2ZCVA

Crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
283
Chain Sequence
MIAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALAAQGITVRQADYGDEAALTSALQGVEKLLLISSSEVGQRAPQHRNVINAAKAAGVKFIAYTSLLHADTSPLGLADEHIETEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQNLSEADFAAALKSVGLPDGLADMLADSDVGASKGGLFDDSKTLSKLIGHPTTTLAESVSHLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a new type of NADPH-dependent quinone oxidoreductase (QOR2) from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Uncharacterized oxidoreductase ytfG
total genus 99
structure length 283
sequence length 283
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zcvA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2zcvA02
3WSWA 3ZU5A 3R6DA 4ND5A 2NU7A 4UAGA 1E7RA 2FRDA 3UCXA 4EUEA 1T4DA 3T4EA 1ZXLA 4OKNA 3H9JA 3IKVA 2BKAA 1BTOA 2OBYA 3KSUA 2VUSA 1O8CA 1E3EA 1EBFA 4WOJA 3WYBA 2H63A 4XA8A 2EKQA 3EVNA 4G2NA 3H4VA 1X0VA 2VCYA 4ALKA 1O0SA 4L9RA 2JL1A 3R0IA 3A28A 4AJHA 1OI7A 2DTDA 4MIOA 4OL9A 3UVEA 1QLJA 4AJ4A 4AICA 1HE3A 2B36A 2F1KA 3M2TA 3OP4A 2I67A 4ND2A 4BNXA 3GVPA 2HLPA 3E9MA 2BH9A 3C1OA 4J9UE 4N5LA 1TVEA 4KTTE 5HS4A 2WWRA 1NPYA 3H7AA 3DMYA 3ASVA 4XWYA 4B3JA 3IJPA 2WYWA 2GCGA 1ONPA 1IZ9A 5L4SA 1EFLA 1SC6A 2R2GA 3WDSA 3KB6A 4M89A 3DONA 3A06A 3H9EO 4M87A 5DBFA 1PJTA 3H6KA 3BMCA 5IDYA 2O50A 5G0UA 4MVJG 5AOVA 3B1JA 4DWVA 3MWDB 1ORRA 5IF3A 2B37A 2X9NA 3QA9A 4GPD1 1LBEA 1KVQA 3HUDA 2BGMA 2YV1A 1SEVA 3AUAA 3ENNA 3HN2A 3PQFA 4GBJA 4Q3AA 5COQA 4ZQFA 1GFSA 4WOKA 4TMFA 5I7VA 1DHRA 3WQRA 4R4JA 1DIHA 4J4BA 3I6IA 3MJSA 4IZHA 3CINA 3JYNA 5KNLA 3G1TA 3RUCA 3RKRA 4Z3DA 5BQFA 3TFQA 5EN4A 2HO5A 1YE3A 5JS6A 5EPOA 2GGSA 5GY7A 3RUFA 1FXSA 3ZW9A 4PFJA 4J49A 4ZQBA 1ZSNA 4GVXA 4BNYA 4BV8A 5I9LA 5JO0A 3ON5A 2VYNA 4LRTB 2JD1A 3ZI0A 2WE8A 1W6UA 2D1YA 1C0KA 3DAGA 1GPDG 1Y8QA 1W8DA 3G79A 4O59O 1E5LA 3RC2A 3GG2A 3ASUA 3TZ6A 4GL4A 1ISMA 1YB4A 2HRZA 3WMWA 4OHUA 4S3MA 4NJOA 3MJ4A 4PN3A 1EDOA 1XIVA 2Z1NA 3W8DA 1GPJA 5T8KA 2VQ3A 2POQX 1N7HA 2OGUA 1E3WA 2FSVA 3GR6A 4IGEA 3WLFA 3WTCA 1TT5A 1R4MA 3IL2A 1DC5A 5F1KA 3M1AA 1HYGA 3S2GA 4RDHA 3S55A 1YVEI 4HBGA 3MJEA 5F1OA 2ZB4A 1SNYA 5DF1A 3QWBA 3DOJA 2BFPA 4D7AA 2NM0A 2O3UA 2BGLA 3CUKA 3G0OA 5IZ4A 5KKCA 3ULKA 4IGFA 4BNIA 5AXBA 4R51A 5IDWA 3PZRA 3JQBC 4GX1A 4OM8A 4RCVA 1P9LA 3S2FA 3OJOA 1Q7GA 4E2YA 4FB5A 3UICA 3WS7A 2B4QA 3AWDA 1UZLA 2G76A 1DJQA 2J8ZA 1MXHA 5JCJA 3SC6A 4BNWA 2Q3EA 2BELA 4IZIA 1NNUA 4Q9NA 3KBOA 5BT9A 1QLHA 3KOUA 3QIVA 2JAPA 2VYVA 1PJ3A 1I0ZA 2YHIB 1IPEA 3E5RA 2DPGA 5JNLA 4BOYA 4FOSA 2NACA 2TMGA 4HNHA 2Y1CA 3GHYA 2ZCUA 1WZEA 3OJ0A 3T4XA 3PRJA 4RPLA 2X58A 2C5EA 3WJ7A 3V2GA 4UUNA 2X0IA 3LF2A 3C7AA 4ZD6A 1P1RA 2BHLA 1O6ZA 2JCXA 3TZKA 4JJGA 4QTZA 3WSVA 4C4OA 4GX2A 3WX0A 3WIDA 4KOAA 4E12A 1D1TA 4ONEA 3AY6A 4B3IA 4IDAA 1FJHA 1E0DA 2GYYA 4OIMA 5EQFA 2JCVA 4OSPA 4CJXA 3AU8A 1HZZA 4CMJA 3OEYA 4B7XA 2PA3A 2YFQA 2PKQO 1CEQA 2Y68A 3NAQA 1PGOA 6LDHA 1P3DA 1AUPA 1A27A 1QKIA 3GVCA 3OQ1A 3F47A 3D64A 1DJNA 1T2CA 1E7WA 2Q50A 4F6CA 1XYGA 3NGXA 3RASA 4MVJD 1R0LA 4E5YA 1VRWA 3KSZO 3Q3CA 2ZQYA 2PZJA 4C7JA 1T25A 4LISA 1DIBA 3X2EA 2YHUA 4CMEA 4IJVA 2X8LA 4M55A 1I2BA 3G1UA 3TWOA 3VH4A 4P4GA 1HSOA 3WBFA 2Q46A 3ZWVA 4N18A 3WXBA 4II3A 4UVDA 2PR2A 4K6FA 3WGQA 4ALMA 1ZVMA 5BNFA 4F46A 5IN4A 4EW6A 1T2AA 2WM3A 3NKLA 1CRWG 4CMEC 1HE5A 3DZJA 2HK8A 4KTVE 1J5PA 2BGKA 1I10A 1Z45A 1B2LA 1JA9A 4D0RA 2HK7A 5THKA 1YL6A 2DPHA 2PH5A 1QYWA 3FTNA 1GCOA 4JIGA 3BMQB 4WEQA 1LSUA 2GF2A 4PVCA 5GZ3A 1G1AA 4R5HA 3G17A 4F6LA 3JQFA 2XXJA 1PGNA 3JTMA 4ZN6A 3DHNA 3PYMA 2C54A 3FSRA 2FPPA 1T2EA 3ONFA 1U3UA 4N5NA 2Q4BA 2X23A 1YQGA 3GFGA 2NUAA 4KMSA 1DFGA 1H6CA 5A4DA 4J43A 5A1TA 3TJRA 4FJ2A 3PFWO 5TT1A 5KWEA 1K6IA 2YY7A 3GA0A 4S1VA 4CMCA 4FC6A 4BUCA 3FI9A 3KM0A 3GZNA 2OMEA 1JTVA 5I8WA 3BMCB 4E30A 5K0ZA 1PJBA 3JD4A 4DMMA 2IODA 3FPCA 4XRRA 4CMIA 1X15A 4QO7A 4YA6A 4BO9A 5FWNA 5CDGA 2ZYGA 1LX6A 3BMOA 1NFRA 3AY7A 3DFZA 5COBA 5CFZA 1EE9A 3EY4A 4AFNA 1EVIA 1W0CA 3GVIA 1YBAA 5BSFA 1VL8A 3SXPA 5JAIA 3K2BA 3U5TA 3JD0A 4XQCA 3N58A 1UDBA 1F8GA 1NASA 1XKQA 2JHGA 3NGLA 4HP8A 1LSJA 1MG0A 3HB4X 5L4NA 3ZV4A 5KVQA 1LA2A 1IYZA 3QVWA 4BQPA 1Q1NA 1R0SA 2R6JA 1O95A 3JQDA 5CAEA 3NJ4A 4U0JA 1OAAA 4IQ8A 4MJLA 3Q0EA 5EMHA 1SPXA 3DHYA 1EE2A 3GQVA 4CL8A 1ZJZA 3IC5A 3GGGA 5A04A 2QHXA 3SX2A 1X7GA 1CQJA 3EUWA 4PLZA 3ZHYA 2IDZA 2UDPA 4BQRA 1Q7CA 2C07A 3DBLB 3FBGA 3U4CA 3CIFA 4YAGA 4I5FA 4NH4A 3BMNB 2F00A 1VC2A 3ZGYA 1VJ1A 4MPDA 3HN7A 4CM8A 1Q0QA 3O8QA 4IMPA 4BKRA 4C7KA 1EUZA 4D46A 1C1DA 1H9AA 1DFHA 1E3WB 3CEAA 3D3EA 4R9SA 3D7LA 1JKIA 1HYHA 4I5GA 1FDSA 1Q0LA 2O3QA 4W9NC 1EMDA 3QQPA 4NJMA 4YAKA 4O1MA 2B35A 3GZNB 2RIRA 4L75A 1R37A 1NAHA 1ZUD1 5G0VA 2VT2A 5T8KC 4MINA 4AL4A 2ILTA 5A5EA 2XOXA 3MZ0A 4DPKA 2AQ8A 2Y1EA 3D4OA 1SO8A 3JQAD 3N74A 3OF2A 4KZPA 4YJFA 5CDYA 2X5KO 2OL4A 3LF1A 1EUDA 2ZJ1A 3KV3O 1EQUA 3BTSA 1LLDA 4TRJA 1GYQA 4LCEA 1Y1PA 5G4KA 4I8XA 1GYPA 1K6JA 3NTOA 3I9MA 3H8VA 1LTHR 3WLEA 4BO6A 1GY8A 2VHZA 3WGTA 4RPHA 1UUFA 4J9VA 1VM6A 5DNAA 4HFMA 2AW5A 1WZIA 3PVZA 2IEDA 1QR6A 4LW8A 2FR8A 5JE8A 4DIBA 2CNBA 2EV9A 1AE1A 3V5NA 4DVJA 4GMGA 4OXYA 1H94A 2BRUA 3O38A 1FMCA 4Z3KA 1EVZA 1PSDA 4BKPA 4JROA 1T2DA 1B8VA 1O5IA 3DBLA 3FNGA 3W1VA 5TQVA 4N54A 2JFFA 4QT0A 1XHLA 4CM8B 4RLHA 2VZ9A 4IS3A 2J3KA 1U5CA 2GERA 4DPLA 5MDHA 3ETGA 2W98A 3I6QA 3MWEB 3GDGA 2QX7A 1PQUA 3LLSA 3MOGA 5L9AA 1PJSA 4H15A 4ZQGA 2VRCA 4R41A 4BGUA 5B4UA 1TB4A 2DLDA 4PLFA 4OMUA 3PIDA 1RYDA 3GUCA 4AVYA 3X2FA 4A5OA 5KIAA 1HE2A 4E32A 1NQAO 1SAYA 2NU9A 3PZBA 5TLSA 3RQSA 3TF5A 3PHIA 4LVCA 4GLOA 4A7PA 3WR5A 3U4DA 1U8XX 3QWIA 1PL8A 3I9OA 2GSDA 4PLCA 3UAGA 3MJVA 5LC1A 1LLQA 3BXXA 5IDXA 1P1HA 1MP0A 1ID1A 1G0OA 4JGBA 4GX0A 1HZJA 2YV2A 4O6VA 4EGFA 3KYDA 3LC7O 2O4CA 4EZBA 3ITDA 4RF5A 3D3WA 4D45A 4RPKA 4OOEA 4LVUA 1ZNQO 2C82A 1ZK4A 4L73A 4B4UA 1ENYA 3UN1A 2FZEA 4FGSA 3B70A 2YUTA 4BB6A 3RROA 3GAZA 1M67A 3NDJA 3U09A 3PJGA 4RV9A 2H1SA 1HSZA 1ENZA 3Q2KA 1I30A 1ZMOA 3UXYA 3VZRA 1VPDA 1QXSA 4D43A 1LDMA 4DQXA 3WBBA 3BMQA 4QSMA 5KJ6A 4J2OA 3ICPA 4IUYA 1HETA 4JJIA 2AMFA 3OQBA 3QVSA 4J91A 4AJIA 4JK3A 4CQMA 2IE0A 2BMAA 2C20A 3FD8A 3DOOA 3TPCA 3VKVA 3VVBA 1T24A 4NK4A 5I7EA 1DBVO 4BNUA 1KETA 5L45A 5EL0A 4PCVA 4CMBA 2LDBA 1DC6A 1YKFA 3EYWA 5L7YA 4CM9D 4CLEA 1GUFA 2A9FA 4FFRA 2CVOA 4P38A 1NWCA 2ZB7A 3LT1A 4B8WA 1SB9A 1DAPA 4UVIA 3U0BA 2BLLA 1QYDA 3SC4A 5CDUA 2HMWA 1IHXA 1QYXA 1DEHA 4DQVA 1WNTA 1B0AA 3E9NA 3JD2A 5ENDA 3LLVA 1WMAA 3FN4A 4BNHA 1ISJA 1MGOA 2E82A 3T7CA 2DBVO 2TMDA 1F06A 1NQTA 1U1IA 4U6QA 2UYYA 4EITA 3D0OA 3HDHA 1E3IA 1MLDA 3HJAA 3LT0A 5TJ9A 4CLRA 4XYBA 3S2EA 1VJTA 4E5KA 2IEBA 2EKPA 4L8VA 4MIYA 1QYVA 1GU7A 4IDFA 1XEAA 3IUSA 3PJDA 1HDZA 3W8EA 2IZ0A 3M6IA 4QFDA 2Y1OA 3I5MA 4WE3A 3GT0A 3FR8A 3NEPX 4CMHA 5TIIA 2X0NA 1XA0A 1KEWA 3E03A 4CQLA 1EEHA 4MP6A 1DRVA 4XQEA 1ZH8A 3JSAA 1QG6A 1KEPA 3H5RA 4ROSA 5ILGA 4MOWA 3PP8A 5G4LA 5A05A 4B7CA 1XGKA 3BMNA 1H2BA 2ZJ0A 4M1QA 4NDNE 3RC1A 3GPDG 1YL5A 4M54A 2CVQA 1JDJA 1Y5MA 3CMMA 1E5QA 2I76A 3QE3A 1GUZA 4BL5A 4JBIA 5C37A 3IS3A 4AJJA 3VZSA 4L76A 2OP0A 4RVHA 1H5QA 3QV1A 2ZQZA 3JQ8A 4J0FA 4IINA 5JW6A 4BO0A 3TRIA 3WFIA 4FSHA 4BNKA 1UP4A 1GR0A 5HA5A 3VC7A 1FDTA 3F4LA 4NIMA 4R1TA 4AJ1A 4DREA 1Z6ZA 5DDIP 1O9BA 3TZCA 1I5RA 3K31A 3VPXA 2Y0CA 2ZATA 3OEWA 3LSYA 3D4PA 3UFXA 4JX8A 4B4OA 3K73O 4QECA 3TDKA 2VHWA 1D8AA 1K89A 1IPFA 2ZTMA 1B7GO 2CSUA 3VH3A 1PJLA 3OA2A 1F0YA 2DTXA 2X4GA 4LSWA 5DT9A 1X0XA 5JYEA 4TVBA 3VOSA 3L07A 2DU8A 2QG4A 5JSFA 1YGYA 4NR0A 3HB5X 4XGNA 3PDUA 3OA0A 4DIOA 2YDXA 4RQUA 3CH6A 2PD6A 2P4HX 3OETA 3K30A 4A27A 5HRUA 3KZVA 4ZQEA 3ST7A 4U7WA 1Z74A 3H9UA 3D5TA 2DUWA 3RBVA 4E4YA 2C59A 1TT5B 3L4SO 1R4MB 1PJCA 3O9ZA 4ZVVA 4CR6A 4Y6PA 5JY6A 5CPBA 3INTA 3BHIA 2E4AA 4FPXA 2HAEA 1E6UA 4KUHA 3BTUA 1LSSA 1GQQA 5H81A 4BO7A 3E1KA 4PLWA 1ISIA 1UAYA 3HZZA 4BGEA 1BXZA 1BDBA 2ZK7A 1PR9A 3D1LA 1E1LA 1J6UA 4KDFA 1EFKA 2NU6A 3DFUA 2DBQA 2X5JO 4WJZA 4D3FA 1DFIA 5G0SA 1TEHA 1MFPA 1Z7BA 3D3WB 1XG5A 5GMOA 4A0SA 1BXGA 4Y6RA 3GUYA 3RUAA 1NTOA 1SEPA 3PLNA 5JY1A 2DM6A 5TC4A 4AG3A 2DFVA 4JJFA 1R15A 4MVJA 1QMGA 2Z5LA 1U2GA 3VTZA 1SB8A 1ADCA 3PGJA 4R9RA 4RGBA 3AM5A 2EEZA 2PWZA 4U0KA 4FFLA 1HDYA 4L4RA 4NG5A 2EG9A 1MV8A 2EP7A 1QV6A 2Y05A 3QY9A 1YQDA 1X1EA 1XR3A 4CLXA 4JP3A 2OOSA 3R3SA 4OQYA 4BKQA 3H3FA 1LRLA 1PWZA 2J5QA 4IJUA 4CM4A 4HADA 1S6YA 3P19A 4HV4A 1GTMA 4W7HA 3V1TC 5TS3A 4WASA 2W2LD 5IAAA 2H6EA 4GX5A 1ARZA 5EJ2A 3WFJA 1WPQA 4DC0A 5LDHA 3FNFA 1WMBA 2E37A 3DBRA 1HDGO 3JQGB 5KVSA 1V35A 2VWQA 3RUHA 2DVMA 2J5KA 3LVFO 5A3JA 2GASA 4W7IA 2V6FA 1IULA 3JQ9C 4MVJM 5CG2A 3FHLA 4H7PA 9LDTA 4EEXA 3S1LA 4UUMA 4BMSA 4FW8A 4EJ0A 1Y81A 1KS9A 3NX4A 4L74A 2VT3A 5JYDA 1PL7A 1BXGB 4WCFB 4UEOA 4Z9FA 4NFHA 2QIOA 3GZ4A 1NBOA 4DL9A 3HDQA 4YRAA 3JQBA 4UUOA 4UVGA 1ONNA 4CLRB 4GWGA 3EK2A 1HDOA 3UUWA 3B20A 3B1FA 3FNEA 2UVDA 4NNJA 3JYPA 4UEKA 5JXWA 1XELA 2AE1A 4IIUA 2Q2WA 1K2WA 4A2CA 3T7EA 4B79A 2CMDA 1A7AA 4J2HA 2O2SA 3H2ZA 4UVEA 4RF3A 5B4VA 1Z73A 2NSDA 1KC3A 3DMTA 3IQDB 1SOWA 5EINA 3O26A 4BO1A 4CLOB 3QWFA 4GKVA 4XYLA 3PHLA 1PS8A 1CDOA 3NTQA 4IDDA 1P44A 3SLKA 5KCZA 4F45A 2WTBA 3EVTA 1XQ6A 1KEVA 4OO3A 1JQBA 2P5UA 1YRLA 1LDGA 3EZYA 3JQGA 5GZ1A 1KVUA 4CUZA 3U62A 2QW8A 4RO0A 2D0IA 3LDHA 2DT5A 3OIGA 4CMIB 2Y66A 1ULSA 1H0KA 3RAJA 2ZB3A 1D3AA 1GADO 1XQ1A 2GO1A 4E2WA 2PY6A 4ND3A 2Q1TA 1P31A 3Q1LA 1H6BA 1T26A 4HFRA 1CJCA 1I8TA 1MB4A 2VTEA 4IDEA 4YQYA 2JKVA 3NV9A 5KVCA 3IOYA 1E7YA 4RZIA 1X7HA 2AEFA 2X9VA 4PGFA 5AXCA 2DBZA 5IZCC 2DC1A 3CPSA 1VE9A 4EUFA 1KVTA 2WEKA 1KEUA 2HJSA 2QQ5A 1BXKA 2ZB8A 3RSHA 4D42A 2RHCA 3A14A 1ZO8A 3M2PA 1JN0A 1B14A 4JBHA 4R1UA 4WPGA 3IAHA 3WMXA 4CV0A 4YR9A 1V8BA 3PHGA 1MA0A 1U3VA 3F3SA 1W4ZA 4TZKA 1VSVA 3EC7A 4XD2A 3KYBA 4R16A 3BTVA 4LRSB 4YB8A 3UOGA 2ZTLA 1ZBQA 1GV0A 3GNQA 1EVJA 3ANLA 1I32A 5TT0A 3PLRA 2J3JA 4YXFA 3DQPA 2ZTVA 2YFHA 2YDYA 1TT7A 1EDZA 4JBGA 2AG8A 2DFDA 2YV3A 2OXIA 2W90A 3K8ZA 3VVCA 4DLAA 1KOLA 4IQGA 1YBMA 4I08A 1K6XA 5ADHA 4KUGA 3NUGA 2NTJA 3IUPA 4BNFA 4DC1A 3D5QA 4JLWA 4ZICA 5F3RA 1FF9A 1YB1A 1M66A 1C0IA 5H83A 4CM7A 2VOEA 4J1QA 3NT5A 1ZSYA 3AY3A 1DPGA 4I1IA 1RWBA 2C0CA 4OJNA 4RLSA 3PHHA 2OZPA 3AI1A 1E3JA 3B6ZA 5F5NA 1NVMB 2I3AA 2QZZA 4WLEA 4YJFB 3BHMA 4JN6B 4GI2A 3RJ9A 5T5QA 3PXXA 5L40A 4UEJA 4U6SA 1B3BA 1QORA 2X1HA 3DO5A 3JD1A 3ZCXA 4AJLA 3ZW8A 2YJZA 3E8XA 3DAPA 3WGIA 4P4NA 1X7DA 3RKUA 3EDMA 3R3JA 4OKIA 1DOHA 2Y1GA 3JQEA 3PQDA 3RFXA 3NJ8A 1GYRA 1E6WA 1C1XA 4MVJI 4K6CA 3W6UA 2IZZA 3UF0A 5ES3A 1VL6A 4IXWA 1GEEA 3AOEC 5JDIA 1AGNA 3DB2A 2DQ4A 3I4CA 4WK6A 2X22A 4ZHSA 4YT5A 4RZHA 2Y93A 3L4BC 1MX3A 1KIFA 2CDAA 4L4XA 4TRNA 4ZU3A 7ADHA 2O3JA 3WNQA 1N9GA 2PGLA 3OMLA 5CPFA 4D44A 2WSBA 4KDEA 3K5PA 3GAFA 4XJTA 4ZGWA 4DXHA 4XJSA 2R00C 3GEGA 2E6UX 3GY0A 3OQ6A 4J6FA 4CM4B 1EK6A 1PX0A 3LC1O 8ADHA 3STHA 3UCEA 2I5PO 5TSDA 4CV2A 3N7UA 1PEDA 2HKIA 5G0TA 4NBWA 5LDGA 3GRKA 1XDWA 1V3UA 1LC3A 5ER6A 3B1KA 3RFTA 1WDLA 3OFSA 5BNTA 2AQHA 2VUUA 2PNFA 2D8AA 3DBHB 4Y98A 2EHDA 1M6HA 3DBRB 3F5QA 5IN5A 3LK7A 4TQGA 3KUXA 2PTGA 2DBRA 4J7UA 1X1TA 3HSKA 1HTBA 5JLAA 4BMNA 3PPIA 2B83A 3GPIA 3IP3A 3SJUA 2VWHA 5C7IO 3GGOA 3JQ7B 3DBVO 3LT4A 1WAMA 1KC1A 2RH8A 4WNIA 1PS9A 4OQZA 4NHEA 5DP1A 3Q2IA 3E6AA 1PIWA 2FSSA 1YDEA 4XB2A 2RHRA 4DYVA 1YB5A 3MJTA 5HM8A 2O23A 5F5LA 1A9ZA 4R01A 5TF4A 3RC9A 3SJ7A 4LSMA 3ZH2A 3TZHA 3F9IA 3ZNPA 5DOVA 3K96A 2O3SA 2CUKA 2OO5A 4WECA 5HWSA 3ADOA 2O7SA 2EXXA 3C7CB 3HNPA 3I9LA 3I3OA 1O94A 2VNSA 1N92A 3VZPA 3WGYA 2HUNA 2VHVA 2D3TA 1KY4A 5HS6A 1I3MA 1OC2A 3E48A 3U4HA 2AEJA 4GVLA 2X0JA 5K6AA 4Q39A 4IBOA 4R68A 3TSCA 2XAAA 3FCOA 3QRWA 2GLXA 2G0TA 3CKYA 3H9GA 2WYVA 1ADGA 2JJYA 3CSDA 1RM3A 2C2YA 4GSKA 4J3FA 4QFCA 3DTTA 3V2HA 3I1JA 4H3VA 1BG6A 4NFYA 2GN6A 4NQZA 1I2ZA 1VKOA 2JFGA 1UZNA 1U3WA 3HFSA 4AJPA 3FRJA 5CDTA 2OORA 3P2OA 1DIGA 5I9MA 1LI4A 3G3EA 2Q49A 1M75A 2ZCVA 2DUUA 2CDBA 4FQ8A 1HF3A 2VUTA 2O3TA 3OECA 3DZGA 4WGGA 2D2IA 4RJTA 1CIVA 1Z82A 4WLVA 1LDNA 2Y99A 5CEJA 4YYZA 1N7GA 3AI2A 1WLYA 4WLOA 1V3TA 4Z0PA 2PZMA 1PZGA 2VYND 3UW3A 4GGPA 1HE4A 2FMUA 2UAGA 2NV6A 5U4QA 1ENOA 1NVTA 3ONEA 3HDYA 4I9HA 2A4KA 1PR3A 1LEHA 3MEQA 3C1TA 1ENPA 5JMPA 3OBBA 1B26A 2HMUA 1D4FA 5JAQA 5CEEA 1PZFA 4GKBA 4YAJA 4D3SA 3ABIA 4GMFA 1I3LA 1I33A 2HMVA 3ZV5A 1VL0A 4J4TA 2QRKA 4E6PA 3ZWPA 4FR5A 4E33A 1E77A 4CODB 1RYEA 4CQLB 4J1SA 2VWPA 2W2LA 4DBZA 4HWKA 4IQ0A 5L53A 4U5QA 4DRYA 4PG4A 2LDXA 3PFFA 3TOZA 4IIVA 4OOFA 1R4NA 2J3IA 3HDJA 4BGIA 2FHSA 5G0WA 3DAFA 3OIFA 5DCWA 1ZXBA 4B3HA 5B1YA 3DDNA 4A73A 2J5RA 4MVJF 2FZWA 4FIZA 1LDYA 3FR7A 4E5NA 1UXKA 3CZMA 4MDHA 5K9ZA 1JAXA 1UP7A 2NVWA 4W6ZA 3IMFA 1HDCA 1JLLA 4R1SA 4HXYA 4NI5A 5EQDA 2B4TO 1NR7A 4ZA2A 2AG5A 3H9QA 2GR9A 3PI7A 2EW2A 2IXBA 4FFNA 4I5DA 5ENVA 5FYDA 3JQ8B 3K9QO 4ZQHA 1QSGA 2AHRA 3H65A 5IXSA 4ALJA 1YOVA 4KQXA 1DIRA 4E0BA 2HRBA 4Z9XA 1DIAA 5DBIA 3AW9A 1GCUA 2VZ0A 4PZCA 1UXGA 3P5SA 3WTBA 1GDHA 1HDXA 3COSA 3DWFA 4J4HA 1VI2A 4FBGA 2G1UA 4K28A 4CL3A 2HK9A 3WWZA 4YBZA 5A9SA 1V0JA 3VTFA 5GZ6A 1Y9EA 2I66A 3GNSA 7MDHA 1L7DA 2JFHA 2O2YA 4CMKA 5IG2A 1I2CA 1N2SA 1JU9A 1T4BA 2X9GA 3EMKA 2B69A 5AXDA 3NT2A 5I9NA 1ZCJA 2V6BA 2EGHA 3AJRA 3E9QA 5JCJD 3H5NA 3Q6IA 1P74A 1VLLA 5F21A 5JO9A 1GQ2A 5A03A 3ANNA 3C85A 3TN7A 1P77A 4NMHA 3HQ4O 5DZSA 3BAZA 1BW9B 4K26A 3JYOA 1N9GB 1JAYA 3TNLA 1Z75A 4RVUA 3VPSA 1HYEA 5EESA 4CR8A 1A71A 1EZ4A 4J1NA 1Q0HA 3ROQA 4QUKA 3F1LA 1C1DB 1E1NA 3LT2A 1LU9A 1ZZEA 4EI2A 1YQXA 1H93A 1LDEA 5A9TA 1PJ4A 4MP8A 1NHWA 1ML3A 4XZ3A 1ADBA 4XR9A 4TVOA 3DTYA 3AFNA 2EP5A 4DUPA 3K6JA 3AI3A 1X13A 2C7GA 3QJ5A 4O0LA 4D41A 5G2OA 3Q9NA 2Q99A 1P33A 3OJEA 5A06A 3FPLA 1AHIA 4RVGA 1YOVB 1V3VA 2HDHA 1DC3A 3WB9A 4AJKA 2R00A 1U5AA 1C0PA 1YXMA 2B5WA 2QRLA 4PZEA 4DA9A 4DBVO 4XYGA 3WJAA 4H16A 4D0SA 1KVSA 2I99A 1OFGA 4WEOA 4OH1A 3JQAA 1C14A 1NP3A 2W2KB 3CE6A 3LU1A 4PLVA 4YCAA 1NAIA 4CLDA 5B12A 3L4BA 4TKLA 5A9SB 4R3WA 1ZJYA 4TSKA 4DLLA 5C5IA 5CG1A 2B5VA 4Y8VA 5U1PA 3WGZA 4YT8A 2H9IA 5JC8A 1U4SA 2J6IA 4MVJH 5H82A 5B4TA 3EAGA 1F14A 1NX6A 1DSSG 3ZNOA 1YJQA 4BB5A 5DCUA 4XGIA 3ZHZA 4CQMD 1AN9A 3MTJA 1NWHA 1K3TA 2BD0A 5KKAA 1NQOA 3A1NA 4CV1A 2GN8A 4KQWA 4YACA 3ONDA 2EF1A 1ZK3A 3W8FA 2CVZA 5C3MA 4Y9DA 3PJEA 3TQHA 1PS0A 5FI3A 1XLTA 4BNLA 2CF5A 1DLJA 3JQ6A 4GGOA 2EJVA 4ND1A 2EW8A 4PLYA 2VHXA 1GZ6A 1U4OA 3DL2A 5EIOA 2IRWA 1LLUA 3KLMX 1I3KA 1F8FA 4LMPA 1JVBA 4NBVA 3RI3A 3INRA 2QRJA 2Z95A 4RDIA 2EIHA 3GK3A 4ALIA 2VNAA 3HFGA 2D59A 1U28A 3G49A 4EYEA 4FCCA 1CF2O 3EW7A 2C29D 1F12A 1V6AA 4R1NA 4FFPA 1H9BA 2W8ZA 1ZSVA 3MOIA 5J23A 3C1AA 1NQ5A 3WGGA 3ORFA 2CFCA 3RU9A 5BSGA 3F46A 5JFOA 3WWYA 1D1SA 2V6GA 3KYDB 4F3YA 2VYVD 4ALNA 3IKTA 3IJRA 3F6YA 3OM9A 4J90A 4WCFA 3PWZA 4PIVA 3V8BA 2JHFA 5COAA 1LRKA 3ANMA 1NVGA 4CV3A 1PL6A 3DC2A 3KHUA 3GDOA 5FFFA 5JMWA 2YHIA 4KP7A 1B8PA 1YWGO 5L51A 4FN4A 5DP2A 1T1SA 3I9NA 5JC1A 4IJWA 4RVSA 2OP1A 2FY8A 3CZRA 3TL2A 1MG5A 3Q9UA 1SMKA 3I4FA 1UP6A 4J1TA 4IPTA 2Q2VA 1VJ0A 1M2WA 4ALLA 1WVGA 3PIIA 4DQUA 2QZ9A 1EBUA 2BFMA 2E48A 4IJKA 2PZLA 1P0CA 4YJGB 1IY8A 3HHPA 4YAIA 2WD7B 4UULA 4XB1A 1Q7BA 4QO8A 4UVHA 5HTOA 3DZIA 1QYCA 3W6ZA 2FR0A 4BNMA 4DYDA 1SCUA 2Q4EA 3VPGA 1PGQA 5JPIA 4LMRA 4MVJP 4EEZA 4TKMA 3RUEA 2DAPA 3CTMA 4W9NA 4W82A 2AE2A 1BWSA 3KTDA 4XQ9A 2GN9A 3DMTC 3WNVA 1BDMA 1DAOA 5LCXA 1P1FA 4PG7A 1NPTO 3S2IA 1B3RA 1NXQA 2B4RO 1UZMA 2A92A 2P2SA 3ENKA 3QWAA 2CZCA 1RJWA 4BHTA 3KSDO 4UREA 3GDFA 4TROA 3ZWAA 4EBFA 2HSDA 2WE7A 1TA4A 3LC2O 4B8ZA 2JD0A 1R6DA 3JD3A 4PG8A 3KRTA 5DN9A 3GGPA 4PLTA 5A02A 3GG9A 3PYXA 2IXAA 5L3ZA 1QV7A 3IDSA 3L9XA 4BNGA 3ZN2A 4HFNA 4BO4A 2VRCD 1KY5A 3BIOA 4YJDA 2WD8A 3KO8A 1HLDA 4A03A 1J4AA 1ZK0A 3VH2A 1ZK2A 3DZHA 1M76A 1TLTA 2W4QA 4XIYA 2WD7A 2X6TA 2JCYA 3E82A 3NRCA 4KWIA 4XGKA 4BNNA 3RU7A 4BNTA 2YW9A 2WYUA 3W4IA 4IDCA 5AYVA 4Z0TA 3QVOA 3DEYX 2BFOA 1AHHA 1LJ8A 1U9JA 1H6DA 2OHXA 2X0RA 3TOXA 4WLNA 5AQ1A 4JCOA 3NYWA 4CM5A 1IUKA 5DCYA 2BF7A 2SCUA 4CM6A 2EERA 3ICCA 3WQQA 6ADHA 1ZEJA 4Z0HO 4BKOA 1CQIA 2PFGA 2P91A 4Q3NA 4XYMA 3W4KA 3MJCA 1FDUA 3ZWMA 4HUJA 4E2ZA 2P5YA 1A4IA 1SOVA 5I7SA 3BMOB 4M49A 4XR4A 1E7MA 1HT0A 1HRDA 2PKQP 1IOLA 1ZIDA 2EGGA 3CXRA 1ULUA 1XWFA 2VRBA 4QEDA 3NDIA 3H2SA 3DHEA 3JQFC 3JQAB 1Z7EA 2W2KA 4ZJUA 4YVFA 1Y6JA 4XDYA 1R0KA 2RAFA 1YO6A 4WUVA 3ROKA 3SEFA 4A26A 3OSUA 1LSOA 4PLHA 2Y1FA 3ZU3A 3ZDFA 5T57A 1J0XO 3D4NA 4E31A 4K1LA 1L1FA 1QP8A 5I7FA 2BI8A 4P22A 5C7OO 2RCYA 1JKFA 4Q3EA 2Q1UA 1E7SA 1GEGA 2CD9A 4I5EA 3PYLA 2OUIA 4PRLA 4QQRA 3WYEA 3ZWNA 1O89A 3KVOA 3KLPX 5B37A 3C8MA 3AM3A 1CETA 1PU2A 5L95A 1YJ8A 3KXDA 4LK3A 3FBTA 4RL6A 5IJZA 1GL3A 3E18A 3FNHA 3VDQA 1NYTA 1MC4A 1DB3A 3AFMA 1P1KA 3BTOA 3O8QB 2C2XA 1WDKA 1GZ4A 1FDWA 2NVUA 4KWHA 3ZHXA 1MXFA 4AJEA 2PK3A 4NU5A 1E7QA 4YRDA 5ILOA 3FWNA 2RH4A 2GZ3A 3WGOA 4B4WA 4XYEA 2VZ8A 2XF8A 3HE3A 1YH3A 1OBFO 4Q3DA 1DXYA 3RBZA 4YJHB 3H3JA 3F1KA 4WCDA 3ZWOA 3DBHA 1UXIA 3P2YA 1R16A 3GN2A 2AXQA 1PQPA 1IL0A 5MGBA 4MKRA 1AXEA 1WW8A 1DHTA 1N5DA 3RD5A 1ZMTA 3GF4A 3M1LA 3VZQA 3MTGA 5JCXA 2VHYA 1PGPA 1FDVA 3JQ7A 4K9DA 1E1KA 2PGJA 2P9GA 4URFA 1M6WA 4EDFA 3MCVA 3EHEA 3SBOA 4XX0A 1AXGA 5BSEA 4R54A 3AK4A 2GNAA 2JAHA 2ZYAA 5I8ZA 1PJ2A 4XQGA 2X86A 4PLGA 3CMCO 3FWZA 3OJLA 4YEDA 3U9LA 3W4JA 4BVAA 3SVTA 1OMOA 2P68A 2FR1A 4TZTA 2YQ4A 2FPIA 2HMTA 4M86A 1ISHA 2OFPA 5ER9A 1WWKA 1X14A 2PD4A 4L0QA 4BIIA 3AOGA 3QW2A 1Y8QB 1YONA 1GV1A 4Q3BA 4BO5A 4YPOA 2PV7A 3DZBA 3RUIA 1PQWA 4RORA 4MIEA 1Y9AA 3LQFA 4MVJE 5A5FA 1UXJA 2A94A 2CY0A 5KJ1A 5KOIA 3E5MA 3RCBA 1J49A 2JD2A 3GLQA 3AUSA 1A7KA 2UUOA 4DPMA 4KUEA 4YJGA 1G6KA 3ZV3A 1LQUA 3ZNQA 4D79A 1B8UA 4PLPA 4QX6A 4IXTA 1T2FA 3I9KA 9LDBA 1P0FA 5F1PA 4A10A 1Y7TA 4TRMA 1HLPA 3ZWCA 1NR1A 2HMSA 4BO2A 4YDRA 3VAZA 4EJ6A 4O63O 2NTVA 4HFJA 4NFSA 1JVSA 3OICA 2WJPA 4AJNA 1Y5RA 1UXHA 5CDSA 1TXGA 4FJ0A 2A35A 4CMGA 3RJ5A 2Y67A 4QXMA 3QHAA 2NWQA 4II2A 1YBVA 4IMRA 1MC5A 1JKJA 4BNZA 1OOEA 3EGOA 3GVXA 1TI7A 3L77A 1DRUA 3OJFA 1KYQA 2Q1SA 4NU6A 3R1IA 4WCFC 1PZHA 1A4UA 5KJCA 3K2EA 2I65A 2NVBA 3RC7A 4MO2A 4CR7A 5IZCA 5JBIA 5C7LO 4CM3A 2PZKA 2O7QA 2DTEA 3I52A 3VPFA 2HU2A 1PGJA 1Y8RB 1C0LA 4E2XA 2PLAA 2YQ5A 4E13A 2XXBA 1DC4A 4Y6SA 2I3GA 1ISGA 3L9WA 4PVDA 3SLGA 2PD3A 4FFOA 5HBRA 2BFAA 3JYLA 1EVYA 3KETA 4RVDA 3VHRA 3F4BA 4FGWA 1KBZA 3GVHA 8LDHA 2VTDA 1K5HA 3TZQA 1YL7A 1E3LA 4DTIA 3AM4A 2GPTA 3PWSA 2Y0EA 1IHYA 4YTEA 2UV8A 3KYCB 4CM9A 1SZJG 2IYOA 5IXYA 4OXNA 1BRMA 3DZFA 1B15A 2X5OA 5ITVA 1ZW1A 2Y0DA 1ZK1A 5AVOA 3K92A 5FEUA 3PHJA 4EUHA 4RF2A 4FFMA 3BHJA 1N8KA 1HL3A 3O03A 4D3DA 2CF6A 3RFVA 3RVDA 2EKLA 4BNVA 1WDMA 2PH3A 4JQCA 4WLFA 3V2UA 4DMLA 1U7TA 1PZEA 4GAEA 1IZ0A 1EK5A 3OIDA 4DLBA 4GH5A 3KEQA 1EQ2A 4X54A 2IYPA 2FPGA 4OYRA 5BR7A 3PDJA 3WOHA 4YWJA 3ZNNA 1WXDA 2FOIA 2VOJA 1E6EA 3VPHA 5DULA 1JWBB 1U3TA 4IM7A 2AQIA 3UCFA 3ZWBA 4HY3A 1NPDA 4RQTA 2IZ1A 3ZWYA 3VKUA 1DDOA 5ICSA 4CMAA 2Q45A 5CP8A 3AUUA 4BO3A 1OZAA 1I24A 3GOHA 4RPJA 1C3VA 3WQSB 3BYZA 2HJRA 4E3ZA 4TRRA 1HXHA 4E21A 1A72A 1GZ3A 3OHSX 4ZRNA 3S8MA 1U8FO 4FS3A 2P9CA 4J16A 3I9JA 3QP9A 2ZKLA 3HG7A 3JQ9A 1DRWA 1E1MA 5IDQA 1BW9A 1H2HA 2V65A 3GHHA 4YRBA 5DBGA 3NT4A 4LN1A 1R66A 4CUKA 3GEMA 3KYCA 3ADPA 2NVUB 1K0UA 4U8GA 4HX5A 4E5MA 4CM1A 3GFBA 4B4VA 3RBXA 1E92A 1LRJA 2O48X 3HADA 2GN4A 4MKXA 1P1JA 1GQYA 3ETEA 3I23A 4FJ1A 4YT2A 1ZFNA 5KJFA 3GEDA 4YJHA 1BSVA 2X7HA 1LC0A 3BZUA 4RF4A 3GC6A 3TL3A 3U3XA 1GD1O 4AJOA 2AA3A 4CPDA 4G65A 2FP4A 1A5ZA 3IP1A 4PRKA 5JDCC 2ZYDA 4IY1A 3ZWWA 3PTZA 1P45A 4O5OA 1U7HA 2EWMA 4J7XA 3L0DA 5JAMA 1XU7A 3KEOA 4M8SA 1I36A 2FN7A 2Y1DA 4GSLA 4HKTA 5BSHA 3LYLA 5T64A 1N1GA 2I6TA 2GUGA 1F17A 4B7UA 1NM5A 4NK5A 3ZU4A 4YQZA 4XKJA 1BMDA 3RWBA 1BGVA 2D5AA 1VSUA 2BI7A 4JP2A 3UGKA 3AUTA 1N1EA 4I9NA 1LLCA 1C1XB 5TJHA 1XSEA 4XEHA 2O3RA 4LCJA 3EZLA 1RM4A 3UHAA 2WMDA 5FF9A 1UAGA 1EUCA 3U49A 4AJ2A 3PWKA 2AQKA 2VN8A 3NTRA 3PJFA 1KERA 2GDZA 1S7CA 3A4VA 3ROPA 1DO8A 1LQTA 3C24A 1DLIA 4UUPA 1HEUA 1XCBA 3F5SA 4G81A 2GRAA 3IIEA 5IFLA 3O4RA 1HDRA 3GN1A 3ITKA 4JXKA 1UH5A 2NNLD 1UR5A 1YS4A 2GZ1A 3FTPA 3FF4A 3QVXA 1UDCA 4NJMB 3ZU2A 1LUAA 2OBNA 4MKZA 2HCTA 1SBYA 2AEMA 3L6EA 4Z9YA 1MFZA 4P4LA 1RPNA 1W73A 2H5LA 3P7MA 4Z6KA 4HNGA 4IS2A 2NLOA 4BV9A 2XPCA 1BHSA 1UDAA 3I83A 1LXCA 2C7VA 1NFFA 5DOZA 4E5PA 2RBEA 5EERA 4PG5A 5G4KB 1B16A 5KVVA 4G5HA 4ESOA 4R5MA 3QLJA 3WG9A 2GZ2A 1Q2XA 1ZEMA 3DOCA 3VH1A 4INAA 4W4TA 4PZDA 4N7RA 4FD3A 4XCVA 4ZRMA 4XRGA 1ADFA 4OSOA 3WYCA 4NBRA 1ONOA 3L6OO 1NHGA 3PQEA 2YYYA 1IB6A 1U2DA 1HKUA 1Y8RA 4BGVA 4IDGA 3AU9A 4PG6A 2Q1WA 5KTKA 2ET6A 4BS9A 4CUJA 2C5AA 2V6MA 1LDBA 5ITWA 1CWUA 5TRTA 3ROMA 5AXAA 2EJWA 1P1IA 1XU9A 4LGVA 1E3SA 2NQ8A 1UJMA 3GMDA 2ZTUA 5A3VA 3JV7A 3PGXA 1PWXA 5FI5A 4WLUA 1H6AA 5T6BA 4BO8A 1RM5A 4NPCA 3U4IA 4L4SA 4GWKA 4ID9A 4ITUA 2QYSA 1ZKMA 1GAEO 1I01A 3WICA 4FDAA 1WP4A 3QSGA 5K6AC 1R12A 4I9UA 2O4UX 3QWHA 1PJQA 5L7TA 3ETDA 4XDZA 3V1UA 3GRPA 1A9YA 4IDBA 3ZWXA 1PTJA 3HWRA 4TWRA 4XIJA 3RUDA 4Q3CA 2Z1MA 1L7EA 3UH1A 2B0JA 4YT4A 4N5MA 1LNQA 2P4QA 1FK8A 3JQCA 1D7OA 4R3NA 2NTNA 1I3NA 2GD1O 3GH3A 1BVRA 4J7CA 5JAZA 4P8RA 2V7PA 4NBUA 4R69A 2D5CA 5KJEA 1OC4A 4MP3A 1RKXA 3H5AA 3C3XA 4Y67A 2NU8A 3C7DB 1CYDA 5T67A 4RPGA 4WNCA 3ZHBA 4ILKA 2NQTA 3GMSA 5THQA 3VDRA 5U9CA 3RIHA 2UUPA 3L6DA 1RM0A 3TFOA 4JNKA 4OXKA 2PGDA 5ICMA 2VWGA 1HWYA 4FC7A 4NBTA 1BVUA 3JYQA 1V9LA 4ND4A 4GQAA 3UKOA 3ZZNA 4DIFA 5L7WA 1MUUA 5TX7A 4J0EA 3NDRA 3DXFA 2G5CA 3A9WA 2I9PA 1JWAB 3QVTA 4CLHA 1T1RA 4FOOA 2J3HA 2WDZA 3INGA 1YDWA 4OGWA 4CLOA 3DZKA 1R4NB 5A9RA 3Q11A 4GLLA 3WIEA 4CQMB 3DR3A 3WGHA 5TNXA 3V1YA 1G0NA 4DGSA 5JDCA 5BNIA 5L4LA 5TGDA 4W99A 3PEFA 4BNJA 1VKNA 3OH8A 2G82A 2FWMX 3JCZA 2P9EA 2DKNA 5CHEA 2CDCA 4BMVA 4RVFA 3LZ6A 5CEFA 4WKGA 2QYTA 2PKRA 3GNTA 1NFQA 2Q2QA 1IE3A 1CERA 4OAQA 2ZIZA 2D4AA 4EJMA 2G17A 5JDIC 3AOEA 1ISFA 3BA1A 2NADA 4BKUA 1KVRA 2HQ1A 1QRRA 1JW9B 3PK0A 2E49A 2YZ7A 4YAEA 3ZV6A 1GUYA 4NZ9A
chains in the Genus database with same CATH superfamily
1H23A 1ZNZA 2BJHA 3K2IA 2HA3A 4M1KA 1AZTA 2DXIA 3R6DA 2NU7A 2YJ3A 5CB0A 1QHXA 1SR8A 4WRRA 3BF8A 3UCXA 5IRCD 4AWAA 2W6QA 2X42A 2WAOA 4L08A 1IXZA 3HKCB 3TX6A 3CA8A 2QIPA 1QJCA 4J16C 5TEVA 4M8IA 3KAPA 2QUKA 3TPZA 5CYFA 4EPVA 3HXQA 1DWUA 1JEJA 5LBIA 3UQZA 3EVNA 3JWEA 3Q4GA 3H4VA 1O0SA 2FSHA 4L9RA 4QOSA 5EY5B 3R0IA 2YC4C 1KTIA 3L92A 1J8QA 5BSWA 2F62A 2QE6A 3IH5A 2WMNB 4JCCA 5SZIA 3FPHA 3EIHA 1QH8A 1WB4A 2B36A 3E70C 4IKOA 5JQGA 3T52A 3A3YA 3I2FA 1QO7A 5BN3B 4ND2A 4DY6A 4Q6BA 3GVPA 1QFJA 2K7ZA 4KTTE 2AKYA 3SLRA 1NPYA 4KQ1A 4RSMA 2BJVA 4HF7A 3VMFA 4D97A 3IJPA 1KXZA 2GCGA 1F0PA 3OEHD 4IUCS 2IHTA 3CONA 3GRYA 1YK1A 1X7WB 2GKGA 2NNWB 3R6TA 1YTUA 1J99A 2QD3A 3UHOA 3RE1A 1EFLA 4ZI7A 3KB6A 4ECEA 1J06A 2OXFA 2XDWA 3H9EO 3QU5A 3LQKA 3PUWA 4MUXA 3BMCA 3MGCA 2KS6A 1JG2A 4Y2GA 4DT1B 1CBUA 1P29A 1M1XB 2VZLA 3BICA 3GUHA 4U63A 4GP7A 1SKBA 2AVDA 2OG2A 1AD2A 5JYBA 1K98A 4RGVA 4MCAA 4IV5A 5LQCA 2XX3A 4ARIA 5IF3A 3ZZ0A 1RWKA 2B37A 4Q1DA 4GPD1 1WD5A 2DPXA 4Q3AA 2YV1A 3ENNA 1UPBA 4JUFA 1VI5A 1GFSA 3H18A 3Q40A 4GZ6A 5I7VA 3JZMA 3WQRA 5KYVA 1DIHA 4AT1A 2V3CC 1H4SA 3MJSA 2AZTA 3JYNA 4LHSA 3ZE8A 3IR7A 3G1TA 3RUCA 1RADA 5THXA 3LLUA 1SCJA 3EX7C 3EC1A 4PGMA 1UBMS 1YE3A 2XVMA 2H4FA 1TQ6A 3BKWA 5GY7A 3RUFA 3PQ5A 3AHFA 3IXQA 4PFJA 3SHWA 2K2WA 4BQIA 4J49A 5DU2A 3NU1A 5D84A 4AZTA 3ON5A 4IHJA 3LUCA 4HD8A 3QOWA 4RENA 1NDHA 1W6UA 4CGYA 1G41A 1GPDG 1Y8QA 2ZWPA 1Z08A 3F6EX 3TZ6A 4RFLA 4GL4A 4Q18A 5J2TA 4X00A 5FR1A 2OFOA 4OHUA 2C58A 5EWLB 5KX5B 4PF1A 4S3MA 5JZOA 1RLTA 1TO6A 4CEIB 3M3PA 1ONSA 2VDQB 1ZI8A 2P0YA 1GN8A 1XZDA 4FXOA 1WD7A 2Z1NA 3F7OA 3FUWA 3BX1A 1ZH4A 1AKTA 1U7DA 3L5OA 5FNZA 3SGLA 4KWCA 4NV0A 4PC7A 2Q07A 3IQHX 4MUYA 1UOEA 3WTCA 4W8GA 1XMXA 1TT5A 5B64A 3GDHA 1R4MA 1VA4A 4DQDA 3ZD6A 1D0VA 3BM5A 3VPAA 1NL3A 4F7WA 5E0KB 1BNCA 3LBNA 4B5KA 1FFBA 2YS7A 1YVEI 2GJKA 2SNIE 3K0BA 5F1OA 2ZB4A 1C7JA 1RI5A 4XX1A 5FAXA 4B81A 4JUBA 1WW2A 5I7RA 5LJIA 3LE8A 1M2OB 5BSVA 5DF1A 3QWBA 2ZAMA 1N9KA 1RRVA 3DOJA 2BFPA 2W6JA 2P67A 1YUNA 4E70A 4LUCA 3UAWA 3H84A 4LY3A 4OHMA 4X7RA 4DWWA 2WUWE 3S8YA 2NU6B 3KKEA 1YU9A 3A05A 2JLSA 3EG5A 1TUBB 3UT6A 2C77A 4R51A 3G5MA 2HU7A 2EWWA 4I14A 5JJCA 3FZYA 1XX6A 3QVMA 3GLHA 4KXUA 1KAMA 4FB5A 3NHAA 4B3JA 3AWDA 1RHRA 4D0GA 2YVKA 3SC6A 1MXHA 4N65A 2Q3EA 1VKZA 2D06A 2BELA 3ONVA 3A32A 4IZIA 4R2WA 1MB3A 3ZHSA 4F9GA 4K9PA 2HZ7A 3H4IA 4LZNA 2WF7A 1OHHD 3Q7SA 2MR5A 3N2YA 1PJ3A 3SJAA 3BC1A 3DPUA 3SR3A 4YRLA 1JMKC 3ZYZA 1CUBA 1H0SA 2F7SA 4JASB 4X6UA 4YP0A 1QK4A 4FOSA 4M7WA 4HNHA 3SHQA 4BOYA 4QSHA 5BXYA 3CUSA 3KOMA 4A5SA 2XQKA 1NBWB 3K16A 5IK2A 3TLAA 2C61A 5J2TB 2J59A 1EU1A 2X0IA 3C7AA 4MUGA 4AX4A 2JCXA 1SQSA 2Z5GA 1TU3A 3IEKA 3A26A 4GX2A 3WX0A 3U40A 4C4OA 4LJYA 2FE4A 5E1OA 3WIDA 3D7NA 4KOAA 1D1TA 1Z06A 3UBMA 4L15A 1M6VB 1XROA 4X1YB 1JDTA 3IP9A 2TMYA 1N3IA 4JXXA 5DYGA 3RYIA 2QMZA 4BLTA 3R3XA 4I55B 5J2UF 1Y1SA 1QUFA 3Q88A 1ZD3A 3ISTA 4U2BA 4CT5A 2JCVA 3BRWA 2JLUA 4CJXA 1KK1A 3ZLBA 1U81A 3E58A 1VFPA 5ECWA 1B0UA 1JU3A 3OEYA 4FKZA 4GICA 3EXHB 4R84A 1KDZA 4YV0A 1FVXA 2PKQO 4EHBA 4ZHQF 5B1DA 1GGFA 1MAWA 1MNAA 3QTTA 4GVPA 3MTIA 4Z49A 1P3DA 4D9IA 1RPJA 3QFFA 3PFHA 1QKIA 1A27A 4TV9A 1Y7IA 3FZNA 3PQ7A 2QNRA 3CLUD 4LGCA 4RETA 4JBXA 1RLIA 1Z62A 4HMOA 5FH9A 2XA1A 1UOQA 4KC0A 1SZPA 3WLPA 4E5YA 2AT1A 4MVJD 4Z8XA 1X92A 3OCZA 3V1LA 1PN3A 1G8KA 4PGAA 2PXCA 3AMVA 1R88A 2IHJA 4BEJA 3O93A 1KTVA 4LISA 4WXMA 3X2EA 2PGXA 1JXMA 1L4FA 4M55A 3T3DA 4AG5A 5K8IA 2JFVA 1JE1A 3TWOA 1DWQA 2EBFX 2PH7A 3P9KA 3C5HA 3UA4A 5E0OA 2Q46A 4OQPA 4N18A 1A5TA 2UUCB 4O1IA 5KDOA 4UVDA 4RTMA 3ZGOA 3WGQA 3CVUA 3CT6A 1OX5A 6Q21A 1T2AA 2WM3A 3NXKA 1EFDN 3O21A 3PNMA 4GKAA 4Z54A 3CYFA 3DZJA 2HK8A 4PGGA 3FW1A 4JI1B 1Q7RA 4Z86A 4ZMBA 3GNLA 4INZA 1RACA 1VMIA 2VJPA 1U8CB 1YB2A 1YL6A 3ZGLA 2AN1A 3FTNA 3NHPA 1L7VC 2XRYA 3BMQB 3H8JA 2FOLA 3DDUA 4XD7D 5CT5A 3ICQB 1LSUA 2NO1A 1GNVA 1CY0A 2HNKA 3BXHA 4LJAA 1IN7A 4PZYA 1RKQA 3NBAA 3GUVA 1CR0A 4GXNA 2PBRA 1EA5A 2PMBA 4PFKA 3FVRA 3PYMA 2Y71A 1Z2NX 2A78A 1UBRS 2IP2A 2PGOA 3ONFA 1T10A 3TLXA 1GTZA 4QOHA 1R0ZA 4RTJA 1L7AA 1X74A 1RZRD 2NUAA 1EAMA 1DFGA 5DCLA 5A4DA 3RRNA 4FJ2A 1U63A 2J9ZB 5TT1A 3L0IB 4B0OA 4ZOQI 5FLXA 3PITA 2OY0A 2OM6A 1CYEA 4URXR 2BFFA 3FI9A 1GT6A 1G38A 4BFYA 3GZNA 2NZWA 4QQNA 3TRJA 5JRZA 4LDPA 3A27A 3UUGA 3MT0A 2QVZX 2YMPA 1PJBA 2LGJA 2O2EA 3JD4A 4LRWA 4XRRA 1IC6A 4Z8YA 1X15A 1JG6A 1CKEA 4RDCA 1G5QA 4FE4A 2BEWA 4KMRA 4DM3A 4BO9A 2REXB 1S2MA 2J9YB 4M1EA 3UXHA 4MRMA 1DCMA 1NUAA 1JDSA 2XUPA 2ZYGA 3D6VA 5I7AA 3KSBC 1LZKA 3O4IA 4JMLA 4LY9A 1CZLA 1E9DA 4NXNB 2GJAA 5EP3A 1NVWQ 2GZRA 2VDJA 3VX4A 4AFNA 3ONNA 2ZIGA 3GVIA 5K3CA 5M2QA 1UWCA 3T1YB 2H3EA 1NVXQ 1X1CA 2WHPA 3VPDA 1TUIA 4HAUA 3N58A 1F8GA 2JHGA 1REQA 1LSJA 4W7SA 4RA9A 3TG2A 4AS1A 3HL0A 2XSZD 3SZLA 2FG5A 3GFPA 1XAIA 2PUAA 1Q1NA 3D81A 4PC6A 4I1UA 1JU4A 3O4JA 1O95A 3JQDA 2NTEA 1A98A 1A9XA 1USIA 4QPZA 3ABQB 1JR2A 5JS2A 1OAAA 4HTFA 1DEAA 4IQ8A 3M49A 3WGKA 2PR7A 4B46A 3IA2A 3QX8A 3ZDDA 2AG6A 1SKQA 1VP9A 2ASEA 1EE2A 1ZMRA 2QSZA 3DHYA 1X94A 2DR0A 3FUTA 1VOTA 2QT0A 2JGFA 4P4TA 2AWOA 2E21A 1KRHA 2GZDA 1V1MA 4LEIA 1P18A 1STOA 4YAGA 1Q14A 1Q7CA 2WILA 3FBGA 3DMNA 4MA0A 5B58C 3RTGA 3TMYA 1RCTE 4LYHA 2KPOA 4R05A 1VC2A 3DTNA 3CF2A 4EY4A 1XDSA 1H9CA 1IG3A 2C95A 5BVGB 1QG2A 1N4AA 1EKXA 3P8ZA 4BVLA 1QGUA 2NUAB 1ULAA 3Q8KA 1E3WB 4LHWA 4P82A 3D3EA 3D7LA 1HYHA 5PNTA 2ECQA 1Q0LA 1N3LA 1Y3DE 3CJTA 3ZY3A 1O57A 3BH7A 3GZNB 2ACEA 2RIRA 4IIXA 4L75A 4YN3A 4BMXA 1W5EA 3L40A 3W9YA 1XNQB 2EYQA 1XRSB 3FJ1A 2BEKA 4PBRA 1SZCA 4TMVA 3A6PC 3CLTD 2GDJA 4TT8A 2XOXA 3KPVA 4MHSA 1A2OA 2Y1EA 2EFYA 5ILQA 2I6UA 4YJFA 2BKVA 4RAQA 2B1IA 4KIUA 3PUJA 1M83A 4GOLD 3WOVA 4L78A 1H42A 1Z63A 1VE6A 2A9KA 2MMCA 3UK0A 1K6JA 3UH0A 2I91A 3F4KA 3SHFA 4A0RA 1GY8A 4W5NA 4KMOA 3RHZA 3FMPB 4KE7A 3B13B 1K7FB 4JLBA 4R8KA 3AYZB 4OHCA 1VA5A 3RJZA 5FFMA 4K9KA 1EEXB 5FPYA 3SJBA 3EZ9A 3T9FA 1WZIA 1XF9A 1A9XB 2O52A 2X8AA 1QR6A 4K0RA 1G64A 2EZTA 4LW8A 3EE6A 3K0FA 2CNBA 2N9UA 4Q19A 5JNTA 3HKDB 2DWUA 3TLGB 4D4KA 3H97A 3N2LA 1B1CA 2J41A 1UJCA 4OQXA 4Z3KA 4K87A 1JBQA 4MJ3A 1OZHA 5KOYA 2Q8QA 1L1RA 3FOEC 3A1VA 5DT2A 4JLNA 4RTQA 3A4MA 1ZQ1A 3V4SA 2XODA 5CIYA 2BKEA 4N54A 4YUZA 4OHZA 3RS4A 1RQRA 4CZ2A 2MSNA 3E9ZA 3HYRA 4ZALA 4MW5A 1KMQA 1XE3A 4CG3A 2D74A 4EF4A 1S2NA 5DSZA 2GXUA 2RKWA 1PQUA 1CJMA 1RYZA 3BXPA 4QUDA 4TYQA 5FPPA 4ZJZA 1D5CA 4YO7A 4A1FA 1PJSA 4H15A 4ZQGA 4R41A 5L9AA 3FTQA 1ZVKA 2CNDA 5CYGA 1RYDA 1Z17A 4A5OA 5KIAA 4PZPA 1QB8A 5K09A 3HGTA 1ZISA 1SAYA 4ZAXA 3W9BA 1EB8A 1L4GA 3W5IA 4UZSA 3M6FA 1W36B 4C4PA 2ZUTA 5LUAA 3IMCA 3LX5A 2FTKE 5AVRA 3H7IA 3U4DA 2Z30A 1U8XX 3QWIA 3G2IA 1PL8A 4PHHA 1HH4A 2Q41A 3I9OA 1B00A 1YC2A 3E4CA 2QF7A 1T8SA 3ESYA 3MJVA 5LC1A 1LLQA 2BFEA 1Q57A 2JIQA 1ID1A 1PV1A 1KI3A 4PAMA 4KKVA 3JZIA 2JIPA 3FE2A 4O6VA 1BFDA 4R98A 4WVLA 3KYDA 3W5SA 4PN7A 1ORDA 3A6LA 1J0DA 1II8A 3C0KA 3D3WA 1VJGA 1U9IA 2NYRA 4OOEA 4M1MA 3ZLVA 5HHTA 4TVKA 3OEED 3TE7A 5LMNB 4Q5IA 2X5XA 3UN1A 1IBMB 2R5NA 3R6WA 2ZJFA 4FGSA 4OJMX 3X1DA 2YUTA 5G40A 3GAZA 2J3LA 1OX4A 1M67A 3HKDA 3TLGA 4EFLA 2XE7A 2YHSA 3I2KA 1OH6A 4KIWA 4YRZA 3T41A 4D8UA 1HT1E 1XTUA 1I30A 4KO4S 3B9BA 2YMMA 1A1SA 2Z2IA 4LZZA 3I76A 4F06A 2PXAA 3VSAA 4D43A 2ZT5A 2FEMA 2H7YA 1QVZA 4L9SA 3C87A 1MU0A 3EMBA 4TWJA 4UXJA 3VC2A 3P2MA 4DQXA 4QSMA 2CLFB 2ZRKA 4J2OA 2ZDHA 4LI3X 3RUPA 1J39A 4IUYA 3ZLJA 2VCEA 4LOAA 4MX8A 3QEAZ 4LF4B 3DYBA 2OVBA 3BDVA 1D9ZA 4FR0A 2Z4SA 4UHHA 4EF5A 2XUQA 4ZYXA 2V8OA 3DAHA 2C20A 3FD8A 1KH3A 3B1XA 2RGXA 5BV7A 2JGJA 5KTSA 3AB8A 2JIDA 4NK4A 3VDNB 4BNUA 1KETA 4YRJA 4PCVA 4CMBA 3NAGA 3DO6A 2GBGA 1VXRA 5JSHA 1XMPA 4OQFA 3BIWA 1GUFA 1Z2OX 1ZJ6A 1NI5A 2A9FA 3A1WA 2CVOA 3AJDA 5AW3A 1NWCA 1X70A 2DP4E 2QJWA 3FHJA 2C1ZA 1YRBA 4ZEXA 1SB9A 2P9ZA 3JY6A 3DDOA 4G89A 4IOKA 3R9IA 1XMSA 1V2HE 3C4QA 4PNZA 4ID3A 5KYUA 1MAHA 5CB4A 4GU5A 5EVJA 4O4LB 4KO1S 1CNMA 1WCV1 5TARA 5IYZB 1B0AA 1Y33E 1IQRA 2JEZA 3E9NA 3LLVA 5JW6A 3FN4A 4KQIA 2ORED 4YJ2F 3U61B 3NWPA 5CDHA 2E82A 2M6RA 2DBVO 2HHLA 1F06A 1N6NA 3LOQA 3VJKA 8GPBA 5KNDD 3SS7X 4Y2JA 2PRKA 3D0OA 4IYRA 5K4AA 5TJ9A 2H0AA 4TYMA 4I4CA 4XPZA 4CLRA 2ATIA 4RHTA 4HOYA 5ALJA 4E5KA 2IEBA 1SBZA 2EKPA 3A4IA 5ARDA 5AVVA 5JNWA 1Z07A 1XEAA 2XCIA 1CE8A 2WTMA 2IZ0A 3QE4A 4KQMA 4UOEA 1UT6A 4FX2A 1II0A 2GCEA 3G85A 5FHRA 1PD0A 2IEIA 3FR8A 3CX3A 4RD6A 2UUAB 4DNQA 4TV8A 5T4EA 2C84A 2IYUA 2WJWA 2GMWA 1TC2A 3RVBA 4NZMA 3CNQS 3N6XA 4I50F 5IDVA 4CTJA 2C4HA 2IXEA 2WIFA 1ZH8A 2GD2A 3NALA 3JSAA 4EB6A 1FVFA 1GWNA 5AHXA 3SD7A 4DIDA 1NNEA 2OHJA 3PP8A 3VBCA 4E4TA 2CV1A 1LFAA 1L6RA 5A05A 1K3UB 2NPFA 3ROEA 2JLYA 2ZJ0A 1RRFA 1KO8A 2QL9A 4M1QA 3QLVC 3R5HA 4DF3A 4EGQA 4B9AA 1HX7A 3Q10A 3GPDG 4YUYA 4ZEOA 3JVIA 4NATA 1WZ2A 1DT3A 3A3NA 4NS1A 5ELLA 3FUVA 2I76A 5JI3E 2G9QA 3R8FA 4BL5A 5C37A 3LQYA 3L6RA 2R87A 3WLIA 4D0LB 3R09A 1YRYE 4L57A 2OP0A 4L76A 1Z0SA 3AB7A 1XVVA 3HCPA 4N41A 1CY6A 2ATVA 3D7RA 1WXFA 3B6EA 5C2JB 5FQOA 4ZPXA 2ONJA 4IINA 1QV9A 1NMQA 4NYIR 5IUJC 1UT8A 3B9RA 5TY0A 1RZ3A 3HXPA 4B3DA 2FLWA 2I62A 3TRIA 3WFIA 3AEXA 3TQIA 3ZS8A 5IANA 2IOFK 4O4LA 5ICEA 1GR0A 3PC8C 3FGPA 5HA5A 3QKSA 4AJ1A 4UPDA 4K6GA 3PEYA 5DK6A 4BKMA 2PM8A 1P7YA 4CG0A 4H4DA 2CL0X 2RB4A 3IUEA 1PFKA 4I9GA 2CMGA 5E3JA 1CUDA 3TZCA 5HKKD 2P3OA 4ZCRA 3KDPA 1W36D 3IPAA 1KI8A 1U5BB 2ZATA 4F0JA 1JWLA 2B25A 4REQA 4LKOA 2PJUA 4JX8A 1S3GA 3K73O 5FLKA 2XMSA 3SSMA 1JEEA 4Y0VA 2AUNA 4QECA 3BT7A 4QOFA 4D26A 1K89A 3D6NB 3RTCA 1XDUA 2CSUA 1Q1ZA 4TXLA 5FA8A 4QEZA 4PC2A 4AZ3A 3HZOA 3K1TA 3Q7TA 4G6ZA 1TQDA 4M0MA 2RHJA 3AF4A 1BJTA 1KI6B 2IYAA 2NPOA 2R25B 1XCJA 4LSWA 1GHTA 2F43A 2X1VA 2DU8A 3L07A 3ND7A 2ZBGA 1X87A 2HSGA 5D5QA 2JCSA 3T1TA 1YGYA 4ZDIA 2H3HA 3EQ8A 3UJ7A 1UQRA 2PWAA 5F3DA 1K68A 2I2AA 1W2GA 2XWJI 2YDXA 3OOHA 1P3JA 4RQUA 4Y1GA 4QU5A 2XMGA 4DNPA 1PFYA 3PF8A 5K0TA 2AFHE 3GEEA 4DN6A 3AM1A 1NW7A 3ST7A 4WN9B 4EJSA 3RBVA 1G9XA 4QYSA 2J30A 3I8XA 2W11A 3L4SO 4YCJA 2JZOA 2NXNA 2QDXA 2A9VA 3I04M 1YZHA 3LHIA 4Z4QA 2FFHA 3FLMA 5KSWB 2WTNA 1DKUA 3BHIA 1FTSA 1E6UA 1XN4A 2Q28A 4KUHA 3ZDXB 1LSSA 3WNZA 5H81A 1QGDA 2DFTA 4OLJA 4PLWA 4ZAYA 2CNOA 4L50A 4YAOA 1L5HA 2W70A 4RTNA 1C50A 1J24A 3QYJA 4JVSB 3LDGA 4A2QA 2BT4A 5KU7A 2W9XA 4XSHA 2FXIA 4GKJB 1XPJA 2CHFA 3HDVA 1GPWB 5F52A 4QUHA 1ETHA 3KXLA 1P4HA 1KAOA 4AKIA 2BF4A 8AT1A 3K35A 1A97A 4Y3UA 2RGRA 3MD9A 5CCDA 4C21A 1ZICA 5G0SA 1SELA 4UMFA 4RS4A 4JNCA 4A0SA 4B45A 4EFMA 4Y6RA 1KZ6A 3CX6A 4E09A 4OXRA 3TS1A 1SEPA 3SQMA 5TC4A 2BL4A 2DFVA 5KWVA 2JRCA 1FRFS 1R15A 1BU5A 3C2QA 1QMGA 3ODGA 5LDDC 4DEVA 1JXOA 2VT7A 4LZAA 3GJZA 3VTZA 4AM8A 1WXIA 1SB8A 4C4AA 4CIYA 3G8CA 4AZ3B 1EGQA 2QZPA 5A5DA 2IBSA 3LK6A 3NNSA 3AM5A 2VJKA 2PWZA 1MOPA 4JVMA 4N3AA 3UHJA 2FCRA 2VG8A 3H0EA 4U39A 5KYGA 3KQVA 1U99A 1Y34E 4WY5A 4ZVRA 4ZQCB 1DG1G 1YQDA 2AFRA 3H2GA 2O59A 2I55A 1KYXA 5FI0B 4Q0MA 4BKQA 2B7CA 3H3FA 3S8EA 1LRLA 4N49A 4CM4A 2QMYA 3OFNA 4HUQA 4N3BA 3T9BA 5TR9A 3W5BA 2ZSDA 1GSOA 1S6YA 1ZA2A 2C0PA 4HV4A 3R7WB 4W7HA 3E9YA 3HJNA 4P3XA 5TS3A 3TZLA 3V1TC 1PFGA 3QM1A 1EP3B 5IMBA 5CX1B 3N5KA 1NVVR 2OHIA 3R3HA 2ZREA 4YROA 1ZI9A 4RUKA 3ZCQA 2JAOA 3HBJA 4DJEC 5EYPA 5I48A 1UK8A 1AGPA 1PWYE 2OV2A 2I1VB 3D8UA 1FQJA 3BRSA 1SD5A 1J7KA 1DI0A 1WM1A 3CKKA 3DBRA 4B2IA 3FVTA 1K6EA 1GSHA 4OREX 2DVMA 2J5KA 2OD2A 3LVFO 4BMZA 2V6FA 1IULA 4OLFA 2B98A 4BLOA 2A84A 2FZVA 4QKQA 2IVZA 3FHLA 4HHEA 2O8EA 1ZVQA 4DZRA 5A2GA 2F1OA 4NTZA 3S1LA 4XWKA 1P91A 3V1KA 1KS9A 4PYLA 1MTZA 2VEDA 4IIGA 1MJ5A 4RMIA 4GLFA 1COZA 3WLRA 1R8QA 2DERA 4INJA 1FJGB 3A04A 4HVCA 1FB5A 3VKFA 5DM1A 3RSQA 2AHOA 1UC9A 4QD3A 2QUJA 1TGYA 2X15A 4YRAA 5EHIA 9GPBA 1XHFA 3F8TA 1N2HA 4LTMA 2H07A 3P96A 3W8NA 2GVZC 3DV0B 3U1BA 4YUWA 2XUZA 3RPEA 1U0HC 4PNHA 3JU3A 2VJAA 1UOOA 3EOAI 3K05A 4RGQA 3TO5A 5JEDA 1GTVA 1XELA 4GR4A 3EULA 5LLSA 3UMBA 5JXWA 5KQLA 2VNKA 2XVXA 4EGAA 4IHQA 1K2WA 4A2CA 2P65A 4L5AA 2WQZA 4LPKA 1L8LA 3MFQA 1M2JA 1Z6YA 3WI7A 1V16B 2OLJA 4V0MA 1TUGA 5GONA 2XSZA 3WMRA 2MIIA 3H2ZA 5FBHA 4YPVA 5JZMA 2Q1YA 4RPCA 3DH0A 3VR5A 2O1WA 2QKYA 1Z73A 2DJ5A 2NSDA 3KTOA 3GRAA 4HUQB 3OZRA 5CK4A 2LCQA 2IC5A 3Q6NA 5EINA 3LL7A 4D3XA 4BO1A 4CKEB 4CLOB 5B5SA 2G8NA 2P0AA 2YS6A 1GO2A 5ALTA 1L7NA 1UIMA 2F3SA 4FCWA 4GKVA 4HB0A 4K9OA 2XYHA 4W5WA 5CX1A 5J5AA 4XYLA 4V1CI 4JL8A 3LUHA 1AQ6A 2IGTA 3B78A 1JQJC 4IDDA 3OP1A 2D2EA 3BXGA 4Z2YA 5KCZA 2FJUA 1OB5A 4ME6A 4O2AB 2PL9A 4IHJF 1MO5A 1HK7A 1GPKA 4IVNA 3D7KA 2P5UA 3EZYA 4QJBA 1QU3A 4X6XA 3LC0A 1OXMA 1S8OA 4QUJA 3W05A 4CUZA 1TAGA 3U62A 5AUOB 4CMIB 4JITA 5AW2A 1U2TA 2BUAA 4EW1A 3EXEA 1ULSA 1MJNA 3A7EA 1KXJA 3L02A 1MB0A 2AV6A 2PSJA 3V4OA 2CMFA 2C3PA 4E2WA 2PY6A 4ND3A 1OJLA 2Q1TA 5BR4A 1EH5A 4K0KB 5M3BA 5EAIA 4TX1A 1P72A 3NP7A 5A71A 4IDEA 4ILEA 4RX1A 2C96A 3NV9A 4DR2B 2Q9CA 1IUOA 4EY3A 1E7YA 5BSUA 3CN9A 2QENA 3OWXA 3ZXIA 3H99A 5AXCA 5FV4A 5IZCC 3QKRB 4B6GA 2PRIA 1AA9A 1FNBA 3C16C 4S24A 4U5XA 3WQHA 5ITSA 1D2EA 1TCUA 1KVTA 3CZ9A 3PUXA 3EYAA 1LZLA 4RADA 1OLXA 2JC3A 3L0CA 4IDUB 1EDEA 3DL4A 4IH1A 4CV0A 1DV1A 3M2PA 2WJHA 4R1UA 4UJ5A 4WPGA 3IAHA 5EKTA 3U3ZA 2OV4A 2Y76A 1V8BA 2OESA 4ISBA 5BR1A 5J43A 5ALSA 4PIMA 5KTTA 5ES4B 1QFSA 4AYWA 4AXXA 1GNLA 2C92A 1VSVA 3IUYA 3C8UA 3P4YA 3DAYA 3WWOA 1FSPA 1RBYA 3BTVA 3SPXA 1ZBQA 3PFKA 5DI3B 3IVXA 3SNHA 1EVJA 5JNUA 1SZDA 1Z2DA 1C3JA 3D8HA 1TM1E 5FOWA 4C5AA 3THXB 1FX0A 3DQPA 2ZTVA 2JAUA 4BIMA 5EIWA 2QAGB 2AG8A 3E9CA 1BEZA 2ORYA 2WJJA 1ODIA 2DFDA 3CF6R 2W90A 3K8ZA 2PS0A 5DISB 1L7MA 2KBFA 1KOLA 1F7UA 3DW3X 1UPUA 4I08A 3VO8A 5GOTA 2ZI9A 1T8TA 4XI9A 4KUGA 4BXOA 3IFSA 1M5TA 3JQQA 2NTJA 3B6MA 1IDN1 3O82A 4JLWA 1ZM9A 2Q7DA 2YN2A 4ZICA 4LNUB 1YB1A 1L5OA 5CNKA 5F77A 1RRCA 1ZSYA 3VKHA 1BFUA 1OZGA 4QATA 2QR3A 3AEYA 3BB1A 4C7OB 3TBFA 4E46A 3ZG6A 3EPHA 3Q85A 3SMVA 2RI6A 4WLEA 4RKYA 5ICGA 1BHO1 2VNIA 2X4DA 4N0MA 3X2SA 2XB6A 4ZYWA 5L40A 2C2WA 3K9NA 4MRSA 4U6SA 2HIAA 1J8DA 3CM0A 2X1HA 3UV7A 3H3XA 4EARA 3DO5A 4YBRA 1DARA 3JD1A 5JSZB 3ZCXA 5I4BA 4OLAA 3ZW8A 3E8XA 3QV2A 3KZXA 1D0SA 1X7DA 2F59A 2B6NA 1N0HA 4X97A 3RKUA 2GTIA 2O2CA 3JQEA 4WESA 1TAUA 3RFXA 3T7KA 3KDAA 1OXBB 1DG3A 3TBHA 1E6WA 1HG0A 3KVRA 4LDQA 4PEVA 3BWBA 1XCMA 2IPAB 1JHDA 4M9ZA 5KVAA 1PQYA 1YDMA 3UF0A 2VTBA 4LRUA 5ES3A 2HREA 4JJ8A 3FPKA 4IXWA 5JDIA 2ISSD 1AGNA 2GEBA 2DQ4A 3I4CA 3BRWD 1DOZA 5DH9A 5D5PA 5IM4F 3B9QA 2A2ZA 3G7UA 5DYWA 3ZCRA 1SUCA 4XUCA 3L4BC 5A4JA 1MX3A 4Z4HA 3MB5A 2AMVA 3H6HA 1W9HA 4L4XA 4TRNA 1PT8A 3AFGA 4G97A 4WKPA 4F11A 4L0DA 3OMLA 3P2EA 3NLLA 5CPFA 1G7CA 2C2OA 3SYLA 4Y2TA 5CM9C 4P86A 3GAFA 4XJTA 4ZCLA 2V55B 1PK9A 2QAGA 2IS6A 2E6UX 1I5OA 2WVAA 3I1FA 3W6PA 4Y2SA 4JYBA 5B1IA 3T7AA 3GLIE 1XLUA 1LS1A 3B1ZA 4FBLA 8ADHA 4D98A 4M0LA 4CV2A 3T1NA 1E2QA 3N7UA 1PEDA 5G0TA 4MI9A 5LDGA 2QXTA 3M6XA 3BJRA 3OLQA 4CFSA 2I8LA 3ILHA 4FHGA 5K05A 5AJTA 2QLLA 2R9VA 4YQFA 4U7JA 2VYFA 4R9NA 5ER6A 3RFTA 4NOJA 3O4VA 4HQNA 2C4NA 1L5SA 1WDLA 4JJEA 1OH7A 1TM5E 2QLJA 1Z0KA 1Y80A 3EVCA 3JQRA 2D8AA 3FRHA 3UJ9A 4HQ0A 2ZR8A 4C7OA 1M6HA 1X1QA 4JYCA 4LX0A 3SBXA 1Z33A 2DMRA 5F7XA 4X65B 2ZXUA 3I5YA 1X1TA 4FEAA 4KXVA 2D1SA 2QXUA 4BMNA 4ZOAA 3TSOA 3SJUA 5LZ7A 2G67A 4ZAVA 3TLYA 1C1HA 1UC4B 3GGOA 4K9RA 1WDWB 3LT4A 4L07A 4KRGA 1W29A 1KC1A 4WNIA 2Z4RA 5EZYF 3TQQA 5CFNA 4LHYA 4XUGB 2RK6A 2I2WA 3FNQA 1YDEA 5LIRA 2QX8A 1ZLYA 3MJTA 5HM8A 3PUZA 4HRXA 4LYJA 1FMFA 2R8PA 2ZU6A 4IP0A 4EENA 2OSBA 2VPPA 1M34B 4LSMA 4MMYB 4WFKA 3EIWA 5IJAA 3R74A 1WG8A 5KPDA 3WDKA 3ZNPA 5DOVA 4BX3A 4G0YA 4WECA 3ZIDA 2XE4A 1GP2A 3I3OA 1DEXA 1HDEA 2HCFA 4LECA 2C99A 4LC1A 4ACAA 3HCCA 1KJ9A 3AHDA 3MK31 4YRGA 3KE9A 2QUZA 2E89A 2ZYTX 2VHVA 4P36A 1SBCA 5C53B 1FNCA 3ESQA 1HUQA 4RY0A 2ID9A 1JBKA 5HS6A 2FH5B 1DQZA 1W36C 1I3MA 4MQUA 3DKKA 2XJ9A 2VSXA 3RR2A 5D86A 4LJ9A 2FMTA 1E2MA 1VE7A 1WY7A 4EI9A 4GVLA 4Q39A 5EFZA 4UFNA 4YYEA 4AULA 4RJJA 3KLOA 3FCOA 1ILEA 1X39A 2GLXA 2G0TA 1SU7A 3CKYA 4OTZA 1KWKA 1BCSB 1QH1A 3KXIA 4BUZA 1EAYA 1RM3A 4GR5A 5F1YA 1P17A 3H2JA 3OQPA 1Y42X 3I1JA 2V5AA 2WNIA 5CA0F 4EJ2A 2GN6A 4NQZA 1IIBA 3H2HA 2PDAA 4FVTA 3VMMA 1LBQA 1T5OA 5EP1A 1UZNA 1U3WA 3HFSA 4IEEA 2Z5FA 2HGSA 1R27A 3C3JA 3P2OA 1WF3A 1GUDA 1EGMB 1OWMA 1SUPA 1E60A 3E22B 2OQVA 4DLKA 2HSZA 1LI7A 3EVZA 2Q49A 3G3EA 4DSAA 5BV0A 1M75A 3QGMA 4EB3A 3HA2A 3B7WA 1LPNA 4WGGA 3ORHA 4LFAB 1QP0A 3C3DA 2E5WA 1G5IA 4B6FA 4GUDA 1Z82A 1SCDA 1LDNA 4LG1A 1KP9A 3DEIA 4EJSC 4BMOB 4D02A 3MAGA 1WLYA 1OPRA 2V8BA 4WLOA 1LVGA 4Q9JA 5AKKA 1RWXA 2DEUA 3D4BA 4LBWA 1W46A 4QYTA 1Q3KA 5I45A 3AEQB 3C43A 3O3CA 4GGPA 1SQ0A 5LQDA 2FMUA 2P3LA 1M2FA 1D7AA 1ENOA 1NVTA 5LB2A 2FG7C 3HDYA 4FDLA 1SXJB 2O0MA 1TOAA 4ETNA 1NI4A 3NVKI 4A91A 1H0RA 3C1TA 3PE3A 2V7WA 5JMPA 3H1AA 5FUWA 2Q5OA 4KRYA 5BQPA 1D4FA 2ZI6A 1PR0A 2C7QA 3A10A 3LHKA 4GKBA 2RB5A 4WFIA 2DR2A 2A0WA 3U3RA 1I33A 1JXQA 2HMVA 1Z3IX 3LCCA 3ZV5A 3K6RA 3AZPA 4OHRA 3BUSA 1E77A 1F2VA 2HFJA 4BWYA 4N0PA 1RYEA 1T3ZA 4W1SA 5FRDA 3PXAA 5J4VA 4Z4GA 3IDOA 2OENG 3QBDA 2RDMA 2J09A 2VWPA 4OHFA 2W2LA 4M8KA 2XYGA 4YMWA 3IDQA 3M34A 4DBZA 4HWKA 4IQ0A 5JAPA 4KE6A 3UA3A 3LYUA 4DRYA 1Q1EA 1AQLA 3SYRA 2PEZA 1YJAA 2O5VA 3HDJA 4KRFA 3CUYA 3HBMA 2HPVA 3DAFA 3OIFA 5DCWA 4Q7LA 3PC8A 1HMYA 1CF9A 2QN6A 2FZWA 2QU8A 4MVJF 4BGPA 1E1RA 3HI6A 1JL3A 1UXKA 2HA6A 1CW2B 3CZMA 4C6SA 4OJKA 4E5NA 2NVWA 5K9ZA 1QZ3A 1KI4A 3D0RA 5KQPA 1XTIA 4N9WA 2WB4A 4BRUA 2ZQ5A 5EG5A 4HXYA 1JFSA 5DGTA 5IUKC 3DEJA 1NUHA 4FOLA 3MYYA 1PKXA 2AG5A 2LXNA 2ZUUA 1G3MA 3H9QA 5EIBC 3UAZA 1K9VF 3VUFA 4QJ5A 3WIUA 2IXBA 4FFNA 4CVNA 5DEIA 4RTLA 3RRJA 2R11A 3HPQA 4P3YA 3E84A 4BP9A 1G21E 4ZQHA 1KEEA 1QE3A 2H4ZA 1QSGA 3AETB 3IQEA 1T9GR 4I9FA 4X41A 3KJGA 3B3JA 4ACBA 3ZHUA 5IXSA 1M73E 1DIRA 1N8NA 4I81A 1CVIA 3PQ8A 4E0BA 3DLCA 5LP1A 1DQYA 2REQB 3QLVA 3LY5A 4FWIB 4OHBA 5DHRA 3GJ3A 1NRJB 2VF4X 4KN8A 4MWOA 3P5SA 4XXHA 1JMVA 1XC7A 2CNNA 1JB1A 2E87A 1WKVA 3COSA 2ZR7A 3HVHA 5JS8A 1Z34A 2G1UA 4K28A 2WZDA 5AI9A 1B76A 1V0JA 2GBFA 2EAUA 5C8ZA 3V32A 5B1HA 3EPPA 2JFHA 3ESZA 5CD9A 1EX9A 3R6GA 1JU9A 3WDLA 2X9GA 2B69A 2ON6A 3OZVA 1ZCJA 1OLSA 2EGHA 2IYLD 4NENB 5FWXA 1C3XA 3QFSA 1X1RA 2IOFA 3ENQA 3B5IA 3C85A 2UYOA 1P77A 4CIXA 4X62B 5DZSA 1DUIA 3O4HA 4H17A 3ADDA 1KJQA 2P6NA 2AR0A 1QB7A 1FLNA 2GTHA 4AIIA 4BV3A 1QH8B 1FW8A 3ND5A 5BO5A 3PNBA 4Q4JB 2Z8YM 1EUQA 1EWTA 3BXZA 1V9CA 1EZ4A 1SIOA 3ROQA 1ZGGA 1X3LA 4JP8A 4ESEA 3GFSA 1ZJ5A 4RULA 1QANA 1C1DB 2ZAYA 3COVA 4MYRA 3KKZA 2ADOA 2WY2D 5LL6P 3G2PA 1YCDA 5A9TA 1J90A 1PJ4A 4ON9A 2GHRA 2DWCA 1P2GA 3CISA 4BZQA 4E15A 3BQNB 4ENVA 3ZR4B 1M2HA 1QHFA 2Y1XA 3KFLA 5A4MS 4XIFA 3LY9A 3AFNA 2C0QA 3KC2A 4G8JA 4Q9LA 1K86A 1VPEA 1F4LA 4B7AA 5ISMA 3WHKA 2C7GA 5G2OA 3KR0A 2VQFB 3OJEA 4GQBA 4KX3A 2VDWB 1FP6A 2GF0A 4RA6B 2VF2A 3TGPA 3UPUA 5HJ2A 1WY5A 3VNSA 3HRIA 3M1IA 4O4LF 1DC3A 2J0EA 3U31A 5G1NA 1U5AA 1A8HA 1PDVA 1YXMA 2CXUA 1CJTC 3E7DA 2H8GA 2XH8A 3BL8A 4H16A 4X60A 1KVSA 1ONBA 2I99A 3TKYA 1UM8A 4IJSA 1EM8B 4HXFB 4OH1A 3N2GB 4H4EA 4WBNA 4OH7A 4YCAA 1E3DA 3CE6A 3UAVA 5A0TA 1G60A 2WI8A 5B12A 1EXNA 5C5IA 3NPMA 4EKIA 5CG1A 3ICEA 4ZCIA 2ERYA 4R9UC 2B5VA 3U80A 3N0VA 1MZPA 5DJ5A 4YT8A 2C9CA 4GI1A 3HI4A 4LWZA 4QNMA 2ZTSA 3BMXA 3EAGA 4KQEA 2CE2X 2PX8A 1XJ0A 5JD6A 1FFHA 5FXMA 4KFRA 2PTHA 3WGVA 2FEAA 2IPLA 3TGWA 3EY9A 2CCGA 1EUCB 1FU7A 3T3OA 1NQOA 2GWHA 3P9NA 2UYQA 3OQMA 4IFEA 3ZVLA 1ACJA 1YVRA 4Q4JA 1NBMA 3HEMA 2PZFA 1AC5A 2DPLA 2Y1KA 4UUBA 4AK9A 4DDKA 5CVTA 3EPJA 4E22A 3W8FA 2B8WA 2CVZA 3FWHA 5C3MA 2W42A 3CC8A 2IUEA 3E7FA 3H86A 1PS0A 1Y4UA 1XLTA 3OE1A 2CF5A 4M7PA 3CRQA 1NF9A 3C6QA 3LUBA 2G40A 5LXTA 1S9DA 1DLJA 3PR3A 4GGOA 4N3GA 3TG8A 2UUBB