3KQNA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
437
structure length
437
Chain Sequence
b'SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
total genus 154
structure length 437
sequence length 437
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqnA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqnA01
4KFSA 3TBKA 4L9WA 3GJ7A 3QKRB 5FBWB 1TF7A 5TB5A 4ARZA 1TPZA 4Q4AA 1W44A 2O5VA 2GJ8A 2ZE8A 4C0LA 4DUGA 2WZQA 3AVQA 1LY1A 1T9HA 2GA8A 1ZINA 2ZE7A 1KHTA 4UJ5A 5TDHA 3RSOA 1E69A 4B6EA 2DFTA 4V0MA 4C0JA 2JGNA 2GEVA 4RFSA 4Q4HA 3LA6A 4ARZB 3SZRA 5J40A 5JLJA 2G9NA 3I4LA 2ZM5A 2FPLA 2QG6A 4Q47A 3U7FB 5AUOB 1M7BA 5C1BA 2ZJ2A 5C18A 2QP4A 4AWXA 4Q1BA 1A7JA 3ZQ6A 4DUGD 2VIIA 2A5DA 1RFLA 3OE7A 1KSFX 4BFSA 1N6KA 3TSOA 4AYTA 4A82A 3K0CA 3E2IA 4Q4HB 1RVDA 2ZEJA 4A8JA 1Z29A 1YE8A 4N3NA 5EZ5A 1UADA 3U3JA 2O8BA 3WYAA 4PC7A 1LVGA 2A7QA 2VTKA 4ZO4A 5IK2A 3PV0A 3KJGA 4Q21A 2WOOA 1E9EA 4URWR 3DL0A 4LBZA 2B6HA 4NBSA 3VKHA 4KHZA 1P9NA 3W9YA 1BOFA 1R4AA 2C95A 2CVHA 4LJ7A 2H17A 4IXMA 1T6NA 3W8NA 2J0VA 1KK2A 2A9KA 3HYTA 1QHNA 2ODEA 4A8JB 1WA5A 3OE7D 2E9SA 5FPKA 2O8BB 4RZ3A 4G3XA 4G5OA 1X6VA 1NMXA 1R5BA 3OIWA 5KDDA 1PVOA 2OHFA 1CULC 1KSHA 3NDPA 3K0EA 2D06A 5J4LA 3NC1C 5IK2D 2AXNA 3B60A 2V7QD 4GT1A 4JLMA 4L16A 5A5GA 1N5KA 5FOVA 2FPKA 2AKYA 1TU3A 1KI3A 2JJ1D 1ZAKA 2R2AA 4LJ6A 2NZJA 3WMFA 2FPMA 2RHMA 1GL7A 1N2CE 4GP7A 1KTVA 3C8UA 1ELOA 1G7SA 2ORIA 2AHOA 3NHBA 1WB9A 3A1VA 1JNYA 4LDJA 4EKDA 2OT3B 3JZMA 4IDQA 4Q19A 4RD4A 3CZPA 4MYUA 1NL3A 2ERXA 4DDWA 2EFEB 4FCTA 4HB0A 3A1SA 5E4FA 3H2YA 2PEZA 4CF7A 1R2QA 3B1VA 1G5RA 4BLRA 2XSZD 3QXCA 4POAA 2NPFA 5FTKA 3TR0A 5LPNA 1S3SA 2VRWA 4FXPA 5K8LA 1ZIOA 2FFBA 1ZU4A 3OHMA 4FD2A 2X2FA 3A1WA 2VLIA 1TF5A 4LBVA 2GRJA 4L9SA 1YJ5A 3D3QA 3PEWA 2VQSA 2ODWA 4O0MA 3KQHA 2YNMA 4Q9KA 4P33A 1G8PA 3VX3A 5HCNA 1T5IA 1C1YA 2D62A 4I1OA 4IOMA 1CJVC 2FFHA 3G82C 3KQKA 3GD7A 3X1XA 1G41A 3KXLA 3KQUA 1FL9A 4Q4LA 4QGFA 2FNAA 1GRQA 1KI2A 4FMCF 3ZLJA 4TYYA 2C03A 2Z0MA 1MKYA 4D80A 1G6HA 5GJVC 2QGZA 2ZRKA 2OEPA 4L5BA 5IRCD 4MRSA 4CEJA 3QVVA 2JA1A 1G20E 3KJEA 1H8ED 2ZPTX 3NHAA 3K1JA 4PO1A 1SXJE 3PEUA 3EX7C 3CRRA 3WHLA 1IXRC 3OIYA 2WJVA 4EDHA 5DNYB 3B9PA 5JHHB 4LGMA 2FX3A 1NVWQ 3QSYA 4NZYA 3CUEF 1E9BA 4D0LB 1FQKA 4EAQA 2IYZA 1XCGB 2ZAMA 4CEJB 2CCJA 4JZKA 4TYQA 1OV4A 3KL4A 1TQ4A 2C77A 3AGQA 1CIPA 1ETUA 2O8DB 3BC1A 1VCOA 2IYUA 1PLKA 1E9SA 5FOTA 3TE6A 3LV8A 4ZDIA 2WKPA 3PXGA 3A6PC 2ZSDA 2QSYA 2XJ9A 2J7PA 2G6BA 4L8GA 2JAQA 5FPSA 3FMIA 1YRBA 2ZRHA 3BWDD 2O0KA 2F3RA 3LNCA 1MT0A 2ZUBA 3MG9A 4PPQA 4D4JA 1XPRA 4OHYA 1EK0A 3AF1A 3HR8A 1CJUC 4NCNA 5J4VA 1YR6A 1DG1G 1RZ3A 4A6PA 4D0GA 3K9GA 3WY9A 1X1RA 4Q1FA 3BJIC 3QPUA 3NEYA 4PTLA 1AIPA 2X77A 2Z4RA 4KFUA 1TX4B 4QHSA 3W5IA 4LUCA 3SQWA 5FOUA 3VR3A 1XB2A 3BD9A 4B3CA 4QBFA 3GLFE 2DCUA 4PANA 3CLVA 3B82A 4FINA 4NDZA 2WPDD 1ZP6A 1W5SA 5HCIA 4A2PA 3PEYA 1M7GA 2CXXA 3QOFA 1Q57A 4C9BA 3U2QA 3L43A 1E0KA 2FSIA 1T91A 2HV8A 3WP1B 2Z5FA 4GZLA 3CPJB 2X1VA 4UNRA 3T15A 1I4LD 1MR3F 1OH8A 3FFAA 2HT6A 3SHWA 5CJ2A 2IUTA 1SVLA 3QXSA 1FMLA 5FOSA 1K8RA 3DPUA 3K70D 3KX2A 2G0NA 1M7HA 3SJBA 2PL3A 2YOFA 3CB4A 4OBEA 4US0R 2QP3A 3CW2A 1XMJA 4DJTA 1UKZA 2QEQA 1E9DA 4LHVA 1XEFA 2J59A 1DARA 4YMTA 4LBYA 1XXHE 2QBYA 2GJKA 1G3QA 1W47A 2OAP1 1VCNA 5JJLA 4OL0A 4LHXA 5KPDA 2QORA 3EZFA 3FVQA 4DCSA 2VO1A 3GQBA 1CRPA 3QEOA 1DEKA 1TNDA 2CJWA 1N5IA 2ZJYA 4HAZA 1ZM7A 3SU8A 4BEJA 4E22A 5DLQC 4WXRA 4U02A 4HSEA 2ZI7A 1P9WA 4TTRA 3N70A 2X8AA 5FBQB 3T5GA 1ODFA 1VYUA 1WQ1R 3ZVLA 2OUKA 5FTJA 5KSZA 2QBYB 1ZW6A 3TUJC 3WHKA 1GRNA 3KKOA 4GOJA 1W5TA 1WCV1 1CR4A 3C16C 4PX9A 2X2EA 1MO6A 4BFZA 3LBNA 4AYXA 3NH9A 2WVJA 1LFDB 3QBTA 2CJWB 3JVVA 4M8NE 1XMIA 4ESHA 1F3OA 1P2TA 3PJRA 1TL7C 5A0FA 4QJ4A 2P3SA 2ZRFA 5GADl 5DN6D 1DO2A 1R0YA 2W2XA 2WBLC 2Q3HA 1XJQA 1NKTA 4MRPA 1F5NA 4QJ5A 3IILA 2QU8A 5H68A 3I72A 1HUQA 3V00A 2CL6X 3MWJA 4BFUA 4XJXA 4D4MA 2ZR0A 4CEHA 2QA5A 4XWOA 3T1VA 3ZZ0A 1W4BA 2RGCA 4OQFA 3RANA 3W34A 1UBFA 2XNDD 2VHQA 4A1FA 1A82A 2YWEA 1G3MA 1QHIA 1RRGA 2QE7D 2EQBA 4L4UA 1BMFD 4U00A 1Q0UA 2UKDA 2ZRJA 2FWRA 2R44A 4CEHB 1F2UA 4Z1MA 3WNCA 1IJFA 4TT3D 1J8MF 1VIAA 2QT0A 1OJLA 1LF0A 3BK7A 3AB3A 2AWNA 1N0VC 1HYQA 2QTFA 1SVWA 1YZLA 1E9FA 3U6BA 1FP6A 4QKQA 4DEYA 1PV4A 1W7AA 3VTKA 4C7OB 1Z47A 2AXPA 2OG2A 4WBSA 5KUTA 2DR3A 3WNDA 3GLIE 5CDFE 3H86A 2VA8A 2QPAA 3DOFA 2OZEA 4BZQA 1G19A 3SS8A 3PUVA 4X8LA 2ANCA 3LX8A 5CM8B 3K70C 1F2UB 1ZD1A 2C9OA 4GOKA 1TEXA 4IOJA 2WHXA 2FH5B 4AG6A 1U81A 2ZRPA 2BM1A 1XTIA 1NVUQ 5EXSA 1J8YF 2RH5A 4Z1MD 5DH9A 2QSZA 4BASA 4CT4B 3GLHE 3K0FA 4IVQA 5EUQB 1ZD9A 3UWOA 3THYA 2GVZC 4XTCS 1BO6A 2GK7A 5HTKA 1G9XA 2OXCA 5LB2A 4OHWA 3IQWA 4B74A 2ZUDA 4IJMA 4UXHA 1KK3A 4KO8A 5CK5A 1W2HA 2I3BA 3AVOA 2G1JA 4IVPA 4JMPA 3GP8A 5BYJA 1S4QA 2PMDA 1II8A 4ZDJA 2IS2A 3K0FB 1GWNA 1VYTA 1EFUA 2ZJ5A 3THYB 3DM9B 3L0SA 1KKLA 4RZUA 1XF9A 1W36B 2R6FA 3W3ZB 2VPPA 2GEUA 3A8TA 4WZ6A 3BERA 2FF7A 2WIAA 1W36D 1KK1A 2GZDA 4NPHA 2GHIA 3W90A 1KNQA 5JZVA 2DBYA 1VDZA 4RD1A 1ESNA 2ZANA 3U7HB 4TZ6A 1ONBA 2W2VA 1G17A 2ZSFA 1HT2E 2IHBA 1KAGA 3U3OA 3RNLA 5BYKA 1CR1A 1O3YA 1XTSA 4W7SA 3MUFA 1U94A 4BFVA 4OQMA 1P3JA 3I3SR 2PBRA 1W0JD 4IKEA 1IN7A 4URVR 4DDTA 1OXUA 3I73A 1G3RA 4FMDB 1NRJB 4LPKA 1U0LA 1SKYE 2KBFA 4C0HA 4RJLA 1E2MA 2MSDB 3EIHA 3TW8B 2F6RA 2OESA 3TMKA 4HUQA 1VCMA 2J87A 2YC4C 4LJ4A 1HE1C 4OK3A 3HU3A 3AVPA 5HKKA 2IBMA 3AVXA 3GJXC 2O52A 4R7ZA 1TTTA 2VP4A 5JI3E 2HXYA 2NO0A 1DAMA 1DAKA 1XD9A 2WICA 4PHFA 2KI5A 1IN4A 2UZ3A 3ZGXA 1KMQA 3TNFA 3RWOA 3MGCA 2ATVA 1QG4A 4M9SA 2PEYA 5EXXA 4IDHA 5CJPA 4Q01A 2FGKA 4HUQB 4PO8A 4XOIA 1D2MA 4NYJR 5E7JA 2RGXA 1DOAA 1AK2A 2B92A 1WDTA 2PZEA 3K0AA 4TL6A 3RC3A 3PFIA 3SJAA 1X1SA 5L3RA 4R71A 3C15C 5K8TA 3OEED 4K81B 4NE2A 4P4TA 1EFRD 2EYUA 1LB1B 1COWD 1X8LA 3LXRA 3FWYA 4EQ6A 3ND8A 3ASYA 4GOXA 3KZ1E 3I62A 3GJ4A 4OJQA 4DLRA 2BBOA 4IHQA 4PR0A 2NOAA 4HAWA 4HB2A 4PZZA 2W83A 4DLYA 3K0AB 2WAXA 2ZRGA 1JQLB 3EA0A 4AI6A 4L15A 2F3TA 2JEOA 5LDDC 1G4UR 4TSFD 4QXAA 2QPOA 4KCGA 4QGHA 1E96A 3F8TA 3BH7A 2V6IA 3CRQA 4TLAA 4W5WA 5BN4A 4D2IA 4B44A 4EQ6B 3E70C 3RDPA 1YZGA 4MGZR 4ZKDA 2GKSA 3WP0A 3BFXA 1XMVA 4V0KA 3AVVA 3SYLA 1NBMA 2QP9X 1DO0A 3QF7A 4WVFA 4W5HA 4RZ2A 3BIFA 4NMMA 3OFNA 1W36C 2XZPA 1UEIA 4US2R 5HZKA 2P6UA 1HQYE 3MCAA 2WMNB 2GILA 2GJSA 1G7RA 4M1KA 4UQOA 1D5CA 3RRYA 3QXJA 1Y63A 1ZNWA 2F1JA 4P4UA 4MGYR 1RRPA 1IJEA 4Q9IA 1E9RA 1Q1QA 3FB4A 3I1FA 4CW7A 2NG1A 1YZQA 4I1UA 2R62A 4M1YA 3LH5A 4FMBB 4E5UA 3QKUA 5GJWC 3RRMA 3R9XA 1XTJA 2ZU0C 3CO5A 5EE1A 3C5CA 1NBMD 2QENA 3F0TA 3Q5DA 3VU9A 1E2EA 1XCMA 2QI9C 3OFND 4M2LA 4NYIR 1QZXA 3OF5A 4U7DA 3DKVA 4ON9A 3F5FA 5DI9A 1T3HA 2JLWA 1U90A 1V43A 1BS1A 3L8ZA 4A6XA 4WZBE 3N2EA 3LVQE 1W0KD 1NKSA 4Q03A 1OH6A 3BB1A 4QHYA 2N46A 5D3MB 3B9QA 1AQUA 3K9LA 1Z3IX 3BAFA 1FX0A 3A36A 3DMDA 4KVGA 4OKSA 4PSVA 3GFOA 4Y0AA 1U8YA 1EX6A 4DSOA 3VU9B 4M53A 3MAAC 4A92A 2RGGA 3OEHA 5BQ5A 1E2JA 1GM5A 2WKRA 4RKFA 1QHHA 4DVGA 4B76A 1N5JA 2ZI9A 2F1RA 2QMHA 2AWOA 4RD6A 1NLYA 1GUAA 4GPTA 4OI2A 1R5NA 1FX0B 4MYHA 4UJ3A 4I1VA 4CRWB 1TAGA 2VEDA 2BC9A 1L2TA 2WJIA 4G0NA 1OIVA 4JL8A 1CR2A 3NBFA 5TMPA 3H4MA 3SHFA 4CT5A 4LZZA 5B57C 1QHHB 2AD5A 2VH5R 1R8SA 4YXWD 1WBBA 2F55A 2IXGA 3P20A 4A0FA 2IXFA 1NLFA 3RVBA 1KDRA 4DDVA 1DPFA 3RHFA 4PHGA 2AR7A 3QNUA 2D2EA 2A3RA 4MYTA 2YWFA 2BJVA 1GIAA 1N0UA 4HEJA 2GCOA 3GJ8A 5FTMA 1D9XA 1NSFA 3Q9LA 4TMKA 2XITA 4S2EA 4V0NA 4LJAA 1GZSA 2NO7A 2ORVA 1N6LA 2JATA 2L0XA 3ZVRA 2CE2X 2FU5C 5UKDA 4I99A 1AGPA 1KI6A 4QFMA 1G8FA 2OV2A 4ZPXA 1I2DA 2FN4A 4LYHA 2BCGY 4ACAA 4MKFA 2IYTA 3CKLA 3ONWA 4OI4A 2GCOB 2IX3A 5FL3A 5JCZA 1E2KA 2OBMA 3IKJA 3IHLA 4XD7A 3ETLA 5DHAA 4JLAA 3RSLA 2PLRA 2ZJ8A 3B85A 4AC9A 3LBHA 3UG6A 1A2KC 2CMKA 1KI6B 2W0MA 4URUR 3VHXA 3ND9A 2D4HA 3GJ6A 1ZM3A 3NVAA 3ZD6A 2CK3A 1ZC4A 4CDGA 2EU8A 3CZQA 1SVMA 4Z8YA 3MWYW 4PPFA 5CITA 2XEXA 4DIDA 4FIDA 1E99A 2GAOA 3CR7A 1AZTA 4GBMA 4AYWA 3TUZC 4OI0A 2PT5A 4Q48A 1VHTA 121PA 4DLZA 4H1UA 1E2FA 2BM0A 1K5GA 4B71A 1NI3A 1OSNA 1TU4A 2J9RA 3L0OA 3IBGA 2R65A 5J4HA 3THWA 3O8DA 3KJHA 1KI9A 4LC1A 4QHTA 1JEEA 2ONKA 4NYMQ 1GG2A 2NO9A 4S35A 3FDIA 3CF2A 1N5LA 3ZIAA 2ZI3A 2QL6A 1YZUA 1SXJA 1EWRA 2JDIA 2GF0A 3BH0A 2OO7A 4KODA 4PQRA 1P73A 4LYFA 1NIPA 3AP1A 2IL1A 5JI2E 5M04A 2IYYA 4A0GA 2WJYA 4PQFA 3P32A 4BUJA 1TUIA 1R0ZA 3PCRB 5FOXA 3THWB 4HLUA 4QC2A 3TQCA 1A5TA 3MWKA 1D9ZA 1T5LA 3QJYA 4PZYA 5FR2A 2EWVA 2XX3A 4OI1A 3KQLA 2GAAA 3LFUA 2OLJA 3P1JA 2FJUA 2F43A 3EIEA 4TMWA 1YR9A 1SXJB 2C78A 3TAHA 4ILEA 4LX0A 1NN0A 2ZXUA 1X86B 1JB1A 1YZNA 4V03A 1G18A 3C5HA 3QKSB 2JDID 2ZJBA 1DG3A 1KI4A 4OQLA 4GRAA 3QPWA 5FL7A 4YMSA 1XFAA 3BS4A 1US8A 5AJXA 4D4LA 2BBSA 5SZJA 1AJEA 2F43B 1YZKA 2A5YB 4BFTA 1I4DD 1QDEA 4MH0R 2Q9BA 1FPMA 4JVLA 4PAOA 1TMKA 3KUCA 2BOVA 4TLDA 3DOEA 2WV9A 1C4OA 5BN3A 1NN1A 1OFTA 3CNOA 2R9VA 4HI0E 4DKXA 3GLFA 5B30A 1TUEA 3EASA 3T35A 4RCZA 3HYRA 4NHOA 1US8B 4TQUS 4M1MA 1N6OA 3SR0A 2J5XA 2ZUCA 1Z6YA 4PHHA 2C04A 4XWKA 5FL7D 3ZZTA 1KI7A 1UEJA 2BV3A 3RWMB 1NVVQ 4LYJA 4LC0A 1Z06A 3MJHA 1U98A 1Q3TA 821PA 3VKGA 2GZHA 1KK0A 4ERNA 2P6NA 3O8RA 2FSGA 3GLFB 1UFQA 2WKQA 1S1MA 2OBLA 3T06B 4UXIA 4Q7JB 4C0AC 3TH5A 4RY2A 2CLSA 3SI7A 3RRZA 5TARA 4RVCA 3GLGE 2FSFA 1Z0KA 3IO3A 4UNSA 3NWJA 4B43A 2LKDA 2A30A 1XXHA 1XZPA 3HU1A 2J41A 5EP2A 4F7WA 4W9MC 5EZ6B 2PZGA 4R2HA 1WBDA 3GJ0A 4DLWA 4WOPA 1VIYA 2DWQA 1XMSA 4G5RA 4DC9A 3UPUA 1B0UA 4BZPA 2BMFA 1PZNA 5EE0A 3TSZA 5L8VA 4AY2A 1MO5A 2Q9AA 2ZJAA 4B6FA 3B13B 2KB0A 3NH6A 1P7CA 3K0SA 4TN1A 5DGXA 3VFDA 4BGDA 3TQFA 2WWIA 3N2IA 2NPIA 4OQXA 1XXHB 3R9WA 5HPYB 4PAQA 4O2RA 1E0SA 2VHTA 5CB6A 3FTQA 3ECCA 2IC5A 1E2NA 5CYPA 1D6JA 2REXB 3IBYA 1Q20A 3L8YA 3IUYA 1TQDA 1F6BA 4M9ZA 3T61A 2IF2A 3CIOA 5JWOA 2O8DA 3IHWA 1JR6A 2HLDA 4NCJA 2TMKA 1KYIA 5AJYA 1CTQA 5EJEA 5FUXA 2D3WA 3EA5A 2AN9A 4AK9A 4DLVA 4BLPA 3SEAA 2WSSA 1SXJC 3PUZA 3QIAA 1ZJ6A 3UATA 4KFTA 2ANBA 2ZI4A 3TRFA 3K0CC 3KFVA 1HEIA 3BB4A 1E79A 1TADA 4HLUC 2AFIE 2BCJQ 5DHFA 4A8JC 4AKEA 2FSHA 3W5JA 2ZI6A 4AKIA 4BFYA 1GTVA 4X8MA 2JJ2A 1CU1A 1NVXQ 1Z0FA 3UMSA 3LLUA 3A37A 4PPNA 4V0OA 3HPRA 3GEEA 4F4CA 1NIJA 2GJ9A 3IIJA 4M9QA 2PT7A 2RKOA 4JIMA 5EP1A 4JT4A 1J70A 1KJYA 2RAPA 1TEVA 3QXHA 2EW1A 3SC3A 5LB4A 1QHXA 4B3FX 2QRNA 3CF0A 4JBXA 1JXOA 4NCHA 3VKWA 5ELXA 5AJWA 1EG7A 5H8WA 1PLLA 5FPYA 2YZ2A 4PZLA 2JLXA 2QTVB 1X8KA 1Q3HA 2HJVA 1IAQA 2FDCA 4F93B 4ESVA 4A4DA 2PCLA 3EPLA 3AEZA 2O8CA 3GLIA 1W48A 3E5HA 5CDFA 3REFA 1JAHA 4JJZA 3TVDA 3B6EA 1ZCAA 4G1UC 1BKDR 4C0BA 3ZVNA 2JJ2D 3DO6A 1W2GA 5DE3A 2J7PD 3I8SA 2Y8EA 4WXPA 4LYAA 5HE8A 1Z08A 1YRAA 1NN3A 3GLHA 4IFEA 3QQ5A 3DHWC 2GXSA 2QMEA 4JBWA 1E2IA 4DCUA 2IYWA 1GKYA 3QXXA 2JLYA 5KSYA 4RD2A 5KNCA 1WRBA 2O8CB 1XZQA 3GLIB 4A2WA 4KAXA 2BMDA 2ZYWX 5KHOC 3O47A 4B2PA 1KMHA 3U3MA 2XGJA 4DHEA 3DDCA 5FUWA 1RRFA 2ZYTX 1KO1A 4DCNA 1S9HA 1SVIA 4NYMR 2BEJA 4A9AA 1KGDA 3GLHB 4JLOA 3LQRA 3M1IA 2BDTA 5JJKA 3LDAA 1OH5A 1KDTA 4YMUA 4A0HA 3LVRE 1G7TA 4HDQB 5F98A 2I1VB 4M22A 1LW7A 1KMHB 1KDOA 1XEXA 2R8RA 4YDHB 4G5SA 3OAAA 2DWOA 3CF6R 4MKIA 1CJTC 5EXTA 4M1SA 3TLXA 2VF7A 2GBLA 4PSAA 3T34A 3LO5A 4GDFA 2W58A 5B64A 4LI0A 1BH2A 3ADDA 1SULA 2ZQ5A 2YOGA 1HV8A 1OH7A 2W6IA 4HZIA 4D4KA 2ZU6A 1KJZA 1YVDA 2H18A 2J7KA 3BXZA 3D8BA 5F9HA 1JXMA 2NO1A 5F9FA 1IY1A 2PMKA 1U2RA 1XEXB 2BKUA 3HP1A 3MSXA 2BIFA 1G8GA 3FMFA 4IVRA 1AS0A 1LS1A 3GPLA 3A58B 1M74A 2ZITA 4DDUA 5C4MA 2XZLA 4M1OA 1OFIA 1TF2A 3WXMA 3CH4B 4JT2A 3P26A 1VKJA 1W4AA 2RGAA 3DM5A 3UIEA 2XOKA 3EIQA 1K6MA 3CWZA 1OHHA 1ZYUA 1KSJA 3EZ2A 4BQSA 1P60A 3SNHA 1FUUA 2WJHA 1XX6A 4KSCA 1VG9B 2QM7A 5D3QA 2P5TB 5E95A 1CBUA 3RS2A 2VSXA 1TQ2A 1SKYB 5GJCA 3NTUA 4C7OA 4FW9A 2C9CA 4KLZA 3VNVA 2MSCB 3H84A 2KWIA 1I2MA 4C0QC 1E4YA 4DCTA 2QROA 3C14C 2YYZA 3QPVA 3D6TB 1EESA 3WMEA 3QG1A 2P5SA 2VBCA 2VF8A 4MITA 1ESMA 3K53A 2K5UA 4G01B 2VP0A 4Q7MB 4Q00A 2C98A 2OAQ1 4DBLC 1QVRA 3K8YA 1J7KA 2N1BA 2XOKD 2XTMA 3B1YA 4YDSA 4HYYA 4M4SA 1NLZA 1OHHD 2GTPA 2NTYC 3SFZA 4E03A 1WP9A 1QVAA 4FCVA 2QTHA 3LRPA 3NBYC 3NEJA 4JSTA 4B3GA 4U5XA 4Y0VA 3VR2A 4TTPA 5KSPA 5GVSA 1XDBA 4ZCLA 3PR1A 3Q3JB 2HCJB 1DADA 2IEYA 1KO5A 4NONA 2FGJA 4EPRA 4KVAA 5FBVB 4C2UA 1D2NA 1ZIPA 2OFOA 3ZVMA 4MGKR 5FBLB 3IQXA 2FOLA 1L4UA 2HUPA 4TMVA 3BGWA 4ZDKA 4EIWA 3CRVA 5FFMA 3GFTA 3H1TA 4LJ5A 4IDNA 2QM8A 1E94E 1EX7A 1E2PA 1RJ9A 4R9UC 1PLJA 4UNPA 4EPWA 1P6XA 3I32A 2XAUA 1Q1ZA 2AL7A 4YMVA 1D8TA 1FQJA 2PJZA 4JLPA 3C41J 4JL5A 1UKVY 3GFPA 1E98A 4MUAA 4LV5B 1UKYA 3AP3A 3R20A 4QBHA 4B3DA 1OKKA 4MRVA 4V02A 4MRNA 1FTNA 2AX4A 4IEEA 4BEBA 2V3CC 1RJ9B 4FWIB 2Q3FA 4KJZA 3ICEA 3QY0A 1G6OA 2R6AA 4Q02A 5C4GB 2PX3A 1M6NA 2XXAB 3AF0A 1Z28A 4LBWA 4LJ9A 2ZRIA 3WBJA 3PEVA 5EE3A 3CX7A 3HDTA 5ANRB 3I61A 4PSKA 1GNPA 1MV5A 4BLSA 2GXUA 2Q21A 1N6IA 4TLCA 3R9IA 1OKKD 1E32A 2JASA 3P27A 2EVWX 4B73A 5DISB 3NC0C 2IT1A 2GCPA 5IT5A 5TV2A 4ZV4A 2W00A 3KDSE 3D31A 3X1ZA 3UANA 3RS5A 3ZJYA 1SGWA 1E4VA 1ZNZA 3T1TA 5J47A 4FI3C 5JS7A 3J81k 2ZYVX 1Z22A 4ASUA 4EUNA 2EFGA 1MABA 1XRJA 2PCJA 3MWLA 5EE5B 3TW4A 3PG5A 1KAOA 3MJRA 1G5PA 4HAXA 1D2EA 4LWZA 3KTAA 2CL7X 1M34E 3O8BA 1SHZA 2VSOA 4NP6A 1XJCA 4Q1DA 1IHUA 721PA 4A2QA 4DSTA 3AUYA 2JLVA 4MYCA 1RYHA 1G291 2G1KA 4XSGA 1W1WA 2YWGA 2G88A 1OB5A 4JSYA 2V4ZA 3IPYA 4URXR 5CK4A 3T12A 4D0NA 3PUYA 5HKKD 5JBQA 1MABB 1MRNA 2OCAA 3NXSA 2GVDC 1GKUB 3HWSA 1SVSA 5P21A 2J0QA 5KDOA 5C2JB 2C96A 1DE0A 2DFKB 3KTAB 4ASUD 2Z4SA 2MSEB 3C4JA 1J99A 4GZMA 2DB3A 1YZTA 4OK6A 5JEDA 2CLDX 3AV0B 1UJ2A 1Z0JA 5E7IA 4DRZA 3FMOB 2REBA 3B1ZA 4TYPA 2OSBA 1KO7A 3HPQA 5F3WB 1JPNA 2ZSBA 1G16A 2QQ0A 4B3XA 1QHGA 3PVSA 2XTZA 4P3YA 5FOWA 4Q9LA 2I4IA 4B2IA 4PC1A 5BXQC 3THXA 2FFQA 4B3BA 5JS8A 4TQ9A 1E6CA 5KNBA 3QUSA 4JLBA 4J0QA 1AZSC 4K46A 1FFHA 5C46F 1E2GA 5CIQA 4BFXA 2W2TA 1CJMA 5EQTA 3WRYC 3ADBA 4FWTA 1UDWA 2GK6A 1VG1A 3X1WA 1L4YA 3LW7A 4NL4H 1N0WA 4XWAA 4ZCMA 4O2LA 3AH8A 1T4GA 3AP2A 1IOZA 2ZVPX 3THXB 4FMDF 1HURA 5KNDA 3AVWA 1MOZA 1UKEA 2FMXA 3FKSA 4C30A 1YR7A 4ZI2A 4ZI3A 5D3MA 4GMDA 1SKQA 3BE4A 2CHGA 2C9YA 1Z6TA 3BORA 1P2VA 1IXSB 3CBQA 1CLUA 3W8RA 3U7GA 2EFCB 6Q21A 5AUNB 1P2SA 3IPXA 2H7VA 2J3EA 3CRW1 4HDOB 4LHYA 3LX5A 4EJSA 2XB2A 5JRZA 4B34A 3W6PA 2GESA 3RS3A 2IYQA 2VYFA 2VHJA 1YR8A 2ZRCA 2CHVA 5FI0B 1G8YA 1U99A 3LXXA 3VNUA 3UMFA 3EG5A 4LRWA 1EGAA 1GILA 3CWQA 1QBKC 4JLDA 1A2BA 3FHCB 3F3YA 5E7MA 1AQYA 3RRNA 4EFNA 1OXVA 4DT1A 3HJNA 2VSFA 3FKSD 2A5GA 2BJWA 5J5CA 2IK8A 3GMTA 3CH5A 4EJSB 2DFNA 2J0SA 4C0KA 4JYBA 1LV7A 4KV9A 1OXSC 1L8QA 1CJKC 2QT1A 1QHYA 4DZZA 3DVLA 4V0LA 5H1YA 2EFDB 2CNWA 4IRUB 1VECA 1XWIA 1DVRA 1OXTA 3W3AA 2RCNA 2OFWA 4M0LA 3SFVA 2A5JA 3V9PA 4Z51A 5AJZA 2YVUA 1X8JA 2V55B 4DT1B 2H92A 4GFDA 2FE4A 4HAVA 4NKRA 4QNRA 1AM4D 3L0PA 1XJ0A 1II0A 1LTQA 3UG7A 3QE0A 4CGZA 1SVOA 1DTSA 2OCBA 4LCBA 2G0TA 3OEHD 1OT3A 2OE2A 3U44A 4AURA 1JJVA 4N0DA 2ODNA 3PENA 3M4YA 2R6DA 2F1HA 4NCKA 4CYMA 4E09A 5SZHB 4QJ3A 4JYCA 2ATXA 4LY6A 1XCPA 1LNZA 2PX0A 2XTNA 3B78A 3WBKA 3AVUA 3KKPA 1IM2A 1KZ7B 5CLQA 3PQCA 1XBTA 3BB3A 3Q7PA 3ZH9B 1B23P 2W0SA 5L3QA 2DWPA 3KXKA 2AKAB 3A4NA 3LQQA 3DZ8A 2HF8A 3U44B 5JMTA 3H0KA 1GNQA 1MO4A 2KE5A 4Q1CA 1U8ZA 4GP6A 2F1IA 4TL8A 5EUMA 1P61B 2ZETA 1VG8A 3SOPA 4D81A 5B2ZA 3RS0A 3M0EA 1EFTA 521PA 1M8PA 1KOFA 1G4AE 3IIKA 2NIPA 3AQ4A 4GL2A 2GEDA 3GLGA 1E9AA 4LV8B 5KYKA 4I1SA 2CDNA 3U4QA 5L3QB 3QBVA 3CRMA 1J90A 1IY0A 2QQEA 4FCWA 4BLTA 3WNBA 1X3SA 2FA9A 4RSGA 4URZR 1RIFA 3OIUA 4CIDA 4DXAA 1W46A 5G3ZA 3O8CA 2JLRA 3R7WA 3EPKA 2J0UB 2F7SA 3B1WA 4ZIRA 4Q1EA 3ZS8A 1T8TA 4GSYA 1W49A 5LD2B 2YWHA 2YV5A 3LBIA 3KKMA 3GLGB 3NG1A 1DBSA 2IHYA 3U4QB 1UPTA 4B75A 4DCVA 3L0IB 4X8HA 3LW8A 3AVTA 1E9CA 4XD7D 2D7CA 1NJGA 2D7DA 4C2TA 1OIXA 2I1QA 1CXZA 2J46A 4AD8A 4QOSA 3GEIA 4LJ8A 4WA7A 2RGEA 3R7WB 2F9MA 4HLCA 3VMFA 2R6CA 4ZIRB 5AK0A 2NO6A 5JSZA 1ZNXA 1CP2A 4PO9A 2P6RA 2H1LA 3OESA 2CK3D 4EFLA 1FW6A 1JEDA 3PUWA 1WE2A 4QRHA 2BMEA 1YHNA 5G53C 3U3RA 3QKSA 5K8UA 4EJSC 1WF3A 4RZXA 5CM9C 4YLGA 1KY3A 5TY0A 3ASZA 3KQNA 4Q4AB 3BFKA 1CF4A 1ZUHA 4PQYA 3E1SA 2GJAA 1KJWA 4C3ZA 5G3YA 1EWQA 1JR3E 3Q85A 3KB1A 421PA 1XPOA 1GL6A 3EXAA 4XSHA 1K5DA 1OLOA 1VYVA 4RKEA 4WAUA 2VL7A 5HE9A 3X1DA 1DELA 5JSZB 4OK5A 2WWYA 3GJ5A 3ZIAD 1GSIA 2ZRLA 4KU4A 5JWRA 1RW4A 1SXJD 3TUIC 2WTUA 2QY9A 1CS4C 1YQTA 2CL0X 4RFSB 3VR1A 4I4LA 3K9HA 1DAFA 5J4YA 1IQPA 4JL6A 4FMCB 2HJGA 4B35A 1Q21A 2AD1A 1XTKA 2C5LA 4KSBA 2V7QA 4AG5A 1G7CA 1FTSA 1HA3A 1OB2A 4OHXA 2BWJA 1UDXA 3BBPA 4JKIA 5TXGA 2ONJA 2JJ1A 3T1QA 3WRXC 3OIVA 4A15A 1IXZA 2GF9A 4YONB 2PZFA 1ZRHA 1G3IA 4TZ0A 2RGDA 4OHVA 4F4IA 1XTRA 2Q6TA 4TYWA 2B7BA 1JAIA 1GNRA 2LWIA 1ZBDA 1XNJA 4QG7A 3VR4A 4TTQA 1P9RA 4B32A 1Z8FA 1E0JA 1KO8A 2W6JA 2H5EA 2ZR9A 1BYUA 3L82B 1XPUA 2BEKA 2XSZA 3UXMA 3U61B 1N6RA 4BRUA 1G3UA 5FTNA 5JRJA 1JALA 4DLXA 4ABYA 2IS1A 1S96A 2ZTSA 4R2IA 3ADCA 4Q1AA 3UK6A 4DB4A 1T0JB 1Z07A 5CIWA 4XVRA 1AA9A 3BH6A 1P5ZB 4Z8XA 4M9XA 2HYDA 1LF5A 2QAJA 2OBNA 4NCIA 4DSUA 5CYOA 5SZKB 5JWHA 2J1LA 2V8OA 3RABA 3IEUA 3OZXA 2EFHB 2JJ8A 1ZM9A 2F9LA 5LD2C 1YKSA 1GVNB 4UNQA 1OFHA 4F91B 2IS6A 3ADKA 2W6JD 3U6KA 3Q8XB 1IN5A 1OFUX 3C7KA 1NG1A 4HAUA 5FUVA 1IN6A 2ZJOA 1LS6A 1S2MA 3CNNA 4NU0A 5A4JA 3IIMA 2ZS9A 2V54A 2FEMA 4K8OA 1H8EA 2QAGA 3VR6A 1Q12A 1TQ6A 3VAAA 3CONA 5EP3A 1KSGA 2A2ZA 4HUTA 4LPSA 1GFIA 2NQ2C 4HLQB 1G8HA 3IDQA 4JJKA 1ZVQA 3EW9A 1VG0B 2B21A 2JLZA 3U60B 4G5QA 3VQTA 1WXQA 5FPHA 3ICQB 3D7MA 3VHLB 4TWZA 2WM9B 3SYNA 4MDFA 3BRWD 3IO5A 2ZAOA 4V0ME 5HZHA 1FNNA 1NJFA 2WOJA 3AGPA 3NBZC 1NMYA 2X19A 4H9GA 2QUZA 2QAGB 1KO4A 1XEWX 1DAGA 4H1VA 1AKYA 2D74A 2P2LA 4AKHA 3SYKA 1UM8A 3B2EA 5EE9A 1E2HA 2XNSA 4IOLA 1ZC3A 1KDPA 2CLCX 1VPLA 1Q1EA 2ZRBA 2ZRAA 2SHKA 2ZYUX 1CRQA 2IUUA 3EPHA 1U9IA 4BPBA 1II9A 2BBWA 3WYFA 1S3GA 5EP4A 5DSZA 1KIMA 1R8QA 1M1YE 3A1UA 3K09A 4C0SA 3Q72A 4XH9B 2HLDD 3RC8A 2IW3A 1G21E 2JIZA 2IYSA 2WIBA 2JLQA 3AF3A 2WJGA 3W6OA 2WSSD 1F60A 4US1R 5AWFC 4MKGA 3SQXA 1H8HA 2FEOA 1NSTA 4P0TA 2WPDA 5KPJA 1E79D 2G77B 2ZSEA 3S1AA 2NMVA 2C2HA 1EFCA 1E1RA 4QM6A 1ZNYA 5AJVB 1FUKA 5DYGA 2A5FA 1O87A 5KO2A 1E2DA 3LY5A 2BVNA 1OPXA 5KTYA 5KSOA 2JIZD 2HYIC 1NY6A 2EYQA 1DS6A 4TMTA 1PUIA 2V1XA 4TLBA 3EC1A 3FE2A 1R0XA 2ZVQX 221PA 1N6PA 2ZR7A 2GNOA 1SHKA 5KOYA 1H8HD 2EWWA 2RHDA 3S1AB 1NY5A 3CR8A 3RS4A 1RRCA 4IOKA 2J45A 4PC3A 1ZD8A 4O3MA 4Z54A 4NYJQ 2KBEA 5JJIA 1GRRA 2KJQA 3PUXA 3WYGA 1E1RD 4HLDA 1QRAA 3HU2A 4CEIA 4KXFB 4BLQA 3G5UA 4M21A 4BE7B 2WMOB 3I5XA 3K70B 3Q7QA 2WAYA 2IWRA 1AGRA 1U0JA 5EXPA 3Q5EA 2Q3MA 4DLUA 5DIFA 4GNKA 4MA4A 3TIFA 2IYRA 4O25A 1L7VC 4IDOA 2R6GA 3I8XA 1JI0A 5G40A 1N6HA 3NKVA 5JHGB 4Q7KA 4DLTA 1ZUNB 4WIAA 4TYNA 4QGGA 5GVRA 3U5ZB 3TR5A 4CEIB 4JLNA 2ZJZA 3QI2A 2VHCA 3TK1A 4GI7A 1IBRA 2MMGA 5KDLA 4OQNA 4MDEA 5GJBA 2C8VA 2O0JA 1N25A 5FPTA 2ORWA 5DN6A 3M6AA 3JVUA 2Q9CA 4YC7A 1BIFA 1QHSA 3TVTA 2QAGC 2QMUA 1ZMXA 2ZROA 3U3KA 5FTLA 3FKQA 4LJYA 1NG9A 4HDCA 2ZI5A 1Z6XA 4KITB 1NMZA 1Z2AA 1T3LA 2DFLA 1WMSA 2GZAA 3SBDA 2CCKA 1AKEA 3OAAD 4KFRA 3EZ9A 5FI1B 4FN5A 2XNDA 2CCGA 2V9PA 4JVNA 5K8IA 4DSNA 1P72A 2IWHA 2BHRA 2WWFA 2QE7A 5AUQA 2RMKA 1BMFA 1GKIA 4QBGB 2XJ4A 1U0HC 4WZAE 2P67A 4BWYA 3KJIA 2W6ID 2ZE5A 3PITA 3ZD7A 3MFYA 3BFVA 3B5JA 1N6NA 3R8CA 2B8TA 2YC2C 1YU9A 4Q4JA 2DY1A 4NTZA 4TT3A 4A0RA 3FMPB 2HT1A 2OCPA 3RLFA 2QGNA 4XVUA 4B33A 2YHSA 1U9IC 3GJ3A 3P4XA 2B7CA 4X8OA 2H16A 2REOA 1NVVR 3N5CA 1ZM4A 4RFVA 3QG5A 3K09C 4NYIQ 1Y3AA 1P4SA 2AK2A 2IXEA 4KBGA 3CNLA 4MKHA 4C4PA 1Z0AA 1KI8A 2OFXA 1KY2A 1T8UA 4D82A 1RKBA 3EZ6A 1T0HB 2BKEA 1F2TA 4IFBA 1Z5ZA 1FMJA 4Q4JB 4I81A 3SN6A 4B48A 1E0AA 4JBYA 1R6BX 2IYLD 2QNRA 5IF9A 4OJKA 2YINC 5H70A 3REGA 5DYIA 1R5OA 4JVSB 1KZGB 4QNMA 4IW3B 2IF0A 2ZRNA 3U7EB 3B7GA 621PA 1M2OB 2IYXA 2JCSA 2JLSA 5BN5A 2ZSAA 3DEFA 4N1AA 3MRSA 1F2TB 1P75A 4DLSA 1GP2A 2FZ4A 3EWAA 2DYKA 4ZCIA 4IEIA 4BRWA 4E07A 1CKEA 2ZS8A 3QF4A 3EZ7A 3GEHA 2QMOA 2BMJA 2CEAA 2IEZA 2VP2A 3SBEA 2FZLA 1C9KA 1GITA 2BBTA 2CHQA 4EPYA 1R10A 4KBFA 5E3HA 4BLOA 4A36A 2XXAA 1OIWA 1VTKA 1Z83A 2N42A 3A4LA 2WWGA 4D26A 4KLNA 3LWNA 2UZIR 1E1QA 3QF4B 2RGNA 1N3BA 5JCPA 3W6NA 4QM7A 4KYIB 3X1YA 2GXQA 3TGPA 2H8KA 1G64A 1RYFA 1G1MA 1VCIA 2PLFA 2WSMA 2IS4A 5HR5A 4P4SA 2WWWA 5FR1A 3RAPR 1DAIA 1UF9A 1UBGA 1JECA 4PC6A 1W0JA 1MO3A 2PH1A 3ZDQA 4R98A 3TKLA 1Z6GA 4HAYA 2GETA 4PHTA 3EC2A 2GBLC 4ACBA 1OXXK 2YKGA 2JLUA 3NDBB 1JQJC 4DB2A 1NF3A 3X2SA 1RE0A 3AF4A 1XD2A 3DZDA 4HZUA 2P65A 4BECA 1MH1A 5DO9A 3ZQJA 4UNNA 2QPTA 4JLVA 1E1QD 4P4SB 3T1OA 4Q66C 3FOZA 3KFXA 3AKCA 1II8B 1S1CA 3NIBA 5JECA 3CX6A 2ZE6A 1E2QA 5IHPA 4G5GA 3DKPA 1AS3A 2DHRA 4P31A 4WW0A 4CZ2A 3THOA 3KKNA 1FP7A 1FZQA 4PAMA 4JS0A 4TQAA 4IDPA 3VR5A 3NBXX 2CE7A 1XD2B 2WWHA 4HZUB 4Q9HA 1A1VA 2LCFA 4F4JA 4TL9A 3WMGA 3KXIA 3UKDA 1HE8B 4BFWA 4EFMA 4F92B 4EPXA 2DPXA 1IN8A 1AN0A 2D2FA 4JKYA 4P32A 2VHUA 1Z0IA 3FHTA 2P0EA 1J2JA 3OEEA 3LD9A 2O0HA 1PJRA 4MQBA 1VMAA 1EFRA 4TL7A 3TAUA 2AK3A 3SE0A 1COWA 1SZPA 1XEWY 5JFGA 3CX8A 1UAAA 2GCNA 1XD8A 3RYTC 4DIEA 1E3MA 3AUXA 4D25A 1SVKA 1Z6AA 1JBKA 3A4MA 2VP6A 1QG2A 1OF1A 3FHOA 1I4TD 1VHLA 4IXNA 4W5JA 1R7RA 1OYYA 2HXSA 3QVUA 3UMRA 1RPZA 4LK2A 3R8FA 3K9NA 4TSFA 2G3YA 1GAJA 1GL9B 4QBIA 3TSWA 3FGNA 2ZRMA 4Q9JA 3AM1A 3SJCA 3MD0A 2ZS7A 4D6PA 5AUPB 2ZIAA 1A4RA 2MMCA 4UKDA 5CLLA 2OCYC 3LLMA 5FBRB 5BW8A 4PPGA 1DAHA 1KI1A 4MRRA 3V4RA 1NP6A 3I92A 1HY3A 1FOEB 3KUDA 2OM2A 1XU4A 1PUJA 4ITRC 4MGIR 4AIIA 1XTQA 4LOAA 3CPHA 4RD3A 5L3SA 2O8FA 3VX4A 2IUSA 3CM0A 5F2EA 3AF2A 5FUYA 3CPEA 1Z2CA 5DI3A 2A78A 1W4CA 1MRSA 1S9DA 3AKYA 4BZXA 4HB4A 1P2UA 1HH4A 4TLEA 4YMWA 2HDNB 1DAEA 4TMXA 1CR0A 2Z83A 2QN6A 4KYUA 5IDVA 1R0WA 2G83A 4CVNA 5L3SB 2O8FB 2IA5A 3T5DA 2VP9A 4ZKEA 1E2LA 4PXAA 3P4YA 4TMZA 1OW3B 3FFBA 2IYVA 1Z0DA 1UBEA 3QENA 5DI3B 2XB4A 4F38A 3V4FA 2E87A 3EWSA 4XVQA 2O8EA 2WWXA 3MLEA 1ZM2A 4UXJA 2RGNC 3ZZUA 1ZCBA 3SDZA 1JJ7A 5BWMA 3EARA 1QF9A 4RCYA 5KU1A 1W0KA 3DMNA 3TJZA 4Q5IA 4NH0A 1GOTA 2LKCA 3AVYA 4II7A 1S8FA 2KSQA 4LHZA 4LSGA 1G5TA 4XTRA 2B8WA 3A1TA 1U8AA 4JLKA 2O8EB 2OLKA 2AFHE 2E1RA 1RC8A 1HTWA 3AKEA 4YQFA 4KI0A 4PFSA 4EPTA 2QRZA 1Q1BA 3AKDA 1JR3A 2OXRA 3L2OB 2C99A 3IGFA 2CVFA 3B8HA 4JLJA 3I5YA 2UVQA 2ZRDA 2Z6VA 3LAWA 1BYIA 1EFHA 4N0EA 2ODBA 4ZDWA 3EAQA 2PJRA 1NNEA 2YOHA 5J4KA 4YXWA 2OILA 3QKTA 3IEVA 1H65A 1OYWA 4MUBA 1HQCA 1F48A 1T3SA 1AS2A 3BOSA 2H57A 1NN5A 4DEXA 2GDJA 3B1XA 2HCBA 4M1WA 2WJJA 8OHMA 1JR3D 2NGRA 4B2LA 3RS7A 2RGBA 4M1TA 1HT1E 4HB3A 1P62B 1EXMA 2CNWD 2V6JA 2YJTD 3PIRA 4RD0A 2ERYA 4GMXA 5CB8A 4URYR 1ZU5A 2QZ4A 1W4RA 3HR7A 4LV6A 3FYHA 3SJZA 4HATA 2VP5A 1OE0A 2V1UA 5SZIA 1V5WA 3FPAA 4Q7LA 4XIGS 4PC2A 1Q44A 3KB2A 1FNMA 4OYHA 2GWHA 3ZS9A 1Q22A 2HF9A 1KNXA 1SQ5A 5AR1A 3ZYCA 1KKMA 2J0UA 4DWJA 3KKQA 4LHWA 3G0HA 5B58C 2NZ8A 3QEJA 3UWKA 3GCGA 1CEEA 1S0UA 4JVMA 1ZUIA 2HEIA 5LBIA 4B47A 3QKRA 5JEEA 2FV8A 3MMPA 2Q0HA 5L3VA 4AKGA 5G41A 2GXAA 1IONA 1IY2A 1GDDA 1ANKA 2ECKA 4EPVA 4QGAA 2XZOA 2Z43A 2ZREA 3EPJA 1Z63A 4OHZA 1JPJA 1XP8A 3JZAA 5FH9A 5TVKA 2ASEA 2RB4A 2CBZA 4QL3A 2FFAA 2FG5A 4Q18A 1UBCA 1NBME
chains in the Genus database with same CATH superfamily
2GFQA 1JMVA 2VDUE 3GYBA 3MT9A 3RTDA 1TF7A 2YFQA 3CA8A 1IOVA 3F6CA 4XIJA 4TWJA 5TB5A 1KFCB 1X1BA 2G76A 2ZJ7A 3NGXA 2X0NA 3BG5A 1KP3A 3BJMA 3GEBA 2ZE8A 4ZALA 2WVHA 4E1BA 2XPCA 4DUGA 2WZQA 3BGSA 4RY9A 5BVGB 1DIBA 3DBOB 1QFXA 1R4MB 3AIIA 1LY1A 2GA8A 1ZINA 1YI1A 2ZE7A 4M6WA 5CA0F 4UJ5A 3GGCA 1ZGGA 3QLVA 3UJPA 3AI1A 1ECLA 4BUCA 3T3PB 4C0JA 4A3SA 1L4KA 1NNLA 2FR8C 1V9CA 2JCVA 3H3JA 4GSKA 4R05A 4Z53A 2HQBA 3FYDA 3KV3O 5E6UB 1K8ZB 1N2JA 3AJDA 2QG6A 4M99A 4JHLA 4KR2A 5AUOB 2YYYA 2AI3A 4FHEA 4D4HA 5D00A 2ZJ2A 4IH4A 3IUPA 5DXJA 4Y2VA 2I4MA 2E6UX 4Q1BA 2NZYA 2YN2A 5H9WA 3ZQ6A 4PRKA 1UPBA 2A5DA 3OE7A 1KSFX 1E60A 1CS0A 2XE4A 3TSOA 1DKOA 5AKGA 1M1YA 1Z13A 2ID4A 3IB3A 2QYOA 3P2EA 4LECA 4ZI7A 2VHYA 5G1PA 3UGTA 3KRTA 5GM1A 2DXIA 4JB0A 3GFBA 1Z29A 2LBPA 1DG9A 1GL3A 1YE8A 1YH3A 2H0QA 1UADA 2A0FA 3HY3A 3KPYA 2ZJ1A 3G8YA 2O8BA 4ZO4A 2XQVA 4CCSA 4Z5XA 1OWLA 2FSPA 3ZU6A 1CUHA 3M5PA 4K6GA 3C8ZA 1NXVA 2WOOA 2IHZA 4JWKA 4URWR 3DL0A 1XVIA 3GXBA 2B6HA 3WDMA 1BEEA 3K71B 1ZLXA 1BDJA 1UUFA 1ZZEA 3CLRC 3K30A 3M4NA 3HADA 4W63A 1L5NA 1SU6A 2O6LA 4LSZA 2NO4A 1LW6E 4IDEA 2BR3A 1JXAA 1YS9A 4JB2A 4KFCA 5LZ7A 2ZCUA 4QAJA 4LSWA 5TMDA 4G0WA 3USCS 2A9PA 3A6GA 4PLCA 4EI2A 4LQ4A 3SSOA 1EVLA 1RPTA 1NMXA 2AJCA 5KDDA 3IMFA 5DV9A 4U2EA 2OHFA 4U3JA 2W6PA 4UUMA 3Q3GE 2EZ4A 3K0EA 3W2FA 2JKVA 3QP9A 5DW0A 2AOTB 2ZTUA 3COWA 3B60A 3NC1C 4V2IA 4DDKA 3PXBA 4KX5A 1K6JA 1QK5A 4YJ3B 1J7JA 1Q50A 2ZQYA 2CXNA 1QIHA 2D1YA 4WNIA 5T4FA 4N9WA 4NDNE 2YV1A 2JJ1D 1L5KA 2A0WA 1ZAKA 2C4UA 2C84A 4L8FA 2RHMA 5PNTA 1N2CE 3RS8A 2C0QA 5F3DA 3C8UA 3TTSA 4OJYA 5H4GA 5DTMA 1JHPA 1HXHA 1WB9A 3A1VA 1JNYA 4UOZA 3JQ6A 4LDJA 5KHAA 2NAFA 1KH1A 3EVZA 3O1LA 3IRVA 1R8JA 3A1SA 1YCHA 1XRSB 2OVFA 3AM4A 3B1VA 3UUGA 4UD6A 1G5RA 3GW8A 3MUNA 2JBAA 3Q3EA 3P0EA 4WLVA 1FRVA 3QXCA 4POAA 5J59A 5FTKA 5LPNA 3DV0B 3QIVA 3A9UA 3FAZA 3IELA 3PDIA 4FXPA 3DGEC 4BLUA 3VO8A 4YI3A 3BQ9A 3OHMA 3HM9A 4HX9A 4LF5B 2P75A 3MILA 1EJ2A 3A1WA 7MDHA 3L4KA 4CL3A 4UU0A 1TF5A 1Y1SA 2CYBA 4MWOA 5REQA 4I1PA 3KQHA 2ZULA 3PHBE 3HZZA 4IIJF 5EIOA 1EFAA 3DXXA 3L93A 3ZUGA 3C6XA 3R1IA 4D43A 1SXIA 1P7ZA 5CCBA 1DQZA 3BGOS 5HCNA 4ZHSA 3WKBA 4DBZA 2XE8A 5CRIA 1CJVC 3G89A 1E1DA 4LDNA 4BV9A 5B7PA 2QLTA 1YA8A 3ZDXB 3K9BA 4MLCA 5E2AA 2W2LA 3VZPA 1ZVJA 1CDZA 1U3TA 16PKA 1FL9A 3KXLA 4Q4LA 4QGFA 1PAUA 3ZLJA 4FMCF 1H1DA 2OOKA 4H6VA 3OZFA 4LFCB 5TIIA 1QR6A 1G6HA 4Z0TA 3U31A 3HVIA 4S12A 1VL0A 2RI1A 1GPLA 2XB6A 4L5BA 4QOEA 3QVVA 2CDCA 2JA1A 1ID1A 1HFJA 4RQTA 5TNXA 4BVEA 1L1RA 3K1JA 3L7KA 4KQMA 3GH1A 3PEUA 3L92A 1U3VA 4WZAA 5JAOA 3DWEX 1Y3IA 2WJVA 5EINA 2DPGA 3PX3A 4DLKA 3RTBA 3ZW9A 4L8WB 2F00A 5LQJA 2VKTA 2FX3A 1MF7A 2A0YA 1WMEA 2ID9A 3QPCA 3MFQA 3UZUA 3MNFA 3ZS9A 4BO8A 4CQMB 4LXQA 1YKGA 1DGQA 4AF6A 1QPZA 4RCVA 1A95A 2IYZA 3ENKA 5JSFA 3E9ZA 4JZKA 1ZK1A 1TKRA 3HY6A 3KL4A 4G4SO 3PGXA 4J7UA 3G2KA 3LUFA 5C3MA 5C4IA 3AGQA 1CIPA 3K2EA 2PSEA 4GYKA 4I4IA 2J9FB 3WADA 3ZY4A 2O3JA 4CTKA 5B12A 2WKWA 2IZ6A 1HRKA 2GZRA 3RRXA 4ZDIA 3DFZA 3HO1A 3A6PC 4YDQA 3H65A 4TMYA 2XJ9A 3OOEA 1U1GA 2JAQA 3M4XA 4GBGA 2PUCA 1H23A 5JT1A 1B93A 4PPQA 3MG9A 4OHYA 1JLHA 1K2WA 3AF1A 3HR8A 4NCNA 1DIRA 4W99A 4FN4A 4NZ9A 1YR6A 5EC8A 5D86A 3A2MA 1J9EA 4FYWA 3WY9A 3OPQA 1QO0D 4Q1FA 4E70A 3NEYA 4NMWA 4V3CA 3CVYA 3FFWA 4QHSA 1TX4B 1W0CA 2LW7A 1QRSA 3VR3A 1XB2A 3BD9A 3E0XA 4OHKA 3VKFA 4WJLA 4X41A 3Q12A 1JWLA 1MQAA 1YSCA 4WFQA 3GLFE 1POXA 3PFNA 1Z5NA 2IBTA 3HB5X 4DDTA 3CLVA 2W6ZA 3B82A 3EOZA 4FINA 2WPDD 4A2PA 1W5SA 4ZD6A 2ZBPA 1BKYA 1E89A 1G98A 1P7PA 2OHVA 4OSPA 4ZCQA 3PEYA 3LT4A 4UZEA 5DM70 3TB6A 3H2ZA 3FCAA 3L43A 3FUUA 2NQ8A 1E0KA 4GF5A 4GZLA 4R2KA 2VG8A 4OMUA 2X1VA 1PU2A 3USES 1JS1X 1VP3A 4DDMA 1OH8A 1HEYA 3FFAA 2HT6A 3NHRA 1VI6A 1EDBA 2C8JA 2JVKA 2V6BA 5FUQA 1SVLA 4GVLA 2EL7A 1YFJA 5FOSA 4P7GA 2XCQA 4W9NA 1QGUA 2V5UA 3UTDA 4ZZIA 5EJMA 2VPTA 2MDTA 1UJ4A 1ZMTA 2R8XA 3UMCA 4DV4B 2Q1XA 4HTAA 4IMIB 1UOEA 2YHIA 4BVKA 2YOFA 4US0R 1V3TA 2QP3A 3OX3A 1XMJA 1UKZA 4Y3UA 4CM1A 1JKFA 3M33A 4YFVA 2J59A 5G0VA 5LSAA 1DARA 5KNLA 4TV8B 5EHNA 2QBYA 2PYZA 3FGOA 3ZDZB 4N40A 2FEXA 3BMCB 3O3CA 4X60A 1VCNA 4IEFB 3KD2A 4OL0A 5K51A 5KPDA 4RU1A 4XQGA 3EZFA 1CRPA 1M5TA 2VO1A 3PXAA 1KR5A 2CNOA 1DXOA 4TTIA 4DV0B 2DLDA 3HTXA 2HGSA 1GA1A 2ZJYA 3FBGA 2DRIA 1MGPA 1ZM7A 5TEWA 3GIDA 4L73A 4E22A 5DLQC 5JQGF 4WXRA 2P5YA 1T8RA 3I9JA 3CRNA 3DDSA 3VA7A 4YRIA 4FOSA 5GGXA 1P9WA 3OM1A 1UXJA 2XBUA 3CUTA 3AR7A 2ZSKA 1MH9A 1VYUA 1WLYA 3K7EA 4HQ0A 4FOPA 4YV2A 2OUKA 3L9XA 2VPQA 1KFEB 1L7MA 5DSTA 4E11A 5ALPA 3TUJC 3WHKA 1BHSA 1GRNA 3KKOA 3RB8A 1MB9A 2JIDA 1WCV1 3A7EA 1CR4A 1EK1A 3B20A 3DHEA 3KKKA 1UQUA 3OPVA 3OY7A 1EAMA 2X2EA 4BFZA 2Y9MB 4Q05A 4JP5A 3DWFA 4IIHA 4V1CI 4O4LF 2CJWB 2JBWA 3D0QA 2IIVA 5LNK1 3GJYA 1TL7C 3FN4A 1F12A 4QJ4A 5DBHX 2CUNA 5GADl 3DWIA 3KP1A 2J4CA 4DY4A 3I1JA 1A69A 1W35A 3C5EA 3DL4A 1NKTA 4BLWA 3DC2A 3IILA 4FX5A 4MR7B 3I72A 2QN9A 2CL6X 2IZ5A 3LMKA 4WY2A 3R7FA 3UFXA 1FFCA 2XIJA 4UASA 3RFCA 4D3XA 1WZNA 2QA5A 3RUIA 4XWOA 1TUGA 1BS9A 3EY9A 4DBVO 2I62A 1PI3A 1L4LA 3P5BA 4FLMA 4XW2A 3EB9A 2H59A 1UBFA 2ZWPA 3G2OA 3NR2A 2YWEA 3ABQB 2UVPB 1G3MA 1YB1A 2RK3A 3WGZA 3NJ4A 1RRGA 3CFYA 3WIVA 2RHLA 3BRQA 3BSSA 1BMFD 3EVAA 4ROSA 5CCEA 5KNCH 2OKGA 4MS1B 4E5SA 4DBLE 4ZYTA 3E7DA 1ZGJA 1KOGA 2ZRJA 1VJ5A 3L79A 3KAQA 1G2PA 1DX6A 1NW3A 2WIFA 3G2NA 3PNMA 4KUHA 4Z1MA 4TT3D 3WNCA 1J8MF 1M2HA 4GC5A 1AGNA 1EFKA 3B1KA 3BK7A 3HKDA 3I8OA 4Q4DA 3AB3A 2AWNA 3FSGA 2PUVA 3S2YA 1L6RA 2CV1A 1USWA 2QTFA 4ZOCA 3KS9A 3A1DA 1E9FA 3U6BA 4QDTA 4DEYA 5C31A 2HCRA 3H5VA 4B45A 2ZZKA 1Z47A 2AXPA 2OG2A 1T5OA 1KYXA 1NBWB 4GX0A 5ALRA 3SEQA 4RVDA 3FCXA 4O2AB 4Z7OB 3DOFA 2OZEA 1UKAA 4NZNA 1P2BA 4B8WA 2ANCA 3K70C 3K9CA 4LWPA 4PCUA 2WHXA 2OMKA 3HCDA 5FO1A 1U81A 2ZYAA 3E81A 3W1WA 3SF8A 5BVHA 3PX7A 1NVUQ 2V45A 1GYPA 3IOEA 2IW1A 1YR3A 2Z1NA 4I6GA 1W25A 5EXSA 4CT4B 4OMCA 4AN1A 2WG0A 5EUQB 3UWOA 3UYLA 5B7GA 3THYA 1PVVA 2JFYA 1JG6A 3PJDA 3WB1A 4CLEA 1BO6A 4H3HB 4DE5A 3PFKA 2WMYA 4IXDA 4JGIA 1QP0A 1UP6A 4PZPA 1G9XA 2QYTA 5HTKA 2FRDA 4AL4A 3OWHA 5GIOE 1OTXA 2I1LA 4W8OA 3H6HA 3UCFA 3JAWA 3ZCQA 4QD3A 3V8QA 2PBFA 1Y9JA 3KLPX 3N39C 4ZYYA 4F11A 2BEWA 4JMPA 1IWBB 2XVXA 1DOZA 2IPNA 2NTEA 5LQSA 1XRMA 1J6UA 5IBRA 3LE8A 4OREX 4HWTA 2IS2A 1L9XA 2O5CA 2R85A 4Y2TA 3B8EA 4MLDA 5KSWB 1JA1A 1ZI9A 3L0SA 2ET6A 3W3ZB 1D07A 3Q7EA 2OCXA 2PKYX 3VNBA 3CQ9A 3QU4A 3RIEA 4I0WB 1CF2O 4P5EA 4E0BA 1GKKA 3M5DA 2GZDA 2JI6A 4NPHA 4PAGA 1A98A 3EFOB 2ZIVB 1H5NA 4DF3A 4TZ6A 4W4TA 4AUMA 2FVYA 3ENWA 3AL0C 1F0YA 4GGOA 2P1ZA 2C2WA 3FUXA 1CR1A 1I1QB 1O3YA 3VVMA 1X2BA 3FD8A 2WLSA 2H85A 2EZ9A 5GTDA 4FWBA 4R5HA 2QRPA 3PXEA 4IKEA 1PR3A 2GVNA 4U2KA 5KMGB 3OPYB 3RBAA 1OXUA 1JKJA 4JK3A 3G49A 4TV9F 4HNUA 2PA3A 1O9GA 3DOCA 3RVJA 4F8EA 5JDCC 1JMYA 1MLDA 3OO1A 4G2NA 2GCIA 4RJLA 4X3PA 2MSDB 5CT5A 2PXXA 2XWJI 3TMKA 3SY8A 2L2QA 4HUQA 1VCMA 2C5BA 2J87A 4B09A 2OHXA 5KYVA 3RD5A 2XV1A 4I3GA 2IV2X 3IV7A 3KKZA 3VI3B 3AVXA 2IBMA 3VNRA 4O0LA 4R7ZA 2VP4A 1PRYA 1DIHA 2WSLA 3AW8A 1CUEA 4JR0A 4RIFA 3NTLA 1UOPA 4X1IB 4BNIA 2QD4A 1X1QA 1YCFA 5ABPA 1N8KA 4X1KA 4YMGA 1E3SA 2ST1A 1IN4A 1PE0A 4PHFA 4U4AA 1KMQA 5DTRA 1U4SA 2AJLI 3VR5D 2ATVA 4X7RA 5FWAA 3JQ7A 3JD3A 2ZYGA 2M6KA 3LLSA 4IDHA 4DC0A 1TKAA 4YIHA 3RFTA 2O7SA 3SHVA 4NYJR 3SJUA 2RBEA 1VHQA 4P98A 1DOAA 4LY9A 3K0AA 4TL6A 3RC3A 4R71A 1X1SA 4J16C 1YB4A 3CIFA 3PQ4A 3ESCA 3PRJA 1NJSA 3DQQA 4X66B 1BCRB 4GRDA 5DN9A 3OEED 3DF9A 5K8TA 4K81B 4MQ4A 2P2DA 1U7ZA 3Q3CA 5JCXA 1COWD 2O1SA 4FBGA 3FWYA 3LC0A 1FU7A 1VI5A 3ND8A 3ASYA 4GOXA 4AZ3B 1N7IA 2X5XA 3MT7A 3SIPA 4MUMA 3UH1A 1Y5LA 2GZ1A 3I62A 3GJ4A 4BNKA 1DKMA 4DLRA 4IHQA 1MX3A 5FWNA 4LCEA 2RH9B 4EW1A 1N9ZA 2HV9A 4ND1A 3UXYA 4M37A 2X8JB 4PZZA 4AI6A 2ZSHA 1JQLB 1RJFA 1T9KA 2VAXA 2JEOA 2Q3EA 2V7VA 5TPWA 5LKRA 2OXIA 5IWCA 3ZXXA 4E7PA 3WK4A 1G4UR 4HVLA 4QXAA 1SU8A 2E6KA 2HH9A 2QPOA 4F9TA 2VDMB 4QGHA 4KYTA 5C1IA 3F8TA 4F86A 3PTAA 1ZHOA 3TMAA 1L5QA 4C29A 1N4DA 2DY0A 2CFTA 4CU5A 1DUVG 2PHZA 3INNA 4EQ6B 2JNWA 5AVKA 3X44A 1QFYA 4MGZR 3FXAA 5HZGA 4F5DA 1A2QA 3E53A 4MZXA 5KOJB 5DM1A 2P77A 1DWUA 2Y6VA 4RSRA 2IOFA 3GG9A 4KLCA 5F7JA 4LAFA 4ETNA 3LQ4A 1BX1A 5EQFA 3W2HA 3H4VA 1UBSB 2QR2A 4NMMA 4U9UA 2BP7B 3BHNA 3I58A 3PUIA 4HQKA 2PMEA 4CM8B 5AKKA 4ZYZA 3ZQKA 2J5BA 3N87A 4R8MA 1Z25A 1NQUA 2Q6KA 2WF5A 3LQKA 3OSZA 4FDMA 4B84A 3VAYA 5ADHA 2VTBA 2VJMA 4EB6B 4U8GA 4W6QA 4HDAA 2YWJA 1RQLA 4MW1A 3GT0A 2AOUA 4KVFA 1RRPA 1GDTA 3QRWA 1Q1QA 3LPNA 3OIFA 4TUYF 4KR7A 3G2HA 1QONA 1QFSA 1RBMA 1WPQA 2R62A 1W5EA 1AC5A 1NQ5A 1ORIA 4FMBB 3UAOA 5CDGA 3RRMA 3R5SA 4YUZA 2V3WA 1JI3A 3PC2A 2AW3A 1OPRA 1KZ1A 2EIXA 3VU9A 1XCMA 2QI9C 4YCBA 3ZY6A 3QEBZ 3EZLA 3ICWA 2J3KA 1LLUA 1QZXA 1WCIA 3R7NA 4JI7B 2JH8A 4COKA 4IFIA 2P3QA 2BAGA 2HNBA 5DI9A 2UYCA 2GRAA 1UT5A 4WKNA 4A6XA 1YKFA 1QMGA 3EUFA 4Q15A 5EMJA 4K88A 2Q8NA 4RMIA 1TW2A 3O4HA 3QVMA 2ZBDA 4LY0A 3DEZA 1YHZA 4BO3A 5G0WA 4IJ5A 3NKFA 4RH0A 1Z3IX 2X5KO 3TD2A 4KVGA 4OKSA 1RZVA 1ZJYA 2DLNA 1JHMA 2GTHA 3GFOA 4PSVA 4ZVUA 4D9JA 4D5GA 5KJ1A 1THGA 2BGJA 3HM2A 2W2MA 1U7XA 2QM0A 4B0PA 3OEHA 3FF1A 4UEOA 5BSEA 5A3SA 2CXSA 3ITKA 3TKAA 2ZIGA 3G02A 2PR7A 4INPA 1QHHA 4IS2A 1XUOA 2HSDA 5IXYA 4QIHA 3ZBTA 4B76A 2ZI9A 3FTNA 2NUPB 1T2EA 3OTIA 3R3SA 1TT5B 2R751 2WPNA 4L4XA 1AE1A 4GPTA 1I7SB 4NCBA 4GLOA 4X6YA 3QV2A 4MYHA 4ZEOA 2O3RA 5GOTA 4CG3A 4JL8A 4D8WA 4DR3B 5CA1B 3WGGA 1DRVA 4B9EA 4LZZA 1IM8A 1JAYA 1V4NA 2FSSA 3DEKA 5B37A 5AVVA 1WBBA 4WCFB 2F55A 2NVUB 3E3AA 1M2WA 2IXFA 1NLFA 1LK0A 3HA7A 3RVBA 4G1BA 4UFNA 4DRXA 1TCAA 2FTKE 3QWFA 5CFQA 3EEYA 1WETA 3LFTA 4ND6A 5CT9A 5E6RA 5HXAA 1Y4DE 4B1FA 1EFLA 1A9XA 1PX2A 3R09A 4MYTA 4IDAA 2BJVA 1NX9A 4O4JF 5F1OA 2XVYA 3M1LA 3WAJA 1R27A 1Y3BE 2GCOA 3N8NA 4OXIA 1D9XA 3K6SB 1HOXA 2FK8A 4N0MA 4V0NA 4LJAA 1BFDA 2GSDA 3OQVA 2IYFA 5A4MS 1FJXA 1JHZA 2EX1A 2F8LA 2L0XA 2IOYA 2HBRA 1ZO8A 4RX1A 4MAFA 1AQIA 2GR9A 3LPLA 3P9XA 5AI9A 5UKDA 4ZVLA 3UFBA 4MR9B 4C1NA 4FEYA 3CWCA 1W59A 3COPA 3D64A 2ZYRA 1YB2A 5K5EA 3I6IA 3OA2A 3NGLA 2JKYA 4P36A 1WUIS 2FN4A 4LYHA 5B1YA 2XMZA 4TVSA 5DHRA 2EJCA 2II6A 3ONWA 3N28A 2WJWA 4FZVA 3IE1A 1T34A 3COSA 1CY4A 3HB1A 5FL3A 5IUKC 4S1VA 5JCZA 1Y6ZA 2OBMA 3JARA 4EENA 4GOLD 4JLAA 3RSLA 1NYLA 2ZJ8A 3V8VA 1DKNA 3UG6A 3ELWA 3O1HB 3NYQA 1KI6B 4URUR 4CKWB 3A6EA 1NM5C 3DH0A 3IP5A 2ACWA 2HDWA 2X14A 3ND9A 3GJ6A 1MG0A 5IEBA 1ZM3A 2CK3A 1FU4A 2HDOA 5C3UA 4BMDA 3NGMA 3RU3A 2H5IA 4DJFC 1XALA 4J90A 2AG0A 1CUJA 2QQGA 4DIDA 1XAIA 4K0KB 4RTJA 4CHTA 3CR7A 2DUJA 3F5QA 4GBMA 1Z6QA 4DLLA 1JE0A 3L1VA 5B6JA 3TUZC 2NZ2A 4OI0A 4DLZA 3IUJA 3QEKA 2J9RA 1NI3A 2O2ZA 3C98A 3U13A 4LC9A 3PNBA 5IZCA 4PYRA 3ED1A 5K2OA 3KU4A 1DSSG 1ONNA 1SIUA 3SHOA 2QVGA 3ZDDA 4DDHA 4OCZA 1NU8A 3GJRA 3ZIAA 3ZV4A 2ZI3A 1MJFA 1SXJA 5KOHB 4HDSA 4X3CA 4AX8A 1YRWA 2PSSA 2OO7A 3HCWA 5JR3A 5K45A 1P73A 4LYFA 4RVGA 2X1LA 2IL1A 1YO6A 5D6OA 5M04A 3LU1A 4A0GA 3NETA 3ZWNA 5CURA 2A35A 3KBOA 5AJUA 1RWOA 5F4ZA 4KKXB 1UPFA 1R0ZA 2GT1A 2IKSA 4QC2A 1E5DA 1A5TA 3C6MA 2X1MA 4GMKA 2X0EA 2HPVA 4UBIA 5FR2A 3VYTB 5FIUA 4BX9A 4YPOA 4YYZA 1G20B 3KQLA 2GAAA 4NC9A 2OLJA 4OP2A 5KQLA 2YFKA 3AZOA 3E03A 4E15A 1JAXA 2WIJA 3A9SA 2RBGA 1YR9A 3EIEA 5GPBA 3UHOA 4NFYA 4M7PA 5IWAB 2P0AA 2VJYA 4LX0A 2K6GA 1Q2XA 2BMAA 1UT8A 3ROXA 2ZXUA 4XCQA 3NTQA 1HO3A 2CXUA 4V03A 2HBZA 4M9CA 4CKCA 3C5HA 1NLMA 5IN4A 3C6QA 4OQLA 1Z0SA 5JCJD 4AQDA 4BRSA 2AA3A 1LK5A 1XFAA 1JFSA 1X3LA 2B9EA 4XUDA 4YFYA 4OL9A 3RJZA 2H3HA 4B3HA 1P1IA 4RABA 3FPKA 5JMPA 1GGMA 2POQX 3WIDA 5SZJA 2Q1YA 4AO8A 2W22A 2IDMA 3NHLA 1I3LA 1RM3A 1UPXA 1T2CA 4U7GA 3PD1A 4MDHA 4FYXA 1XLWA 1JL3A 1QV6A 1EFDN 4K03A 5I4IA 4ZQIA 3RSQA 4YP5A 1WD5A 4QQFA 3C3DA 4DJDC 5AW2A 1XTBA 1IJBA 1Y9DA 4TMFA 3RJMA 1NN1A 5EIFA 5J2TF 1E5TA 5JNUA 3PYXA 1OBOA 1TUEA 3T35A 3HYRA 3KCQA 1IZ7A 3HL0A 1US8B 4TQUS 2C9DA 3JVDA 4MV5A 3UJBA 3C3EA 1Z6YA 4ATNA 4PHHA 4XWKA 3C5WP 4AN4A 4I1RA 1RXEA 1R16A 1N1GA 3SCZA 1UEJA 2GCGA 2DPMA 3D2CA 4IIFA 1NVVQ 1QQ6A 2ZQZA 5LYJA 1QYXA 4QO8A 5BOSA 4LF6B 2G09A 4UUOA 4KN9S 3RARA 2N47A 5E0OA 3Q3VA 2P6NA 4ERNA 5BRAA 1RR6A 1K4YA 5TR9A 3OQOA 4G4GA 2Q3LA 5LQAA 1UFQA 1NUAA 1S1MA 2OBLA 4RV5A 4IV0A 4UXIA 1H85A 3TH5A 3VBCA 2YV3A 4EHLA 3HUUA 5HOEA 4UHKA 4K9QA 2FJ0A 5DP1A 1FYEA 1Z0KA 2QE6A 4U2GA 4ZAZA 4RIEA 3SZLA 1KVTA 1TQHA 2AXQA 2HTEA 2LKDA 2VWPA 3AO0B 1MOQA 3NEPX 1XXHA 3HDJA 3WNVA 4F7WA 2GPAA 3WWDA 3DFUA 2PZGA 1ODKA 1L7AA 4FFMA 4S05A 1TPYA 1EUDB 3O5AA 4DLWA 4CXMA 3OU6A 4R9NA 3UGKA 4EBFA 2DWQA 2HF7A 3QJGA 3CZ9A 2BEUB 3T0GA 3E35A 3L41A 4ZEMA 1B0UA 1HLGA 1Q7RA 1K75A 2I22A 3MWDB 2I7DA 2NTJA 4LVOA 3DZJA 4L72A 5AQEA 5BUQA 4AY2A 1PR0A 2OR3A 2ZJAA 3D5TA 3NH6A 4OUKX 4OP1A 5ALKA 2RC6A 4TN1A 3VFDA 4ZOQI 1T0IA 3JTMA 2O59A 1K66A 3F6BX 3GLQA 3GVXA 4L85A 5AT1A 3JQDA 1SEPA 2ZYIA 2Y2UA 5CBPB 5HPYB 3T0FA 4JP3A 3I3OA 1USVA 1EEHA 2IC5A 1ZRSA 4Y9DA 2G7ZA 4RDHA 3IUYA 1TQDA 4UAUA 4R1LA 1M6EX 4ALKA 2SKCA 3CIOA 2VJAA 1EVQA 4FZJA 1H6AA 4GAEA 4J3FA 3E1KA 5EA2A 4E21A 3NONA 3UAWA 5EJEA 1D0IA 2XUJA 5JSQA 5DLEA 1YONA 3U3ZA 3KLMX 4EA9A 3S2FA 3KQVA 3EA5A 4IIUA 5AIAA 3V4LA 1Z34A 3WVNA 5K8CA 5L7TA 2GLXA 1WV0A 1L3BA 3ETCA 4HNSA 2ID7A 3K31A 4KWCA 4JIGA 1ZJ6A 4OSEA 3INRA 2W8BB 4MKXA 4PPYA 1ND6A 2GERA 2VZLA 4ISCA 4D4IA 3ZD8A 1HEIA 3UHAA 1E79A 3PWKA 1JBEA 4PIVA 1CQIB 1VL8A 4HLUC 4YJ3F 1OUMA 3O4VA 5HW0A 4K6HA 1DEAA 2OC9A 1DJPA 1QG6A 5KYYB 1L5VA 4R5MA 1UT6A 3A37A 3GFVA 2OYSA 4QELA 4EJ2A 3TGLA 4JYMA 4OFWA 4V0OA 2X0FA 4S1WA 5F64A 1NIJA 4F4CA 3FB1A 2Q5LA 2H8GA 4JIMA 3OCVA 3VTAA 1KYTA 2N75A 4AD8A 4E88A 4JT4A 1WS6A 1KJYA 4Q9DA 3ILYA 3G2JA 3QXHA 1MN6A 4MCJA 4YCCA 5IJ0B 3CF0A 4LF4B 1Z33A 3VKWA 4NDAA 1BZYA 1XKXA 4BNTA 4Q4CA 1PTJA 1FS6A 3LT0A 5KTSA 2JLXA 2N3ZA 2ILTA 3ZTWA 4B7ZA 2FDCA 4WT7A 3EPLA 2B7LA 3GLIA 3E5HA 5CYGA 3REFA 1JAHA 3KUKA 4C0BA 4RMHA 4EG8A 3ZVNA 4MA5A 1SUPA 2JJ2D 5CDYA 5B55A 4JNCA 1KY4A 3LT2A 1W2GA 1E1KA 3I8SA 3K8QA 1JVBA 2Y8EA 4H59A 4MB2A 4R01A 3ZX4A 4EA7A 4Z4GA 2QD3A 3EF0A 4H0CA 4LYAA 4NI5A 5ED4A 1SC3A 1Z08A 3BWYA 4GNRA 3GRZA 4LRXA 3L18A 3ZCSA 4Q3BA 1FDOA 2A9VA 1KVUA 3QQ5A 4ML3A 3ULKA 3WO0A 1AV6A 2JRLA 2AS0A 3GG2A 2IYWA 1NJ8A 3QUQA 3U7RA 4YT4A 2QRJA 4P1ZA 2A9FA 1P33A 2WWRA 3IE2A 4DQLA 1JYEA 2Q99A 1DAOA 2EZ8A 4KAXA 4ILKA 2XKKA 3T3EA 2BMDA 3SS7X 2OWEA 5LQRA 1KMHA 1ORRA 1QH8B 2QL9A 2R4QA 4C3OB 4CF6A 4DHEA 1Y1KE 3V2GA 2O4UX 4V3BA 4Y6OA 5KB3A 1QH1A 2XDWA 5K7SA 2FUKA 5L4LA 2VK4A 4KXMA 2V7WA 4RPIA 1SVIA 4GI1A 2BEJA 2VCYA 1KGDA 3GLHB 1ECPA 2F8TA 5FWYA 2IEDA 2BDTA 5JVDA 2QG4A 5EVCA 3W5AA 4ZZ0A 4H31A 1DJMA 1NPTO 3UMJA 2I1VB 3QWBA 5L95A 2VJDA 8ATCA 5A3RA 4OBWA 4YDHB 4G5SA 2DWOA 3CF6R 2PANA 4EA8A 4HY3A 1D2HA 1ULTA 2F1OA 2XWBF 3LO5A 4MR7A 2W58A 1I2CA 2WG1A 4ZRMA 1SC4A 4HADA 4NQZA 1BQEA 1BH2A 1YNOA 3QY9A 3PPIA 4F1JA 4KMRA 5BXYA 1C4KA 1SULA 3DR3A 1HV8A 2W6IA 1SCQA 4V2UA 2OGZA 2ZU6A 4FW8A 2WM8A 3SAJA 4J94A 4MVXA 5IX8A 4UE3S 1KJZA 2J48A 2H18A 1HE4A 5EWLA 2NO1A 4REOA 1IY1A 2HPZA 2NU7A 2PMKA 1P1CA 2HN9A 5FULA 1LBSA 5FHQA 3G9UA 1M6YA 4IVRA 1T5BA 4RZQA 5DYTA 1LS1A 5TMBA 3W5UA 5LJIA 1IY8A 3GPLA 3A58B 4UHCA 2Z2ZA 4EO4A 2O50A 4EI8A 4CM4A 5G1NA 1OFIA 3AHJA 1RBYA 1M8KA 1WPGA 2MSLA 4JT2A 2RGAA 1LX7A 2UUPA 3MCVA 5D8DA 4DM3A 2P6OA 2B5WA 4JMLA 3AIOA 5AVUA 3A2KA 5IYZB 1K6MA 1NOKA 2EKLA 3V7WA 1AURA 1E5XA 3H42B 4FE7A 3IPCA 5F3RA 3SNHA 3EEQA 3MAJA 4RJTA 4FX2A 1H0SA 1CBUA 3KSAC 2ZIXA 5GJCA 2J9YB 3NTUA 5DW3A 3DLCA 4FW9A 2C9CA 4KLZA 3R5FA 3WL3A 1FMCA 4QULA 2MSCB 3H84A 1EXDA 1GZHB 4KGVA 4JN6B 3KVVA 2FWBA 4P93A 3ILHA 5EQJB 4C78A 4ZYLA 3HJCA 4C87A 2JI8A 3TQQA 2HL6A 3WMEA 2DUNA 4XYMA 1F2VA 4Z1OA 2PYDA 4B7AA 5C81A 1YJCA 4ZJZA 5EJ7A 1Z45A 3W78A 4Z86A 5K99A 1KC3A 2EKDA 2C98A 3WGQA 4P53A 4I9HA 1UKCA 3K8YA 3TTWA 1L5RA 1XAJA 1J7KA 4YUVA 5B1EA 3FNGA 4HYYA 5DNWA 3WV4A 4BOYA 1OHHD 2GTPA 3UGQA 5JV5A 4PFQA 3P45A 5ISMA 2GYUA 3CG0A 2XGOA 1WP9A 2EKBA 2NZUG 4Y67A 5CNIA 3EVFA 3VO1A 2GKGA 2XRYA 3EJWA 4XYLA 4U5XA 1Q95A 1EG2A 4TTPA 1E3JA 1R6UA 2A4MA 4ZP1A 1SUEA 4N65A 4S1OA 3W7VA 3FFXA 4LIPD 4TV8F 4PRYA 1FXUA 1UK6A 3CXUA 3OQPA 5GVSA 4LCBA 2NUAB 1MA0A 1I6LA 3P9SA 3RT7A 2IV3A 3DZKA 5LU9A 1DADA 3T5AA 4JLUA 5C9ZA 4PYJA 1ZIPA 1Z8DA 2BE9A 3KOXA 2HADA 2XE7A 4XYEA 4KRFA 2FMKA 1KS9A 3AM3A 2HUPA 5B4VA 4DNPA 2B69A 1P7VA 3BMNA 3E05A 3V7UA 4JNKA 1KAEA 3VYRB 4MAAA 5IJ9B 3WNZA 3H1TA 5JAPA 3BMXA 2PGOA 1RJ9A 1Z0ZA 4IJWA 1QMPA 2X5JO 3T7EA 5BUCA 3M6WA 4W9NC 3PDWA 1YS6A 4EUEA 3G0OA 4NV3A 5HK8A 4CKXA 4NEHB 1AMUA 4Z6KA 2Z58A 2PJZA 4TXMA 4KWIA 4WA8A 3LIPA 5AHOA 3NAZA 4MWGA 1IRIA 1UKYA 3AETB 3MF4A 1I6WA 3O2SB 1OKKA 3AOEA 2JD0A 3F46A 3LLVA 5LDGA 4MP3A 4B3DA 3ZWDA 4ADSG 1FTNA 4ZT5A 2V3CC 1WOMA 2IVZA 2DCMA 2NSYA 4TRNA 5D3ZA 5IBPA 2Q3FA 3AUSA 4KAAA 3ICEA 2JZOA 5EIBD 2P9CA 3M3DA 1C0IA 4Y1FA 3VRHA 4ND8B 1M6NA 4OAQA 3KTFA 4C5BA 4HXGA 3IQFA 1Y3HA 1SKUA 1P3DA 1Z28A 1WKCA 4LOIA 4LJ9A 4EVSA 2BKXA 4DCMA 4EEXA 3F98A 1BE0A 1EP9A 2UU9B 3CX7A 3HDTA 4M8SA 3T94A 2PWBA 3TZEA 4BLSA 4MOWA 4G0ZA 1QK3A 1Y3CE 4UARA 4ZK2A 1Z36A 4TLCA 2IGTA 2P2SA 2DWCA 4Q6WA 3KNZA 3HN6A 2EVWX 3CZ5A 4DMLA 1AKQA 3N5KA 3NHKA 5BQFA 3G3EA 4NWIA 5DISB 4BO5A 2IT1A 4YUWA 4ZV4A 1D2RA 2OUIA 2W00A 3KDSE 3C3MA 4O33A 3QK7A 4YAUA 2RGUA 5C7OO 5IKPA 2R7LA 3KIPA 3A6JA 1V9SA 4AM8A 1E1MA 3DULA 2C7VA 3LXUX 4XYGA 4B5LA 1H1LB 4ZOAA 3IESA 3RYFA 4TSRA 1IZ9A 2EFGA 1MABA 1TGVA 4JU8A 2CMGA 1T5HX 2PH7A 5FYDA 4F2WA 1TIKA 3NBUA 4B85A 1A77A 4HAXA 3FNBA 4O2AF 1D2EA 2OQRA 1BGVA 1FVOA 1KMIY 1FLNA 2RHBA 1LXCA 3CYFA 2VPZA 5EUCA 5KJCA 3O8BA 1NVBA 2VXBA 2VUHB 4Q1DA 4MUXA 1IHUA 1Q17A 4Y6SA 2VAMA 4YIKA 4A2QA 4R83A 4EYQA 4ED9A 4ZTUB 2NNWB 1RYHA 1LQ2A 3DAFA 1UWVA 1Y3FE 2FHPA 1DC8A 2V4ZA 4P3XA 2WYUA 2HZBA 2NT3A 3BHJA 3I04M 3T12A 5HKKD 3AUJB 5KKCA 1MRNA 2I2WA 3GGJA 3PSHA 2ZATA 1GKUB 1B42A 5P21A 2XT9A 2J0QA 4AQ7A 2CT8A 1R37A 3IQDB 5KDOA 4EYEA 2UUAB 3L4JA 1V8OA 1G2QA 2Z4SA 3JQRA 1J0CA 1DFGA 2HA2A 3KTAB 1ZGBA 3D3WB 4XIYA 4XM1A 4ZQHA 5IUJC 3FYUA 1YZTA 4BHTA 4OK6A 1KFKB 1EGVB 1N2OA 1Z0JA 1L3CA 1X7WB 3AV0B 5E7IA 4RM2A 3W5VA 4YGXB 4DRZA 1G8MA 1CUVA 2WHPB 5HIJA 3B1ZA