3WL3A

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
publication title Expression from engineered Escherichia coli chromosome and crystallographic study of archaeal N,N'-diacetylchitobiose deacetylase
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 97
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 3wl3A00
3DFIA 5B2FA 1Q7TA 3DFMA 2IXDA 3WL3A 2XADA 3DFKA 2X9LA 3DFFA 4XM2A 1UANA 5B2EA 4XM0A 4XM1A 3WL4A 3WE7A 5CGZA 4XLZA 4EWLA 1Q74A 5BMOA
chains in the Genus database with same CATH superfamily
4JKIA 4MVJF 4IH9A 1GKIA 5CMLA 4YA6A 4YCSA 3ISJA 5JISA 2WKSA 1VL1A 1RLTA 3X0DA 2IA5A 1Y98A 4BRUA 1JAXA 1JKJB 1PJTA 3AHGA 4YP9A 2NX2A 3OQ1A 1DWPA 1NF8A 4MS3B 3Q2KA 1GPUA 3KQUA 5EKDA 1YA4A 3EUEA 4NFLA 5KNBD 2CLCX 2H3EA 2V58A 2ECPA 1B74A 3PKZA 4ZYYA 1QPZA 4N7RA 2CNWD 1W2HA 1EM8B 1T5IA 1Q1GA 4CDNA 4BKUA 4EHAA 3OFNA 3D6NB 3AVYA 3SIRA 3V7NA 1JHRA 1NNLA 1KNQA 4D57A 1UBLS 5AIAA 1TEZA 3NTQA 4K1LA 1RMTA 3TLZA 4MWTA 4AYXA 2HR1A 1BWRA 5AKGA 2ZE7A 1JZQA 1PQWA 2NSDA 2ONCA 5FNVA 2G82A 2ZJ3A 1YACA 3R77A 4LZAA 4OXNA 1QX4A 4Y9DA 2X7HA 4X1KB 3C3XA 2BKXA 5LQKA 2Q6LA 1UKBA 4Q1AA 2XDAA 1ZNWA 2P11A 2GHQA 1E1CB 1M1ZA 4L8YA 5LMUB 1CZNA 3A06A 3KXDA 1GZUA 1NZJA 1YHNA 2C2BA 3CWZA 3O31A 3OZGA 4G81A 3VU0A 3UO8B 5CX4A 3NUGA 1ID1A 3KALA 1W94A 2PLWA 1COWA 2X0RA 1HFKA 2R2AA 3EPPA 1H5UA 3KYIB 4M55A 4UREA 4EKGA 1XEWX 4N7MA 4C6TA 5JFOA 2ZSDA 1YH3A 3ZDFA 3TAXA 3WWEA 3P7MA 4NBLA 1AZTA 4UOQA 4PINA 1J33A 1UR5A 3WHIA 3J7AC 3NEYA 3E0XA 2GUWA 4RD3A 3CVWA 1SURA 4NAHA 4INPA 4RESA 5JLAA 2P91A 1I4OA 4MR8A 3SX4A 2RJNA 1V6CA 2FLKA 2BFCA 5GY7A 3AGQA 4GQBA 4Y0NA 1ZRNA 2IDMA 4WJZA 3PDCA 2ZCJA 1ONOA 1P61B 1AN0A 4IVNA 4YPFA 4F60A 1FDRA 2QLLA 2GZMA 3VKUA 5LKRA 3D8NA 4L75A 2HIMA 1Z5VA 4IINA 4DZZA 1LTKA 3ESCA 2J31A 3I5AA 1MV8A 3BCUA 5F4ZA 1GL9B 3MSXA 2AEMA 4IQ4A 4UNPA 5DBHX 3U39A 3UMSA 3V4LA 3LIPA 2FN7A 4XFDA 3B3QA 4ZODA 4C4PA 3ICPA 3NPAA 4QOJA 3OLQA 1EIZA 1L5FA 2GR9A 2IEIA 1CYEA 3EGCA 1KMNA 2A4KA 5IX8A 1QMGA 4CCSA 1GA1A 3EA4A 5KOYA 1OB5A 4X8MA 1RI4A 3PR3A 4OGKA 4Q4HA 1GGFA 2QTVB 4GI2A 2C7QA 1EVKA 1NMSA 1KI6B 4LISA 1L1QA 2EF0A 2FP3A 3GMSA 3NS7A 1Y63A 4W6ZA 3BFPA 1N5KA 1VSTA 2O0LA 1BMDA 3BMCA 4QUGA 3W4JA 3X1ZA 4IMIB 5CLIA 4KLAA 4FYPA 1X86B 3QI2A 4P7BA 3OF5A 2BSQA 1PN3A 2EZUA 4I50A 2OPHA 3SR4A 1FX0B 4JX9A 1F0YA 2RHLA 1QHNA 4J4TA 3FOZA 4O4LA 2JJ2D 1KSJA 1TAGA 2BMFA 3E58A 4TQGA 4CEIA 1UKZA 4H0NA 5IJ9B 3LX5A 4LYGA 1D03A 1GNQA 3A2KA 3EIEA 5A6SA 1K9SA 3LLMA 4B7CA 1I2DA 3QYPA 1K6MA 3GFSA 4A7PA 4OFXA 3I2KA 1OWNA 2RHWA 5BWOA 1V41E 3RGGA 2CLKB 2X1VA 1HDEA 5LMCA 4CWAA 3DW1X 3GLUA 3D81A 3NHPA 3P9IA 1UJCA 4L3OA 4UHBA 2IU6A 5AOBA 2D1TA 4HUQA 2IEDA 3CF0A 1X1AA 1GZ5A 1WB5A 3AT1A 1AT1A 1X1QA 1ZJYA 4NYIQ 5AO9A 1MVNA 2UVQA 4C0JA 4DDHA 1S4MA 1EG2A 5FV7A 1BHJA 3SQWA 1KKLA 2WJZB 3B38A 3EVBA 1QUEA 3IAS6 2HLDD 3NANA 4JOBA 4MRAA 4POAA 2R8XA 4S1OA 4RZSA 4KPFC 3CUYA 1NC3A 1WPRA 2BMVA 2ZB2A 4QXAA 4UTZA 3RYFB 5BRAA 3U17A 2F00A 4ZO4A 4D7AA 3PNLA 3QWIA 1O1YA 3EVZA 5EEGA 4PEVA 1U8AA 2J5QA 3QKIA 4MCJA 4X6XA 2EX0A 2XB4A 1JH8A 1FVFA 2RI1A 3ELYA 2XEDA 1JEEA 3ZX4A 1UADA 4CT5A 1MRNA 2BPOA 3M0EA 1M8KA 1ZGAA 4P5DA 4U9UA 1CUAA 1Q1ZA 1T34A 3I45A 4BWVA 4MOWA 2R0QC 3EBPA 3WYNA 1F6BA 3ZNQA 3BZWA 1RYHA 3OESA 5DCWA 2AYYA 5H3CA 1CUFA 4AECA 4H27A 2B1GA 2H57A 3T61A 4FNGA 2Z56A 3ZHUA 3HYCA 2ZYIA 5ICGA 1WEKA 3JAKA 1GLNA 2FTKE 3EDOA 3VR2A 2NYUA 2EX4A 6NULA 1W88B 1F5SA 4NCHA 4HZGA 4IL5A 4EVQA 2WDZA 5AH0A 3TNLA 3U48A 5FWYB 4REQB 5ADHA 5K7SA 2ZZMA 1N5IA 3OMLA 4M0DA 4A4DA 2HN9A 3K6SA 4J1TC 2F59A 5FUMA 2UUBB 3EC7A 1SEVA 3AV3A 1ICEA 3QKSB 1B14A 3FDXA 3PZRA 1Q16A 1AF4A 1YC2A 3CX3A 2HA3A 3D6MA 3M49A 3NONA 4FHEA 4PZDA 4OMDA 3K9FC 3LG2A 5C18A 4PZYA 3LUGA 3HY3A 2F1JA 1LQTA 4GX0A 3FB1A 5D1HA 5F73A 4L7QA 2C84A 3AEXA 3NVKI 4JBYA 2XQKA 4NK5A 5AQEA 3BF7A 4V03A 3BERA 4B6EA 1XNGA 2N9UA 2RHJA 3DW3X 4HLUC 4MW1A 4O2AA 5DIZA 5FR2A 4D9NA 5AQ1A 3FCSB 2WMNB 4NYJQ 3VH2A 4BVAA 5T41A 1P2FA 4MRVA 4IUCS 3D7NA 1M10A 2KS6A 4PXYA 3LQFA 3BH6A 3QE0A 2WFMA 1RPJA 2JAHA 4QGHA 5ALKA 3V2HA 2CD9A 2QSZA 4YXFA 1U3FA 1JFSA 3LK6A 1D2MA 2Z4TA 3AIMA 3EY9A 2OCIA 1A1SA 3LCJA 4FTWA 3VGPA 3K20A 4YJ2A 3HKCA 4EITA 1OX5A 3TLMA 1YZVA 1HLPA 5IJAA 2FR8A 4GRIA 4BNNA 2EGUA 4JC5A 2CNKA 2VIIA 5FWXA 3A1NA 5HS6A 3TNFA 1ZIXA 2VDNB 1KI9A 2XCLA 3GGJA 2YZNA 1U90A 1GV0A 2KYRA 5A5FA 1JFLA 1O97D 1N5JA 1DIHA 4TRNA 1WMDA 2NU9B 1YB7A 2DHDA 5KMGB 3QWFA 2PCLA 3GVIA 1EX7A 4LV6A 5IF9A 2EF1A 4UM9B 3RAEC 4IXDA 2WIFA 4IOLA 4X00A 3QY0A 4AF7A 1NVDA 3L8MA 4RE6A 3GC6A 1L5YA 4NVRA 2OBMA 3U0VA 1IZZA 1J2UA 3RT9A 3GJTA 4LZNA 4ZI2A 2GOYA 3O3OB 2G08A 3FZQA 4UM7A 4G23A 1C9JA 1Z6YA 1SJ9A 3JWIA 2YZKA 3E5MA 3PNSA 4IF4A 1XQVA 4P36A 5H7XA 2GJ8A 1E4VA 4RCYA 4HH1A 4RHTA 3JPYA 3U4GA 3KPYA 4X8HA 3ZI7A 3NR2A 2VQFB 4HYEA 1A9SA 2XTNA 2BKUA 1XRQA 4JLOA 1P3JA 4PO9A 2D4HA 1F8GA 1KBOA 1P44A 4HZIA 2HM7A 3UJ7A 1OROA 3F5QA 2UYHA 3UPTA 2HJGA 3QVTA 3W2EA 2DLCX 1YJXA 2I76A 2LDXA 5LWQA 2GBFA 4QAQA 1DFGA 4Z7QB 3MCZA 1TAQA 1P2BA 5EWJB 3R9WA 1EQAA 1Y8QB 5C5CA 3R74A 4FEEA 3D8BA 5A06A 1RIFA 3R9IA 1PR6A 2J5BA 3RVNA 2EDAA 2WM2A 4LJ4A 1P18A 3PDJA 3O4JA 3S55A 5AW3A 5FBWB 2H1WA 3BIOA 4QJ4A 4UE2A 5I9TA 2PUAA 1V8FA 1X1SA 3GRYA 2LIVA 1XTPA 4MP3A 3ULKA 3ZQJA 1QIIA 3EPLA 5EZQA 4RK5A 3EXG2 1MX3A 4DBLC 4K9NA 4KXNA 3OM0A 3Q40A 3NEAA 3TLCA 2B94A 3KSMA 2XXAB 2ZBGA 2ZEJA 2P2NA 1QO7A 4DYVA 2CC2A 1XF1A 2C7OA 2XHEA 1P60A 2Q6KA 1NNI1 2JKZA 4WE3A 2B1RA 2I9PA 3S68A 3IMFA 4ZVRA 1VB3A 1PJLA 5K6RA 2EFDB 3B9QA 4OGGA 5JVDB 4PBTA 9LDTA 1NW6A 4Q3BA 3OUUA 3EVAA 1WJGA 3S1AA 2DFTA 3GLHA 4NMXB 4ZC8A 4YT2A 4BP8A 4HYQA 4KXMA 3RS9A 3J81k 1S2OA 4JYZA 4OLBA 4GE3A 2QTZA 1KSFX 4DNQA 1KK1A 3OTIA 1IVNA 3NAGA 4MYTA 2HYDA 3FMPB 3R0VA 1SCNE 1IZ9A 2BLNA 4INOA 4KUHA 4MR9A 1C8VB 2ZXUA 4IM7A 3S6JA 1EB9A 1JAYA 2X1MA 2H6EA 1KMQA 4XEUA 3F5DA 5F2KA 1FQWA 8ATCA 1CFJA 1J20A 3FCUB 1F4LA 3ZDEA 1AQYA 5CVCA 4Z0TA 3ZXYA 1OJ7A 4JJ6A 4HDAA 2PKQO 1OH6A 5DK4A 3T5MA 2JFVA 4D9KA 1W1UA 1GPJA 1DMSA 3NDIA 1CHNA 1GG9A 3Q3GE 3WBBA 1ADFA 4KZPA 3L93A 4AP6A 2IYQA 3BMNA 3D7RA 1KYZA 1BVRA 3QVWA 3K9GA 5LKAA 2I66A 4D8XA 1L3CA 4H60A 5LBIA 1DOHA 4MRRA 3BSYA 2ACEA 2B7CA 4IFTA 3SNKA 1Z6QA 2HNBA 4FFLA 1LDMA 4IO1A 5EUMA 5J2TB 3SZMA 5EIBD 4BLRA 4M9ZA 1W93A 4F6LA 4HSEA 1E64A 2ALJA 4KXQA 2EKQA 3EEOA 1FE8A 1KAMA 2GI4A 1OAOC 2HSDA 3OTWA 1QRAA 3E27A 4PFKA 2JD0A 4EVSA 6ABPA 3U7HB 5DNDA 1S9DA 3MGCA 4URZR 1FFGA 4H7KA 3OWXA 2EWWA 4G0OA 2YQZA 1PT9A 3FLBA 3NWPA 1RXYA 1F7VA 1YDWA 3NGMA 3PPIA 4MPJA 4UNSA 2B3TA 2WSSA 5K05A 5KPJA 1UMDB 3CXUA 3DDWA 3NNNA 2DTXA 3QE9Y 3DEKA 1EFPB 3Q8MA 2Q21A 4J1SA 3KAPA 2OR3A 4IS3A 4Z1MD 2SCUB 1LBTA 3OCJA 4DR6B 3DUWA 3UHJA 4PONA 1J0DA 2Z3ZA 4IKEA 3D5EA 4QWWA 2J9RA 1WHTB 3N0TA 3EGDB 1I32A 4MWEA 4YROA 1D07A 2X2OA 4ZV9A 1C0IA 4M9QA 4EPTA 4XYEA 4OIMA 2VUTA 421PA 1DDIA 1DUSA 1VE5A 4IV0A 4BLWA 2QUAA 1QHEA 1QQ6A 1TMGE 3STWA 3D6UA 3ITKA 3VJRA 4OI0A 3HVUA 5LZ5A 3RROA 3VR0A 2X86A 1RAEA 4CKZA 1R00A 1LQUA 3PI7A 2CJPA 1T2UA 3DB1A 1ZMXA 1HLFA 1LU9A 2IEAA 2QZJA 2VUUA 2NUPB 3PC8C 4WVFA 5GV8A 1BJKA 1JP7A 1KH3A 2GAIA 1A9QA 1PE0A 3EYWA 3Q0TA 2IYXA 2PMKA 5EZ6B 3SJZA 2IH5A 2O48X 3OTGA 3REGA 4C06A 4R3NA 3V80A 2O0HA 2YIVX 4H6WA 2P3QA 2X7XA 5IH3A 4ZKDA 1G6HA 3VU3A 4ZO7A 4LFBB 1F2UA 2ILVA 3TRIA 1GFSA 2IS2A 1Y42X 1I80A 1WCYA 4DMMA 3L6CA 3C7KA 4XR9A 2CD7A 1J0BA 1YOVB 4QYIB 2HU8A 3PGLA 2B2CA 1QVVA 4RGYA 3AU8A 1U9JA 2EZ9A 3AR4A 4QHYA 3IEIA 3SIWA 1J8VA 3JRNA 4FKZA 4P6VF 3B7GA 3MLBA 4CF4A 4UOEA 1MC8A 4BYGA 2XWJI 3BORA 1YZNA 5DK6A 1TO2E 2W71A 1A4XA 5C1OA 1HNZB 1TT5A 2W6ZA 4JP5A 1PQUA 1JFVA 3U1BA 1HRKA 3AUTA 2CXOA 5B53A 5TVKA 5JNSA 3OPYB 2E0IA 1KFCB 1U3TA 3Q3VA 4J0HA 4J0FA 4D81A 1BOFA 2YJZA 5TV2A 1P7CA 3UOWA 4EFDA 1JECA 3Q5GA 2VYVA 4J16C 4BFSA 3OHSX 3HDJA 3RFVA 3OP4A 5BY2A 3CV3A 4DR1B 1H4QA 3FWYA 4OTZA 3TAUA 3W5UA 2COKA 4RV5A 1C7IA 2F4NA 1PJ4A 3IKTA 4AXXA 1JKJA 1VHLA 3ZWMA 3UIEA 2V6GA 4ARSA 4M8IA 4R8VA 4MS3A 3WSTA 4M99A 8ADHA 1LBIA 1NVUQ 3DAOA 2FWMX 1HTWA 1YB6A 5EKUA 3UT5B 4MB6A 3RHZA 3OETA 4B7UA 1O54A 1EM8A 1W2WB 3CLRC 5F1KA 2I7VA 5U4XA 1DAIA 3L5OA 1K8XB 3OD5A 4YUXA 1XDZA 4GOJA 2W9XA 2VXBA 4G8JA 1URPA 3DBHB 1KMHB 1S2GA 2FPPB 3PL5A 3T52A 5DLPA 1B41A 4BQNA 5K0EA 3TW6A 2RHCA 1KIMA 4LVUA 3GFOA 4X1KA 3RTEA 4K3UA 3UAVA 1DIGA 2FMXA 2O3TA 4KYVA 4Y6PA 1LRJA 3WGJA 1QYVA 1SWVA 2PFGA 2VQ6A 1E1CA 2ZROA 3NBZC 4CN9A 1IM2A 4QDKA 2RBEA 3QEBZ 4K9MA 2GXAA 3PYXA 1B0AA 2QT9A 3OQOA 1USWA 3REOA 1HT1E 2R25B 5YASA 4D9EA 1OT5A 4OX9Y 3OQIB 1NXPA 3UMMA 2QVYX 2TMKA 2PT5A 4XGRA 3Q98A 3K0SA 5SYNA 5CNJA 3DVSX 1GDDA 1R6AA 4Y9UA 4YI3A 3X1YA 2HBRA 4B46A 1SC4A 1M1NB 2KLHA 2I54A 4OK3A 5HM6A 2AOWA 4ESVA 5E7QA 2XXJA 3R3SA 2GTIA 2G9QA 3BXXA 3R40A 1E1DA 3ANYB 4BZPA 1TJ5A 3HVIA 1FFSA 1NE2A 4JJGA 1OGJA 3KZOA 5J5CA 3HCWA 1VZ2A 1YI0A 2VRBA 3VOSA 2JI4A 4GP6A 1UK9A 4IHAA 3BPSA 4MS1B 3T4PA 2R2GA 3VKHA 4ETIA 2R66A 2VP5A 4RWZA 3EFEA 3ENNA 4AJJA 1TMYA 3AEYA 3H2JA 4JLAA 1DP4A 4K86A 1U8ZA 2MSWA 2P5YA 5H70A 3OHPA 2GEFA 2B8WA 2JI8A 5B55A 3L02A 5DBGA 4NDNE 4Z9XA 4WGGA 5K8CA 2QY9A 3BRQA 2IVZA 3CE9A 4PRKA 1TX4B 4BMOB 1LSJA 2CV2A 3ROPA 1DAGA 2EFEB 3I5MA 2YVKA 1UZMA 1FYWA 3W1EA 3WYAA 2BUAA 3NVAA 2DWUA 4GSLA 5T8KA 4BJ5A 2QTVA 1KI6A 1HDOA 1CR2A 3ACBA 3VR1A 3OE7A 2JH3A 2QG6A 2NZ2A 3PUHA 2HA6A 5HJ2A 1HE8B 2DBVO 2WYUA 4LWPA 4BNIA 3P2MA 4CU2A 4EJ0A 3RS4A 1AKNA 2QX8A 4EYGA 4DE5A 3WLJA 3AM5A 3SWWA 4YXWD 1FX0A 5D3MB 1M7GA 2VXYA 4TM7A 1RP1A 3E3OA 4URFA 4WRRA 1GNPA 2HSWA 4TMKA 4F4FA 5BUZA 4QULA 3WFJA 4J94A 4LHXA 3E8MA 2RK4A 1J39A 2FMTA 3VR6A 3VJKA 1ZH0A 4Z0PA 2QPOA 1CJTC 4NARA 1Q95A 2XMRA 4GG1A 4Z54A 3QWAA 4C0AC 1U3UA 3HA2A 3QFHA 1Z82A 3J80A 2IBTA 1PD0A 2Q3MA 4JT4A 1K7XB 2JFZA 1ENYA 1DO0A 3SC4A 1Q7RA 4GFDA 3I2GA 5IU6A 3QF4B 1PCXA 4DCNA 4XFJA 4AKTA 4A82A 2XKBA 4Q7LA 1IDN1 3CTPA 1SH7A 4RHXA 3RLFA 3W2TA 4DCPA 2DR2A 4OGWA 1LTHR 3PICA 4JA0A 1XVUA 1NVBA 3RYFA 5AW1A 4A0RA 1OF1A 4DV1B 4E5SA 4BU0A 1ORHA 1ZL2A 1NLYA 1ZISA 1L0BA 1UC8A 1ZINA 1E1MA 4YREA 4ARUA 1IQPA 4WKBA 1GKLA 4EG3A 3M4NA 3II6X 5KUTA 4OI2A 1LB1B 3CCBA 2CL0X 5FBHA 5KTSA 1JEYB 3AVXA 2VPXA 4U00A 4UTOA 1GRVA 1B2LA 3OFND 1CUEA 1MOQA 2XQIA 2QAGC 1SU8A 2CW5A 4CNBA 1E2HA 2BCEA 1LY1A 2BSXA 2H5LA 3OZDA 3N3BC 4U2KA 1WTAA 3TM4A 1MO3A 3EVDA 4MVXA 4Q5IA 3SPXA 4Z49A 1H69A 3U4CA 1Y9ZA 1WU8A 1XDSA 4RIGA 3WJ2A 2OYSA 4GOLD 1XMQB 4PLTA 5E1BA 4LQDA 3TOXA 2VSNA 4TSFA 1KF0A 3D8HA 1W88A 3BKWA 3OKCA 4AMBA 1O0BA 1AA9A 2NZYA 5I5EA 1YOBA 1Y4ZA 1NM5C 5HRAA 4CG3A 4REQA 2ZR7A 4QREA 5FWYA 1DRKA 2DFVA 1WDTA 3E5RA 5IC5A 4J0DA 1YJQA 3K1AB 2XBMA 4UPDA 3QKSA 5L6MB 3C1UA 7AT1A 1ZNXA 2NV6A 3HY4A 1SZPA 3QYJA 4M8LA 3K72B 1COWD 2O1XA 1WR8A 4M38A 4OYYA 4NDZA 4RKWA 3QVGB 2ISSD 5BSMA 2ATCA 1ISJA 3RFCA 3HK2A 1TK3A 3ER8A 3H13A 1JLRA 2XVXA 5A4AA 4PO1A 4C14A 1E2KA 1V9LA 1THTA 5CB4F 1F2TB 4DLVA 5JYEA 2YDYA 2XUGA 1KXJA 2JGAA 3IHTA 3TIGA 1JQBA 3B89A 1H6AA 3FOWA 4L9AA 4BB9A 1JVBA 5D6OA 1T9GR 4FNOA 4YMIA 2R5NA 3TD6A 3B1JA 1O95C 4FFOA 1B6GA 3EAQA 3DZIA 2J4DA 1T4GA 3OX4A 4HWKA 4PZPA 1FQOA 3L1HA 2ZRHA 1BH2A 4OJQA 3CIFA 3AETB 2A3RA 2R6AA 1TGVA 3HCNA 4WXHA 5DM70 4WASA 1FCJA 4LZZA 1E7SA 3ND7A 4KTTE 2DT5A 3C3CA 1AS0A 2FW1A 1AHHA 3HGMA 2ORIA 4AB1A 2H4JA 1JTFA 3DFIA 4Z53A 2CFIA 1ZEMA 2Y0CA 2VNJA 2FMHA 5KYYA 1RBYA 2EERA 2BFFB 5CT5A 3LO8A 3MJSA 3H4VA 1A5BB 2W58A 2ZYWX 1R0WA 3BBPA 3BD9A 4ZQHA 2RC5A 4KO8A 3KVOA 1H2AS 3NALA 3IOYA 4N7BA 5EMLA 5CDGA 2NU9A 2IUYA 3NDPA 4LS3A 5LR6A 3E70C 4XJXA 4A6XA 4FVTA 3N75A 4H35A 4N40A 2HOQA 3WQBA 4URXR 4DQDA 3FUXA 1MQAA 3JQ7B 4AG3A 2OBXA 1GILA 3WRWA 4M0UA 4AZSA 3IPCA 3PQ6A 4OU5A 5JNTA 2HBQA 3ZZTA 1P0FA 3A27A 4RU1A 5KHLB 1RZRA 4OHBA 4DJ5X 1MAWA 3VSDA 2Q28A 4I55B 4LNHA 4XR4A 3CTMA 1U0LA 4J4BA 1R6XA 3MT7A 1RABA 3C3YA 2A30A 4KNYA 2C2WA 1IWBB 2HK6A 4TZKA 2C4WA 2Q5QA 1OH5A 1HDYA 1P73A 4EATA 3LUHA 1GQFA 3I9FA 5A0FA 2O5VA 4A10A 4CF3A 1IHOA 2ZUCA 4HH3C 4IJ6A 3BH0A 4RPLA 1VTKA 5GM1A 1YFLA 2HMTA 4HAXA 1ELOA 1MR3F 4TS9A 4I5IA 5G2OA 5SZHB 2EKDA 4GEKA 2ZG6A 2E37A 5EWJA 3ZU6A 3GUVA 2BH2A 2F9LA 1Y8QA 3FLMA 2BDUA 4JZKA 1PI3A 1F20A 2XR1A 4WKPA 1YZKA 2WMOB 5E6UB 2VS1A 2XX3A 1PFYA 2IPXA 3EQZA 4G25A 3HU3A 5KHAA 1GITA 1XXHB 4TN1A 2DH5A 3MHPA 3NKVA 4FM9A 1HRDA 5LYJF 3O95A 3P2KA 3RF6A 4PHHA 1ZGCA 3G8CA 2PS3A 2J9YB 4AM8A 4CCYB 3O4VA 2F8SA 3H8WA 4AICA 3DMHA 3G79A 3GA0A 1XXLA 3TRKA 2XXAA 1K8QA 2Q5FA 2WZDA 3PA6A 4D4MA 5K0SA 2MYUA 2D59A 3CSUA 4LKOA 1C7RA 1H23A 1WM1A 4EB3A 4YJFB 1W36D 1XOIA 3VDRA 2Y77A 3VZPA 5JS1A 5ALHA 5JVDA 3E8SA 3KS9A 5E2BA 5HKOA 1S2IA 2CWDA 5J4VA 1NATA 2CN1A 1XZFA 2VF5X 3MJEA 4D9CA 4YAGA 3NOOA 1RE0A 1WRBA 1Y5NA 2YOHA 3FVWA 1KSHA 5E8JA 3RNOA 2UUPA 2XTAA 5IXJA 2EIXA 1UODA 4LQLA 3F7MA 2JAXA 3SZOA 1A9PA 1MB0A 1VBMA 3CX8A 3WK7A 4OBWA 4H0CA 3M1IA 3CGWA 3CSDA 2B0CA 2QQGA 1T8TA 4EO7A 5F5LA 1P5HA 1M75A 1SO8A 2X9LA 4BASA 1JQDA 4S1TA 1ECGA 2Y93A 1QE3A 3PUZA 1UQUA 2OORA 5KVAA 4AJ9A 1YS2X 4ZN6A 3OU7A 3W9SA 4DIKA 5A2GA 2QU7A 4MKHA 3FHTA 3F8TA 3RKSA 2Y71A 1TXGA 4B4KA 4JJAA 2D4AA 5CNKA 5AHRA 3N2ZB 4PY2A 3DDNA 1EDDA 4K87A 3SQDA 3VHLB 2PE5A 4HWPA 3QBEA 1PT7A 2VPZA 5J47A 3E9QA 2LCQA 1WZEA 2ETXA 4TTTS 3DC7A 1AQLA 2GCPA 2RG7A 3FWHA 1XV5A 1YQEA 2JI9A 5J2TA 5IFLA 2QZ4A 1NFQA 2WWXA 3NAZA 5H3HA 3TLYA 3MQ2A 2AI3A 2JKYA 5CD1A 3C85A 4OFZA 2MSNA 1IY2A 4MTLA 3RUAA 2H17A 2QLNA 4ER7A 3K6KA 2ADOA 1YWGO 2N47A 1U94A 2AEEA 1PQ4A 5KVSA 1C1DB 2QL5A 1M74A 2BCJQ 2XTMA 4HATA 1ACMA 4YN3A 3WLHA 1VJTA 3ZHSA 3KLNA 4RORA 1EGHA 2H1SA 1UMDA 1N6KA 1WMEA 3I6MA 2CFTA 4OP1A 1FS4A 4QBKA 4QFBA 4RJIA 3OIDA 1J9GA 5ENZA 3N8GA 5KX5B 4HDOB 4N48A 2X9VA 1EFPA 5AI6A 2BFOA 3FTQA 4B6OA 4B73A 1KO8A 2QS9A 4KSYA 1XNHA 3B48A 2DMRA 1CUBA 3GLKA 1RQ2A 2QM8A 4G0PA 5LP6F 2SCUA 4JT9A 4BO9A 4JLBA 2UYCA 2V74B 4I99A 4Z4GA 5ILOA 3HN6A 1XQYA 1PWHA 3M6WA 4MHOA 1K4MA 2Y68A 2B61A 5F7ZA 4GSYA 5BW6B 3KKQA 1WHTA 4Q7MB 2EBFX 3EGDA 5ADWA 4S2EA 1NVEA 1C7ZA 5C4GB 1SRRA 2ZB8A 3PD0A 4MA5A 3KVVA 1FNMA 4H7FA 4F5ZA 3VDNB 1TVCA 3O8OB 2FF7A 3GRCA 3OPMA 5CHYA 3TQFA 4EHKA 4BUJA 1M83A 3EB9A 3MMSA 1EWRA 3ITNA 3NGLA 1QGZA 5DN6A 4DMGA 4DPLA 3NHRA 3W5DA 3NTUA 1Q0SA 2I2DA 2NUPA 2ONZA 5CVVA 3KL2A 4P1ZA 3U26A 1J8DA 1VCIA 5BORA 1KJIA 4HOYA 3VPAA 2XMQA 4ZGGA 1AHPA 2I78A 2R60A 4YMHA 4DUYB 2PL9A 2FCRA 2H06A 3KCQA 1GT91 2IHKA 3SC2B 4A2QA 4DLRA 2V5AA 1N1DA 3OEEA 2V9PA 3EF3A 4DS3A 2ZRNA 3PX2A 4KBFA 3KTAB 4E5YA 4C3OB 2NT4A 1PZGA 4DPMA 3NCTA 1USKA 3Q12A 5HZMA 2F6RA 4UM8B 3VR4A 1YOVA 4QYIA 3NRCA 3BMQA 4ASUA 2IYLD 5TGDA 2GESA 3HEAA 3F49S 3ZY5A 2B82A 1M3SA 1WMAA 4BLOA 4J0EA 2FZCA 3PUKA 3CUKA 4MH0R 5KU1A 1JJ7A 1T0BA 1XVAA 2CLEB 3GJQA 3QVUA 4YP0A 4DWOA 2XE6A 1DEAA 3UJ3X 3IHWA 3B5EA 5G02A 1KFEB 2Q62A 3WNZA 4EQ6B 3KL4A 3OTQA 1NMYA 3OPYA 1D2RA 1M7HA 3BD6A 2R68A 1W29A 4L8FA 1ONBA 4KVAA 2R5WA 3AUJB 3ZLUA 4HQLA 5GJVC 4K6KA 1GJRA 5EINA 1SEPA 3N58A 1VG0B 4N18A 3BSFA 2V7VA 1AQIA 3R09A 4GHWA 5MFZA 1FFHA 3ZHBA 3PD1A 1GQRA 1L7BA 1JHPA 1VQ1A 3F1LA 4G67A 2Y0EA 3DLTA 4Y7CA 3SKYA 3DXZA 5FV4A 1P2UA 4N7JA 4TRMA 5BYJA 5TB5A 4Z51A 4G5XA 4BN5A 3F78A 4TYWA 4U9IS 4WXYB 1ISGA 1XRMA 3UA3A 1U0GA 3RTBA 4NCAA 3A28A 3TVDA 1ZWKA 1SAYA 1XKLA 4Z2YA 7MHTA 3PR1A 1EJBA 1QDUA 2SKDA 1Y1TA 3BT7A 2HT1A 1JDSA 1Z73A 5ER6A 5B5SA 4WY8A 3UT5A 5LVAA 3HADA 3E84A 1LD3A 3JAMA 3BIXA 3DJYA 3ICOA 3HSKA 4E08A 1R50A 4CQJA 2ZJZA 1S96A 5F77A 4MP8A 4WNIA 4E7PA 1HX7A 4UHJA 5EWLB 5H9WA 1J90A 4DBVO 3PGKA 1JQ5A 4R5MA 1KMHA 4JUCA 1ENOA 2FPPA 4BTEA 1JGTA 1PUXA 5BT8A 1CCWA 4CODB 5I7UA 1V5FA 2L2QA 3D8SA 3H2BA 1JB9A 4YRQA 2X6RA 3F46A 4EHNA 5AW2A 5F7OA 1OWPA 2QJRA 3A05A 2I3DA 1N1MA 1ZUIA 3R6GA 5JATA 2H0AA 3SBXA 3CX7A 3IQGX 3I09A 3SZUA 4JELA 1NBMA 3VKWA 2AJLI 3IHKA 2CVOA 2JIDA 4ZI7F 4OPMA 3A6LA 2YHBA 1BCRB 4OHWA 4XAQA 5I47A 3HYTA 1E6LA 3UMYA 4ZHQB 4HVLA 1HY3A 2QK4A 1APBA 3OQIA 4AX4A 3H0EA 4ISBA 1R6BX 3QH4A 1DWUA 2WSSD 4OQLA 4XUEA 3ZJ5A 3CJRA 4IDAA 4BV8A 4EO9A 4D3FA 3ZD8A 5A3RA 4RTRA 4GYKA 1A5AB 4NMWA 3NORA 2FEKA 3M34A 3OF2A 1DEXA 1M1NA 1ADGA 4BE4A 1QV7A 2QV0A 2ZRIA 1IZ7A 3A4NA 4GGPA 4HWGA 3VFDA 5I7WA 1TAUA 2Z3VA 4MEJA 4Q4AB 1OBOA 1P2VA 1VXOA 3BXGA 4DIBA 3KFXA 4IRUB 3V6LA 2DAPA 5L51A 3OTHA 4MDHA 2NACA 1ZVKA 5EFOA 1IOWA 4ZEXA 3X44A 1MFPA 1PNVA 4C05A 2O59A 3CG0A 4MUFA 2ECFA 4Q47A 4PFJA 4AKIA 1YS7A 1P2SA 1XEXB 2DCMA 2QAIA 4MS1A 1YQ9A 4F2GA 1J2YA 2JA2A 4JQOA 2VVTA 4AJ4A 2BRUC 2HY7A 2X6TA 3RG2A 3N8DA 2FE1A 4EJMA 1LW6E 2QT0A 5LD2B 3HRIA 3ZDCA 2KQUA 2L19A 3C6MA 3EQ2A 4DSTA 1UM9B 4PYOA 1C7FA 4Z3OA 1SBNE 2C1EA 2PTHA 4E3WA 4G6ZA 2A6PA 1UIMA 3JZFA 4L8VA 2N75A 1L8OA 1G64A 1IBMB 2Y2VA 1IEXA 1F6DA 5B1YA 4B83A 5IDWA 5HQTA 1QKKA 4G86A 1DAEA 2Z6AA 1NN5A 1HF3A 2VDPB 3JWJA 3CO5A 3ZWNA 1K0UA 1YZQA 2B5VA 2QAGB 2QVGA 3ILXA 2QTWB 3LO5A 1Z4QA 3PUXA 1X87A 4N5IX 3BX1A 1VHQA 5AIBA 2JAOA 1XTZA 4HLCA 2Q7DA 1EEXB 1Q6ZA 1AZSC 2BFWA 2NT3A 1C8KA 4JVOA 3ZS8A 2FHSA 4KPUB 4XUDA 3TK1A 3WL8A 4TT8A 3PFBA 1H5NA 1DQRA 1H4SA 2XWQA 2NSYA 1DXHA 2I3BA 5K3DA 3HCDA 1RMYA 2D2XA 3W6OA 1RKXA 5HTKA 2X14A 3IIKA 4CF5A 3UOGA 1CV2A 4MO9A 1ZN8A 3CLVA 4OXRA 3LL7A 3CQ9A 4KACA 4NWIA 5D3MA 4WACA 1PUIA 3BWCA 5EGSA 4BPBA 3PFGA 4WNAB 1GZDA 4IAOA 3PGJA 1TE2A 4N0QA 3EDQA 2FW9A 5L3SB 1J4AA 1Z26A 4M88A 4QFDA 4R6WA 4H7HA 4DV2B 2F1RA 1T0IA 1G20E 4JB8A 1MO2A 1Z4MA 5FTWA 3QXHA 5JDCC 1SCDA 2IV2X 4KR2A 1OFIA 2R84A 1UT5A 4PLYA 3ZE9A 5EJ5A 3BDVA 4NULA 2VYVD 4PX3A 4AMVA 2VTDA 3DO8A 3VVMA 3QF4A 3T7RA 3EEYA 4ALIA 4BIIA 4XLTA 1FJHA 2WHXA 1JFRA 1ULTA 3A58B 3MTQA 2VBFA 3FROA 1J7JA 1M2KA 2EG9A 5EJ2A 2W2OA 5KAPA 2OAEA 2R6HA 4AVYA 4QU0A 4D46A 4LJSA 1NFRA 5JD4A 2G0TA 2HDHA 1I51A 3T9BA 3BWXA 4IHJB 1NJ5A 3AUFA 4FYMA 5DNEA 4NG5A 4O4HB 2I91A 1DG9A 3H19A 4R05A 1GUDA 1W5FA 3LLCA 4IIDA 4BMCA 2H9IA 4C5AA 2QEQA 1JEYA 4MLCA 5C8YB 5DU2A 2Z4RA 4BPRA 1H2RS 1LZKA 2DR3A 2EARA 4R2KA 1RKQA 4RENA 4YJHB 1VI2A 4Q1VA 4U5QA 2O2ZA 5T4EA 3H5TA 2VG8A 2XMZA 3THOA 3GXBA 3IP5A 3U3DA 4BVBA 1OZHA 1T9GS 1LGYA 4XSHA 1XBTA 4UOZA 3B1FA 2JFPA 3IBYA 1Z0ZA 2PK3A 1AGXA 1TIPA 4KXFB 4MVJI 1E2FA 5J40A 1KQOA 1MW9X 1IQUA 3O2NA 2Q8QA 3IP8A 4B2LA 2QG4A 4YWJA 1Z6TA 3P27A 3SGLA 1PS0A 1JALA 2OZLB 3K1AA 3OFKA 5I7RA 2IP4A 1WQ1R 3W3AA 3C97A 1S7GA 4DMHA 5K5EA 3WQSB 3QVGA 3NTLA 2G28A 1H65A 1Q12A 2DSTA 3T3HA 2DC1A 1YMQA 1E9FA 2D13A 2YXEA 5ICFA 5TMDA 2QTMA 2KW5A 1F2TA 1N2OA 4GI5A 1XMVA 4IYJA 4JUFA 5DTIA 1T9CA 5ESWA 1E9CA 3L3BA 1B16A 3EH1A 2PT9A 2P3LA 1P9NA 4NBKA 1EDOA 3LT5A 1VKJA 2IPNA 5IARA 4D25A 4L72A 4UVHA 3M9LA 2CMDA 1DCMA 2PGNA 2O2CA 1D4AA 3KUKA 3LFUA 3QHPA 1RWXA 3AETA 5DI3B 5IEBA 4UD6A 3K1JA 3W8NA 3GNQA 4Z5XA 5JWRA 3PEYA 1MFZA 1NWHA 4UU8A 4ZT7A 3GBVA 4D26A 1KZYC 1K6IA 3IGFA 2HCFA 1YCDA 1PEAA 1QH1B 1D4OA 3LBHA 3KD2A 2BFFA 4OJTA 3ZE8A 4NZYA 2JCGA 2QGFA 4P2BA 1Z5ZA 1E98A 1W85B 2PT6A 4TL6A 3NFYA 4HYTA 4Z9AA 3RU7A 2BGGA 1XQWA 1X7YB 1S89A 4IMRA 4WWHA 5JS6A 4UMEA 2JIQA 1JWBB 2IL1A 4R1PA 2ZVPX 4V38A 5KDDA 3BWDD 2VTBB 3OE7D 1FDTA 5CDYA 4G0VA 1KL7A 3H9CA 3R41A 1K08A 5IWCA 3JQ7A 4NNOA 2XIJA 3CZ4A 4WSOA 1M1YB 1RTTA 2C77A 1USIA 4IIJF 3HU5A 4Q9JA 2ST1A 5FLEX 4TYQA 4ZYLA 1DG3A 5FI5A 4I55A 3TCXB 2PSDA 2W43A 1A5ZA 1PW5A 4QUJA 1ISRA 4GVXA 4A26A 4RTPA 1XT6A 2EV9A 2FVYA 1WKBA 5BR8B 3PK0A 5HWSA 1XMJA 1RLOA 3SF0A 3VR6D 4W5QA 4BO7A 1KEPA 4NEQA 4GPIB 1OVGA 5JARA 1DAKA 1AXGA 1XJWA 4LQ4A 3CR3C 3I8XA 5CLGA 4P3KA 3KKEA 2BELA 4PBRA 2F2TA 1QYCA 1AZLA 2EFGA 2OESA 2ZWAA 3SYMA 4DMRA 3OI7A 2QWXA 2VOJA 5JCPA 3UAGA 3EIHA 1BVUA 1VL0A 2FQQA 1MH1A 4OFBA 2IQ5A 3HJCA 4F2PA 3A14A 3A4LA 4KKVA 1JBKA 5E6UA 5J5VA 5HIAA 1H9AA 1UBUS 3C3MA 4CGZA 1XXHA 5M04A 1P4GA 3H6KA 1W0CA 5A0TA 2Q5JA 2R9VA 3B5IA 2MDTA 3Q41A 3S2ZA 1QOQB 2H18A 5E9JA 4BRZA 1OAOA 4MGHA 3SHOA 4E5PA 3CLTC 2WPNA 1R0KA 1YFKA 1UC5B 4LJYA 4QGGA 2BTOA 1NXVA 4WESB 3ZIDA 3PE4A 4DMLA 4ZTZB 4D97A 1IHPA 4O2BF 2JGRA 5KQPA 1CS0B 1XU7A 4LRQA 3H1EA 3ZXUB 3L4SO 4PG4A 1LPNA 4ZU3A 4B33A 1QWSA 4MGEA 4YJFA 2ZT5A 3EEIA 3EVTA 4UTVA 2FOIA 2QQFA 3ZWBA 2WEKA 4ENVA 2OV8A 3U5ZB 4RUKA 3HJTA 4YR9A 3Q1KA 4L8WB 5F7XA 1AM4D 1XLTC 3SYTA 4LZOA 4TSFD 4L28A 3VAYA 4CUKA 2YZGA 3P9QA 3R3UA 1TEHA 3C43A 4FGSA 3TVTA 2AJDA 1PZFA 3UJAA 4LF9B 3ON5A 2OD2A 5T3UA 2APJA 5JNRA 1QVAA 2H0RA 4UU0A 3LW7A 3BGDA 4X54A 2NU6B 3IDSA 1Q0LA 2JA1A 5LP6C 3UV3A 1QYRA 1SBQA 5A4DA 4AJHA 1TQ8A 2HA7A 2WP8J 1TKBA 2I6SA 2OSVA 2AQHA 1VSQA 4KVGA 5DWQA 1A04A 1N2XA 3FMIA 3H04A 2YWRA 3TPCA 3PNBA 4LOKA 3SVZA 2HZBA 1IM8A 4HQOA 3R3XA 2F7SA 2PS9A 1IULA 3GNTA 4UHHA 4WLUA 3GOQA 3PC8A 4MVJA 4XQEA 4CLRB 4ZVQA 3N8HA 2V1UA 3T3OA 4WT7A 1XJQA 4F7DA 3QX3A 4R2JA 1TUBB 4H18A 4HO1X 1Y34E 3IR7A 1KMIY 4N03A 2FUCA 2CJXA 4IDHA 4U39A 3UICA 1P1KA 2CVPA 1PLKA 5AP9A 3KNZA 3LRXA 3PFFA 4ZI5A 3TSOA 4I3FA 5D00A 4E1AA 5DGTA 2X9GA 1JX6A 3GJ5A 4C6HA 4GBMA 3NYQA 3GF4A 4XX0B 1NBOA 4OG2A 4JEHA 4BFUA 2D0DA 3C5VA 3CH6A 3SE0A 2BISA 4K03A 5EFZA 4U3JB 5KQLA 1SC9A 2MIIA 3OFVA 4QM6A 2DJIA 1C1DA 2Z57A 1HV8A 4MV1A 4FFBB 4P08A 3TZBA 3PUJA 4EG7A 1WVGA 5SZIA 1N0HA 1HZZA 4LJAA 1E69A 3UG6A 2A9PA 1CULC 5KX5A 1EJ6A 5LPNA 1PIWA 2AMJA 4MKRA 1JKFA 1WXIA 2WP0A 3KXKA 2HWYA 3I9LA 4UM9D 4MEBA 1AK1A 3U1TA 4M1TA 3C15C 3T15A 1WDLA 3LX8A 3F4KA 3QX7A 2C5SA 1W4RA 1MW8X 3FN4A 4V0OA 4B3CA 4GUAA 4DCOA 1K5HA 3H18A 1WXXA 1O94C 4G9BA 2WNSA 3GW8A 2BI8A 4NICA 4RABA 3F6EX 4XWKA 5I7FA 1AXRA 2DT8A 2I6FA 4ER6A 4ZV4A 3E23A 1RZRD 1KYWA 2V0GA 2Y1XA 1H4TA 1JE1A 3P20A 4US1R 5K09A 1L5GB 3VH4A 4PPNA 1PFUA 4J03A 2YWFA 2OG2A 1GNLA 3O8OA 4HAUA 2P9QA 2ZRPA 1IUNA 1J2TA 3T9AA 2AKYA 2DETA 3FM9A 1PD1A 3PQDA 4JNKA 1ULHA 2J07A 3JQEA 2DZDA 2IJGX 3QUQA 3AWDA 3T3PB 1SXHA 3AHFA 1NMEA 4KAJA 3S2GA 4E5KA 4ZGBA 2WWFA 3ZCTA 2DYKA 2WD7B 1QX3A 4YONB 3P4YA 3TI7A 5K0BA 3WBJA 1ZG3A 1QGAA 1CUHA 3SC2A 4JIMA 3SM3A 1VP3A 3M5DA 1G8PA 1ZC4A 2QRHA 5DLEA 3QEKA 5ED4A 4LF5B 1KJ8A 4I2VA 3KTAA 5BV2P 2A0KA 1OBFO 2L18A 4MUEA 3SS7X 2GCOB 2EFYA 3TM5A 2W6PA 5JJLA 1D04A 3ABQB 3L43A 5C51B 2C54A 5JU6A 1VPTA 1ZGZA 4YCJA 4D8TA 4MW9A 1WZ2A 3A7DA 1Z4IA 1ADYA 1HFEL 4LGCA 4WLNA 5AKJA 4C89A 3PYMA 1P17A 3QUSA 1KH2A 4TMYA 3LBIA 4L02A 2ESRA 5ALDA 5BUQA 2FZWA 1X92A 1W4BA 3FSRA 1E3EA 1O96B 4EJSB 5FLXA 4EQ6A 4C87A 1X1BA 5HOQA 5I3CA 2ZJFA 5H8WA 2WJIA 1DC7A 1JHAA 1NXTA 4HFMA 4L2IB 3WLKX 1YZ3A 2FNAA 4U7FA 3ASUA 4J29A 4KSBA 3K5HA 1KHTA 2O1EA 2DHRA 3AOGA 3BL6A 4S2UA 3EJWA 4CUJA 5KQMA 2OV3A 4K81B 4DLAA 5IMSA 3AJDA 3SR0A 4CXMA 4M1OA 1TEXA 1JR6A 1IZ8A 1FS5A 2IZ1A 3EIWA 3QE3A 4KE7A 4UASA 5IAKA 2QMHA 3CMCO 4IIHA 1KJ9A 3O9MA 5EG5A 2IYTA 2A0WA 5D6NA 1SCIA 3X1WA 3ORSA 3OY2A 4KLZA 1W4LA 1TW3A 3AR8A 1WMFA 4WOJA 3VYVA 4LJLA 3TTVA 5LQDA 4XRGA 1U5BB 3R23A 3TNYA 1LPOA 5DTMA 1Z8DA 3JPWA 3G2QA 3PC2A 5DE3A 5HUJA 4L4SA 4B6JA 4CKCB 2QUZA 4BBZA 1A9YA 4UMFA 5EWLA 3GCDA 5CGQB 3FFXA 2IRWA 3D4PA 3RS5A 3NWBA 1SVMA 1WUKS 1A2BA 2G5CA 2RIPA 3WRYC 3AFGA 4TLMB 5CT8A 5FPQA 1E77A 3LYLA 3HYSA 4HEJA 3ETCA 3G5UA 2C3OA 2OBNA 3UMVA 3WLQA 3ABSB 3GRZA 4RVNA 4CTJA 3OA0A 4QDUA 4AJ2A 3HU1A 5AICA 1BWQA 3DTVB 4UMVA 4M8SA 3STXA 1I2AA 2PSSA 1C1HA 3BE5A 5JAPA 3HVKA 4ZHQA 1S6YA 1IWOA 3D6JA 4TX1A 2QPLA 4BQIA 3QU9A 5FI1B 7REQB 2ZUFA 1V2GA 3K1ZA 3IAEA 1KGSA 4YP5A 1C30B 2BFNA 2CDRA 4R9UC 4B76A 3CLSC 1UBFA 2CFRA 4P4SB 3ZGNA 4H7PA 2AR9A 4QUBA 3ZNOA 5C5EA 2B8JA 1DAOA 2UZAA 1DWQA 4Q4AA 2ZUTA 5DCYA 4Q6WA 4BQEA 2X15A 1DSSG 4B3MB 3P9CA 3NM5A 3PX3A 4ZTUB 3IBFA 4B9EA 2RBGA 1XEXA 2IIVA 3PXCX 4WGFA 3TAHA 4AL4A 4C30A 1MZPA 2GEKA 3A0UA 4AJKA 1E1KA 3PHHA 1XLUA 2PVCA 1UAGA 1XIVA 4BGDA 4N65A 1GG5A 1PNTA 4G3XA 2HB6A 1UM9A 2EVWX 2VSYA 3KQMA 5DN6D 2VAMA 1J23A 1Y3FE 3L0SA 1WULS 2Z95A 1XRRA 4PZUA 1SKQA 3ZN2A 2PZBA 1KEEB 1ZQ1A 2PQ0A 2Z4SA 2QSYA 2VEDA 4P80A 3W06A 1QPGA 2ZAMA 4CTOA 1G60A 4FYXA 4ZAVA 5JZSA 1VYTA 2QAGA 4YUZA 2PGDA 3ADBA 3OEED 1A9XB 4XWGA 3VNAA 2D7CA 3BF8A 4YDRA 3GBSA 3EA0A 2GGSA 3OA2A 4KPUA 3ZYCA 1BH6A 5EQDA 1GGHA 1K8ZB 1FUKA 1V47A 3AC0A 3RO7A 3AX6A 4MLZA 3VR4D 5BWLA 3WMFA 4ASUD 2HV8A 4NOMA 3AV0B 4JN6B 4RIHA 2XUFA 4LRYA 2HADA 2BC9A 2BIFA 2VF2A 2QVCA 3GLRA 3JRXA 3KV3O 4LV5B 5TJHA 2NUAB 1A9TA 1Y0BA 2FQWA 3V1LA 1LA2A 1T4BA 2J7KA 3I6QA 1H2FA 3ENWA 3PC6A 4Q16A 3OUZA 4U7PB 4WNAA 4CUZA 5C80A 3O6VA 3GYBA 4JL5A 4ZAGA 4E33A 1P4AA 5L3SA 5HYVA 3KBBA 4DIUA 1GGNA 1QS0B 2CK3A 3C4QA 4I4LA 4WLFA 3IVMA 1C29B 5C1BA 2QPTA 1JLSA 1JYEA 5E4TA 5BYBA 1EK1A 4I9UA 4QQFA 5D1NA 1JHZA 5ERYA 3DXFA 4EZEA 1GUZA 4TT3A 2VC2B 1TYZA 2F64A 2OCGA 4FR2A 5AW7A 3C5WP 2W5UA 3QY9A 1J97A 2ARKA 3WLOA 1IHYA 2HXSA 4ZCQA 3KEOA 4RVHA 2Z5VA 4K9OA 4L4UA 4XSVA 5EHXA 1O95A 1SKAA 2ZSUA 3NM4A 4RKFA 4TL8A 3UPDA 1XVIA 1DHTA 1ZGJA 4MGKR 3GLFB 2DWPA 2YS6A 4KHPB 1JUDA 3ESXA 3WAGA 3NWOA 3ZI0A 4IHJA 1PAUA 1QRDA 2NWQA 2W6NA 3OPQA 4R9SA 4KPYA 3EFHA 2PBLA 3KXPA 4COKA 1Y81A 3L0CA 3MRXA 2C96A 3H9EO 1N5LA 1QZUA 2FR1A 4HTAA 4DSNA 1RWQA 5C8YA 4Y30A 4KWHA 4CMGA 2EDCA 5B7QA 1YZFA 4JQCA 1CF4A 4PC3A 3P9KA 4A2WA 4CL0A 1Q2UA 4P5EA 3ASVA 4YJHA 4Z7JA 1TTHA 5JCXA 3K71B 4P0QB 4PE5B 3RFXA 1CY2A 1BSVA 3QLVC 4RLHA 2WB2A 1OFTA 3PGVA 4UVIA 3T1QA 2CVHA 2EP8A 2CMGA 2FPKA 1NN0A 2H31A 5BXYA 4YCDA 1LRLA 3IOEA 2Y05A 4EZIA 1L5VA 3GAAA 4Y2QA 4B4DA 5JSHA 3AW9A 5DW0A 3GFFA 4QGBA 1T10A 2CXPA 4JUDX 5J4LA 1GPAA 4DOMA 1UJNA 2P0AA 3VC2A 3EZ9A 3GP3A 3DV0B 1TPYA 4DLZA 4HDRB 2WNIA 3AF5A 4ALMA 2YV3A 4Z9FA 5KBYA 1NBMD 2XD9A 2PXAA 3TKAA 2OZLA 2PN1A 4BXOB 4G0QA 2IIQA 4W6QA 2Q9CA 3W8EA 5C7YA 1II0A 4WPGA 2QOEA 3AVPA 4KYTA 3SZRA 1KE2A 3L82B 4QVKA 2CUTA 3NFRA 1RT9A 1W46A 2G3YA 2OFWA 2QXUA 3LE8A 6REQB 2Y27A 1ZWLA 3WV4A 4W82A 3EIOA 1VGQA 3A6DA 3DLAA 1D6SA 3TTSA 3A6EA 1V71A 5E8RA 3NHAA 4NQZA 4MRSA 2AZXA 2NXCA 1N75A 2A8YA 3CKKA 2WKPA 3NNSA 1EFLA 1CVLA 3IAXA 5FPTA 3WVNA 5JDIC 2CLLB 2XB6A 1XN4A 4Y9TA 2I34A 2VL7A 3LDFA 2O14A 2A0UA 2AG5A 5DI3A 3DBOB 4YRZA 3DWFA 5JD5A 1W19A 1U4NA 4WH0A 2FZ5A 3OKPA 2FYTA 5GWXA 5CT9A 1E18A 3ZLTA 3LLUA 3VKFA 4HAZA 2Q9AA 3OQPA 4RK6A 1J22A 1QE0A 2V4ZA 1QH1A 2VJKA 3HJBA 3TX2A 4DSOA 5CBPB 2AD5A 1SUIA 2NO7A 2FEAA 4ZVSA 4WECA 2P1DA 2Q1SA 2M6LA 5IJWA 2PKXA 5EN4A 3N0VA 1W85A 3DOOA 4L4RA 3S2FA 1KRXA 1JILA 2ZP1A 1X7YA 2GPJA 2ZJ5A 5EUQB 1P6UA 5EXXA 3VZRA 4MA4A 2WA2A 5JS7A 4E70A 2QX7A 3L6RA 3X1JA 2VTBA 3KU1A 1GQQA 1UJBA 2PJUA 1SQ6A 3WO0A 4EJSA 3FPEA 2PD4A 2C5AA 4QUIA 1M1YA 3VISA 3ROXA 3NUZA 4KEAA 3ZDXB 1SHZA 2GEBA 5CFLA 5JYBA 1U0BB 1ZR4A 1EAMA 4BWYA 3KYBA 4IGFA 1UQTA 5B7GA 4ND3A 5AKLA 4CHGA 4M8NE 3IUEA 3BQMB 5L3VA 1Z4OA 2HRQA 2Q9UA 2QR3A 4GOXA 4KK3A 3SMQA 5LP6B 2YIJA 1GYPA 4R3WA 4RHYA 4G26A 3R5TA 1E0DA 1KYVA 1XZBA 2JNWA 3LC1O 3MMXA 4KXVA 5B30A 4Q01A 1H42A 3ZE7A 2CGEA 5EPOA 4K1XA 3I6BA 2JHCA 4RH1A 2HLNA 1UDXA 2CF5A 4B9AA 3BTVA 3O8NA 4G9EA 4IR7A 3TXXA 2PS1A 1HBJA 4JEMA 3LCUA 1GFZA 3EDYA 1NF2A 3KZCA 4O33A 4TTPA 1CUVA 3I9MA 1U0FA 1L4MA 1CLEA 4LGVA 2SKCA 4WK4B 1VLMA 1U2EA 4YMLA 3B1VA 3NETA 1E7RA 1TFUA 4O2LA 4UDNA 4F1WA 5FTLA 4D82A 5IJ9A 3UNXA 5BYKA 1I7NA 4WESA 2IYOA 1DT5A 5LQMA 5ARCA 3B6MA 3L6EA 1CS0A 4QEKA 4F11A 2QL6A 4MB0A 1BN6A 5EHNA 1T8PA 1N3LA 5AXBA 3OO1A 3IPRA 4BEJA 3IOCA 4KITB 4I46A 4RF5A 1SHLA 1F6WA 3K7EA 4OM8A 2IYPA 1CZHA 3UC5A 4JI3B 4UXJA 1SBIA 3VMFA 3BFVA 2DM6A 4O02B 5B4VA 2PXXA 1PR9A 1QBGA 2ZPTX 4EB0A 3PC3A 1AUVA 4PC6A 2XB9A 3G8DA 4OAQA 4Q4CA 1FJXA 3LJKA 1HYGA 4F6RB 1YIAA 2PHZA 5JR3A 4FIZA 1N2EA 2NU6A 2QMUA 4BQQA 1V9CA 4MMZB 3W3AD 3BRSA 4JBLA 1JIVA 1GO2A 1EGAA 5AI9A 3NBAA 5CW1A 4BJ3A 4OYRA 5KB3A 2QT1A 4RQAA 3FKJA 4UUAA 3TI9A 4S1NA 1XDBA 4EH1A 2E1RA 3DAFA 1MA3A 1YGYA 1YJCA 1OFUA 5L4LA 1A7UA 1VKHA 4CLRA 2XZTA 3Q8XB 3GJYA 1JEDA 1JU9A 1VLJA 2FGKA 4BX3A 1EWQA 4QQ8A 3RR2A 2JGJA 4FFNA 2ZYVX 5DO9A 5AW8A 1TUBA 5BSTA 4YBRA 4D92A 1VHTA 5ICMA 3TQQA 1KDYA 1SVKA 2YS7A 4KDRA 1BDJA 3AERB 1LW7A 1Y8RB 3E3AA 3GJ3A 4GC9A 4FHGA 5M34A 4XX0A 5FYDA 2A9JA 3H86A 2RHHA 3H97A 3ZLJA 3FVQA 2GT1A 2DCUA 3FCYA 1I2BA 1N2ZA 2PT7A 3QUTA 4U3JA 2OQRA 3L1IA 5CDFE 3LIIA 3TG8A 4NQRA 3QFTA 4LXUA 3VDMA 1G7CA 2FRVA 3BE4A 3LUBA 1CRQA 4FFBA 5FB3A 5JRJA 2BGIA 1FJGB 2C83A 2P65A 1KSGA 1K66A 3P2OA 5ARDA 1ZHFA 1YRWA 5BW5A 4JUIA 4NCBA 3N8KA 4AS2A 2C5BA 2PH3A 3R7FA 2FPIB 2Y3IA 2B7LA 2XD4A 5BWMA 5F76A 1GAXA 5KWJA 1O87A 1C8LA 5D5PA 2JLXA 1G9SA 4ZI7B 5AKKA 1QGUB 1E3SA 1ANKA 4RF2A 1PKEA 2W2XA 3SQMA 4DUPA 5JNLA 4ABTA 1D8TA 1KVSA 5IYZF 2Q0HA 2ZIXB 3CC8A 4EM6A 1F7UA 3Q11A 1Q7TA 7MDHA 2WZQA 4EEKA 2HQBA 2Q1TA 2H8GA 4HQNA 3FF4A 1U0HC 4ZAZA 2E87A 1J99A 2OHJA 1ODSA 3HEBA 1R5NA 3PQ2A 1MRSA 4L8GA 4LWQA 1PR4A 1BQEA 3QSGA 3RASA 5JHGB 3KKZA 1HYEA 1NPDA 2HK9A 3ICVA 2YMLA 1RJ9B 2FDRA 4NPAA 4P4GA 4PWZA 3ZGXA 3V8NA 1A50B 3X1DA 2O5EA 1WX1A 4J43A 2O50A 5HJ7A 4IJWA 3Q8LA 3G2IA 3LGXA 3OQBA 1NG1A 2XT0A 2PWBA 3MRSA 2WD7A 4NCKA 4NU6A 4WA8A 3RS3A 5I7SA 4S05A 1V8ZA 2HIAA 3D6AA 2DJ5A 1R2QA 3O84A 3DL7A 3R8XA 1ZD5A 3BWVA 4JDUA 1D1TA 5LUAA 2YL2A 4OJNA 1W9MA 4TSRA 4BX8A 4EX7A 4H3KB 1YA8A 1TB4A 2HK8A 2W2KA 3NVMB 4JDPA 4O6VA 4FUTA 1XDWA 4C03A 2GCOA 1LBSA 4P3XA 1DRUA 4YH1A 3H9BA 2VJDA 3G2JA 4YDHB 1EA5A 1T9HA 4RK1A 4WDRA 3DSRA 2WFAA 2YW9A 3NYIA 3LDUA 2JD1A 4OX9B 2CVFA 1V45E 2AMLA 2F9MA 2QP3A 1ZD1A 2NTNA 2QRUA 2VP3A 3EZGA 3WXBA 2BEUB 3RYIB 1PZNA 1BA2A 2F90A 2IHZA 2VKQA 1O96A 1BMFA 2VSFA 2Z5GA 3K35A 4HADA 3VMMA 1MLDA 1NULA 3GJSA 3MTGA 4FQ8A 4YUAA 1Z0SA 1VMAA 4GZ6A 2J85A 3PXEA 4L2IA 2PBRA 2HRBA 4TSKA 4V2UA 4WK2B 3SE7A 3KT6A 4MMXB 5HGJA 3A8TA 3AF2A 3G0DA 1ZX1A 2J9ZB 3LKZA 4M1ZA 1Q3KA 4U8GA 1EZ4A 1QHHB 2GZ2A 3I9KA 5JCJA 2XGOA 3ZBUA 1ZHHA 1OAAA 4XOUA 3RODA 3SXUB 1OZAA 2PX2A 2AG6A 4OLHA 1P7YA 4IILA 1QIHA 3MS7A 4G09A 2ERYA 1DQPA 3L9WA 1AN9A 1PK9A 2FN9A 3Q72A 4X95A 1Z5GA 3REQB 5IUJC 1R7RA 3L1JA 3NHBA 2JW5A 5KYNA 2J3JA 4FJ0A 4X66B 3DLHA 5EMNA 3B20A 2YH2A 2AQKA 2VHEA 4E11A 1I94B 2WSBA 3KPUA 2OGUA 4X93A 2WOJA 3L6OO 4WEOA 4XJVA 3EDRA 4HJRA 4CKCA 5NLLA 5GJBA 4MVJD 3FPKA 3A26A 3FDIA 3M82A 4YAJA 5DXFA 2MCFA 4C5BA 5AVKA 4DIEA 5JY6A 3I32A 2OXRA 4A16A 1CEEA 1TD9A 3IEXA 4KYUA 4KAFA 5CA1B 1G20B 2ODAA 5LFAA 3FKSA 3OFSA 5IAGA 4KR6A 2WHEA 2HV9A 1JR3A 5KJFA 4I9HA 2I87A 2JHPA 3A10A 4V24A 4DV0B 5F2NA 1O7JA 5CXUA 3I9V1 2GJAA 5DOVA 2H7VA 1SVOA 4LY3A 2H2DA 1TJYA 2H4XA 3JWGA 3RBZA 1QB7A 4BYMA 2JK0A 3DTVA 3F9IA 1MDFA 3CRQA 3UWSA 2RBKA 3IMKA 5AVWA 3GPBA 4JAVC 1OA0A 1HQYE 4K9SA 4Y6LA 3WGYA 4AG6A 4MLDA 1SB9A 2VNSA 3CKYA 4IWNA 5JJKA 3PQFA 4JI0B 3V6MA 4RJLA 2J8ZA 3E0QA 3KJFA 7REQA 2A5DA 4JBXA 2OCDA 1E0SA 3QJGA 3T94A 1U04A 3PEEA 3UAYA 2FSVA 4AK9A 1C30A 1ADJA 1XMXA 1WNTA 3A3YA 3T3EA 4P4SA 2AG8A 3V9PA 5A1JA 2H1IA 4YR7A 2HW8A 4YQZA 5JDCA 2VQEB 1P75A 1N2JA 1JJBA 4RJTA 1P3DA 3LPLA 1H0SA 5LXTB 4KN5A 1KOLA 4Z4QA 2XUDA 5HQ3A 1UMKA 1OB2A 1U63A 1PF7E 3ONDA 4PXAA 4Z86A 4M83A 4JJEA 3WIVA 2I55A 3ABOB 1SQGA 1ECPA 1F14A 3WKBA 3PT9A 3ONVA 3KVYA 4TYYA 3I2HA 3TMAA 3UT6A 3QUCA 1K97A 2VHCA 1OZFA 4ENPA 3G2PA 3ZY2A 3JZIA 2R44A 2H7XA 2B98A 4OCZA 3OQ6A 2WR8A 4BMXA 4C4SA 3IJPA 4N9WA 1GVNB 4TLCA 3I72A 3NIDB 5I4CA 2H07A 2LNDA 3MTEA 4JXKA 3SHQA 2PO5A 1VPVA 4QVGA 4EARA 5JNUA 3OJFA 3SEZA 1HC7A 4D9HA 3CLRD 1K8YB 1KEEA 3U2QA 2I1LA 3F3YA 4AKGA 2RGAA 3PSAA 4DW8A 1JDZA 3FUUA 4GBJA 1NYRA 1S1MA 1TF2A 5CBPA 4MV6A 2UV8A 1A9XA 4BLSA 5KTRA 4RMNA 4B4WA 4OYHA 3DAHA 4ZOLF 4P3PA 4V0NA 4EBBA 1FK8A 3AXSA 3O0TA 4IICA 4BNWA 1OHHA 4D3ZA 5DEOA 4M0LA 3P71T 1P5FA 1Q21A 3C7AA 3GRUA 1AKVA 4EUSA 4K40A 1I4LD 3AK4A 4X1YB 5EVCA 1Z62A 3AKEA 4KQGA 2NUAA 3ENQA 5AHOA 5UKDA 1HGXA 2B6HA 2HXYA 3ZV5A 2HIGA 2ROQA 1R18A 5EHIA 1YCGA 2V1XA 3UBTA 3G85A 4ZTBA 4DN6A 2GBGA 3BULA 1QS0A 3I39X 4C2TA 1U7XA 5DIFA 4OU4A 2R4UA 4IIJB 4B3TB 2YYYA 5DNAA 1RI5A 4BN4A 1F3OA 2HO5A 4IXMA 2JHGA 1N7IA 3H1PA 3LY5A 4O5AA 4YRFA 4YLGA 2XCIA 1GOTA 1NIJA 4FNAA 3N3AC 4GDMA 4QRHA 5ALYA 4YRSA 5GMOA 1VG9B 1GGMA 1KRWA 3N39C 4IWYA 3GLFA 4KRFA 2AN5A 1R66A 1YCHA 4ER0A 3E4CA 3MWDB 2P67A 3PNOA 1UZAA 3WAKA 4J0CA 1JQLB 4DV6B 5KSWB 2P30A 4YDSA 4ED9A 1C3JA 1R0BA 1Z8NA 3L0YA 5KTMA 1PSWA 4JI5B 2DB3A 3HO6A 2PNJA 4Y2VA 5HFNA 2XF2A 3FD8A 1FX1A 3EVEA 4MQEB 2PPVA 1X3LA 1P7WA 3B9RA 2IWHA 4AQ7A 1HEIA 3ABRB 5AK5A 4XVUA 5K0NA 1P4HA 1RC0A 2YICA 3TL2A 3N2YA 2NO4A 4KX5A 2XNHA 4AWXA 4TLLB 4IG4A 3LP6A 4BFLA 4FGWA 2QKYA 3KOXA 1W36C 4HTFB 4FZ5A 1E8NA 3U4IA 3ND9A 3OZIA 2C9CA 1PNQA 4AU1A 5AK0A 4O2BB 1K5DA 3VR3A 3DV0A 2RGCA 2XOKA 2OGTA 3OCCA 1C14A 1Q92A 2D74A 4HDRA 5AI8A 2B6NA 3SLGA 3EZLA 3B8EA 2G9RA 4R1QA 1JA9A 3AFOA 2UXDB 3AM3A 3O8DA 2ZXEA 3WDMA 4BXOA 2H2HA 4XD7A 3IEKA 3WI7A 3QQPA 4B3JA 4AJNA 1SY7A 3ZNNA 1G8AA 1KAEA 1QM5A 3PCXA 4LYDA 3MXTA 4TTVA 1JA1A 1L7OA 2ZRAA 2HA0A 1Y89A 6REQA 4B87A 3O2QB 4FK8A 2XZPA 1OYWA 3ZHRA 3H99A 5I51A 4ZVVA 4Z0NA 4X44A 2L82A 3PGXA 1OYYA 2CE2X 4EMSA 1CSEE 4RL4A 5DVZA 3INRA 1X8XA 1J9EA 3M89A 4OHYA 4C21A 1JPUA 1AXEA 3BZUA 2R6ZA 4TMTA 3QVSA 2EQAA 4YT5A 3C3KA 2ZS8A 2DULA 4ID3A 2QN1A 4UZEA 3QW2A 4G1UC 4BWFB 2AL7A 2E4VA 4PCVA 5EJ8A 3D4BA 4MWBA 2XNJA 3T34A 3C74A 1K3UB 2VP2A 2QRKA 1IJFA 4HQFA 4WCDA 2G77B 3HR8A 3PXDA 3HJAA 1V0JA 3KFVA 1K6JA 3ORQA 1EUZA 3D3EA 1M5TA 3TBFA 2Y1FA 4AS1A 2VXCA 3ANXA 1K7YA 2LUOA 5JY1A 1U3WA 4O1HA 1J2JA 4I81A 4BS9A 3SFZA 4GKJB 4KBGA 3MVEA 5DTEA 3WYCA 5CEEA 5CFQA 3AM4A 2VT7A 4XX1A 3I05A 3D5TA 2I29A 2UZ1B 4WW0A 1G3UA 1ZH6A 1J8QA 3H0CA 4K9KA 1NVTA 3C70A 1RCUA 4GKKB 3DYIA 4DWVA 4C2AA 2WHRA 1QJCA 2WTBA 2IWRA 2A0YA 5FNVF 3G8YA 3PWKA 1ZM9A 2WWRA 3HL0A 2OXFA 4FHZA 3S99A 1EFDN 2E7ZA 2QM7A 2YXLA 2WBLC 1PGOA 1E5TA 1A27A 2IE0A 4WA7A 4EVIA 3V46A 4KCGA 4L74A 3UGJA 4FYVA 4BKPA 3ELUA 3ILSA 2G76A 4JBNA 3V1UA 3OZFA 5LP6A 4J7AA 1GZ4A 1E5XA 2Z2IA 3C7TA 4BKOA 1WETA 2CK3D 3AHIA 2JFQA 2IOFK 2X9NA 3Q15C 3VVBA 2GRAA 2O7NA 3B52X 3ESYA 3T99A 4V39A 2IHBA 3D64A 2C7RA 3WRXC 2WTAA 2XYHA 1XB2A 3DOJA 1IN5A 3EMDA 4FCTA 4TT3D 5B58T 2P6RA 5AMXA 3B7PA 4CV0A 1ZOSA 5EGNA 4RTJA 1YRYE 3WL3A 4D44A 4DLPA 4FOPA 2J87A 3ZK7A 4B6PA 2BAGA 2VWQA 2G6TA 2GD6A 4LW8A 1O95D 2YHSA 1J09A 3D31A 4A2PA 3D7MA 3G17A 1VFPA 3GMTA 4RIEA 2VZ0A 1SCJA 4ND6A 4C0BA 3HO1A 1OI4A 1TKCA 1J5XA 3CG4A 3CW2A 8OHMA 3OQVA 2F1OA 3TOVA 4LDPA 1FYDA 1P1RA 1J2RA 1Z3CA 2FEPA 4H6XA 5ES3A 3ZH9B 2J5RA 1HTTA 3BL5A 3PT5A 4BX0A 1AY0A 2FUNB 4P2GA 3EDCA 2KPOA 3GQBB 1PGJA 3H11B 4D42A 3R9KA 2LKCA 4JT8A 5CA0F 1BW9A 5K0LA 2JB9A 3CT6A 2A5YB 3VTFA 3W6NA 3QOWA 3HDTA 4N82A 2GYWA 2X4IA 2XNSA 1OPRA 3JS5A 1KVRA 2F1HA 5GONF 4C07A 3LDHA 4RDXA 1CUXA 1TC1A 2ID9A 3OZBA 2Z8YA 2PJZA 4DAEA 1O8CA 4MINA 1V4BA 4UE6A 3TB4A 1GPKA 5IN4A 1VE6A 4YB8A 3A2MA 4YI5A 3QPCA 1E20A 2P5SA 4BNXA 3VTZA 1BHSA 5L40A 1A8QA 3RHFA 1U1IA 5DJ5A 3JWHA 2A14A 1O94A 4PW0A 5KVVA 3IVRA 4A0HA 1KNXA 1Z5WA 1ZJ5A 2FPGB 1TCCA 1C9MA 1I8TA 4GXTA 3QKTA 1XLVA 5GM2A 4YRPA 3TJMA 4LYFA 5FL7A 4B4OA 4DDMA 1G18A 1NY5A 3GDFA 3ECCA 5JXJA 4CIWA 3P0RA 2GM5A 5FOTA 1L7DA 3DCYA 4G0UA 1A4IA 2CNDA 3U7IA 2HHCA 5BVGB 3TDMA 5L7WA 4GI7A 2VHJA 1NR1A 3FY4A 4G56A 1G8GA 1H1TA 1R6VA 3LHFA 2AWNA 1M1UA 1AMUA 2F3QA 1XAHA 2H4FA 4KQXA 1UJ5A 3SN6A 3TW4A 3COZA 3B6ZA 4DPKA 1YI1A 1SULA 3R3HA 4AIIA 2OCXA 2VNHA 5BSHA 2X0JA 3PC4A 2H2IA 5DM0A 1BU5A 2VJMB 4HPJB 1Z28A 1VP9A 2RB4A 3MYRA 1I4WA 1OWMA 3EN0A 1I5RA 3IKMB 2CB0A 2FPUA 3HBJA 3R5KA 4LNUB 3D0QA 3RIMA 3AERA 4EG4A 1Y8RA 3FA2A 4A1FA 3T9FA 1UKEA 3DZ8A 2RGGA 3H4MA 5FCDA 1YF3A 1DBWA 3N07A 4FYJA 3QLTA 1GDTA 4A15A 2JAWA 5HBGA 2WUWE 1IC6A 3VPXA 5FOVA 5G0VA 4G1EB 3NCHA 3HB1A 1EFCA 2HCRA 3LT0A 2WJ6A 4R01A 1NXXA 1XA0A 1DC4A 2CZCA 2OV4A 3BCHA 1HE1C 4QDZA 3Q6NA 3NKLA 6Q21A 1X94A 4MRMB 3PRJA 4UHKA 4XWWA 1B3BA 3MAJA 1EP1B 4L78A 1EKXA 1D0VA 1GUFA 2QJWA 3L7AA 4CRWB 2FPIA 2ZPAA 3ECAA 4A91A 2DWQA 1CR4A 2B7BA 3E5HA 3LT1A 1OV4A 1EH5A 4JJ7A 4A0QA 3G0BA 1XQXA 1CUWA 1CR1A 1QGUA 2N0SA 5EIBC 4ZI7A 1EHYA 5LQUA 3OZCA 3G0GA 4HBGA 1JQEA 1HXHA 3N76A 5FOQA 1XCJA 1GVHA 2P2SA 3ESRA 4TV9F 3IH5A 5AJVB 3W05A 5L4SA 2Q5HA 1ETUA 1LRKA 2A1IA 3DE2X 3UBMA 1O89A 5G3ZA 1FVOA 3SI7A 4BV3A 2XZLA 1NOIA 3FYDA 3T5DA 3BIWA 2D1QA 5J23A 2JGNA 3ROTA 4HWTA 3RJ9A 1E6CA 1D9XA 1RJ9A 2EW8A 3A1SA 4BFWA 3T9EA 4C7KA 4ZGWA 1LC3A 1PG5A 3U40A 5TS3A 5H3LA 4EA8A 4BE7B 2AF3C 3U3MA 5JAIA 1BHQ1 1FP4B 1UJMA 1VI6A 2P9YA 1FTSA 4L51A 1OU4A 1VJ0A 2PAAA 2A94A 2CJFA 3K96A 4YQFA 4D0SA 1CY6A 1EX1A 1E8DA 3QMMA 1UOOA 3LPMA 1RQ7A 1AS3A 3O5AA 5AJWA 2ZSAA 4RMJA 2VLBA 1BQ4A 1HMPA 3KDPA 1RRVA 2I8AA 3O90A 3WRYA 3TB6A 3C3AA 3O1JC 4YAWA 2OK8A 2Q7OE 3RK0A 2BL4A 3B1XA 2H7YA 3K73O 4QLOA 1PQYA 3VHXB 2Z5FA 1V3UA 1NVWQ 2FAXA 1FRQA 1IDOA 4FGZA 2ZDGA 3H83A 2NO6A 1OXBB 4P3NA 4PRYA 1B23P 1EI9A 2FOXA 1GCGA 3K0CC 1ESDA 3EPJA 3ZC3A 4YACA 1U9IA 1T2DA 3I9JA 2BEUA 1K92A 2AUMA 2ZYTX 3KRTA 4LRTB 4NSNA 4QXRA 3RYIA 1ZGBA 4GEGA 1EP2B 1C4OA 1DTSA 4G85A 2QN6A 1QHXA 2ZJ1A 2AVNA 3P2EA 1OXUA 4V0RA 3RG8A 4EG6A 1NUPA 4TM8A 4U7DA 3TZEA 4DNFA 1Z8FA 1ZUNB 2II6A 3IXQA 5JLJA 4K3VA 2C9OA 4G4JA 4UCFA 3KKPA 1C4XA 3LLVA 2EJUA 1KY3A 1QHHA 3CCCA 3UH0A 4JODA 1XR3A 3PRHA 2EW2A 3CO0S 1XWIA 4GPD1 3SKXA 3TXYA 3SXUA 4B0PA 3ZVKA 2ZJ6A 1XUOA 2YKGA 2ORYA 2PKRA 4QWMA 3ER9A 1EZ1A 3ZLVA 3UUGA 4HEQA 2OT3B 1XTQA 1T8WA 1J5PA 2Q29A 1HOXA 3L7OA 3LF1A 3RJMA 3REQA 3HV2A 2IXEA 2BE9A 1U2GC 4RFSB 1XRSB 4RHFA 3KUUA 1P2GA 3C2QA 4JC4A 4OATA 3PQ7A 4U7GA 2F43B 3I73A 2V7TA 1X2BA 4MWSA 1F8UA 1P4SA 2X8WA 3QLUC 4ND1A 1T2VA 3JQCA 4DR4B 5CRIA 1I4TD 3GT3A 4P81A 1IPEA 5FUVA 5TLSA 2JCSA 1PJQA 3ZLBA 2YXNA 3VSAA 1ZMOA 4CM6A 2DH6A 1LDBA 3L40A 3HNRA 3CZ5A 3VX4A 4F91B 5CA1A 3RFFA 1G20A 2JLUA 2A3NA 3B8HA 1E3QA 4FDVA 5CM9C 3PVZA 5M2QA 1Z0FA 1GQSA 2D5AA 3MSCA 3RK4A 2ZTMA 3AHCA 2HNKA 2VPWA 3A6PC 1I13A 4NIMA 1Y7HA 3IBCA 1L7EA 2IYNA 3MOIA 1NMXA 1R64A 2KHZA 2XB8A 3V7FA 4HNVA 4U02A 3AI1A 2O4CA 3BJRA 3RADC 1XCOA 4JQYA 3W79A 2C7GA 1C9EA 4TUYF 1SIWA 1DE0A 2G25A 1QZTA 4AC9A 3D0KA 3LUDA 1DKNA 5A62A 2PV7A 3KYJB 3JAWB 4AJIA 2Y1DA 2HD4A 5K8LA 3GLHE 5FWDA 3X3HA 4WXPA 2VDKB 5I5GA 2P7IA 3K30A 4QT0A 1U8CB 4DUZB 2FW8A 4QYMA 1NQWA 2QJOA 3KHSA 5LXTA 5FOXA 2C0CA 2GK4A 4KXWA 3RYTC 3N6RA 1UPTA 4OKIA 3BGVA 2GA9A 4I5DA 4DA9A 4FGUA 4PTYA 3WMEA 4R8RA 3EIXA 1K3TA 2NZUG 3BB1A 1N7JA 2G4LA 3HH8A 2IH4A 4CBVA 1Z34A 2OECA 2WHQA 4LRUA 4D9JA 1KAOA 4OMUA 3OLXA 4DV3B 4AKSA 3EIFA 4HS9A 5C2JB 5JEEA 1E2UA 1P0QA 3B3JA 2AIRA 3IQZA 2WJ3A 3K0AB 1YSCA 4I8IA 1C0KA 3A32A 4KNVA 1DLIA 4F5EA 3OT1B 2VZEA 3G9XA 4P31A 4C01A 1DHRA 4QZVA 1YTUA 2HL6A 4BNJA 1X19A 2X2EA 3BFXA 3FNBA 5A5DA 4F85A 1TL7C 4J1NA 3FCCA 3OOEA 3V8EA 4X65B 3QLVA 3TQTA 4FONA 1KP3A 1EZZA 2BVNA 2JIPA 4N3GA 1BYUA 3ZGOA 1E2QA 1BFUA 1FMJA 4GMFA 3RVJA 1UQRA 3IKJA 4X1YA 1YRHA 1OXSC 4E14A 1G5PA 2QUIA 4A1OA 2BHRA 2DUNA 3U3KA 2QGZA 4WKGA 2PLNA 3AFNA 3T3NA 1GXSB 3L79A 4FDTA 2HHHB 2O19A 4RKEA 1L8LA 3A3NA 5HJEA 1BMFD 1ZD8A 4LG1A 2O3RA 3IP3A 3IT3A 1V25A 4XVQA 5L3QB 1J9ZA 1G5HA 3NV7A 1HE2A 4IIJA 3JYPA 4DF3A 2B1IA 2NTYC 3PJGA 1Z68A 3AF1A 4OB6A 3W2FA 4RNDB 4FR0A 1LX7A 3KK0A 1G1MA 4B48A 5JCJD 3SAJA 4ZO6A 1YR6A 1V7PC 2PQ2A 4YHBA 3WG9A 3NVDA 2VDUE 3DKPA 2O20A 4R1SA 3TKLA 2A9KA 3JQGB 5JDIA 1LFAA 4L0CA 3U1VA 4DREA 4GSKA 5K9ZA 1Y5MA 1BX0A 1Q1AA 3MWDA 1CEQA 5E0OA 5FT9A 5JYCA 4HGQA 5AVOA 1PEDA 1RLUA 3MGBA 3FNEA 4B79A 2IYAA 2G9ZA 2C3PA 3AILA 4MW4A 5LDGA 2Q6TA 4F8JA 2CYAA 1ZOIA 2DUWA 4PPFA 1A9ZA 3WBFA 2GZHA 4LBYA 4MQEA 5DYNA 2TYSB 3H2KA 4Z0HO 2SECE 2IXDA 5F4BA 3DHEA 3ZE6A 5KNCD 2CYCA 4KRYA 4JFAA 1L4FA 1JKXA 2Y9MB 4B1FA 2IC5A 2X4GA 4HGZA 3WYEA 2X2PA 4JCOA 2PSEA 2AE2A 3P97A 3EW9A 3FKSD 1M2EA 1N5DA 3P9ZA 1H22A 1JR3D 1MF7A 4GX1A 4HTFA 4BFYA 4WOCA 3E61A 3BGOS 2XRYA 5CDUA 1KPIA 1WW2A 1E5LA 3B6JA 3HC7A 3I62A 2R751 1KU0A 2IF0A 4O2BA 1Z25A 5EE5B 4CM9A 4CIAA 2XZOA 2D0PB 3DTVD 3CVJA 4NE7A 1JEJA 4NENB 1CDDA 1IN7A 1WWKA 4ZVPA 5GZ6A 2RMKA 1P39A 2IX3A 5K4HA 4PS1A 2DY1A 5F51A 2FR0A 1U2DC 4JBIA 1BO6A 4YP6A 3UPUA 1Q44A 1CEXA 4H2DA 2IUUA 3AOEC 1N0UA 3I4CA 2W98A 3AZOA 1YKSA 3JQAB 1MO5A 2Z6VA 4JP2A 5GJCA 2EKBA 3HHEA 3ZE0B 4D99A 1AH2A 2Q1YA 5KKCA 2Z8YM 4Q1CA 3BXEA 1LNZA 3P4UA 1A8IA 1W0JA 2H5EA 3LC7O 1G55A 2G67A 3G0CA 1DJQA 4IJUA 1QVWA 1OASA 3AJRA 4AY4A 4BFCA 5EIEA 5FO1A 3IEVA 2A84A 2W2PA 4RTKA 4INJA 4KO1S 4I4TF 2O6HA 2VDLB 4ZT6A 3S2EA 3OE4A 5IF3A 4QEDA 4DCTA 4GDFA 4Q3DA 2JI6A 4PLFA 3RBVA 1DX6A 5IKMA 4G5HA 1AE1A 4LE2A 3RUIA 4R81A 2GCNA 2WOOA 1C2YA 3EZNA 1EB8A 2PYDA 4PAWA 4JZYA 5ALSA 1L5KA 3RHTA 3TKYA 3JD4A 4P54A 4RDHA 2G7ZA 4ZVNA 5IP5A 3W8DA 1IATA 2FSHA 2UAGA 2GXSA 4YASA 3RQSA 4J7CA 2EL9A 3O8LA 4B71A 2Q07A 4ZPXA 2PX5A 1J0EA 1LV8A 2YN4A 4BHTA 1PR3A 3THWB 4JI6B 3HG7A 3JCZA 4NXNB 3H2HA 3CJTA 2PZGA 1NURA 2RH8A 1CY4A 4GXNA 1F0PA 2YOGA 1NVKA 2N42A 2XQVA 3I28A 3GRPA 2QN8A 2H5IA 3FMGA 3I5YA 4CLHA 1EX6A 5KS2A 1U8XX 3EJ6A 5KWEA 1ML3A 4M21A 2A57A 4GKBA 4RH3A 2UZ1A 4HB4A 4RANA 4KQWA 1UOEA 3CB2A 4RZHA 1V1MB 3GLGE 2IDKA 2ZB4A 3SS8A 1NXOA 4DDKA 4YRGA 2CJWB 4LF7B 1OHHD 1JDPA 4RPHA 2J3IA 5JZVA 4D9IA 1H5QA 1NVVQ 3LBNA 4FW8A 4QG7A 2VDVE 3FFTA 3UVEA 4O4JB 2HGSA 2XKKA 1O9BA 5HMLA 3V8RA 1GNTA 3ETHA 3G5MA 2GHIA 1FLVA 2C99A 5D3KA 2X19A 4HGNA 4ZT2A 3QIAA 2NO1A 1SBZA 3HZZA 2ZVDA 3DHWC 3GV0A 3KAQA 4LIPD 5K20A 4R2XA 1B76A 1J25A 1C80A 3HA3A 4BU1A 2OHIA 4U4AA 4ZQCB 5DM2A 4Y0AA 3DOCA 5FWNA 2PL5A 3ET5A 3TDNA 3GZJA 5IYZB 2B5OA 1Z7BA 2FY8A 3BK2A 1K75A 2FQ1A 3GNSA 2D7DA 1X0XA 1S8FA 3H3XA 4AY3A 4HNHA 4D4JA 4EL0A 3H9QA 1PTJA 4P32A 3VPDA 2QAJA 1D2GA 5HCIA 2G09A 5I8ZA 1KJJA 2RHOA 4FE7A 3LZ6A 4C3VA 3DPIA 5LOVA 2O8CA 4KQ2A 1A88A 3N53A 4GBGA 3MEQA 4OB7A 1PT8A 4WL0A 4YMSA 4BB5A 1JAHA 5JJ5A 3A1UA 4N0DA 2G1PA 4N76A 1Z17A 3AR6A 2HF7A 4DDTA 2J7PA 2DKFA 3GEMA 3NEPX 5E4JA 3H11A 3Q8WA 4B47A 4IF6A 4UDXX 5C4MA 4G89A 4KWEA 3L4B