 4KPGA 1BE8A 5CW1A 1SBIA 2ID8A 3EIFA 3I34X 3I37X 2W2QA 1SH7A 5AVJA 2PKCA 2DP4E 2HD4A 3WQBA 3ZXXA 1MEEA 1R64A 1S2NA 2IXTA 1PJ8A 1TK2A 1Y4DE 3LPDA 1Y3CE 4J94A 3DVQX 4H6WA 1C9NA 4OMCA 3GT4A 5FBZA 1SUCA 2PWBA 2Z2YA 1TM7E 2E1PA 1AVTA 1WVMA 1SUDA 2SICE
chains in the Genus database with same CATH superfamily
4UBKA 1KJ8A 2PZKA 3MRVA 2RIPA 3RYFA 3ZLJA 3BGOS 4IG9A 4LGVA 4JA0A 2DETA 1FFEA 2GAOA 4ON9A 5JATA 8MHTA 3IE1A 4OJTA 1NONA 4FDMA 3UK6A 2YH2A 4NYJQ 4TX1A 4YRGA 5CLQA 1XLTA 1SPBS 3E9DA 1E61A 1ZMXA 3E7WA 2FE1A 4KAFA 5EESA 3SSAA 1H65A 5KNDD 4JUCA 3DHNA 1CIVA 4BIMA 4ZZ1A 4BNJA 3TR0A 2VIIA 3LVRE 4MMXB 4KQXA 1HEUA 2JGKA 3ESYA 2H1SA 1NM5C 1U7OA 4FILA 3CTPA 1NRXA 4ZCSA 4ZI7F 5JAMA 2ILTA 5DT9A 4BGVA 2NAFA 1UXIA 3TQHA 5T6MA 1R1DA 4DW8A 2EWWA 1X77A 1MGOA 1U7TA 1WPRA 3F6CA 4J29A 1MAHA 3JQDA 2V8BA 2XH8A 1NX9A 3D0RA 4JIGA 4NDNE 4P0QB 4CQJA 1A4UA 2WU0A 7ADHA 3NTRA 5TXGA 3VVCA 1M9NA 2C8LA 1PQ4A 1YS4A 3K6SB 3B5JA 3GLHA 1Q44A 5B6JA 3JVUA 3GMSA 1Y9AA 2ERXA 2NXCA 1LUAA 3IUPA 3LYUA 4KLAA 4QNRA 2PS0A 5E7JA 3MPOA 1OI2A 4WX2B 1DGQA 1B0UA 1V2HE 1VKRA 2PV0A 3BMOB 2O2CA 2B4RO 2ST1A 2TS1A 4DJJA 1HFWA 2PIAA 2VXOA 3ZHRA 4KNWA 3DCNA 1PL0A 3WK9A 1CU1A 4R9VA 2IY9A 4B33A 1VDZA 2IEDA 2ZPUA 3IDOA 2AC2A 3T94A 3D4LA 2OGTA 4D56A 1HWYA 1Z4OA 1QQ5A 2QUZA 3K8YA 1QFYA 4I4LA 4HEA6 1S3FA 2VSFA 2EP8A 3QKRA 3DPSA 1W35A 2GJ8A 4L1KA 4ZQHA 1NVMB 3R7NA 3VI4B 1E8DA 4GMDA 1RAEA 5E0OA 1RTKA 1OT3A 1X1DA 5LA6F 4JKYA 5KNBA 4ZWNA 3J81A 5CFMA 4MUMA 4EFDA 1X7GA 1C30A 2OHGA 4LTDA 4FC6A 4MPJA 4QYIA 2L69A 2AYXA 4BVAA 1N2CB 4XI9A 3BJRA 5EZYB 3VX3A 1U7UA 4MVJH 4OQ4A 3AUXA 1E89A 4ZOAA 5CG2A 4Z0TA 1QH0A 2Q8QA 3HA3A 3TXXA 4JGGA 3ZCRA 3U60B 4RMGA 2Y92A 3L6DA 2FQWA 2WMNB 3L5KA 4XGIA 2K4MA 2OYCA 3B3AA 1EE1A 4QDUA 4XQCA 4Z9YA 2Z2ZA 3H4VA 4C0BA 1E92A 1FLAA 1WD7A 3AJAA 3CZ5A 3ENKA 4DRXB 4ZHSA 1QVWA 4U6NA 4F45A 4BXOA 5L4LA 1G5FA 4EPRA 1SC6A 2I2DA 4FFBB 2H63A 3SQLA 1R2QA 2QVBA 2FHSA 5IKOA 2FMIA 4KL8S 3NRBA 2CXQA 1K3FA 3ASVA 3B36A 1VLMA 5GIOE 2H31A 3WK7A 2VDWB 2DB3A 2ZE8A 1LD3A 1RQ7A 4KWHA 2OBXA 2XDAA 1GAWA 2FR8A 2AJLI 4I1OA 4N8SA 1IQUA 1N0HA 3OC0A 5DEIA 2LWIA 4QREA 4CMHA 3EIXA 5LVAA 5IJ9B 2WNSA 3HS3A 3MQFA 1F3OA 3BL6A 5LZ7A 5TC4A 3WLTA 2DPMA 1WVIA 4UDXX 1UJ6A 4CUZA 4Z4IA 2OYSA 4JJKA 2BLNA 2ZJ7A 1IOLA 3DUFB 4RVDA 3ROEA 2WWTA 3KSAC 5LLDA 5EE3A 3NGXA 1XTKA 1Y7HA 4DR3B 1FFDA 4J7UA 3A27A 3KSZO 3CN9A 3V46A 2BUAA 3HVIA 3F7MA 1TM2A 3PNLA 4MR8A 1PR5A 4NMHA 1VMAA 2WV9A 2CSUA 2C2WA 4Y7CA 3K8QA 3WRXA 3U13A 2I4TA 1BSVA 2P7HA 4QT4A 5JO0A 4PIPA 5AK6A 1L1EA 3KUUA 1HM5A 1GT91 1C1HA 3ZGYA 5EIWA 3S2EA 1X8XA 4LK2A 2EKQA 4Y2QA 4O4IA 4YJKA 1DIHA 2NU8A 3SJBA 3UXYA 3ND5A 1DAFA 3ZWXA 4MUYA 4NYJR 2O5RA 3KLOA 1T4BA 3SVTA 2AX4A 2HT6A 3DTYA 5MF6A 4IEEA 4FBGA 3NWEA 4CIXA 1BVHA 3NH9A 2AR0A 1MU0A 5JSKA 2W2LA 3T99A 1SULA 2HWYA 4AFNA 3OQ6A 3WGZA 1IQ0A 2IBTA 2ESRA 5ESXA 2YJGA 1E8NA 4FHFA 1ZMOA 5DMXA 1HNXB 4JX9A 3BVPA 5CB4A 3KBBA 1X1AA 3TW0A 4DQDA 4G85A 2B1QA 4HVCA 2QAIA 4AY3A 3VX4A 3STWA 1P7ZA 3CISA 1AGPA 4YO7A 1D6SA 4GBMA 5BSWA 3ANNA 5L3QA 3I04A 5FI0B 3ZWOA 1E5VA 2MSLA 3RIMA 2V3WA 3UWDA 5HJ7A 3I9KA 4I19A 1AO0A 3KE9A 3ROPA 2G67A 3AJRA 1FU4A 3R5XA 5IU6A 3QU5A 4CMIA 4II7A 3WB0A 1N3BA 1RBQA 1YRAA 2HPZA 3GN1A 5EMHA 3AVXA 1MIHA 2CHGA 2C9MA 1FQJA 2O57A 1Q1GA 2HU5A 2Q0HA 3CEHA 4V24A 2HJWA 3TEMA 2XF8A 2CD7A 4DA8A 4QM6A 2WFMA 1W0CA 4WK4B 3UHOA 3J7AC 3Q9LA 4RL4A 4KXXA 3RC2A 5HSGA 1PL8A 2WABA 4HMQA 3WRVA 4AUKA 3C8MA 4WNCA 4XWAA 1G9SA 3WLIA 4GYWA 1XPRA 1PE0A 3OE1A 1RMQA 2X5NA 3LY8A 3COYA 3ZU5A 4F84A 2FN8A 4EHHA 1E32A 1YFZA 4YN3A 1WXQA 2XGMA 3R3SA 1REQA 1K98A 4BB9A 3F71A 1VE6A 2R0QC 1SELA 4RIIA 2Q1YA 2YKGA 1Z07A 3H65A 5DTRA 1J5XA 2FN3A 2VG8A 3HQ4O 3JQ9A 3A4IA 1CS0B 1YVRA 2P3QA 1VYVA 4E1VA 1M8GA 2YFKA 4LE1A 5ED4A 3FHTA 3M6VA 4CGYA 4E46A 2C83A 2IODA 1P2VA 2R8RA 2FKAA 3FB4A 3OQOA 3KVOA 2ZB2A 4H7EA 4LCJA 7ABPA 5KX5F 3B2EA 4KDRA 3EF0A 4HGOA 4P4NA 5CLGA 5BR7A 4HZUB 1VPVA 1TJ4A 4DRZA 3A6LA 1BVUA 1Z56C 4WBSA 2GCPA 1SZDA 3CVVA 4WE3A 4RD3A 5FFNA 4KR9A 1TKBA 3I83A 3PJEA 1MC5A 1V5WA 2HO5A 4W6QA 3X2FA 1W47A 1B1CA 3GL9A 2BBSA 4KXQA 2D7DA 1WLSA 4TMFA 4NWIA 5LMNB 1NIJA 2QU8A 4K9KA 5CNKA 2O59A 4TSFA 1EK6A 4KN8A 4ARAA 3WLNA 4BE9A 3UMYA 4OK5A 1RXYA 4C7XA 4JEHA 3RIYA 3GIWA 1QIMA 3NNDA 3ENZA 2J5QA 3F96A 3PE6A 4FCCA 2P75A 4G56A 3EIHA 2H06A 3JYNA 2YW9A 1DAEA 1NAIA 1U65A 3TW8B 1UMDA 4LVUA 4ALJA 3FFXA 4C07A 4CN9A 4W5QA 1V7CA 4MUBA 3NJ8A 4BKRA 3O82A 4BECA 3W79A 2P2DA 2GPTA 3T5TA 3EXHB 4CM6A 1VXRA 2JEOA 2PANA 1UBMS 3SJCA 4EB3A 1FYDA 2B8TA 4IWXA 1BHSA 1QOZA 5F4BA 5TS2A 4HI0E 4CKZA 4PX3A 3ZDCA 4TSRA 3M3DA 3I1IA 3PNPA 4L3VA 1OHHD 5JXJA 2PS3A 1Z62A 2IUYA 3SCZA 5HIKA 2O19A 2GJAA 4PCAA 4UFOA 3V97A 2VSYA 5BN3B 5LQDA 1Z68A 4GR5A 3PD1A 3SYKA 1IVYA 1C9MA 1P9OA 1ZS9A 3NAGA 4B7AA 1P0QA 2DQ4A 4RTKA 3AKZA 1FSPA 1YB6A 3OZTA 1MRSA 4Q3OA 2XECA 1HDZA 4LWZA 3SKYA 3VYWA 1KBOA 1QHXA 4LNUA 4ZI7A 2WD7A 4NU8X 2C2GA 4HZIA 1AMUA 1RJFA 1RKQA 4TGLA 1V1RA 1N7HA 2PSJA 2AN5A 3RF6A 2I03A 4MRNA 3CIOA 3VU3A 5JALA 1KIMA 5A06A 2WVJA 4X8LA 4B35A 2ORWA 2V6IA 2QQGA 4R2WA 3RO7A 2QB5A 3ZVKA 5M3BA 3E8MA 3QMVA 2W6JD 4MA0A 5C37A 4RA6B 1G21B 1IN8A 4LZZA 4AJNA 3I2HA 3LYLA 4UMDA 4BKUA 3WKAA 3AF5A 3U4IA 3ZD7A 2YRFA 4HCJA 4UVGA 4BEWA 5BMVF 1Y9EA 2H0AA 2V6GA 2YWFA 4GSYA 4NIMA 4PPGA 3DFUA 3PDHA 3NQ41 2A8YA 4MV3A 4RJ2A 5EUQB 1YKGA 4ZMBA 4MV5A 1TMKA 2OGUA 5CFRA 1M8FA 2BGMA 4YJFB 3CH5A 5H3LA 3U3RA 2IS1A 1CQIA 4QBTA 1XSEA 1PJZA 3RU2A 3TNYA 4E6PA 1PI3A 3FOCA 4WDRA 2W42A 4GXTA 4D42A 1USGA 3F6BX 1FFBA 2I6XA 3KSMA 1XPUA 3CNLA 1JH9A 5LFAA 4DB4A 1IBRA 5LA6A 2RGEA 5JSHA 1PR4A 4E5YA 2H5EA 4UDYX 1K0UA 4OLBA 2Z95A 1K7EB 2JJYA 4G4SP 1VPTA 5EFOA 4HNVA 2BGLA 1D9XA 2QVYX 1KI3A 2BVNA 4G0YA 4UDNA 3MM4A 1O87A 2ZSDA 4IP0A 4DV0B 1T4MA 3CUYA 1WBJB 2HNKA 1AGRA 3OEYA 1X0VA 2XNKA 3CPEA 5TGZA 1SC3A 3CX7A 4HAVA 4D9CA 2OLKA 4MUKA 3T9DA 3QTLA 4JFAA 1Y8QA 1R4ZA 4L73A 1GNQA 1S6YA 4GHWA 4H6PA 2Q4OA 1QTQA 2BN4A 3BS4A 4PYLA 3JQAA 2P6PA 4O5OA 3K32A 3Q41A 1RR6A 4LOHA 3SC4A 3DCYA 1EFUA 3IIKA 2V7BA 3TL2A 1N6OA 2BKEA 4GSLA 3OX3A 2CSXA 3ZDXB 1I2ZA 4EZBA 4X61A 3MFYA 3F7TA 1EBFA 3GRAA 4EG4A 3W3AD 4MGEA 3E9EA 8LDHA 1DFIA 4CF4A 4C6TA 5CDTA 4B3GA 1GR0A 5HCIA 5IVKA 3RSOA 3UJHA 4GD3Q 2SKCA 4DMHA 4X62B 3C74A 4BUCA 3GJTA 4WY5A 3SLRA 2Q2NA 1EH5A 4KX3A 5TF0A 3KXIA 5JXHA 4UE3S 2QRQA 2BZSA 5CYFA 4EL5A 1HT1E 3VSCA 4B3IA 5DYNA 4G8BA 4MOWA 1QSGA 2IDZA 3A05A 5E9WA 3I5YA 2GCEA 5C8YF 9GPBA 1T5OA 1H23A 1G8YA 3OIUA 2VXBA 3G5MA 4ZAYA 2HO4A 1PUXA 1XV5A 3GAAA 3NOQA 4KN5A 4KVAA 3AF3A 3PITA 5REQA 3SF8B 1NDQA 2O8VA 4MO2A 3UTDA 4IUDS 1G6KA 2IEGA 1JAZA 1RHJA 3MSCA 4OBBA 3BHJA 2B82A 5DNEA 1JDZA 3MT9A 3GUCA 2CZQA 2PZGA 2YHUA 2AH5A 1LLDA 4Y9RA 4HXEB 3THRA 3N2EA 2H4WA 1WTCA 3S2YA 3QIAA 4QGAA 4FIDA 3UYKA 1OUMA 4XUCA 5CFPA 5K0JA 4U0JA 3PUHA 5BP7A 5LIPA 5JR3A 2DUUA 4Q9DA 4AUMA 2P69A 3L7NA 1FFCA 2W2KB 4MPRA 1G42A 3ADOA 3WIDA 5EMJA 1WUHS 2GJ4A 5MFPA 2CBGA 3CF6R 5A5VA 5JAPA 1KERA 2HY7A 5FOQA 2F9FA 4AL4A 2I5PO 2ZXEA 2HBZA 3NBKA 3NIFB 1X7XA 3O9VA 3WWDA 1MA0A 2DQSA 3O8RA 1SMKA 2XODA 4ENWA 3VYTB 1LFAA 4JS0A 2PLFA 1DTWA 3H8VA 4QEZA 3RVQA 3FCOA 2Y99A 2AV6A 4NG5A 4JBIA 4KAXA 1QG6A 2D0IA 4DCCA 5AJHA 4FC7A 2Z6VA 1MD9A 1KQGA 1TVKA 2Y4NA 2VBFA 5C8VA 3D6NB 4Y6SA 1E5QA 1DPGA 4KKXB 1C4OA 1LB1B 3LFHA 1CD5A 2EBHX 1P7CA 3AY6A 3C14C 3TDKA 3W5IA 3WK8A 3HYSA 1WHTA 4KNVA 2ISSD 3QEOA 1A0OA 4TUYF 4E1BA 4UBNA 4TXNA 4PGMA 3DB1A 5CX1B 5DP2A 3V4SA 3EDMA 4RVNA 3H7IA 1RKXA 5HKOA 1W88B 4NF2A 2PWPA 1BHJA 1Q1AA 3G2LA 3ZY2A 1OBHA 4JJ7A 1AZSC 4BP1A 3GRVA 1SU6A 4WKNA 1B0ZA 1YZ3A 2FF5A 4FLMA 1U94A 3H6GA 2TMGA 3D8BA 1J7KA 2A0KA 2P9EA 3EUEA 3HPRA 3LNCA 4QVGA 2IOYA 3TIVA 5I8WA 4J16A 5T57A 1E1RD 1Q95A 2I34A 3SHFA 2JD1A 1SOVA 4PY2A 4RKWA 5FOUA 5JQGB 2FPXA 3ETGA 1WM1A 1SUCA 1UFOA 3AHHA 2Y4OA 1BWSA 2ZI4A 3O3MB 5EZSA 1JXMA 3C6BA 3FDFA 4DJDC 1NN0A 1Q14A 4O08A 1GL3A 2EAUA 2Y0DA 3T6KA 3WS7A 3D6HA 3SI7A 4EB8A 2ZETA 4XRGA 5EMKA 2IWHA 4IS2A 3QNWA 2PPVA 3NH6A 4QGHA 2RKBA 5KX5A 4YT4A 4F4FA 2VWQA 3C4VA 3CY6A 1J70A 4KIUA 4YRDA 1H0HA 4X8OA 4M1EA 1U9JA 1NURA 2PCLA 2Q2WA 3FUVA 1BFDA 2JLBA 1DJQA 2Q4EA 5B7QA 1QHFA 4AECA 3B2NA 3BHNA 3NB0A 5TJ9A 3TZEA 5DN6D 3BFVA 4B85A 1NVFA 3OQHA 1ZD4A 5CA0B 4OXIA 1TUBA 2IKQA 1A7AA 1GSAA 5COQA 4L72A 2HR1A 1Q3HA 1SXQA 5CYPA 4JI8B 1OXUA 2R1VB 2ODAA 3R3HA 4EY7A 4QDXA 2TSYB 1WDKA 2QMZA 2ZRQA 3BXPA 3DTVB 1SIBE 4UD2A 5HA5A 5AOAA 3FD8A 1QR6A 3PQEA 3NDBB 3NORA 1Z13A 1FFXB 5BVHB 3CMMA 4UEWA 5I6DA 1E69A 2XB2A 3X2EA 1BS2A 1HE8B 1VMDA 2B1IA 3HH8A 3PL1A 5D86A 4K6KA 4EDFA 1HEIA 4TRNA 3VSBA 3ANYB 2JFZA 1D2NA 1MC8A 2VDOB 4CDGA 2OD7A 4O1MA 4H18A 1D03A 1JHPA 2EJWA 2H4HA 2W4MA 2A5FA 2VYNA 5L3SA 3FPKA 2ZPTX 3SBDA 4AP6A 1BEEA 1Q1BA 1RWQA 4HNRA 3IB6A 4YCBA 2G0AA 5LMUB 4C0HA 2ENWA 1UDCA 3GUYA 4UTZA 4WTOA 4XVHA 1A4RA 4B73A 1DCMA 4BZQA 4ZOQI 1SG6A 5IXYA 5LU9A 1EDOA 4EPWA 4KMOA 5BOSB 4RK0A 4TROA 1VLVA 4H1TA 4QU8A 2FH5B 3QE3A 1Q0UA 3JQPA 1E6CA 4HFMA 4QUIA 2C78A 2PA3A 3IJPA 3PXCX 3I58A 4PPQA 1P1HA 4LRQA 1DAMA 1T8WA 2VRWA 2DKOA 2EZ9A 5FPPA 4LF9B 3L8CA 2PUDA 4EAQA 4HNTA 1WEKA 4E21A 2Q28A 1NF2A 3SBOA 5BW4A 5LD2B 1G291 1X74A 3DMGA 3ZQJA 4UVHA 1V1MB 4NBNA 3KD2A 4JJ6A 2D59A 4PXAA 2NZXA 1XJ0A 3TFOA 3KYDB 2WM3A 3BTOA 1PP4A 2BE9A 2BFEA 2XE6A 3D0OA 3F4BA 3M4XA 2JRCA 3DYVA 4FX5A 4LNAA 3CE9A 2F7SA 5AK5A 3EXEA 5HQ3A 3IJRA 3NO4A 5F3RA 5C5EA 3O6VA 1L5HB 1W2WB 4QLOA 2ZM5A 3HBNA 1ZHHA 1NVGA 1VPEA 4XVRA 1Q6YA 2NM0A 1Z5VA 3H84A 3L7MA 4LBZA 2HA3A 1VJGA 4ND6A 4UM8B 4Z3DA 2DTEA 1HSZA 1LK5A 3HABA 4YJHB 2AYYA 1BO6A 3BILA 5BMVA 4EKNB 4IJVA 3R5HA 2WTNA 1NVAA 4FE3A 3NTUA 3ITNA 4L8YA 4QOIA 3B6ZA 5DHRA 1O94C 3R3WA 3FVRA 1DXHA 2B1JA 1YI1A 3QITA 5HF6A 3FSRA 1R74A 3IPLA 1W0KD 4KR0A 4E1AA 5DM70 4N65A 1VI5A 4CQMD 4N3AA 3UMBA 1GQRA 2A0XA 2ONZA 4GP9A 1L5QA 1POWA 4DYHA 4ESHA 5KO2A 2IH2A 1XZKA 2OOSA 3D4BA 3MG9A 3WJ7A 5IH7A 3K71B 2JJMA 1GADO 1J90A 1YL6A 3KZ1E 1T9KA 4Q9AA 3HKCB 4GVLA 5GONF 2EX1A 2VHUA 4EG8A 1AD2A 1CUYA 1K6JA 1QHHB 1ZH8A 3QPBA 3AONB 4RORA 4UHCA 3MBOA 2X0JA 3VAZA 2A5GA 4ALIA 2P6OA 2YR0A 1PJSA 2G9QA 4KLZA 1V48A 2SNIE 3NS7A 1ND6A 1P0FA 2VCEA 4KLNA 3UMFA 3UNXA 1N2OA 4MVJP 1FX0B 3TINA 1QZXA 4M7PA 2OCIA 1NNLA 4IDQA 3OTGA 1P5JA 2Y1EA 3A6GA 3NHZA 4LOLA 1QKJA 2ZROA 1JKJB 1UK7A 3PC8A 3R3XA 4TTAA 3ROTA 4BQOA 2O3TA 3LIPA 1J2TA 3P19A 1ZSVA 2JI6A 3GLUA 4DY4A 4PV7A 4C4XA 4ETWA 2P2CA 4BWFB 1KMCA 2Q6KA 2YJ4A 1CSEE 4CF3A 4A0FA 1J8VA 3CF4A 2N75A 4EJSA 2A4KA 4NCXA 5ESWA 2I2WA 3THSA 4DLLA 1MJHA 3GG9A 4HN4B 1GZ7A 1EBUA 1AUVA 1HL3A 3NOXA 1YB5A 2C8KA 4FLFA 4E5UA 3GPDG 5CFOA 5JTTA 2N3ZA 2PA0A 2Y1XA 3O73A 3CUVA 3ASYA 3I39X 1D1SA 3LXMA 3COWA 3I9V6 3N87A 4PLHA 1N9ZA 1C3JA 4UC0A 8AT1A 4TKLA 1MB9A 2PEZA 4NCNA 1URPA 3NOVA 5TPZD 2NT4A 4Z0NA 5F77A 4B3CA 5J58A 5K5EA 3F5DA 2BONA 5HR5A 1HTWA 1HE1C 4JC0A 3ESDA 4YJ3B 1HC7A 3D4OA 2JFWA 4EJFA 2GTPA 4F60A 2JS7A 1YR8A 3GWGA 3NZEA 4HEHA 4EY5A 1RTTA 2OCAA 2PRYA 1X7ZA 1E9VA 4HH4A 2QP3A 4NYMQ 1WQ1R 4Y1GA 1L9XA 5C8YA 4EO9A 4EY8A 3PLAE 1B26A 3ENVA 3UT5A 2O0HA 4CM8B 3LLVA 3AW9A 3ZR4B 3CNOA 3GT0A 3P52A 2J6BA 2D2VA 3EXG2 1RJ9A 2NO1A 4XUGB 3ZI0A 1GKLA 2HIMA 3FN4A 4KOAA 2BM0A 1EVJA 3NTVA 4ENPA 3A1EA 2JZOA 2YY5A 3I9JA 4BGUA 5ADVA 3HN6A 2YJTD 2ZE5A 2QD3A 4IQGA 4L0DA 5BQPA 3UWSA 3IA7A 1P5RA 3AV3A 3OJOA 4FOTA 1J22A 2JLSA 3RYCB 4YAOA 3UHPA 1L7EA 5DASA 5TB5A 1UXJA 1XZPA 4I6EA 3VR1A 4ZYLA 4MWTA 2NPOA 3G2NA 4CYMA 5HJEA 3K9NA 3IAUA 2M6SA 3OEED 1MVOA 3EG9A 3B9QA 4IZIA 4K05A 4MXDA 4EA8A 1FZTA 2QVLA 3QF4A 1EINA 2ATIA 2Q1TA 1XDSA 3ZJVA 4UZSA 3S1AB 4PW0A 2H29A 1XKXA 5TEWA 1ONNA 3ZHQA 3D8RA 3U7GA 3WYBA 4DADA 3MERA 2R7KA 3C85A 3RSFA 3T3GA 1TX4B 2AMVA 2GD0A 1LTKA 4EJ2A 3RSQA 221PA 5CT6A 1FTWA 1WXHA 3F6SA 3MN1A 5KSYA 1F2UB 5MDHA 1PJQA 1U5AA 1LLCA 3DNPA 3EASA 3ENWA 3QPVA 4ZCLA 5C1DA 2JIZD 4GEKA 3T1YB 1JT2A 1UFVA 3G8BA 3UENA 1GKYA 2IHJA 1GQ2A 3HCBA 4TUYA 3ZWNA 5K8TA 1UDXA 3TXYA 4PC6A 1DRWA 3JARB 1F1BA 4INPA 5A4DA 3FOAA 3RVKA 4KE9A 2W0SA 5DMHA 5DSXA 5AOBA 2N0SA 1R7RA 2O7RA 4WIAA 1UC8A 2O0MA 5JAUA 3VQTA 2QLFA 1L7PA 3QFCA 1Y42X 1IEQA 1R5NA 1YRQA 2FK7A 4LXHA 1GL7A 5CVUA 5ALKA 2C98A 3OF3A 2FGJA 2V4MA 3RBAA 3B1ZA 4FR0A 2IS4A 1U9ZA 1IZ8A 4MYRA 1YIAA 3O84A 3FGPA 4FOOA 5F1YA 5JDIA 4PN7A 5D87A 2R62A 3PE4A 3V1UA 1Q7RA 1EXNA 2Q4RA 2OHVA 1I5RA 1SVKA 3JZDA 1KJZA 3Q98A 4RMJA 1R4AA 3TW4A 2VPIA 2X8JB 2APJA 3B1JA 3KL2A 4LQDA 3KUKA 3T9CA 4DARA 5KYVA 4DREA 2AX3A 2G5GX 3SQOA 1W25A 1CQJA 2CCJA 3LC0A 4RZXA 5C35A 4ZO7A 5MN6A 4HAZA 3TJMA 3L7LA 5THXA 4AICA 3B85A 1EGVB 2QW0X 1UKYA 1FDRA 2PL5A 4W1QA 5EGSA 1WP9A 1AV6A 3OKPA 1RW4A 2C0QA 3LFTA 3OZSA 1F8XA 4MLCA 4N7BA 4WL0A 5FTNA 3ILSA 1XZCA 3CZRA 3PIRA 4ZKDA 2VWPA 3H2JA 1FVOA 4RIEA 4CR6A 3QBEA 1RJGA 3A0RB 4G4JA 5JZOA 1T0JB 1E4YA 5EJ9A 3TLYA 1P8JA 3RVPA 2D06A 3TRKA 4OHVA 4OVKA 3UMRA 4TTRA 3JAWA 4LZOA 3I52A 4CCYA 5JZMA 3P9NA 3P9QA 4YJDA 1UCFA 2AK2A 5JRDS 3ZUGA 1BS1A 5KHAA 3WBJA 4AMYA 5DCYA 3U56A 3V4RA 1KAOA 3HYNA 2RHTA 4MAFA 4L2IB 2O5EA 3N53A 4PO9A 2F43A 3BE4A 1BQ3A 3ZPXA 2J41A 2QE7D 1E1KA 1CDZA 2HJVA 3F3MA 4ZOLF 4S1WA 4XB6B 3Q5GA 4NYMR 2D1SA 5T5QA 4MRMA 2OD2A 3OCZA 1RI5A 3AHEA 3AXSA 4YUVA 5SYNA 3BD8A 2CE7A 4ZI2A 3AV0B 1GPLA 2PKQO 1BFKA 3D1VA 2D1FA 2IYLD 3IQFA 2CC2A 3L0PA 5E6UB 1XHLA 1IJKA 1VIVA 2CYCA 4RK1A 4CTJA 3GUZA 3ZWQA 3UJ3X 1GA4A 3FVQA 2QRJA 1J6UA 1L7BA 3LPMA 5EE1A 2C3MA 4DA6A 2FPWA 5C34B 3K9CA 3PXGA 2X4IA 4FE7A 1M2EA 4EYGA 4QXPA 5EVJA 1O9BA 2VDVE 3GFGA 2HA7A 4M89A 3ETLA 1SB8A 4GU5A 2I65A 2ODTX 3OLWA 3UYLA 2P4SA 4ZI5A 1XN1A 3I9NA 3T5CA 5K3FB 1OHHA 4IG4A 4OGLA 4UEOA 1DFHA 2PK3A 3FMGA 3P9CA 3Q7QA 4XJTA 1KEKA 1CETA 3ESXA 1LDGA 1XELA 3QTBA 3WYFA 4EHDA 2HMAA 2YWXA 3DW3X 1FB5A 1AGXA 4QGSA 5FLXA 1ZXXA 1KJYA 3BXFA 4OV6B 1Y7IA 1IUKA 1KSFX 4FSDA 5L4NA 3AI1A 1QCDA 1I3CA 5EKDA 4CFZA 4ZJUA 1RZUA 3FF1A 3QOYA 4BP9A 1MH1A 4WK2B 1ZIDA 4BVHA 1H2RS 4UCXA 5C7YA 2QM0A 3O0DA 3H17A 5DYYA 2BFCA 1O4VA 3Q0TA 2J9ZB 5J9FA 5L6MB 2HLDD 2FQ1A 2I7XA 3S28A 3C97A 4UZEA 3Q0EA 2XDWA 5IW8A 1R66A 4NL4H 5CNJA 3VYVA 5DGDA 2M6RA 3K9LA 2X0KA 3KTOA 1COWA 3IPYA 1TQ6A 1QGYA 3BSSA 3I4CA 5BVGA 3MHTA 4CGZA 4NHOA 1VBFA 1VMIA 2NZ8A 4E2YA 2UVDA 1NNUA 1OFHA 1HZZA 1WU7A 5G02A 4L4RA 1GITA 1BX0A 1G6Q1 1RABA 3MGBA 1UJCA 3AGQA 2HNBA 4NMXB 3T3HA 2EXXA 1K2VN 2QT9A 4YO8A 3X43A 1EIWA 1AF7A 5JSYA 5E6RA 3DOCA 2QZPA 3A4TA 3BXGA 2FFQA 3GQBB 2QKYA 3LC1O 5EIAA 1SNYA 5FTLA 1CDOA 2P0EA 4HGZA 3NHSA 5GONA 2DFKB 3CGWA 3EBOA 3KRTA 4YS6A 2J9GA 3P4XA 3IUMA 1HGXA 4PS1A 4OI4A 2RHWA 3P97A 2AZDA 4R5HA 1ECBA 4LOKA 2ECPA 4YBRA 1RXWA 2WOOA 2YVAA 1I94B 5JQWA 4UNQA 1VCOA 1K0FA 4BO5A 3T7KA 2ZREA 2HK9A 3AM5A 1QFJA 4H3SA 3QVTA 1C8LA 4OKNA 5AW4A 1J5PA 1UT5A 3CSUA 2Z9CA 1YU6A 4FHDA 1LS6A 1NATA 4JBGA 1WUIS 2C77A 3UANA 1FNDA 5EEHA 3W4JA 4IFIA 4X92A 3WB9A 3JYQA 3KALA 3M1YA 1PZGA 2VF4X 1MJFA 2ZGVA 2P0AA 3L01A 5M5BA 1AURA 4AZSA 4UNRA 3H4MA 5GMOA 4RTJA 4ID9A 2JZNA 3CLHA 5FBKA 3VAYA 3BZUA 5BR4A 1CZLA 1EFVB 1HSOA 3RKUA 3QUCA 1Y4AE 1IJFA 2DLDA 1PT9A 2G6TA 2DBYA 1VE5A 5I48A 4FFRA 2ID8A 4GF5A 1FW6A 3W3AA 4W5NA 1X80B 5IAKA 4A4DA 2QYOA 3FNGA 3GRPA 5GAJA 1F2VA 2ORVA 4YJ2B 2CGEA 3UWOA 2ZITA 4MINA 1OAOA 4QULA 5IAOA 3E9NA 5CURA 1X1EA 3T4PA 4D9FA 5IYZF 2PX5A 3OX4A 3SZLA 4BO2A 5IFKA 2ODPA 1Q21A 2F8SA 5BNWA 1TU0A 3EQ2A 1Y5MA 3GFTA 2I91A 3A36A 5IANA 4UE2A 4B3RB 4CM4B 4J43A 2W48A 3H19A 3TAUA 2YRXA 2PYIA 4LC9A 5KKCA 2PZ8A 3UT6A 1IN7A 5L7YA 2H1LA 3QKIA 2Z5LA 4O29A 5B64A 2JKZA 4G89A 3OQIB 2Y1FA 2I2XB 2X2EA 4Q47A 3B9PA 3LDHA 4BFCA 4MV9A 5DNCA 3DVQX 4XPIB 2OXRA 2SHKA 3QWIA 1C1XA 5JLJA 2FPPB 1JXAA 3MJHA 4CG3A 4YRFA 1WDMA 2EKBA 2QZZA 5I7SA 1XNJA 4JOBA 4A5SA 2X0IA 3FTCA 2VDRB 1L7MA 3DCIA 3MB8A 3NONA 4FDLA 2W00A 4XD7D 3Q9SA 1C7RA 1ZNXA 1S2DA 1E9DA 1V8BA 1E58A 2COUA 2YWBA 2VZEA 3FNBA 4X95A 4KRFA 5BW6B 1DRKA 2BAGA 3VZQA 4UBMA 2QZSA 1ZIPA 4ND3A 3AUYA 5CT8A 2XIJA 2BMFA 2BP7A 4KSCA 4LHXA 2QM7A 4JXJA 1YVEI 2IYEA 4QWWA 4H31A 4NENB 1D2AA 2QAGC 2OO5C 1T2FA 3E35A 3HZRA 1KAQA 4GGMX 2GHRA 4QPZA 4P84A 4JLNA 2QLTA 1VL2A 1KO8A 2Q7XA 1L5ZA 4EVRA 5JZSA 1DCFA 1NW5A 1US8B 1QIKA 4DR7B 3T4UA 1NQTA 1Z2OX 4NOKA 5J1SB 2PLAA 1R0KA 4KMSA 2GZHA 2EFJA 2R3SA 2RH9B 4BX8A 1EP1B 1KPHA 2IXBA 1JR2A 3UJAA 3KVYA 3K4QA 1DJMA 4CF6A 1LSOA 2YHBA 2DFPA 3A8TA 4GKJB 5CJPA 1VKHA 3KQVA 4ZEOA 4YY3B 1NOIA 4OFWA 1RXVA 2E55A 3FDZB 5ALFA 3P0FA 4PSAA 1BMFD 2G4VA 5CLFA 3CUEF 4O8CA 3GJ0A 1WXFA 4L57A 1IK4A 2VAMA 2HHAA 2ECFA 1SG0A 4JOSA 3RS4A 5H68A 4C0JA 1L8OA 3ER6A 4JJGA 3ZK8A 4MRPA 5B4VA 1E1RA 2OTCA 4LFCB 5EIHA 3WSWA 1KI6A 2GYYA 4GL2A 3IAFA 2R86A 2ZS7A 5BWMA 1ZWLA 1T3LA 2IZ0A 3EC2A 4Y7DA 3PDCA 3FB1A 2EQAA 2YWEA 3DL7A 3NNNA 3PPYA 4L6IA 4X1KB 5D84A 4BNXA 4AKTA 4OOEA 5KOJA 1AHHA 1JIXA 3D0KA 1KFBB 2DULA 3NHKA 2C95A 4N49A 4ZAFA 2FUG1 1BD4A 2O2SA 4D97A 1JA1A 3VNUA 2AG5A 1Y48E 2PXXA 3T3IA 1K5PA 2X9LA 3WMRA 2AOUA 4Z53A 1A69A 1XCOA 2WMYA 1JEAA 1QH1A 3C6MA 4IGIA 4RHTA 3N2LA 1MB4A 4Z9BA 5ALYA 6CHYA 3W5DA 3DYBA 1N2GA 2PX0A 2WU8A 3Q7IA 4XIYA 1MH9A 3AFHA 5DN6A 1QAOA 1UPTA 3V4VB 4CCAA 2VYVD 4JT9A 5KHOC 2YL2A 1PWEA 3P27A 2ZB7A 5JADA 1H22A 1EESA 2KS6A 4RV4A 3LXXA 1J97A 1R0RE 3P9RA 3CXUA 1UBSB 3C6KA 3LCUA 3DMNA 4ZOLA 3X44A 2JBHA 3WNDA 1U28A 3PL5A 1GAQA 1JFSA 2A6PA 2DFVA 1WXIA 3BRSA 1RWBA 3QPWA 5EIBC 3G13A 4QBHA 2IP2A 1X1QA 5K0CA 3IP5A 3BWXA 2ZRPA 3ND8A 4D8VA 3G1UA 1Y3IA 4CR7A 1NG1A 2GLXA 4ACBA 3DDHA 3H2ZA 1PNRA 3RYFB 4LF8B 2EERA 2ORED 3TPFA 3V8PA 4D43A 4NS4A 1QCZA 4DLWA 4NU0A 3SAJA 2AJTA 4N3GA 2B98A 3MBKA 4QTZA 2Z6QA 1EX7A 3HACA 1H9BA 1XZFA 3RVNA 3G17A 3A3YA 4MW0A 5TPWA 5LOVF 3L0DA 2QRKA 4ZOCA 1ZEMA 4RD6A 4E5NA 1JJVA 4U7PB 5HYVA 2JGLA 4Z0HO 3T7AA 1A98A 3AY7A 1FA9A 2F1RA 2QIPA 3SBXA 4BQQA 1ZM3A 2FV8A 2JFUA 1O0CA 1PF7E 1RPAA 1GL9B 2NO6A 3NT2A 2OECA 2PO7A 5LZ4A 4JLWA 1ZH0A 4G07A 4L6AA 2ZJYA 4S1NA 3NDRA 4IKOA 5GGYA 4C78A 4D9KA 2AKEA 1IULA 1JHZA 3TE7A 3FY4A 2D2FA 1AC5A 1PGNA 1YZLA 1NX6A 3NM4A 4UPEA 2W6MA 4N3CA 3DZ8A 4GOND 4X20A 3PYMA 1ZD5A 5F5XA 5KYXA 1KOGA 3LS2A 2YMLA 4RF4A 2VHZA 1AQJA 4G5OA 1NBHA 1PZXA 3N3BC 2UYYA 4Q02A 3WKEA 1Z83A 3DGFC 2XXAA 2H07A 3IV9A 3WNBA 1UBLS 3GLHB 1I9GA 4H4DA 2OUKA 3V7FA 1VJRA 3SBEA 1F60A 2DJ5A 2ZJAA 1RLTA 4JP5A 1L5VA 2WKSA 1ZGHA 2O7QA 2YYSA 3NXSA 2Y66A 3OETA 2D0PB 3D7SA 2FSIA 3G5UA 2OBNA 2H1OA 1R5OA 2G76A 3PVSA 3U4DA 1BH2A 2MYNA 2OK7A 5I9LA 1ZNYA 5MN4A 3RAFC 1G5QA 2JCVA 2OG2A 2TMYA 4HP8A 4EFNA 3UC9A 3LXRA 4H08A 1FJHA 3QLVA 4NYIR 1S96A 2WIFA 3QKRB 3VJKA 1CWUA 3QVJA 5J4LA 5GADl 4CDNA 4RH1A 2CNOA 2I4IA 3W9YA 1IZ0A 1WSBA 4YAUA 4RNDB 1SY7A 3K0FA 5AK3A 1GAXA 3CLKA 3GB9A 2RGWA 4C0SA 4NFYA 1YE5A 1Z0DA 1C30B 4P7KA 4QYIB 1PWYE 4JBHA 4CQMA 4YEDA 3OVMA 3R1IA 4EW6A 5IXSA 4UBJA 5J47A 1R15A 1E3JA 1KYXA 4HWKA 4LJ8A 3TR5A 4GMHA 1I13A 3DKPA 4WBXC 1C2YA 4CUJA 1V7ZA 2UUCB 3DP9A 4BX3A 5AVSA 3LO8A 2AHRA 4JB2A 3ZVNA 1UH5A 1W1IA 3DBOB 3LGXA 1ZNZA 1KWGA 1LX7A 2DC1A 2FSVC 3PFGA 2FW1A 3CF2A 3H1PA 3EPKA 2ZWVA 5AKXA 4BXOB 1EFDN 4OYHA 1UT6A 1Q2UA 2QL9A 1TFUA 5FUVA 4N4AA 3HJGA 4FX2A 4IRMA 2RGAA 3R3JA 2Y77A 4WESA 2QY9A 3WVNA 1V5GA 5JIBA 1I7PA 1JA0A 1XYVA 4OPMA 4G67A 1UPXA 4I5EA 1ZOSA 2B5OA 5IDWA 1IZ7A 1KAEA 1W46A 4JP3A 5CXUA 3AM3A 2CXOA 2GEUA 3HL0A 3K0BA 1D8TA 1G8MA 1F20A 3G8DA 4A6DA 3FOZA 3L7BA 4UTNA 1WVGA 1RSZA 3PNQA 3TSCA 3RIEA 4N40A 4O33A 5FA8A 5FLKA 3BREA 2CV0A 2XAAA 1SVIA 3TKYA 5KQSA 1B8NA 1O58A 4IF4A 1J49A 3OBIA 1ID1A 1P44A 2ZWAA 3AL2A 2X86A 3B8EA 4HRVA 4MS1A 3Q3GE 1D2GA 1E9FA 4Q3LA 4MJ3A 1GJRA 2CT8A 1RYHA 1ZKMA 4MR8B 2A1UA 4KV7A 4G9BA 1GYPA 2G17A 3VPBA 5IYZA 2G63A 1UFQA 2XNDD 2Z1MA 1H85A 3MJEA 4IFEA 4M1MA 5TMBA 1TTTA 1QC5A 4PYRA 2XQKA 2G3YA 1D6JA 3RDPA 2AS0A 1R6UA 2OKCA 1T6ZA 4BVJA 1OX5A 1P6UA 4KI7A 4O4IB 4MKHA 5T4BA 4DF3A 1JSXA 2IXDA 3LX4A 5MHTA 1I7SB 4E2WA 3LD9A 1ESDA 3PIIA 5EJFA 1GYRA 4NBLA 1ZMTA 4OP1A 3SHQA 5JCXA 5EI5A 1U3TA 1RRMA 2WTXA 3ZW9A 2ZWIA 4HFRA 1XCGB 1SZJG 2O8FA 1NVTA 3LK6A 2RB5A 3PUKA 3QFTA 3MBIA 5FI5A 3S8MA 1NTRA 3L6OO 3OTOB 1WB5A 1ZH6A 3MWDA 4BGEA 1F38A 3K1JA 3QM1A 1GNVA 5CB4B 3QVOA 2IEZA 4M9ZA 2UUOA 4MHTA 4RHXA 4BNTA 1ZAYA 4EUKA 4C2TA 1XTVA 4GZ5A 1BMDA 1PR0A 2BJWA 2C5FA 2R00C 1XPOA 1WZ2A 5L3QB 1YRBA 2FPKA 2NYVA 2J3DA 1SPXA 2O05A 1ARZA 3L02A 4UMFA 4DCPA 4G36A 3BGWA 4KKVA 2GK3A 4BLSA 1GT6A 2LR0A 1D1QA 1SVSA 3NVAA 3OEEA 4X7MA 5T8KC 6AT1A 4QYSA 5M34A 4Z3OA 5JAOA 5EPEA 4P7FA 3TIIA 4CMIB 1R6DA 2QTRA 4LJ5A 1PVOA 2ECOA 2Z2JA 3G68A 4JOCA 4LFBB 4OX9B 3KXLA 2OXEA 3DV0A 3GMDA 3LY5A 5AI0A 1POXA 1Q1QA 3TLMA 3KT0A 5DYTA 3H0CA 5IM4F 4HLCA 4D46A 4KDEA 1QFZA 2RBEA 4FE4A 2A0FA 3CF0A 5L40A 4AKGA 2FWIA 1PLKA 2BFBA 3WNZA 1IBLB 3GLVA 4LWQA 2AUNA 1RPNA 4XTRA 2ZIWB 5KJ1A 2DPGA 4K3UA 2C9OA 3AJ9A 2HHJA 5IN4A 1V6AA 3AF0A 3KJFA 4MQEA 1YVDA 4ZO4A 1XMOB 4PBTA 1VJCA 4OMUA 5FL3A 4C1BA 5E2IA 3JR7A 2EDCA 1JEDA 3M8KA 2QTAA 3M2PA 2Q8PA 4NZOA 1QMGA 3KQTA 4KO1S 4MUJA 2GOYA 1OF1A 4C4PA 3T3OA 1J5EB 1M1XB 1ECPA 2WJ4A 3DE5X 4RXUA 2W11A 3T5BA 4RF5A 5IUNC 4YP6A 1OYYA 3ICOA 3EWIA 4C3VA 3VNQA 1AQLA 3AEYA 4BMDA 3NBMA 3DMTA 4NXMB 1I9CA 3O95A 3SDZA 4ISCA 5KNLA 2PD6A 1GPAA 5K99A 4P2BA 5LPNA 2OHJA 5KJEA 2NU6A 3GCXA 3QXGA 4LDPA 3GDOA 4QBFA 5B53A 3TNLA 4OHXA 4I9FA 3EVTA 3FRJA 3K70B 1XQ6A 3M6XA 4P4UA 1VOTA 2JGMA 5CVDA 2YCLA 3RV3A 3WLEA 4GKKB 4JLSA 1OBOA 4CR8A 1QPGA 3BWCA 3RW9A 4C4RA 2ZJZA 1J8DA 3H8WA 4KQKA 1N0IA 2DBZA 4RXTA 4J2TA 3EPJA 3LC7O 4Z7QB 1T1SA 3ORYA 3UAOA 3L4BA 1RFGE 2VHYA 3KS9A 1VXOA 4J90A 1RP7A 3HEBA 5JO9A 1JFFA 4KPYA 5LWQA 5FBQB 3T7DA 1T6XA 2FVXA 2XTZA 1UMDB 1CRLA 1VCNA 5K0GA 2O7NA 3TRDA 1JKMA 1WQ3A 3TTYA 3IC5A 2XUKA 2HFJA 2OQRA 2EP5A 3G85A 4UARA 3UMJA 4GIBA 2QE7A 3MJTA 5IJAA 1H5NA 3ZGOA 2IITA 4UBLA 3Q3HA 9MHTA 1RC1A 2D74A 1GVHA 3PTZA 4MWGA 4PO1A 5C8ZA 3RB8A 4TQ9A 4M0EA 5B1YA 5JW6A 2QJTA 1U7DA 4YAIA 1R5BA 4XIFA 1CJKC 4XVQA 5ICFA 1VE1A 4P4TA 5AW0A 4JJFA 2I7CA 3Q3VA 2WYUA 3BE5A 4NG4A 4A1FA 5GJBA 3P4YA 3FYUC 5DIZA 4IZOA 4PLTA 3ROGA 2NZWA 3MFQA 4TVOA 3WDMA 2C4NA 1TRKA 2QSJA 4J2OA 5MGNA 3GR6A 5ALUA 3GJXC 3RHSA 1YDEA 2JHGA 3LO5A 5K0TA 1NFFA 2RHMA 4QATA 4CTNA 3CVOA 4CNBA 1NM5A 4LNUB 3H9BA 3EEYA 4ZI7B 4UOEA 4ROTA 2RK6A 2WD7B 4Y9UA 4X5OA 4QSMA 4RCVA 1V1RB 1GG8A 2X7XA 3M34A 1A9ZA 1NT4A 4NZNA 1YO6A 2XZDA 1JJ7A 4DHEA 3T5AA 4XJSA 2P27A 2P41A 4MWEA 5EP1A 4QLBA 2IGBA 4O02B 1N3LA 3ES9A 4JUIA 3UQZA 4CDRA 3CVYA 1VP3A 2EGHA 1QF6A 3INYA 3W9SA 2O1EA 1BW9A 4NBRA 2WJHA 3TSYA 1V35A 3GEHA 1F8FA 2ZDHA 1O94D 3L92A 4HH0A 3VV3A 2XWQA 1HE3A 2CV1A 3O93A 2YXNA 4FNGA 5JHHB 2A0WA 2ZUWA 3IIEA 3L1JA 4QHSA 4FMBB 2HWXA 1QAQA 1XWWA 5G1NA 1LBHA 4JJEA 4LXYA 4DM7A 1HORA 1CQIB 2JFBA 1F8GA 2PXHA 3C8ZA 3HDHA 4J0DA 5F51A 4AO7A 4N3NA 5AKIA 2HLDA 2WU4A 5KJFA 1GZHB 3DLTA 3B3QA 4MQ4A 5BSHA 3AB7A 1KPGA 1AKEA 4INZA 2OB2A 1BAPA 3T1TA 5LA6B 1GU1A 1K7FB 1N8KA 3QVUA 1P2UA 4GM0A 1DXQA 4DGQA 2E4ZA 1ZYUA 3KKKA 4C05A 3L0IB 5EXXA 1UK9A 2VQ6A 1HE5A 1ZJ5A 3LL4A 2VLBA 3TZBA 4NZZA 4Z99A 2HYDA 1RYDA 3PEUA 1D4FA 1LSJA 1X2EA 3CMCO 1CYEA 3RAEC 1Y8QB 2OGZA 1KP3A 5D8DA 1U8TA 1GQYA 1SKYB 1UIMA 2P7IA 1UJ5A 3JQAB 4W5OA 1OI4A 1N1GA 4DLVA 1R8YA 1P4AA 3IOBA 1FVXA 3WGOA 3PQ6A 1MFPA 4KIGA 1QFXA 1T34A 1UK8A 2VP4A 1W94A 4GX0A 5B37A 4RXMA 4C0AC 1W9HA 2QRZA 3UJBA 2A2ZA 3PPXA 4CM9A 3VR6H 4C6TB 1KC3A 1OD6A 1UBOS 1QS0A 3BFKA 3R24A 4R6XA 4MUXA 2BDTA 1IDN1 1A5BB 2XEXA 4BCBA 1VSQA 2X8BA 4OOFA 1WY5A 1V95A 1XLVA 2G0TA 3QOXA 4TLLB 1QGZA 521PA 5B7NA 4L7VA 2IC5A 4QRHA 3COJA 1QIHA 4ZQFA 3IMGA 3A9RA 5A7GA 4A2WA 1IAVA 4XCQA 2PUGA 3D7RA 1SRQA 3NG1A 2W6PA 4BMPB 4ABTA 4Q00A 3O8QA 1V45E 2P2NA 2YRWA 1F6WA 2I4NA 2ICAA 4L28A 3SPXA 3ZJ4A 4L8FA 2L18A 5TGTA 3OEWA 4MPTA 4Q7KA 5F12A 1JIIA 2XHZA 1JS1X 3KX2A 4AJ1A 5REQB 3BWBA 5GPBA 3VH3A 5CT9A 5DI9A 3VR3D 4YA6A 4YAJA 3WQQA 3WGIA 2RAFA 2QG6A 1YDFA 5EJ2A 1Z0FA 4TVKA 3RU3A 3PD0A 1KYWA 4RZHA 4I55F 5ALNA 1ML4A 1KY2A 2GB4A 4LYDA 1NYQA 1RNLA 2WZDA 3I53A 2OP1A 2ENUA 4Z4EA 1DC8A 2Y1CA 3CUKA 3L9XA 4G5RA 3FTFA 3AR2A 1NHGA 1PCXA 3VDQA 2X2OA 3CWZA 1QTNA 1B4DA 1BXKA 2Y0BA 3ZZMA 2W7TA 1JV2B 1L4BA 4BBPA 2EU8A 1NJSA 2WQ7A 1OLSA 5K01A 4J49A 4CLOA 1WD5A 4F46A 4JR1A 3UJ6A 4ECAA 4EW2A 1E5TA 2OYRA 3IULA 1ORHA 1Z7BA 4M1QA 4FTWA 4XB2A 1X7XB 4P82A 1CBUA 4I4IA 2OQIA 1JHRA 1SIUA 3SIRA 2NUAA 2IEAA 3KKNA 4XCVA 4ZU3A 4EABA 5B3JC 1DTWB 1NOKA 1Q3TA 4G81A 3H2BA 5JSQA 1S8FA 1OBCA 3PXBA 2V54A 1N77A 2AYZA 2DKFA 1TVKB 2RBKA 1DCTA 1Z0KA 1Y6RA 4CM1A 3RABA 1JLRA 2ZI3A 4JEMA 4NU5A 2JEYA 5FRDA 4M1SA 5U4XA 1OASA 1P2SA 2AOTA 4FONA 3I3OA 2WJJA 1BXRA 3N6RA 1WHTB 4G97A 5J4VA 4P3NA 3VKWA 1NQAO 3BFXA 5IVIA 3U4CA 1QX3A 3ZW8A 2NXWA 4BBAA 1DJLA 3OIGA 1Z0SA 2VYCA 4U2CA 3SIPA 1Q20A 2JJ8A 1FNMA 1G5PA 3ANSA 1ZGBA 2DPLA 3FW1A 3NBXX 4IXMA 4M9CA 4TTJA 5IDQA 1YR7A 3E7FA 4YWJA 1XE3A 4MI9A 4U2KA 5LP6C 2BYTA 4KWEA 4HDKA 3KL4A 3PHJA 4MYHA 1OR8A 4P3KA 1JVSA 4YFYA 2PIDA 4JGIA 3WQRA 1N2IA 2QPLA 4J91A 4WKBA 5ES3A 3EQZA 5TT1A 4BRWA 5MFZA 3NHWA 4BWGA 1TK3A 2WBLC 4TN1A 5ALPA 3VZSA 3FNRA 5JYCA 1T1IA 1R6BX 3EZYA 4NY1A 1HDYA 5T64A 3Q7EA 2FWAA 2HDHA 2O50A 4DDKA 1BH6A 1SUAA 1BMFA 2EZ8A 2C3PA 2QN1A 1YTLA 3ODPA 4BO6A 4ZAWA 1P1KA 1CJBA 3FOWA 1ZG3A 4TM8A 4WAUA 2J4CA 3KQNA 3ZE1B 3G9TA 3RC3A 4Y1EA 3BL5A 3BH0A 3H6HA 5KX5B 3AVWA 4B83A 2Q41A 2O1XA 3IPAA 1EUQA 1QX4A 2G04A 4TMWA 1JKFA 3FCSB 2JD0A 1S4QA 2ZJ2A 4DZRA 4RHEA 2H2WA 2EKDA 5T67A 4E51A 2HF9A 1YZNA 3HDVA 2YWGA 3UCEA 5M04A 1OI3A 4QC2A 5EQFA 3U40A 1TA4A 1TUBB 4M99A 1U0OC 3AETA 3NMUF 2GILA 3BXXA 3ONEA 4GZ6A 4JL8A 1NN3A 2MSKA 5HM6A 1FOEB 2OC9A 2I54A 2XWBF 5IK2D 4BC1A 3D8TA 1FFAA 3ORHA 5BYJA 4UUMA 4ZYWA 3CT4A 1U3GA 3LOQA 3I6QA 1S1MA 4B3XA 1N6LA 1IRIA 3I9V1 3ODGA 2EYUA 1NI3A 1V3VA 2Q5LA 2VYVA 3BMCA 3H5WA 1VB3A 4KO4S 4OCZA 4Y2PA 1IZYA 3ZHCA 4RTLA 3IHLA 4K6MA 3HXOA 4R3UC 1KGDA 3H9QA 1G2QA 1R5JA 1LF5A 2IYNA 3BDAA 4LZPA 1Z74A 5DNWA 3GEBA 1ANKA 1KEZA 2IVZA 4CLRB 3STXA 3B1YA 4Z1MD 5BUZA 5L3SB 5IJZA 4QJ5A 1HRKA 4Q34A 2PH5A 4NE9A 4MUNA 1E9EA 1P7VA 3N2KA 4TLBA 3RGGA 4HDSA 3D6TB 1A9TA 4LDNA 4TKZA 2R1ZA 2XB8A 2V03A 3NCHA 3MYRA 1VRVA 3WGGA 1T6YA 3IKMB 4D0NA 1WXEA 3LBNA 5CXQA 4IIJF 2X2PA 5BR1A 2ZIGA 2JLYA 3PWKA 2NQTA 2WVHA 1I2MA 5L7WA 2AMYA 1NQOA 2XDYA 5GM2A 4F38A 1HYGA 5HX7A 3HJCA 3LWNA 3UH1A 4A2PA 2Q3BA 1P6QA 3KKLA 5LDGA 1PT5A 4ILEA 1L9KA 3ANXA 3BPSA 2BFEB 4QOSA 3RS0A 4C9BA 4F6CA 1MMFB 1T8YA 1TW2A 3NBAA 5TQ2A 3DFZA 2LV8A 3EXEB 5HQ3B 1OQAA 2J48A 3UO8B 3PGVA 1CZHA 1G98A 4FGJA 1G0NA 1P1JA 2F9MA 1II8A 2PS1A 1R8XA 4GYYA 2HMUA 4LWPA 4ANFA 1HKUA 5EEGA 4C14A 2I8CA 3OF2A 5LUAA 1AOXA 2GM5A 2W2OA 3CB4A 4BWVA 4LDAA 3G2HA 4V38A 5DM1A 4AYWA 5H3CA 1IUNA 1DLIA 5FHQA 4BNYA 4DIDA 5BMVB 4YMLA 5KDDA 3F49S 2PL3A 3B70A 5HPYB 3BORA 1LBSA 3BC1A 1E62A 3JS5A 2HTFA 3TR6A 4QUBA 3GOQA 4KQ9A 1V3UA 3RRJA 3C3AA 3PRHA 1NW9B 4K6CA 1SXJC 1W87A 5EHQA 5K0ZA 2VJYA 1MO3A 1AZLA 1DRJA 3JQ8A 4M1YA 3USZA 3ZHXA 4FMDF 2A88A 4KGZA 4U02A 1OU4A 3EDQA 6YASA 5HS4A 2QV0A 3ITKA 1OH6A 1L4YA 3UKDA 3DLBA 1JSRA 3H0EA 3JALA 1SC4A 5EG5A 2I9KA 1N9GA 5ICEA 1Z6PA 1EX9A 1XMSA 5B1DA 5LUBA 1I3LA 3M2TA 4A5OA 3I73A 1VIYA 2V7XA 5LNK1 1KYYA 4YR7A 3RSGA 3JQFC 2WHQA 1FLVA 3N2YA 3OZIA 3SN6A 3C3BA 3LVBA 4EVIA 4B44A 1SOAA 3ZJTA 4A6PA 3THOA 2JPDA 3R20A 2WF8A 4YDQA 2LDXA 3CKKA 3FETA 4GS5A 3SQXA 4OQLA 2YBDA 3DKVA 3V4LA 3RHZA 4NPCA 2H0QA 3MUFA 1PTKA 5ERYA 4TZ0A 3VKUA 4TXJA 3CR7A 2E87A 2NTNA 3GYGA 2ACEA 3BIOA 4MKGA 2YJNA 5J40A 1MOSA 1L1QA 1THGA 4IFBA 4CTMA 4EJSB 1OXSC 1AUQA 2GJ9A 3PF8A 3Q5DA 2RFLA 3ZWDA 3C5WP 1A9XB 2Q5HA 4MYUA 3A1FA 1AMNA 2IW3A 1NVVR 2CMKA 4UCFA 1UPAA 2REQA 5T3UA 1AU9A 4DDTA 5FO0A 1WCV1 5E0KB 3DBVO 1CNFA 2EQ5A 3SR3A 1AQUA 2JHAA 4FWIB 3ZEAA 5JCZA 3DO8A 2YC4C 2OBFA 1X94A 3QVXA 3KG2A 1RC0A 3KXKA 3WZMA 4NZMA 4FZ5A 5EXSA 1JQ3A 2OMEA 1GDDA 1X13A 1WOMA 1ZM4A 2B2NA 2R8XA 4BFSA 4E4TA 1E2JA 4OP2A 2CMDA 3T8YA 2J59A 2IHUA 1T9CA 1PLJA 3N8KA 3WADA 4WBNA 1LDBA 4IIYA 1HXHA 1FU7A 1X7ZB 4GYJA 4ETMA 3LC2O 5C8YB 2HTEA 1T1GA 2R2AA 1IUOA 3G6KA 1QONA 4H35A 3ZVLA 2PVCA 2EJVA 1M33A 2FEXA 1N5KA 3UT5B 4D79A 4V1CA 1FTYA 5EKTA 3UMGA 1DB3A 2QI9C 2X22A 3E9ZA 1XJ5A 3LPCA 2E7ZA 4YMVA 1RJ9B 3KJXA 4DG8A 3IHTA 1ODJA 2XNDA 3GCGA 5FLYA 4HAIA 2L42A 4E94A 1V8FA 2HGSA 4C87A 2CMFA 2GKOA 4XYLA 2ZSFA 3GLIE 3KTFA 4Q18A 5TMEA 1ZL2A 3TCXB 1ETHA 5JCJD 2X4DA 2C20A 1P31A 2C92A 1P7PA 3JASA 2YZGA 1CS4C 3OC6A 4IXWA 5SY4A 4FHEA 3RJ9A 1DVRA 1P7YA 1B6RA 1NMYA 2VF2A 3FR8A 4Q3EA 5FFFA 4IIUA 3TNJA 3W7BA 1OE0A 5FH9A 1KJQA 3BA1A 3GELA 1PWXA 3RS7A 4B4UA 1EVEA 3K8OE 1M5UA 2XT9A 4DAOA 2I99A 4Q4CA 4W63A 3EG9B 2ZG6A 4BNMA 3QF4B 5BV1A 1ESNA 2CVQA 2I0FA 5JYDA 5KOHA 2IS2A 1DCKA 1YQ9A 4C22A 1JALA 1LSSA 4PS0A 2DERA 4P36A 1WZIA 3ZTWA 1NYLA 4CEHA 1DQZA 4AF6A 3AF2A 2UVQA 1NG9A 3OHPA 3WLOA 4HB0A 4F5ZA 2V97A 2HPHA 2IXFA 3T5DA 4ZQGA 1ML3A 2NSYA 1VFNA 3A3NA 3L49A 4ZV7A 4AU1A 4EYEA 3BCRA 4QGGA 5CDFA 1GKIA 1M2OA 3HJUA 1JHYA 1QJCA 4GKVA 5BQOA 5ALXA 4D25A 2P65A 1GAJA 5B3AA 2C3YA 4MK4A 1A7KA 4FEGA 2C2HA 3E84A 1E0DA 4LRTB 4O2RA 4BATA 4DL9A 5HRCA 3KQPA 2QLNA 3OD5A 3WSVA 3RODA 4GLBA 4AIRA 4E32A 1F7UA 1NQVA 2YXPX 2GJSA 3LQ2A 1A4XA 4Z8XA 1JR3E 5SY6A 4FEYA 1LDEA 1PFUA 4P08A 3R9XA 2GN0A 1FMTA 4L5BA 1IJBA 1DXYA 2LIVA 4K26A 4LOIA 4V0NA 4EQZA 1J1ZA 4H7KA 3V00A 5EOVA 4N8DA 1FVFA 1ODSA 4GLFA 5FOVA 3IEMA 3FYSA 3VH4A 2X14A 4D0LB 4QVKA 4UUPA 1HYBA 5GQSA 3G0HA 4BY9E 4EO4A 4O3MA 4L8LA 2QZ4A 1E3SA 3PUJA 2V6FA 3AHIA 1R0SA 4O4JF 4C7VA 1C7IA 4P92A 2WPDD 3PNKA 3EZGA 2IE0A 1FXSA 3KVVA 4HX5A 3WWCA 2NUBA 2V4ZA 4AS2A 4ZTUB 4E3ZA 1FFHA 5C7LO 1TLFA 1WSAA 2WJ6A 3DE6X 2ZWMA 4JUAA 2WWXA 3IQEA 2VDQB 4CMAA 4MCJA 3C3WA 2ZYTX 4B2PA 1MTZA 2R7NA 3AJEA 4DUGA 4EPYA 1UP4A 3Q2KA 5JJLA 4INOA 1DMRA 3LVFO 3O1HB 4J4HA 1UOOA 2WOJA 3ZCVA 3IAM6 4BO4A 2GVZC 1QCYA 4LYGA 1Z6TA 2VK8A 5JNLA 1PJ2A 3FDXA 3RREA 3KO8A 2WF6A 2HRBA 3IOYA 4FD3A 4D3ZA 4MDEA 3PE3A 5EERA 1G64A 4V0SA 4D6PA 4F85A 4CQNA 3ZX4A 4PO3X 1FP1D 2WM9B 3JAWB 4RGQA 1I36A 1QZZA 1UINA 4HUQA 3SR4A 2AHOA 1TQ4A 1FLDA 2PL1A 2WZQA 2V59A 4W9MC 5M7EA 3PQ4A 1BHO1 1MO2A 4R40A 3H1TA 5HBGA 5BUCA 5F9MA 2F43B 2JGJA 2VF8A 1J06A 3DDSA 4KODA 4C04A 1D4ZA 4A73A 4NATA 1VQ1A 2E5WA 1Q1ZA 3BFPA 4DJEC 3G5AA 3ADBA 4MRMB 3DHYA 3WHPA 4EW3A 1WSWA 5LP6A 2Q3MA 2WG1A 1GQSA 5K6TA 2J0VA 3ZD9A 1ZM2A 4POOA 4G1CA 4JT2A 3ZLBA 2CL0X 5J2TA 2JG3A 1R9MA 1LC0A 3ENNA 5JHGB 4TOIA 5KVSA 1D5WA 4WXHA 5B1SA 3B1VA 5KYGA 1RCFA 1U2RA 3TD9A 2WB4A 1IXSB 2CK3D 3KKEA 4K6GA 2IX9A 3A4YA 4C21A 2WKRA 1NJ8A 3Q12A 1USWA 4KVGA 3WRWA 1G20A 3OCXA 1U0RA 2A14A 3WWZA 1FUKA 4B6EA 4FEAA 1KFCB 3TW6A 3GD7A 3U19A 2OD9A 4OI0A 1CZNA 4IIJA 1E5LA 4R8KA 5EJIA 1IY9A 3RC8A 4CMJA 3SX2A 5AD1A 2DP4E 1JU3A 3FSEA 4U7HA 3QGMA 1JIVA 1W19A 2CL6X 2P4HX 4HS4A 2PGNA 3B8HA 4X41A 1MXFA 1U8FO 1U0NA 5IUJC 3CSSA 1XAGA 2VHWA 3I9LA 4TLMB 4KWCA 2R4QA 1X3LA 4EO7A 4QQ8A 2X6QA 2C0CA 3DOHA 3L6BA 1A8HA 2BGTA 2EJCA 2I76A 3EH1A 2XKKA 3LP5A 5CCDA 3P7MA 5LQKA 4HG2A 1V6SA 3OO0A 3U7RA 1PJBA 4MPPA 3L8GA 5HNKA 1EWYA 2BFCB 3GPLA 1L4LA 1FMLA 1JT9A 2MMGA 4PHTA 3JD4A 4MW4A 3S44A 4A9AA 5KPDA 2H2GA 4B5KA 2CW5A 1IAQA 4KXVA 4M9RA 1V4BA 2Q2OA 1TZCA 3EB9A 3R77A 3PQFA 3CB2A 1U4SA 3IJ5A 4HR7A 2XOKD 1O94A 4AMZA 4YREA 4WH0A 4Z9AA 2VNKA 3VR5H 5BVGB 4Z0PA 2R1TA 1VPDA 3ZYCA 1TAQA 3EUFA 4MRRA 4EOGA 4EKYA 5AW6A 4M4SA 4QYWA 4BAUA 3RSCA 3OZVA 1QHNA 1YI0A 1TAHA 1A96A 3VTZA 1ZCAA 4IKPA 4P3OA 3BOSA 2WMOB 5E6RB 1RLOA 4PSCA 4C30A 3STYA 1C5KA 2PX4A 3PT5A 5GONB 1BQEA 5E1DA 1KZ9A 3GHHA 1UZUA 5G0SA 3W1VA 3WDSA 1H2XA 2PWYA 4N76A 4AO8A 3O8CA 4HGYA 3KB2A 3UK0A 4MWBA 1CVIA 3AZPA 4HTAA 1G5HA 2QNIA 1QOPB 3HSYA 3WYNA 1GPJA 1NVEA 1DS6A 1QQTA 3C7DB 3HFRA 2E4UA 2GM4A 5LJLA 5FD8A 4WACA 3G6WA 3MNFA 4HLUC 1A5SB 1E6LA 4MROA 4OFBA 4FK8A 4PTYA 1JYSA 1OH7A 3CVWA 4MI3A 3HBJA 3O9ZA 4H27A 4MIYA 2ISCA 4FKZA 3SVLA 2HWKA 4PU0A 4KK4A 1V3QE 3P9XA 1DKUA 1YR2A 4Y2RA 2HIHA 1X19A 1LFDB 4QT0A 4I08A 4MS3A 2OKGA 4QO8A 4BIIA 4E2XA 1COZA 4XEHA 1I3NA 4CL8A 3I5MA 3MTBA 4I1UA 4P0PB 1PS8A 4FYPA 3DFFA 5LQSA 4YCSA 4DR5B 2PM8A 3GFVA 4EARA 4Q12A 2HN9A 2O14A 3HCDA 2X23A 2MOKA 2QX6A 1NKSA 3V9AA 1DX4A 4AX8A 1EE2A 4JC4A 2AWNA 3DFIA 1R50A 1ILWA 1C9YA 1WP4A 1I01A 3HCFA 3K35A 2GZ1A 1K4MA 4MV7A 4UNIA 3I6YA 3UJ8A 2WHXA 2A67A 4NBKA 1Z3IX 4KVZA 4ZT5A 3WV4A 4D9IA 1Y3HA 2HQBA 3D6JA 3B7PA 4FFPA 4PVCA 3SXJA 4EA7A 2F4VB 1X0XA 3TZKA 3QA9A 1WB4A 2QRMA 4M22A 1V8DA 5F9HA 2IVFA 3L2OB 3QVWA 2NO4A 4G65A 3GNSA 1NXVA 1UP6A 4HWOA 5AUNB 3SU8A 5CIYA 2C9ZA 1WETA 5J2UF 4E70A 1T0IA 4KB5A 2FTKE 3WL5A 3L18A 3SX4A 3KP1A 3DFKA 1CLUA 4URWR 4PYOA 1E9BA 3T9EA 1Z0UA 1ADCA 3WFJA 1U0SY 5M29A 1VKOA 1CY0A 4BFTA 3MELA 1EDZA 1KZ1A 1XL1A 2GH1A 2HQ1A 3KOXA 3NKVA 3DVAA 5ESDA 1KEVA 5AOVA 5CLJA 2A7QA 5CITA 3MXTA 3T4XA 4ZT6A 4LYAA 3HWRA 3HCEA 1H42A 1KBQA 1TQHA 1NUPA 2PMDA 5GJWC 2ZB3A 3RK0A 5JNVA 3U81A 4MP8A 1P80A 3EUWA 2OGSA 2C4UA 2BT4A 2QL6A 1L3BA 3ABSB 1XCMA 3C6ZA 2BP7B 2BTOA 3MYYA 4JA2A 1IDOA 3F9RA 2X0FA 5A04A 3KLPX 3GZJA 2Z5FA 3L8HA 2D0OB 3RYHA 1T36A 3A1TA 4YQYA 4ZVVA 4KQEA 4DC0A 4XDZA 2P4UA 3HM2A 1L4EA 2H08A 1QIEA 3ELUA 2P11A 4R68A 3FYHA 3GRKA 5B57C 5KKAA 2E1RA 3KPUA 4TKVA 1HMPA 1W4CA 2H9AA 5EP4A 3SNHA 4WLOA 4DLUA 2H11A 3AR7A 3BRCA 2DF8A 1FTQA 3PK0A 5K4HA 4N8EA 5D85A 4MEJA 2H4YA 2ZSIA 4XFJA 1G8KA 2J5XA 2QUKA 3ZV7A 3WGVA 5CDGA 1JSCA 1LQTA 2I2CA 4HJXA 1GP2A 1VBMA 4KWTA 4M1KA 4DGSA 2CZGA 5KNBH 3GDHA 4URUR 2ZQ5A 4X00A 4DCMA 4E88A 3C3YA 1ULSA 2QU7A 4PCVA 2A3RA 4Z3KA 2FPIA 1LPNA 3FXAA 4QQRA 2J3LA 4IY1A 1Z7YA 4DQLA 2ZXUA 3OZXA 3WB2A 3EA0A 2BCGY 2Y6UA 1ZW1A 2GAJA 3PJDA 3QLEA 1SUBA 1TECE 1SHJA 3QMMA 1FRFS 4OU5A 2P77A 3UKOA 4F0JA 3BRQA 3OQNA 5BSKA 1B73A 5AI8A 3UWKA 2BEKA 2Y1LA 4I5DA 4M21A 1KI6B 4U63A 2G88A 2ZRHA 3OPMA 3EGCA 4F3YA 4BE7B 5CMLA 4DIBA 4O4JA 3EEBA 1QH8A 4R1UA 3HBMA 3VBCA 4ZJPA 1SUSA 2AG6A 2JK0A 5KOJB 4C88A 3UH0A 1KIAA 1Y9ZA 4XJXA 3CLRC 3W5VA 3ADPA 2YJZA 4FW8A 4EATA 5A5DA 2B7LA 3L7CA 4ZOBA 4YRRA 2OR3A 4W5TA 4TLCA 2AOUB 4F2GA 1P0MA 2AEFA 4QBIA 4RVUA 3B51X 4FN4A 3KEFA 4MWZA 4X3PA 1QH1B 3PC4A 3IVGA 4A8TA 2XUOA 2WT8A 1E7MA 2Q6TA 4PZUA 3NBUA 5EE5B 5AT1A 3S2ZA 2B92A 3BD9A 1EFHA 3FGNA 4KHPB 2RHOA 4P38A 1XQVA 3KQUA 1W4LA 3IKJA 5IVHA 3A9VA 1N25A 1TMGE 5HTOA 2ONKA 3HNRA 4IOJA 1XR3A 4WVLA 4ZOLB 5KU7A 2CLOB 2HC9A 2R4UA 1ICIA 4P3YA 5JD5A 3FMOB 1EK5A 2XKJE 5J4YA 5KWJA 4IEFB 4JJ8A 4GQIA 1WG8A 3HM9A 1I0ZA 3IAS6 3ORRA 1RYZA 3U0VA 1L4UA 4WOJA 3F74A 1ZJYA 4IIGA 2WUWE 3QWBA 1NW8A 1PK8A 1USIA 3E70C 1DI0A 1C3OA 3Q3JB 3OZEA 2K7FA 2GT1A 2M1XA 2VH2A 3R8FA 4CKEA 3KEMA 1XZIA 1P77A 4Z1MA 5TPWB 4HDOB 4HX2A 4XM2A 1PEDA 2AN1A 1OYVA 5C80A 2JLRA 4Y0VA 1VSTA 1JHXA 5TGDA 1DT5A 3DT6A 1SC9A 4YP7A 4N6GA 1OC2A 3IQXA 1UDAA 1I0IA 5BSFA 2KLBA 2Z8ZA 2GRJA 3SIXA 5BYAA 5B5SA 2VUHB 2PRIA 4KRGA 5IJXA 1JXQA 2B2XA 2GPJA 4P93A 3WTCA 2V0GA 3LKDA 3Q8KA 1VIDA 4JLVA 1FDTA 3UOGA 3LIIA 3PYXA 4YBZA 3W4IA 4FYXA 5FJIA 1U5CA 4FFWA 2ERCA 2VOJA 1WPGA 4X20B 3TLGA 5KYXB 3OJLA 3LTEA 2YFQA 3CBGA 3O91A 1XHFA 2NO5A 4GOLD 5H1YA 2V7QD 5HBRA 4J1TC 2VA8A 4JEIA 1UOEA 3S0JA 3C3XA 4FB5A 3LTNC 4CQLA 2XXAB 3AIKA 4OI2A 4BO3A 2PLNA 3I45A 5EIFA 3ZV6A 1ISGA 3QQPA 3WJ1A 1Z75A 2W4QA 2LIPA 2IZ6A 3U7EB 2NNLD 4N5MA 5AW3A 5CIWA 3TGPA 4DCTA 1U3WA 1ZVMA 1D1TA 2FN9A 3A6FA 1PG2A 3LUFA 3U1VA 2O2HA 3CINA 5HE8A 5C4IA 2X4LA 1ZR4A 3G2IA 4XSGA 4BDTA 5JS8A 3MRXA 5A6SA 1NN5A 4LX0A 4H77A 1T9DA 3ZJUA 3PLRA 4BB5A 5JC1A 4XQ9A 1L7RA 4OBEA 4DA7A 2ZT6A 1X70A 2POQX 3H2HA 5BY2A 3WDKA 4BOYA 3FUTA 4HEJA 3ER8A 1PBNA 4GRDA 4QDTA 2VJAA 2ZRIA 4BJHB 4CI0B 2G71A 2Z8YM 2FGKA 3UV6A 3V8BA 3I9FA 3TSWA 4YT8A 3K0FB 2G08A 2JL1A 2JIRA 2R8OA 4RY2A 2P2SA 3K0CC 4R84A 4F97A 1LZLA 1P9RA 4QODA 3GGSA 4CTOA 1OYWA 1V1JA 3GZ4A 3IQHX 3QE0A 1EFCA 4CQMB 5AESA 1CUJA 1U2SA 2QPAA 4ZRNA 2BPOA 1AQNA 2CJFA 1Q16A 3TQOA 5JMTA 4PTZA 1I7QB 3CEMA 4WLFA 1JLLA 2BHTA 2BR3A 4IDBA 3LZDA 4RTSA 4KE6A 3R23A 2VQSA 3UF0A 3N39C 2HLHA 1XHEA 2BKUA 3WBKA 3EQ6A 2G36A 1CB7A 3EVZA 4BO7A 1P8AA 2FX5A 2MIIA 2QN3A 4O25A 4MW6A 3SOZA 5H3HA 1N2BA 5GZ3A 1L4NA 3DZCA 5K45A 4DKJA 1Q15A 4WK0B 1EPUA 1S1CA 3ICWA 2J45A 2X41A 1Y8CA 1EVIA 1EBBA 2CJXA 3GWZA 3MAGA 3MOSA 5JXGA 2WA1A 1PR3A 1ZJ4A 2UU9B 3MGKA 4NXNB 1FYVA 5FPTA 4DSAA 4WESB 4YGYA 2VBGA 2PDAA 2IS6A 3VKFA 4DHWA 3DNFA 4JK3A 4MKZA 5ULLA 2CDBA 2Q9AA 1PJCA 4ATNA 3OZWA 1XVUA 1JDNA 3SMVA 4BMVA 4HL6A 4UEJA 4BLTA 1T9BA 3SZ3A 1QQAA 4AIIA 4JQYA 4HNHA 2I6UA 4KQ2A 3KEOA 3N0TA 2B69A 1LC3A 4FD2A 4EBBA 4JJ4A 3IEXA 2W6NA 1G4HA 1JMYA 3CNQS 4MQ5A 5F1OA 1T35A 1YHNA 1SAYA 1T1JA 2CYBA 1IONA 2D4HA 2PUJA 3DVRX 4JCOA 4IHJF 3BULA 1NUSA 2QUBA 3EC1A 2FN4A 4MS1B 2CFOA 1JG4A 2ARKA 3A3PA 3L6CA 4OKSA 3TZHA 1QDEA 4F1JA 4WKGA 2RSLA 4DXAA 4TXHA 2BGGA 2OPBA 2A1UB 5BYKA 3KJIA 3ML1A 4GI2A 5IYZB 5CVEA 1GQFA 2PNJA 3S27A 1QC5B 1SBYA 2ALJA 2GGSA 3TO5A 3U1TA 4GM1A 1E7WA 2A0UA 5EC8A 2B4KA 2A9FA 3PEEA 2ZT7A 1SIWA 3BCSA 4IJ5A 1ZW6A 4TWZA 5J2UA 3RI3A 1VMKA 3FKJA 5B6IA 1TU3A 4NDZA 4S1PA 1ECLA 3L8FA 1W49A 3EVFA 3EG5A 1PR6A 3GEEA 5DBGA 2O8FB 4E5DA 3B89A 3TBHA 1L5MA 3TTXA 1MOQA 1N2ZA 3WR5A 5BN1A 4MCIA 1QIFA 3VKGA 2ZI7A 4B0OA 3MWDB 4N12A 3YASA 5JEEA 2ADFA 3ZCUA 5FOSA 4JXKA 2VUIB 3ABOB 4M8NE 4TRMA 5JCJA 2WD8A 3MGGA 2G9NA 2DPHA 1N1DA 1KAMA 3MJCA 1KEWA 3LLMA 4PWZA 3NALA 2YHIA 4ZTBA 2FUCA 4UFNA 5AH0A 3A4NA 1E7YA 4H6VA 1ORIA 1T9HA 1EK1A 2Q5CA 2E9SA 2X19A 4W4TA 1VM6A 3ABRB 4NU6A 2BFDA 3RU9A 4DJFC 2QAGA 2IELA 1HOTA 1WB9A 2IEYA 2EP7A 3BE8A 1J07A 2Q3EA 3DV0B 1M10A 5BOVA 1K7CA 2HDNB 1MV5A 1KNQA 4QUAA 5HF9A 3ZY5A 4L0CA 5JH7F 4O59O 3LLSA 8ATCA 1GLGA 3EEOA 2XNSA 3RK4A 1RXEA 4I36A 3EVCA 4D6YA 5ELMA 4WOKA 2H2AA 1UC9A 3FMVA 1YCGA 4XDYA 2BFBB 3L0OA 3RFCA 4AJLA 2J46A 3DF9A 3QE9Y 1HOXA 1RQGA 2QOEA 1W44A 4IJMA 4J0FA 1TAUA 2P9TA 5KSPA 4WZBB 3ROXA 3FLAA 5I7FA 2IUSA 1Z5ZA 2F48A 4ZO9A 5K3OA 4MQEB 2HMYB 4HYEA 2FSPA 2D1YA 4GXNA 2EBFX 4XSVA 3NHBA 4NS1A 2GCGA 4OATA 3G7UA 3HXLA 3NT4A 4MDYA 4LHWA 3VTAA 4J3JA 2R65A 5HJ5A 1H9CA 5CEFA 4P3XA 4I7EA 1Z63A 3O38A 1Q7EA 3AUSA 1QLWA 2CXTA 3FCCA 3HU3A 4IGEA 3F9IA 3OCYA 1O03A 4ND1A 3Q3CA 2XF2A 4RCZA 2F64A 3ZV3A 2YFYA 2IHZA 3EVDA 3E2IA 2OXCA 1PNVA 1NN1A 1S8NA 2O5VA 3E8SA 3R4VA 3G02A 1SUWA 1AX9A 1DEXA 3HJRA 3WRYA 4CG0A 3HTXA 3AGPA 1EQUA 2UYOA 3MOGA 2XA1A 2NU6B 3IEPA 2YXBA 5DULA 1GGKA 2ZU0C 3HV2A 5CW1A 1INLA 4ERXA 3DVLA 2PUBA 1JILA 5FQNA 3S55A 1G8JA 2Q1SA 3OFJA 2JGAA 2P6NA 1DL5A 3I34X 1ZK4A 3LHIA 5T4FA 2WP8J 3I37X 1B0PA 1TZKA 5CIQA 3LE8A 4GEGA 4I9NA 1J9GA 2VJDA 3W2TA 3MJRA 5D3QA 5AM3A 1ZN8A 5B3KA 1RLJA 2OFPA 5EXTA 3IUEA 4RD4A 2GERA 1W96A 3C43A 1YS6A 1XDDA 2JI9A 3TRJA 2R6ZA 1CUXA 1BDIA 1JFFB 1MV8A 4ABYA 1T13A 1M66A 2CLCX 3R8XA 3T54A 1EX6A 3FJ1A 1S2NA 2VDUE 1VZ3A 3KELA 4RKFA 3NP9A 2VL7A 2WE8A 1F7VA 2X3UA 3G0DA 1Z9BA 3DFMA 2MWMA 4KIWA 5EJ5A 4LI3X 2QTVA 3G8AA 2C4TA 4BTEA 4ML3A 3MJ4A 3RWBA 2VJPA 2D2IA 1T3TA 3IP6A 4RKRA 4AMGA 5HUJA 4P8RA 1PZEA 1LQ2A 3JTEA 4MEBA 5ENVA 4IV0A 5BRAA 2H92A 1VRCA 1MBZA 1YNOA 4P4SA 2GPWA 2ZJ4A 4EJ0A 1IE3A 4FR5A 4MICA 2A9RA 4MWOA 1ZH2A 1O89A 3LBYA 4OBXA 2P9YA 3OICA 4LJLA 2W22A 2JD2A 5BSGA 3ACDA 1U3VA 1I1OA 1FDWA 1G7RA 1Z15A 5DPMA 1UZMA 2VH1A 1WAMA 4G5HA 5LSAA 1YULA 1EEXB 4IRXA 1QRUA 1NAHA 2Y0EA 3BGIA 5K3CA 4HNSA 1YDHA 3PQ5A 1OFUA 4UHBA 5BO5A 1TLTA 3HYRA 3N74A