3KQNA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/dna
total genus 154
structure length 437
sequence length 437
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqnA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqnA01
3TQCA 5CIQA 1G7RA 4RY2A 4MGYR 2PLRA 3ZH9B 1NKSA 3KB1A 3HU3A 2ZI9A 3QXJA 4KBGA 3KJGA 2C96A 4Q03A 3THWA 2OM2A 3RRZA 1KZ7B 1NMXA 4ARZB 3T34A 3GEIA 2AFHE 3NBYC 4WZBE 4JT2A 3U3RA 4CYMA 4TYNA 4URZR 1A2BA 5AJWA 2IS4A 1XCMA 3OFNA 3BRWD 2CL0X 2ZS8A 4OHZA 4D0GA 3VR4A 1U98A 4DCSA 4CZ2A 3W8RA 1E2FA 4Q4AA 2GK6A 2YHSA 4QGHA 1KI4A 2GVZC 3A1WA 2Y8EA 3CZQA 1MO5A 4GOJA 4R9UC 3ZGXA 5JHHB 4DLVA 2J45A 5CLQA 3RS0A 1AA9A 1EFTA 1OFTA 1IBRA 4CF7A 3WBKA 2F55A 3SDZA 3M4YA 4A2PA 4DVGA 1LF0A 4N3NA 2QTHA 3PEYA 5L3QB 2CCGA 5EE5B 2DFKB 3UKDA 4L5BA 2W6JD 1NLZA 3G5UA 3X2SA 4BFXA 1VYUA 1YZLA 4DSTA 1SHKA 3B5JA 1XTIA 1NVVR 5BQ5A 3VKWA 5IDVA 2V6JA 4D82A 5JZVA 3QOFA 4Q1CA 2RGGA 3QEJA 1MABA 1P75A 2O8DB 1NP6A 3MUFA 3C15C 4TL7A 1JECA 3QUSA 1AIPA 1CBUA 1WXQA 2FFBA 4NYJQ 4AC9A 3B85A 4BRWA 3LX8A 3U60B 2I1VB 3KQHA 4CEHA 2G1JA 1A82A 3B78A 5BYJA 1BYIA 2HUPA 2ZRGA 3H0KA 3H2YA 1OPXA 1ZCAA 1VCOA 4E09A 1LNZA 3K09C 3EPKA 3EZ2A 4HATA 2ZJOA 2D7DA 4Q1DA 2ZI3A 3O47A 3VAAA 2CHQA 3ZYCA 4PQFA 3AVWA 3A4NA 4DEYA 4ZI3A 4I1SA 4R7ZA 3WYGA 5EE9A 1Q12A 3U7FB 2G0TA 5FUYA 3IPXA 3SZRA 1KI7A 1Z07A 5HR5A 5JLJA 4JYBA 4LJYA 4P4UA 2RGEA 2OT3B 3R9IA 4BFYA 2YOHA 1AS3A 2VSOA 3IIJA 4P4TA 3UIEA 3AVYA 1HA3A 5A0FA 1ZM4A 3L8YA 1RJ9B 121PA 1E2KA 2RKOA 4US0R 2QBYB 4OHYA 1T5IA 2O0JA 3A58B 4H1VA 2WPDA 4XTRA 2C03A 4A0RA 5CB6A 1TAGA 1GILA 1JEEA 4JLDA 4KU4A 3SQXA 2PT7A 4JLOA 4RD6A 4KLNA 4RKEA 2GDJA 1ZINA 2IYWA 4FCVA 2IA5A 1IQPA 1NF3A 5A5GA 3W90A 5G40A 3I5YA 1MRSA 1QHSA 3U6KA 2J0UA 5GJWC 4QC2A 3ZQJA 4UNSA 1ZNXA 1DBSA 1XBTA 2WPDD 2YWFA 2YJTD 3BWDD 3EA5A 4PC2A 4B3XA 5K8IA 3LVQE 1QG2A 1XB2A 2EFEB 2PL3A 4TLAA 1ZIPA 3AKCA 2WJVA 4LBWA 1N6HA 2PX0A 1WDTA 2WSSA 3OEHA 4GP6A 2WMNB 3KJHA 4KFSA 4BZQA 3I4LA 4PC3A 4URYR 3RSOA 2FJUA 2WJIA 1OXTA 1KJWA 3AVXA 5G3YA 4P3YA 1UBEA 2IYTA 5JJLA 4QJ3A 4V0OA 1YVDA 2YC2C 2CLDX 1Z0JA 4GMXA 3MWKA 1QHNA 1ZC3A 3QVVA 4DWJA 1AJEA 1LV7A 3JZMA 4XVUA 3U2QA 1U0JA 3A8TA 4W9MC 4GSYA 4CIDA 2P6RA 3TKLA 5SZHB 3IGFA 1XCPA 2FGJA 2B8TA 2DWPA 5FI0B 4AKGA 2ERYA 3MMPA 4HAXA 4UJ3A 2AFIE 4NL4H 2VHQA 5LB2A 2V1XA 3KKOA 4QJ4A 1VCMA 1G9XA 4IOKA 4ZDJA 2WKRA 3QI2A 4LJ8A 1FFHA 3L2OB 4JKIA 5EUQB 3RAPR 3MWYW 1KYIA 2OAQ1 3T1VA 3A1SA 1N6OA 3CRMA 2OXCA 2PJZA 3EW9A 5G41A 2YZ2A 1SXJA 2C8VA 5EP3A 3U44A 2YOGA 4W7SA 2NGRA 1AKYA 1BO6A 4YQFA 3FKSA 5HE8A 2ZROA 4HLUA 4LC1A 3GJ7A 1Z5ZA 2IXGA 1OKKA 4PPFA 2BOVA 4OQXA 4B75A 1KDPA 3JVUA 1EGAA 3HU1A 4ABYA 3CLVA 4C2UA 3DZDA 5SZIA 4DJTA 1NLYA 2Q9BA 2P65A 2OFOA 4NE2A 5ANRB 2WAXA 2WKQA 4BUJA 4EPTA 3NEYA 3FVQA 4NCKA 1MABB 1P2SA 2BIFA 2ZRCA 1FNNA 4ACAA 4PZZA 2KBFA 2WKPA 3V4FA 1NKTA 1Q0UA 3EZ9A 3TK1A 4EKDA 4ZCIA 3PEWA 3BH0A 2IUSA 4U7DA 1IY1A 3ADKA 3NDPA 1Z08A 3FMOB 4S2EA 3TUZC 4PHHA 4D26A 4Z54A 5B2ZA 1Z3IX 8OHMA 1ETUA 5FPHA 5ELXA 4DUGD 4QNMA 4NDZA 4QKQA 3EIEA 4RD2A 1DAGA 1N3BA 3K70D 1JJ7A 2OLJA 2WIBA 3BB4A 1I2MA 1DTSA 2LKDA 5KO2A 3QE0A 4B76A 4JBWA 1Z83A 1KY2A 3KTAA 4FWIB 4HEJA 1T8UA 2ASEA 4KYIB 2VHJA 3QPWA 2EFDB 2CXXA 3FE2A 3SR0A 4EFNA 3SYNA 4FINA 4MKHA 4HAVA 3AKYA 2ZPTX 4DBLC 3EPLA 4KCGA 5CDFE 2IYXA 3SI7A 3FHOA 5FPSA 3OHMA 2GJ8A 1OFHA 2GZHA 1NVWQ 4HAZA 4MRSA 2HCJB 3PIRA 4MITA 1IN6A 1G41A 5EUMA 2FH5B 3ZQ6A 5FR2A 2F6RA 2QGNA 1BH2A 2IK8A 1PJRA 4DLSA 4KFTA 4TTRA 3NWJA 4ILEA 1NVUQ 1U0HC 3MG9A 1R0XA 3K0CC 1A4RA 1E32A 4QHSA 3ASZA 1MO6A 4HB2A 1AK2A 1Z6YA 2QORA 4AYTA 3PV0A 3THXA 3U7GA 3ONWA 2K5UA 2GWHA 1N0UA 4L15A 4JKYA 2IHYA 2EVWX 2J0UB 3QY0A 2XNDA 3T12A 1M7BA 4LV5B 3BB3A 5JI3E 3EZ7A 3K1JA 2PT5A 1WCV1 2IYSA 1S1MA 2GBLC 2LCFA 2OAP1 2XGJA 5FBWB 4G3XA 4LWZA 2JLWA 5E7MA 1GNRA 4IJMA 3EWSA 3PUXA 1YZGA 2DFLA 2MMGA 4JLJA 1Z28A 1ZJ6A 2KE5A 3AF2A 2RGAA 4LGMA 3Q7PA 2ATVA 3H4MA 4B47A 4MGIR 1G16A 4BEJA 1W44A 3T5DA 2XNDD 4IXNA 5HCIA 1QBKC 3R20A 1DO0A 4ZO4A 3P26A 3VKHA 1HE8B 2E87A 1XEWX 4MUBA 4LPSA 1AKEA 2WWFA 3ZS9A 4DLRA 2GXQA 1EESA 1RRGA 2ZJ8A 2OXRA 1T0HB 2XJ9A 1DG3A 3LLMA 3P27A 1E2JA 4NYMR 2WV9A 4E03A 5SZKB 1GKYA 1MH1A 2WICA 1DELA 1W46A 2NPFA 3T1TA 2ORVA 4HDQB 4LJ9A 3K0AA 1OSNA 4RFSA 2BHRA 2DFNA 4ZPXA 2DCUA 1HE1C 2NO0A 3A1UA 1CKEA 3LNCA 3Q9LA 3D31A 1OH5A 4BE7B 2CEAA 1ZNYA 1SXJB 2ZR7A 3RANA 4AURA 3U44B 3U3KA 3FFAA 1J8MF 2P6NA 3CNLA 2DY1A 2FOLA 2XITA 4RKFA 2IYQA 3R9XA 1T91A 1KK2A 4DSOA 1QHGA 4TMKA 5LPNA 1U9IC 2V8OA 1CR4A 5GVSA 1SVOA 1SVKA 2F3RA 3W5IA 4MYCA 3KB2A 1TUIA 3CPHA 3NH6A 3EC2A 2CJWA 1E2HA 1BS1A 2DBYA 4JIMA 1D2NA 4D4MA 1KI2A 2FSIA 1OXUA 1KI9A 1VHTA 4V0KA 3BOSA 2DYKA 1SGWA 1EFRD 2ATXA 1Z2AA 3O8DA 3LWNA 3PUVA 5CM8B 3K70B 1YHNA 1SQ5A 2GK7A 1P9WA 3QBVA 3C4JA 3NIBA 4LHWA 5FPYA 3C8UA 1UKEA 4C0QC 4F91B 3THYA 4RCZA 4MRVA 1A2KC 4YMSA 4F38A 2JIZD 2WAYA 1S9HA 4NTZA 1WMSA 4B71A 4FW9A 2NZ8A 4MYTA 2RGNA 4B48A 2NPIA 2SHKA 1KJYA 3PFIA 4NCNA 2OFWA 3WNDA 3AP3A 3EWAA 3MRSA 3WP1B 1QRAA 2J0VA 3KTAB 3LBIA 2J7PA 1DG1G 2ZRJA 2IX3A 4TL6A 3FMIA 1GRQA 2VLIA 1K5GA 4R2HA 4MYHA 5FTMA 3LQQA 4A0FA 2DHRA 3QG5A 2XB4A 4M9ZA 4OKSA 1KHTA 1Q1BA 2JDIA 3PR1A 3LBNA 1TF7A 1VG0B 2IYUA 1US8A 2J7PD 3OIYA 3C14C 1KAOA 4D6PA 2W6IA 1SKYB 5IRCD 2HXYA 3W3AA 1E2GA 3E5HA 5IK2D 4DDTA 4BLTA 1T3LA 4BPBA 2V3CC 4C7OB 3U5ZB 1TEXA 5C2JB 1VCNA 4Q66C 1CULC 1E79A 3PCRB 3ZZTA 3KKNA 1ZUNB 3CF0A 4CGZA 3NBXX 2A30A 3THXB 4MUAA 3E70C 2VTKA 2WJHA 1R5OA 4ESVA 1X8LA 4G5SA 4UXHA 5FL7A 3KKPA 2JAQA 1CJMA 4LBYA 4D2IA 1P60A 1I2DA 2QI9C 4OI1A 3HR8A 2JLQA 4Q00A 2W6ID 4A8JC 4Y0VA 2I1QA 2JLZA 4QGAA 1K5DA 3I92A 2PMKA 3PJRA 5DN6A 4Q01A 1N5LA 3W6NA 3G82C 3UMFA 4C0AC 2F9LA 4IVPA 1SVSA 3CNNA 2VQSA 5FL7D 4QJ5A 1H8EA 1XPOA 3ECCA 2V9PA 4UNPA 3E2IA 3K0SA 1P6XA 3H1TA 1NMYA 1GWNA 5J4LA 2CVFA 1SULA 2OO7A 2VF7A 3AEZA 3NKVA 4Q9LA 3TE6A 2WWYA 1TADA 1L2TA 1P61B 1P2TA 3PUYA 3U3JA 2WVJA 1U99A 2OBMA 4EPXA 4D25A 1XPRA 2UVQA 3CRVA 4U02A 1KNXA 3OIUA 3K0AB 4RFSB 1IHUA 4DZZA 1E96A 4G5RA 4BFWA 2Q3HA 3MWLA 4IKEA 4BZXA 4IDQA 3UMSA 1U8ZA 4MA4A 1W0KD 2GF0A 4QRHA 4WVFA 4Z51A 4X8HA 5KSPA 5C18A 2BBOA 1RYHA 2HLDA 2OV2A 3W3ZB 5LBIA 3EPHA 2Q0HA 4M1YA 3WMFA 2BMDA 2VEDA 4TTQA 3O8RA 2XTMA 5JS8A 2H57A 4BZPA 2QP9X 3AB3A 4PSVA 2FU5C 2VSXA 1GFIA 5EXPA 1G1MA 3IDQA 2ZE8A 3FFBA 3KJEA 5J47A 3V9PA 2CJWB 2QT1A 3VR5A 1UM8A 4D0LB 2XTZA 2BKUA 2HLDD 2YVUA 4WOPA 3K9GA 4GPTA 3MJRA 4A4DA 1JR3D 4EJSA 1IY2A 1OT3A 4LZZA 1D5CA 2DR3A 4PO1A 3GEEA 4V0ME 1R5BA 2YINC 1JI0A 2J5XA 1F5NA 1NIPA 1UEJA 4P32A 1KI8A 1GSIA 4TMVA 1HEIA 2D74A 3L8ZA 5LB4A 4DCVA 3THYB 3KQKA 1G7TA 4PHTA 1R0WA 1Z22A 4HUQB 5CDFA 2ZU0C 3RS4A 3GJXC 2Z6VA 4GDFA 1E9FA 3CR8A 3O8CA 1BYUA 5J4HA 4MRRA 2QT0A 4M1SA 2ZVQX 3TSWA 1FTNA 2Q21A 5IT5A 1I4LD 1P72A 4B2IA 4URXR 4LSGA 1II9A 4A92A 4WIAA 1RW4A 5D3MA 5DYIA 4AYWA 4AKEA 2XSZA 1RRPA 3TVDA 1C1YA 1U81A 4TQAA 3TH5A 4BLRA 3VNVA 1XF9A 4AG6A 4AWXA 3CH5A 3EZ6A 1DOAA 3LA6A 5F9HA 1OYYA 1BKDR 2NO9A 2ZTSA 4DHEA 4Q19A 3BBPA 3K9NA 3LH5A 1GVNB 2R6DA 2QBYA 2QP3A 2RMKA 1FL9A 4IDPA 3R7WA 4WAUA 4XD7A 2OHFA 5KDOA 4RSGA 2C5LA 3AF4A 4Q7JB 2IUTA 2YWGA 1N5JA 4KAXA 2IS6A 2XSZD 1IN5A 3SJAA 2FPKA 5IHPA 1T9HA 1GRRA 1US8B 3FGNA 1KY3A 3ZD7A 1YQTA 2WOJA 3GJ0A 2A3RA 1P3JA 2WBLC 2QE7A 1FP7A 2B7BA 2BEJA 4HB3A 4LJ6A 3X1YA 6Q21A 2V6IA 3R9WA 3OEEA 4NYIR 4NYJR 1E9DA 1ZC4A 3QXCA 4FXPA 4IFEA 4F93B 2WTUA 2YC4C 2RAPA 5J4KA 1VYTA 1N6PA 3PQCA 4R2IA 1DAMA 1W0JD 2ONKA 1XZPA 1XCGB 1N5IA 4ERNA 3AGPA 4KSCA 1SKYE 1CP2A 4DB4A 1KSJA 4BLQA 2C99A 3KQLA 2J3EA 4XSHA 5KPJA 1VG1A 2BJWA 3UG7A 2X2FA 1E2PA 4M1OA 1PUJA 4NZYA 2TMKA 3JZAA 5CJPA 1AGPA 3W6PA 2H18A 5DYGA 1JXOA 2A78A 2G3YA 3EG5A 1NLFA 2HXSA 521PA 1W2HA 2VP5A 2FV8A 3D3QA 3QENA 1GKIA 2IWHA 1PV4A 3BB1A 2JLRA 1JXMA 3RS5A 1WB9A 1U8YA 5CB8A 4R71A 3AQ4A 2GEVA 4QM6A 2ORIA 2WOOA 1L7VC 2FF7A 5FTNA 3CONA 2D3WA 4EPYA 1I4TD 4TTPA 2QG6A 2D4HA 2AXNA 4LDJA 1Q1ZA 4WZAE 1MR3F 1G21E 2EFGA 2V54A 3KZ1E 2FZ4A 1JR6A 1YR6A 5HZHA 5J5CA 1P7CA 2W6JA 2VBCA 3QNUA 2O8EA 5JS7A 1NY5A 1D2MA 1O3YA 3DKPA 3GFOA 4OI2A 2ZIAA 4GNKA 4PANA 3ADBA 3LXRA 3BFKA 2Q9CA 4AI6A 1AN0A 5KU1A 1R5NA 5EP2A 1QG4A 4LV6A 2REBA 2ZI5A 2XZLA 1MO4A 2ZSAA 2GHIA 1RRFA 4EPVA 3AVVA 1OV4A 1T5LA 3B60A 4HDOB 2C95A 4UNNA 4W5HA 2VIIA 4AK9A 4O25A 1JJVA 1N2CE 1DS6A 4PHGA 5AUQA 5CM9C 3LBHA 5B57C 1G17A 3SE0A 3T5GA 221PA 2RB4A 3K8YA 3ZDQA 2ZS7A 2IXFA 4BQSA 5JJKA 2ZSBA 1ZIOA 3GLGE 1NIJA 1UADA 4EJSB 2GEDA 1G8GA 2QNRA 4NBSA 1CF4A 2GKSA 4EFLA 3QKRA 5TDHA 3CB4A 1CXZA 3RDPA 1XEXB 1KDRA 1YR9A 4PZYA 4IOMA 1Z0FA 4F7WA 5FOVA 4GZMA 3KKQA 4N0DA 4QHYA 4MDEA 2RGDA 1M1YE 2WSMA 3N2IA 3WYAA 4B3DA 1H8HD 5GJCA 1JQJC 2HT6A 3W34A 4A0GA 2IT1A 1HQYE 1IXZA 4HZUA 5CK5A 2B8WA 2XOKA 3B13B 3X1WA 3IQXA 1NN0A 1YZTA 5D3MB 2J59A 5FFMA 4DCUA 1HYQA 1G4UR 4C0BA 1Z6AA 2GXSA 5B58C 3WNCA 1FTSA 1B23P 1BMFA 5FI1B 1W7AA 4CT4B 1YRAA 2PMDA 4OYHA 4Q21A 4DLYA 621PA 3AUXA 1A5TA 2MSCB 3IKJA 1W4BA 1E1RD 3LD9A 2GESA 4XSGA 3M6AA 5J40A 3R7WB 3GCGA 2XOKD 3NC1C 3C41J 4RCYA 2WWIA 4GBMA 4ZDKA 4RZUA 1G7SA 4NH0A 3TUIC 4YDSA 1DAKA 2PCLA 1MRNA 2CLCX 4JLMA 2R62A 4I81A 4L4UA 4QGFA 1BMFD 4PQYA 1UJ2A 4H1UA 2HYIC 3KXLA 1GITA 2BC9A 3RYTC 1LFDB 2AWNA 4TQUS 3VR6A 4UNRA 1Q3TA 2WM9B 3L0OA 3DL0A 2JLUA 4KI0A 2EW1A 1P73A 5EZ5A 4JSYA 2CE7A 4LYAA 2HCBA 3MD0A 3I8SA 3T06B 5JWOA 1UDXA 1VTKA 4MGKR 3CO5A 1J8YF 2OFXA 5C4GB 2XNSA 2R8RA 1E6CA 4YXWD 4LUCA 2GXAA 4BGDA 4MRPA 1IAQA 1W1WA 4LHZA 1ZNWA 4Z1MD 4PC1A 4G5OA 1G19A 2NO1A 3U7HB 1OFUX 2A2ZA 2WJGA 2A5YB 3KL4A 3BAFA 1S8FA 3FB4A 4QFMA 1OHHA 1OXSC 4JBXA 4M9XA 1YU9A 1RPZA 3EXAA 5HZKA 2J0QA 2G0NA 4B74A 1Z0DA 1NVVQ 4M1KA 4ZDIA 2ZYVX 5HKKA 1IM2A 3A37A 4DB2A 4MGZR 2ZRLA 4JJKA 4PPQA 1EX7A 1TL7C 4IFBA 3SJBA 4Q1BA 4DSNA 1ZD1A 2ZE5A 4JJZA 2ANCA 4Y0AA 2Z4SA 3LQRA 2B6HA 5KSZA 1OHHD 2O8EB 1ZAKA 1ONBA 4B3CA 2FWRA 1PVOA 1U90A 5DLQC 2KI5A 2IYZA 2G88A 3TSOA 5HKKD 1IJFA 4JLPA 4Q1EA 1HUQA 3U7EB 1XTSA 3FMFA 4IOLA 4V0MA 3NHBA 3TQFA 4EAQA 1HT1E 4DDVA 2AN9A 2KSQA 3N70A 3CZPA 2X77A 4UXJA 2Q3FA 1WE2A 1XP8A 1G3RA 2W83A 2GCOB 2JLSA 1QHYA 4WZ6A 1GL6A 1G8YA 4DUGA 2EWVA 1WQ1R 1G6HA 4WXPA 3TAUA 2BVNA 3VX3A 1JR3E 1KJZA 1X3SA 3R8FA 2BMJA 5DE3A 3AF1A 3RRYA 1NMZA 3C7KA 3QXHA 5AUPB 4OHVA 2IYLD 3DMNA 1G3QA 3QKRB 3K9LA 2H1LA 4QBFA 4IHQA 3DEFA 4W5WA 1SXJC 421PA 4CEJA 2IYYA 2QPTA 2VP4A 2HF8A 2CVHA 5CYOA 2IEYA 3PXGA 4KJZA 3RRNA 1B0UA 4HLUC 1RYFA 4JZKA 3B6EA 2P67A 4Q7MB 5DH9A 5E7IA 3NG1A 3SBEA 1KZGB 2GJKA 1YZNA 4MKIA 1KSFX 2OESA 2IYVA 5DHFA 1P9RA 2DB3A 1NL3A 4HZUB 1V43A 1G6OA 3TLXA 1E9BA 2NO7A 3WHLA 2GAAA 4POAA 4CRWB 4FMDB 4CEIA 4GMDA 2BCJQ 4Q1FA 5TARA 1G7CA 1VIAA 2FPMA 3NC0C 3TGPA 2EU8A 3K70C 2ZRIA 2IS1A 2X8AA 3REGA 3PEUA 1J90A 1C4OA 1Q44A 4PAOA 2ZM5A 3TAHA 4EUNA 2NQ2C 2Q9AA 2FSFA 4N0EA 5JI2E 3PVSA 2OILA 1M2OB 1PUIA 2PBRA 4DEXA 1KOFA 4C7OA 1N6LA 5J4YA 4HB4A 5BYKA 2IEZA 1LY1A 2ZSDA 5CIWA 2GRJA 2JJ1A 5K8LA 4WXRA 3GD7A 5JWHA 2YOFA 1XNJA 1VMAA 2CL7X 1YKSA 4JVLA 5DHAA 3AM1A 3B1VA 4DT1B 3PG5A 1FZQA 2NIPA 2ZXUA 1TMKA 1GL7A 2ZEJA 3LRPA 4NHOA 1W49A 4OQMA 2AKAB 3MSXA 4YMTA 4G01B 1ODFA 1CR1A 4Q7LA 2BCGY 2FMXA 1IONA 3QPVA 3D8BA 1X1RA 2N1BA 2LWIA 4DIDA 2QMUA 2J46A 4A0HA 1KGDA 1S0UA 1PLLA 2JJ1D 4HZIA 1ZM9A 4UQOA 4Q7KA 1VG8A 4URUR 1IJEA 1IN8A 2IBMA 2O8FB 1D9XA 4B2PA 3QBTA 1OYWA 3ADCA 2R6FA 2IC5A 1T0JB 4IEEA 4LHVA 2JATA 1GRNA 2PH1A 1XXHA 3QG1A 3SHFA 3VFDA 2UZ3A 4LI0A 1W36D 2FGKA 4EIWA 5M04A 2A7QA 2XZOA 1DAIA 1CS4C 2ZRBA 2O8BB 4IVQA 2RHDA 3UWOA 3VQTA 3M0EA 2GXUA 4G1UC 1EFCA 4OK6A 1TF2A 1YJ5A 2QAJA 3ETLA 5HCNA 2AK2A 5K8UA 1G5RA 2CHGA 4PQRA 2G83A 3SHWA 2AD1A 4NCIA 4RD0A 1UDWA 1Z0IA 2WIAA 4CDGA 2N46A 1TNDA 1XMIA 1VIYA 3AV0B 4TL8A 1KDOA 2H16A 4GI7A 1L8QA 3O8BA 1YZQA 2R6CA 5F3WB 3GLGA 3CRRA 1EFRA 4KLZA 2NO6A 2WZQA 4LPKA 2ZSFA 2AKYA 5H8WA 3CBQA 5FL3A 3A4MA 1GZSA 1XD2A 3QKTA 3AVPA 3LDAA 4XH9B 4EQ6A 3A36A 4LJAA 2HV8A 4C0HA 5E3HA 2JIZA 1KK1A 3BC1A 3KJIA 2C98A 721PA 1WBDA 1R0YA 2FDCA 2OCPA 1NI3A 3W8NA 1WA5A 4KV9A 3KXKA 3SU8A 2H5EA 4FMCF 4BECA 1AZTA 2QA5A 1Y63A 3A1TA 3AVQA 4DDWA 4K46A 3TIFA 2ANBA 4Q4LA 2O5VA 3NTUA 4JT4A 5AR1A 1QDEA 1W4CA 2VH5R 1ZMXA 4OBEA 5DO9A 3I5XA 3SFVA 4HUQA 4GOKA 4C0KA 3QXSA 2PLFA 5DISB 2H7VA 1OH7A 1Q57A 4H9GA 3P20A 2V1UA 4PTLA 3SN6A 2QMOA 4CEJB 2EWWA 3QPUA 4NP6A 4PFSA 5CYPA 3VR1A 1FOEB 4V02A 2HYDA 4LHYA 4LC0A 3TJZA 5TV2A 1RE0A 5GADl 3DVLA 4EFMA 2RGBA 1KSGA 1CLUA 3B2EA 1FP6A 3KKMA 2QZ4A 4L9SA 1XWIA 3N5CA 4AIIA 3GLIE 5IK2A 4CEIB 2G9NA 2ZRPA 3DM5A 1NRJB 1UBGA 2H8KA 1KO5A 3HWSA 3NBFA 2ZI6A 4JLKA 1E2QA 3HP1A 5LDDC 4A1FA 1GUAA 4F92B 2A5DA 4I4LA 5BWMA 3F5FA 4B6FA 1Q22A 4TT3D 4RVCA 4EDHA 1CTQA 1EXMA 1IY0A 5FH9A 4XWKA 3GLHA 2RGNC 1XMVA 3AKEA 3IBYA 3CWQA 4M1MA 1NN1A 4FI3C 4DCNA 1BIFA 1TQ6A 1RVDA 4NCHA 1SVIA 4A36A 2XJ4A 1DVRA 5DNYB 5EQTA 3VHXA 2ODNA 2XAUA 1TX4B 3AVTA 2FG5A 2PZFA 4ESHA 1M7GA 2GZAA 4FCTA 4ZI2A 3KUCA 4QHTA 4ZIRA 4XVQA 2YNMA 4C9BA 3QSYA 3Q5DA 2QROA 2JASA 3V00A 2GJ9A 5HE9A 5AWFC 1W4RA 3G0HA 1E0AA 1U0LA 1JAIA 4EPWA 5H68A 1W36B 3LVRE 1QHHA 1S3SA 1NG9A 3WRYC 5JRJA 1DEKA 1Z6TA 3VKGA 1A1VA 3EZFA 2QRZA 2BWJA 4FMBB 3GJ6A 4GFDA 2XXAA 4IVRA 4LV8B 4B3FX 3SJCA 1N6NA 2EFCB 1NSTA 4M1TA 4O0MA 2OBLA 1QZXA 3GLFE 4XIGS 5J4VA 2W2TA 2ECKA 1W0KA 3BIFA 3GEHA 1Z29A 2QAGA 1XXHB 2GEUA 2BBWA 2D2EA 4AY2A 4Q9KA 4DLXA 2ZUDA 3DDCA 3U61B 2NTYC 1S4QA 4LJ7A 1HQCA 1MT0A 4DLUA 4MKFA 4XTCS 4S35A 1LB1B 2QMEA 3LX5A 5FBVB 4M8NE 1CEEA 3C5HA 5CITA 3LFUA 2IF0A 4M1WA 1D6JA 3MFYA 3WHKA 3GFTA 4Q48A 4G5GA 3KFVA 4ASUA 1KTVA 1VYVA 4URVR 1NJGA 4B32A 3SYLA 2QN6A 1S2MA 1NNEA 1FW6A 5AJYA 3UWKA 3ADDA 3HR7A 4L8GA 2FFHA 4DCTA 1JR3A 1LF5A 1QF9A 1OXXK 2C04A 1DO2A 2C9YA 1JEDA 2QU8A 3Q3JB 3GLGB 4B6EA 5FOSA 5LD2B 3MGCA 4IEIA 2P5TB 3GJ8A 2ZRMA 1S1CA 1EFUA 1ZD8A 2VL7A 2I4IA 4YDHB 4EQ6B 3BH7A 1XD2B 4IRUB 4Q9HA 3MAAC 1HV8A 1SVMA 2CMKA 2F9MA 1QVAA 3Q72A 4ASUD 4OQLA 4DSUA 1S96A 4LOAA 5KUTA 3I61A 3NXSA 1VECA 3FMPB 5IF9A 4Z8YA 4GL2A 1NSFA 1TUEA 2E1RA 3JVVA 1HURA 1U2RA 1VHLA 2IF2A 3NEJA 3QF4B 4TMWA 4OI0A 2D06A 4TQ9A 1E2EA 3WYFA 1KKLA 3BXZA 1DPFA 1NBMA 1XEXA 2FZLA 5FUWA 3GJ3A 1MO3A 3CWZA 5B30A 3BH6A 3DPUA 3ZVMA 1YR8A 1G5TA 3BD9A 1O87A 3QQ5A 4IW3B 2L0XA 4TMTA 3ZZUA 4FIDA 4F4CA 5GVRA 4PR0A 4FN5A 1EK0A 4EPRA 1MOZA 5HTKA 4LBZA 3TVTA 2HF9A 1NBMD 2FA9A 4IDNA 3ZD6A 5JMTA 2QSYA 4HLDA 1IOZA 1JALA 3DMDA 3P4YA 4HSEA 2BDTA 4LX0A 4HAUA 3L43A 3OE7D 4NU0A 1VG9B 2JGNA 2QTVB 1P9NA 2VP0A 3RS7A 2GCPA 2GA8A 2KB0A 4C0JA 1HY3A 3PITA 4EJSC 2Z43A 2BM1A 2IWRA 4PAQA 1ZD9A 2NZJA 4LY6A 4MRNA 1E9EA 3ZVLA 2B21A 1W0JA 3B1XA 3D7MA 5KTYA 1U8AA 2GJSA 3H86A 1ELOA 2EYUA 4Q4JA 4A82A 2OCAA 1A7JA 4TSFA 1XPUA 2JCSA 4GP7A 3BK7A 1UEIA 2BBSA 4N1AA 5FOXA 3ZZ0A 2HT1A 3GLHB 1XEWY 3HYTA 4FMCB 2ZJBA 2CNWD 1H65A 3NHAA 1CRQA 4XVRA 2R6AA 3UXMA 4TZ0A 1Q3HA 1YZUA 4JLAA 2RGCA 5AJZA 3QXXA 2VP9A 4M9QA 1ZRHA 3AP1A 3P1JA 3CR7A 3VU9A 3HU2A 3QKUA 1EFHA 2AWOA 2QQ0A 3QKSA 4TSFD 2CCKA 5AJVB 3T15A 3UK6A 2W2VA 2CHVA 4ZIRB 2OBNA 4CT5A 1F6BA 1NG1A 3H84A 3W9YA 3OIVA 3EIQA 3HYRA 2IW3A 5JHGB 1GTVA 2VPPA 3I3SR 1R10A 1WP9A 1OE0A 4KFRA 2VA8A 1QHHB 1X1SA 2X2EA 4MH0R 4F4IA 4DLZA 5L3SA 1AZSC 1HT2E 3KXIA 4L9WA 5DI9A 1W5TA 2ZI4A 2XXAB 2ODEA 2W2XA 4JS0A 5P21A 3F0TA 5TVKA 3RC3A 2ORWA 4FCWA 4B3BA 2WHXA 3GP8A 1FX0A 1NN5A 4IDHA 4I1OA 2QAGB 2X19A 1TQ2A 2VSFA 3F3YA 4KODA 1XMSA 4JSTA 1OIVA 3P32A 3WMEA 1F2TA 2CDNA 1Z6GA 2RGXA 2QMHA 4M21A 4ZV4A 1ZBDA 1E9RA 2J1LA 3M1IA 3QF7A 2IHBA 2A5FA 3AVUA 2ZJAA 1E2IA 3IO5A 1LS1A 4FMDF 3OZXA 3L82B 4RFVA 3SC3A 4Q47A 4UJ5A 4DC9A 1XXHE 4Q9JA 4LK2A 3LV8A 1AQYA 2R9VA 2GVDC 3SNHA 3KX2A 3X1ZA 4DLWA 1KO1A 1CIPA 2JEOA 4KVGA 2ZJ2A 2ZRAA 4UNQA 4HAYA 5TXGA 2F1HA 1F60A 1KO8A 4B43A 4OK5A 2VYFA 4RD4A 2PJRA 5L8VA 1CR0A 1COWA 4KSBA 2GCOA 2ZANA 2PCJA 4BFVA 1IN7A 5JBQA 3AUYA 2QY9A 4KO8A 2QTFA 1W47A 5KNCA 3K09A 1H8HA 4LJ4A 2AL7A 2QEQA 3WMGA 3L0IB 2FPLA 4MYUA 1R4AA 2FN4A 2ZJ5A 3EA0A 3OFND 1E2LA 4LBVA 5EZ6B 5CLLA 1XTQA 2LKCA 2OCBA 1COWD 1L4UA 3GLIA 4NMMA 4W5JA 1T4GA 3A4LA 4RJLA 1P5ZB 4MKGA 3ASYA 2EFHB 2JLYA 3CPJB 1TU3A 3EAQA 1E1RA 3RHFA 3AVOA 4C4PA 1D8TA 2WJJA 3RVBA 2A9KA 5TB5A 1KNQA 2JJ2A 4YMUA 2J0SA 4ON9A 3SJZA 4TWZA 2AR7A 1RIFA 2OG2A 4Q02A 4NYIQ 4A2QA 2YWHA 1V5WA 4Q18A 2W58A 4Q5IA 1DAHA 3CRW1 4B34A 1VCIA 2MSEB 4KBFA 3UMRA 5KNBA 4Q1AA 1JQLB 4OJQA 1SHZA 1YR7A 2J7KA 2Z4RA 4ACBA 5KOYA 1XTKA 2CK3A 3NDBB 3B1YA 1G8HA 4Z8XA 4C2TA 1ZNZA 2IL1A 4QBHA 1E3MA 5GJBA 2JJ2D 5AK0A 2QM7A 5F2EA 2X1VA 4Q9IA 4YC7A 3UATA 3BGWA 3RWMB 2P5SA 3LXXA 4PO9A 4Q4JB 1GKUB 5EP4A 4YONB 3IILA 2GCNA 4YXWA 1W5SA 2FNAA 4PC6A 2ZJZA 3U3OA 1VPLA 3W5JA 2CK3D 4BLSA 4Z1MA 1AS0A 1OB2A 5E4FA 1G3IA 2IYRA 3IQWA 2GZDA 4DT1A 1FUKA 2F3TA 3RSLA 4ZCLA 1ZU5A 3RC8A 4JLVA 2G6BA 1KMQA 1MKYA 3WNBA 3GLFA 1GL9B 3VU9B 1MV5A 2HJVA 2KBEA 4JMPA 3SBDA 3QKSB 1S9DA 3GLHE 5CK4A 5FTJA 3FOZA 1KI6A 2QPAA 1J99A 4DKXA 1VKJA 3DM9B 4O3MA 1ZP6A 3CPEA 4YMVA 2JLXA 3THOA 2O8FA 1J70A 1KK0A 3R8CA 2QSZA 1FPMA 2RHMA 3EIHA 3T35A 1VDZA 1X8JA 1M34E 3PEVA 1GOTA 3IUYA 3T1QA 3AP2A 3SEAA 4BASA 1F2UA 5BW8A 2BBTA 5L3SB 3KFXA 4XJXA 5FPKA 2ZITA 2BV3A 2ZR9A 3CUEF 2ERXA 2KJQA 4P0TA 1XTJA 1ZM3A 2HDNB 2O0KA 3LLUA 1Q1EA 4QBIA 4OL0A 2O8BA 1KO4A 2F43A 1FX0B 2O0HA 1SVWA 3LY5A 4TLBA 5JWRA 2ZAOA 5G53C 4KFUA 1FUUA 3MWJA 4HLQB 5FUXA 1UKVY 1XJ0A 2Z0MA 4PX9A 5CJ2A 4AKIA 1GNQA 3IEVA 1F2TB 2G1KA 1Z47A 3CH4B 4R98A 4ITRC 4LYFA 4L16A 5KSOA 2F1IA 2ZSEA 4TL9A 4KVAA 5D3QA 2WSSD 4JVSB 3OEHD 1KIMA 3NH9A 2ZVPX 3SS8A 1FQJA 3GPLA 4JVMA 5SZJA 3BE4A 3EX7C 4UKDA 4E22A 3THWB 1LS6A 5KYKA 5FPTA 1OW3B 3BFVA 1UBFA 5BXQC 2DWOA 3AH8A 3BS4A 4IXMA 4TN1A 1OFIA 2FFQA 1E9SA 2V7QA 2JA1A 2ZYTX 1X6VA 3EC1A 5FBQB 2FSHA 3U4QA 4TLCA 3TR5A 1D2EA 2A5JA 4Q4AB 1KMHA 1K6MA 1E2NA 2NOAA 2ZE6A 1CR2A 3S1AA 2BM0A 3CF6R 4JLBA 1KSHA 1G8PA 1KI1A 1LW7A 2YV5A 1GP2A 4BLOA 3TR0A 3DOFA 4PPGA 1RZ3A 2REOA 4HI0E 2V7QD 5K8TA 2GNOA 2WJYA 3AF3A 2F1JA 2DWQA 4A6PA 4M22A 2ZRHA 3ND9A 1Z6XA 3K53A 3FWYA 3PENA 2ZAMA 3GLIB 1SXJD 3K0EA 3REFA 2D7CA 4IDOA 4NCJA 4U00A 1OB5A 5E95A 1R8SA 2UKDA 3FKSD 3W6OA 4O2RA 4P33A 5JCZA 1P2VA 4YMWA 4NONA 1OKKD 2Q6TA 3IBGA 2XB2A 1M7HA 2DPXA 4OHWA 2C78A 1Z8FA 1EG7A 1NBME 3CNOA 2ODBA 3CF2A 3VR2A 2AHOA 2BKEA 4M9SA 1R2QA 2CE2X 2V55B 1UKYA 5FTKA 5EE0A 2C2HA 1EWRA 3K0CA 4HB0A 1X8KA 2FFAA 5EE3A 2QL6A 4OQFA 4CEHB 1P62B 1Q20A 4TYQA 4B35A 1AS2A 1XX6A 2IXEA 4DXAA 1SKQA 2O8CA 3ICEA 2PZGA 3T61A 3VHLB 1ZCBA 5JRZA 3QIAA 1UPTA 1D9ZA 4D81A 4HYYA 4RD3A 2WWXA 1FMLA 1SVLA 2EYQA 4BFTA 2GBLA 3VNUA 3TUJC 4AG5A 1CJVC 2B92A 4JL8A 4RZ2A 2VF8A 1T8TA 4D0NA 2OLKA 3QJYA 5DI3A 3RABA 3X1XA 4BFSA 4Q4HA 3VTKA 3AF0A 2CCJA 1G5PA 1R6BX 3Q85A 3QEOA 2REXB 4WA7A 3I1FA 4AD8A 3KDSE 2P2LA 2NG1A 1XD8A 4MQBA 5FOTA 1DAFA 2VHUA 5EP1A 2VHTA 3EARA 3Q8XB 4C3ZA 2R6GA 1N0VC 2JLVA 1AQUA 2WWGA 2JJ8A 1GAJA 3B1WA 1JB1A 4OI4A 3GLFB 1XD9A 3OF5A 4A15A 4TZ6A 1ZUIA 2YKGA 5EXXA 1Q1QA 4D4LA 1KI6B 4G0NA 4MDFA 3FHTA 3E1SA 1HTWA 1CU1A 2XX3A 3CX8A 1PLKA 4I99A 3T1OA 4KITB 4PZLA 4TYWA 3TMKA 2ZU6A 2ODWA 1JPNA 5KDDA 1Q21A 1ZM2A 3RS2A 1ESMA 1F2UB 2ZUCA 1JPJA 3CKLA 5JEDA 1UKZA 1Y3AA 1T3SA 1G20E 2ZYWX 1E0SA 3VX4A 2ZREA 2CBZA 4K81B 2PEZA 5L3RA 3RNLA 1OF1A 1G3UA 2F1RA 2F43B 3FHCB 1OIWA 1XZQA 5JFGA 1W48A 4IOJA 4PC7A 5FOUA 5KNDA 1U9IA 1RFLA 1AM4D 1QHIA 3EPJA 3TSZA 4CVNA 1E4YA 1XJQA 2PZEA 3AGQA 3TW4A 1W36C 4GRAA 1EWQA 1II8A 1TTTA 2ZI7A 1OJLA 3VR3A 4D80A 1RKBA 4II7A 4DDUA 4TMZA 1JBKA 2Q3MA 1Z2CA 2ZRNA 1E2DA 1W2GA 1WRBA 4PXAA 1Z0KA 3BORA 3OESA 1R7RA 3BERA 3MJHA 4OHXA 4PHFA 1WF3A 3K9HA 1E9CA 1XFAA 2ZRDA 5H70A 1RC8A 2IS2A 1UBCA 1NN3A 5HPYB 3U4QB 4KHZA 3CM0A 2F7SA 4G5QA 3QF4A 1PLJA 1J2JA 4BLPA 1KMHB 4NKRA 5L3VA 2D62A 1KDTA 1T6NA 1W4AA 4PSKA 3S1AB 3DOEA 4AKHA 2P6UA 1JAHA 1R0ZA 2C9OA 4E07A 2XZPA 2P0EA 5FBLB 4KXFB 3U3MA 4OQNA 1KI3A 1KK3A 1LTQA 5BN4A 5UKDA 4HUTA 5F98A 5LD2C 1JNYA 2BMEA 2GF9A 2PX3A 2BMFA 2Z5FA 5TMPA 4LJ5A 3DO6A 5AUOB 1OIXA 2J9RA 3TRFA 3ZLJA 3GFPA 4DLTA 1E99A 1KAGA 4BRUA 5BN3A 3Q7QA 1E2MA 5BN5A 4TT3A 4BWYA 1NY6A 1QVRA 4FWTA 4A2WA 3PUWA 4M53A 1M6NA 2N42A 1ESNA 4TYPA 3SOPA 1XU4A 4HDCA 4C0LA 1E0JA 1F3OA 4P4SA 2HEIA 2OSBA 5JSZA 5FTLA 3C16C 1UFQA 2GILA 2O8CB 2C9CA 3OIWA 3DZ8A 4QL3A 4AYXA 5F9FA 1PZNA 3I8XA 1L4YA 1TF5A 4V03A 4OK3A 5TY0A 5FR1A 3I32A 1UF9A 4YLGA 4B44A 2OCYC 5FUVA 5JJIA 1OXVA 3SFZA 4UXIA 1DARA 1OLOA 2VRWA 1G8FA 2E9SA 1GM5A 1GDDA 3PUZA 4F4JA 3CIOA 4A8JA 4D4KA 3GQBA 5C4MA 3I73A 3UG6A 3HDTA 3L0SA 4M0LA 4PPNA 5DI3B 1J7KA 1GG2A 4Q4HB 3ZIAA 4D4JA 4JLNA 2P3SA 2R2AA 4NYMQ 4P31A 3CX7A 3A6PC 1K8RA 3NBZC 1ZM7A 3B1ZA 3ZVRA 2GETA 1TPZA 4V0NA 3X1DA 1N6IA 4TLDA 5EXTA 1XMJA 4KYUA 4QG7A 2FEOA 2QPOA 3I72A 1E98A 4US2R 5C46F 2I3BA 1C9KA 5AJXA 3TNFA 1X86B 2IUUA 2Z83A 4QM7A 1TQDA 3RLFA 1G64A 1P4SA 3I62A 3IPYA 4LRWA 3ZIAD 1FMJA 2PEYA 1Z06A 4QGGA 1ZW6A 3C5CA 5DSZA 2JDID 5A4JA 3K0FA 3B8HA 3ZVNA 4B3GA 4GZLA 1NVXQ 3GJ4A 4A6XA 1CJKC 3WP0A 2J41A 3ZJYA 2WWWA 1N25A 4C0SA 5JCPA 1GIAA 2YYZA 3TW8B 1T3HA 4RD1A 3J81k 1IXRC 1E79D 3KQUA 3DKVA 2EQBA 5C1BA 3IIMA 2ZQ5A 3IO3A 4JL6A 3B9QA 3GMTA 3FPAA 3HJNA 4J0QA 2AK3A 4ZDWA 2ZYUX 3MLEA 1CJTC 2H17A 1YRBA 3NVAA 4JYCA 1DADA 4GT1A 1G18A 2AXPA 2QGZA 4PSAA 4TLEA 3UANA 5H1YA 2VHCA 4ARZA 1G4AE 1II8B 3IHWA 2OUKA 4M4SA 1Z63A 4A9AA 5DN6D 3F8TA 4BFZA 2J87A 3DHWC 3FDIA 2YWEA 3SYKA 2O52A 2OZEA 4ZKEA 3BJIC 4DRZA 4JBYA 1XJCA 2CLSA 4JVNA 1TU4A 1G291 2AX4A 1H8ED 5KDLA 3CW2A 2VO1A 1P2UA 2QAGC 4TMXA 3ND8A 2B7CA 2QM8A 1HH4A 4NPHA 2A5GA 2FEMA 4B2LA 3ZS8A 4OJKA 4GOXA 1TQ4A 1YZKA 1XDBA 2H92A 3MCAA 5G3ZA 5L3QA 1LVGA 3GJ5A 4URWR 3B82A 2C77A 2ZJYA 4QBGB 2MMCA 5FOWA 1M74A 1ZUHA 4B73A 2QUZA 1CRPA 1E4VA 4XOIA 1F48A 2W0SA 2W00A 2ONJA 3AKDA 5FBRB 4HLCA 3OE7A 1E69A 5JECA 3IEUA 1BOFA 3V4RA 2GTPA 3A1VA 2VP6A 3Q5EA 5KHOC 2OEPA 1G3MA 1SXJE 1E9AA 1U94A 1S3GA 1M8PA 5DIFA 2D2FA 3IIKA 2O8DA 2QQEA 4WBSA 3BFXA 3FYHA 3EASA 1DE0A 3LAWA 1FNMA 1XTRA 4JL5A 2G77B 4M2LA 1N6RA 4O2LA 2HJGA 3VMFA 1E94E 1YE8A 2GAOA 3B9PA 3LW8A 4PAMA 4X8LA 2FX3A 2UZIR 2ZUBA 4X8MA 3WXMA 4V0LA 5KPDA 1II0A 3KUDA 3CX6A 1UAAA 821PA 2RCNA 4LYHA 2QRNA 3CRQA 2CNWA 2GJAA 4C30A 1ZYUA 2MSDB 2XTNA 4P4SB 2R65A 1N5KA 4DIEA 3WBJA 5JSZB 3D6TB 1N6KA 3RWOA 4HAWA 1E0KA 2ZRKA 3OAAA 3SQWA 2RH5A 4TYYA 2W0MA 3KQNA 2V4ZA 1DAEA 1ZVQA 5B64A 4RZ3A 5DGXA 4CW7A 4LYJA 4FD2A 1RJ9A 5E7JA 2CL6X 3P4XA 1QHXA 4X8OA 4QNRA 4K8OA 4ZCMA 4BFUA 2OE2A 4A8JB 3L0PA 3FTQA 4US1R 4XWAA 2FE4A 5EE1A 1ZU4A 1IN4A 1XEFA 3B7GA 1E1QA 2ZRFA 1I4DD 1SZPA 3OAAD 4QOSA 4ZKDA 5GJVC 2BEKA 2BJVA 3QVUA 1RRCA 1FQKA 1IXSB 2ZR0A 1R8QA 3RS3A 3UPUA 3ICQB 2WWHA 3RRMA 4XWOA 2DFTA 4BEBA 4LCBA 3U6BA 1AGRA 1CJUC 2AD5A 4I1UA 1KKMA 1OH6A 4XD7D 5EXSA 3FKQA 1EX6A 5JEEA 1KO7A 1N0WA 1NJFA 4U5XA 1XRJA 2QENA 4I1VA 1E1QD 1TEVA 4B33A 4E5UA 2FSGA 3HPRA 3WY9A 3K0FB 2QP4A 1GNPA 2R44A 4PO8A 3HPQA 2ZETA 2NMVA 3TBKA 5AUNB 2WMOB 3N2EA 4WW0A 5EJEA 2ZE7A 4QXAA 5KSYA 1Z0AA 3WRXC 2ZS9A 3LW7A 2QE7D 1ANKA 1OH8A 2KWIA 3OEED 2XEXA 3IHLA 4LHXA 4RZXA 3LO5A 2VP2A 1WBBA
chains in the Genus database with same CATH superfamily
1KVTA 3K0KA 5FUMA 3P2KA 3BRWA 1XP5A 5GM2A 2AT1A 3PQ2A 5JV5A 1NTRA 3LQYA 1MJFA 4YRQA 3HSYA 3MT7A 3VYSB 1BX3A 4CIAA 4BX0A 4GPAA 4I8DA 5ALYA 8LDHA 2C96A 2WZBA 2E85A 5HIKA 3WWEA 3IDZA 3P4UA 1DZ3A 3F8WA 3T34A 4MKXA 4K1XA 1XF1A 2AJLI 4WZBE 1WZEA 2EKDA 2I2AA 2IVZA 1LZLA 3AG5A 3QLVA 3E23A 4JT2A 4TYNA 4URZR 5J2TB 2QTAA 1N57A 5J2UB 3EDOA 1M6VB 1CV2A 1FDIA 3PS9A 2FUG1 4FLFA 4FJ1A 4YQYA 5DP2A 2PXHA 1U98A 4FFBA 4D0GA 5KQRA 1FVOA 1UPXA 5M2QA 2GK6A 2X9NA 1KI4A 2GVZC 2FG6C 3ZGXA 3CZQA 1QQ5A 4R9UC 3ZW9A 3WZ2A 4DLVA 3QUQA 3O1JC 3RS0A 3BREA 3HWRA 2C9BA 3F5DA 4K9QA 4QU9A 4CF7A 5JZBA 4KPFC 1N7GA 2G1UA 2ZUFA 3ZK7A 2R6ZA 2VRBA 4N3NA 4RMJA 4ENUA 4YP0A 2AOUB 5K01A 5EE5B 1Z2NX 2DFKB 5AHRA 3G5UA 4HDKB 1QGOA 2E1PA 4BFXA 1GD1O 1XTIA 2P40A 4HAIA 5DU2A 3VKWA 4PVCA 6NULA 4QE3A 4Y9TA 3LFHA 3ZGYA 1QGED 1CNEA 3HABA 1U2SA 4Q1CA 5LZ9A 5IJAA 4URFA 3K73O 4KRGA 4XW2A 1H22A 3ONDA 3TNYA 3QUSA 4BVEA 1WXQA 2FFBA 2H59A 4L78A 3T3OA 2QGFA 1EGHA 1VJCA 5E7QA 3B85A 3LX8A 4DLLA 3HA2A 4F97A 3H2YA 4RETA 4Y1EA 1YA8A 4JQOA 4YJGA 5F1OA 1G8JA 1TIKA 1ZSYA 3ABIA 3EGVA 5BWOA 3TFOA 4A3SA 1JB9A 1LNZA 3SKVA 3MHTA 3KKKA 4Z2AA 2A7XA 5BOSA 2R66A 4HATA 2TMGA 4RGVA 1SK9A 3JQAA 3VAAA 5BSEA 1XAHA 1CS0A 2CHQA 2IBSA 4TKMA 4RQUA 1TRHA 5I9SA 3E27A 5ERGB 3MBOA 3A4NA 1UBNA 4ZI3A 1FFGA 1MDBA 2EJCA 3L8EA 3V4OA 2Z08A 4GXRA 1XQVA 4HDMB 5JPIA 3U7FB 2AMFA 2W6NA 5DLEA 2WTXA 3ADOA 2NP7A 1FS6A 2BGRA 2MYTA 2RBKA 4MV4A 1UBJS 2RJOA 3RVQA 5JZSA 2OT3B 3ESXA 5AI8A 1AS3A 2VSOA 4P4TA 1LVHA 4YUWA 1VGQA 3TFWA 1ZM4A 1PEDA 3RF7A 2XWPA 3LGXA 1E2KA 1J21A 2RKOA 3M4ZA 5AKLA 4BMYA 4CTOA 3KCQA 2G36A 3I5AA 1G38A 4OHYA 2CV0A 1VSTA 2VZ9A 2Y1DA 2C03A 4M7RA 2Q5OA 5J1TB 3HO1A 1IRIA 1LGYA 1SKBA 4RD6A 2PSDA 1SHLA 4KLNA 2Y1XA 4J1TA 1Z5NA 2HSDA 4RL4A 4FCVA 4WLVA 5FWYB 1Y6RA 4UU7A 1G6KA 1EB9A 3K7EA 3RKSA 4DCMA 4WKCA 5C5IA 3KYCB 5BSKA 2WUDA 2JFPA 2X0IA 4XWGA 4CU2A 1ZK4A 3I5YA 5TPWB 3NDRA 1PWXA 4GMFA 4I2VA 3U6KA 1GPKA 3EE6A 5GJWC 5IMSA 2WG0A 3WLEA 2YWFA 5HF8A 2ZTHA 2PUTA 2EX0A 1QG2A 3OKCA 3L49A 3QPBA 4XFKA 4QUKA 3JWHA 2AFRA 1M6EX 4Z99A 1Y4AE 2PYDA 3INYA 5LQUA 4IZOA 1KJIA 4BNZA 1MDFA 3I4LA 1IG0A 5A5VA 2FJUA 2VDVE 1OXTA 4FS3A 3RSGA 4EHAA 3KZCA 5G3YA 2AQKA 1HT0A 2IYTA 4IFIA 2I22A 4DIKA 3PJRA 3G89A 2E37A 4OSEA 2CLDX 4LF4B 3ET5A 4I19A 4NNPA 1YJAA 5G0TA 5AVJA 1Z0JA 5KB3A 1ZC3A 3JASA 4FDVA 1T36A 1LV7A 1ZPDA 1O6GA 3CN9A 4JUBA 2H2GA 5AK3A 5B2EA 3DJFA 5TMPA 2ZBRA 3B3QA 1XCPA 4K2HA 2FGJA 2XF8A 2J33A 2F4VB 4ZHQB 2HU2A 5LBUA 4DMUB 2ERYA 1A0OA 1SUFA 4HAXA 4UJ3A 2AFIE 2WF8A 4ZT3A 4CV2A 4ZGGA 1PQWA 2VHQA 3GNTA 1ID8A 1LEHA 3EVTA 3F1LA 4FLEA 4TUYB 3VNQA 2WD9A 3OQ1A 4KPGA 4DYHA 4M83A 2PUFA 4MV7A 1RBZA 2WKRA 4W99A 3Q6IA 1GZUA 5ENDA 3ZJVA 3L2OB 3OHSX 5EUQB 1NX9A 3MWYW 4XIIA 3ZVKA 4LECA 4V38A 3A1SA 4Y2TA 1V9SA 3UAGA 4BMOB 1N6OA 3FI9A 3URMA 3RYIB 1AKTA 3VDNB 4FFBB 2PU5A 3O1LA 3EW9A 5G41A 1W25A 1U04A 2C8VA 2P2CA 2CFRA 2TMDA 2WM2A 2YZ2A 4CPDA 1FE8A 4JNKA 1AKYA 4NU8X 3PFNA 1RCFA 5HE8A 2VZEA 4MVJF 4LRSB 3D1VA 3R74A 4GD3Q 2XWJI 1K97A 5A5EA 4QXQA 5FNVF 2BOVA 5IEBA 3QP9A 1KDPA 2XB9A 3KELA 4ABYA 4C2UA 1U63A 2C4KA 1ZRSA 3COWA 3DZDA 3JZDA 4DR2B 1SKAA 1T1RA 1TCUA 4N0MA 4Y30A 3TZBA 2QLLA 2HDWA 4KIGA 2OFOA 1FDOA 3D6MA 5ANRB 5BSWA 3V6LA 2R1ZA 3IKTA 1EUCA 3GAMA 3Q7TA 1W9MA 3PNOA 1XRRA 2BIFA 5K03A 1DGQA 1ONPA 2C0CA 3B9BA 3MS7A 4PZZA 2HA5A 3RC2A 4RPCA 3W2TA 3TLJA 3EZ9A 3TK1A 2E4VA 2BF7A 5K0FA 3PEWA 3BH0A 1N2XA 1DDIA 1ZVMA 1ZN8A 2IUSA 4XD2A 4ENPA 5LM3A 1OWLA 4U7DA 3EOZA 3ADKA 3D6HA 3EDMA 2C4UA 4PHHA 2ECFA 4Z54A 2FYTA 4N7JA 5TMEA 3TE7A 1F0YA 1SBCA 4IH1A 3LMKA 1MZVA 2VHVA 1ETUA 2Q27A 4HYQA 3R8XA 3SKXA 4C6HA 2JZCA 4QKQA 1V9CA 2HHLA 3TLZA 1DG9A 5KJ1A 3Q7RA 1DAGA 3UHOA 4DJFC 1JJ7A 3K70D 3NOQA 1I6MA 1QZZA 3DTVA 3JQAB 5AJUA 3BB4A 2I4RA 4Q9NA 2LKDA 2L17A 3QE0A 3PCTA 4KTTE 4Q6WA 3KTAA 4HEJA 4HHEA 1G60A 4AN1A 1KEEA 3SR0A 3PC7A 4B4VA 2ATIA 4PS0A 3KC2A 4HAVA 4MKHA 4DBLC 5CDFE 3FHOA 4LDZA 5ICFA 2GCIA 3AM5A 4X1IA 4EG8A 5HIJA 4CL2A 2BMVA 4MRSA 3VUEA 1L5SA 3AYXB 1IN6A 1CHDA 3CUSA 4MITA 3ZQ6A 4AJ4A 1HDEA 5AHWA 1BXRA 4KFTA 4GXQA 1NVUQ 4DAOA 1ZS9A 3MG9A 1Y89A 2IXBA 4WKBA 4F0JA 1ZNQO 3OU2A 4HDAA 1E32A 1UINA 3QFRA 1HE2A 1Z5UA 3PLAE 1AK2A 1NNUA 5KYUA 1L6RA 4DLNA 2QORA 4N6GA 4RIHA 2X5KO 1I7PA 2R5NA 3HCEA 1G42A 1RCUA 1UMDA 3EDCA 3U7GA 1VGVA 3THXA 1NFFA 1KRXA 5IC5A 1LBQA 2G4VA 2GK3A 3FKJA 3KQMA 4B6JA 1M7BA 2JLCA 3BB3A 4R54A 5JI3E 1F4PA 3DZBA 3EZ7A 2DVMA 2W6OA 1WCV1 1YD7A 2GBLC 2IYSA 2OAP1 3HC7A 3MCZA 4HN4B 1V25A 5DNEA 4W5OA 1G8SA 3LVBA 2O14A 3NKLA 2JKZA 5BV2P 4MQUA 2I9PA 1B00A 1GNRA 3E3LA 5D5HA 1YZGA 2DFLA 1YQXA 2EBFX 2CSUA 4ZVKA 5FQNA 6ADHA 2OVBA 1WABA 3CUYA 5INTA 4B47A 4MGIR 3B48A 1NU8A 2XNDD 4EZEA 2P9FA 4IXNA 4UVGA 4NCBA 1LC0A 3R20A 1YU6A 1DO0A 4Q16A 3P26A 1T36B 3BKWA 2WWFA 4DLRA 2GXQA 2FR1A 1NFRA 2VDLB 2ZJ8A 3JQFC 1PTJC 1QO0A 3BJMA 4WESA 2HWYA 1T0HB 3IP1A 4NYMR 3VPCA 1I3NA 4MVWA 1GKYA 1MH1A 3DUWA 1DELA 3F71A 3QVJA 4CQMB 5JD6A 2DZDA 4JEUA 3WL3A 1PW5A 2BFAA 2NPFA 3JYOA 1MF7A 1OSNA 2BHRA 1C3OA 2DFNA 1QZ3A 1L1QA 1DKLA 1U4NA 2A84A 1HE1C 1D07A 1DQYA 2ACEA 2NO0A 3L6DA 1B3BA 1RQLA 1CKEA 2O05A 3NBQA 3LNCA 4X45A 3TXAA 3UUFA 4LRYA 4BE7B 1U5BA 4QOHA 3OPXA 4DR3B 3N6VA 5ARBA 3FTFA 4W1PA 3MWFA 2ZR7A 4AURA 3M6MD 3U3KA 4CQJA 2CGEA 4TTSA 3SNKA 2XITA 3UBMA 3TKYA 2JEZA 4OATA 4DSOA 4R8SA 4YQZA 1FYWA 4J0JA 4OQDA 2I2BA 3PXDA 3TIGA 3DAFA 1POWA 1YUNA 1G63A 4LNUA 1SVKA 4CCWA 1RFGE 1K7CA 2NN3C 1QDUA 4OYLA 2L82A 5DEOA 4IX9A 1N8SA 3R7SA 1E2HA 2GK4A 4B4KA 4BP9A 1QSGA 1C7ZA 1PQYA 3RGWS 2IHTA 1U1DA 2UXBB 1DJLA 5H3LA 2HDOA 2WJPA 1CQPA 3IERA 3QK7A 2FSIA 4KNVA 3V1TC 2AB0A 1THGA 3BOSA 3CLRD 4MULA 3VHRA 4E5VA 1EFRD 1XN1A 1PG5A 3KD2A 3PUVA 4MWEA 1EUCB 2AXEA 2JKVA 3WKDA 1U7DA 4CLEA 1NBWB 4JMLA 2GK7A 2OM6A 3QBVA 3NIBA 2C2YA 1SC1A 1Y7TA 4F91B 2B3TA 3FNGA 2COUA 4RCZA 2GD6A 4WK2B 3WOHA 1EUYA 1NBEA 2JIZD 2Q9UA 3R0QA 4RDXA 4YRIA 2RJ3A 5ALMA 1WMSA 1DJPA 4X3OA 3PWTA 1AN9A 1AY0A 1O54A 2NZ8A 2ZXEA 4KLRA 4RESA 1OBVA 1V7PC 3FDXA 5TS3A 5EUBA 1H93A 3UTDA 4DJDC 1QK4A 3VPAA 4FEGA 2SHKA 3UWPA 4NCNA 1ZOSA 1P2DA 1KPIA 1E3SA 1Z5OA 4HL6A 3QMVA 3OJLA 4CE6A 1F1JA 1T3TA 3DTVB 3IV9A 1FDTA 3EWAA 3ZEAA 5KOHA 3IMEA 4FP9A 3MRSA 4R6XA 1LI5A 1UR5A 2LPMA 3KTAB 4IYRA 1DG1G 1B0PA 4P08A 2FXVA 4N4AA 4TL6A 1D0VA 5F5NA 4C5BA 2YMQA 1KEEB 2P9GA 2YWDA 2AI3A 2Q0XA 3AZQA 3DEJA 7MDHA 1CJSA 2IUEA 3HLTA 4BKOA 1K5GA 5F23A 4D3ZA 5H59A 5LVAA 5HNKA 2Z5LA 4LOJA 4MYHA 4X1IB 5E6SB 4LSWA 4UREA 5IASA 1Y4UA 4MR9A 2WQ7A 4FDUA 4PNPA 4RK6A 2XB4A 3T4PA 1I1NA 1KHTA 1VL1A 2FPGA 4YAEA 5FHQA 4DKJA 2J4CA 2VDRB 1BXRB 1ZQ9A 2ZCUA 3W1EA 1T2UA 3GUHA 3L1HA 3P2JA 4QOEA 4BUCA 1QR6A 3SXJA 3L7OA 3ZWBA 3JSAA 1WXWA 4EF4A 3AUJB 3WLLA 1DLJA 3GL9A 4EY6A 2QQFA 4DDTA 4MI1A 1T3LA 4FE3A 3W9BA 3HNRA 1FXWA 5HMLA 1GTRA 1VCNA 2QSJA 4C87A 1UWVA 2OQRA 1PYGA 4CGZA 3KKNA 4ZCPA 3UWMA 1UMDB 3THXB 1QQBA 1M2EA 4HY3A 3E70C 2VTKA 3JAMA 2WJHA 3UO8B 4ESVA 1X8LA 3G8AA 3NBAA 4UXHA 5FL7A 2W6PA 1CJMA 2JI8A 1FSPA 4BJ1A 2Q6OA 3KEFA 3E0QA 3OZFA 1ORWA 3ZBUA 3R41A 4A8JC 1NAHA 2PJDA 3HL0A 2HBRA 1JTVA 3L8MA 3OKAA 1NXQA 1JR2A 2ZB3A 1DT5A 3HA3A 2GBIA 3L8FA 3Q87B 3H17A 4KOAA 4QVKA 5DN6A 3IDSA 4Q01A 4BO0A 4EUSA 2MYUA 1E1CA 3R3JA 4KNWA 3UMFA 4C0AC 1ZK0A 1GY8A 1HLGA 3H1GA 3CLUD 4O4IF 5F12A 1GR0A 3GCWA 3PFFA 2GLXA 4BNDA 2R3SA 2YNMD 2V9PA 5A9SA 3QA3E 4FJ0A 4G5XA 3K0SA 2IHJA 4H15A 3D43A 1YS7A 2VF7A 1RLIA 3OMXA 3TE6A 1P61B 1ORHA 4IIEA 1QNFA 4WESB 3HB4X 3UH0A 4DCPA 2WVJA 2Q8PA 4HNSA 3DWGA 3FOWA 4ZAGA 4CMAA 4OHPA 1P2GA 2P62A 3E7FA 1E5DA 2UVQA 2ZLBA 2ZYGA 1MG0A 4FGZA 4YVFA 4NOLA 5H4HA 3KZOA 5T3YA 2R8OA 2ATEA 1VJ5A 5GIPE 1C3OB 2QL9A 3SSMA 3V34A 3UMSA 5KYNA 3NPMA 4MA4A 4WVFA 2GF0A 3ZIUA 3GH1A 4ES6A 1UK6A 4Z51A 5C18A 1NDHA 1U5BB 3I6MA 5GMOA 3DAYA 4RANA 1QP8A 4GR5A 3W3ZB 3BFPA 1C9NA 5JS2A 1RC1A 2R7NA 2XXJA 3SM9A 3LQFA 3TVYA 3O8RA 5C1PA 2H57A 4KE6A 3FAKA 2M6RA 4BZPA 2DT5A 1M0EA 1ECJA 2JAXA 1N9KA 4LNUB 3IDQA 3ROXA 2BFEB 4G85A 1NQUA 4F9EA 3HNPA 2JHPA 2PGDA 4MHOA 3NX4A 1NT4A 2Q4DA 3SP1A 1JR3D 4JB0A 2EF1A 1J8FA 2D1FA 2XDAA 3QWBA 3TM4A 4Z4EA 3EXHA 2FZCA 3OO0A 3S2UA 1R5BA 1H2XA 1KL7A 2X3UA 3MYYA 2J5XA 5I7FA 4UM5A 3EF0A 1CDEA 1NIPA 5ECWA 4YMGA 3E9RA 1DKOA 4C7XA 5I4IA 2RG7A 2D74A 4M8LA 2XCIA 2Z98A 2HK7A 4OLJA 4E2XA 3KQKA 1EFPA 4OFBA 4WJKB 2F8LA 5G0SA 1Z22A 4HUQB 5KAMA 1NBAA 1UM9A 3OD1A 3UAYA 1NPYA 3MJ4A 2HO4A 1I51A 4IINA 3ZI7A 3RC9A 1E9FA 1FTWA 3O8CA 1BYUA 2I4TA 2V9ZA 2WJ3A 3CR8A 3G68A 4HRAA 1M8GA 1PDVA 4QDKA 1SQSA 4JLUA 4M1SA 3VAYA 5IWAB 1VIDA 1FTNA 1Q7TA 2IOHA 2Q21A 1L4NA 3OFKA 4I5GA 1P72A 2FKNA 5IT5A 4URXR 5KQSA 2GBCA 3KKLA 2C2OA 2PSHA 2UUPA 3E84A 4ZYZA 1EBFA 4E33A 3J80A 5KOHB 3KV3O 1CB0A 4FFWA 2CNDA 4PFQA 2YHAA 1SVUA 3QBJA 5HBGA 3RVRA 1NBIA 1IBLB 4LNAA 1RIIA 5SY9A 2NO9A 2DLNA 5I7SA 1CIJA 4NBKA 2BFBA 2I67A 2ZTSA 4XEUA 3KR2A 3LH5A 1GNVA 1GVNB 3M33A 4FFMA 4YO8A 3WNVA 1GGEA 1QYIA 1J2EA 2QP3A 1RMTA 2Q29A 3SHVA 2OHFA 2OXTA 2WF9A 5KDOA 3IVMA 4FYVA 3LHIA 1QORA 1N1DA 3PZBA 2V4MA 4RSGA 5DNAA 3VPDA 2IUTA 4ZD6A 4D4HA 4MR9B 1N78A 1KBOA 2IS6A 5HF9A 4IDCA 1D2CA 3UOAB 3L7MA 1KIAA 2OQIA 1I1QB 2FPGB 2WSBA 4QPPA 3PYXA 4WFIA 4W1RA 5IHPA 5HGJA 5B58T 1SUWA 1ACJA 4IUBS 1KY3A 4L85A 4E7PA 1VKHA 2Z1NA 2HL6A 3DWFA 5ENZA 1HYBA 2Z30A 4LJ6A 3ESBA 2J08A 4DYDA 3TLKA 6Q21A 3PE3A 2PUCA 1Y3HA 3GZJA 5LN1A 1TE2A 4NYJR 3QXCA 1NE2A 1Y1RA 2YC4C 2RAPA 3KALA 3PZRA 4R31A 3HDQA 1C8KA 1W0JD 1WV0A 3BL5A 1K3TA 2ONKA 2H4YA 3NGXA 4BTLA 3MT0A 4WA8A 3BIJA 4KSCA 1WULS 1CP2A 2IZZA 3NHYA 4U63A 1YS9A 3W5VA 1O77A 3KQLA 2LGJA 2QZZA 1Q14A 5IXJA 2VJDA 1VG1A 4YV2A 2BJWA 4GECA 1NRIA 3UG7A 4DAEA 4M1OA 3UBTA 1TO1E 2G70A 1AGPA 1QB8A 2Z8XA 3JZAA 4ZVSA 4RMHA 2HIHA 3W6PA 1Z35A 2X15A 4EKEA 3GRAA 4K86A 1NLFA 2YHIB 3CW9A 1W2HA 2VP5A 1Z0SA 3QENA 1PV4A 2IWHA 2VZ0A 1E1CB 5BORA 1ECCA 2GD0A 1JFRA 4JJFA 2VYCA 1WB9A 4O4JF 1U2GC 4BNDB 3ZN2A 2FF7A 5A4DA 5FTNA 1OFVA 5IAGA 2VQFB 5AVZA 1I4TD 5CDUA 2G25A 2QG6A 3I9V1 1VHJA 4LDJA 4LXGA 1UP4A 4I6EA 4YYEA 1Q1ZA 1MR3F 1F12A 1G21E 1WXHA 2LVBA 3JWJA 4MP8A 5IHXA 1YR6A 2R86A 5HZHA 5KEIA 1MOQA 3HBLA 4EQZA 2WP8J 5F76A 3QJGA 5DM60 2RAFA 5ABPA 3WYCA 1PN3A 4DVJA 1UEXC 5IZCC 2NVOA 1EBBA 1ZGCA 3JQ9A 3NOOA 3ONNA 4I50A 2VJYA 4PFKA 3MTAA 3N8KA 3EIFA 1VE3A 1KOLA 3RFXA 5GZ3A 2IH5A 3BWYA 1TB4A 2PQ2A 1U3UA 1F4LA 5KU1A 1H6BA 5EP2A 3H9CA 1TA0A 2Z1DA 2GHRA 2XIJA 4GXTA 1N8NA 2XZLA 4D56A 1RPJA 4GH5A 1TYCA 2Y1KA 5K4AA 2QS9A 3DQZA 4QDTA 2WFZA 4Z9FA 1K63A 1U3GA 4C3UA 4RHYA 5ARDA 1NC3A 4X66B 1WDLA 4H60A 4UUNA 2W2NA 3N87A 3N8GA 4WLUA 4EMSA 2NTNA 4I3GA 1P1CA 1PZGA 4H4EA 4C4RA 3JCZA 5CM9C 1PT7A 4X3PA 3LIPA 5FLYA 5HS4A 1G17A 3SE0A 5MGNA 3BF8A 3R76A 5BR8B 4BNMA 5JJKA 1ZIOA 1U0SY 4LCJA 5C5CA 1ZLYA 3JTMA 4YMLA 2GEDA 3EGIA 3TRHA 4X24A 3EXHB 4H3SA 3LQKA 5I7UA 3CB4A 4BNFA 2X2PA 4ATNA 1BA3A 4TLMB 5JNWA 1PR4A 1T9BA 2O7NA 1EFPB 3OZGA 3ABQB 5IJ0A 4A16A 1QX3A 1UM9B 4DOMA 4LGYA 3WYAA 5GJCA 2C61A 3W05A 1CUSA 4HX5A 3GFGA 4GYJA 4ER0A 1HQYE 2IP4A 1VJ0A 3H9UA 1RI4A 2P7IA 3EPRA 1IXZA 3G5AA 3VRHA 1MT3A 2UV8A 3PNPA 3OUTA 2B8WA 4N5DA 3HV2A 1A4IA 1C14A 1S3IA 2R7MA 3GVXA 4URHA 4UUOA 1YZTA 3S2SA 3X1WA 1PZXA 4C2TA 3EPPA 4JGBA 3TDMA 4FS8A 1I33A 1C7FA 5DBHX 1UBMS 4UHBA 1KORA 5H9WA 2XZTA 4Q93A 4AJ2A 1YRAA 4FFLA 4OYHA 4DLYA 3O73A 2BFBB 1ZZGA 2MSCB 2C0QA 4NFLA 4O4LF 4Y2XA 4ZVVA 5EJ5A 1E1RD 5I7WA 4BGEA 1FFBA 1KU6A 1MNQA 5E9QA 1CY8A 3H5WA 5EHZA 1XELA 2H8GA 2JGJA 4ZEVA 3CO0S 1TAUA 3C41J 5H0IA 2GN0A 5HFJA 1G7SA 2PMBA 4Q3AA 5FBKA 4Y3UA 4DRXA 1HFKA 3DO8A 1NWHA 1WNFA 1MRNA 2CLCX 1OWNA 1PJBA 4PGHA 3EX7C 2BZGA 4J6FA 4PQYA 3HACA 1PNQA 2OV4A 3KXLA 4TQUS 1P0FA 2QXYA 1A8HA 1Y3BE 5KTKA 1J0EA 4QULA 5DOZA 3K71B 1SUDA 2JLUA 1BMDA 2II6A 3KZNA 1F3LA 2EW1A 1H1TA 3G0GA 1P73A 2R1TA 3F7OA 4RF2A 4P86A 4ZMRA 2HCBA 5I5GA 4DQKA 3KSRA 5MF6A 5JWOA 2RONA 1RAHA 3SVLA 4AECA 1UDXA 4MGKR 1C0EA 1KEZA 1UMCA 4GKVA 1YJ8A 4WK0B 3RV3A 5CA0A 3WQBA 4CMEC 4J0IA 4B8WA 4YXWD 4HMPA 2CNNA 3I1YA 3VPXA 2J3LA 3FPLA 3ENKA 4H08A 1QWSA 1E1YA 3NHRA 3WISA 2HBZA 1XTPA 3SF0A 1I9GA 5AVQA 5ALIA 4RY0A 2NO1A 1P2BA 5JD4A 4JX9A 3BWMA 1K4MA 1O5IA 4LK3A 4ZRMA 3TOZA 2A2ZA 1DO8A 2UUAB 1DTWA 2A5YB 3KL4A 1ZUWA 5KWIA 2WTAA 4ZO8A 1Q0RA 1S8FA 4QFMA 4C7VA 2YFQA 3KO8A 1E7MA 1JHMA 3HRHA 1PNVA 1YU9A 4OB6A 1L5QA 1VLZA 2J07A 4WCFC 4R1UA 3EXAA 2YIJA 4ITUA 4B74A 2QU7A 5AVXA 1T0IA 3FLEA 3P5SA 1IOLA 3H9GA 2YL2A 2Z2YA 1JU9A 4KO4S 4PYKA 2P9CA 4F4HA 2C29D 3IOBA 1EX7A 4RF5A 3SJBA 3P96A 2JGEA 3ROGA 4Z7QB 5LL6P 3NHWA 4FJ2A 4AMBA 1NUTA 4BLUA 3EH2A 3LQRA 1SBTA 2H3HA 3BEOA 4FZ5A 1B6SA 1OHHD 4D0SA 1ZAKA 1ONBA 5LMZA 1RWNA 1ZEMA 1B6TA 3FWNA 4BWVA 1Z38A 1VHWA 5GZ6A 2R87A 5JW6A 4I50B 2YX1A 5HKKD 4JLPA 3EBLA 3OCUA 3I5MA 2A88A 3QU4A 2NU8A 4BPRA 1XTSA 1E66A 2VWHA 3PP8A 4C4XA 2XKKA 3KWJA 4UHJA 4WXEA 4GYWA 5A7GA 1H05A 5BNZA 4DYVA 3GFQA 3PXBA 1A88A 1S2GA 1SCJA 3JR7A 3RO7A 3WNZA 4BVFA 2NNLD 3I04M 2J6BA 4IWYA 3D3EA 3ZR4B 3PIDA 4F5WA 4WZ6A 3QE2A 5EYPA 5I9TA 4BCCA 1K3FA 4FYXA 3UHAA 2PTHA 1G6HA 4QDZA 3VX3A 4I4TA 2YYSA 3CEHA 5GPBA 5T6MA 3OM9A 4E14A 3ST7A 1XZBA 2IZ0A 2YR0A 3QXHA 5HK8A 2ZSHA 4TXNA 3NRJA 4JWTA 3ML1A 2XA9A 1HI9A 2NV0A 5LMNB 4OVKA 2Y76A 2H1LA 1ZSVA 5EPOA 3DEFA 2C8KA 5EINA 2NQTA 3I39X 1O96A 4M38A 1GV1A 4YRLA 4CEJA 4OXKA 5CYOA 3PXGA 3RPEA 4HLUC 3GYGA 1RYFA 5IJ0B 4JZKA 5JMWA 1HTTA 1JIIA 1PIWA 4Q7MB 4BAGA 2HDHA 3I05A 3NG1A 1Q0TA 1PJCA 5DNVA 4K6MA 2GJKA 4MKIA 4RV9A 5HFNA 4GIBA 3M49A 2D5CA 2UZ1A 1YVRA 1Q77A 3N0WA 2DB3A 2VXBA 4WINA 2E18A 4X00A 1V43A 4ZYWA 1A7KA 1Y9AA 3LHFA 1XKQA 1G6OA 2B37A 1EM8A 3DV9A 1E9BA 2HQSA 4CRWB 2ROQA 4POAA 2ECPA 4FMDB 2I3AA 1F20A 4GMDA 3HSSA 4LOHA 2J3QA 2NSJA 4FCCA 2P9QA 2D00A 5E1OA 5ED0A 4YWHA 3KJNA 1R0BA 2E4AA 2FPMA 4IY1A 5C3MA 1BGVA 2LTAA 4GE3A 3COYA 5CFNA 2PWZA 2WIJA 3B1FA 3N9IA 4KAFA 4EVRA 4FKZA 3QBEA 4BL5A 2V6BA 1IJKA 2WYIA 4RFLA 4A23A 2ZTUA 2Q9AA 2QYTA 3MGKA 4ZAYA 4F5EA 4ZQBA 2E7ZA 4ALKA 3PVSA 2EQ5A 2ESRA 3GRKA 1P39A 2YDXA 4AJ9A 1NV8A 3OCXA 3ORFA 3HUEA 2DECA 4C7OA 2PRZA 3RUIA 2PBLA 3QW2A 4HQFA 4KO3S 2IEZA 4O6VA 3TSAA 5A1TA 2HN9A 2GRJA 1O6ZA 1HSZA 4K26A 5A7FA 1O94D 4WXRA 4K28A 4MB2A 1RZRD 1JUDA 1KEWA 1XNJA 1VMAA 3A6ZA 1C3EA 3NVKI 4ENWA 1PG2A 1DRJA 3ISJA 1RYZA 3C3CA 1K8ZB 2NIPA 2WKWA 1S5PA 2JF0A 4L2IA 3FTCA 3CLKA 5AO9A 3ZY4A 5JVDF 2ONCA 3MSXA 4N39A 2R1TB 4PE5B 5CHEA 4XPIA 4G01B 3A4VA 3I23A 4LOKA 2OWEA 3UJ8A 1UMCB 5IDQA 1IZZA 1YI8A 2GHQA 1GAQA 2LWIA 4DIDA 5CA0B 2QMUA 5I51A 4A0HA 3K4HA 5EJ8A 1VGRA 2P41A 2RKBA 2YJNA 4UQOA 4URUR 1IJEA 4LZAA 3VZRA 5LNK6 1D9XA 2FLKA 3M9LA 4MP3A 4R9RA 5IDYA 3KJFA 3ANYB 5L4NA 4J94A 1DTWB 2QLMA 1GGFA 3ADCA 2IC5A 1T0JB 2B35A 1AUOA 3I5UA 3MPUA 1L5VA 1GRNA 3LUPA 1RM5A 3LK6A 3QG1A 2QVBA 5CVJA 1QIKA 4L0DA 4X20A 2ZB2A 4F1WA 4C43A 2FPPA 5BV7A 1JN0A 1W36D 4LZNA 2A7QA 3CJTA 1DAIA 3N7AA 4ENSA 3G2IA 4O8CA 4IKPA 2K7FA 1F0KA 1LQUA 2P2DA 3DONA 3FYTA 3M0EA 3MJDA 3MQ2A 4QPDA 5EIFA 5FQOA 3VQTA 1VQ1A 4CI9A 2GF2A 4OK6A 4BJ3A 3L3BA 5HCNA 3O38A 5LDGA 5DTEA 1G5RA 2G83A 3SHWA 4EHBA 4EJ0A 1I2AA 1RWQA 2WIAA 3EC7A 4CDGA 4CIVA 3JATA 1XZLA 2CHEA 2J30A 2TECE 4G1MB 5JCJA 4BYGA 1KDOA 2KYRA 3L7DA 4CLXA 5B1HA 1A50B 1CZKA 1AHHA 1YZQA 4BGIA 1UPUA 5F3WB 1MXFA 1ORDA 2VDNB 1EFRA 4KLZA 3KSDO 5EQDA 1QGAA 1LLUA 3KWLA 2YRXA 2XWSA 3CZMA 5NULA 2NU8B 4CMBA 2XMCA 5J23A 3LDAA 4XH9B 2J3KA 2V58A 4KSYA 4A0SA 4DZRA 2C5AA 3E7WA 2JIZA 1KK1A 2PHZA 3BC1A 1AX9A 4QUJA 3TINA 1VRWA 2B25A 2XLCA 1Q50A 721PA 4BQEA 3I2KA 4UW9A 1WBDA 3E1GA 3W8NA 1UP7A 3PGKA 2XCSB 1Z4QA 1Z7WA 3KXKA 4JXJA 4L5CA 2GPNA 3SU8A 5BMVA 2Q62A 3U4IA 4FMCF 2PUHA 2GNPA 1AZTA 3FPBA 1BFDA 2Q1XA 5D2CA 5ALOA 5EYPB 1EJ2A 1YDFA 2JAOA 2ANBA 4CM6A 3JQ7A 3MA0A 4F72A 5AR1A 3WQSB 4I4TB 3NHKA 2G63A 1MXHA 3MRVA 4YFVA 5DO9A 3IAS6 1N2BA 3A1EA 3I5XA 3SFVA 3FCYA 1I32A 1IHOA 4KXYA 1Y4DE 3QXSA 5KJFA 1Q83A 4AP9A 4M0MA 4CUJA 1ND6A 5DISB 1HKHA 2H7VA 3T7AA 3DB2A 4H9GA 1K3UB 4X6UA 1VL6A 3LCUA 4BVKA 3P9SA 3ETDA 4CEJB 1O96B 2P7HA 1ES9A 3H3FA 2ZT8A 4KRFA 4NP6A 4PFSA 1IJBA 1P6UA 1UPCA 4I46A 3ZDXB 4V02A 1FNSA 5ALFA 2D6FA 2OL4A 3TJZA 2YMPA 1GPYA 5JTTA 1J8QA 4IMIB 3ZCSA 2ZBUA 2IKSA 9MHTA 3D7RA 4W5RA 1QHEA 2UZ1B 2HB6A 4U7PB 1FP6A 5F2KA 3M9XA 3N5CA 4ZO7A 3EGCA 4GEGA 1EM8B 4AMVA 1KGSA 4O2AF 1HF3A 2YIDA 2ZRPA 3DM5A 4DA8A 1KO5A 1LPOA 2GD2A 4JH0A 3DDZX 3EXEA 1E7QA 1RLOA 3DLTA 1S89A 4HNHA 4Y6SA 5KS2A 3SCZA 1QP4A 2CSXA 4BNJA 3UNXA 4F92B 2C92A 1VMEA 2Y2UA 1XDGA 2A5DA 2GASA 4EB3A 5BWMA 2QZSA 2ZP1A 3E7PA 5LYJF 2IDKA 4QGSA 4DNFA 1CTQA 1IY0A 2K4MA 1N92A 4TXJA 3RAFC 1PR5A 3K6SA 3G49A 4YASA 3MBIA 1VPEA 3KVRA 1ZJWA 3CF4A 1DQPA 3EB9A 3AY0A 3FMVA 4FBGA 1PYOA 2WNIA 1FY2A 2I54A 4KN8A 4ENTA 3EVAA 2PV0A 3USCS 3BEDA 3E7DA 2XJ4A 3ETEA 4A36A 5TGTA 1DVRA 3KLOA 4ZQEA 4QXMA 5EQTA 1K7SN 2HLHA 2E6KA 2FLVA 3DOIA 1M7GA 3EEIA 4ZI2A 3BXFA 1DI0A 4JOCA 2YNMA 4L2IB 5E9AA 2LDXA 1AK9A 4YH1A 4CETA 3DLAA 1UFKA 4DQXA 2VAMA 3MB5A 1NBHA 4LQDA 1N5OX 5SICE 2DBVO 1A69A 1U0LA 1JAIA 2DUUA 1IB0A 1V4NA 1AKWA 1U9CA 3LVRE 3UA4A 2UYQA 4TXHA 5D1NA 3TG8A 1S3SA 2JS7A 3WGLA 3VKGA 1DBWA 4LZPA 3WQHA 2XXAA 2JGMA 3E8MA 4IVRA 3X43A 4GPD1 4L72A 5IMBA 3O82A 3SJCA 4B3FX 4CG1A 3L1IA 2W43A 3HO6A 1UUFA 2RH9B 5D5QA 1JTFA 4KEAA 2NO4A 2XYHA 4RAQA 2W2TA 1CHNA 3BIFA 3GEHA 1G1AA 2QAGA 3V1LA 1Y8AA 4X20B 1ISFA 3O03A 4AY2A 4KXVA 1Q6ZA 1BKSB 1TFRA 2AN4A 2ZUDA 4QU8A 4A73A 4DLXA 1MJGM 4CN8A 5HKAA 4Q12A 3AYZB 2GGSA 3QIVA 4G1CA 1M66A 1CEXA 3L6UA 4P6VF 3STWA 3VMMA 1NF2A 1KEPA 5BNFA 4D9FA 3EEOA 3C5HA 3TTUA 5CITA 3PF9A 4RZHA 3LFUA 3P9NA 4UUQA 3AOEC 4YYZA 9LDTA 4M1WA 4OY3A 1D6JA 3IE2A 2R8ZA 3FPKA 3GPIA 3NIWA 3PC6A 2YUIA 4II2A 4GICA 4Q48A 4AF8A 3LRXA 1EGMB 3FOCA 5KCZA 4UTOA 4WUVA 3VU8A 3GV0A 2C8JA 2WM3A 4ASUA 4D9CA 1KTVA 2HJRA 1VYVA 2HCRA 1NJGA 1VMIA 1NVAA 3C43A 3SYLA 3TN7A 1S2MA 3L9WA 3ID6C 4IQFA 1XGKA 3HR7A 3JATB 5E4TA 1L5MA 2H51A 2FFHA 3GRFA 1JR3A 4HF7A 1P1JA 4DXDA 2C04A 3DYIA 3SGLA 5HW0A 3NW9A 2X1MA 1JEDA 4DSZA 4B6EA 2HBQA 4G41A 2Q6KA 1MB4A 5AH0A 3GJ8A 5CW2A 2WTBA 2ZRMA 3SICE 4EWLA 1RHMA 3BH7A 1P1BA 1E3QA 3WL5A 4FONA 3FOEC 2WZCA 3TX2A 3MAAC 1WMAA 1QPGA 2CMKA