3WL3A

N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
267
structure length
267
Chain Sequence
b'FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
molecule tags Hydrolase
source organism Pyrococcus horikoshii
publication title Expression from engineered Escherichia coli chromosome and crystallographic study of archaeal N,N'-diacetylchitobiose deacetylase
pubmed doi rcsb
total genus 97
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 3wl3A00
4EWLA 1Q7TA 1Q74A 2IXDA 3DFFA 5BMOA 4XLZA 4XM2A 5B2EA 5CGZA 3WL4A 3WL3A 3WE7A 1UANA 3DFMA 3DFKA 2XADA 4XM1A 3DFIA 5B2FA 2X9LA 4XM0A
chains in the Genus database with same CATH superfamily
1MC4A 2ZE8A 1BD4A 3L7DA 4O0LA 3WMXA 1N2EA 2ID9A 1L4FA 3B1KA 5JRDS 1IZ8A 3R0ZA 3BWYA 4FBMA 1FXUA 1XTVA 2ZT8A 1ISPA 4UBMA 5JCJA 3ZG6A 4ZYWA 1HM5A 3PC8A 3M82A 3AKEA 1KWKA 2DPGA 3AOEC 1E6MA 2G82A 1AK2A 1X8JA 1P0IA 1UBNA 2HADA 2B20A 2FEMA 3KSUA 4HDRB 3LH5A 2IITA 5GJCA 5FT9A 3GUHA 4WNAA 4D2IA 2ZBQA 3BVPA 1I0ZA 3AG5A 3C3KA 3PGJA 3R0IA 3WV4A 3VRHA 2P3QA 5K3EA 3OM0A 1MC5A 2Q7XA 4EG8A 3RVJA 5ELMA 3WB0A 3TFWA 5TEVA 3I23A 4XVHA 3ADDA 3MOGA 4C4PA 3A6HA 3A2NA 4JJZA 1JHPA 4E51A 3IQEA 3PB3A 3NTRA 5I4IA 4R8MA 3OQOA 4N49A 1QR2A 3WTCA 2HU5A 2ZANA 1I1QB 2PGOA 3TK1A 5HKKA 2UYQA 4HQFA 1CUUA 2W0SA 2HMUA 4GLJA 2AX4A 3V9PA 3RHFA 4MRRA 4OAPA 1VKJA 3AB7A 1T2CA 1XZQA 2A0XA 4XD7D 3RYIB 1ZMRA 1P6QA 2YIMA 2WWIA 3NIFB 3S2GA 1KRXA 3AESA 2CXQA 3ZGXA 5SZIA 3MMXA 1NBIA 1Y5IA 3PFNA 1JG3A 4IF6A 4XWTA 3VVMA 4L73A 3ZWAA 1RACA 1N3YA 5EXEA 3UPDA 1Y3CE 5GTDA 2BBTA 1PIWA 4C7JA 1O54A 1RAIA 4KUEA 1YR3A 1MABA 3I2GA 1BDHA 5EHGA 1Z2PX 1DARA 2SCUB 4OIFA 4LFCB 2W6ZA 1NIJA 1ABFA 1VE1A 4HGOA 3D6FA 2I5PO 4TS4A 3BF8A 4QTYA 1UAYA 1ES9A 1LPBB 1BWPA 4OHFA 4FBLA 4PQGA 3FDIA 1K0FA 3TQRA 3N6XA 1NURA 1S2OA 5KQGA 4B85A 1YL6A 5K6AC 5H16A 1NY5A 4KYIB 1U80A 2R2AA 4RFSB 1XYYA 4JSRA 1K4KA 4IIGA 4QDJA 3QTTA 4ZIRB 1J0XO 3F96A 5C8DA 4HB0A 1EINA 3QPCA 2NAPA 5BN3A 3G2NA 3NDPA 2Q0HA 3HKDA 1DBIA 1FS4A 5E4YA 3F3YA 4YO8A 4GXQA 5I8PA 1NXOA 5KYYB 1CUVA 2KW5A 1MO2A 4BV2A 1QFSA 1U7PA 3HACA 5H9WA 1MA3A 3R40A 4QODA 5EG5A 2AX3A 2ZUDA 3CF2A 3PENA 4M0UA 5AJHA 5CNJA 2X15A 4KN6A 4B34A 2C78A 2W6NA 1G5IA 2RH9B 4PCUA 4JASB 2HB6A 3UK1A 4L3WA 1L8XA 3PITA 3QKRA 1ZI6A 5ICEA 1Z0SA 2BJWA 2MYUA 3E7WA 1AMUA 1FE8A 1U28A 3K0FA 4ARZA 4WECA 5IBRA 5HP4A 2J1LA 4X1KB 3PQ2A 4MW7A 3MJCA 2MYPA 3NIBA 4UM7A 3V4OA 4EENA 9ATCA 2JLZA 3ZX4A 3QKSA 5IARA 1J2EA 4HN2A 4QOGA 5I01A 1P45A 3M89A 4MYSA 3QV2A 4UREA 4X44A 1DIAA 3CZ9A 1Q6ZA 1K6IA 1R9NA 1FSSA 2CYAA 3TQOA 3TG2A 4G0WA 1ULTA 3RYIA 4D9JA 4XQ0A 4W5OA 3PR1A 1GPH1 2PIAA 4F2WA 5JNWA 2Q27A 4PYRA 1PDWA 2C20A 3QEKA 4AAYA 1UKVY 1A4IA 1WD5A 3HZHA 5JYCA 4DCNA 1YZ3A 5IZCC 5A1TA 3P0JA 3NMUF 4LFAB 4BRSA 3KJNA 4GPD1 4CL3A 5JD3A 4D6XA 2G1PA 5LVAA 4RFVA 5COQA 3RODA 5EMLA 2G72A 2YCLA 3M6AA 1B23P 4AO6A 3FVQA 3IP9A 1OA1A 1M6VB 4P9NA 2ODWA 5EPOA 3EODA 3H1FA 1W73A 3GOHA 1OFUX 1CZNA 1SXIA 3A1FA 4IJMA 4QU9A 2WIAA 1XUOA 4TROA 4XQGA 3OQ1A 5KOIA 1QU3A 1YZGA 3OIFA 4U1RA 1MH1A 2VYVA 3P0RA 4I8XA 2E6UX 1HNNA 2QZ4A 4OTZA 2BSAA 1VG0B 3AY7A 3Q7TA 4B6SA 2ZRJA 3HV0A 1LB1B 1A3CA 2ERXA 2LPMA 1HDIA 1HOTA 3ANLA 3EXEA 2W6IA 2H29A 2GPYA 4G2NA 2CKDA 5AI8A 2AT1A 3OZVA 3L40A 1RVV1 3CF0A 4HOYA 1EVIA 2QVYX 1UC5B 3VOAA 4UBJA 2X9VA 2LBPA 3MUNA 3TE7A 4MIEA 3AF2A 3SOZA 2ZJZA 4QGAA 4EA7A 4ZRDA 5FBVB 3BRSA 1Y3FE 3IP1A 4Q4AA 1C9NA 5CPBA 5ECYA 4PSDA 4Z53A 3U4IA 4P1ZA 5EKSA 1CFJA 1ENYA 3QG1A 4G9GA 5B7QA 1GAXA 2Z8YM 4B0OA 1XSEA 1XWIA 2DSNA 2VF5X 4LOHA 1KFKB 4X1YB 2C4UA 3TYXA 1V47A 3OPMA 1II8B 2ZRFA 2G04A 4DJEC 2HSZA 1Z5VA 1EESA 1KI6A 1PYOA 1LNZA 4ND6A 1YBAA 4QL3A 4AKIA 3QHAA 2IT1A 3PDIA 4J91A 5LZ8A 3L0PA 1MVLA 4QHYA 5KEIA 1EEXB 1UT8A 2HDNB 5EUQB 3X2FA 3NFRA 2CJPA 1E4VA 3BGOS 1Z4NA 1WO8A 5IZ4A 1Z0DA 1RJDA 4UNPA 4J0CA 4JLUA 5J9FA 5KAMA 2HRZA 4J3FA 3UYLA 2OZEA 3MOIA 1EH5A 1FJXA 5HQJA 4YV1A 2CHGA 5IDYA 4ZCSA 1NXWA 3ENWA 5IW8A 4AI6A 2H1IA 2XXJA 2NZVG 3TL3A 3LLUA 4B4VA 5L4SA 2J85A 1JB9A 4C7MA 1XNJA 5JH7A 1AGPA 3Q3CA 3QENA 2QV7A 1KI8A 3DDUA 3W7AA 3VR3A 1T6NA 5FEUA 2G1AA 2H07A 2ZRNA 3AR3A 3EZGA 3OLVA 4JSTA 4MI6A 3ZWNA 4B3CA 2QRHA 4EX6A 2RGRA 2GWRA 2J33A 4KV7A 4Q82A 3V4LA 4C0JA 4URYR 4P4SA 1O0BA 1O95A 1Z82A 3HBJA 2OXFA 5EOVA 2HO4A 1UOEA 5AM4A 4I81A 3RKRA 4RNDB 1IY8A 4IGIA 1I36A 1R0SA 3TRKA 4IO0A 4M8KA 1FXWF 5AI4A 2NXEA 1ODLA 1O6FA 1Z4QA 1NU6A 1KDVA 2WK1A 3MS7A 1V48A 3UXYA 3VTFA 4LC0A 3UICA 4A8JC 4CUKA 5AIBA 4WNIA 4IXDA 2O1XA 2HIGA 4LCEA 1WQ1R 1UMBB 3GAZA 2XB9A 5FL3A 2OVFA 1E9DA 4K7JA 2ZK7A 3SSMA 3URKA 3W4KA 4BMXA 5DNCA 5IM4F 1YS9A 4RK5A 4EFNA 3VR6D 1ESZA 4FDTA 3P2IA 4QTUB 4DAEA 1GCUA 3CMCO 4G56A 4RJ2A 2ZDQA 3I9JA 3AR6A 1RI3A 4RS4A 5CTJA 3WQBA 1UK6A 1XDWA 2BDEA 4RHFA 4A6DA 4I1UA 3ZWVA 4X7PA 2HJ9A 1TF7A 3GVXA 4ZZ0A 5BMVA 3GYGA 3RUDA 1XL1A 3RIGA 4CMKA 4ES6A 4QPCA 1NGSA 2WILA 4F1WA 5IM4A 5FEMA 3BAZA 2XNSA 2YN2A 3EVCA 1QVVA 1LRJA 2DTDA 3ZU4A 5IYZA 2W9XA 4O2BB 4S1OA 1SD1A 2GM4A 1TFUA 2XCRB 1KS9A 3BORA 2F6RA 4PGAA 4BKPA 3CJQA 1VSTA 2D62A 2Y2UA 1TUEA 3ENNA 3I6IA 3OEYA 4MB0A 2ZIUB 2QN2A 1WUHS 4EVSA 5K45A 1GIAA 4JP3A 4EKIA 1PJ8A 2ENWA 3M4JA 5L6MB 2ZJ7A 3EVNA 4TXNA 5CYPA 1X7ZA 3UXMA 4RENA 1E7MA 1U9ZA 2J0EA 3I1IA 4JKIA 3T5CA 3CUSA 3INNA 3VI4B 5LR6A 4DWWA 5JD6A 1OX6A 5HCNA 2I9PA 5FUYA 1L7MA 4NONA 1Q21A 3PV0A 4BEJA 4HVLA 1MQ8B 4NU5A 5E6UA 4I50B 1QOQB 3LX8A 4GUDA 3STUA 4AUEA 6NULA 2OVBA 5CIQA 4YBZA 2IZOA 1I30A 4LW8A 1VBNA 4HJXA 4S12A 2O6HA 2QJRA 2DP4E 1RU3A 1SC6A 4C3OB 1YZFA 4HL6A 2IDZA 1E1QD 3DYVA 4M4SA 4RIHA 1ZHOA 1L3BA 3F1KA 5DN6A 1SO8A 4MVJH 4MGKR 2HO5A 3W2IA 1ZH6A 2GSWA 3KFXA 1UJMA 5AJXA 5AKHA 3SHTA 1OW3B 4GI3A 1R0ZA 3O8LA 1X7YA 1RJFA 4LXUA 1X1QA 2ERYA 1BAPA 4P4NA 3RRNA 4N3NA 2HWWA 1EHIA 1LPNA 2IW3A 3M6MD 4YJ3F 1ZUD1 2GN6A 1K89A 1Z34A 3L0BA 2FP4A 2ZJBA 3UBMA 1ZOSA 3KC2A 4LRYA 5HCUA 1T9ZA 3MMSA 3OIWA 1NVUQ 1DIRA 1KYZA 3H2ZA 1VE3A 4B6GA 4CDRA 2IE8A 1FYVA 3M33A 1V5WA 4F3YA 5AP9A 2YYAA 2IYYA 3H75A 3WIVA 5H3LA 2BGMA 4Q7MB 2YWCA 3NHFA 3EN0A 1YC5A 3T4XA 2NU9A 5AW1A 5DBGA 1X7YB 2BD0A 2HK6A 1ILWA 4Y2PA 5SYAA 2WWRA 3CVYA 1KFEB 3VC3A 1RP7A 4UJ5A 1U7XA 3NWPA 5BXQC 4TMZA 3WQHA 1QTNA 2PQ6A 1EFUA 4ZHQF 1ZP6A 5T4EA 1A8IA 4BO1A 4KNWA 2ACWA 1W35A 2Q3EA 2W2PA 2EERA 3P5SA 1Z8DA 2IIVA 3DF9A 3GVHA 1O6CA 4IIJF 2QTWB 5GZ1A 2A3RA 1U11A 1ZK3A 2FQQA 2Y9PB 3KSZO 4BQNA 3TRIA 1Z06A 4C4SA 2UVDA 1NW5A 5JI2E 1AQNA 3CRQA 4YDQA 1L7PA 4P38A 1GARA 1W2GA 3H8WA 1BJKA 2ATCA 4U9IS 4BZPA 4HPWA 2V1XA 3C3EA 2NU6B 1BS2A 1TVMA 4YRKA 2V03A 1MRSA 3F6RA 3KEMA 1GRVA 1PNTA 1F5SA 3D5EA 2ZU0C 3RREA 3W9SA 2UZ3A 5A5GA 2NW6A 1HTWA 2RH5A 2V98A 3AHEA 3MB5A 4OQDA 4WXYB 5IASA 2FR1A 3EW7A 3Q9UA 2HLDA 8OHMA 2QLJA 3KT3A 4A4DA 2N42A 3BXGA 2VP0A 1P5RA 1NG9A 2QZPA 4Z3KA 1SBCA 2V6GA 3GXOA 4MYRA 2B8TA 2Z3WA 1QHHB 1UCFA 2BFAA 3OPYB 2DHQA 1U6JA 1SCNE 4PM4A 5JQGA 1TGVA 4YRFA 1MIHA 5EA2A 2W6MA 1WTCA 4IILA 3ZW9A 4DA9A 2ZTUA 4RZSA 7GPBA 1BMDA 4E5MA 3REQB 1K2VN 4CFSA 2WICA 3ZQKA 4D9FA 1VHDA 2H2IA 2REBA 2WT8A 4M8LA 4NU8X 1Z38A 2AJDA 4BNIA 2QTBA 2PJDA 4A5SA 4CU2A 4R1LA 4MI9A 4D8UA 2DT8A 2PKWA 5ES4B 2VTVA 3UK2A 3GLFE 3C85A 3CUTA 4A8JB 5LP1A 2X40A 1I4DD 4C2BA 4OP3A 3AKYA 3LUJA 3TKLA 4DMKA 1KBQA 2ZRDA 4XDGA 1RYDA 1KRHA 2FSVC 3GLUA 2ZM5A 2YWFA 1JKJA 2X0RA 3CJRA 4KSYA 1M66A 3JPWA 3DV2A 3I2HA 4IOLA 4RJIA 5BW8A 4M8NE 1FRNA 3D4IA 4HMPA 1FUEA 3IAM6 1EUZA 3SQXA 2VPZA 2M6KA 4JLDA 3X3HA 2ZUEA 2XHEA 1A8SA 1GA6A 4DHWA 4M7OA 2PWYA 4UDXX 2XMSA 3EQ8A 3I64A 4OQLA 4ZOLA 4JDUA 1F3LA 2BGKA 1RHKA 3IE2A 1PR1A 5B7NA 1X7GA 2PGAA 4A6PA 1PHPA 1R4NB 2PQMA 3RVKA 4D0NA 5AVZA 4P3YA 3DD1A 2WINI 3DR3A 4D80A 1CR4A 3DA8A 3TMYA 2F4NA 1OOEA 1ONPA 3BHMA 3CUWA 3EDCA 3K32A 4HB2A 4RABA 3T1NA 4Z3OA 2NU6A 4NDZA 2Y77A 4QJ5A 4CCYB 2HSGA 4Q15A 5EP1A 5YASA 4DYVA 2NPFA 4MV4A 3U7FB 1O95D 3SIXA 13PKA 4K9OA 3RG8A 1O6GA 3LJKA 3U7HB 1E4EA 1PE0A 2Z57A 1CP2A 1PR4A 2VTDA 2YMLA 2A9RA 1DAHA 3DMHA 3MD0A 3Q9NA 5C4GB 3TTXA 2QM8A 2Z3VA 1Q0PA 4XGIA 4CR7A 2E5LB 4WJLA 2AR0A 3COPA 3PGXA 5C8YA 5FF9A 1M0WA 1DC5A 4TLCA 1K2WA 4YAUA 2JHAA 2P9BA 3HYTA 5K3DA 3KELA 4YJFB 4JI3B 3S70A 4A6EA 5FTLA 3QXGA 4QM6A 3F9CA 2G08A 2Q50A 5EP4A 4UM9D 4D9IA 1KH2A 4LX0A 3MJRA 1KR5A 1RWWA 3CM0A 4V39A 1WDKA 3RK1A 1E92A 5ELLA 4EB3A 4PG4A 1QIIA 1WMDA 3L82B 4C0AC 3T8YA 4ITUA 2PX5A 2O48X 2F9LA 2PKEA 3FG9A 3MCAA 5DGXA 3PJRA 4C0XA 4G37A 1AKMA 3VO8A 5B30A 2H4ZA 3N07A 3VU9A 1NVMB 1R0KA 3KT8A 4LC9A 1GGVA 1DC3A 1N2CA 1WOYA 2UZAA 4MR9B 3GGSA 3VU3A 3NOXA 1TLLA 2HJVA 3OJOA 5ALLA 1UQUA 1JU3A 3RIHA 3WK8A 3GROA 2EHJA 1H05A 3WWCA 1A9QA 5F7OA 1GM5A 1IG0A 2XADA 3L8EA 3KX2A 4M8SA 4YRCA 2BEWA 3EB9A 4FEEA 1YZHA 3GNLA 3KM0A 2VL7A 4KXYA 1X15A 1ZICA 3QVTA 2MDTA 1KDRA 1QLJA 4YPVA 4EY4A 5KAPA 2BKXA 2X77A 2GVDC 4MHOA 4D8TA 1E64A 4BRWA 4U6QA 1KH1A 2PZLA 3LT4A 2XMQA 1JQEA 4RK1A 1PR0A 4A0QA 4C06A 4RF2A 3CBQA 1IN8A 2G80A 4LHYA 3OIUA 3WE7A 4EPRA 3ZIAA 3LAWA 2IV2X 1OAAA 2HA6A 1QO0D 3X1DA 3WKAA 2D6FA 3AI3A 1PQYA 4OAQA 4WXRA 3UWOA 2EGHA 1LQUA 5SICE 4CM7A 3PD0A 1Y6JA 4UAUA 3OZFA 3TSYA 4ID9A 3VU0A 1BXRA 4DV0B 4J1QA 4MARA 2OBLA 2XSZA 2GT1A 5D00A 1JHQA 1ZMOA 4AQDA 3DNPA 1EQAA 1E8DA 2BUAA 2WM2A 3NFYA 2ZROA 2JFNA 3G1WA 1RQPA 2PT9A 5DO9A 2WG0A 3DMYA 3HMQA 2CEKA 1I6MA 3OVMA 4C08A 4FOLA 3DGFC 1G6Q1 2O8VA 3TCKA 4X64B 1MPTA 2OA0A 4DNPA 2B7LA 1ZR2A 1OLSA 3W5IA 4Y8VA 4RK7A 5K0SA 1ZGBA 3RFVA 3D1JA 4M49A 2C42A 1R6AA 3L7OA 3LG2A 1AGYA 2VPYA 5DMHA 1DNPA 2PV7A 2Z4RA 4P98A 3QMWA 5DIFA 2GSDA 4AN1A 3QVOA 5EFZA 5E2IA 1ZVKA 1KPIA 3VXKA 1ZUWA 1Y4SA 3EZ9A 1X2EA 4DKJA 3T7AA 1RI4A 3SBEA 1SIWA 1EWVA 3NBAA 4UARA 3MGGA 1IL0A 3SXPA 1CRLA 1Z37A 3EVGA 4GXTA 1FTSA 1NVTA 4W5RA 3RWBA 4DFDA 2HGZA 3QMVA 2XKJE 3OLCX 3STTA 1NC1A 1K9VF 2FETA 3A6PC 5LUAA 2WSYB 2KBFA 1TT7A 3MW8A 3PF8A 4CF6A 4PN7A 3TH5A 1BROA 5A1JA 1F17A 2Q4TA 2GEJA 3AHJA 3E7DA 3R6WA 4M7RA 3VV3A 3THYA 4YCLA 4J0EA 1QJCA 3ER8A 4XSGA 1P6UA 2R6GA 3C3YA 1NZJA 3D1LA 3S3TA 1GDTA 4KKVA 2H2DA 4TT8A 2Y4NA 2A9PA 4D25A 1Q92A 2D1YA 2GNAA 2X9LA 2YYYA 3SHWA 3OSUA 1PGQA 2ZWPA 4XB1A 3S4YA 2G70A 2XWJI 5AI9A 1D8AA 5E1OA 1G2OA 3ZHQA 3AWIA 1YZVA 2R6FA 4IWNA 1CRQA 4AJ1A 1VBKA 1F8XA 2ROQA 3EAQA 2VUUA 5JS8A 1WBBA 4AFNA 4MWBA 1ZH8A 2F8SA 2QI9F 4QEZA 1Z7BA 4FSDA 1GPWB 2XVXA 4CLHA 1TIKA 3L7IA 3T54A 3OKFA 2B6NA 3L0IB 4MRVA 1JR3D 2B35A 2X0IA 2YJTD 3GFQA 3DWFA 4O63O 3M3DA 3SICE 1H2XA 3R5JA 3ND7A 5BN4B 1BTOA 3E9ZA 3STHA 1HG0A 4KJXA 4BQIA 1RQNA 1KPHA 1Z6ZA 5EEHA 3UWMA 1WY5A 2C3UA 1DXOA 4KN9S 5J2TA 3PHHA 4R0VA 5LWHA 5EY5B 4B4UA 4HDNA 2OZLA 1NF3A 3BRWD 3IUPA 2Q6IA 3IUSA 4PPNA 4AQYB 2OQVA 4BLTA 4V24A 1KZ9A 3KAKA 4JVLA 5IXSA 2WFAA 1GL7A 3D3JA 3IB3A 3IT0A 5JLAA 1F6WA 1IBKB 2I2CA 3BMCA 2J7PA 2CZQA 5TARA 3MJDA 3N74A 4YRRA 5A0FA 1HE2A 4HTFA 2VAMA 5EQTA 4CCYA 2YC2C 4MJXA 2GILA 4PNHA 4DXDA 2G3YA 2GCOA 4EECA 2PE5A 3IS3A 2ZDHA 3VHXB 5HQTA 4CGYA 5JZSA 3QI7A 4WOPA 2EZ8A 1Z5GA 3S40A 3D54D 3FPHA 3CSDA 3WGUA 3A31A 4YJHB 4ZO4A 2NZWA 4CF4A 1GQSA 3R3YA 4EI7A 1CBUA 5BW4A 3EH1A 4TTIA 5C8VA 4QUJA 4Z51A 1P9LA 5LXTF 2C3OA 2JIMA 2QUHA 1QE0A 4O5AA 2XGJA 1K06A 3CLSD 3KEFA 3MOSA 3SR3A 3LBNA 3DMDA 1XRQA 1GLGA 3F5MA 1WCIB 1MC1A 1T6YA 2J8ZA 4LNUB 2H17A 3P1JA 2Z43A 4RFSA 3SNHA 3VSEA 3SD7A 2J32A 3ZJYA 1XP5A 5ISMA 3SWWA 4EYEA 4LOIA 5JCZA 3ZK7A 4HTAA 3HCDA 3LQ4A 2OUIA 2AZMA 3JQ7B 1RZ3A 3FF1A 2YINC 5IX8A 2V9ZA 5GMOA 3EWSA 3I4CA 3YASA 4RZ3A 4H2DA 1R8SA 3H9QA 1NHGA 1KJIA 1T9GR 5HA5A 5FPPA 4ND8A 4OUDB 5A3VA 1JLHA 4Z6KA 1DG3A 2VAVA 4UOZA 2CWWA 1UDBA 3HO1A 5I9SA 3OE5A 3MINB 3AMVA 3EEFA 4UW9A 3UV7A 1ZOOA 3QUTA 1FZQA 4OK6A 1GPJA 4NBVA 5TT1A 1CS4C 4MQMA 4AJEA 2CUTA 2QN6A 2PZMA 2O2ZA 3IVAA 1IAQA 4FYXA 4BV9A 3WV5A 4R71A 3MLAA 3PQ3A 4W5QA 1VJCA 2C5FA 5BMVB 2QT1A 2HWUA 2XKKA 1Y0BA 1H0RA 2CVZA 3EGDA 3BPSA 3D8SA 1O87A 2QHXA 3T7KA 2Q8NA 3HXPA 2IPOA 3THWA 3AUJB 3BXPA 3MMNA 3VZCA 1NNEA 5SYMA 1QX3A 4QATA 5AM1A 4JJ7A 3WC4A 1KJ9A 3CT6A 1DQYA 4MZDA 4UZSA 3CW9A 2BGWA 2V7VA 5ALSA 3I5YA 2FEAA 1SXJB 2HRBA 1V43A 2JI7A 1XAJA 3BUSA 3KALA 1OBHA 5HFNA 3DMPA 3VZSA 5ESRA 3CUKA 4ZK6A 3CSSA 1RYNA 1T43A 2YW2A 1LSSA 5FO0A 1RYZA 3U26A 2W6OA 3KPYA 2VYQA 4GGPA 1AQUA 3TGLA 1DUIA 4RZQA 3MBOA 4X63A 3EVDA 2OV1A 4ZANA 3SEFA 1KQ3A 3ANYB 5UKDA 4MLDA 3LPAA 1U1CA 3H0EA 4MRNA 1JPNA 1U99A 1WJGA 2G9UA 2V8OA 2A9OA 2YJ6A 1Y1PA 3R24A 2YZNA 4LF6B 4FEAA 2JL1A 3KZNA 4KQJA 4F12A 4X41A 1BCRB 3GYBA 3HWRA 3UH0A 3OBIA 4MYHA 3UY4A 3MF4A 4DRYA 1I7DA 4RF4A 2XDQA 1Q2UA 1G2IA 3GUUA 4IXNA 3NAGA 1R0LA 2YFQA 4N6GA 5CIWA 1XE3A 3LT5A 4NEQA 3ILXA 1K98A 2PSJA 4JD5A 2RI0A 3OH8A 1UC8A 4D4IA 1PGOA 1ACJA 1XEXA 1OXBB 2FPGB 2W83A 4YUWA 1EP1B 2Y1FA 3WWEA 1FVFA 3T4EA 1YZTA 2E4ZA 5ADVA 2Q6LA 4LZNA 4WZAA 4YMLA 3HXKA 3P9IA 1UWKA 4IJQA 4NSNA 3UJDA 3V8EA 1U2SA 4HBGA 1PFQA 3TTWA 3GPBA 3G9QA 2VHCA 3RSSA 1ZVVA 1LXCA 721PA 1F12A 2GPBA 3QZUA 1E3QA 1KK1A 2I7VA 5F7JA 5I5EA 1B14A 1NC3A 2V5VA 3MHTA 2NT4A 4QUKA 2DERA 5KQRA 1FJHA 2H92A 2PUWA 1S6YA 3BIOA 3EAFA 3WLKX 4M36A 1DMSA 1H2AS 2OP1A 2V97A 3JRNA 4EMUA 3W6NA 5KSWB 3X43A 2ON6A 1WBDA 1QQ5A 1HK7A 2XMDA 3QBEA 3B7WA 2QRJA 3R09A 2QTCA 5ITWA 1IBRA 1VG1A 5KJFA 4CKYA 4NNOA 5E9JA 3CX6A 5A4IS 3HB5X 4JXZA 5DWDA 4IZOA 4GI5A 3NIDB 4KOEC 4QFMA 1DAPA 2DETA 1BMTA 4CEJA 2FUCA 4RQUA 4U2BA 3FYUA 2JFZA 1ESMA 3HPQA 5DK4A 3U44A 3ZWYA 1MAUA 2LW7A 3EDYA 2E89A 4OV6B 2EKBA 5IAAA 1A8UA 2FGKA 1VC2A 1ZRNA 1TIPA 1XJQA 4K8OA 1L3CA 1RLIA 2IYVA 2IA5A 2RH4A 4FLFA 2W93A 3PHIA 2FGJA 3SNKA 1N7JA 3W79A 4D99A 4GAEA 2EG5A 1ZW6A 3ZY5A 2IHNA 2VATA 3W5JA 3LW7A 1WKCA 5TIIA 3MWKA 1ESDA 4EI9A 1RNLA 1OC4A 4F4UA 4R0NA 4MI1A 1NMSA 4YUVA 1N2OA 1NQUA 2C4VA 2FEWB 2ZBFA 4DJTA 1E2KA 1WF3A 5FBRB 1YWGO 5C5IA 1OIXA 2NUPB 1OB2A 1ZAYA 3QIAA 4QGHA 4GC9A 3UIEA 3NKLA 4F11A 2VDQB 1RYBA 3R3SA 2BTQB 2FPSA 5I7FA 5JC1A 1OLXA 1WABA 2X1LA 4W7HA 4PX9A 4ECEA 4MWCA 1DOHA 1T3HA 5TPZA 5DLEA 3C5WP 1VPTA 1EGHA 2GBFA 5FFMA 5TC4A 1CDEA 3H17A 4HX5A 1C0EA 1ECGA 3A6KA 1K97A 2ZUUA 5K3AA 5KTKA 5BNZA 2BRUC 5TQVA 2I3DA 2OHXA 2UVPB 4BLUA 1XHLA 2O5VA 2CNWA 3VR4A 2FWIA 4X54A 5SY6A 3Q15C 2TSYB 3K4HA 4ZCRA 5LL6P 2UZ0A 1WSBA 2Z6UA 1LA2A 4JBXA 3TLEA 1HXHA 1JBQA 3FVRA 1YZNA 4HH1A 3IOEA 3RV3A 4DBZA 1P60A 1U0GA 1VL0A 1Z0ZA 3N6RA 4HLDA 3SZOA 4GZ6A 4DA7A 3SEQA 2P9TA 1FLVA 1T9HA 2Z2IA 2FMUA 2YH2A 1AMNA 1QO9A 3T7TA 3S8YA 4RY8A 5LCXA 1U4NA 2N3ZA 3S2EA 5LU9A 1H6BA 3UHAA 3IRVA 4JUDX 4PAMA 5AVTA 3R7FA 4JQZA 2CDNA 1NYTA 2DULA 3HABA 5TS2A 4BASA 2XMCA 4YT8A 1VHJA 1BE6A 4DKXA 4NOLA 1KU0A 3SHOA 1ZA2A 3CG0A 3PUIA 2A14A 1KWGA 2XAUA 3N2IA 1GFZA 1PWEA 1WSDA 3M9LA 3G9XA 4RD1A 1B43A 5DCWA 5AVRA 4O1IA 3DJFA 4DC1A 2F43A 4DCTA 2PIDA 1MLDA 2B21A 2BBWA 3DM9B 4IJWA 1OX4B 3DONA 3JARA 4X66B 1R50A 2OMKA 1SBIA 1KDTA 5DGHA 3PUYA 2YVAA 5EJFA 1EK2A 3UAXA 3IESA 4EVQA 4LHZA 3ZE6A 5EZYA 5LQKA 4FI3C 4MQUA 3MJHA 3RJ5A 2Z6QA 3U4QB 4RM2A 4PAQA 1LW6E 2ZYSA 5FXMA 1L5YA 4Z8XA 2DJIA 2DXIA 2DUNA 1XD8A 4IOJA 3IBYA 3QWBA 1ZGCA 4ND8B 1Q1GA 4OUDA 1SVMA 3RS7A 3TEMA 4CG0A 2RG7A 1Q0LA 5F3RA 1WEKA 2HC9A 3KHSA 3PVZA 4AY6A 4FONA 1XKQA 4IW3B 3DVSX 1XZKA 1L0BA 5AW5A 2NV2B 5KKNB 4QYSA 1R2QA 3ANXA 4WUTA 1P4GA 4UJ3A 4B3JA 5JD5A 1N78A 3OU6A 5HBRA 3ACCA 3N2KB 5KTNA 1A7UA 2JD1A 1KMMA 1UMCA 5JISA 5LZ9A 2OB1A 2QMQA 3A1CA 2C8LA 3A6FA 2ASVA 4WACA 2NVUB 1EJ2A 4CUZA 5CD1A 2CNWD 1QG4A 2RC5A 3DPUA 5CBPA 1GUYA 2JLQA 4QO7A 1ZK1A 4F5YA 1E2FA 3H1TA 4Q4AB 3E05A 2F7SA 2X19A 1VLHA 3ELUA 3R5SA 4QJ4A 2I7XA 4IUBS 2Y05A 4HWTA 3D81A 4Y6SA 4XRRA 3GJ7A 2C99A 4C20A 3CFYA 3H2HA 5CU7A 4EATA 4I1IA 2Z8YA 4MV1A 1OWPA 4A27A 4C05A 1B8PA 1SXJA 5C81A 1CG6A 1RRMA 1AXRA 3AIIA 3ZPXA 4D9EA 4BFLA 4E7PA 2J9FB 2BGNA 3D4LA 1TX4B 4MWSA 3B38A 2DG2A 2XUKA 3PNQA 4ENTA 2HK9A 1OZHA 1U3GA 3QY9A 4P36A 3VPHA 1US8B 1NULA 2ORWA 3DE0X 1POWA 4OU4A 4ZN6A 1I7PA 3R3ZA 4EMTA 4QRHA 1QKKA 3QXJA 3Q7EA 1OXKB 3I34X 5C1OA 3RYFB 1DKUA 3OZCA 4MJ7A 2ZRBA 1FLDA 5I3CA 2BFCB 3MTGA 3Q0IA 3RBAA 3I5XA 4C0LA 1YAJA 3ND6A 4JU9A 4F1KA 4GIBA 1YVUA 3M9XA 4EYGA 3CIFA 1UWVA 2EBHX 4P4GA 1KH3A 2GARA 4OBWA 2XUJA 1B8OA 4G07A 3EJWA 3NUZA 2HJWA 1W59A 2WFMA 1J2JA 4IFTA 4NE9A 3MBKA 5A5FA 1EA5A 4YR7A 4F93B 3IBSA 1WUTA 1XC7A 5G1PA 4RV4A 5KJCA 1EPUA 3HN7A 4CV1A 3P5BA 3CISA 2I99A 5DTEA 1FVXA 5AQ1A 2I6GA 4H7PA 1QHHA 1Z4MA 3OE7A 5DT9A 5IXJA 1ZSNA 2PG3A 1E18A 2QLNA 4NDNE 1J23A 3DOEA 1LLCA 1V1RA 2D06A 2QX8A 3Q3VA 4V0ME 1R5BA 3LVFO 3QVGB 3V7UA 4KPUB 2OMEA 3ZV7A 3UPTA 2C7QA 1C3OA 4WX2B 3VDNB 4BCDA 2BFWA 4P7FA 2Z6VA 4LJLA 1ZZGA 2B1QA 5ENDA 2KLBA 4EB6B 2RI6A 5JHGB 4DE5A 4F38A 4V1CA 3DMTC 2BL4A 3TW4A 1PS9A 3DOFA 2CMHA 3MSXA 4BNVA 4LHVA 2FEPA 3ZIDA 5BUQA 3PUHA 1N0HA 1BXZA 3N2EA 4L50A 4PLZA 2HMYB 5CBPB 3SZ3A 1RZRD 1PR2A 2AJLI 3UMGA 1W1IA 3SJZA 1YDGA 4G5GA 4QIHA 2R25B 4J6EA 1OT3A 2JGEA 2YZKA 3U40A 3V2HA 4ECAA 2IWRA 5EIBC 1OBCA 1IY1A 4FKMA 5DNVA 3UCEA 4DLAA 4JV5B 4POAA 4RM3A 4Y9DA 1I4WA 3V8BA 4H4CA 4ZRMA 1XTSA 2IS2A 1YONA 3P2MA 4QULA 5KBYA 2IYLD 1N5IA 4J7XA 4I50F 2M6LA 2CVHA 3DKRA 4BVJA 2SKEA 3EULA 3P94A 4D96A 3VJKA 3GLRA 3FPBA 1KDYA 2P3SA 5DHSA 3WL6A 1NAHA 3F7OA 3FCOA 5ALNA 3V55A 2CF6A 1GWNA 1THGA 3TO5A 2RSLA 1E79A 4GQIA 1NN0A 3RNLA 4RORA 4AIRA 5M2QA 1AV7A 2II6A 3ROMA 1PU2A 4BNWA 4HXYA 2CVQA 2AHRA 4FFSA 4G24A 5C8XA 2W8ZA 3KQSA 1UBLS 1ENPA 5L45A 1KVRA 3L01A 1RZRA 5BUCA 1DT5A 3VR5H 3Q3EA 1JEOA 3U9TA 1IAVA 1FFWA 5CT9A 4B46A 1D2NA 1WU7A 1XQWA 2PZGA 2WHEA 2UZ1A 2WD7A 2Q1SA 1X7XB 3CUEF 3DFIA 4GNKA 3PJFA 4KI0A 1EX6A 2W70A 2DPLA 1F2UA 1G21A 1O77A 1YHNA 3IAEA 1LI7A 1WVGA 5JBQA 5A03A 5B6IA 3VPSA 4IHJF 2XXAA 1CY1A 5L3SB 3CF4A 1C2TA 1G3QA 1UBOS 5KWSA 4UATA 3QE3A 5FNVF 2ZRMA 4MMYB 4PAOA 4B43A 3FB1A 3PJGA 4Y2YA 2ZCJA 2RCYA 2SKCA 2VZ9A 1XLTA 2QQ5A 5PGMA 2VT7A 3T7SA 1CR0A 3KB1A 3QYAA 1E8NA 4KTTE 5H82A 1NP6A 1E9RA 4BMZA 4DEXA 5AW3A 4EPXA 4IJ5A 3A2MA 3UXEA 1V8FA 2WSSA 1Q3KA 1UJ4A 4HWKA 1GUFA 5TF4A 1GNVA 1NUSA 2D59A 4YEDA 1V8PA 3NANA 4M1TA 3PWKA 1P73A 3L4EA 4UOEA 2QD3A 1LQ2A 2D2XA 3KEGA 3MBIA 1R0BA 4CI9A 4V2IA 4EZBA 1TOAA 1VIMA 2COEA 1TVEA 2VWPA 4M9SA 3CE6A 2IDKA 3SK0A 5ER9A 1X1RA 3AONB 2ZBRA 4HWGA 1KI1A 2QWXA 2ZULA 4GWKA 4EJSB 3IVXA 3AJDA 3PZBA 4JEIA 3CLHA 4WY8A 4Z9XA 3TSWA 4OSEA 4R5HA 1A9PA 1V95A 4TSFD 4AWBA 3S0JA 4UQOA 2HMWA 3HL0A 5JIBA 1IY0A 4KE7A 1G8HA 4QUAA 1QOZA 4PZAA 1TQ4A 2C3YA 2JGJA 1Q0UA 4GFDA 1MV8A 2R8RA 2IXAA 1N5MA 3OIGA 2BMVA 4JBHA 3ICWA 1SQFA 4K6MA 5E6RA 3RC7A 3QLUC 5JPDA 3EGEA 5U9CA 1JR2A 3NH6A 4G85A 4BOYA 5B2FA 4YHBA 1H66A 2DQSA 2NAFA 1MPXA 3FUXA 3PHJA 2O07A 2DUMA 1OI7A 3EZ7A 3OJ0A 4LVNA 4NEGA 5AHRA 4AT1A 5MN6A 5HIMA 3IBTA 3E9RA 2OECA 3JAWB 4BVLA 2CLFB 4WNCA 2W37A 1YH3A 3QLVC 5DXAA 1ZNYA 2JIRA 4BEVA 3AFMA 3IBCA 3DLHA 2W2OA 4WLUA 1NBHA 3ZHOA 2GWHA 1TTHA 1F2DA 2JCXA 3OX4A 5ITZB 3DB1A 1JKFA 1IN1A 2G5TA 3ROEA 3H04A 3IHWA 2ECOA 3QFRA 4KW7A 4Y6OA 2JVIA 1VJ0A 3K05A 4KIJA 4Q7KA 2ONZA 3AOGA 3LNTA 4E0BA 1NBEA 3TEFA 5B1SA 4EKDA 1TQHA 1UH5A 2AZ4A 2NTYC 1EDZA 5IPFA 4KTVE 2MSNA 5BQ5A 3KYBA 1U0LA 1J2RA 2FSGA 2O1SA 1MEEA 1NXPA 4FR5A 4G0XA 5ELXA 3JTMA 1DSSG 1VHWA 3I73A 3NVDA 4Q5IA 1EB9A 2YXPX 3D8HA 3PF9A 1Q1ZA 4R01A 4PS0A 5I7HA 3CKLA 4MTCA 4ZOAA 3O75A 3MK31 2I4IA 1P2UA 4WNYA 4CMAA 2ZRKA 1QTQA 3U19A 3JR3A 1CEXA 1N25A 4HQKA 4XUDA 4FDLA 4KOAA 5H68A 5D1HA 1XFDA 1CLUA 2RKBA 1HG1A 1CYDA 2WPDA 1U9JA 1VSUA 4QBHA 5DYTA 4F45A 3QUQA 5JMTA 4KFTA 5E9WA 3IERA 2VPQA 3K6RA 3KWFA 3Q7RA 5AI5A 5A0TA 1NN1A 4NBSA 1DJQA 5H7XA 3H9GA 1C29B 1DU4A 4IDHA 2A58A 2YOFA 4LRQA 3QE9Y 3R1IA 4O2BF 5LXTA 2FMHA 4J2TA 4UQLA 3Q88A 1NASA 2C9BA 2R66A 3ZQ4A 4XYBA 4E08A 1YUNA 1L5HB 2VEDA 1Q20A 2L18A 5D3MB 3RIXA 3SYMA 3K1AA 5D5QA 3RJ9A 2QRMA 2WAXA 3EXFA 4NYIR 2HL6A 1WR8A 3IEKA 2ZE5A 2P9FA 4OFBA 1KARA 4ROTA 3VO9A 4QOFA 3WL4A 4F5EA 1JVSA 4EHLA 5ECWA 1G5TA 1GO2A 3MTQA 1JEAA 3JD4A 2H3EA 3T6KA 5CA1F 3RC2A 2Y0BA 4YJGB 2QTVA 4TLAA 3TLXA 3LC0A 2QPOA 4DUPA 2V55B 5LNK6 1LKZA 1U81A 4FWIB 1QBGA 3QXXA 2CV1A 3MS2A 4G81A 4N3AA 5EMKA 3TIGA 3ROKA 4O4LF 1I0IA 1DXHA 4WN3A 4MUFA 5SY4A 2XUGA 4XJVA 5KTMA 2WU3A 2KM1A 1TYAE 2PYZA 4H3VA 2J0SA 4TKVB 1HR0B 2NZXA 1U98A 4JFAA 4E5YA 1O94A 5JBIA 1D4OA 1KGDA 3PK0A 4Z9FA 5BSTA 3VX4A 4J0HA 3WNDA 4BQOA 2I2FA 1ABBA 1Q0TA 1Y5RA 2F00A 5KI6A 3KS9A 1WUYA 1MENA 2GAIA 3KWJA 5EAIA 5K3FB 4RL6A 3RG2A 4BBAA 4KO2S 4TKUA 2X14A 1LTQA 2GN4A 5H5JA 1J42A 3VHXA 1XQYA 1KEPA 4P22A 3JR7A 1KC1A 4NZZA 3BM5A 1T3GA 5CLGA 5EKDA 1U9IA 3KB8A 5EWLA 3ZWXA 1U7UA 1BA2A 1TC1A 3LE8A 3CN9A 3EMBA 4GOMD 5FV7A 3ONEA 1T4CB 4GXNA 3DOHA 2OKCA 1T4BA 4M1ZA 2Q0QA 4N3CA 3FNIA 1H9CA 4PHHA 3FYHA 4YJFA 3V00A 2JIBA 3WKEA 2HYIC 1MO3A 4D8WA 4JLSA 1SURA 2GJ4A 3IOCA 4W9NC 2GJKA 1C8LA 3B9BA 4U7PB 5LBUA 2R00A 4EKYA 1G8AA 1SY7A 4L0MA 3ETDA 4LYYA 4DDVA 3WLJA 3U3KA 2AI1A 2PV0A 3I58A 5I6DA 3NU1A 4ND7A 3QMPA 3W3AD 4RDXA 1OXMA 1FRZA 5NULA 4E2XA 3TVDA 5EWLB 3LECA 4PO1A 3ONVA 4IGKA 3U7QA 4PPFA 3LPDA 4NMWA 1RM5A 3KZ1E 4MHSA 5TPWA 2O3JA 4MO9A 1WZIA 4URWR 5DLQC 4B4KA 3TSCA 4BMYA 1TJYA 1XVTA 1UXIA 3G8CA 2XMGA 4IDCA 1E5DA 2PZBA 1ZGZA 4FE4A 5EERA 3TI7A 1QV6A 3R5XA 1R9GA 5FOXA 3E03A 4M0MA 1OX4A 3GJTA 3JARB 3X1KA 1VPDA 1MNQA 2HGSA 2PR2A 4E70A 4BWYA 3UHPA 5A7HA 3DUFB 4PC1A 2I22A 4WCDA 1N2IA 4XGQA 1Q7EA 1E2MA 1LPSA 4HGYA 4GKJB 5JAHA 1GTMA 1USGA 1NMZA 1PWYE 3HYSA 2OXTA 4IX9A 5ERGB 2X5JO 3AU8A 4P8RA 4JT2A 4E07A 3SM3A 2PFSA 1T1SA 1NWCA 2PX0A 1YUBA 5LOVF 3C6ZA 3NHSA 1ZBDA 1B6GA 1VM6A 1WLSA 3EGCA 4FFWA 4RVCA 1A8QA 4MYCA 1HDEA 3RRFA 2PX4A 3N2GA 5CHYA 3KUKA 1HH4A 4Q3BA 4AO7A 1Z2CA 2Q28A 4PC6A 3TDMA 1OXXK 3EVFA 5FBLB 5A62A 3ICOA 2ZXUA 1QQAA 3N87A 5J3JA 1FX0B 2OBBA 1VPWA 2RGDA 1MB0A 3H1AA 3JASA 2W90A 1OKKA 2X8LA 4IZ6A 4LJRA 4MAAA 5JXGA 1QPBA 3A4TA 3COJA 1ZQ1A 4AUKA 1C7JA 4CN9A 4BQFA 1YI0A 1U0HC 2D3TA 3A7DA 4FINA 3R23A 1EVJA 1Q7TA 2EFJA 1OY1A 1DRVA 3KB6A 4JJ8A 4ZPJA 3X1MA 4RLQA 2FB9A 5IT4A 4PYNA 3K5HA 4BRUA 1M2HA 2QR2A 1RWMA 2QQ0A 4NARA 3WLAA 2J48A 5JFTA 3U6BA 1OGYA 4IDQA 4XX0B 3K09C 5CA1A 2GF9A 1FU4A 4FYKA 3I76A 2P6PA 3A1TA 4M9UA 1SPXA 5FOUA 2OCKA 4HEA1 1WVMA 2DQKA 1NQWA 5DHRA 1BYIA 3O4RA 3ENQA 1N5OX 1W2HA 3EFEA 3OCCA 1KAHA 1DIGA 1J0EA 3ESDA 1E58A 4UE2A 2AI3A 1C30A 2VJPA 4XDYA 3GVIA 2OK7A 4Y30A 3T61A 4EHBA 2ICAA 5AJUA 1N2XA 2IU0A 4DNFA 2EQBA 3S7TA 1KMIY 1TA4A 1U7TA 3OE1A 1ZJYA 5A5VA 2NVUA 4H1TA 4G0QA 3RFFA 4IMIB 1P2DA 2WTNA 5G2OA 2JJMA 4FWBA 3PDCA 1G5FA 4V2UA 3WGJA 5BURA 2NO7A 1GTSA 5DSTA 4EPVA 2B3DA 3G79A 3L5OA 5TT0A 4F0JA 1EX7A 1RRVA 1DKRA 3HCAA 4FM9A 3EWNA 1N5RA 4B8WA 3BRQA 2IYFA 1XRSB 2MYTA 2XVMA 3ASYA 1ZOIA 1SXHA 1UKZA 3CRZA 3PC6A 2KS6A 5BV2P 1JLKA 2K2QB 3H9JA 3ZTYA 1ORWA 5KOJB 3UUGA 1KEUA 3EGVA 4TVBA 3SFVA 3BTUA 4ALLA 1HL3A 3PQ7A 2C29D 5A5DA 1RIFA 5JSKA 4Q37A 2DU8A 1SUWA 1B73A 3K9QO 3KBOA 1B00A 5C34B 1MB3A 4MVJD 3FTFA 1YKGA 2YIVX 2P9JA 2R8XA 2FWNA 4HXGA 2VH2A 3CT4A 2YOGA 4BDTA 2FW7A 2ZZNA 5EN4A 1NJ8A 1EFTA 2QY6A 1XRMA 3CQ9A 4G0UA 3DE1X 1P61B 3H4VA 3R4VA 1GPLA 3TZCA 4E5UA 1JNYA 2V58A 2P30A 1DL5A 1CW2B 4MCJA 3BD6A 4A6XA 1H4QA 5IVPA 1K8QA 2I55A 1X19A 3QYFA 1XROA 1X9IA 1J90A 2PVPA 2YXEA 1EWRA 1TK9A 3MQ4A 3R3WA 3WLMA 2G63A 2C83A 3OJXA 5HKAA 2B9EA 2VHVA 1N2CE 2FZ4A 4QOIA 1UK7A 4TXHA 3COZA 2A94A 3A11A 1A88A 5CH3A 2G9NA 1CUJA 3NH9A 4UBOA 5DX0A 4EUNA 3VR3D 4ZV4A 2D5CA 3FUCA 3OU7A 2BBOA 2AQIA 1CC1S 1F0KA 3CC8A 3IXMA 1DXQA 1S3SA 2G8NA 2XDAA 4YBRA 2OGTA 2B69A 4RLHA 1SMKA 1JYSA 3VAAA 3HSKA 4LWQA 3S2SA 3HJFA 2V74B 4C87A 5KYKA 2GZ3A 2YVUA 2JGLA 3KV3O 4MJ3A 4RBNA 1R4NA 3TRHA 3ZJVA 1IYZA 1XXHE 1W5FA 2WYWA 2QTLA 5GJWC 1KPGA 2AJCA 4Q3AA 3WJAA 4RTMA 1N6OA 2O2JA 4PSKA 3VMMA 2OL4A 4TV9F 1K8XB 3OQ6A 1SFRA 2P2YA 2D4HA 2JA1A 3JQ9C 2IHKA 2GJSA 5DCUA 2CXSA 4DLWA 2ZJ3A 2BWJA 4D3XA 1RMYA 3Q1LA 3IC5A 3ILSA 4ZQCB 4C5BA 5K8UA 3ISVA 4J7CA 2GASA 1PFYA 1HTBA 1ZJ5A 2VF4X 1XZEA 2XI4A 2QVXX 3KKMA 3LFHA 3NYWA 1ZIOA 4MB6A 4NNPA 3V3TA 5JSUA 1PK7A 2QZ9A 3FDZA 2JAOA 2QT9A 2QGFA 3DMNA 5EZSA 3HJUA 4OEHA 4EVRA 5L7TA 1KYXA 3R0VA 3KSBC 1HQKA 1ULSA 3P4XA 1C14A 4ZVSA 2EFCB 2HQOA 2EJUA 1GQFA 1SCQA 1NVVR 4JYPA 2YV4A 1L7AA 1EM8A 3I2JA 5IFKA 4FT4A 2GZSA 2I7TA 1V5IA 2CB9A 2OCDA 2WWHA 4KDCA 3QFCA 1WW8A 2ZQYA 4RHXA 4YMWA 3T7RA 2JAWA 2IELA 4EABA 4ZYXA 4KMOA 2W58A 1EQ2A 1T34A 3VDMA 3ZDQA 1VE9A 4HS4A 5F52A 1F06A 5D85A 4C4OA 3N7TA 4MS4B 4OLBA 3OESA 1QIFA 4W5NA 1W88A 1EWYA 4ZZ2A 4UXHA 1M74A 1PJ3A 4D6YA 3D2BA 2IXFA 4ZRNA 1EE9A 4R9UC 2VH5R 3GFGA 4EMSA 2JFGA 3FGZA 1GGKA 1P91A 2FRVA 4JSYA 4PO9A 5JG7A 3PVSA 1F3OA 4GLFA 1ODSA 4Z9YA 5AKLA 5KYYA 3C15C 5F76A 3VR0A 3G2OA 5A3QA 2YZGA 1Z3IX 1AKVA 1PGJA 2AFHE 4RF3A 2Q8QA 3W9YA 4D3DA 1F20A 1VKHA 2D1QA 1QSGA 1QF9A 2E4XA 3P71T 2Y6VA 2FK7A 4ZTUB 2WF8A 1MBZA 1VL1A 1HNZB 1NSTA 3C3PA 4CQMD 3SR4A 4JP1A 1X1EA 2XF8A 4QHSA 2MYNA 3IEPA 3OJFA 1GHTA 3K3PA 3ZI7A 4I4LA 1VLMA 4UAVA 3AG6A 1IBSA 4D9MA 2E82A 1WCYA 1C1DB 2I6XA 1KSJA 2Z3ZA 4HP8A 3Q3IA 1J9GA 3TOVA 7MHTA 1EXMA 2PQ0A 4JL5A 4PO8A 1LQTA 1PEKE 1QVZA 2IJGX 4FU0A 3NHAA 1CZLA 2EKZA 5TX7A 5LQMA 1W5EA 4QX6A 4EY5A 3EOBI 3WIUA 3ZIAD 1G8GA 4Z4CA 4OMDA 2AGVA 5JNLA 1LW7A 1N2CB 3AZQA 3WGNA 2HXGA 4CM4B 5G53C 2E49A 4J4TA 4YAEA 2VNJA 3H6KA 1AKRA 1VB3A 2YXBA 4G5QA 2D54A 1JIVA 1F60A 1QS0B 1GG2A 2ID7A 4JYMA 3ZU5A 4EDHA 3P96A 2QN3A 1U2PA 4LV5B 4PLWA 1DBQA 3KOUA 3V2GA 1AZTA 2DTXA 2QRZA 2VVTA 2HHHB 4J2OA 3UW3A 3K6KA 3HCPA 3PYMA 4YK7A 4ZEVA 3PKJA 1C9DB 2QL5A 1FSGA 4ODIA 2VS1A 3N76A 4IDDA 1TEVA 2ODAA 4IGFA 1QH8A 5LQCA 4NE2A 4V0QA 5B6JA 4WLVA 2FDCA 1POXA 2B4QA 4Q21A 3S5JA 1CK4A 3CUYA 4LGMA 3G5UA 3M83A 4GPBA 3ABQB 4INZA 4RSHA 5IAKA 4KFRA 2GB4A 2H4XA 1BG6A 1GJRA 2FPKA 3D0KA 3IMEA 4FCVA 2WPDD 4M21A 4QBGB 3HQ4O 1F48A 1FA9A 1V39A 3NALA 4II7A 4RWZA 2QRVA 4OYYA 2MSWA 3DE7X 3L8MA 4JJ6A 4Q3EA 3ZW8A 4US0R 3FOEC 1QU2A 3SJ7A 3QELB 4EG7A 1H4SA 4Q4LA 3ESQA 3RJTA 2AR9A 3I09A 1OKKD 2YQZA 1ZPDA 3EIWA 1I4LD 1YK1A 3WL3A 2E6KA 1YRLA 2JKVA 3P52A 4PZ0A 3PUJA 4XSHA 4GL4A 1Z33A 4FFDA 2F1OA 5JLJA 2VTKA 5DZSA 1ZRSA 1GL3A 3MUFA 4ZQGA 1I5RA 2HJSA 2XXAB 3D8UA 4C3ZA 1SCIA 5TB5A 4HB3A 1JSLA 2NQ8A 2C94A 4D3FA 1CEYA 3VR4D 1TF5A 5BW5A 1QCDA 1QK3A 4XFKA 1U63A 3ZCSA 3BGIA 2XNDD 1K08A 3NAQA 2XIQA 3F5QA 1SC9A 2BMWA 1N1EA 1FQWA 1SHLA 1XHFA 2RAUA 5EIEA 5F98A 1JALA 1SELA 5I47A 4DV3B 2FE1A 4M2LA 2Q1TA 2PS0A 3G49A 4N41A 2VHUA 2X9GA 4LUCA 4RDCA 1EVZA 4ZAGA 4C78A 4DT1B 2AFHB 3WL5A 3NBYC 3TXYA 5B64A 2HWXA 1MX5A 2FLKA 4MRMB 3RUAA 5AW8A 4L2IB 4MKIA 2B6HA 5CX4A 1HDXA 3K96A 5DTJA 1GILA 5AJVB 5H1YA 3W1EA 1Z4OA 5TLSA 2BF4A 2F17A 3SZLA 5E9AA 1HFEL 1R66A 4Z2YA 3DZBA 3T34A 4Q9HA 5BQOA 2QNBA 3BMNA 1GPDG 4KAXA 3P0HA 2CGEA 1KO4A 3I37X 1G60A 3LLVA 1FOEB 3CLUC 5G0WA 4DVJA 2IZ7A 1V16A 3FTPA 4RK0A 1HSOA 4KMMA 3S1LA 3EZYA 1KS2A 3C41J 2GBCA 3KLPX 4AKSA 2GCOB 2FFQA 4FCTA 4HQNA 2AFIB 3MGCA 1V11B 2XX3A 4HQOA 3ABOB 5FOQA 5IBCA 2ZRHA 1UXKA 1O5OA 1Y9ZA 4M60A 3QV1A 1E3DA 2P3LA 4X6LA 4BO6A 4NE7A 5BN1A 1VYUA 1A1SA 2G5PA 4RZXA 1G38A 3SOPA 4L9WA 1VJ1A 3L6UA 1Z2NX 1VKZA 3A7EA 1M8FA 3QH4A 2R751 5COAA 3WQRA 5I4BA 1UAGA 5L4LA 2NO0A 3EMDA 4NPAA 3BSFA 2I4RA 4PE5B 2QX9A 1IZ7A 2B34A 2UZIR 3EXHA 3N2ZB 4LFBB 3RTCA 1MHTA 3FHTA 2BEWB 4K6GA 1M5UA 5BV7A 3UJ9A 3DEJA 5DM60 4TKLA 4TYNA 2KHZA 3SYNA 2FUG1 2YY6A 4UTVA 1UPAA 3LOQA 1GRCA 4WKCA 2D2VA 1R9JA 2PT5A 2DWPA 1Y7PA 1R5NA 3PCTA 4ZEOA 3R8FA 4XJSA 1YASA 4DLSA 3ZCRA 2ECFA 3AXTA 4Q39A 1BMFA 1TB4A 4OBBA 3NQ41 1DX6A 4UHHA 4ETWA 5H4HA 1U04A 4FHGA 1E9EA 4LYHA 1MUUA 4GPTA 3CS3A 3SDSA 1LBEA 2IZ0A 3EF0A 5THXA 1QHEA 1VI6A 5LZ7A 5CCEA 2OCBA 3LZDA 4UZFA 2GFIA 3WBKA 4INAA 4JT4A 3DKKA 2IEYA 3KYCA 5C1BA 3TUIC 3WLPA 2X0JA 3RTGA 3SJUA 3KXPA 4WCVA 3DEAA 2A86A 4ER6A 3IDFA 3PC8C 2GJAA 4KWTA 2H7XA 4ZVUA 3VVBA 1U3DA 2RGXA 5DLYA 4B6JA 3TNJA 4DZZA 3RIEA 4QTZA 4IEIA 1GTVA 1SC4A 1XKLA 3M6LA 5ECGC 1SUFA 4X6YA 3WIEA 4YLEA 1DC6A 4X65B 3T5PA 4FD2A 5I4KA 4OJNA 3RTEA 3D3QA 3FTNA 3L7BA 5AI0A 4W5TA 2ZLBA 2A33A 3K1TA 4N5MA 1U7DA 4EPWA 2D8MA 5BWCA 3UXHA 5AOBA 1YFJA 1DLIA 5C2JB 3GR6A 1SCBA 2V6IA 1T0BA 2PWZA 3QMMA 5DB4A 2PX2A 5EMNA 2QXUA 4A8HA 4QJIA 4G25A 4G3XA 3DNFA 2FDXA 3S2IA 4QQNA 4IPTA 4NIMA 1RQXA 1TT5B 2VUTA 1F6DA 1FP1D 1L7BA 2H1SA 1RBYA 1SOWA 5LB4A 3STVA 3V4ZA 1PKXA 4YCSA 1XXLA 3BC1A 1D6NA 4YRPA 3PPXA 4XX1A 3TUZC 1CVLA 3WLHA 2PLRA 1FJ2A 3E81A 4Q9IA 2O8BB 4JB3A 1RD4A 4A2CA 1S8OA 5HRAA 1JE1A 1WDWB 1KZYC 4Z0HO 4GI2A 4I55F 4YXFA 3V42A 2G76A 3H1PA 1N3LA 4OP2A 1CY4A 1PEAA 5A6SB 1WB6A 1O4WA 1EFPA 2WJVA 4RVSA 2OLEA 4UVGA 1APBA 4YI5A 4FIDA 1I2ZA 2NSYA 1C7FA 3EEQA 5ICMA 3L04A 1ZCZA 4RKYA 3ML1A 5JANA 2REQA 2VO1A 1ZG3A 5CJJA 2DEUA 3BK7A 3C1UA 3IKJA 4XUCA 3WA7A 3S8EA 3V8VA 2P0AA 4AF7A 1JW9B 3K5IA 1SZJG 1ZN2A 2DWCA 1OWNA 4BEBA 2QMUA 3GK3A 1NUUA 5ADWA 5LQAA 1LF5A 1N7GA 2I67A 3D3NA 5AK4A 5KWVA 2NXNA 1QV7A 4QSMA 2YIJA 4HDMA 5TPZD 3STXA 1KYWA 3LCCA 4DN6A 2YYSA 1S4QA 4KWCA 4Q48A 2P7IA 2B8JA 2I4OA 3IOBA 4JR2A 3ZVKA 3JVEA 5DHAA 16PKA 3X1JA 2PUGA 1FDTA 1TUBA 4J75A 1I24A 4FNAA 2JIZD 3DDCA 4MMZB 4YMSA 2OD2A 2WYVA 5P21A 5ARBA 1UODA 3PICA 2HIHA 5TSDA 4Q7EA 3IJ5A 3ROGA 3UUEA 3IQWA 1ZM7A 3EMVA 3NIGB 5E7MA 1QAOA 1WP9A 1LDNA 2C2WA 1R16A 5LQRA 4UCQA 1PTJC 1GPAA 4Y0AA 1SZCA 5HVNA 1J49A 2OQ2A 2QX7A 3D02A 4TV8B 2ZVDA 4YRQA 5JPCA 2I0FA 3EEIA 2RCNA 4U6SA 3B3GA 1J06A 4R98A 5TPWB 3BN3A 4HWRA 5AXCA 3OFNA 4P0QB 3A06A 3EA0A 1C0PA 1QX4A 2H4WA 4EEKA 1VYVA 2FFAA 5DWVA 3TBHA 5L8VA 4NRDA 2MSLA 1X94A 1Q74A 2O2IA 3AF1A 3C6MA 2O20A 4MGZR 1WXQA 1Y33E 4PLVA 2PR7A 1USKA 3OMWA 3RLIA 2B0CA 4D74A 3RCBA 2G09A 1ZMXA 4R0MA 1NW3A 3KZKA 4B3BA 3ONFA 1C7QA 5IHXA 1CUYA 3AEUA 1Z3CA 1FP4A 2P77A 5DP2A 5HF8A 4WLFA 1L4GA 1UF9A 3K9WA 1IBMB 1H4TA 2J3LA 2JFPA 3IP5A 3LCRA 1JT2A 5T8KA 4Q4HB 1ZSYA 1VYHA 3IVGA 3PA8A 1CJUC 2B92A 1PV1A 4KPFC 3TZBA 4I46A 4H1UA 2OAEA 4IOKA 5DEIA 3WYBA 4NOJA 1AC5A 2HIMA 4V0NA 5GV7A 3LU1A 4MROA 1KSGA 1UBTS 2O8DB 1VBMA 3ZIUA 2HUPA 2JIQA 4J29A 4MWOA 4P82A 4EG0A 1J2YA 5FYDA 2CFIA 3D6HA 5EE0A 4QU5A 1FFAA 4IQ8A 3VH3A 2O19A 1RI5A 1ATIA 1I4EB 3GVCA 4FR0A 4UD2A 1HQYE 2PXHA 3T5GA 5K7SA 4LBYA 2Q7DA 4ACBA 5JATA 4M0EA 5CFMA 1GGFA 5J1SB 4QREA 4ZT6A 3DLAA 4MKGA 3H5OA 4DIFA 1VRWA 4I9UA 4W63A 1V3VA 3JY6A 2CLHB 5LDGA 5CTAA 4DPMA 1WUJS 1EGAA 3B1VA 2EW8A 2Y71A 2RJNA 4Q4JB 1ZRMA 4I6EA 3S2ZA 4BAGA 1LS1A 5FPYA 1QMPA 3L1IA 3QU2A 3E35A 3E7PA 5KYWA 2W6CX 2JIOA 4WZ6A 1NUAA 1IN6A 3OM1A 4Q3KA 5FHQA 4DXHA 4JA2A 2ESRA 2P11A 5TXGA 4DSAA 2P2ZA 2FX3A 2VDKB 2WHPB 2PGNA 5FBWB 3ECSA 2XA2A 3BRCA 3L7NA 1EK6A 4XCVA 3R9XB 1TJ4A 1IHPA 2I6SA 3EASA 2PMKA 4TVKA 1CFZA 4GZLA 1HL7A 3L8GA 4MK4A 4DMRA 1J1UA 1V26A 2X9QA 3WDKA 1PZNA 3UC5A 2ZB8A 1XN1A 1AJEA 2QUJA 3IQHX 4GR5A 1GAQA 1VQ1A 4NP6A 4RTRA 3FMGA 4G1BA 4JNCA 3ZHRA 4E4RA 2E1RA 3UK7A 2H2FA 4JEMA 3VOBA 1HFWA 2ZCVA 3KKOA 1F9EA 3HH8A 4TWIA 5DHTA 1Z26A 3VPFA 3IIKA 4C76A 1B0UA 2HCJB 1G8YA 4MR8A 4LBZA 2ZJFA 3KEQA 4ZCQA 5AO9A 1ODTC 2CCGA 2BFOA 3KPVA 5EMJA 2ZI7A 3ZGNA 2QRVB 1I80A 1XCBA 5ESXA 3OOSA 4UUNA 4FZ3A 2QVBA 4HAYA 3ZJ4A 1IH8A 2DH6A 4TYPA 5I3ZA 3QPVA 3W5DA 3DC2A 4WKNA 4BVHA 4EPYA 3ZXSA 4TVSA 1VIVA 2XT9A 4XD7A 5DGIA 4C6TA 1ZUHA 3BD9A 3RV4A 1JQJC 5CB8A 1XV5A 4WH0A 1AQIA 5I7EA 4B4DA 1OZAA 2FSHA 4ZCMA 2ZQZA 2QE6A 3F8TA 3DJYA 4EQ6B 4YCJA 1NQOA 1UC9A 1Y4DE 1PRYA 2YCBA 3JX9A 4GKBA 1SXPA 2EKPA 2B94A 3GL9A 2JGIA 3LC1O 2F62A 2HSJA 2VWQA 4OJKA 5DDIP 3IEXA 2HF7A 4J90A 4KC0A 3VM6A 3X1WA 1Y80A 1PR6A 1DEAA 1QORA 2P78A 4BJ6A 4XARA 1RT9A 1Z13A 2ZT7A 3RFXA 1EFPB 3BB1A 4WFIA 2B1JA 3SBDA 1P33A 4KQKA 1NBMA 4LE2A 4QT4A 2FMFA 4AP5A 4TTQA 4QOSA 1VB5A 5LSAA 1SVIA 1IG3A 2GYYA 4C3VA 1HWYA 3UC9A 5AKZA 1J24A 2ZVPX 4PZZA 5D7NA 5EJEA 1ZIDA 1Y37A 1FYWA 3JQAB 3R7SA 1W49A 1PBTA 2CK3A 3FRHA 4H7JA 4XR9A 5BWOA 3P9PA 3U17A 3RASA 3KDPA 1HLDA 2VR1A 1ORRA 4C6SA 1QCZA 3GFFA 5L3ZA 1S96A 1IQ0A 1U3TA 3LX5A 4UBLA 4GSYA 1HBJA 1NMQA 1ZUIA 3O74A 3QKIA 4G5XA 4QQRA 4QC2A 1X1AA 4IDEA 2AYYA 2H1HA 3R7BA 4BMCA 5B4TA 1E5VA 1AQJA 1NDQA 1ZXLA 2BMAA 3AVYA 1M2FA 2IYZA 3OQMA 4L57A 1TVKB 5T64A 3NBMA 4J0IA 1RYYA 3FPKA 5C0OE 4W7SA 2WTXA 2H5IA 4UFNA 4OSOA 2L0XA 2Q2VA 3OIYA 2ZRGA 1G20E 5DM2A 1TVCA 1CUBA 2H7CA 1Q16A 3IKMB 4OGKA 4R6XA 3ID6C 5SYNA 8AT1A 4EJSC 4H7DA 3I9V6 3GLHA 4HVCA 2Q5HA 3FNFA 3OJCA 2WJ3A 3THYB 1HYQA 2BZ0A 4LJKA 3ZWCA 1Z62A 4F60A 1E1MA 4PR3A 1ODIA 4YQFA 5FI5A 1DFIA 4HUQA 2HK8A 4GD3Q 1Q83A 3Q5GA 4O4JA 3O38A 5B53A 4BFVA 4EUKA 2Q8PA 4KRYA 2ES4A 2IYXA 2LRHA 2GVNA 2XVAA 3AXSA 4HAOA 3UATA 3UHJA 5B4VA 5FWYA 3K0AA 2X0KA 1AG9A 5AH0A 3AUXA 2YJ3A 1C80A 2XYPA 4FMCB 4NJMB 5DU2A 3PFIA 1KE1A 4Z1OA 2NXJA 1B1AA 1VDZA 5DOVA 5TVGA 5HRCA 1QV9A 4KIWA 2EX1A 5E3JA 2FDRA 4ITRC 4IV5A 4OXKA 3B89A 4K6FA 4LS3A 5LA6F 1I2BA 5CW2A 3ER9A 5AD1A 1NKVA 1FUIA 2IGTA 4C2UA 4TYMA 5G02A 3L8ZA 4QQKA 2GZ2A 1CHNA 3V2IA 1T4GA 2QEQA 5IDWA 4Y18A 3BWBA 3NT4A 5CDFE 4KZKA 5TQ0B 4AF8A 3COYA 3IPLA 5LM3A 4FFBB 3S81A 2XCIA 5CJ2A 4W9MC 3V1NA 1DMRA 3HS3A 1X80B 1TA0A 4V38A 4MGYR 3A28A 3GUCA 4R2KA 5BOVA 1NLUA 3ZV3A 4B2YA 1QHNA 2YW9A 4ZVNA 4ZO9A 2BZ1A 2C5BA 3O8DA 2BJVA 4TQAA 4AJJA 3C3BA 2I78A 3ACBA 1L5SA 2CNBA 3VC7A 2AN4A 2RHDA 1DQSA 2I4LA 2BGRA 3ESZA 1E3WA 3FAKA 3INTA 4MUYA 1T0JB 4R81A 2V3VA 3DLPX 4BKUA 1T1EA 2XMBA 4OPMA 4B79A 2YXLA 3CU5A 3BHIA 3O8BA 3CTPA 4HPXB 3ZLVA 2RHCA 1UFRA 3H1EA 1C7ZA 4O02B 2ZIZA 1HF3A 3R5HA 1U94A 3NHUA 2QF7A 2EZUA 1RRFA 2PL5A 3PGLA 3NBFA 3M2PA 1H0KA 1W1WA 1OR8A 4M0LA 2A5GA 2R3SA 1QP0A 3KEOA 5B3KA 4Y0VA 4RPJA 4XWWA 1QH1A 3CPHA 1N9ZA 1QIMA 5IN5A 3AI7A 3ZE8A 1HFJA 4NV0A 4F3RA 3A4YA 5CFLA 5H4GA 2DBVO 1GEEA 2D00A 1XO1A 2P5TB 1K9SA 1IMJA 5FTKA 2OZKA 1RAGA 3G1TA 3C3JA 2OESA 3JAKB 1M10A 2R6DA 1VHLA 4AJ4A 2G1UA 2R0QC 1ANKA 5E8RA 5ALPA 1VL2A 3NGMA 2IP4A 2XB8A 3M1IA 3MTEA 3OFSA 3QITA 1COZA 1NLZA 2FCRA 4K9PA 2W6QA 3V7FA 3WIOA 4DCOA 4I6JA 1JDZA 3V7WA 1B0AA 3DZKA 3HCWA 2UXCB 1YQWA 2CVPA 1UKEA 3OT1A 2WP0A 3CR8A 3Q10A 1KK0A 4N76A 3C7KA 2YC4C 2P40A 1XTRA 3SLGA 3BIXA 3NYRA 1Q1AA 3HXTA 3KOXA 4CM6A 4JZKA 4I8DA 4L6CA 4E6PA 4MQFA 1P31A 4MV8A 1O96B 2IDMA 1MIOA 1SOAA 2GO7A 4LJ9A 3WMWA 2AIRA 1XWWA 2HLDD 1JIJA 5D7BA 1COWD 3PX7A 1DPFA 2XHZA 1SBHA 2X2FA 3W1WA 1PT7A 3B1YA 1UDRA 1Z75A 2VDRB 4EB8A 5L3VA 4HWOA 4KVFA 2HU8A 1IHYA 4MVJF 3II6X 1R18A 1NQAO 3OEHA 2DWUA 4BIMA 3OZWA 1YS1X 4U5QA 3JTEA 4K46A 3N05A 5EP3A 4CR6A 3GELA 3Q8LA 1K75A 2JZOA 3COSA 4NH4A 2IOQA 1KOLA 4LDPA 2HQBA 2IEGA 3R5TA 4U7DA 4G0VA 1IFXA 2LCQA 3TF5A 1T9KA 1SA0A 1DB3A 3FR7A 3DOOA 1HT3A 4S05A 3EK2A 5J5VA 1NKTA 2WZBA 3MCZA 4D4LA 3INGA 4TLDA 5MGBA 1MD9A 3DO5A 2LGJA 4FZRA 3O2JA 3RS9A 3F90A 3FETA 1AKQA 4ZVMA 1XDGA 2JVKA 1G8MA 1SB8A 4TYYA 1RM0A 2R4TA 2V7WA 4O4IB 4INJA 4WKPA 4G1FA 4C29A 4J1SA 5KIAA 1Q7GA 5ILGA 3LRXA 3G5AA 3SJCA 5HJEA 1VPLA 3GUVA 1G4AE 4QT0A 2H1CA 2WM8A 4R2HA 5C51B 1NATA 1Y5LA 2OC9A 1NT2A 2IYTA 2P2CA 4O2AA 5HUQA 3D3WB 2JJ2D 2MINB 3O82A 5CB6A 2VQEB 1W1UA 2X0EA 3J80A 1U8UA 5G0SA 3GN1A 1IY9A 3VYSB 4MGEA 4OQYA 5HGJA 5AJZA 1Z4JA 1YKSA 3ENKA 2Q6VA 1ADFA 3LWNA 1X77A 2A67A 5BN5B 4KLRA 4D9CA 4J1NA 3DDOA 2C59A 4AN4A 3ABRB 1A7KA 4OREX 1R5JA 1AO0A 1G9SA 5JT1A 4P83A 4F7DA 2OO3A 4L8YA 5CDUA 5A6VA 3DHNA 5I8ZA 3AV3A 1QGUA 4JOBA 2C88A 4IZHA 3OZUA 4RIFA 5C7LO 3LOPA 2ACKA 3V97A 5CAEA 1DUVG 1C50A 1Z6QA 2NZJA 3JATB 4QDTA 5CLJA 2UDPA 1RS0A 2XIJA 1SQ0A 2IZ5A 4KE8A 3PXGA 3K15A 1GA4A 2XT6A 1TYDE 3TLJA 4YRAA 1P3JA 1UEXC 3P45A 2JI8A 4GVPA 4PHGA 2B8NA 2VP6A 1P7VA 1U0NA 1KZHA 1G64A 1P0QA 3DW3X 3WK7A 1ISMA 2K87A 3H2BA 2D13A 3M6FA 2WR8A 2VF8A 2J46A 1XWFA 3HDGA 3QU9A 1Y34E 3LLSA 1P29A 3IVMA 1OQAA 4J7AA 4IYJA 4MJLA 4MW2A 4CTMA 4PFKA 1BN6A 3L7KA 1IEWA 2ZRIA 1H3NA 3PJDA 3DSRA 4A0GA 2JGNA 4CTKA 3E5MA 1E3WB 3WMRA 1D1SA 2AW3A 1JFLA 5T4BA 4B35A 2NNLD 1SD2A 1WVIA 2L19A 2ZXFA 1MU0A 2XWSA 3TDNA 4BYGA 2AXEA 2PN1A 2A1UA 4FYIA 1XTPA 4GBED 1PLKA 1URPA 4DR7B 4EYQA 2Z30A 4Z9AA 1OMOA 3UHOA 1MQAA 2FR8C 2XJ4A 3H2KA 3SXUB 4EPTA 3C0KA 2Z2YA 4CHTA 4G1MB 1FTWA 4WL0A 3VGPA 3ZK9A 3IQDB 5J47A 4NBLA 5JRZA 4ZQEA 5FNVA 2WP8J 4D0SA 1NJSA 5K6TA 2GM9A 4EWLA 4L5IA 3GDOA 2EFDB 1M0SA 1V8ZA 1GKUB 2J0UA 1VIDA 4ZT7A 2FEKA 2CCJA 2PH3A 3OKCA 1XNRB 4XQCA 4TMTA 1QRSA 2Q5JA 3ELBA 1NXVA 3AEQB 2CCKA 4W5HA 3CY6A 4M83A 1CB7A 1FL9A 1Y3HA 2B9VA 3KQQA 1I6KA 1UOOA 1IOVA 4GMFA 4JKYA 2VJAA 4WI1A 3TB6A 3FE2A 3U4MA 1NVWQ 4B9EA 1UZLA 2X1HA 3MWFA 4G5RA 4BWGA 3WGVA 1E3SA 1YU6A 3KLNA 4IQ4A 2YICA 2ZM6B 2PSFA 2YMQA 2WT9A 3F6SA 4YJHA 4ZDJA 1E69A 1H2EA 1ML4A 1E5TA 5DWQA 4DWOA 1DO8A 1I51A 1M33A 2P90A 3KKPA 4H7HA 3UN1A 1UMKA 1IEQA 4MS3A 4QECA 2VXCA 3EIEA 3JQRA 4BLRA 1WZ2A 4YV2A 1WDTA 4O2RA 1TTTA 4N65A 2XLCA 1HDGO 3ADPA 4H35A 1HQCA 3WI7A 5CG2A 4KLZA 3GLGA 4I50A 2BDTA 1HKUA 5ARDA 3LIPA 3HCRA 4INPA 2OFFA 1YS7A 2VJLA 1NWHA 3W7VA 6YASA 1CB0A 2W2NA 4NKRA 4HDCA 1DTSA 4HX2A 4PX2A 4XIJA 1N6IA 3C4VA 1F0NA 4KN8A 4ZMRA 3SC6A 4ER3A 4BNHA 3D2CA 4MI3A 4PCAA 2PKQP 4G8CA 1I2AA 4XWOA 2BR5A 2FZGA 2OE2A 2IL1A 3KOMA 4DCSA 1XCMA 1A5BB 3BDVA 4BU0A 2PNFA 4C03A 2XRYA 4KQ1A 4IV0A 3H9CA 5DP1A 1NM5A 4MEJA 5THKA 3WMEA 2QN7A 1JEJA 1V96A 1HMPA 4WKBA 5EFOA 4BFXA 5F35A 5LBIA 3IUQA 4B32A 1FCJA 2BMJA 4ZYZA 1O96A 2Q6TA 3GZNA 4EHAA 1K6JA 1PP4A 1R5OA 2MSCB 3QUBA 1I2MA 4DLYA 4MINA 3OMLA 3FMVA 4AYWA 2IH5A 4QFCA 2QA5A 3E6AA 4XH9B 1YZYA 4BZQA 1O2DA 4C4ZA 4HGPA 4DL9A 2QVGA 5AUPB 1CKEA 2ZGVA 5IT0A 1BGWA 3O8RA 1XEXB 2FPGA 1C7EA 3T38A 5EJ9A 1U7ZA 2V7BA 1H2ZA 1FY2A 1YMVA 2FWPA 4K9RA 5FTNA 3U3RA 3AUAA 4RVNA 2ZRQA 3W05A 3I61A 4TWBA 1TUBB 3CLTC 1FFXB 5CVJA 1BCSB 3GGDA 1H1DA 1XF1A 3KQOA 2Y93A 5EQDA 5ULLA 1UP7A 3WLEA 4J4HA 1RCTE 2OBXA 2Q3FA 4X1IA 1B76A 1TKCA 3BGDA 3TFQA 3QELA 1SCJA 3BFPA 5D8DA 4CGZA 3N8IA 1QAMA 3CVXA 1ZONA 4M9XA 3EXEB 2O8NA 1JFFA 1UXOA 5F5LA 1QYWA 2TMYA 3LPNA 5F21A 4G6ZA 3D0OA 1O1YA 4EA9A 4I36A 2I6QA 1GKLA 1WZUA 1UPXA 1E6WA 1U2DA 2XKBA 4BGIA 2WTEA 4DGQA 4GDFA 4JN6B 4PXSA 4BN4A 3G59A 1QIDA 2J3QA 2XTMA 2HV8A 3RAJA 1W44A 3U1TA 1GNLA 3S27A 2IOFK 1TK2A 2H2GA 3ZE1B 5FPTA 1WB9A 4ZTBA 2NLOA 3L4JA 1LX7A 1FYEA 4G5YA 3HEBA 3PNVA 4HZUB 4AKHA 2CZCA 2HA0A 2JKYA 1SAYA 2RGUA 4RHEA 4QG7A 3ZWDA 1G18A 4YMUA 1DV2A 2EDAA 2HJGA 2ZBEA 3HGMA 4QYXA 4C88A 2O0JA 5CFPA 4LQLA 3CG4A 2IVFA 3UJ6A 4LHSA 4FC6A 4MW9A 4JI0B 4F85A 3KHTA 3LA8A 3L6DA 1CULC 3B6MA 1ZUNB 3L93A 5EJ2A 3RWOA 4HK4A 3VH1A 1MJGM 1MGPA 1Q44A 2BHTA 4RHYA 4AKTA 3D2LA 4JL8A 5IG2A 5FBHA 4B40A 4L7VA 2GYVA 2YX1A 2PD3A 3H16A 3E48A 3HUUA 4LJSA 5FPSA 1XZHA 2PK3A 3C14C 1GUBA 2CLOB 4DA8A 2A7XA 2H1LA 4U7FA 4WVFA 2OWDA 3KKZA 3PX3A 3R9KA 3W6PA 3ZBPA 3HMKA 3RC3A 4JUBA 2JLRA 1QK5A 2ZATA 3CH4B 5CG1A 5F78A 3W06A 3PD7A 3NP9A 1JXQA 3R3XA 3AVOA 3GLIA 5TNXA 5L6LB 2VXOA 1QGED 3ZVMA 1UMBA 2QXYA 3OTQA 4I08A 3OF5A 4ZYUA 4TKUB 2O1WA 2PUBA 3K70B 5HEKA 4B73A 2Z0MA 3HXLA 3RS8A 3D8TA 1PR9A 3OPNA 2EQ5A 2DLCX 1VLJA 1IXZA 4EY7A 1WE2A 1L4BA 4REMA 5B36A 1FFCA 2GTIA 5BVGB 3LGSA 1EFCA 4L6AA 2HW8A 2D7CA 2F59A 2VSFA 4I9FA 1RC1A 1RIIA 5CB0A 3M1YA 3WWYA 2FQYA 4UPEA 2IYPA 4QPZA 4IIFA 3KO8A 4U0JA 4JI4B 3ODGA 4WNAB 1QYDA 4OHYA 2MMGA 3B13B 3AF0A 3LVRE 1YR2A 3HJRA 5LIRA 1XTTA 2Y92A 1Z56C 3G6KA 3IKTA 1JQ5A 1IC6A 1ZNXA 3BXXA 4KO1S 4TKMA 1YULA 1GZHB 2F1JA 4D57A 5IKXA 3H3JA 3QX3A 4G26A 4ALKA 2WF9A 4I55A 4O8CA 4C1BA 2DH5A 1N2ZA 1HUQA 2O3QA 4DLLA 2DCUA 3ZDRA 3PXCX 2B5WA 1MX1A 3HSYA 1TQ6A 4I14A 3AOEA 1PL7A 3MRTA 3CLSC 5E8JA 5ADHA 5M29A 2A1IA 1E20A 1NW4A 3F5FA 4O4JF 4WBNB 3A0UA 4O2BA 3IULA 3UAOA 5HDBB 3CZRA 1V45E 2W71A 3AUUA 1IDN1 2HPVA 3R77A 4AM8A 1UP4A 2X4IA 2ZE6A 2FXVA 2CC2A 3RE1A 1XTUA 2QPAA 4BKOA 3PTLA 3UQZA 7MDHA 2EBUA 4P54A 2XGSA 4NABA 3KJFA 1L3IA 1RCFA 2Z5FA 4KR6A 1XMIA 3UKJA 1HZZA 2NSHA 1BHSA 2GYWA 3AHHA 1T9GS 3RUEA 3H5LA 4CDGA 1Z0AA 1LVUA 4P0TA 5KHOC 2C2OA 1CQWA 1J70A 3K0SA 1SKBA 2HRQA 5SV2A 3TRDA 3GVPA 3LC2O 3HU2A 2XE8A 4QVIA 4OIMA 1DQPA 1KHHA 3LGXA 4BLPA 2PWPA 1R4MA 1FUYB 5KNDH 1E4EB 3KU4A 4KU4A 4ZVOA 4FTWA 4Y7CA 4AG5A 3NI2A 5D3KA 2HA5A 5IUJC 3OE7D 4DA4A 1YDHA 2P68A 2ZUVA 1JV2B 1E3TA 2FZLA 1R8QA 4R8RA 3X2EA 4MWZA 3ZD9A 4NJOA 3S2UA 3W8DA 4CR8A 3PUWA 1W47A 3LKBA 4LJ4A 2ADOA 4OBEA 1B7GO 1ST3A 2BR3A 5SZKB 1Z74A 2IKQA 2Z2KA 2IHJA 5IF3A 3OCWA 3WK4A 1O8CA 3AR4A 4UVEA 4MX8A 3BXEA 3OOYA 1UM9B 4IYRA 4X95A 1QKIA 1ZISA 4KAFA 2VDWA 4EYOA 3C4QA 3EVBA 2GHQA 4AZSA 3CUUA 1NW9B 3KJEA 3ND9A 2VQ3A 4GEKA 3FRJA 1CCWA 4MR7A 2NUAB 5G0UA 5L3QA 4FYMA 3JZAA 4OFZA 1DBSA 3DYBA 5KNBH 3QM1A 2OHJA 3ELYA 2AL7A 2VPTA 4X93A 1ZGAA 3NBKA 1DTWA 4UULA 1GRQA 3ICVA 1P4SA 2EX0A 5A7GA 1XA4A 4R8SA 4E13A 4GMKA 2GNPA 2SNIE 4N47A 4XYGA 3WYFA 4B3XA 4K26A 2I29A 3QNWA 4HAIA 5BN5A 2IUYA 4ILEA 3L8FA 4UXIA 1UOPA 1YFZA 3D4OA 5IKOA 3OQIA 2UUBB 1JQBA 4QLAA 3VKUA 4C89A 1H1LA 2J6BA 3PGKA 3ICCA 1W29A 3ROTA 1J5XA 4G0OA 4MV6A 2Y99A 6REQA 1GPNA 1ISJA 4PXAA 1AU9A 4IXTA 1NLMA 1DC7A 4JVSB 1JEYA 4FQ5A 1LPAB 3R5KA 4LSGA 5B1IA 1ACMA 4CL0A 7REQA 2NU7A 5DXJA 2CL6X 2N0SA 4C6HA 1N2HA 4FWTA 4TL8A 3GFPA 2H85A 4Z5XA 2J41A 2KB0A 4I5IA 4NJMA 5CR9A 1JJIA 1XQVA 1F8GA 1B8NA 2XTAA 3IQZA 1QNLA 4ZI3A 5A9SB 3QY0A 4FYWA 1WUKS 4DQVA 2ZOSA 1GTL1 1KBOA 2IUFA 3WZ2A 1JFTA 5BV1A 2AZXA 2FPLA 1EM6A 3L7AA 1G1AA 1E2LA 1K3FA 2GZDA 4J94A 1F0PA 4YMGA 5IRCD 2FSUA 4DRZA 3OAAA 4ZGGA 3I0MA 2RJ3A 5D01A 4QU0A 2O0KA 1HT0A 1TM3E 3NEYA 5CLFA 2VA9A 1E7SA 1K66A 3TLKA 2Z83A 3TMKA 5LQNA 2X8WA 1VCOA 3K1JA 2ZB4A 3AZPA 1KMHB 4YAGA 1YR7A 3ET4A 2PUHA 4RPLA 3NJ4A 2O2HA 2QYHA 5F1YA 1J0BA 2EOAA 3UG6A 2MSKA 4CNBA 1PJ2A 3PYLA 1H22A 1UMDB 3HO6A 4A91A 3QRWA 3RSOA 2DMRA 3EPKA 2D7DA 5D5PA 4UMEA 2F1HA 1P9NA 4QD3A 4BGVA 5B3JC 4MUKA 1T3TA 4MQEB 4O4IF 1C9YA 4YLGA 5EJIA 1LZLA 2NSDA 3KJGA 2OY0A 3FMPB 1SWVA 1U2ZA 1JH8A 2IYRA 1FMFA 1NNI1 2QAGA 4PSVA 2ACVA 3QYPA 1JI0A 3Q87B 1MOQA 2IP2A 3LF1A 4HG2A