1AK9A

Subtilisin mutant 8321
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYCGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPCASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPAKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords SUBTILISIN 8321
publication title Large increases in general stability for subtilisin BPN' through incremental changes in the free energy of unfolding.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 100
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ak9A00
3ZXYA 1SPBS 3EE6A 3EIFA 3VV2A 4NMXB 3PTLA 1GTG1 1THMA 4CFYA 1UBNA 1WSDA 1SN7A 3DE6X 2SNIE 2Z30A 5AQEA 3PRKE 4ZARA 1TM5E 4GI3A 1CNMA 1GCIA 1OYOA 1TM3E 1TMGE 2SICE 2SECE 4BWGA 3WHIA 2ZWPA 1GA4A 3BPSA 3DDZX 4LVOA 3T41A 4CFZA 2W2NA 5AVKA 5JMOA 3AJ8A 1DBIA 4I0WB 3H42B 3GT3A 4KG7A 1GA1A 3F7MA 2ID4A 2SBTA 2Z2ZA 2PMWB 3GCWA 1YJCA 3DE1X 3DE2X 1KDVA 4J94A 1NDUA 5SICE 1V6CA 2TECE 1C3LA 4ZOQI 1GTL1 1SBTA 1JEAA 1SBHA 1OT5A 4KB5A 2ST1A 2B6NA 1SH7A 3VTAA 1Q5PA 1SBCA 3Q40A 1TO2E 1SIOA 3AFGA 1T1GA 1LW6E 1AV7A 1V5IA 1TK2A 3Q5GA 1XF1A 1AVTA 1Y3CE 3CNQS 3QMPA 2ZWOA 1Y3BE 2DUJA 1NLUA 4C3UA 2Z58A 2DP4E 1TECE 1Y4DE 1SUAA 3QFHA 1Y4AE 1SUCA 2PWAA 2HPZA 1NDQA 3DVSX 3LPDA 4CG0A 3GCXA 1KE1A 1SUBA 1PTKA 3LPCA 1Y3DE 3I34X 2E1PA 1GTJ1 2G4VA 3P5BA 4H6XA 1CSEE 1YU6A 1SCAA 5JXHA 5AVJA 4MZDA 3DE3X 3I30X 4YN3A 1EA7A 1P7WA 1C9NA 1Y3FE 4OMCA 3L1KA 1WVMA 4AKTA 3I2YX 3DE0X 1Y1KE 1GNSA 1SCBA 1AF4A 4M1ZA 1SUPA 2Z56A 2PWBA 2V8BA 1ZVKA 2W2PA 3TI9A 4OV6B 3BX1A 3LXUX 1AQNA 5ARDA 4H6WA 1MPTA 4WOCA 4DZTA 1BE8A 2ID8A 1BH6A 3ZXXA 5ARCA 1TM1E 3VV3A 4AKSA 2IY9A 5JXIA 5JXJA 5AMXA 3I37X 1HT3A 1BFUA 3D9QX 1Y34E 3WQBA 2Z2YA 1YJBA 4LVNA 2IXTA 2WV7A 3DVRX 3UNXA 2Z57A 1KE2A 5K7SA 3A3NA 1BJRE 1TM7E 3DE4X 4HVLA 1GA6A 3SICE 3DE5X 1ST2A 2P4EA 1MEEA 4NE9A 1A2QA 3DW1X 1SBNE 3TI7A 1SIUA 5FAXA 4OMDA 2W2MA 3A3PA 1P7VA 1C9JA 3DE7X 2W2QA 1WMEA 1SCDA 1SIBE 1C9MA 1Y48E 3DYBA 2GKOA 1ZVJA 5ARBA 1TM4E 1VSBA 3LPAA 2X8JA 3DW3X 5I9SA 1DUIA 1OYVA 2W2OA 1SELA 2PRKA 1S02A 4C3VA 1R64A 1KDYA 4DJ5X 4KPGA 2PKCA 4NE7A 3VSBA 2PYZA 4DWWA 1R0RE 2XTJA 3HJRA 5B1EA 1P8JA 2Z2XA 1WMDA 4RYDA 1T1EA 1T1IA 2DQKA 1Y9ZA 3DWEX 1PFGA 1TO1E 2ZRQA 2WWTA 1IC6A 1S2NA 4FONA 1SVNA 1BFKA 3D43A 3EDYA 3DVQX 4K8RB 3BGOS 1GT91 1SCJA 2HD4A 1ST3A 2PQ2A 1SUDA 4Z2AA 1YJAA 1SBIA 2XRMA 3A3OA 2X8JB 1EGQA 3VYVA 1BE6A 4B5LA 1GNVA 2WUVA 3TECE 1AH2A 2WUWE 4HX2A 1KDZA 3CO0S 1AK9A 4JP8A 3F7OA 1S01A 3QTLA 3VHQA 5FBZA 1Y33E 3WIUA 1WMFA 3SQOA 3AJ9A 4WOBA 1AU9A 3WIVA 1PJ8A 1SUEA 3GT4A 1SCNE 2QTWB 5B1DA 5CW1A 5FFNA 4H6VA 3F49S 1IAVA 3OSZA 1PEKE 1R6VA 5JXGA
chains in the Genus database with same CATH superfamily
3ICWA 4R9RA 4EGCB 3DKKA 3VZSA 3BQMB 4JSTA 4KMRA 2G9NA 4ME6A 4Y8VA 1A95A 3K0EA 1WXHA 3KTOA 4DCSA 4G4SO 2I2XB 2ZDHA 4AJOA 4AM8A 2V7VA 2HYIC 2QROA 5JS2A 1B16A 1WNFA 4IGEA 1FS4A 4G0WA 1YONA 4MVJF 2VRCA 5ALWA 2GPJA 4Y9UA 3R7WB 2GHTA 1G20E 1YFJA 3NBUA 3BXXA 5DVZA 1WPQA 5FKJA 4OP2A 1PKXA 2IPXA 4CCAA 3G2KA 3QUTA 3ZE6A 2HWXA 2HK8A 2JGJA 3MBOA 4R8KA 3TD6A 1QRTA 4WVLA 4X45A 4XJSA 4Q9AA 2QLTA 4DR2B 5KS2A 4ITRC 2QAIA 3DXZA 4YGXB 5DBOA 3R20A 5FF9A 4A82A 2JJ1D 2IU4A 4ZOLB 4B3IA 2D5LA 2VP5A 5ITSA 2FZVA 1OWMA 4BLOA 4KCGA 4RU1A 3KXLA 1TM3E 3UJ9A 4JB2A 1WZNA 1Z4JA 2OCGA 1RHJA 3R6DA 1QR2A 2Q6OA 2ZJYA 3PHGA 4KTVE 3W5SA 5DIFA 2JAXA 5EJMA 5U1PA 2EGUA 3EHDA 3N8DA 2W8BA 2WPDA 3GA0A 3IKMB 4TSFD 4JLWA 1BA2A 1H2BA 3CZMA 2QL7A 3NPAA 2WABA 5FFMA 3TJZA 3U4GA 2QK4A 3T1QA 3BGSA 1ZOLA 2O3RA 4LVOA 1SKUA 2IYPA 1P2FA 4DL9A 4ZYLA 2AQKA 1SPXA 2I4LA 2P3QA 5GGXA 5AW8A 3ML1A 2PWZA 4CFZA 5IASA 4NTZA 3I53A 4U5XA 4F5EA 4MMZB 2WYOA 3DBHA 4BQFA 2WJGA 2Q1XA 4URVR 2RGYA 4PF1A 1H5UA 4C0XA 1OJLA 3CRRA 4W6ZA 3GRFA 2ESRA 1KYZA 3T1OA 3Q2KA 1UH5A 1YK1A 3GEMA 1SXGA 2OBNA 3CRZA 3GFQA 2FA9A 3HZOA 3ASUA 4BXOA 1W0CA 3NXKA 1D2MA 2BFWA 3G0IA 3PUJA 1DQNA 4HFMA 1LUAA 1EAYA 3DUFA 4XQEA 2OXTA 1IQRA 3LOPA 2UVDA 4PLZA 4AVYA 4LFAB 4WL0A 3QJGA 2FDCA 1UPXA 3IDOA 4N1AA 1FYFA 1HH4A 5CAEA 3MJDA 1ODLA 4ZO4A 3REQB 4QATA 3F98A 3FKJA 4E51A 3MWDA 4NEQA 2EJVA 5KTTA 2AR7A 4GUAA 4RACA 5IKXA 1Z82A 2NQ2C 2GETA 2G4LA 4R1MA 4D9CA 2A9RA 3T3MB 3K7EA 4WK2B 1W9HA 2QN7A 5CUQA 3CF4A 5FLKA 4P53A 3U1BA 1HUQA 1MR3F 1LDYA 5ALDA 3SBDA 4B6PA 2P8JA 2Q41A 3BD8A 4P08A 2CNNA 1SU7A 2VCEA 3S1LA 3WO0A 4KFRA 4ZOCA 3TW8A 4RMGA 1V4BA 4OLHA 1O4WA 3STWA 5KJFA 5DHFA 2YW2A 1I6WA 2X41A 3H6HA 4N49A 3F5MA 3P4YA 2JHFA 4LCJA 2ZSDA 2W8BB 5AI9A 3W79A 4K2HA 1XNGA 3MWGA 2RB4A 3Q41A 4MW4A 3WP1B 3RUPA 5HIAA 3FF4A 4MR8A 1BWQA 4HAWA 4NS4A 4MVYA 4DLBA 4FMCB 3I52A 5HCNA 1JXOA 3EULA 4PAOA 4AI6A 1SXJD 1XVTA 1PUIA 2CXHA 3HB7A 3FHLA 4QARA 4B4WA 4Q48A 2PKQP 4XYBA 4CLRA 2ZYVX 4FYVA 1FX1A 4UHJA 3DBHB 4BMXA 4ZDJA 1XLWA 4EY6A 1JHXA 5JZOA 4QZVA 3W5HA 1ZNZA 1EPUA 1XL1A 1GVNB 4Q24A 4WNIA 3UXMA 4RZQA 1S8OA 2TSYB 2B7BA 2YDXA 5FPPA 1NN5A 1S3SA 2Z58A 5CJPA 3TZQA 3P2YA 1ITZA 2B61A 2PUWA 4HDCA 4YRPA 3IEPA 1Q7CA 2B0CA 4DIKA 6GPBA 4Q1EA 4Q9JA 5ISMA 2QGFA 3HGMA 2WU4A 3PFGA 4J4HA 3QWFA 4P34A 1FFXB 2NPFA 4TTQA 4LK2A 4TX1A 2PWAA 4YJFA 1PZMA 1TYAE 3O8OA 3AUSA 4FOOA 5M3BA 4M1SA 1SCKA 1ZXLA 3T7RA 2XF2A 5CAEB 5GIPE 2HV9A 1VYVA 3SQWA 1VLMA 4DADA 3MWDB 2PFKA 2VZ8A 1TQ8A 2BLNA 1JBKA 5ER9A 1WXWA 2YOGA 2PSJA 5HDBB 2K2QB 3K6SA 3UA3A 1QHGA 5I4CA 1Y4ZA 3HWX1 5EINA 1PSDA 4FX5A 2IUFA 3WWPA 5JNVA 3RE1A 4N8DA 3IIJA 4X8MA 4FE3A 4KVZA 3U37A 3KQQA 5EQFA 3U7JA 3KJQA 2QMQA 1OIXA 1GZ4A 1JDZA 2HA3A 4KACA 1JKJB 1FP4A 1C0KA 3TW8B 1BROA 5I6DA 3LPCA 3OIFA 3V48A 3VI4B 2OY0A 5BN3A 4DRZA 3UWPA 3BHNA 4E08A 1E1RD 2Z08A 2HPAA 3TNYA 2DFTA 4JBYA 4FE7A 1N1MA 1IK4A 1L9KA 1LNSA 2ZE6A 3OMLA 1RM3A 4MR8B 4OQ4A 4WI1A 5IK2A 5HEKA 2PLWA 1Y8RA 2ZWMA 4MQMA 2WYUA 5FOQA 6NULA 1XCMA 1X0XA 4C1BA 1V71A 4YDSA 4MR7A 4EJ2A 5AW6A 2B94A 4CLRB 1CY1A 1H8ED 3ELUA 2ZDGA 3R76A 2XCTB 4XJVA 1WF6A 2B5OA 4BVGA 5DBGA 2C2ZA 2WKSA 4K87A 3D5QA 3KEQA 5D86A 4FDAA 1CY8A 1EA7A 2A1TS 5IPFA 2D0OB 4NCJA 1GEGA 3GLHA 1T3SA 4GLLA 4YP5A 5JV5A 1L4YA 1OLUA 2NVUB 5CDFA 2IU6A 1RMTA 2NU6B 3ZDRA 5JJBA 3I2YX 3QU4A 4QJ3A 2RAUA 1SOAA 3NBQA 2XMQA 5BRNA 4CVNA 1Z6XA 3F47A 4KQ6A 1W4ZA 3BL6A 1QK5A 3O8OB 1O89A 5FBVB 4ED9A 1JDJA 1EKXA 1KJQA 4ZPXA 1CUBA 3T99A 4OPMA 1A96A 7GPBA 1ZHOA 1E1NA 2VWQA 1M66A 3L4KA 3ASZA 3O21A 2HMWA 4FE4A 3N6XA 2V8BA 1OZAA 1IXSB 3I0ZA 4YI3A 2W2PA 3DEIA 2I7DA 1UXOA 2X0IA 5HK8A 3K6SB 2GM4A 1M67A 1WUYA 4GEKA 4BMSA 3LXUX 4QRHA 3ROEA 3CVVA 3O3OB 3GDOA 3T7EA 4DLVA 1O8BA 2OC9A 4C05A 3UMSA 2J8ZA 5ALUA 1T9DA 2A0YA 5BR4A 3N70A 5LOVA 1FP4B 2QD4A 3PUWA 2G0AA 2J3QA 4NK5A 1QDUA 2Z8YA 4DZTA 4AY6A 2HQRA 2OCAA 3EQ6A 1CUZA 4J1NA 5FNVB 1K7YA 5HE9A 3PXGA 4IOJA 1RRFA 3SNKA 2FPSA 2QM3A 2GK3A 4PLCA 3WLIA 1OBCA 5DM0A 1TKAA 1Y8RB 2NXJA 4MR7B 2PRZA 5J5AA 2RGUA 1F2TA 3AOEA 1QNFA 1Y37A 4DXAA 3II6X 5JATA 3FUVA 4DMRA 3IV7A 4P92A 4BRSA 3C5CA 2J41A 1GN8A 1DARA 2PEYA 3M33A 1SRRA 4WY2A 4MV5A 1RYNA 3G5MA 4TKZA 5HVNA 4K40A 2IV2X 3GPBA 1YBHA 2GILA 2HQSA 3Q3GE 1GDHA 4UTXA 2P2DA 3GLHB 2J9XB 2P4QA 5L9AA 2X1MA 2VBCA 4BFWA 1OLUB 2IXBA 4AMGA 1GRVA 1VGQA 4P31A 1LA2A 3O9MA 1SKYE 3OFND 4BO2A 5K0EA 4C6TA 4N0EA 1IULA 3BHMA 1UFKA 3DOFA 2NNWB 5MFPA 2IYYA 1WKVA 3HKBA 1MC8A 1JQLB 3G7SA 3E81A 3EZ7A 2WTEA 2ZJ2A 4ZAFA 1XQXA 1V8DA 4ACBA 3AX6A 3ANTA 3TNDA 1JQ3A 4R2MA 3WDMA 3I4FA 1GSHA 4HQLA 1VIAA 2JFBA 3D9QX 3P97A 2Q45A 1OAOC 4B47A 4BRZA 1IZ0A 1Z4PX 1QFYA 3JTEA 1T91A 3CUSA 4HAXA 3JQ8A 4RMNA 2DHRA 2PE5A 2QMZA 2WMNB 4DLWA 4RJIA 1L7BA 4GO1A 3T9BA 1M5TA 3SHOA 5LOVB 1T2NA 2V6JA 2Z2JA 4ROSA 1YVPA 2H2GA 3NW9A 1V26A 3CF2A 1FTSA 5IABA 2I91A 3UWMA 3IP5A 3GJ4A 2YYAA 4GDFA 1MEEA 1X8JA 3VBCA 1F8UA 3KLMX 4W9RA 3WGTA 1ZDMA 3DXFA 1F8YA 1W7AA 3MPUA 1DINA 2O8VA 1H22A 3T1TA 2PGDA 1CVIA 1M76A 4ZDIA 1F2TB 3GCDA 2I6QA 1TDJA 5EAIA 4YXFA 1A88A 2G7ZA 2I65A 2OTCA 3OICA 4AJPA 1V47A 1G0OA 3MMXA 3AIIA 4OEHA 5CTJA 1RMYA 2ZM6B 2O5EA 3H3FA 2BFAA 2XB9A 2QYOA 1JFRA 4LK3A 1N6KA 3UJDA 2C31A 4QVKA 2YWJA 5HIIA 3U09A 1H66A 2ZR8A 5C1DA 3AHJA 5FI3A 3OE7D 1YS9A 2WM3A 1V96A 2BTEA 3EEFA 4C6TB 3EUAA 2CLDX 4BZZA 4DA0A 1X8KA 2FPXA 4PVDA 4I4TB 2ZU0C 2IX9A 3HKBB 4MKRA 2P7IA 3HQ4O 2IHZA 3B13B 4YVFA 4O4JF 1EFUA 1XBTA 2C3OA 2FX5A 2Z04A 3C8DA 1YE5A 4D44A 5E7MA 1OYYA 1WB6A 5JS8A 1JFSA 5AVSA 1PFWA 1GYRA 4UM7A 2NSHA 1TRKA 2IZ1A 2C98A 1HT0A 3BEOA 2QTGA 1U8FO 2OQRA 3RWOA 3SR3A 2O8DA 3DOHA 1AXEA 1VA4A 4OREX 5DDIP 3ILSA 2WQZA 4FHEA 4C3VA 1Q7EA 3NNSA 3HS3A 1P2TA 3GU3A 3PUHA 4J6FA 1YB4A 1IWPB 3ZWXA 4RD6A 1VE7A 4FOSA 4IH9A 5LSAA 1P7PA 2Z95A 2EZ8A 1E9CA 4FDUA 3WMRA 3VSBA 4EKEA 4B7CA 4B3TB 3RK1A 1MQAA 3RSSA 5J4YA 3JYQA 5JMTA 5F9FA 2O2SA 4FVTA 4GMGA 4ZC1A 1NR5A 1CLEA 1BVHA 4FILA 1XMJA 3Q0EA 4AKIA 3ACDA 3GNQA 3K1JA 4AJJA 5K0JA 4Q19A 3OQBA 4QVIA 1LBHA 3P8ZA 5KWIA 1SR8A 2AG5A 3ND7A 4IMIB 4PQFA 1PR1A 4NECA 1J1IA 1LF0A 2BDTA 2GSDA 3SVZA 1R5BA 2DPXA 2EKPA 2QX7A 4J0HA 3TZ6A 4KPYA 5HS4A 2QTAA 3FYDA 4KRXA 4MW6A 4NVRA 4QGHA 4P1ZA 5E1OA 5E6SB 4J9UE 3DDCA 3U7HB 4BP8A 1VCMA 3FGPA 5L3ZA 3FTEA 2Q0SA 4KFSA 1CR6A 2BC9A 2I7CA 3EHEA 4MITA 4DPMA 3DVQX 5AKHA 2X2FA 2W4QA 1U81A 3JQDA 2K5UA 4G01B 3EUWA 5JEEA 2IBTA 2IT1A 1K68A 4YUXA 1RYEA 1ST3A 1NL3A 5EUQB 4HUTA 1HETA 1ZH0A 2OD2A 2O4CA 4K9MA 3HKCB 4L0CA 2NU9B 3A1DA 3K1YA 1K3TA 3NPMA 5CRIA 4DS3A 1B3RA 3FHCB 4M7RA 4ARIA 2P79A 2O6HA 1ZG3A 3A1NA 3PEWA 1U8EA 3UKJA 4RYLA 1GN9A 1WU8A 1H65A 3L0DA 3IMCA 4ETMA 1H1DA 3A3OA 2CCGA 3MTBA 2PV0A 2YNMD 1OH8A 1XA3A 4JZKA 2GHQA 3VYVA 3E9ZA 3PA8A 4E13A 5DK6A 4LF8B 3QH4A 4RVDA 2GEBA 1S5PA 2HH9A 4IUCS 3AKDA 3O82A 2IBMA 2V3WA 1DMSA 2C0QA 2WHEA 2O8DB 3M3PA 4JBXA 2Q9UA 4ZGWA 1FUYB 1D1PA 1YA8A 3GPLA 3PD0A 3TCXB 1JX6A 2RHDA 1WXIA 4GE0A 2BFNA 4D9EA 3K70B 2CFOA 1RYBA 2ZYDA 4NYJR 3RU2A 4EIWA 2J0VA 4JD5A 1PHRA 2YHAA 4K6FA 2YWEA 4O2LA 3T5GA 1GPJA 4B31A 4XUDA 3WGVA 2IXAA 5DFAA 4PICA 4KDCA 5ES4B 2C57A 4C0BA 1CPYA 1GLNA 2ZS8A 4M8IA 1DC4A 1MMFB 2PUTA 1VL5A 3HSYA 2GK6A 1DEAA 3K5HA 3MLAA 3ZY4A 1W85A 3A25A 4A6PA 4CV1A 3TX2A 5EKXA 1D2CA 1ZL2A 3JYLA 2QL9A 5B37A 3TW6A 5THXA 1B6RA 2FW0A 2NXWA 3GUCA 3KKZA 3OY7A 4LYDA 1NVGA 4PZEA 4TN1A 3VNBA 3ZEIA 4EPTA 3DZ8A 5D2CA 3VNVA 5H1YA 1JR3D 2AFIE 2PZBA 1JAZA 4C4RA 1NYQA 2ATCA 1M7BA 2ZI3A 3HHEA 4LGCA 3ADPA 2ZJ0A 3OSZA 4I5DA 3M6WA 3LT1A 1UWVA 2GMWA 1G21E 4KXLA 4XDYA 3OSUA 3P2MA 3FFAA 4E5SA 4U4AA 4TVKA 4EW6A 2EU8A 3CUWA 4WVFA 4I19A 4RHTA 1ZJ4A 2ZRGA 4M8NE 4DCPA 5KNDA 3L84A 1MW9X 4OF4A 3GOHA 2EC5A 2IS1A 5AKZA 1U0BB 3A1SA 1C3OA 2A5YB 3M5DA 5KQGA 1SN7A 1QP7A 1KEVA 4RLSA 2BM9A 4KMSA 4EGQA 2R8XA 1PW7A 4ND8A 3A9SA 3VPSA 4NZPA 3V1NA 3ZCPA 5ICCA 1JFFA 4P58A 1I3CA 1VYHA 1KQFA 1UP6A 3IKTA 1OZGA 3JZDA 4KE9A 3Q8MA 1W48A 4PQEA 3QUQA 3PRKE 1IB0A 4KLNA 4NLLA 5L7TA 4BQQA 3DKVA 2PX5A 3ZU2A 4ZK6A 4YMIA 2OQ2A 4FQ8A 3CWQA 5DTEA 1DL5A 2CVHA 3O8CA 4TKLA 2YX1A 1P5HA 3DXXA 1DBQA 5I7WA 5JH7B 5DX1A 1MIOB 1JQDA 1ZCJA 3K9WA 3L7JA 5CVTA 3MWKA 1TMGE 1NNEA 1R5JA 2BN4A 3GP5A 4JNKA 3G8BA 2WIGA 3OF2A 3PWZA 3F5QA 1JR4A 2WQ7A 2V7PA 3PI7A 4MGYR 2HDWA 2NPIA 2VK4A 3DZGA 4XASA 1PJQA 2QVZX 1W85B 5B30A 1ZM4A 5GP1A 3B1VA 4CEIA 4DNPA 1PJTA 4B34A 2OQVA 3R5HA 2KHZA 4DR6B 2REQA 4M86A 5F77A 3WGMA 1TJPB 4AJ1A 4PNPA 1Z63A 3MCUA 5E1DA 3VKGA 2AUNA 3SIRA 2V3VA 3MXOA 1W5FA 1U2QA 2UXDB 3L07A 2PJZA 3ITDA 3UAWA 1Q2UA 2PY6A 2PM8A 4BIIA 5EJ7A 4J6EA 4UBIA 3K9GA 5I8WA 4ISBA 1A71A 2NADA 4A7PA 5IVKA 3PJRA 3M9LA 5DNYB 3MTIA 2H7YA 2Z6AA 3G0DA 2YWFA 1RHQA 2DYKA 3B2NA 3OZTA 5FOXA 5JNRA 2G7MC 4HH0A 2XZLA 1PL6A 1EXVA 2VCHA 4LVCA 2LZ0A 2NAFA 2CN1A 4MIOA 3AY6A 4O8ZA 5C8YF 4TUYF 1Q7RA 1QUFA 1V6AA 2PXAA 2Q0HA 4BP3A 4LY3A 5A5FA 2R0QC 4ND8B 2FUNB 4MQEA 1R74A 4YRAA 3OQJA 1JFFB 3N39C 3P96A 4YEDA 3RRFA 3BXHA 2FVXA 2Q7XA 2TECE 1RSZA 3HJUA 5EZQA 1R0WA 4GRAA 5CYGA 1FQWA 4UNRA 2CLEB 5EOVA 2PGNA 2P3SA 5JI2E 1U9IC 4UFNA 4CIAA 3L92A 1BX0A 1LVHA 2CNOA 3UWDA 4ZYVA 2UZ4A 1HE3A 1DX9A 1PJ3A 2VDNB 4GVPA 5KSZA 1E2PA 1EFKA 2GASA 4FEAA 2XLCA 3C8UA 3NT5A 3FYSA 4PO1A 4XWTA 5DF1A 2Y27A 3FOFC 4NDAA 1U1IA 2H9YA 3CLKA 3EWNA 4N18A 4LGYA 4ZVSA 2YS7A 3LPLA 3WB9A 3ZCXA 4FGLA 3FJOA 1NWHA 4UE2A 4D98A 3B85A 2D5AA 4ZCIA 1M2VA 2J3MA 1GARA 5DB4A 1ZGGA 4YC7A 4RVFA 1POWA 2WWWA 2I2FA 1QKKA 1E6MA 4O4IF 2JANA 2YWGA 4BGDA 3SQNA 2JA2A 3RUIA 2UZAA 1YB5A 2ZSFA 1D09A 3D8SA 2RH4A 5FL7D 3RO7A 1A7JA 4MVJH 1E20A 1QHEA 1EX9A 1AVTA 2JIMA 5M29A 4DE5A 2ABWA 5JAUA 1L7OA 1E61A 3SSNA 2EJWA 1D07A 2HA6A 2FZKA 4TLDA 2FXIA 3MCAA 2YXLA 4ZV7A 3IEMA 1YE8A 4K9LA 3N1UA 2BGJA 2HFKA 1WY5A 4GG1A 1C4OA 3CVOA 3E4CA 2WYIA 1J8FA 4E1BA 3PQ8A 2BW0A 4G0ZA 5BV8A 4BEWA 3TF5A 2AF4C 2XMPA 1HYEA 3CLSD 3EAFA 5ICEA 1X38A 5LMZA 4D41A 2AWOA 5LC1A 3WO1A 1P0CA 1KY5A 3GEDA 4MQ4A 4MQEB 4CEJA 4ATNA 5FLYA 3H1BA 4EYGA 1Y7LA 2JLAA 3LRTA 4WQMA 5U4XA 4PFQA 4A6XA 2XOEA 1RXUA 3GDWA 1TTHA 1KBQA 2FRDC 4OHOA 5CJJA 4TPKA 3WLQA 4LJLA 2JBHA 3RABA 1KEWA 5TDHA 3WP0A 1RE0A 3QOYA 1D6JA 4JJEA 2HL6A 3OTWA 4AY3A 4E07A 1P73A 4ZQBA 3UIEA 1Z2NX 1K7SN 2DHQA 3ST7A 2HJ9A 2BFBA 2ZRHA 3RK4A 1Z8FA 3OQ6A 3UMRA 4MKHA 2Q2OA 4OD0A 4PX2A 3SXUA 1SKMA 1S2IA 1TT7A 4M38A 2P1DA 2H4WA 5H7XA 1B23P 5FA6A 4JQYA 3KZOA 4LBWA 1KKLA 3ZE8A 2JK0A 1M2VB 3AKYA 3GGPA 3P4XA 4JBGA 4R8MA 3RDPA 4LF5B 1NHGA 3GUHA 4WA7A 3ZU4A 3RSQA 1PJLA 3OPYI 1ZW1A 2HA0A 3W3AD 1HEYA 2JAQA 3N28A 5EWJA 4RPCA 4D3YA 4D81A 3ENNA 4YAFA 4L78A 1ORHA 1T8WA 3IQXA 2LV8A 1GSOA 3C7TA 3CJTA 2WMYA 3OPYA 4GW3A 1T0BA 5E0OA 4IH4A 1RPZA 3GT7A 4JXJA 3UY4A 3STXA 3TIXB 3I64A 3P9QA 1JR3E 1MVNA 1H2ZA 3TTWA 3VKWA 1XRNA 5FI5A 3UMJA 3BCHA 3D8UA 3S7ZA 2FSVC 5BRAA 3JQRA 4Z7QB 1JQAA 1QO9A 2Q3DA 4LS3A 4IEIA 3UW3A 3R2JA 1N36B 2LXNA 2HRBA 4C88A 1KFKB 3IVMA 3AGPA 3CLTD 1YS2X 3EF0A 3ESZA 1RKBA 3R5TA 2I9KA 2AD1A 3N7UA 1F3LA 1QU3A 2VDWB 2VS1A 4EA7A 2VPZA 4CEJB 4AWBA 5JO9A 4M1MA 5KVCA 3TCKA 2FKNA 2XMBA 1FFSA 1FZQA 2Z3WA 5ICGA 2Z4RA 2P1ZA 1N6IA 3PEEA 3ZJYA 3AM3A 4ALLA 1XTSA 3GT0A 2Q4DA 2DGDA 3BQ9A 1QQTA 4I4IA 4UU1A 4B4OA 2J48A 1AMUA 2JZCA 1T6NA 3IP3A 1JV2B 4HB2A 5ARDA 2FOLA 4PAWA 4D9HA 2BFBB 2NPOA 4RTMA 2ZBQA 1O4VA 3NVMB 3OFVA 3VTFA 4GMFA 1ATZA 3H8JA 4R40A 4L72A 3SXUB 1WZ2A 3CN9A 4GPD1 5A6SA 2J6BA 1KEEA 4C7OA 4OUDA 4UVHA 3SI7A 1TW2A 2A9KA 1XYYA 3JALA 3GXOA 1DLIA 3F8WA 4WOJA 1DZ3A 1UOPA 4AULA 3BB3A 1GZ5A 1ESMA 2OFXA 4XKJA 4I66A 4ZPJA 1KDOA 2Q4BA 1VXOA 1ELOA 2JJYA 5F64A 1UC8A 1V3QE 3ABRB 2BDEA 3UENA 3DR5A 3IBSA 1DC5A 3NFYA 4HDRA 4AQDA 1N6LA 3BICA 2XSZA 1IOLA 3VDQA 3JQAD 2VTDA 5T67A 4N40A 3AFHA 3ZWBA 3EY4A 3COZA 5JASA 1P2BA 1J2UA 4MI6A 4DYDA 4ZYTA 3HLKA 1QH8A 1YR3A 1ZN7A 3CUYA 3JQBC 3FNGA 5D3MA 3WLEA 4CM4B 3A9CA 4FK8A 1XSEA 1L7AA 1VSVA 1LRLA 1JZSA 5TQ0B 4LHVA 5TT0A 2BBSA 1N6HA 4R9UC 1XTKA 3O2QB 5AK5A 1A8IA 1QG4A 1B8PA 3V8MA 4FFWA 5AMXA 4EJ0A 1K4MA 1Z6TA 3VVCA 1P3DA 1G6HA 1UKAA 3G85A 4OXYA 1NHWA 1WWKA 1A9XA 3KJXA 4H4DA 3NVKI 2XMCA 1KOFA 2IHJA 3FNHA 2D0IA 4G09A 1Q1EA 4IFTA 3ADKA 1YGYA 2WZCA 5IAAA 1YK0A 3EEYA 3I32A 2VRWA 3R3YA 4E30A 2ZAOA 5G1OA 3FNRA 4DSNA 1A5TA 2KBFA 2CL6X 2F8LA 2ZBGA 2PBFA 3MJCA 4UCXA 4WD3A 2QX9A 3RTDA 3UJ8A 2ARKA 2BM0A 3DEKA 4NZZA 2CGEA 4PSVA 5KTNA 4BCCA 4BPBA 3OTQA 2VP2A 5E4YA 3W2IA 4PO9A 1TJNA 2RHCA 4LJ6A 3LWBA 4PX3A 4MQFB 3RR2A 3VM6A 1PNTA 2G82A 3A8TA 4IXWA 5E38A 2FPGA 1NVAA 2BFDA 3OVMA 2G40A 1KEEB 4Y2JA 5A6SB 4HLQB 4OUDB 1YXMA 2AUTA 1A5SB 4HVLA 1FUIA 1MGOA 3WQHA 1Z6ZA 2HJHA 5E1BA 5FBWB 3N2LA 3C6ZA 3DFFA 2FG6C 2H3EA 3KUXA 2COUA 3DTVA 3H3XA 3TQQA 3MOIA 5JCJD 3ZVMA 2QORA 2HC9A 4FYYA 1PF7E 2QVYX 1EUCA 2XF8A 5JJKA 3QW4B 2MINB 2ZJ3A 4CMEC 1K75A 1PP4A 4HDRB 5B7NA 4JP1A 3QBVA 2JKYA 2ODEA 4WXEA 2CJWB 1AK1A 3HL4A 4J75A 4GQBA 3V8VA 2G1PA 1H0KA 3NWEA 3QG1A 1X13A 2I6XA 2J5QA 4U7FA 2IPLA 3I8SA 3SEFA 2C83A 2WM8A 3A6KA 3SYNA 2JIZD 2O8FB 2AX3A 1QH8B 4MUJA 4YMUA 2FCAA 1SBYA 4TXHA 5D3MB 1X86B 2B83A 3A27A 3HB0A 4K7JA 1SCDA 1VI6A 4CT5A 1WLSA 3DMFA 3P4UA 4ZRNA 1E79D 4EPXA 2BP7A 2WT4A 2YBEA 4FFLA 3F5DA 2Q5EA 3GZTB 3WNZA 3VAYA 3NWJA 4D9BA 3M2PA 1NV9A 3AWDA 2YYSA 3PUYA 3IFSA 3L06A 4J0GA 3A9VA 4EFMA 2X8JA 3PC2A 2OSVA 3R3ZA 4UHHA 1SY7A 2AKYA 2W83A 2IFTA 1UDXA 2CDCA 4EZEA 1P2DA 3IPYA 1P1RA 2FV8A 3X1KA 3UJHA 2VT6A 4UXIA 3H2SA 4YCCA 1Z0AA 4K3VA 4M8SA 3GRVA 4BX8A 1O0SA 1NVXQ 5IJXA 5IKPA 3D8HA 3RT7A 1XVIA 4Q6WA 1XNJA 3TJMA 1M2HA 4BUCA 2DQYA 3GDFA 2WV9A 2GH1A 4GD3Q 2F00A 2CXPA 5FPHA 5CDYA 1Z4NA 5ENVA 1RXCA 4IDHA 1N6RA 4OQNA 4COKA 4L9RA 3O3NB 2FPGB 4ZI2A 4XE5A 4Z2YA 3VYWA 1D5CA 4DWWA 4I55B 4TWAA 3IHLA 2MSNA 1QCZA 3EIOA 4FX2A 5KSWB 1J22A 5IC5A 3ZU3A 1XWIA 1YQDA 4CQMD 3BWMA 3DEJA 2G9ZA 3DTVB 4RK6A 2MYTA 4F6LA 5KOJA 1D3AA 3WV4A 1V41E 1EUCB 2D8MA 3BM5A 2YIMA 3COPA 1T43A 2AK2A 3H87A 5T57A 3CRW1 3EAGA 3H19A 5TQVA 3ZOZA 3ZLUA 4J3JA 2E89A 3L6OO 2I67A 4JLDA 1JWAB 1GGNA 1SFRA 3ZWKA 1O6FA 1OXUA 1TFRA 1TQ2A 1UAGA 5HJEA 3AW9A 5EG5A 3KE9A 2O2HA 4L3WA 1PDWA 2DG2A 3ZTWA 4DLAA 4FZJA 1H4VB 4DUZB 1WBDA 4LOLA 1DO8A 3ES9A 3PDHA 2CYBA 3CVYA 5KTPA 2WYWA 3A36A 4M1QA 3ZBTA 2ET6A 3ENKA 2GZ3A 3OURA 1LNQA 3AVVA 4YAGA 4FR0A 3EG9A 2VNSA 2BP7B 4M1KA 1Z39A 4B6SA 1DMRA 1O58A 2NO5A 2OORC 3B82A 1Y8ZA 4GXQA 4LZLA 5HOEA 2BEWA 5L4LA 2W6ZA 4KVGA 2XRMA 4YHBA 2J3JA 3GIWA 1J2YA 1NW9B 3ZJTA 2X8JB 4FKMA 3CXUA 4IIYA 2P5TB 1PJAA 1KY2A 2QRJA 2Y2VA 4JX9A 3KPYA 1G6OA 3C6KA 2EKDA 1I4LD 4DA9A 1R8SA 2NWQA 4G5QA 8MHTA 3P9CA 2XCSB 2DE0X 1GL6A 5DP1A 4C4ZA 4MWGA 3WKAA 3D4LA 3R44A 4YRRA 3ZU5A 2WKPA 4HP8A 4UMDA 5E0KB 4CW7A 2A8YA 1F51E 3CCCA 1RVDA 3LLMA 2CL5A 1N0HA 1QWOA 1EBBA 3LIIA 5LWQA 1PFQA 3CJRA 3CKMA 3CUKA 3M4NA 2HIGA 4KBFA 2Y0PA 4PZPA 3QX3A 3E2PA 4Y2HA 2ECQA 1OXSC 2DVMA 3K1AA 4RJ2A 4ILEA 1HDCA 2BEJA 3MHTA 4X6UA 1J06A 3HCPA 3PF8A 4Q1FA 2VXYA 3A4IA 2CE2X 3AEQA 3TLMA 2CHVA 3PPYA 2CFIA 1INLA 1USKA 3Q1KA 4UASA 5F1PA 3RFXA 3OJFA 3L7YA 4NEGA 1WMFA 1F8GA 3COYA 1FUEA 4ROTA 4C4OA 1VM6A 3PEVA 1SVMA 4NYIQ 3PHHA 4Z8XA 1M2JA 1Q1ZA 1RBMA 4N47A 4CNBA 4E70A 1KP9A 2RG7A 1FJXA 3N2YA 1Z7WA 4JLUA 4POOA 2W42A 4MHSA 4C04A 3MUEA 4B3HA 2UYGA 4LNUA 1U5BB 4KUEA 2QM7A 1XNHA 3SD7A 3IVCA 3WRVA 3MNFA 2DOKA 2FWJA 1Y81A 3GRZA 1Z47A 1PNRA 2ZUSA 4UUNA 2XYGA 3MERA 3QEMA 1QQ5A 1TMKA 2FAXA 3NEPX 3RUHA 4BFLA 3IXQA 2WUFA 1D4FA 3WKBA 5C80A 2VOJA 4M1WA 3TLJA 3M2TA 1YC5A 2IIVA 1U6JA 1Z33A 2P78A 3K5WA 4C08A 1HDRA 1XFDA 2BEWB 3F6RA 4FMDB 4NNOA 5CGZA 3UT6A 2R8RA 3TOVA 2AOXA 3A6HA 3HYNA 2I29A 3W9YA 1ZRSA 2GAAA 4D3SA 2DFDA 3GIDA 4OHPA 4RLFA 1RYDA 1G9XA 1TYDE 1YHNA 2QNBA 2VUUA 1U7XA 5TV2A 4M88A 2VPXA 4URFA 5CEEA 4UVGA 1WCIA 1UPFA 3UGQA 4U39A 1NRJB 4S12A 2NXEA 2B2NA 3D8BA 2VAPA 3FWHA 1A7UA 4EZIA 1JDTA 2C2XA 4PLWA 3BJIC 3HVRA 1V8BA 2VAVA 4N0PA 2I0FA 1RI5A 4IRMA 3G1UA 1ZP6A 4RQUA 3NEAA 1MQ9A 2GARA 2FPPA 3VJLA 4DYHA 5LXTF 1HQKA 3PZRA 1M2OA 2WK1A 5ERYA 1YI0A 3AEQB 4FSHA 5ES3A 1UIRA 1DCKA 3FY4A 3RRJA 4Q3DA 4XVRA 2GXQA 1A8UA 4GWGA 4OYHA 3VUEA 3ZKWA 1SEPA 3TSCA 2F3QA 4M0EA 4XW2A 1HE4A 1ZVMA 4FP9A 4YDQA 4C2TA 3RHTA 5J2UF 2PGAA 5B2FA 5AW0A 2GLTA 1SQ0A 2AQ8A 3RVPA 3KPWA 4H31A 3JQ7A 2OOKA 1QP4A 3JSXA 3TQOA 4DEVA 2ZRJA 2VDOB 4UHDA 3B1ZA 4B3DA 4AXBA 1NW7A 4Y1RA 2C3MA 1XD2A 3B3QA 5ESDA 3ZDBA 2Y8EA 1Q3TA 2IHVA 1TUBA 4UAUA 1EWQA 3J80A 2VJAA 3BMNA 4P5EA 1E2MA 1YCGA 5G2OA 1J4AA 1BXKA 1MAWA 1XZBA 1ND6A 4FBGA 3UC5A 3VDMA 1W5EA 4ZMSA 5J2TF 1BH2A 3A9UA 4EA6A 5DBEX 4IYJA 4KXVA 2FJPA 4Z4GA 5K1ZA 1J56A 3DQPA 3HCBA 1FRNA 2OCKA 4MEAA 1A04A 5ALSA 4IHQA 2HSWA 2PMWB 2AZXA 3CH6A 1E9FA 4HH1A 5F3DA 4QRIA 2QXYA 1SZJG 3AJAA 4UMFA 4CKEA 2ZSKA 4FMPA 3KCNA 1E1QA 3DE2X 1I7QB 1MO3A 3N6VA 2W2KA 3VSDA 3KL4A 4B3GA 1CVLA 1ENYA 3AFNA 1A72A 1VHTA 1WCIB 3JQ9C 1F14A 2C4TA 2RK6A 3NXSA 2BMEA 3R6LA 2AI3A 5KYVA 4EATA 2QL6A 2QN9A 1AXRA 3TEMA 3QPAA 4GKAA 2WVAA 3SBEA 1DKMA 5EP4A 2P6OA 4Q7LA 3ECAA 5BUQA 1K98A 5EIHA 4IV0A 2YXNA 3EF3A 1SBTA 3QVOA 1P7YA 1Q1QA 1TT5B 1VLQA 2A1UA 2FPPB 1JEAA 5DTMA 3LQ1A 3ADBA 1M2OB 1OT5A 2HB6A 3I72A 4X20A 3Q7IA 5JADA 1OFVA 1SHJA 2Q2WA 3EIEA 3OZSA 2E9SA 3AHEA 5H80A 4ZCMA 1OBHA 2EW1A 4DA6A 1MAVA 1QYRA 1RAFA 4FFRA 1GG5A 1E4YA 1HQDA 3CTMA 3Q40A 4BAZA 3GLIA 4IVQA 2C4NA 1YQWA 3LTNC 5HIKA 3L1UA 3JQ7B 1XT6A 3GAZA 3BWVA 3LUGA 4ZOEA 3GEGA 3ZYZA 1V9CA 1WB4A 2W6CX 3QOWA 3T95A 3M9WA 3UB4A 4WJZA 3H86A 4JBIA 1AT1A 1TUBB 2X0JA 1LDNA 4QM6A 2BHRA 5TPWA 3NETA 2PGLA 3SAJA 2DUJA 2O2XA 2O23A 1W88A 1ZNQO 3AL3A 3WKCA 2BHTA 2PNFA 3T6KA 4X91A 1AE1A 2XYVA 2IWRA 1UT8A 1EG7A 3HU5A 1JAXA 1GPBA 1W2HA 2OHIA 5ICMA 5IULC 1P9WA 3CLSC 1SUCA 2JFZA 2DEUA 1N2BA 1X7DA 2N9UA 3L04A 1WAMA 3ID6C 4CKEB 4ESHA 2C2OA 1RADA 5IVPA 1AUOA 1J0XO 2FMXA 3RVDA 4B7UA 4D25A 4NS1A 3PTZA 5BUCA 1L7NA 4M98A 4QDKA 5A4AA 2VF2A 3WLHA 1P39A 2JGDB 4F72A 1DTEA 3LPDA 5JAQA 3HADA 5E2BA 4M83A 3V1UA 4FXPA 1G8JA 1VCHA 3AI1A 3KQWA 4FYKA 4K9KA 1I6LA 3WBJA 1I3OA 1P0MA 4UUQA 5EJGA 4O2BF 3OEED 1SUBA 3BD9A 3MGBA 1R16A 3RUFA 3SBXA 4F3YA 1M2EA 1W76A 2A1UB 2E4XA 2A94A 4G2NA 5JAHA 4LY6A 1RWOA 2VF5X 4MJXA 5CFOA 2SCUB 1JPNA 3FROA 2ZS7A 1AB6A 1Y3DE 2E5WA 4PONA 2HU2A 2Y6UA 4C0JA 2JHCA 4BN5A 2W6IA 3EZGA 1T0IA 5DTIA 4Z9FA 4YCBA 4IPTA 3NKFA 2HA5A 2RHGB 1DELA 3W3ZB 1ZJ5A 2FWAA 3GLIB 1N7IA 3LJKA 2X23A 2J08A 2ZJ4A 3T7JA 1OYWA 2GPWA 1OY1A 5CITA 4LWOA 2HZBA 3C14C 2IDKA 2VBFA 4HGYA 2VZ0A 4KQ2A 1NURA 5T4BA 1VMKA 1PU2A 2H1VA 2OGUA 2RJNA 2VZEA 4NV1A 4IIJA 4TLCA 4KR3A 1L4EA 4IJKA 1E59A 1GGEA 1XKTA 2VL7A 5TPWB 4WKGA 4ABYA 4HNAA 1N7GA 5EZYF 3CPEA 5F33A 1W88B 2BI7A 2BH9A 3GL9A 4FYXA 5DW3A 2IX3A 2R6HA 3JAMA 3L1KA 5JSZA 4Z4EA 1DRVA 4P0TA 2VPTA 1JQEA 1W36D 3TPZA 1CDOA 2XYHA 3AHCA 1B8UA 3HP1A 1JH8A 3BZUA 4P3NA 4QQFA 5DNAA 3GGCA 3OM0A 5LA6A 4EPWA 5A02A 1GNSA 4PBRA 2V0CA 3F71A 2ASEA 4LXGA 4ZTZB 1AF4A 5I9IA 3PNOA 5IDWA 5H8WA 3WRYA 3TIIA 4UPEA 2P9EA 3W2FA 1C0LA 4F2WA 1LDMA 3R3HA 3BMQB 3SM3A 2Z56A 1CUAA 3Q12A 1H85A 3ZIDA 2XZTA 1J23A 1UBGA 2QP9X 3BYZA 3HLYA 4N9QA 4NZOA 2AW3A 3AGQA 3WQRA 2ZI5A 3V4VB 4DUPA 5CB4F 4UBKA 1EU1A 1JJ7A 3WRXA 3QEBZ 3CHYA 4W9NA 2QTVA 3TI9A 4OOEA 4JP3A 3Q2IA 3R0JA 2WZDA 1KJWA 3B9RA 4JCCA 5LNK1 4H6WA 3QJ5A 1FPMA 2E18A 2OP1A 2RGCA 3WYFA 3IOBA 4DC1A 4RKRA 3SOPA 8GPBA 1KKMA 5TVGA 1NJGA 1JSRA 1ZSNA 5HILA 2AFHE 2IEYA 4YRCA 3SS7X 4EG5A 5CFRA 4HWOA 1BYIA 4D8VA 1QIJA 1U99A 2ZCJA 3VR4D 4LBZA 3SZGA 5AI0A 4LZOA 5JCOA 1Y5NA 4H7EA 1KTIA 3IHWA 2G1AA 2XDQB 3AP1A 5MN4A 2ZQYA 3EGIA 3ZWDA 2HCJB 5CA0A 4IIJB 2Q50A 3KAPA 3QI2A 3WMWA 4D80A 1VC2A 3EXIA 3PFBA 4PE5B 1XOIA 5AVRA 3CH7A 2BTQA 1D8TA 1RI3A 3WY9A 1NSFA 1I4DD 4IHJF 5BSHA 3NJRA 4L3OA 4MQBA 4GVXA 2BR4A 5JSZB 5I9MA 2GD2A 1DG1G 1HI9A 1IBCA 1R0ZA 2VK2A 5DRYA 3DCYA 1K6MA 1VJCA 4D99A 1BQ4A 4JFRA 2RH5A 1TU3A 1A9RA 1NLMA 1DP4A 1OTXA 1U5AA 2XT6A 1ZI6A 3FG9A 4WY8A 3U3OA 3V80A 5IT9A 1CZHA 4M9XA 5DTJA 4PYIA 1JU4A 3JX9A 3I62A 5LDGA 3LIPA 2IYNA 3PQ5A 1X1TA 5TMBA 3IUQA 1UF9A 5JBIA 5IG2A 1AN0A 4B2LA 4YO8A 5I7SA 3MT8A 4CMBA 4DSTA 4WBNF 5EKTA 5DT9A 1OLOA 1Y34E 3OBIA 4MV7A 2G8NA 1XZJA 5HZHA 2O52A 3AL2A 4PYKA 1HC7A 4S24A 3URMA 4DLRA 5LZ2A 2QQEA 3I3SR 1JE0A 1N77A 1R9JA 4BZPA 3FIJA 4OJYA 1ZMRA 1H2WA 5EHXA 3LWZA 4R8RA 4FFSA 4Y7DA 3UNXA 1MV5A 4OX9Y 5DHAA 3NOVA 5A4DA 1CJVC 1B15A 2QRGA 2CD9A 4S1OA 1C8KA 4D8XA 2PUEA 4NZ9A 3IP8A 1XP8A 1PBNA 3P19A 5FBQB 5HKLA 1CC1S 1QM5A 5COBA 5HCUA 5EVJA 2ZUUA 1DWOA 1ZI8A 3KV3O 1A4RA 2QSJA 2I2CA 1UDWA 4BLWA 2CW5A 2IYXA 4XRRA 5BQ3A 5C5DA 4YRTA 5DSXA 2FPKA 3U4CA 2R4QA 2VYNA 2QUKA 4E21A 4OL9A 4OLAA 3GWZA 3DO6A 4Q00A 4IICA 3O8QA 4IQGA 4OHZA 5CDSA 1LSJA 1M5UA 4RV4A 2Q5QA 2ZTUA 2Y1OA 5JYCA 1R6BX 1ZESA 2BBOA 3LCVB 2KI5A 4DMLA 3OPMA 4Q1CA 3ZHXA 3D0RA 4Q1VA 1FNBA 3KYIB 4MP3A 3Q8LA 2HQOA 3P0EA 1IY8A 3GFRA 4JYBA 2NQ8A 2BTQB 4O4HF 5ILQA 3FOCA 5DWQA 3Q0TA 4LPKA 5HQTA 3OWHA 3QA3E 4GVLA 3RVBA 2VZ9A 3KEMA 4E12A 4NK4A 5DK4A 2IZ6A 2A3NA 5IEJA 2ZWAA 4N6NA 3UTCA 1P0IA 1OXXK 2HRCA 5IM5A 1ZITA 3BWXA 3ILHA 4E2WA 4X94A 1EVQA 4F45A 2ZLBA 3ESRA 1FTNA 3SP1A 3UN1A 5LQRA 4NCBA 3WL5A 3F3SA 4LMPA 1Q3KA 1Y6QA 1WW3A 1E0SA 3WGOA 2NAPA 3P9KA 5KNCA 5J1SB 3I61A 2HLDA 5I9SA 3HYRA 1U4SA 3RAEC 5F4ZA 4A03A 1MTOA 1Z38A 1R0SA 3B12A 4LJAA 4HDMA 1VYUA 4AJNA 1GAEO 4J1TA 1Z45A 3FNEA 4WERA 4WN3A 1FXWF 1UKZA 3D4IA 4D1YA 1KDYA 4LYFA 4B2PA 1OH7A 1SKBA 1DT5A 1D2NA 1TZBA 1Y63A 4IEFB 3W9UA 3BC1A 4MQ6A 3RIHA 1XIVA 3W8RA 2X5OA 1NZJA 3BTOA 3EW9A 4IUYA 2IJGX 4P3PA 5TRTA 1L7XA 4NCNA 5BSUA 5KHAA 4LFCB 3NP9A 4A3SA 1G20A 4RYDA 1W0KA 1AS2A 2GR9A 4A8JC 2Z8XA 1S8FA 4GZ3A 2XMGA 2GYUA 4A92A 3O95A 3W6OA 5HUJA 1QR6A 1TO1E 2PO5A 3A2LA 3FLMA 3GGDA 2MSKA 3E7XA 1N5DA 3E5RA 3P0HA 1CUJA 2A7QA 1S2NA 3O8QB 4I5FA 4DLLA 3O0DA 1JEYA 4KFCA 4TVOA 3FUXA 3B3JA 1L5SA 1O77A 3SMVA 1JDBC 5F1YA 3CM0A 1H5QA 5A1TA 2A78A 1T9KA 1O9GA 3JAWB 1Q17A 1YVRA 2ZKIA 3U7GA 4LJ9A 4YV7A 4NATA 2BHSA 2HD4A 2XEXA 1Z17A 3E3LA 3TOCA 1CFJA 4ZV9A 2FMUA 2ZAYA 2ECOA 1UJMA 3NU1A 4ZO6A 4QDTA 3PDWA 2C04A 3YASA 1T6YA 4PN7A 1R8XA 1IEXA 2RAFA 2FFQA 1QGOA 4Y2SA 4FHCA 4DDUA 5K3DA 3TL3A 4KN6A 2OXCA 3FGNA 3N2ZB 2GM3A 3DJFA 4YJGA 3T5CA 5JQGF 5DRTA 5EESA 4CIYA 3EWIA 1EGQA 1XN4A 5JECA 1UAAA 1FNCA 3R3VA 4MUEA 3KV1A 4JXZA 4JYPA 1PT8A 4DV0B 1WE2A 3OF3A 3R7DA 2PZKA 3B7PA 3JQEA 4HDMB 2Z2IA 4IRXA 1MO4A 4KR9A 4QUKA 4E6EA 2BSQA 2RBEA 2WJYA 4FHFA 5A04A 3Q3EA 3STYA 5D3KA 3IPRA 5G3YA 1YI1A 2QYHA 1J0AA 4CJXA 2QW8A 1BRMA 3M6VA 5BW4A 3E9CA 3I23A 3N75A 1F8XA 3FUWA 3AY0A 4B46A 2C1ZA 2QD1A 4N7RA 2P27A 1PTJA 3TLKA 1G20B 4BAUA 4M9UA 4AO7A 4DQUA 2CL0X 3ZQ6A 4X1IA 2PEZA 3HJHA 2P3OA 1RJDA 2RONA 2ZTVA 2H4ZA 1JAHA 1U0LA 2F1JA 1BDBA 1SUWA 3R5JA 4PC6A 4G5SA 4ZI5A 1RI1A 3AJEA 3I5XA 3WA6A 4JH0A 4U2FA 3NHSA 1JEYB 2QTMA 4ZVTA 1VSUA 1SULA 2Q1WA 3P9ZA 4POAA 4UFOA 2QTWB 3O84A 3SHWA 2QLFA 3GNSA 3P1JA 4RSHA 2ONKA 4RK1A 3JWIA 3RFUA 1QSGA 4EVRA 3KDAA 5FFNA 1PWYE 3KCQA 1HDZA 2J31A 3F49S 4UDOA 5BSWA 4ZK2A 4A2PA 4DV1B 4AX8A 5L3QA 5JXGA 4G5YA 3DLIA 3UJBA 4OGKA 4MHOA 2HA2A 4HWPA 2C1XA 3CZQA 4R83A 4V0ME 3C74A 5EE0A 1DG3A 4F5ZA 4H4CA 2QVXX 3EIFA 2FWBA 4DMUB 5FA8A 2X86A 4BQIA 1OHHD 3AVTA 4IIGA 4A5SA 2JLZA 3A28A 2WG2A 1LNZA 1KGSA 5GJVC 2XXJA 2CVPA 2FG5A 4RPHA 4TM7A 3AETA 3H4MA 4MRNA 1RZ3A 4I9UA 1QU2A 1M72A 4YGYA 4DA7A 3CO5A 5KTMA 4CCYA 1F1JA 3ZGOA 4TQUS 4AUEA 4ZARA 1NN3A 1NVEA 4DIMA 1FDUA 1UEIA 2GN4A 1E7MA 2Z9CA 3DL4A 4RPGA 2D6FA 3EMBA 2APJA 5DGDA 1CU1A 1TADA 3ZW8A 1YTLA 2HRDA 4HOYA 4IUDS 1HTBA 2P30A 3OQNA 3OAAA 1Q15A 1BA3A 2VHTA 3EF1A 3KHKA 4OIFA 3WDKA 2ACKA 1YO6A 3AYZB 4IXTA 4YRQA 3CNNA 3LVRE 3OHPA 5E9AA 2VBGA 4XVCA 3N8IA 4XXHA 1NBAA 3UWSA 4ALJA 3WLAA 3CUTA 1CKEA 1S9HA 3A6LA 4I5IA 4R98A 3T7CA 3ZTYA 3V9AA 1D6SA 1KPGA 2ZREA 1QZXA 1DEXA 2FCRA 4PVCA 3K71B 4MQUA 4RKEA 3AONB 3NH6A 3UO8B 1VL2A 4JS0A 3L93A 4V2UA 1FE8A 4LZNA 2WKQA 2ZATA 1CUDA 2AC4A 3KSZO 1JHQA 3PI6A 1BXGB 3IUMA 5J63A 2OK7A 3B2QA 3MWJA 4LZWA 3FUTA 2JZNA 5WRFA 3TX6A 4B85A 2WB2A 2P0EA 3P0JA 4RVOA 2VAXA 3LUPA 4EHBA 4FFDA 5C1PA 2CDNA 1OGJA 2IUSA 1GNRA 3T5DA 3N7AA 1N5IA 4HJRA 5FQNA 4U8HA 2VC2B 3WWYA 4BRUA 3GT3A 5TE9A 5TR9A 4RBNA 5F7XA 3U3DA 1DIAA 3IUEA 2FNAA 3TGPA 3NT4A 3NOXA 3ZHQA 3K0BA 3H4TA 4ZAZA 1JFTA 2Q1TA 3V7FA 1M7HA 1R4MA 2G36A 3ZWMA 4NAVA 1ZK4A 1D1QA 2P1RA 3MJSA 2HSGA 4PLFA 1E18A 3M4ZA 1K6JA 1RWWA 4HN2A 3KKKA 3AETB 3JQFA 4RIGA 1PL8A 2CK3D 1HURA 1SB9A 2AC7A 1WTCA 2ZS9A 4DZRA 1APBA 4FIZA 1A9ZA 3Q8KA 3B6MA 2XNSA 5HKKD 4YCAA 3N9IA 1R9GA 2JRLA 1GQFA 1GQRA 4Z3KA 4IG4A 3LWNA 4LXTA 4ANFA 3B6ZA 3ZQUA 3F5FA 4WPGA 4DBZA 1KU6A 3DGEC 4KAFA 3KZNA 4TMKA 1P77A 3KALA 1EWKA 1KYVA 2L42A 4JI7B 2RE8A 5KQSA 3FDIA 3G8AA 4NCHA 3DOOA 2AFVA 3LNTA 4ZOLF 3WNBA 4OFXA 4QNRA 2OHJA 4PNHA 4Y2UA 4AD8A 4CN8A 3CRQA 2AJLI 2VP9A 4IJMA 5ICSA 4H15A 4PRLA 1FDOA 3JR3A 3KTAA 5KKCA 4D3DA 4UOEA 4DQDA 2H08A 4QSHA 2Q6IA 1FX0A 1T3TA 4H7JA 1CUWA 3DMTC 5CURA 3AFGA 3CMCO 4BTLA 1BEUB 2BR3A 2GCNA 4NL4H 1ZJZA 2EF0A 3OI7A 1TKRA 3NHUA 1Y8QA 4DJJA 5C52B 1F7UA 3LQFA 4UJ3A 5IHXA 1BDIA 1ZYUA 3O7MA 1M6WA 2F90A 4H1TA 5C8DA 3BWBA 4X1YA 2GXUA 1JXAA 2JJ1A 4JHXA 4Z1OA 3JVVA 1M34E 3SHVA 3MGCA 3DXYA 3W9SA 1P6XA 2HDHA 3M7IA 4HWRA 4DNFA 3L1VA 5DHTA 5IAOA 1V25A 1IOWA 4RA6B 3L4JA 1FXUA 1E8DA 5HJ2A 1OBVA 3O9ZA 1C7IA 1FVHA 1RJGA 3I4LA 4WDQA 1SC4A 3L77A 3RYCB 5IJ9A 1M1YA 1R4MB 2GWHA 1QBKC 4E7PA 4TSFA 1BE0A 1YBVA 4E5PA 4PY2A 8ADHA 1IUNA 1S1CA 4OHXA 3ISVA 1SCUA 4RS4A 4KPFC 3RYHA 3I9JA 4BVEA 4O3FA 4F2DA 4NMLA 1ISPA 4MX8A 4R4JA 5FUYA 2EKQA 1WEKA 1DAPA 2GKSA 3WG9A 2PT6A 4I8XA 1HMYA 2CFTA 3DVSX 3EGVA 1FFHA 3LVBA 1YASA 1UZMA 1E4VA 2M6SA 3IAUA 2HOQA 2EFHB 4ZP1A 2LW7A 4PFJA 1KO1A 5F5LA 1MG0A 2QTTA 2ZSAA 2XQJA 1POXA 5IUJC 2V97A 5EKUA 1M9NA 3OY2A 4IDOA 3VJKA 5A3JA 1V39A 5KYKA 3RTBA 1C3JA 4O1MA 4YMTA 1FYEA 4J8PA 4OJNA 1IIRA 2BUAA 1T3LA 1PYOA 4E4YA 3KTAB 1EVLA 2PGJA 3CB4A 4TV8B 3ZDAA 1XD9A 1PS8A 2QXTA 2WVJA 4OBEA 5E9JA 3VDXA 5DGTA 2A7XA 2L82A 4QGAA 4Z6KA 2G4VA 2X2OA 1XZAA 3P5BA 2IYRA 4QNMA 3CEJA 3ORSA 1G3MA 5KDLA 3ICOA 1NUQA 3V4LA 3CRVA 3EQZA 4NU0A 4YPVA 2RGNA 1H0RA 2D3WA 4FMCF 2PUGA 3K5PA 3NASA 4HNRA 4MVJI 1G5FA 3TZHA 2B20A 2B1JA 2ZQZA 9ABPA 4XX0A 3RVKA 3K6KA 1N1DA 4WCFA 4L8VA 1N5RA 1P60A 2D0PB 4YXWA 1JZQA 1IK6A 1MJGA 2JI6A 1DXOA 3KKPA 2NT4A 3OLQA 5AW7A 1SK8A 2WIBA 2PKEA 1OT3A 4G37A 3ESAA 1SU4A 1FQOA 1ABFA 1L5QA 1W36C 2IPAB 2CXNA 1KHTA 3CR8A 1EEXB 5DYNA 2FWRA 5B7GA 1KRWA 4I1VA 2PKXA 3H1EA 5IJ9B 4LF4B 2P9ZA 4JT9A 5JAOA 4AY4A 2BD0A 7REQB 4QGSA 4J16C 3DM5A 4KQ9A 4QTZA 3D6TB 3OCZA 1R00A 4I2VA 4PG6A 3ZDFA 4DV4B 3D2CA 1SCUB 2EQAA 4FYPA 3WAJA 1SXJA 3HUEA 3EPJA 4IG9A 3RU7A 4B3RB 4ZJUA 2OCBA 3H8SA 5JG7A 4MVJM 4DDWA 1YCDA 4S0XA 3CLRC 4HGZA 2EL7A 3G2HA 5EXXA 1ZMTA 1QF6A 2EZ9A 5DOVA 1JKFA 1ZVKA 2C96A 1FS6A 3DM9B 1OUMA 4G1MB 4CI9A 4X0EA 2Q2NA 1SKYB 1XTJA 1ZGAA 3HXLA 3KOUA 4XD7A 2ORIA 1JBEA 4LZAA 1W581 2B30A 3RC2A 5P21A 3SS8A 3NTUA 1QAOA 4BWYA 1U2DC 4JGIA 2I4IA 5IKOA 4E2FA 4ZT4A 1WKCA 3ABSB 3ZDQA 2AN3A 3ZS9A 5HQ3A 3ZU6A 1ZIOA 2P2YA 5JPIA 1N2ZA 1EI9A 3RC1A 4INPA 4Q4AA 3DT8A 4KO2S 3TLGA 3V97A 4CMJA 1YZQA 3QKRA 4B8YA 3QE4A 4IXDA 4QDOA 2ECFA 3EMVA 2B9EA 1LPNA 3DFMA 1WV0A 1QVVA 3VO2A 2ZUVA 1I2MA 4RMJA 3K53A 4NBUA 2C5EA 2DHEA 2Q5FA 1PWEA 3KFLA 1CK4A 3RUDA 4EHLA 1Q0UA 4UPVA 3TG8A 2VJBA 3OE1A 4XX0B 2HLHA 2V9PA 5D1NA 5K8VA 2ZR7A 5E3IA 3JRNA 1I6MA 1LW7A 4EBFA 3VVBA 2BKUA 4ZALA 1OIVA 2W2TA 2F3PA 4ZAVA 1PWXA 1AGRA 1MT3A 1YBFA 2H1RA 4NBRA 2M2IA 1V7ZA 1QCYA 3RC9A 3V4PB 4ZMBA 2WPDD 3VR4H 3REFA 4LZJA 3PICA 1N1GA 4FFNA 2PUDA 1QP8A 5BORA 2G5GX 1CQIB 3PL5A 1QWSA 4LG1A 1FJ2A 3AVUA 2J9FB 1ZAKA 1KAHA 1J8YF 4OKNA 3WGUA 2G5TA 2Y1DA 1XTVA 1FMLA 2O1SA 3HNRA 3ILXA 3IDZA 3MAJA 3MTEA 2P5YA 4HGQA 4F6CA 3VJMA 2C7PA 1DAHA 1K97A 2D4AA 2C88A 1H2XA 2OAQ1 2SKDA 4KV7A 1WW8A 1H8EA 1XUOA 2C94A 3C4VA 4GBJA 3VU3A 4BQSA 2GZHA 3OZEA 1P9NA 3AJDA 3EFEA 5C31A 3KO8A 4QC2A 5FTNA 3WC4A 1XPJA 4PBSA 1GEEA 1D8AA 4Z4IA 2Y66A 3BILA 1KAMA 5AW4A 2MSDB 2J45A 4HQRA 5K3CA 1XTRA 4Q01A 4LOJA 1ZOIA 1R3UA 1PUXA 1QVRA 2GGSA 3H5VA 4NENA 4ZU3A 4RSMA 1UUFA 3EB9A 4JC0A 4LZPA 2WIAA 5KVQA 2F43A 4TZ0A 2OFPA 5HQ3B 1PJRA 2DSTA 2J5XA 2QJTA 1D9ZA 3TLGB 3ZX4A 3WIDA 2NG1A 1UM9A 4XQ0A 4XB6B 1JJAA 4B4KA 3SFZA 1ZGHA 2CVZA 5KYUA 2P2SA 3OOWA 2BISA 4D4JA 5B2EA 5BNFA 3QRWA 5FNVF 5K6RA 5HBRA 10MHA 1SC1A 1Z12A 5JVDB 3OOJA 3MMSA 3OJ0A 4HAYA 3ACCA 4MKZA 5AH0A 1JYEA 1DQRA 2ZYHA 3DPUA 3MUNA 1EDBA 5F2NA 3TM4A 1UDCA 5ALHA 3DOIA 4M53A 2L18A 1BGXT 5AVVA 1A9SA 3A3PA 3C3AA 3NYRA 2XRFA 3L02A 3KEGA 5FWYA 3ZDEA 2W8ZA 1LRKA 3M49A 1GPUA 1NAIA 2H1FA 4NZMA 3UF0A 5HM8A 2XXAA 1TJYA 3WGZA 3P9XA 3RAGA 1A8QA 4YAWA 2J5RA 3A4MA 4LPSA 1J2RA 4MW5A 1C9MA 2PZMA 4BX2A 5BSKA 2DB3A 3JAKA 4PN3A 3DYBA 2ZIWB 3P9NA 1UK8A 2XGGA 4Q3CA 3KQPA 4QUEA 5AW9A 1NN1A 3PDIB 3GHHA 4G1FA 4OI2A 1JFLA 1NI5A 4BCBA 4JR2A 1ULSA 3KZVA 2AFIA 4U6NA 1XZMA 2WKRA 4RPIA 2D59A 3LWDA 5GOZA 2E48A 4F91B 1ZKMA 1CZLA 1F12A 2QI9F 2C9CA 3RHZA 3CF0A 4YRMA 1WCWA 1P72A 1G21A 4L9SA 4ON9A 1VP9A 2XYRA 4PCLA 1P2UA 4V0QA 1WVGA 2G5PA 2JGNA 2OHFA 4CTKA 3IX7A 1ZXBA 4JCOA 3LQYA 4UPDA 5FBHA 3UHFA 4HYTA 3ZCQA 4XZ3A 5LDDC 1ZUIA 2C9BA 4B2IA 3SC4A 1B93A 4ESOA 1KJNA 4LMBA 2F43B 3D6VA 1MB2A 3IOYA 3OFNA 5DLEA 1XPOA 1IXZA 2HDNB 2O5RA 1QFSA 5LOVF 3BH7A 3E48A 1CQJB 2X13A 1UM9B 4FGWA 5AKLA 1FNDA 1J0DA 4MWSA 3DHNA 1TA4A 2ZIUB 3P9SA 1GUYA 3PVCA 1KK3A 3S0JA 3KB8A 3NUZA 4DLNA 3FRIA 4IBOA 3ZX5A 2J9ZB 1PZXA 1ZUD1 4NJMA 5C4IA 3OEHA 5JMWA 5K9ZA 3QBTA 3BXFA 4Y2GA 4GGPA 3O47A 2G09A 4KXXA 5G02A 2ZRLA 2GPAA 3RFCA 3R6GA 4YRJA 2Q8QA 4E5UA 2CCJA 2P6RA 5DBHX 4A2WA 1V5GA 3D8RA 5BN4B 4YCNA 4W5QA 5FWYB 1KYYA 3IT2A 3QPCA 4CF3A 1ABBA 5D8DA 4S05A 2HSJA 1M0SA 4XYMA 3RM3A 3UKDA 4KE8A 2RCNA 2ASVA 5AJUA 4Q82A 2Z5LA 1ZISA 4MICA 4HX5A 4NBWA 1AF7A 4OMUA 2YY6A 2O50A 4JJ8A 3KBBA 1NLYA 2BDUA 5AXBA 2J9YB 4MPTA 3UHJA 4YMHA 3DAFA 3EXFA 4I4TF 1RDFA 1CX9B 2AFIB 2GCIA 1QYWA 3KUUA 3LF1A 4IZ6A 4PYLA 2RI1A 1WSAA 4KO3S 2PLRA 1XTUA 1JTFA 1DCTA 4I08A 2GOYA 2ZT8A 2P68A 1G21B 4YBRA 4BKOA 4LTMA 1MO5A 1XI2A 1U65A 2JVJA 3SDBA 4ZGGA 5DNCA 3RVJA 4R1QA 1C7RA 1STOA 2C5SA 5DNDA 4GMDA 4EYEA 3ER8A 2W0MA 3OZGA 3SJUA 1AKVA 3OQVA 5BSMA 1G7RA 1O5TA 3OE7A 3Q7QA 3VHQA 2HU7A 2QZJA 3WLOA 1C3VA 1Z5ZA 5FBZA 5LKRA 1WBJB 4UEWA 4IQ0A 1E2JA 1V3TA 2ZBDA 1JB1A 2ZTMA 3GEBA 4U7JA 1JGTA 1OVGA 5BVHA 2DBQA 2E6KA 4INOA 3WIUA 2IP2A 1P0FA 4FT2A 1AGPA 1CEXA 1MB3A 4X6XA 3N0VA 2NTYC 3ZR4B 1TF7A 5K6TA 5A3QA 3QSGA 4NJMB 4P6VF 2H16A 3E7PA 3WIVA 4XIYA 3OOEA 3R7BA 1Z5WA 1VHJA 5AUOB 2FFRA 1L2TA 4KBYA 1OROA 2OCXA 3DEYX 3ON5A 4V24A 2JK1A 4GNKA 2AVDA 3Q8WA 3BH6A 5F7JA 4GIBA 5J4VA 4GE3A 1N9GA 5CW1A 5DHRA 4AICA 3HACA 4MW0A 5G4KA 2RK3A 3UH0A 2CJXA 3G13A 1LTHR 3EXHB 4L2IA 4X97A 2ODNA 4WWHA 2VP4A 3TGWA 4KHPB 3B89A 2XA9A 4QPPA 4G0QA 3I12A 2JLBA 1D0SA 2AH5A 4YT4A 2IYZA 4B7ZA 5FV4A 2EFEB 3B1FA 3COWA 2VF4X 3KLOA 4XCVA 3EXFB 3QLEA 5FDFA 5EMHA 1LWOA 2CMFA 3VH2A 1SVSA 4NBLA 3W78A 3GN1A 1TQHA 2KLHA 2GI4A 2P2ZA 4IS2A 3G0GA 4FFVA 3KEFA 4HFJA 4ZCRA 1A8PA 4PGAA 1O94C 1YNSA 2GD1O 5K0ZA 1Z7GA 5TC4A 4DV7B 4YQEA 3M8KA 4CUJA 4C03A 1WSBA 1KHHA 1CJCA 1VIMA 3JWGA 4PAQA 1JA0A 3P32A 3EISA 1WQ1R 4TRMA 3RVRA 3EX7C 1CF4A 1I2AA 4KV9A 4OA5A 3UG6A 1W9MA 2O5VA 3W77A 3ZBPA 4OXNA 1M8FA 4HBZA 4JYZA 2XUGA 2XAAA 1U1EA 3KZXA 2I4OA 3LG2A 4OTZA 4DDHA 3PLAE 5HGJA 5BVHB 2Y05A 1U98A 2YNMA 3WMEA 4AZVA 2ZZMA 4Q7MB 4QXRA 1CUSA 5CLHA 3SG0A 1K2WA 4BFYA 1NQTA 1X1DA 1GA4A 3QKSA 1E3MA 1ZH4A 2XV1A 5E6UA 3RUEA 2AF3C 1XE3A 4DABA 4U7PB 4DJEC 2NO0A 2EYUA 3TUJC 3FOAA 4HLUC 4DM4A 4CMCA 2HMAA 5COAA 3CZ4A 4BO4A 1EWYA 5HJ5A 3TQIA 4BV2A 3I6MA 2AG0A 4LJSA 1N9GB 2IU3A 1F0YA 4ZKDA 2IF2A 5G4KB 4D42A 3DEHA 1BQEA 3ZE9A 5JMOA 4L2IB 2FN8A 3K8ZA 1EX7A 3KEOA 4TYPA 4LX8A 1URPA 1K8YB 1D9XA 4O4JA 4LKRA 3K32A 4PC2A 5EKDA 3BXEA 5H4GA 4G6ZA 4JGGA 3R40A 5G41A 3HVUA 2PYDA 4ZU1X 3FYUA 5CH8A 3ZHVA 3TLBA 3ZQ4A 2CJPA 4H7PA 4XM1A 1YBMA 1E0KA 1K86A 2O3UA 5A05A 4P4LA 3KYBA 1EDEA 4J2OA 5A0VA 4PQGA 2W6JD 1X3SA 2C99A 2OCIA 5HGXA 1O6CA 1J8DA 1U3DA 3MRVA 5CYPA 4EHJA 1L4MA 4J7AA 1LI4A 3EBPA 3HXOA 5GWXA 1KXZA 1JR3A 2GX6A 2F3UA 2YVKA 2G83A 4BCDA 5KKNB 2NYAA 2P65A 2PRJA 4G67A 3DR3A 3TOSA 4YT8A 2F1OA 1YKSA 3N0WA 1VPTA 3UHAA 4BGEA 1W8DA 3M81A 3X1ZA 1U3CA 2WYHA 3Q6MA 2WP0A 4A8TA 1PFUA 3W4KA 2FW9A 3VYUB 5BOSA 2IHYA 3U49A 5BSVA 3TLXA 1KO5A 1E7SA 2P3LA 4KB5A 5JH7F 5KOHA 4QT0A 4L95C 2CKDA 2P75A 2Q21A 2RBGA 4DLPA 5LQUA 3QKSB 5DCLA 5KVAA 4HGRA 2CDBA 3D1JA 5C18A 5E6UB 4L74A 3NHFA 1Z29A 1DBWA 1KVSA 1PDVA 4DMMA 1R10A 4M1TA 2WF9A 3SHTA 5KMGA 1U2PA 1DX4A 1IWOA 1U2GC 3LRXA 3RVNA 3EIXA 4R9VA 4A2QA 5HG0A 4BVBA 2YDYA 5F12A 3K70D 4ZQCB 1V5IA 1FUUA 2P6PA 2VSXA 1WPRA 3IE1A 4BVJA 1E0DA 1SRQA 1GZUA 1RWVA 1TGVA 2CB0A 2R1UA 3C24A 5CXSA 1Y3CE 1AB5A 2XRZA 4H77A 3UANA 4HWSA 3VOBA 2QGZA 4C0LA 3GY0A 1NNUA 1Z07A 1F06A 3FLAA 5AHWA 3ZE0B 3PRJA 3U3JA 4ZT2A 4Y1EA 3TOZA 4AJ9A 3IPXA 4BNFA 5C5CA 5JYDA 1U28C 1P4GA 2FUKA 3A04A 4H60A 1U8XX 3LO5A 4HQ0A 3ZWCA 1PG2A 1U7TA 2WVHA 5CB6A 3LZ6A 3JQPA 4FC6A 3I3OA 2H48A 4AP5A 3K09C 1OD6A 1SNYA 4DLTA 2V4ZA 5ECDA 2XWQA 3S8EA 1GCGA 4WEOA 1HRDA 1XK6A 2IQ5A 4JR0A 2P35A 5ALRA 4DHEA 4FFMA 1FVOA 4ARUA 4I1YA 5HUHA 4Y6GB 4CXMA 1G8PA 5CEFA 2OXRA 3LC0A 1RACA 2D3TA 1JG7A 4NE2A 1FMCA 4FGKA 5KJ6A 4K6MA 3C8ZA 4QHSA 2Q3EA 4KN8A 3TKLA 3OIVA 1KE1A 5JWRA 4ZCSA 1B26A 1GUFA 4DLYA 1IPFA 1VE6A 2FN3A 2VUTA 2OFFA 3OZVA 3RADC 1OPXA 1T9GS 5KOHB 1DAGA 5HQJA 3GVCA 3SVTA 1NI3A 2R2AA 5DGCA 2E1PA 3NNNA 4JUDX 2ZRNA 4RF2A 1QC5B 3B9PA 2REOA 2CBXA 4EVSA 5A7FA 1Q0SA 2N0SA 3PVZA 4P9NA 5FOSA 1DWQA 1YU6A 1EXDA 1TLTA 3I58A 3VR6D 2XGSA 3GFSA 1V16A 4FGUA 3PCRB 2QVCA 2ZT5A 3JYPA 5ED4A 5AOAA 3CSSA 3NYWA 5JT1A 1KIMA 1NC1A 2QMYA 1ZOOA 3F6EX 5KWSA 1KFBB 1KZYC 1XCBA 3THWA 1NBHA 4ZZ3A 1HE8B 3K0HA 5EPOA 5E2AA 5CIYA 3R8XA 3OT5A 2PX3A 4W63A 2CLFB 2YXPX 4BEVA 2C0PA 2HIMA 2P62A 4NCXA 4XWOA 1P1KA 4D9NA 2E21A 3BGIA 5BW6B 4GECA 3WZLA 5FX2A 5KPDA 1IONA 2XXBA 5AIAA 1KORA 1QIFA 1SCBA 3OJOA 3EQ8A 4HXGA 1YU9A 5EMMA 1QF9A 3KSMA 3RNLA 1ZWKA 3MB8A 1VCOA 2V58A 3OTGA 1N8TA 1SUPA 3LA6A 2MYUA 2FDRA 3I9NA 3RIGA 1RXSA 3QY0A 4G8BA 4WNCA 4N7JA 1YOVB 1N1EA 1AGXA 1M33A 1W30A 4WTOA 4CF6A 4ZXPA 2HFJA 1LFDB 4BMNA 3O8LA 5KB3A 3FSGD 2NTJA 1A7KA 2OXFA 3L1HA 1NN0A 3ORRA 3KXIA 3UV7A 3HCDA 5JSKA 1MB4A 1Z9BA 2J4CA 2YC4C 4DV6B 4X8OA 2C4VA 3FPCA 4ZREA 2PGOA 2Y93A 1I4OA 3HUFA 3QLTA 2Y77A 3E9EA 4JSRA 2AN1A 1XZGA 1BMFD 1Q14A 3IQDB 4PYRA 5AR1A 4PLGA 3DP7A 1L7RA 2J0UB 2XTZA 4WOCA 1YD7A 1XDBA 1YJQA 3FBTA 2J1LA 5ALEA 1EGAA 1Y1TA 2P9BA 4I1OA 2ID8A 3CGWA 3IJ5A 1N2OA 4J1QA 4LXYA 4B33A 4BE9A 1E0JA 1K8QA 1SKAA 3A0UA 4IIEA 4Y6LA 3AM5A 3CUEF 2A58A 4XIFA 1I0IA 2JHPA 3HUTA 3U40A 3WQQA 1V16B 4XOUA 2I2BA 4INZA 4GQAA 4ZN6A 2HLNA 3HCOA 3ROZA 1PT6A 2IRWA 1BE1A 2B4QA 2G1JA 1O9BA 4G5GA 1RXVA 2H2WA 3AHHA 3PHJA 2JIDA 4EUNA 2FWMX 1IRIA 5D00A 2JFOA 3THWB 4QECA 1Y5LA 4C6HA 1ZI9A 2DSNA 2IXEA 4IIXA 5LD2B 3PWKA 4X66B 2AEMA 3C4QA 1P6QA 4G65A 4BDSA 1X87A 3P45A 3PJFA 4QPCA 5F9HA 1QCDA 3HKDA 5EJ5A 2F8SA 1NIPA 3A6GA 3B5IA 4FNGA 3I37X 2RGWA 4IO0A 3ZVLA 1LSSA 4NPAA 4PLPA 4NULA 3TZKA 3RJMA 4FIDA 1BFUA 1YQ9A 2JATA 3NX4A 4M99A 1NMSA 5A71A 3B3FA 2EFGA 3HRIA 1UJCA 2KYRA 2H0RA 2J3DA 1RYZA 3DDOA 3KXPA 4OI4A 2VXCA 3AQ4A 5FR1A 3Q3HA 1WXGA 1TCUA 2GK4A 4YWJA 4H08A 3TZLA 4ZEVA 5FTKA 3MBIA 4MDHA 4YMGA 2D5IA 3WQBA 2Z2YA 4J7CA 3ACBA 4DC9A 5FPKA 4IF4A 5KO2A 1RTKA 3C45A 4GF5A 1AN9A 5FUXA 3AF6A 1EJ2A 2MSCB 4KXYA 4QXOA 4UAJA 2IHNA 2VPYA 3LBHA 1S2LA 5CPFA 4DZZA 1GHTA 1KE2A 5K0LA 1YKFA 4Y6RA 5C4MA 1BJRE 5IYZA 3IAAA 4OB8A 1YA4A 2VWHA 3G1WA 3I1JA 4KMOA 4WZZA 4CM7A 4LF7B 3I6QA 3EVBA 2VYFA 2HBYA 3KYJB 2WW8A 4Y2TA 5E9WA 2WHRA 4KGXA 3G2IA 4ODIA 4KYIB 1RWXA 3DBRA 2GPNA 3IAM1 1KC3A 2IOYA 1ZH8A 3KVNA 4N39A 2P2NA 2AZ4A 1T5HX 1EE9A 1O9HA 5CD9A 1O57A 4M7PA 2JGKA 4DR1B 3KKQA 3CW8X 1SAYA 3E6AA 4W99A 3VR5D 4R0NA 2ZTHA 5EPUA 5A1JA 4EF6A 5I7UA 4PYOA 3CBGA 3K0AA 2SHKA 4A0GA 2MYNA 1QP0A 2UZ1A 5DEOA 5KQPA 1W93A 2FPLA 4GYYA 4WJLA 1HQYE 5JFTA 3RFVA 2WHPA 3OMWA 3I2JA 3ED1A 1ULUA 3VPDA 1B43A 3BTSA 5EJ4A 5HRUA 3FWKA 1NNSA 5D6NA 4Q9NA 4TYMA 1I1NA 1SHKA 4A6EA 5AXAA 2B0JA 3H9BA 3HKDB 4XLZA 4NU5A 3CNHA 1S7GA 1W29A 4YFVA 4ZT6A 3ZY6A 1LQ2A 4YJ3B 3LO8A 4Y0AA 2AG6A 1RQ7A 3CNOA 2DFPA 2XDWA 1T5IA 1NUUA 4V2IA 5AVOA 5IAGA 3K2IA 2Q4RA 1PR3A 2PKQO 3WYEA 1PZFA 2MJLA 1I2ZA 2A84A 1Z0SA 2LE0A 3GFVA 1UJBA 4H3VA 5LIPA 5TLSA 1YH3A 1U2ZA 2ZCUA 4N0DA 4TV9A 3TAHA 2R48A 4DCTA 4B80A 1Z4IA 3HY6A 3H5WA 3AUKA 1DBSA 3N8KA 4CM6A 4EX7A 5LMUB 3KS9A 1K4KA 1H4QA 1TNDA 1OLSA 3G7NA 1EQUA 3W5CA 5IXJA 2C4WA 4U7WA 4PCUA 5TX7A 3OG9A 4RNCA 2XTJA 5IYZB 1QOQB 4AKEA 3T5PA 1OSNA 4LXQA 1W46A 3BHIA 2D2VA 1GITA 3ZS8A 2C8JA 1G5PA 4R71A 4EUSA 1ZLYA 3KPVA 2J3IA 4MYRA 2C7GA 2HV8A 4BRWA 4EH1A 2UVQA 4BGIA 2AMVA 2E3JA 3INNA 1Z8NA 4OX9B 4BV9A 3OC0A 4RDCA 3ZH9B 2VPQA 1IC6A 4B76A 3DYIA 3QTBA 4DMGA 4AX4A 4FONA 1BCSB 3K0AB 3EVAA 2UZ1B 4GZMA 1EA5A 1NC3A 1NBMD 1ZU4A 2I34A 3IERA 2ZM5A 4QOGA 2W00A 2WHPB 1S2OA 3FI9A 5LZ5A 2ZUTA 4B6QA 2X76A 5K3FA 3TSOA 2FW7A 1AQIA 2ENUA 4LQLA 1H6DA 4JLAA 2UDPA 2XTAA 3FETA 5AM1A 2GVZC 1VSTA 4C0SA 4F9FA 1Z6AA 3P2EA 1J24A 4XFJA 4Z2AA 3AZQA 5JCJA 3TSAA 1Q44A 3INYA 1BHO1 5THKA 1GCUA 5ALXA 1KK0A 4FNMA 1DWUA 3G49A 1P1IA 2BKEA 4DUYB 3MTGA 2Q4TA 4PAMA 3N6RA 4REOA 3IUBA 4OJMX 1T9CA 1XRLA 4R0VA 4RKQA 3U44A 3SCZA 1VLZA 5E3HA 2ETXA 4HRAA 3MGKA 2JIZA 3JWEA 4TV9B 2ZJ6A 1KDZA 3BTVA 4RZUA 1N3IA 1ZS9A 4QU5A 1O97C 1UJ5A 2JFGA 1ECGA 3VR0A 1XWFA 4BB6A 4OFZA 3T3NA 3A1UA 2QRPA 3HR7A 3F7OA 2G71A 3RK0A 4D4LA 1N2GA 4ZCQA 1E98A 1VIYA 2A4MA 4LSGA 1QQBA 1H5NA 2NLOA 3PGJA 2GYYA 2HMYB 4L8GA 4OXXA 3ODGA 2GO1A 1PLLA 1OZHA 1UOOA 3DKIA 3H99A 3Q15C 4D4HA 4DLSA 1D0VA 4FDTA 5JZSA 2QI9C 2BMFA 3R3SA 5CXQA 5A3VA 1OIWA 1CJTC 5D84A 1QJ4A 2IS6A 3NIWA 3QE9Y 2W37A 1ZR2A 4D0RA 3ECCA 2B34A 4WOBA 1E32A 4DCJA 4D9JA 3PXBA 4OQZA 3MD9A 5K6AA 1IHXA 1PQYA 2CXQA 2R751 1FZTA 1ZUHA 2HXGA 2IWHA 3E82A 3UUEA 3P2OA 2QZSA 1PL0A 3D7RA 4XVHA 1WVIA 2EW2A 2PL9A 4RETA 4WLUA 4YMWA 5JHGB 1LI5A 1T26A 1E9RA 2G88A 3I9OA 3PF9A 1IVYA 1ZOSA 1DXQA 2FFAA 4PQRA 4R2IA 4R2JA 4BNVA 2XH8A 3DFZA 2AK3A 5B12A 5TIIA 3HI6A 2O0JA 4NBVA 4JELA 3BOSA 1AKWA 1XZ8A 4RIEA 2O06A 3I01A 3ESXA 1T1RA 3R6TA 3HFJA 5JBQA 1IQUA 1N3BA 3T1HB 1SXQA 1UMBA 2BKVA 3OF5A 1TAQA 4PWYA 2Z2KA 4BJ3A 4R1SA 4TROA 1GG8A 4FUQA 1MA3A 3ETLA 3HJFA 4ZI3A 4ZVNA 1QNLA 3SNHA 3AOEC 4F4DA 5F21A 1YDEA 1WSDA 3UMVA 5A9SB 2GJ9A 4F85A 1A3CA 4H3HB 4M3NA 3TWOA 3QIAA 1RRMA 1IDN1 3UCXA 3UYLA 1EUYA 1MGPA 1JMYA 3KDPA 4YA6A 3U44B 4RVGA 1Q0QA 4N9WA 4DJFC 4LGVA 2ZUWA 1KZ9A 1M73E 2E4UA 3NAMA 4DAOA 1BDHA 1TAHA 4RD0A 1G63A 1NMZA 2Y71A 5ALIA 3WGIA 3QVGA 4M89A 5EHQA 4ZAGA 4DLZA 4BV8A 5C7OO 3AR8A 3D7MA 3SBOA 4ZYZA 3VHXB 1JL3A 1I8TA 4M55A 1JIXA 1YZ3A 2EDCA 4RTRA 3TLAA 1HZZA 1UZUA 3HGQA 4BQPA 4EAQA 4JQOA 4LVUA 3F7NA 5GOTA 2YVAA 3GMTA 4TXJA