3KQNA

Three conformational snapshots of the hepatitis c virus ns3 helicase reveal a ratchet translocation mechanism
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
437
structure length
437
Chain Sequence
SPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Serine protease/NTPase/helicase NS3
publication title Three conformational snapshots of the hepatitis C virus NS3 helicase reveal a ratchet translocation mechanism.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 154
structure length 437
sequence length 437
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3kqnA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqnA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kqnA01
4CDGA 3TVTA 3V9PA 1W46A 5FL3A 2ZETA 4IDPA 4NP6A 1M74A 1PJRA 1RW4A 4HDCA 5FTJA 5KDLA 2X19A 4CEJB 3O47A 1V5WA 2QQ0A 5EJEA 2V1XA 4OYHA 1JXMA 1KMQA 3CIOA 1NIPA 2A78A 4CT5A 1S3SA 2C95A 3W9YA 1VTKA 2GXAA 3A4NA 1EFRD 2IYTA 5DHFA 1Q1QA 4A0GA 5B2ZA 2YOGA 1QBKC 2Z83A 3V4RA 3WBJA 5DHAA 3BH0A 1E6CA 1LNZA 2BEJA 3QPWA 1E1QA 2DHRA 4F4JA 4PSVA 3GJXC 1UF9A 1IN4A 4OHXA 3B1YA 4R2IA 1AS3A 2A5GA 4LOAA 4Q47A 3GJ3A 4RSGA 5LD2C 1AZTA 2JAQA 3QXHA 5C1BA 2IUSA 4NZYA 3I8XA 1WBBA 1YJ5A 3CZQA 2HYDA 1JPJA 1ZBDA 4AC9A 2ONKA 4M9QA 2YKGA 2ZI5A 3DZ8A 1UEIA 1F3OA 4IVQA 3TAHA 3GJ5A 3P4YA 1E2MA 4D4JA 3HWSA 5E4FA 5EUMA 1H8ED 3NH9A 2GJSA 4N0DA 1N6OA 5SZIA 3AKCA 2GJ8A 4EPWA 3KFVA 3B1ZA 1OB5A 2GK6A 1II8A 3QIAA 4LC0A 3SQXA 2ODBA 2BMEA 2BMFA 2ZRIA 4M4SA 4AWXA 2GJAA 5CB6A 2R6CA 3CH4B 1G17A 4WXPA 1W1WA 3TRFA 2FFBA 2ZREA 3HR8A 2ZVQX 1KI4A 2K5UA 1KMHB 4Q4JB 2ZRBA 2I1QA 4K46A 2G6BA 2C9CA 3O8DA 1LB1B 3CUEF 2IXFA 3CO5A 1CLUA 1FFHA 4MUAA 3ZIAA 1DS6A 5DLQC 2ZEJA 1Y3AA 1UEJA 1W0JA 2TMKA 2WOOA 2E9SA 1G20E 4BEJA 821PA 4A4DA 4WZAE 4KODA 3BH6A 2CE2X 1E9SA 3L82B 3ADDA 5AJYA 1N0VC 1ESNA 2REBA 2JLQA 4NYJQ 2P65A 4DCSA 3CRQA 4LYFA 3T1OA 3RHFA 2QMHA 4B48A 3W6OA 3AB3A 2FG5A 4Q19A 1Q1EA 1W49A 2MSEB 3A1WA 5C2JB 4MGIR 2WZQA 4RZUA 3R7WA 1G16A 3NWJA 4RKEA 3TMKA 3B8HA 3RWOA 4LRWA 1QHXA 3TJZA 2VP5A 4X8LA 3VQTA 2ZJZA 4ZDWA 1GITA 4Q1EA 1CR2A 2OILA 4RD4A 3BOSA 5G3ZA 2IYLD 3EAQA 4HI0E 1R7RA 1WCV1 4M1OA 3QKTA 4KYIB 3CNNA 5AJXA 2H7VA 3FKSA 4LPKA 4V0ME 5D3MA 2ZI9A 3LVQE 2Y8EA 4OQXA 2A2ZA 3G82C 2A5YB 4QBGB 4G5OA 4JJZA 3SFVA 2XZLA 4LHXA 1E1QD 4M1MA 4B71A 1Z0JA 2QTFA 3CNLA 3CX6A 2Q9AA 4HLUC 4Q9KA 2KI5A 3DPUA 1F2TB 5FTNA 4Q5IA 2E87A 4D81A 2J45A 1GKYA 2HDNB 5BN4A 3FVQA 1I2MA 4L9WA 1QVRA 3ASZA 4ZIRA 3U44A 5JSZA 1QG2A 2DFNA 2G0NA 4QKQA 3H86A 2OXCA 1LFDB 2NQ2C 1ZRHA 1P2VA 3B60A 1E9DA 3CZPA 4S2EA 3K53A 1GKIA 2AK3A 4ERNA 5J4KA 2V9PA 3NTUA 1Z22A 5AUNB 5EE1A 1OYWA 1NN5A 5DI3B 3B1WA 4JVNA 4RFSB 4B2LA 3ZS8A 4EDHA 5LDDC 2VA8A 4EFNA 5G40A 1P2SA 3PQCA 4BQSA 3EA5A 3IEVA 3RRMA 1OYYA 2JLWA 1E69A 4NPHA 1SGWA 3ADBA 2I4IA 4PQYA 1KI9A 2AD5A 1M2OB 521PA 4C4PA 3NXSA 1N6PA 2WV9A 3RANA 1ONBA 4HAYA 4WXRA 4Q18A 2ZRLA 1W4CA 4TLCA 2GCOA 2JJ8A 4DT1A 1FZQA 3ZIAD 4UXJA 2PEYA 4LJ4A 4KBFA 1NVVR 4HAWA 1KJWA 3PITA 1W0JD 3BFVA 2VL7A 4YDHB 5C4GB 1OH6A 2HF8A 3NBZC 4B44A 3FB4A 1EFUA 1D9XA 2Z4RA 1KNXA 5EP4A 2IT1A 3B7GA 2GKSA 2OM2A 1NBMA 3THYB 2AK2A 2NTYC 2ZRMA 4D6PA 4GT1A 3UMSA 5FBLB 4IHQA 5JS8A 1GWNA 1KYIA 1Z47A 1IXZA 4UJ3A 5K8TA 3GLIE 5BN5A 5IT5A 3CW2A 1II0A 4KLZA 2D7DA 2VQSA 2ZSEA 5KO2A 1IN7A 4GL2A 1SKQA 4EPVA 4V0NA 3WXMA 3EZ6A 4E22A 5KU1A 2XZPA 1LS1A 1NF3A 4IDOA 1E4YA 1XNJA 1W0KA 2F1RA 4BLSA 1XEWX 1ZYUA 3FKSD 3KJEA 4HLUA 5DIFA 5E7MA 5FI1B 4RCYA 3GLFE 1ZC4A 3DMNA 4DLRA 1FNNA 1Z29A 2LKCA 1T9HA 4JLJA 2OFOA 1MV5A 1XZPA 2BV3A 1XDBA 3EC1A 4LY6A 2OHFA 3TNFA 2V7QA 1Z6GA 2QUZA 3C16C 4AK9A 1XMJA 3DVLA 2GILA 4AURA 4P32A 2QBYA 1TUEA 2F1JA 2H1LA 4UNSA 1NLFA 4LHVA 1VG1A 3B1XA 1Q3TA 4TLEA 2JJ2A 1CS4C 4HZUA 3ZZTA 3K0CC 4XVUA 3SU8A 2ORIA 4QC2A 2ZYWX 2X8AA 3QF4A 1Q1BA 3THWB 3HR7A 4QBFA 1SULA 3ZVMA 4M1WA 3U3RA 1DE0A 4JBXA 2BKEA 4MGZR 1G6OA 2JIZA 1DVRA 1XJ0A 2J3EA 3FPAA 4TYQA 4A15A 1TQDA 2H17A 2OG2A 4AKHA 4QGFA 3MSXA 3BB1A 3QOFA 2R62A 4D0NA 2QPTA 2HF9A 3LX8A 2PL3A 2IF0A 5GVRA 4YXWA 4IJMA 2FWRA 5TDHA 3SJAA 4DLYA 6Q21A 4PPGA 2UKDA 1NIJA 2ZUDA 4TWZA 1BYIA 5J40A 3KUCA 2RHMA 2HJVA 3OF5A 4PZZA 2IS2A 2FGKA 3T34A 3T5GA 3QXJA 4BECA 4A92A 4QHTA 4IEIA 5JHGB 1G5TA 1U99A 4G5RA 1MO3A 3P1JA 2ZUCA 4BFUA 2AFIE 3GLGB 1YZLA 1JNYA 1OH8A 1G3MA 3RSLA 3O8BA 2WAYA 2BIFA 2DFLA 4X8OA 4N0EA 1S96A 4Q7MB 1G3QA 2AFHE 2IK8A 3KFXA 4R7ZA 1NBMD 1TQ4A 4B35A 1G8HA 1TQ2A 2BBOA 4D4KA 1T8TA 3R9IA 5IDVA 2O8DA 1CBUA 3WRYC 4KVGA 3OEHA 1NVUQ 1G5PA 2RHDA 2BJWA 2ZRJA 4OKSA 3VHXA 2QPOA 2VIIA 1GRRA 2IXEA 2AXPA 2IHBA 2B8TA 3KXLA 2JA1A 4KYUA 1Z2CA 2VRWA 1P9WA 2CDNA 3ETLA 1UBCA 2V4ZA 1XTRA 1JXOA 3PUYA 4YMWA 3A1TA 2GESA 3C14C 4HB4A 2A30A 3R20A 5CK5A 5AJVB 2ZPTX 4A0RA 5J5CA 1JR6A 4EUNA 3LVRE 3SBEA 4PPNA 2ZITA 3K70B 2QMUA 3SDZA 3RS4A 1OSNA 1QHGA 3NVAA 2W0MA 1XXHE 3GJ4A 3F5FA 4PC6A 1HH4A 2DB3A 5FTMA 2J41A 1GNPA 4US2R 2REXB 2XNSA 2V7QD 5KDOA 3QXCA 4OQFA 2R6AA 4AD8A 5JWRA 4NYIR 2P6RA 1VG9B 3K0CA 4I81A 5F9HA 4LGMA 3ZZUA 2B92A 5CLQA 1NN3A 3Q5DA 4YQFA 2H92A 3U7FB 2JJ2D 4XWAA 2VHJA 1AGPA 3EC2A 2G3YA 1T0JB 3B5JA 2BHRA 4BFSA 3L0OA 3SYKA 4Q4HB 3TBKA 1XWIA 1VYUA 4C3ZA 4I1SA 3EPHA 4IRUB 2B7CA 4DDVA 4WZBE 2JIZD 4BEBA 5HKKA 1KDPA 3I62A 1ZM9A 2ATVA 2GCNA 1XTSA 1ELOA 5CB8A 5HTKA 1X1RA 1OJLA 3U7GA 4YXWD 2VSXA 3EPLA 4BRWA 5FBRB 2QAJA 2RGEA 3LLUA 2GVDC 1G19A 3GLHE 3KXKA 4KI0A 1EWRA 3SYNA 2CL6X 4WW0A 1GRNA 4V0MA 3DKPA 5LB4A 1XEXA 1V43A 4A6XA 3CLVA 3IGFA 4BZXA 4TZ0A 2EFCB 3SJZA 2ORWA 2V8OA 4BFYA 5C18A 3EASA 4PHTA 3RLFA 3DZDA 2VP4A 1W4BA 4CRWB 4QJ3A 4E03A 3GJ0A 3QKRB 4C7OB 4EPTA 4KHZA 3TAUA 1Z0DA 2NOAA 2QTVB 3UK6A 2C96A 4FW9A 4PO8A 4U7DA 3EIQA 4FMDB 3DL0A 3CBQA 3TR5A 2PZEA 4ESHA 1N5JA 1RYFA 1U8AA 3NBYC 2GHIA 3Q72A 3OEHD 1ZC3A 2D74A 3LD9A 4OJKA 1GM5A 4LSGA 4M8NE 3GEEA 3TKLA 3THOA 1M8PA 3BD9A 1U0LA 4LHZA 1NLZA 1TTTA 2IYXA 5FPHA 5JFGA 1ZM2A 2D4HA 3K0EA 3N70A 4HB2A 1IY1A 3NEYA 1XU4A 3KKQA 4R98A 1R8QA 4D80A 5HPYB 1SVLA 4JYCA 1N6KA 4OHVA 1XTIA 4RD1A 4C0JA 3ZJYA 2BBTA 1W5SA 1RYHA 3MJHA 3BFXA 2WVJA 1X3SA 3QG5A 3L43A 3M6AA 1OKKA 4OI1A 3F8TA 2O8BB 4BLOA 4C9BA 4A82A 2WMNB 2ZU0C 3T15A 1PLKA 5FTLA 2D3WA 4D82A 4TTQA 4PC7A 2ODNA 4BZQA 2SHKA 1G3UA 2F43A 2WJVA 3OIYA 4ACBA 2V3CC 3ASYA 3U4QA 1E99A 4KAXA 2JLUA 1U8YA 3VR1A 4NYMQ 1WBDA 1ZU5A 3GFPA 1ZD9A 1KJZA 2R6FA 1JR3D 3I8SA 1MO4A 1AKEA 2FU5C 2V6JA 2YC4C 4BPBA 2ZANA 1XTJA 3B2EA 2VP2A 1A2KC 1CIPA 4OK6A 1IJEA 3WNCA 2BEKA 4YDSA 3GLIA 2O5VA 1G6HA 1A4RA 2C78A 4H1VA 1T6NA 3MCAA 2PJRA 1FQJA 1E2NA 2ZU6A 4TTPA 1GOTA 3K0AB 4DSOA 1IN8A 1RJ9A 3DEFA 1XCPA 4FD2A 2BBSA 1N2CE 1TEXA 5DYGA 1PV4A 3A4MA 3AF0A 2IC5A 2OZEA 3KKNA 4GZMA 1N5LA 2ZI7A 3FFBA 4BLTA 3GLFA 1DPFA 4Q7JB 5D3QA 1X8JA 4QGAA 1Z83A 3REFA 1TF7A 4Q1AA 1E96A 2F9LA 1DEKA 4GI7A 5EP2A 1TQ6A 2XJ9A 1Z8FA 5H68A 3RRNA 3NDBB 3B13B 3KKPA 4IW3B 3L0PA 3AVUA 1MO5A 2FFAA 1X8LA 4B33A 3R8FA 1SHKA 3FE2A 4HAZA 4M1YA 2RCNA 4O25A 4CW7A 1H8HD 4NYJR 1KHTA 1Q21A 4D26A 4HLCA 4Q7LA 1EWQA 1PLJA 3W8RA 2FSIA 2WPDA 1WA5A 2Z4SA 3ND8A 5AJZA 5HE8A 3AVQA 2Z0MA 2IYRA 4A8JC 1MABB 3HYTA 2WWHA 3W5IA 4QFMA 5FOSA 1SVIA 4B32A 3SI7A 1J7KA 2XXAB 3C5HA 1GFIA 3QJYA 4N1AA 4ZPXA 5HE9A 2XGJA 2QROA 1QHSA 3OEEA 1U98A 4HUQB 4C2TA 1KDTA 2ZI4A 4TQUS 5E7IA 4PXAA 1US8A 1LW7A 3C8UA 2C99A 3KZ1E 3WP1B 2WWGA 4MRVA 3TVDA 1H65A 1D9ZA 1Z0FA 3H1TA 1OKKD 1R5NA 1G8YA 1G8GA 3PUWA 5IK2D 2F7SA 2WJHA 4L4UA 2FPLA 4B3XA 3U6KA 2CBZA 2FE4A 3EWSA 3GJ7A 3WNBA 4DSNA 3UXMA 4TYNA 1QHHB 1RE0A 2GXSA 4FCWA 4Q9LA 2OT3B 2RAPA 3RC8A 2YC2C 2REOA 2B8WA 2ZYUX 3D31A 3GMTA 4L8GA 4OBEA 4JLKA 1BO6A 2GJ9A 3PEVA 4B74A 2P2LA 3AH8A 2YWGA 4M9XA 1T3HA 2AD1A 3WYFA 3C5CA 4ESVA 3E2IA 1P6XA 2EW1A 1R5OA 3S1AB 1E9EA 5FPSA 1Z0IA 2WJGA 1ZINA 5EQTA 1W36C 2IS6A 2IYVA 2XNDD 2GWHA 4MRSA 1OHHA 4UNQA 3K1JA 3L8ZA 2ZVPX 3PENA 1M7GA 221PA 4C0LA 2QQEA 1PZNA 3AVTA 1M7HA 2GK7A 1EFHA 4L15A 4MDEA 2NO1A 2XOKA 2OBLA 4ARZB 3MG9A 1XP8A 2FV8A 1HY3A 2Q3MA 3CPJB 5HCIA 1I4DD 1Q44A 4LHWA 5JWOA 2YJTD 3THXB 2VHTA 3M1IA 3DO6A 4Z8YA 1WRBA 4CZ2A 2GEVA 1XJCA 1JECA 4BE7B 2X1VA 3PUZA 4LC1A 2WMOB 3FMIA 3UMFA 4QM6A 3IILA 3U7HB 1YVDA 2WM9B 1EXMA 4Q21A 3QBTA 2QY9A 2ZYVX 3HU1A 5J4VA 1XEWY 2BDTA 4GOJA 2FEMA 1KK1A 2FX3A 3KKMA 3AF1A 1XXHA 3I73A 4CYMA 2VBCA 4KVAA 4TZ6A 3GJ6A 3OIWA 2GAAA 1TNDA 4GP6A 1FPMA 3G0HA 1JAHA 1OFTA 2ZSBA 4BFZA 1E79A 1SQ5A 1Q3HA 2ZE8A 2ZRGA 1L2TA 1AA9A 1HQYE 1CEEA 2ZIAA 2YVUA 2UZIR 3DOFA 4LZZA 1YHNA 1KI3A 2EU8A 2IA5A 4A8JA 4PHFA 2CL0X 1Q1ZA 5KNCA 3GP8A 3Q7PA 3I92A 4JSTA 2CHQA 3D3QA 3KTAB 4BGDA 5KDDA 2WJJA 4YMSA 2DBYA 5CDFA 3OE7A 2J0SA 1RZ3A 4Q4LA 2OXRA 2VP0A 3KJGA 1OH5A 1HT1E 1UKVY 3MFYA 3HP1A 3GEHA 4ABYA 1JJVA 1MR3F 1E2QA 4OI2A 1T4GA 121PA 3OEED 2YWFA 1E2KA 4BLRA 4AYXA 3QI2A 1R0ZA 5FBVB 4GFDA 1IJFA 4EJSC 4HAUA 2JASA 1E0JA 1WQ1R 4ZV4A 1WE2A 3GCGA 1N6RA 2ZYTX 1GNQA 4XTRA 1ZU4A 3LNCA 3GLHA 5G3YA 4NU0A 1R2QA 621PA 1BIFA 2D2EA 1Z0KA 1YR9A 3TSWA 2WSSA 5FOWA 3A37A 3QXXA 1S1MA 3EZ2A 5L3QA 3QKSA 3RNLA 2CJWA 4LV5B 2OEPA 4HZIA 4GMDA 3WP0A 1E2LA 4WA7A 1BMFA 2RGNC 2QP9X 4HYYA 2FPKA 4P4SA 4QJ5A 2JDID 4Q4AA 1R0WA 2KSQA 1G291 3WY9A 1FOEB 1FMJA 4UXHA 1OHHD 3Q3JB 4Z1MD 4DIEA 3C7KA 3NHBA 3KQNA 4JS0A 3KDSE 3DOEA 3AVVA 2GXUA 5SZKB 1U94A 2CLCX 5GJCA 2ZR0A 2XOKD 2N42A 3UMRA 4C0KA 3QXSA 1MT0A 3IDQA 4R2HA 3A8TA 2QENA 4JT2A 3PEYA 3VU9A 3RRZA 3MJRA 2AWOA 1IN6A 3D8BA 2H57A 4I1OA 1E1RA 1II8B 4EPRA 1Z07A 3PUXA 1DOAA 5TV2A 1KSHA 5JI2E 5L8VA 3EG5A 5DNYB 1E0SA 1FX0A 5FR2A 1RVDA 4Z8XA 2PLFA 1KO7A 4C0AC 1G1MA 5BXQC 4KBGA 3FYHA 4C0QC 2FZ4A 1JBKA 1XMVA 1ZM7A 2XTZA 5GJBA 1G4AE 3TSZA 4XIGS 4RJLA 1E79D 2J46A 2OUKA 4MH0R 3AEZA 1IOZA 1CR1A 1NMZA 1KI2A 2ZJ5A 4DC9A 2C04A 2DFTA 1IBRA 2ZRCA 2HV8A 2PMDA 2CCJA 4JVMA 1GILA 1XJQA 3FDIA 5CLLA 3CF6R 2QAGC 4DSTA 1TEVA 3PG5A 2NMVA 5DYIA 1UAAA 3WBKA 2NZ8A 3OE7D 1P62B 4DLWA 2QTHA 2XAUA 3F0TA 1T0HB 4EPYA 4EJSA 2OCPA 2VF8A 4AYTA 4WBSA 4JSYA 1SXJE 3PUVA 4Q02A 2IWHA 1YZUA 4AI6A 4B76A 3BFKA 4KU4A 3R7WB 3VR5A 3ADCA 3VTKA 2CHVA 1KI1A 3QF7A 2HJGA 4XSGA 4D4LA 2JGNA 4XWOA 4TLAA 1ZAKA 5H1YA 4FMCB 4URVR 3LQRA 4JYBA 4DCNA 4S35A 2Q3HA 4PPFA 2RGNA 2DWPA 1PLLA 3MAAC 4NCKA 4KITB 4G5SA 4QGHA 4DJTA 5D3MB 2GBLC 2BMDA 4JKIA 1JQJC 4F4CA 4ZDJA 5LD2B 3EPKA 1W36D 1KDRA 1G8FA 1K8RA 3RVBA 1ZMXA 1BMFD 2WWXA 2CE7A 1X1SA 3SYLA 4IOJA 2JLZA 3AQ4A 4DUGA 4LYJA 1XCMA 3V00A 3UG7A 4KFRA 2O0JA 2P5TB 2ZRHA 2FSHA 4XWKA 3IHLA 4RD0A 4BFXA 4ZIRB 2EFEB 3U44B 2OV2A 5JSZB 3ADKA 2GEUA 3SS8A 1RC8A 5EP1A 3SR0A 4B43A 5KSOA 4JLPA 2AN9A 4O0MA 4OQMA 1Q22A 4MKIA 3BXZA 2GNOA 2ZQ5A 3CX7A 4GZLA 1QZXA 1KO4A 2XSZA 4KFSA 4JLOA 3WMGA 3K9NA 1YE8A 4D0LB 3DDCA 5L3SA 3UATA 5DN6A 4GPTA 1E1RD 2QGZA 3JVUA 4M2LA 3QE0A 5JHHB 1GUAA 1JALA 1L7VC 2ODEA 3SN6A 4F92B 1VYTA 4O2LA 3SFZA 3EZ9A 1J8MF 2ZSAA 1NG9A 1CXZA 3E70C 2CNWA 1VHTA 3VR2A 4IVRA 4OI0A 2GCOB 3DKVA 4DT1B 2QAGA 2V55B 1KOFA 2GZDA 1Z06A 4DCVA 5KNBA 2W6IA 2PT5A 3I1FA 4PX9A 1ESMA 4JL8A 2RH5A 3BERA 2D06A 2JATA 2FFHA 5J47A 1U81A 3QVUA 2Q3FA 3LXXA 2GVZC 2ZI6A 4Q9JA 1G21E 5CK4A 1Z63A 1RRGA 3QUSA 3EWAA 4JVSB 1DAHA 1HUQA 4AG6A 1Q0UA 4BWYA 3Q85A 4P4UA 3EZFA 1DTSA 4I1UA 1E0AA 2VP9A 1F5NA 4JLVA 1SKYB 3MMPA 2G1KA 4DHEA 4KO8A 5K8IA 4TLBA 1CRPA 3ZLJA 2R2AA 4Q01A 1D2MA 4UNNA 4JLDA 5FH9A 2OCBA 5G53C 2GBLA 2KWIA 4JL5A 5CJ2A 3LRPA 1DELA 3WYGA 1U9IC 3IUYA 4P33A 3A6PC 5JZVA 1SVMA 5DO9A 2GA8A 5JECA 2CK3A 3KUDA 4ZO4A 1NVWQ 3LV8A 1YKSA 3QPUA 4XOIA 4B47A 1IHUA 5GJVC 4F91B 3UWOA 4TT3A 4DUGD 5EZ6B 5EXTA 5TVKA 3P27A 5AUOB 2ZSFA 5JLJA 1CULC 2RKOA 2J5XA 2ATXA 3Q5EA 3EX7C 2NO0A 4HDOB 1ZP6A 4NYMR 5ELXA 2QBYB 3VX3A 1OFHA 2ODWA 5AUQA 2QEQA 5IRCD 4U00A 3A58B 1N25A 3LW7A 1E2DA 4HB0A 3CR8A 5KYKA 2LWIA 3T35A 3B1VA 1R8SA 4A0FA 2ZE6A 4HZUB 5KTYA 1WMSA 4DLVA 4NCIA 1D2EA 2X77A 1P9NA 4RKFA 3MWYW 4DB2A 3QF4B 2YZ2A 4G5QA 1BOFA 1W5TA 2C77A 4B3FX 5KSZA 1G7TA 2PX3A 1EX6A 2YV5A 3FFAA 1R5BA 3IKJA 4QNMA 3SZRA 3U2QA 1W2HA 1SVSA 1XTQA 2XSZD 3W6NA 5DGXA 2HXSA 2HXYA 4A9AA 3NDPA 4LPSA 1CR0A 4DCUA 5DN6D 4CEIA 1MKYA 2O8FA 4LBVA 3EXAA 2WSMA 4NCHA 5CIWA 2FGJA 3BWDD 4GRAA 3WYAA 3H4MA 4K81B 4FMDF 3H2YA 3U61B 4M0LA 2RGXA 2VH5R 1SXJC 2WWYA 1EK0A 4HDQB 1D8TA 2ZS7A 2JLSA 4PPQA 1XB2A 3NBXX 1Z6AA 5A4JA 1GL9B 4TTRA 4F4IA 2CNWD 4CEHA 5EXXA 4AYWA 1Z2AA 4OQNA 1G5RA 1LY1A 1AQYA 4ZKEA 3FHOA 3WMEA 2IYQA 1KK0A 1W0KD 1DAFA 4TMXA 5EE9A 3TUZC 1T5LA 4IKEA 3N5CA 3PCRB 4FCTA 1WB9A 3L0IB 2BBWA 2AXNA 2VO1A 4HLQB 4Q1BA 5E95A 2B6HA 2HUPA 3VR6A 4A2QA 1YZKA 2IS1A 1GG2A 2WJYA 3FHCB 5BN3A 4NKRA 2QE7A 1FP7A 4DDTA 2O8DB 1ZUNB 3MUFA 1OFUX 2XTMA 1P5ZB 1WF3A 4RZ3A 2R6GA 2UZ3A 4DEXA 2CMKA 3LH5A 1U9IA 4AKIA 3I72A 5FUVA 2J0QA 3RRYA 1NSTA 4GMXA 3W3ZB 4EPXA 3MGCA 3NIBA 4B3GA 2YYZA 2A5JA 3HYRA 5CITA 1CJMA 1C4OA 3KXIA 3R8CA 3SBDA 1DG3A 2HLDA 4ZCMA 2XX3A 2HEIA 4U02A 1FQKA 1TADA 2IS4A 1NY6A 2HCBA 4B6EA 3SEAA 3PIRA 1U90A 4TMTA 3PFIA 2CK3D 3VHLB 3SHWA 3LLMA 1XBTA 2ZI3A 4C0SA 3IIKA 4D2IA 5HZKA 4ILEA 4TT3D 1N0WA 2FSGA 2EYUA 3B82A 4WZ6A 1FMLA 4US1R 1L4YA 4RD6A 4BLPA 4BFVA 4YMTA 4L9SA 1TU4A 2BCJQ 2FF7A 5E3HA 1DBSA 1RIFA 1N3BA 1ZW6A 2BCGY 1OFIA 2CLDX 1NJFA 2QNRA 4PSAA 5SZHB 5BWMA 4HAVA 4ITRC 3QEJA 4ACAA 4WAUA 3MD0A 2B21A 3B9PA 4LBYA 4TMWA 4B75A 3E5HA 4MKFA 3B9QA 1YZTA 5SZJA 4WOPA 1HV8A 3T1QA 2FN4A 3JVVA 4NHOA 3K8YA 4II7A 1SXJA 4MUBA 3EW9A 4GNKA 3WRXC 4IXMA 1UJ2A 2NZJA 2F55A 1A2BA 2EFDB 4HSEA 5B57C 3MWKA 2KBFA 3NEJA 3PEWA 3K0SA 1G4UR 5FOUA 5HZHA 1ZUHA 4DLUA 1W4RA 1E9FA 4U5XA 1GAJA 4YLGA 2IUTA 1KZGB 2OBMA 1ZNWA 4RVCA 4KJZA 1XEXB 3SE0A 2B7BA 4URWR 4CT4B 2IEYA 4A6PA 3RABA 3X1YA 2JEOA 1NKTA 4I99A 2GTPA 3LQQA 4TMKA 3T06B 3PJRA 5EP3A 4RD3A 2NIPA 1T5IA 2O8EA 3RS7A 2YOHA 3AP1A 1YRBA 1QG4A 2ZS9A 3L0SA 3A4LA 1Z5ZA 1KNQA 3K0FA 3LBNA 2QE7D 1ZM4A 1JB1A 4B2IA 3OHMA 4M9SA 3EIEA 1O3YA 1NN0A 1JEEA 2H18A 5KPJA 2G0TA 1S9HA 3T1TA 3FHTA 2KB0A 1GIAA 2NO9A 3C41J 4JLNA 1W2GA 2EVWX 5B64A 3X1WA 2F1IA 3ND9A 3NC1C 1DO2A 1OH7A 2ANBA 4F7WA 2HLDD 1KKLA 4GOKA 4DLXA 3W8NA 1CKEA 3VX4A 1M6NA 1X86B 1GDDA 3AGQA 4QHYA 4PAQA 2ONJA 2P67A 5LBIA 1XD9A 5HKKD 4ZDIA 1XMSA 3OFNA 4LCBA 3AUYA 2XITA 3AF2A 2IBMA 4AKEA 1MO6A 3K0FB 4DIDA 4G5GA 2ZJYA 1XRJA 1HEIA 2PT7A 2ZROA 5FOVA 3K9LA 5P21A 4DLTA 1Z28A 2E1RA 4MKGA 1PVOA 2F43B 3VR4A 1DAKA 2AR7A 2Q21A 4ON9A 4UNRA 3I5XA 4QXAA 3U4QB 1EG7A 2A3RA 1KAGA 2PH1A 1B0UA 2F3TA 4IOKA 3PXGA 4DZZA 4R71A 1E4VA 4BFTA 4OK3A 4MRRA 4ZKDA 1TL7C 3CPHA 3KB2A 2F3RA 1NLYA 2C2HA 2J87A 1GL7A 3A1UA 5FTKA 3REGA 3M0EA 2NO6A 4YMVA 2OE2A 2CL7X 3GLIB 2I3BA 1CJTC 4PC3A 1SXJD 1E94E 3KJIA 4LBWA 1YU9A 2NGRA 2FDCA 1YR8A 2YOFA 4URUR 4LX0A 4QM7A 1VECA 2IXGA 4XJXA 2C5LA 5FL7A 1P72A 1RJ9B 4UXIA 4EAQA 2C98A 2JCSA 5FR1A 2J0UA 3T5DA 3LDAA 5H8WA 3N2EA 4TL7A 1QVAA 3SJCA 5CJPA 3U3MA 2WICA 3T12A 2FPMA 2GETA 3VFDA 3K9GA 3FKQA 3KQLA 2QM8A 4P0TA 1T8UA 3ZQ6A 3GLFB 2IX3A 2RGDA 1SVKA 2XJ4A 3FMFA 1E3MA 1OB2A 5K8UA 1S3GA 4K8OA 4NMMA 2Q0HA 4B6FA 1G7SA 2R9VA 1EFRA 2VHQA 2H5EA 1KI7A 2PJZA 2Q9BA 4XVQA 4EQ6A 4Q00A 4PAMA 5DI9A 2XZOA 2O8CA 4KFTA 2VSFA 3IO5A 3KKOA 2EQBA 2WWIA 3ZH9B 1J70A 1KSGA 1GP2A 2JLXA 1E0KA 1CJKC 1KGDA 2DY1A 2XB2A 5F98A 3A1SA 3HU2A 3QG1A 4IOMA 1VCNA 1NBME 2HT1A 1KY3A 3CNOA 4FCVA 3W5JA 1P4SA 4LI0A 4OHWA 1P2TA 4B3CA 3AF4A 3ONWA 2VPPA 1W4AA 8OHMA 2Z43A 4W5JA 1JEDA 4LV8B 1DARA 3IHWA 4DLZA 4X8MA 4LHYA 4E09A 4MQBA 3K09C 1US8B 2PEZA 3F3YA 2PMKA 4PZYA 3OFND 3AVYA 1CRQA 2W83A 2L0XA 5LPNA 4O2RA 2LCFA 4NCNA 1KO5A 4IFBA 3ZZ0A 4UKDA 3D7MA 4LJAA 3JZMA 2BM1A 4TMVA 1AS0A 2ZE7A 1UKYA 1UM8A 2OCYC 3TW4A 2PLRA 5EE5B 2WKRA 4M1TA 1NKSA 2DFKB 4WIAA 3ZVLA 4CEJA 3MWJA 4WVFA 3IBGA 4FXPA 4H1UA 2IF2A 2QN6A 5JJKA 1HA3A 4V0LA 1U2RA 3GJ8A 1LS6A 1RKBA 3CONA 4QJ4A 1E98A 5H70A 4L16A 4B34A 3EA0A 1A7JA 1E9RA 2ZJAA 1GKUB 3BH7A 3GLGE 5F9FA 1Z6XA 2ZAOA 1EFTA 4IOLA 4KXFB 3ZQJA 1KSJA 4Z51A 2BWJA 4POAA 1KI8A 1G41A 4US0R 4JMPA 5FL7D 3CRVA 1UADA 4JVLA 1GVNB 3W90A 3ZVNA 1Q12A 3H0KA 4MYTA 3I5YA 3KX2A 5BW8A 2VSOA 1LF0A 1IAQA 3EZ7A 2WPDD 4YMUA 3EARA 3QSYA 5EE0A 4KV9A 3SC3A 4DRZA 5FPTA 2ZJ2A 1TF2A 2CXXA 5KPDA 2D62A 3DM9B 1XXHB 2ORVA 4A2PA 1E32A 1AS2A 3HPQA 4C30A 4F93B 2BOVA 2AX4A 2GAOA 1S2MA 1N6LA 2Z5FA 4M53A 4TQAA 3HJNA 1WDTA 3L2OB 4NBSA 4RCZA 1OIXA 1PUIA 4FMCF 1A1VA 2PBRA 3BAFA 2C9YA 1YZQA 4PQRA 3CWQA 5A0FA 1X6VA 1ANKA 3IQXA 4A8JB 4NH0A 2QU8A 4BZPA 1Q57A 4TN1A 1Z3IX 3LA6A 5G41A 2WIAA 4QNRA 1SVOA 4MYCA 1ZJ6A 4G1UC 1VMAA 1IY0A 1QDEA 4ZI2A 5AJWA 3UPUA 3EIHA 3SNHA 4RFVA 1KMHA 4LWZA 4Q4JA 4PTLA 3K09A 1XD2A 1YZGA 2W58A 1E2IA 1OW3B 2QMEA 4V0OA 2J9RA 2QRZA 5CM9C 1MRNA 1E9BA 2VTKA 3BJIC 4G01B 3TGPA 4BRUA 1KTVA 3WMFA 3MWLA 1R4AA 4ZI3A 5FFMA 3ZVRA 3O8RA 4LJ6A 3GLHB 2FJUA 4QGGA 3MRSA 3TH5A 2XB4A 4DBLC 1BS1A 1P61B 3HPRA 1KO1A 3QY0A 2OO7A 2C9OA 1KKMA 2A9KA 4KFUA 1UDWA 3QBVA 4TL8A 4TMZA 5L3QB 1OXXK 2VYFA 2CJWB 3QKSB 4DEYA 1W36B 2WIBA 4TLDA 4EFMA 2EWVA 2WTUA 1NVXQ 2ZAMA 2BJVA 4P4SB 2FA9A 2QSYA 5BYJA 4Q4AB 2BC9A 2H8KA 1C1YA 4NCJA 3CKLA 1XD2B 2D2FA 1FL9A 3ZD7A 1N5IA 2OAQ1 5EZ5A 4CIDA 1IM2A 4GSYA 1JI0A 5JBQA 2FSFA 4XTCS 4XSHA 2QI9C 2ZSDA 2N46A 2GEDA 2CLSA 4JKYA 1ZIPA 2OAP1 4W9MC 5EUQB 1JR3E 4JZKA 4A2WA 1R10A 4Q1DA 2QMOA 1VCMA 4OK5A 1VKJA 3AVWA 3TW8B 5J4LA 1F60A 1E9AA 1CU1A 3BRWD 2HYIC 3P26A 2C03A 1NG1A 2R65A 2V54A 5FI0B 3X1XA 1F2TA 1GRQA 3OIVA 1GNRA 1AZSC 2F6RA 5TXGA 1K5DA 3VU9B 3U5ZB 1II9A 2V6IA 4QG7A 4RD2A 1UBFA 2J59A 4DVGA 3QPVA 3LAWA 3IEUA 1KI6A 4FINA 1FX0B 4TQ9A 5FBWB 1AGRA 2CEAA 3P20A 5DSZA 4FN5A 3B6EA 1EFCA 5BQ5A 2KBEA 3ZGXA 3BE4A 1NY5A 1J99A 1F2UA 1QF9A 4RY2A 2ERYA 3VR3A 1DAMA 5DI3A 1G18A 2J0VA 4RFSA 2KJQA 4FI3C 3NBFA 4UJ5A 4IXNA 1GSIA 3JZAA 2GRJA 3H84A 2ZE5A 1U0HC 4XH9B 2EFGA 4B3DA 3SQWA 3RYTC 3MLEA 2QZ4A 2DPXA 2P6UA 1J90A 2VHUA 2WSSD 1S9DA 4PC1A 2ZJBA 3C15C 4JLMA 1AKYA 3LX5A 3A1VA 2GCPA 4F38A 1I4LD 5JMTA 2ZM5A 1Q20A 3AM1A 2W2TA 1KI6B 1OXTA 5K8LA 2QA5A 1P2UA 2IUUA 1AQUA 4EJSB 4YC7A 3PVSA 5FOTA 4MITA 4AY2A 3AUXA 4PAOA 3UWKA 2FFQA 3RS0A 2FMXA 1EESA 1F2UB 1JQLB 3Q7QA 1KZ7B 3EPJA 2X2FA 4YONB 2I1VB 1OXUA 1GTVA 3VKGA 2A7QA 4QRHA 3O8CA 4N3NA 1DADA 4JT4A 4DDUA 3THYA 2PX0A 2QORA 1P3JA 3UG6A 1XCGB 1D5CA 2W6JA 3ZS9A 5JRJA 4PO1A 1UKEA 3UANA 3KQKA 2P6NA 3U7EB 1FTNA 3AP2A 5JJIA 3GFOA 1R0YA 4ASUA 1VCOA 4I1VA 3TQCA 5LB2A 2PCLA 5EXPA 2IYYA 1NMYA 4Q7KA 3RC3A 4GDFA 1UFQA 2O0HA 1D6JA 2J7PA 3L8YA 1KK3A 1KIMA 1YR7A 2VEDA 4TSFA 3NH6A 4Q66C 2MSCB 5CIQA 1W48A 2ZRPA 1F48A 5KSPA 2UVQA 1E2EA 4E07A 4G0NA 3AGPA 4BLQA 4LUCA 5JI3E 3CWZA 2OFWA 2J1LA 1ZNYA 5CYOA 3X1ZA 2IL1A 5AR1A 5EE3A 3RS3A 3K70C 1OF1A 1VIAA 5AUPB 2IYZA 1SZPA 4HATA 1KK2A 1WP9A 5FOXA 1OT3A 5L3SB 1N6HA 2DWOA 4QOSA 4IDNA 1OE0A 1OIVA 421PA 3GPLA 2P5SA 4JL6A 4RZ2A 3U3OA 1N6IA 1Z0AA 1NSFA 2WKPA 2R44A 2ZRNA 4PO9A 2IWRA 4QL3A 1HE1C 1E2HA 1ZIOA 1A82A 3THWA 3KQHA 3K9HA 1OIWA 4PQFA 3KB1A 1N0UA 4EKDA 5B58C 4FIDA 2MSDB 2G77B 1DO0A 3LWNA 2QAGB 1LTQA 3BS4A 1XPOA 3E1SA 4A0HA 1KAOA 1LF5A 2IHYA 2OESA 4OHYA 1ETUA 2PZGA 3J81k 4IEEA 2EFHB 3CRRA 1EX7A 1QHIA 3NKVA 2O52A 4MGKR 4W5HA 1F6BA 4ZCIA 1KY2A 2H16A 2NPIA 1BYUA 4P4TA 1CTQA 4HEJA 4DWJA 1BH2A 1TAGA 1R0XA 1PUJA 3CF2A 4ZDKA 4M21A 4W5WA 4LJYA 3GLGA 3QVVA 1X8KA 4B73A 2KE5A 1TUIA 4Q48A 4B2PA 4HAXA 1Z6YA 4OL0A 2W0SA 2A5FA 4B3BA 2GZAA 4JJKA 1J8YF 3QENA 3ICQB 3DM5A 1Y63A 2WBLC 3V4FA 3TIFA 2W6JD 5C4MA 3RDPA 2JJ1A 3TQFA 4LDJA 5KNDA 1YQTA 3BGWA 5FUXA 1ZCAA 1ZCBA 5F2EA 1R6BX 4ASUD 3BORA 4Q1CA 4JBYA 1DAEA 4Q9IA 1ZD1A 2WWFA 3A36A 4AIIA 1Z08A 2J7PD 3WHKA 3OAAA 1RRCA 1U8ZA 3FTQA 2WJIA 4M22A 1S4QA 4R9UC 3C4JA 2OLJA 3BB3A 1QRAA 4TSFD 1HURA 3GQBA 1HE8B 4KSCA 5TY0A 2YINC 4OI4A 2YNMA 1FW6A 3I3SR 1SHZA 4JLBA 2GJKA 4BFWA 4E5UA 4DXAA 4KCGA 3TUJC 1SVWA 1ZVQA 2QT1A 2W6ID 3D6TB 5CM8B 4TL6A 1NNEA 4QBHA 1G7CA 1HT2E 1VG8A 3W3AA 2VP6A 3B85A 4AKGA 3LO5A 3U3JA 4C2UA 2EYQA 1L4UA 3TE6A 4CEIB 2O8FB 2R8RA 1G3IA 1W47A 5DISB 5FPKA 1G8PA 1HYQA 3CF0A 1XD8A 4FWIB 2QPAA 2VF7A 4GP7A 4GBMA 5FBQB 2RGGA 4BUJA 2ZTSA 3TSOA 3Q9LA 2OCAA 5M04A 4Q4HA 4ZCLA 1EGAA 1UDXA 3ICEA 1M1YE 2CHGA 1VHLA 2NG1A 4CEHB 4MRPA 5FUWA 1HTWA 4LV6A 2ECKA 4C0HA 4Q9HA 1XTKA 4P3YA 1P75A 1ZUIA 2AHOA 2ZJ8A 4NDZA 2GF9A 3BK7A 3ECCA 3FMPB 5AK0A 4RZXA 3BC1A 1CR4A 1MOZA 2QRNA 1AJEA 1T3SA 2NPFA 1UKZA 1G3RA 4LYHA 3UIEA 1MH1A 1ODFA 1K5GA 1C9KA 3P32A 5EXSA 5UKDA 2W2VA 3IQWA 4PSKA 4XD7A 2IEZA 4G3XA 1P9RA 4Z54A 3AV0B 5TARA 2F9MA 1ZNZA 1JR3A 4PR0A 5A5GA 4MRNA 1NMXA 3CX8A 2NO7A 5CDFE 1E2GA 2GZHA 1MRSA 4URZR 2ZR9A 1QHYA 3X2SA 4QHSA 3QKRA 4C7OA 3LBIA 3ZDQA 4MKHA 1G7RA 3W6PA 2GF0A 1NVVQ 1W7AA 4Q03A 3AVPA 4I4LA 1I4TD 2VLIA 3IIJA 5JS7A 1OLOA 2JJ1D 4V0KA 3R9XA 3FMOB 4TYYA 1D2NA 4D0GA 1XFAA 1TF5A 4DSUA 3Q8XB 1KJYA 1VPLA 1QHNA 4C0BA 2IW3A 2CCKA 4CVNA 4M1SA 3GEIA 3OAAD 3PEUA 4PC2A 5JEEA 3IPXA 3X1DA 1GL6A 3LW8A 4TYWA 2ZS8A 5DH9A 5KOYA 3QEOA 2ZRFA 2W00A 1KO8A 1XZQA 4DLSA 4DDWA 1CF4A 3SJBA 2FH5B 3PR1A 3I32A 5J4YA 4LBZA 4HUTA 1E2PA 3K70D 3N2IA 4JBWA 2V1UA 2GDJA 5KUTA 2ZUBA 3QKUA 1COWA 3KJHA 1E9CA 3AKYA 2DWQA 3AF3A 4DB4A 1DG1G 3TK1A 1CP2A 1GZSA 3HDTA 1P73A 2J7KA 3CR7A 2O8BA 4IVPA 2G83A 1H8HA 3AKDA 4M1KA 3VKWA 4CGZA 4NE2A 1SXJB 2LKDA 1YRAA 2QP4A 2QSZA 1IQPA 1M7BA 2PZFA 1JPNA 3FGNA 4IFEA 5JCZA 4CF7A 2ZJOA 1NP6A 4PANA 1VCIA 1S0UA 4XVRA 2WHXA 4TYPA 4FMBB 1VIYA 2IYWA 2MMCA 1OXSC 2OLKA 4OQLA 4A1FA 5JJLA 3VKHA 2BKUA 4Y0AA 4NTZA 4OJQA 3BBPA 1O87A 1L8QA 2D7CA 1VYVA 2ASEA 1YZNA 2ANCA 3AKEA 2QG6A 5C46F 1ZM3A 4KSBA 2FZLA 3AVXA 1XF9A 4JIMA 2AKAB 3IBYA 1W44A 2IYUA 2Q9CA 2QM7A 2QT0A 2BVNA 4QBIA 3VNVA 1RRFA 5IK2A 1UBEA 1XEFA 3IIMA 4MGYR 5B30A 3TLXA 5TB5A 2O8EB 2MMGA 3K0AA 4UQOA 1TU3A 3RAPR 4LJ8A 1AIPA 3WNDA 3IO3A 5HR5A 5JEDA 2PCJA 2DCUA 1P7CA 3CH5A 2ZR7A 3GFTA 2F1HA 4PFSA 4UNPA 4XD7D 2QGNA 4A36A 2RGCA 3B78A 4J0QA 4MYHA 4H9GA 5AWFC 1E2FA 4NL4H 3CPEA 2FOLA 1A5TA 2XNDA 3VMFA 1IONA 2O0KA 4D25A 5FPYA 2AKYA 4HLDA 3FWYA 1NL3A 2JLRA 2P0EA 1BKDR 2VHCA 3RS2A 1XX6A 1LV7A 1N6NA 2ZRAA 4MYUA 1VDZA 2WWWA 3R9WA 2BM0A 4PZLA 1TPZA 2WAXA 3T1VA 5CYPA 3OIUA 4DKXA 1FUUA 2YWHA 5IHPA 3LY5A 2P3SA 1OPXA 3CM0A 1B23P 1U0JA 3BIFA 4LYAA 1CJVC 4D4MA 2YHSA 3CB4A 1MABA 5KSYA 3KL4A 2Q6TA 2OFXA 1P60A 3G5UA 2XXAA 1NJGA 3GD7A 3W34A 3AVOA 2R6DA 3QNUA 2RB4A 2EWWA 1I2DA 1NRJB 2ZRDA 4HUQA 4LJ5A 1FTSA 1J2JA 1YR6A 4EIWA 2OSBA 5DE3A 1AK2A 2JLYA 1COWD 2RMKA 4Y0VA 3CRMA 2BMJA 1JAIA 2GXQA 2HCJB 2W2XA 5TMPA 3OZXA 1DAGA 1HQCA 4HB3A 4M9ZA 1NN1A 2CCGA 1FUKA 4LJ9A 4PHHA 1QHHA 1WXQA 1UPTA 2DR3A 1FNMA 4LJ7A 3TR0A 1IXRC 2N1BA 3NC0C 4NYIQ 4Q1FA 1IY2A 4GOXA 1K6MA 2FEOA 3LXRA 5GADl 4IDHA 1LVGA 1FP6A 3S1AA 3ZYCA 1S8FA 4V03A 1E2JA 2IYSA 2J0UB 3LBHA 721PA 1VG0B 4W7SA 1XPRA 4MA4A 1IXSB 5FUYA 3KQUA 3ZD6A 2XEXA 3RS5A 3OESA 3QQ5A 1KDOA 2Z6VA 3DHWC 3NG1A 3T61A 4ARZA 4DCTA 1NI3A 1SKYE 2RGAA 2G1JA 5L3VA 3U60B 3PV0A 1Z6TA 2JLVA 3P4XA 1H8EA 2C8VA 4OHZA 2G9NA 3DMDA 3LFUA 5JRZA 3THXA 2WKQA 4MDFA 1T3LA 2HT6A 1AM4D 4EQ6B 1RFLA 3RWMB 3AP3A 2ERXA 3IPYA 2O8CB 1XPUA 1RPZA 1M34E 2FNAA 5E7JA 2YWEA 3U3KA 3VAAA 4AG5A 1N5KA 5IF9A 1OXVA 2JDIA 3UKDA 3BB4A 4EFLA 1KSFX 2WOJA 3FOZA 1IN5A 1CJUC 4X8HA 5L3RA 2CVHA 1ZD8A 4IDQA 5BYKA 2OBNA 2A5DA 2ZRKA 4Z1MA 3SOPA 2X2EA 2AWNA 1AN0A 4P31A 3WHLA 5GJWC 5F3WB 3U6BA 3CRW1 1RRPA 1S1CA 2ZXUA 3I4LA 1TX4B 5KHOC 3NHAA 5GVSA 4JLAA 5HCNA 4O3MA 1G64A 4LK2A 1XMIA 1T91A 4BASA 1JJ7A 1ZNXA 2QL6A 3M4YA 5JCPA 1UBGA 2QP3A 2AL7A 3VNUA 4FWTA 3RSOA 3TUIC 4TL9A 1OV4A 4URXR 3KTAA 4PHGA 4V02A 5JWHA 1DAIA 4KLNA 4NONA 3I61A 4L5BA 1TMKA 2RGBA 5J4HA 5ANRB 2CVFA 1G9XA 2DYKA 2G88A 4URYR 3SHFA 2XTNA 3HU3A
chains in the Genus database with same CATH superfamily
4ZPJA 1MQ8B 4JBGA 4MQEB 3AJRA 4BCCA 3V2UA 2MSNA 4ZXPA 2ZETA 2P3QA 2P2DA 4NP6A 1PJRA 3K2BA 5KDLA 2X19A 3IAFA 2O7RA 3QSGA 4E5MA 1ORIA 2FQXA 1BHQ1 3DBLA 1M2HA 4PNEA 1JG1A 2WUGA 3D6JA 2BR4A 3ROPA 5BNZA 4JN6B 4OGLA 3UT5B 2HA0A 1NIPA 1P31A 2A78A 2X8WA 3I2GA 4IO0A 4CT5A 4KQ1A 2GKOA 1JNXX 3FCUB 3W9YA 4NNOA 2IYTA 1YL5A 3C1UA 1DT5A 4ITUA 1Q1QA 5DHFA 4TUYF 2I3GA 5ALHA 3T7IA 4ND7A 1A9XB 3P0RA 4TWAA 4XZ3A 1R6XA 4ZP1A 5DHAA 3WBJA 3QVGB 5K9ZA 1P1IA 2Y6UA 3L0YA 2NZ2A 4JT9A 3QPWA 1E1QA 3IP1A 4FBLA 4KZKA 2NXNA 1GV0A 4QQ8A 2OK8A 1DRUA 1UXKA 3OSUA 4E21A 1AZTA 3VH2A 3QXHA 5LQAA 1GARA 1WBBA 4A73A 5LNK6 3MTEA 5M2QA 2NTVA 4AC9A 1FSSA 2XT0A 3GGSA 4M9QA 4RJTA 2ZBPA 1LJLA 5JDIC 2YKGA 3VR6H 4DM7A 2JJQA 4GSKA 4Y9DA 4ALIA 1FCJA 4IVQA 3TAHA 1FS4A 3CCCA 4R8SA 3TQOA 1TC2A 3BMQB 1QFJA 1B74A 5DNVA 1W30A 3SLRA 2FPWA 2ZWOA 4MRAA 3RAGA 5E4FA 2XXBA 1IZ7A 1H8ED 2B2NA 3NH9A 2DOKA 3EPPA 4PYLA 4ZU3A 4D5GA 2NUPA 1B14A 1WUKS 4ALNA 1LZKA 1N6OA 1R5JA 4KQHA 4RKWA 2ODQA 3ZZ1A 4AUMA 4C7BA 4OF4A 1DFHA 1HI9A 2YFKA 1UM9A 2X76A 2FDRA 2VDWA 3GFBA 1OFVA 3HUEA 3GG2A 4BC1A 2AB0A 3B1ZA 1OB5A 3PSAA 4IGAA 3DR3A 2ODBA 1KYYA 3SQXA 2ZRIA 2BMFA 5JG7A 4A8PA 4QLOA 1L5NA 1EH5A 1U8CB 2NXCA 3DMHA 2NXEA 2YYYA 1IMJA 2VPZA 5GMOA 3H11B 3IE2A 4WXPA 3SZLA 3TNDA 1DIOB 3CG4A 5LQSA 2CGEA 2F8SA 2JI6A 4Q4JB 4A6DA 2I1QA 5FF9A 1AKTA 1XNGA 4IIUA 4J7XA 4K46A 2ZZKA 1HZJA 4XYEA 4IZHA 2QYSA 4BP3A 1VHDA 1FFHA 1Z68A 1K4MA 4LDZA 1Z4MA 1WHTA 2X9LA 2WNHA 4N7RA 4LRXA 5FCDA 1H6AA 4DIBA 5GIPE 1GYPA 1UEJA 1W0JA 2OTCA 2QY6A 3H1AA 5DB4A 3VPDA 5C5IA 3P9RA 2E9SA 821PA 4BEJA 3CEHA 4IXWA 4C6TB 1JA0A 1BHJA 1U1CA 1VYHA 3MINB 4KODA 3P2MA 5I9SA 3S29A 5D84A 1E9SA 1U7ZA 3ADDA 2HNAA 1N0VC 3KJFA 3HVHA 4MYRA 4UU7A 4U39A 1E8NA 1R9GA 2P65A 2RHGB 3NR2A 3OE4A 1Y4AE 3NPAA 4J03A 1Q6ZA 4IZ6A 1RCUA 2OBYA 4RELA 4ZTBA 3RHFA 3T1OA 5A04A 1MN6A 3ECSA 2MSKA 3DEJA 2Q6VA 5FKJA 1KYTA 1W49A 3A1WA 3TECE 2GFQA 2P1ZA 3OY2A 5KKNB 1NYTA 1G16A 1P0QA 4DQUA 4FZJA 5J2TA 4QYXA 1Q0SA 4RPCA 2I1WA 3ST7A 3QX7A 3VNRA 2HGZA 1QHXA 1I3KA 1JAZA 4X8LA 2ZJZA 4I6JA 4DG5A 5I51A 3WYDA 3BHIA 2QTZA 2YQ4A 4J0JA 2DC1A 4F5DA 3D3EA 1DJLA 5FNZA 3U80A 1OFUA 2MINB 3L7KA 1ABFA 4H6PA 3QKTA 3KSZO 3L8CA 2H7VA 4IMIB 4V0ME 4JROA 2IHVA 4TKLA 3R5JA 4K40A 2QZJA 3H75A 3EIWA 3G82C 4ISBA 4ZGWA 4ZYVA 3CW8X 4G5OA 4W5RA 1IUPA 4HHEA 2AVNA 3M4XA 1M73E 4FKBA 4LHXA 1E1QD 4B71A 2XCQA 2QTFA 3QELA 2Q9AA 2B61A 3HKBB 5FTNA 3LS2A 2E87A 3QEAZ 2XKBA 3HXOA 5K20A 1T2CA 3PUJA 4U0KA 4BP9A 4BO7A 1ZH0A 2WHQA 3VZQA 5FHRA 4F1WA 3QX9A 3ASZA 3FUVA 5ED4A 4ZIRA 5JSZA 4PG4A 1QG2A 3I1YA 1X7GA 1DZIA 5DGTA 4B1FA 4B7AA 1LFDB 4MVWA 3WLAA 3QE9Y 1P2VA 1V1RA 1E9DA 3B60A 5TMBA 1C8LA 2ONCA 3AV3A 1P39A 5AW6A 1EGMB 2V9PA 4FXOA 2QQ5A 4NSNA 1T1SA 2JHGA 4ML3A 5BSMA 3IAM1 1OYWA 2VZ8A 1NLUA 1CY8A 4BVHA 4B2LA 4PCVA 4Y2TA 3GLQA 3ZS8A 4D43A 2VA8A 3O1LA 2VF2A 2PH3A 4BNKA 1DJMA 4DLPA 4EY3A 1P2SA 1JR2A 1QFZA 1I5RA 3W2HA 4QG3A 3PQCA 5GM1A 4BQSA 3RRFA 1OREA 2UYHA 2GPYA 5AKKA 1E69A 1SXPA 1GKKA 1NBOA 5B1HA 3BREA 1L5HB 5E1MA 4BVLA 4YUXA 3AR8A 1KI9A 1ZK1A 4BX3A 3DFZA 3AXTA 5G1PA 4DG8A 1VL0A 1Q11A 3RSGA 2JGJA 4ZYZA 3KFLA 1ONBA 1WULS 1V2HE 3FB1A 3QU4A 2AN5A 5IN4A 1WOYA 1Y6QA 3BPSA 5HUQA 3L8FA 4DT1A 3MCUA 4UXJA 3UXYA 4XFDA 3OZFA 2HQBA 4LJ4A 4KBFA 2OZVA 4HVCA 1QKKA 1KJWA 1DKRA 1W0JD 1CHDA 2DHDA 2VL7A 3EVAA 3G0BA 4N40A 3VR4H 3D7SA 3NBZC 5JAPA 2AN1A 3FB4A 5KVSA 3DOHA 5MF6A 1U7WA 1APBA 1NW5A 2BSAA 1O94D 2Z4RA 3DLAA 5HM8A 3GGGA 1XQ1A 3TZLA 4GZ3A 2GKSA 3HDVA 1NBMA 2EKDA 5KX5B 5DHTA 2NTYC 4ZVPA 3ZGZA 1S5PA 5FBLB 4D96A 3Q88A 3WGNA 2VK4A 1GWNA 1CSEE 5CPFA 2Q1UA 3WR5A 2JFOA 1JJFA 5K8TA 4PLZA 4B17A 8ABPA 3AMVA 3CW2A 1SKAA 5I9TA 1VIDA 2SBTA 3ONVA 3KIPA 3OMLA 3VSBA 4R2XA 5K0FA 3MXOA 5HW0A 3GROA 2VT7A 2I34A 1BWRA 3INGA 4AQ7A 2X0EA 2A9OA 2D7DA 1H1TA 3DFFA 5DTEA 1MAUA 1RP1A 3MTIA 4FQ7A 4IHKA 4M6WA 4MJLA 1IHXA 2AC4A 5J58A 1SKQA 1IZZA 2BFCB 4V0NA 4OM8A 3EZ6A 4G26A 4E22A 3UHAA 2P9QA 5A62A 3DTVB 2XZPA 4I5GA 1NF3A 2E21A 1E4YA 1VHJA 2XR1A 2ZBRA 4N12A 1Q14A 4JI3B 3QUQA 2X4LA 4PG5A 4IQ4A 1XEWX 1SBTA 4HLUA 3GYGA 3NIGB 3GLFE 3KLNA 4HN2A 5BVHB 3JD0A 2A33A 2HA3A 3DMNA 4CR6A 4MCAA 1FNNA 1Z29A 1T9HA 4JLJA 3ANMA 2BV3A 2VJDA 2ZT7A 3BHNA 1J49A 1DCKA 1QHEA 2VPYA 4LY6A 3ETEA 1RAAA 3TNFA 2V7QA 1JV2B 4AZ3A 1Z6GA 5C4IA 4UMEA 4HFRA 3S2EA 3QHAA 3UFXA 3DVLA 4I66A 1ABEA 1BA3A 1H1DA 1B0PA 4J0FA 2IX9A 1KBZA 2VJMA 3AERA 2ZBUA 4OREX 4LHVA 4UBKA 3B1XA 5FV7A 1E3QA 3H5AA 4HZUA 3ZZTA 5IXSA 4PAWA 5EN4A 2I78A 3Q2IA 5C3UA 2ZYWX 4NG4A 3QF4A 3R2JA 4U3JA 3C6MA 3THWB 1VFPA 3H0CA 4QBFA 3G0OA 3DW3X 2YYAA 1YBHA 3ZVMA 2X7XA 1I2AA 1P7YA 5DSXA 3OD5A 2BELA 4M1WA 2GA9A 2E6UX 2BKEA 4MWDA 1G6OA 1XJ0A 1WXFA 3I4FA 4A15A 2EQAA 3BJRA 4QU8A 4DV1B 2H17A 2BJHA 3OWXA 4S1OA 1JVNA 2AF4C 3EXG1 4QYIA 4X97A 1N2JA 3O8NA 1YT5A 3ODPA 4WLOA 4NZZA 5DV9A 2DG2A 2VDPB 1XL0A 4ZOLF 5IJ0B 1YAJA 4IJMA 5DBOA 1NE7A 4YXWA 4HJXA 5TDHA 4KXWA 4PPGA 1NIJA 1QJCA 2UV8A 1JLLB 1E5VA 4HQ0A 5AT1A 2VJYA 3KUCA 2PT6A 3HVUA 5J40A 3OQVA 3VA7A 3KR9A 2P41A 5JQWA 3AR2A 1SOMA 1JILA 1QB8A 2HJ9A 1EM8A 3L7CA 4YRMA 5JISA 3GIDA 2ENWA 3GU3A 2H6EA 1HFWA 4IEIA 1E4EB 4G5RA 4W1SA 1EHYA 5K6AC 5IF3A 3P1JA 2F90A 1NWCA 4IDCA 3TINA 4BFUA 5K8VA 4D79A 5U4XA 4MIKA 3ISJA 1GQYA 2EG5A 2AUTA 3AL3A 2GBCA 1JNYA 3UCXA 4BBPA 2QRVB 2HADA 2VUUA 2DKFA 4X6YA 3RSLA 4DN6A 1J25A 3TSYA 2Q2VA 4KTVE 2WAYA 1J8QA 1IBCA 3TBFA 1XZLA 4X8OA 5LDGA 3D0KA 3ZTTA 4MKZA 4Q7MB 1G3QA 4R7ZA 3KFXA 4CL8A 1OAOA 4YDQA 2ZIEA 1NBMD 2HX1A 1G8HA 2BBOA 4LNHA 1T8TA 4HVAA 1Z74A 5EIFA 3HFJA 3WRYC 3YASA 2FW8A 1ZUNA 3AEUB 3ESBA 1ORDA 2FXVA 3B5IA 5BWLA 1NVUQ 3HYLA 4J3NA 1JFLA 4YV0A 2BJWA 2DTDA 4OKSA 2ZRJA 3AHEA 1F1BA 3IT1A 4OFZA 2B8TA 1CY2A 2XNJA 1EYZA 3KOZA 1XTRA 2F8TA 2D1RA 1UXHA 3PUYA 4B5LA 5H9WA 1ZIDA 2GESA 3L9XA 1HEUA 4EY4A 4RTPA 4HNGA 5CK5A 3OIFA 2X4IA 4Y2SA 1ZGHA 1U0OC 3RAEC 2L19A 3GQBB 4EUNA 3TGLA 3SBEA 2B9VA 2PD4A 3JARA 5JW6A 3RI3A 1TDJA 4EHJA 5KKCA 1C3XA 2QMUA 4K03A 4B0OA 3VZCA 3IUJA 3FJYA 4I6GA 3RS4A 1OSNA 4E14A 2ADFA 2PTGA 3JS5A 2UAGA 1XXHE 2RHBA 3QWAA 2I2BA 4FOSA 1MFZA 5JSQA 2IOFK 3BMOA 1M5UA 2I4NA 2V7QD 3EG9A 3QXCA 4QVGA 2GI4A 1VE6A 3KEQA 2JCGA 2R6AA 4OQFA 1UCFA 1Q50A 4XUCA 2XCRB 2OBXA 4NYIR 3ROQA 4DV4B 2QUIA 2JL1A 5J5AA 4I81A 4ZHSA 3JWPA 4ODIA 4WDQA 1ZOLA 1L4FA 3N8HA 3UK1A 5C81A 2H31A 3ULKA 1VJ5A 3QMMA 4R9RA 1HDRA 3EH1A 3HXLA 2JD2A 4RV5A 4YP7A 4BGIA 10MHA 1KZ6A 3EC2A 3K6SA 2G3YA 2BHRA 4BFSA 3T3OA 3L0OA 4UBJA 1F5SA 4EVSA 2YDYA 1WPRA 2D0DA 5LQNA 3IAAA 4EF6A 1XWIA 3U7EB 3ETGA 4OHUA 5CAEB 5IWAB 2DUNA 4WPGA 4YREA 1ZOSA 3EPHA 3A70A 4IRUB 1WMEA 4TV9F 3LUHA 4GOLD 4ZV9A 5HKKA 4BO1A 4YA6A 3RBVA 4RS4A 1XTSA 1ELOA 3R6GA 3FSJX 2GHQA 4V0QA 1T5DX 4LAFA 3OZAA 2P9TA 1M2GA 3GDHA 4EZBA 5CB8A 2QUBA 2XKJE 2C59A 2WC1A 3A1CA 3KKLA 4YXWD 2KPOA 2YWDA 1BXKA 5FBRB 3EPLA 5B55A 4MWGA 2RGEA 1K68A 4JHXA 6PFKA 3LLUA 4TT8A 3ZD8A 3GAFA 1H93A 4UTRA 4KI0A 4Y7DA 1FUYB 4MIYA 1R0SA 3PQ6A 2BGGA 4U2BA 3SEQA 1FFEA 2R3SA 2VTDA 4I0WB 4CTNA 4FB4A 2CL6X 3TKAA 3STHA 5MHTA 1U8UA 3T3DA 1IBLB 3JQBC 2EEZA 1PFGA 1V43A 1VKHA 3CLVA 3IGFA 1C9DB 1E8DA 2EFCB 5LSAA 2V8OA 4BFYA 5C18A 3BA1A 3FGZA 4I55F 1T1JA 2VP4A 4QJ3A 3QKRB 1NDUA 2CF6A 3EXIB 3PDHA 3PX3A 2X42A 2NOAA 3V8RA 2BGWA 2QTVB 2PE5A 3STUA 2OV3A 1A4UA 3E5NA 1I14A 3JQ7B 5BYBA 2DXIA 5FWAA 1LGYA 4FMDB 4KQ9A 4LMPA 1H85A 1QH1A 2FUCA 2HJWA 1N5JA 2PX8A 3NBYC 4FR2A 5FB3A 4ZAWA 4UAGA 4QGSA 3Q72A 2BN4A 2FN7A 3ZEAA 2CSUA 2D74A 3LD9A 3OZGA 4ANFA 1GM5A 2HQSA 4OIMA 4YK7A 4LSGA 1AV7A 4KKXB 4YO8A 1PS9A 4LHZA 3BXFA 1DL5A 2VAXA 3TVYA 1TTTA 3GVCA 1E5QA 3L07A 2IYXA 5FPHA 1LPBB 3N70A 2AZDA 5L45A 1CQJB 3OUZA 3UV6A 1RWOA 1XU4A 3EBLA 4JH0A 3KKQA 2QSJA 5DLEA 2DY0A 1SVLA 3AL2A 3F4KA 4J1TA 1LH0A 4JYCA 3WLPA 4RD1A 3SX2A 3ELUA 2AMJA 3WTCA 4EB6A 1LQTA 2HBRA 3COSA 4ZFNA 4HRXA 1IUOA 3MHPA 2WVJA 1X3SA 2P1RA 1E3DA 4QTXA 4C4XA 1ZW1A 3L43A 1IHOA 1NJ1A 3M6AA 3ML1A 5HG0A 3NHFA 4OI1A 5CH3A 2O8BB 2O7VA 4S0XA 1XZHA 2DAPA 2IUYA 1PLKA 1RHJA 2D3WA 3K73O 4TTQA 4PC7A 2ODNA 4FYMA 4EB8A 4EY7A 1P3DA 1JSCA 1GGMA 2XMPA 3G1WA 2F43A 4G86A 1JDPA 1LLUA 4ICIA 2V7XA 4LJSA 1V2GA 5AYVA 5LOVB 2V3CC 1N9GA 3R24A 4RXMA 4Q15A 1TJ4A 3SXPA 2NAFA 3VPFA 4MUXA 2JLUA 5IHXA 1LBTA 4ZU6X 3PDIA 1RHMA 4EW3A 2TMGA 1I8TA 3BXEA 4PLGA 4YXFA 3FAZA 3G9QA 3F5MA 3BFJA 1OLUA 4LRTB 4Y2QA 4CV2A 1A2KC 3P96A 1CIPA 1TM5E 3DAHA 3L41A 4FFNA 4YUVA 1IM8A 5AM5A 3WNCA 3ZNNA 3LBYA 5IMBA 3ABIA 4RA6A 1G6HA 4YAKA 1X39A 2RI0A 5ILOA 1C3OA 1QFMA 3OTHA 5MDHA 3MCAA 1KP3A 1WZNA 1FQJA 2C1XA 1K4KA 4UM5A 2ZU6A 4AJNA 3EDYA 3VOTA 3EYAA 2CD9A 3LFTA 4I1IA 4I9HA 3UUWA 3DEFA 2QVCA 4TM8A 3PK0A 1SUEA 2DU8A 4J2OA 2BBSA 1TEXA 1S8OA 2H1SA 3PEFA 5DYGA 1H2ZA 2ZCUA 2F1OA 2NVUB 1X87A 3ZWMA 2Q2NA 1PV4A 4TQGA 5D51S 2XCLA 2I33A 2QZSA 3P2EA 5AW5A 4DARA 1WBJB 3KKNA 1EVZA 1U65A 3C7DB 3D8UA 3FFBA 4BTVA 4DNPA 5JAIA 1DPFA 1QH8B 3N75A 1EINA 4GI3A 4HPXB 5D3QA 4FR0A 5C1DA 4B80A 3QLTA 4BGVA 5KREA 1USGA 1GPDG 2PKQO 4WL0A 3R7LA 1JT2A 3DDWA 4IHAA 3V1TC 2P27A 3WQQA 1WB4A 1WKCA 1ECPA 4FT2A 4MHOA 5H68A 1BDJA 2SCUB 1W93A 3RYCA 2C0QA 2ASVA 1YK1A 4KXXA 3ZGVA 4B33A 2Y1CA 4RSMA 3PF8A 3R8FA 1IXKA 2NSHA 1SHKA 1XEAA 5DTJA 3ZJTA 5J3JA 4KQ6A 4M1YA 2RCNA 2QW1A 3KQVA 1Y5RA 3SLGA 2OYCA 4AMGA 1IQ0A 3TDMA 2VHYA 5KMGB 4OHKA 2JAPA 3W8RA 4TV8A 3ND8A 3AVQA 1NQVA 5DP2A 5IDXA 4MPDA 5FOSA 5KYXA 1ZA2A 1T2VA 4B32A 4BMVA 3CVYA 1QANA 3FCAA 3PA8A 4LTNA 2IVFA 2BTOA 4DFDA 4JLSA 4N1AA 2OB2A 1FFYA 4FYHA 3PNQA 3QLVC 5DXFA 5GPBA 1TK3A 1JEQB 4HUQB 4O5OA 4C2TA 1KDTA 1QKIA 4GI2A 2ZI4A 5LA6A 2RONA 3LTEA 3UWPA 4NFSA 3UJ7A 3HJHA 3IUQA 1LK7A 4MV4A 1D9ZA 3OM8A 1AQLA 3WLFA 4ND8B 1NVMB 2WJ6A 3OJ0A 4R81A 1R5NA 5D3ZA 1G8YA 5K7SA 4DMHA 2LZ0A 2F7SA 1QU2A 4WN9B 2FPLA 2WF9A 2WJAA 4A6EA 1RABA 3CQ9A 3U6KA 2CBZA 2FE4A 3EWSA 4FPXA 4I1RA 4KE9A 4TYNA 4GX0A 1RE0A 2QU7A 3U7QB 1U8XX 4GNRA 3VUEA 4IGEA 3TE7A 4GI1A 2C4TA 4M8LA 1FFXB 5B4VA 1WUHS 3HV2A 4B74A 2H4FA 2QL7A 3FW1A 4UQLA 4QPPA 1VDMA 5DCUA 1OMOA 2EW1A 4KPUA 4FLEA 4DVJA 1E9EA 1Z0IA 2P4SA 3O4IA 1K8QA 2AFHA 4BKOA 1AHNA 2IYVA 4YJFB 3DQZA 1OHHA 2QVLA 1TW2A 1NI4B 2AQKA 3DLCA 2O6LA 4C89A 3RT1A 1V6CA 1GG9A 2IP2A 4RY0A 4AF8A 2GK7A 1EFHA 2CNBA 2NO1A 1F2DA 3ONNA 2VSYA 1CF9A 2NU6A 4GOND 1EUYA 1EZ4A 2L18A 2QRPA 4RTQA 2FV8A 4B8YA 3CPJB 5HCIA 4LHWA 4X60A 5JWOA 2COUA 3CCBA 3OZSA 2VHTA 1WRBA 2ETXA 2NADA 1ULTA 4HL6A 2GEVA 2ZKIA 4Z0TA 1C0KA 5EJ2A 3SHQA 1KQPA 2GEJA 3FMIA 1EXVA 2BT4A 5IM4A 4YQZA 3K2QA 1SCQA 4QXOA 1RC0A 1XLVA 3QBTA 4Q21A 2WTXA 2ZYVX 3HU1A 1KEKA 4QYWA 4GYKA 2C7RA 2FEMA 1KK1A 4WADA 3PDWA 2FX3A 4F21A 3GPBA 4FUTA 4KVAA 3HLTA 1HNNA 4J0CA 2R8XA 2IEBA 4JFRA 1IOLA 1XP5A 4BBJA 3G0HA 4JASB 2G5TA 4BFZA 3SHTA 1FXSA 1SQ5A 2Q8QA 2OO5C 3VSEA 4BVBA 1XLTA 3R7FA 3BXPA 1ZO8A 1D03A 3LPAA 3BRWA 4LZZA 2EU8A 1OLSB 2IA5A 3GWZA 4H17A 3T4PA 1ORRA 3WLNA 4C20A 1NMQA 1BW9B 1YFKA 3WL8A 2X5XA 2Y27A 2VATA 4JSTA 3JALB 4BGDA 5KDDA 4RHEA 2GFIA 1KWKA 3NT5A 2J0SA 2CZQA 3UV3A 2ZIGA 4BLUA 4DMCA 4S04A 1NQ5A 2VP0A 3KJGA 3F5QA 4YPFA 3HB5X 2E5FA 4L95C 1P0PA 3IE1A 1F0PA 3OTIA 1UKVY 1QOPB 2OKCA 1JJVA 3ADOA 4DA6A 1E2QA 2H7XA 4OI2A 1I30A 4GKKB 1C41A 3KB6A 1KQGA 121PA 1JYEA 2FR0A 1JFVA 2C58A 3B6IA 1E2KA 1R6UA 3O0DA 4RHFA 1R0ZA 1YHZA 1RM3A 3GVXA 1TIPA 3A1NA 3N2YA 1LBHA 4PG7A 4XUGB 4KIJA 4ZV4A 4JB8A 3GCGA 3DBLB 4G8CA 1N6RA 4BO4A 2ZYTX 2BMVA 2FSVA 2JPDA 4OAOA 5EHZA 5G3YA 2SKCA 1QYDA 1BIFA 1NASA 4NZNA 4AN1A 4K05A 4PYIA 1F8YA 2VBFA 5FYDA 1GAQA 5JZOA 4WFIA 4KQ2A 4BFCA 3EZ2A 4HMPA 3NJ4A 4E33A 1RWVA 4LV5B 1YQ9A 3SYTA 2IYNA 2B99A 4F46A 1U1FA 4ZV7A 3UCEA 3TSAA 1CY6A 1HOTA 2CXOA 3PJEA 4GM4A 1H2BA 1H4VB 2KSQA 4E7PA 2MCFA 3WLRA 1QZZA 4BWFB 4RORA 2IOFA 1OHHD 2GUGA 2HQRA 2VHVA 3E7FA 3C7KA 4DIEA 3KQNA 3DEZA 4GICA 5BWBA 5C5DA 3FLAA 4DG9A 5GJCA 3R3WA 3A14A 4YTEA 3M4JA 4D46A 2WTEA 2JD1A 3IDQA 3H4IA 1U5BA 2PMEA 3TW8A 1A9RA 5DRTA 2LUOA 3T0IA 2NUPB 1B8NA 1J97A 3WGVA 3C3JA 3GEMA 4PY2A 1VMKA 1UM9B 1UKAA 2AWOA 3PC8C 3D8BA 5CW1A 3K92A 3L7LA 1E1RA 4G81A 2Q1TA 5L8VA 2PDAA 3PUXA 1KSHA 4D8UA 5DNYB 4IIXA 2XKAA 3ZD9A 1DFIA 4P86A 4PEVA 2C1ZA 4FFLA 3UJ6A 5DW3A 2BFWA 4RDIA 2X9NA 3UBMA 4BCBA 4C0QC 4NEHB 2P4HX 5EKUA 3ANSA 4DGQA 3DWIA 4BP1A 3PICA 4KIGA 5FBKA 4D9BA 4JOCA 2HMWA 4D56A 2NUTA 1JG2A 4H7IA 1FUEA 2OUKA 4MH0R 1WHTB 3ZGNA 1SU6A 4MKXA 4MTCA 4RPIA 4DC9A 1VI2A 3WYNA 2ZUFA 1K63A 3ZWAA 2PMDA 1URPA 3CF4G 1XJQA 4PYKA 5CLLA 2COEA 1QZ3A 1AGXA 2VN8A 2CXTA 3PRHA 1TEVA 3MWGA 4H6VA 5JUWA 2YJ3A 4AY4A 4HDRA 3ZTWA 3L5OA 3WK5A 1OU4A 3MB8A 3ZWBA 3CZMA 4EPYA 2IZ0A 2OCPA 1W581 2VF8A 2GTIA 1QOZA 4JSYA 4OBWA 1XQWA 2WU1A 3FGPA 4Q02A 4ZMRA 1GRVA 2IWHA 1BEZA 1YS1X 1Y48E 1YZUA 2YY7A 4BQOA 1A72A 2E6KA 4H7PA 2Q3BA 2PLWA 3KVNA 2CHVA 4WFQA 3VTKA 3WIDA 3RGWS 4OX9Y 4XSGA 3ZI4A 2JGNA 4JI7B 3IIIA 1Z6PA 2HF7A 2UXCB 3KD2A 5H1YA 4WZZA 5K51A 4FMCB 1EQUA 2H8GA 4DCNA 3F47A 4S35A 4HK4A 2CMHA 4H4CA 1ZBQA 1PLLA 1F1JA 2ZWVA 4NCKA 4RBNA 3ZU3A 4QGHA 1B6RA 1EU1A 4F1JA 3LPCA 3EXEA 2Q41A 3RW9A 5LQDA 3KR2A 2WIKA 3QV1A 1RXEA 5AOVA 2BMDA 3DZKA 3U9TA 1KFKB 2OAEA 2WA2A 1YZVA 3PFFA 4JKIA 4NOKA 5LD2B 5E3JA 3T9BA 1FEZA 2RK4A 4H31A 3RVBA 1FUIA 1WLYA 1KRXA 3QELB 3ZJUA 4N82A 3A7EA 1XCMA 1V7PC 3FFWA 3AJ8A 1PT5A 3FMVA 3UG7A 2I8LA 1Y6RA 3UMJA 2ZSIA 1XRSB 4M7OA 4LMRA 4EA7A 5ITZA 4NOMA 3I2YX 4XWKA 1E1DA 4JJ7A 4L3OA 1WB6A 4BFXA 3IDFA 2EFEB 4ZIRB 5C1PA 5JSZB 4YB8A 4ETWA 3ADKA 4BQQA 4AZSA 1UQTA 2D7JA 1LVUA 4MQLA 1KOJA 1M2NA 4KO4S 3AL0C 3CLUC 3WJ2A 1Y6ZA 2AN9A 1TCUA 1V1RB 1ZK2A 2BFAA 2BF4A 3I6YA 1Q22A 4OQMA 4QTUB 4MKIA 4RS3A 4F8EA 4P8RA 4QU5A 2V3VA 3TPCA 2ZQ5A 2VJCA 1FXUA 2H7CA 4G65A 5KWJA 4GZLA 3HABA 1U0RA 4FOOA 3M9LA 2MSWA 5EXEA 1NXPA 1FFWA 4UMDA 3K9NA 3TLAA 3RUAA 4D0LB 2EBHX 3DDCA 2QZZA 4GVPA 3S2GA 4D8VA 1V8PA 1Y4ZA 4GPTA 5CT8A 2WFAA 1E1RD 4ENRA 2EAUA 2YS7A 1FK8A 3JVUA 1NHWA 2J6CA 3DNMA 3QE0A 3RO7A 4HYEA 3RVNA 4E08A 1HMYA 3S27A 1JALA 4WOJA 4RDXA 4X1OA 2CB9A 3AHDA 3DEYX 1BKYA 1B6SA 3VDQA 2ZIXA 4R8KA 1M8FA 1PDOA 3VVLA 4LIPD 5BV0A 3EVZA 2C07A 3TOSA 5I45A 1AN9A 3ZJVA 5KHLB 2WYHA 1HE2A 1VHTA 3DHYA 1O0SA 1Q84A 2BF7A 2X7HA 3EUWA 3G49A 5J63A 4OI0A 3DO8A 4DT1B 2QAGA 3DFMA 4DCVA 1Q0HA 2H63A 1CJSA 4NZMA 4FCCA 1CUGA 5J2UF 2BSQA 2ZWAA 3Q3CA 2RH5A 1JHAA 4G0XA 5EJ5A 3PYXA 4HH3C 5EYPA 4ZHQF 2IXDA 1RYYA 4B8WA 5HBGA 2Q3FA 1XDGA 4QUGA 5JDCA 3LXXA 4Q9JA 1Z63A 1VBMA 1RRGA 3IE0A 4MVJA 3VO8A 4JVSB 4NCXA 2WMYA 2ZFUA 2NP6A 3GUHA 1DAHA 1HUQA 1M2VA 2NTJA 3OZTA 3U9SA 4BWVA 2A1IA 3EJ6A 1DTSA 4I1UA 1DCTA 2CUZA 2IIQA 4GKVA 4DADA 2VP9A 2WHRA 4XWGA 2V7VA 1E0AA 1NX9A 6GPBA 3L49A 3MMPA 3E9YA 3M34A 1CRPA 1JX6A 5H02A 2CJFA 5HNKA 3U13A 5IT9A 2ZULA 4Q01A 3R7AA 3G1UA 4JLDA 4XM1A 5FH9A 4M6WB 1OA0A 3QTLA 2Y66A 4JZYA 3OOEA 2JGFA 2XE7A 2GZ2A 3LRPA 4WX2B 5EHNA 1MGOA 2O5CA 2E4AA 4DLBA 2X0KA 4HWRA 3IMGA 1PFYA 1O58A 3FBTA 1SVMA 5ALPA 2PAAA 5DO9A 2GA8A 1ODCA 3AI7A 2IOQA 3GUZA 4QD3A 4HNTA 2CK3A 4A26A 5CDTA 3S1SA 3KUDA 1I36A 4ZO4A 1NVWQ 3PD1A 3R6TA 2O5RA 3DUWA 1IHUA 3I09A 2IBSA 4XIFA 4HGYA 4F91B 3EPRA 4JP3A 3VPAA 1XKQA 4NECA 4YWJA 5JZBA 5EZ6B 3N9IA 5EXTA 4AZ3B 4RMIA 3GJRA 3P27A 1Z4JA 2ZSFA 3A9WA 4P6VF 4PRYA 3KZNA 4PYNA 1CULC 1Q3KA 2DKOA 2RKOA 5AM4A 1ZONA 3UFXB 3P5SA 1ZP6A 4NYMR 2XDWA 3VX3A 3K5HA 2LNDA 2VJMB 3AERB 3JD3A 3LW7A 1P9LA 1EK5A 2ILTA 4HB0A 4U00A 1ISSA 3T35A 4INOA 2ZE6A 4HZUB 5KTYA 1WMSA 3ER8A 2X77A 1P9NA 4RKFA 3B3JA 4PRKA 3PXAA 3QF4B 4U3JB 3N6VA 1VLHA 4BO0A 3IHTA 2C77A 2I6FA 4UZEA 1VRCA 1E1YA 1Q1AA 4TM7A 5F4ZA 4EG1A 1E4OA 2PYIA 2YV5A 1R5BA 3FFAA 3IKJA 1SXHA 3TL6A 1H2EA 3OJWA 2H9AA 2HXYA 4UZFA 3FNRA 3T7EA 5KYYA 5AW7A 3CNQS 4NMHA 4QYIB 1CR0A 4DCUA 3H7AA 1JH8A 2OGTA 2QKYA 2QVBA 4G97A 4NCHA 3KOUA 4WY8A 3UJPA 3V7YA 3RASA 2H07A 4WINA 3PPIA 3A1FA 4AO6A 1CY0A 4C5BA 1L7NA 4G1EB 1R4MA 4N7BA 1CZUA 1FFAA 1TCVA 3FUWA 4H7JA 1WPXA 2A86A 4AJ2A 4K9OA 4BNTA 3BVPA 1EK0A 2E89A 3N74A 3S7TA 2HWKA 4F6LA 2B0JA 1DMSA 3PNVA 4G1VA 3FPKA 1EM8B 1XB2A 3CZRA 1GL9B 3NORA 4X92A 4F4IA 3ZGYA 4UZSA 1A9OA 1F4LA 4AS3A 1WXDA 5EXXA 3D2BA 4LEIA 1QTIA 3PQ5A 3DLPX 1C8BA 4OQNA 5TT1A 3LUFA 1YWGO 1AQYA 3W0LB 1MVOA 1GPUA 4UHJA 3WMEA 3LDHA 1KK0A 4MA0A 2BUBA 2YJZA 1U2GA 2J67A 4DY6A 5EE9A 3PBKA 4HNHA 1T5LA 5ALNA 3TUZC 4EP1A 4IKEA 6ABPA 2X0DA 3BMXA 1E1MA 1W19A 4Q12A 4AMUA 1WB9A 2O8NA 2V4UA 2ZAGA 4A2QA 3LCJA 3Q7RA 5KVVA 1AQ6A 1JTVA 4NKRA 1FP7A 1PL8A 3UCFA 4FYVA 1MPTA 1ZUNB 1L5SA 3JATA 3MUFA 4N3AA 2ACWA 1DHTA 1XZIA 1FRFS 4U8GA 3SICE 2P4EA 2R6GA 2UUCB 1XRNA 5DNCA 2HRCA 1Z36A 4UE6A 4MVYA 4DEXA 2CMKA 3A10A 1U9IA 4G5FA 3I72A 5HFAA 3FTCA 2AT1A 2F3PA 3RVKA 3RRYA 4TVSA 1NJ8A 5JZ9A 2O2SA 1AH2A 4CU2A 5T6BA 4P4LA 1XR3A 1DG3A 3C7CB 4H27A 4CV0A 4G07A 7ADHA 5EJ9A 5GZ6A 3JARB 2IS4A 1YS6A 3C7TA 4IO1A 2EERA 1CRLA 2Y1EA 3MTJA 1O0CA 3OUUA 2EIHA 2ZJFA 2CK3D 1ZOPA 1P2DA 3TW0A 2PU7A 1KWGA 1RAFA 4JQOA 4OMDA 3FOWA 4XGQA 3UICA 4JXXA 2ZI3A 3IIKA 3HZRA 3NTOA 2G9VA 5HZKA 1D0IA 3VYWA 3ENZA 1SZDA 1UJ4A 4ILEA 1N0WA 1E3IA 2FSGA 2V65A 3BMOB 2EYUA 2VSQA 3EG9B 4FN4A 1MDBA 4IJUA 5JNUA 5L6LB 3AUUA 4Z0PA 5JROA 4A2CA 4LOKA 3IP9A 3G2PA 3PS9A 4MW5A 2JFVA 4ESEA 2QNRA 2QIPA 1XMOB 1RLJA 1NI5A 1IL0A 4HAVA 4HWSA 4ITRC 4V0RA 1MHTA 3M70A 3QEJA 4WAUA 3K6SB 2BSXA 3B9PA 2ZUSA 3DVQX 4HXEB 4D4IA 3BXXA 5DT2A 4M88A 4G0YA 1BFKA 2QYHA 1K8XB 5SZJA 3SYMA 2CSXA 1TTHA 2VF5X 4BRZA 4G41A 4IR7A 4BQIA 2OGSA 1HV8A 3RFXA 3T1QA 3JVVA 4QDJA 3H16A 3T41A 3DMTC 4H4EA 2EZTA 3K8YA 1M54A 2RAFA 4GNKA 4WE3A 3C8DA 2ZXEA 4C03A 3AM3A 3DG9A 3HYCA 3BZWA 3DMGA 4BQEA 3G59A 5JYEA 1NXXA 3OIGA 4IMPA 1MEOA 2CNOA 2JH8A 4LS3A 5EIOA 3AJDA 2AW3A 4EL5A 3K0SA 4M0EA 5HZHA 1PV1A 4IIJA 3G23A 4DLUA 1E9FA 3IDOA 3IDSA 1GPYA 2Q5OA 4MVCA 4P7BA 3MJTA 4YLGA 2OBMA 4YLEA 4YX9A 4FFVA 5K3AA 4PINA 4E2ZA 3GL9A 1A97A 1DEHA 1V6AA 1X1DA 4M89A 4URWR 4A6PA 3O83A 3X1YA 1AO0A 1OXBB 4I99A 3NGMA 3CLTD 3NGXA 4TMKA 2AMFA 3CBGA 3T06B 3PJRA 3UJBA 2NIPA 3JQ8A 1GNLA 4WH0A 3C24A 4G5HA 2YOHA 1DBPA 4HDAA 4F6CA 3EODA 4F9GA 1QG4A 2ZS9A 4O4HF 2QE6A 2B5VA 1C29B 1G9SA 2YZNA 5EHIA 1QH1B 3F7OA 1BMTA 3EISA 5I7WA 1ZMTA 1EIZA 1QIDA 2YMLA 4DNFA 1AKWA 1Z15A 3GNTA 5ENZA 2VQDA 1WV1A