2ZCVA

Crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
283
Chain Sequence
b'MIAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALAAQGITVRQADYGDEAALTSALQGVEKLLLISSSEVGQRAPQHRNVINAAKAAGVKFIAYTSLLHADTSPLGLADEHIETEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQNLSEADFAAALKSVGLPDGLADMLADSDVGASKGGLFDDSKTLSKLIGHPTTTLAESVSHLFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized oxidoreductase ytfG
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Crystal structure of a new type of NADPH-dependent quinone oxidoreductase (QOR2) from Escherichia coli
pubmed doi rcsb
total genus 99
structure length 283
sequence length 283
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zcvA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2zcvA02
2QG4A 4EJ0A 4MIEA 3S2EA 4WLVA 4K28A 3RKUA 2C7GA 2P9EA 1SO8A 3ZV5A 1HZZA 4DUPA 3D0OA 4P38A 4AJ2A 1XYGA 4DLLA 1ARZA 3L77A 1BMDA 3GQVA 3PPIA 2C54A 3RJ5A 1KVTA 2GYYA 3O26A 4D79A 4BL5A 2GPTA 2VHVA 1ISGA 2OUIA 2FP4A 4GL4A 8ADHA 1LI4A 3OQBA 4I5GA 3S2GA 2SCUA 4XQ9A 3QIVA 5I7FA 3UVEA 4LCJA 1HDXA 4ZQGA 2NQTA 2ZCVA 5F1KA 4MJLA 2IEDA 2GERA 3FWNA 1N92A 2ZJ0A 1XWFA 2CNBA 3H5RA 3IMFA 4AICA 1MC4A 2O2YA 3ZWPA 2VRCA 2OGUA 3IIEA 4GWKA 3ZWXA 2Z95A 4EITA 3ZWAA 2GN9A 3WYCA 4NFSA 2BD0A 4GSLA 4MVJP 1K6XA 3RCBA 4PZEA 5JAIA 1T24A 3EHEA 4OQZA 2HO5A 1C3VA 3JQEA 3JQAB 5IJZA 1KERA 4IZIA 1TXGA 1FK8A 1F06A 3IJRA 5TJ9A 5IG2A 4JROA 1SCUA 1ZK3A 1K6JA 2PKQP 4JJGA 5BQFA 4RVSA 2GZ2A 1CETA 4BGIA 5ILGA 2WD7A 4R01A 4CL8A 5L51A 3RASA 4TRRA 5COBA 4LMPA 3JQ8B 3V8BA 3LSYA 3PXXA 1LXCA 5JAQA 1Y5RA 4BO7A 4DC1A 3TZKA 4AG3A 2CVZA 1YOVA 2UYYA 1M67A 3EZYA 4R3WA 3I9OA 1KBZA 3INGA 2C5AA 3DL2A 2A9FA 5JC1A 1W73A 1OI7A 2OL4A 3AW9A 4UREA 2H1SA 2HMSA 4XYMA 1QV7A 3QWFA 4MVJF 3W4KA 1KC1A 3PDUA 1TEHA 4AJ4A 2RIRA 1ZVMA 4BNGA 4Z6KA 4HXYA 5IXSA 2ZTVA 2B69A 4PCVA 1R37A 5TT0A 4YAIA 1ZSVA 2IRWA 2OP1A 4QX6A 5IZCA 5BT9A 1EVJA 1ISJA 1I2BA 3JQ8A 4IQGA 4D43A 2WDZA 4HWKA 5CDSA 1U9JA 1ENOA 1YO6A 2X58A 2ZCUA 4NFYA 1HYEA 4DPMA 3RC7A 3DO5A 4FJ1A 3W4JA 1RM5A 4K6FA 4DREA 2VQ3A 4R68A 4RPLA 3UAGA 4ND1A 4ALMA 4HUJA 4XR4A 4TRMA 2ZTUA 3PIIA 1JTVA 2JHGA 1YJQA 4UUPA 3ASVA 2Q2VA 4WGGA 3VPXA 4EJ6A 3KEQA 4J2OA 5IDYA 3K30A 4AJPA 3AU8A 3AUSA 3BTOA 2UAGA 2VWHA 4XKJA 2ZB8A 4GKBA 4NDNE 4IQ8A 4TVOA 1NBOA 2HLPA 4QSMA 2AG5A 4YRDA 4M87A 1E7YA 1ONOA 1ZK0A 4E2XA 1M75A 3ANNA 4XX0A 3JYQA 1Y5MA 3DAPA 3QQPA 3WDSA 1PTJA 3DZGA 1VI2A 3EDMA 4E13A 3RQSA 2X86A 3L4BC 3GUCA 4TVBA 3ZU5A 4DXHA 4GH5A 3H3JA 2EIHA 5JMPA 3QWIA 2IYOA 1R4NA 1FJHA 3ASUA 4W6ZA 4CMEA 3DQPA 3F4BA 1VL0A 2Y1FA 3DOCA 1TA4A 3GPDG 2GASA 3ZWNA 1W4ZA 1Q0LA 3ENKA 3AI1A 1EUCA 4Q3AA 4CMBA 4P22A 2V6BA 2P91A 4DLAA 1HDRA 3QWBA 4U6SA 3LVFO 1Y81A 5MDHA 4RVDA 1Z45A 5G4KB 1HRDA 3FHLA 2AQ8A 4CQMA 1G0OA 5KJFA 3A28A 1GZ4A 4ALLA 1F0YA 2Y1DA 5H81A 3F3SA 2PD6A 2HRBA 5L4LA 1I3LA 1SEVA 2YUTA 4XQEA 3DOJA 1F17A 1ZK4A 1HXHA 2ZTLA 3MJ4A 3P2YA 4CMEC 3OSUA 3WYEA 3U49A 3H2SA 2BKAA 4JNKA 2X1HA 3K96A 3OECA 4B4OA 9LDTA 1CRWG 1LTHR 1V9LA 3PWZA 2HQ1A 5CEEA 4B8ZA 4B4VA 3SC4A 1DDOA 1WVGA 2HMWA 4I9NA 4QUKA 3DBHA 4RORA 4JLWA 1BRMA 1ZFNA 3JQ9C 1XSEA 3F1LA 2Q4BA 1NQOA 2O50A 3KZVA 3DMYA 3QVTA 1N7GA 4R69A 4A7PA 2VUUA 3D3WB 3I6IA 4CM9D 9LDBA 3WGGA 4ZQEA 3ZNNA 1XG5A 3TQHA 1VPDA 4ND5A 4MIYA 4B7XA 3BA1A 1UAGA 1XELA 4C7JA 2Q1UA 3NDIA 1B8VA 5DBGA 2EV9A 4RPJA 2PK3A 2EW2A 1QLHA 2O3UA 4ONEA 3JQ6A 5JXWA 5A3JA 1YDEA 2VT2A 3WICA 1Y8RB 2ILTA 4KUHA 1YGYA 5ILOA 2VYVD 4I5DA 4DPLA 3PI7A 3OH8A 3FI9A 1I3NA 4QFCA 4N5LA 1NTOA 1ZUD1 4YA6A 2DM6A 1H6AA 3MJTA 1IPFA 3RUIA 1PJLA 2RHCA 1ENPA 3AM4A 3UF0A 1ZKMA 2PZMA 2CVOA 4A5OA 4FR5A 4B7UA 1H6BA 3LQFA 2DBQA 3PDJA 3PWSA 3CUKA 4CL3A 1ADBA 3HUDA 1UXHA 1PZGA 2GN4A 3I83A 1BXGA 3N7UA 4OXKA 3DMTA 3FWZA 1I3MA 3WWZA 1JAYA 3DR3A 3E8XA 5EPOA 3ENNA 5LC1A 4TWRA 4CMKA 4JK3A 1I36A 2O3RA 4PLYA 1PL8A 3VZPA 4PLPA 2E6UX 4GVXA 1NHWA 3C7DB 4OMUA 2D1YA 2OOSA 4UAGA 4FOSA 2NVUB 1E6EA 4B4UA 3WGHA 2HK8A 3NKLA 4CM5A 2GR9A 4R3NA 1X13A 3DEYX 5KTKA 4DWVA 1HLPA 1P74A 4RDHA 1BTOA 4YT8A 1YBAA 2EJVA 2I3GA 1PL6A 4URFA 1A4UA 1EE9A 1YH3A 3FNFA 5H83A 2WYWA 3BTVA 2VWQA 4HFMA 1YONA 3R3JA 1T2FA 1Z75A 3GUYA 1Z7BA 2DBZA 4NJMA 2PZKA 4WOKA 1P9LA 1Q2XA 5DCUA 2QZZA 4MP8A 3C1AA 2ZB4A 3Q6IA 4LSWA 4GMGA 4BO5A 3AY7A 4A10A 1ULSA 4CM4A 3CMMA 4CM6A 4M55A 1GCOA 4F46A 3E03A 4XB1A 4YAGA 4WEQA 3AUAA 2HU2A 3HADA 4BIIA 1C14A 4K6CA 1I24A 3PHLA 1PZFA 2VOJA 3SXPA 2GZ3A 1Q0HA 1DIBA 3JD1A 3GZ4A 4OAQA 3FCOA 3HHPA 2O4CA 4KTVE 2G0TA 5FEUA 1U8FO 3LYLA 4PZDA 3VOSA 1EK5A 5KNLA 3QRWA 1N5DA 1BW9A 1FF9A 1GTMA 1I01A 3JQDA 3PYXA 4YJDA 5HA5A 2AHRA 4BKQA 4JGBA 3E9MA 1KETA 1RJWA 1T2AA 1X14A 3D3EA 4CLHA 4BV9A 4GX1A 1LRJA 3UOGA 2OBYA 3FRJA 4ALKA 5HWSA 2DTXA 3PHJA 4N5MA 4AJKA 3VTZA 1Q7CA 1U2GA 1PJSA 1IE3A 2HK9A 2X9VA 1NFQA 3GG9A 3W1VA 4CM4B 3NV9A 5L4SA 4RF5A 2BFPA 5TX7A 4IIUA 1QP8A 4E21A 3VDRA 3CSDA 2PY6A 3QSGA 1NWCA 5B4TA 1YL5A 3QA9A 5A3VA 3ZGYA 1I33A 1M76A 4LW8A 1ENYA 2PWZA 1ISFA 1XU7A 3PLRA 1JN0A 2DU8A 1E3EA 3IS3A 4I5FA 4NBRA 2PKRA 1A9ZA 1Q0QA 4CV0A 4FJ0A 4TROA 3JTMA 4HX5A 5F5LA 4AVYA 1WZIA 4XDZA 4O6VA 1L7DA 3JQBA 5J23A 1WDMA 3MJSA 4BKPA 5AYVA 3U62A 2YY7A 2NVUA 4U7WA 4GWGA 1LLQA 3WXBA 4LSMA 4AJLA 4CUKA 4WE3A 4CMAA 2QRJA 1MV8A 1HZJA 2R6JA 2EF1A 1Q7GA 4GPD1 3EYWA 1WW8A 2Y1CA 2J6IA 5L9AA 3KYBA 4NJMB 1VE9A 5KCZA 4CV2A 1RKXA 4RF4A 3CINA 2B4QA 5THKA 1NASA 2WSBA 4K9DA 3TFOA 1HDGO 2D2IA 4OOEA 5KOIA 2Q1TA 2J5RA 5I7VA 4NR0A 4EI2A 1WDLA 3WNVA 4OJNA 4L73A 1MLDA 1O9BA 2VHWA 5TIIA 2QRLA 3ZHBA 5AXCA 1KYQA 4Y6RA 1XKQA 2B5WA 3KBOA 1OAAA 3C3XA 1LRLA 3LU1A 4O1MA 1PR3A 3MTJA 1Z6ZA 2D3TA 2HJRA 3DAFA 3S55A 3DZBA 4IBOA 4J16A 4GI2A 5T57A 3WJAA 1B7GO 3DFUA 2GD1O 3BMNA 4MP3A 1I5RA 2PH3A 1NFFA 2VHXA 2ZKLA 1NXQA 2O3JA 4FD3A 2EGHA 3WIEA 4GX0A 3P5SA 3PGJA 3CZRA 5B1YA 1H2HA 2RH4A 1ZW1A 3GRPA 3H9GA 3HWRA 4WLEA 4ZD6A 3AOGA 5JE8A 3O9ZA 2EG9A 3IKVA 4IINA 4YJHB 3U4HA 3IC5A 3TRIA 4BKOA 5C7LO 5KJ1A 2O3SA 4DTIA 4YDRA 3ADPA 2JD2A 2EWMA 3BMOA 4J49A 4ZRMA 4AJIA 1DB3A 5GMOA 2PGLA 4YYZA 4RZHA 4NPCA 2C2YA 3D4OA 1P45A 3F47A 1DJQA 4NBUA 4OKIA 2CF6A 1YB5A 1MUUA 1KVUA 1LC0A 1X7DA 1FDUA 1HE5A 3HDYA 1K5HA 5A5EA 3UUWA 4IGEA 1K6IA 1XGKA 4CM3A 3GZNA 1ORRA 1UUFA 4YT5A 4MINA 2Q1WA 4M54A 2NTJA 1D1SA 4R54A 2JD1A 3GNTA 3GNQA 4BNKA 2VYNA 4QECA 4FSHA 3HN7A 3WNQA 2JAPA 3A4VA 4D0SA 3WMXA 3VH3A 4M89A 3A1NA 1ADGA 3TOXA 2QYTA 3UXYA 4KTTE 3AFNA 3JQGB 3JD2A 4TRJA 1LRKA 1X1TA 2J3IA 4Z0TA 3COSA 1OBFO 3U4CA 4BNTA 3DBLB 2VTEA 1C0PA 4LISA 1CJCA 1ZJZA 2YDXA 4D46A 1TLTA 5F1PA 4Y98A 1FDVA 3JQAD 1HE4A 1GU7A 4WCFA 4GAEA 2WD8A 5TJHA 3MOIA 2EGGA 4D3SA 3K31A 1LNQA 4OL9A 3RUCA 4XGNA 4J4HA 4DPKA 2ZIZA 3OHSX 3WS7A 2HMUA 4HFNA 1E7QA 1YBMA 1HDOA 1DC3A 1H94A 3KVOA 3DWFA 3F9IA 3KXDA 1NHGA 5JCXA 1GUFA 1SB9A 3DZHA 1MG5A 3BHIA 4E30A 3V2UA 3VDQA 5FF9A 3CPSA 4K26A 1UZMA 5JAZA 5KVCA 4UEKA 2G5CA 5AXAA 2PLAA 2BH9A 4XB2A 3Q2KA 1KEUA 3ZHXA 3DZKA 2DBRA 4H7PA 4PVCA 4ZICA 4NBWA 3OA0A 4O5OA 5DF1A 4D45A 1B3RA 3BMOB 1YB1A 4XD2A 2C59A 3T4XA 1O94A 3ZNPA 4IQ0A 4J9VA 1JKFA 1WDKA 2V65A 4CMGA 1A7KA 3KYDB 2YQ4A 3QV1A 2FZWA 1GZ3A 4BMNA 1CQIA 1O6ZA 3WQRA 1SPXA 3E18A 3GVHA 3MTGA 4OQYA 1OOEA 1PJ4A 3W8FA 1B14A 4PZCA 2F1KA 4XQCA 3BMQA 3OA2A 4G5HA 1DFIA 4S3MA 4YJFA 4YTEA 3X2EA 4PN3A 4E2YA 5AQ1A 4WNCA 3Q3CA 4P4LA 3WGIA 3OMLA 1V3TA 1QYVA 3KM0A 3TNLA 2WYUA 1DRUA 1KVSA 5HTOA 3BAZA 4J7XA 4F6LA 1AHHA 1QRRA 2E49A 5B4VA 4NBVA 5ITWA 2NU6A 1EQ2A 4J7UA 4BQRA 5CEJA 1ZIDA 3E5RA 3FD8A 2W2KA 4IUYA 4CMHA 5DZSA 3ZHYA 2Q46A 2GNAA 2DBVO 3KSZO 4YCAA 2W4QA 1QORA 2NNLD 3AM3A 1D3AA 5EERA 1VKNA 3RFXA 5IDXA 2XF8A 3B6ZA 3HB4X 1B0AA 1XA0A 2QRKA 2D8AA 2BRUA 3HDHA 3VHRA 4ALJA 1JU9A 1CDOA 4J1SA 4GGPA 4CM8A 2P2SA 1GQ2A 4TQGA 3M1LA 1G1AA 1P1KA 5EQDA 5CDGA 2WTBA 4ZQBA 3IOYA 1XDWA 4IJUA 4NG5A 4Z9FA 2OHXA 2W8ZA 1NPTO 3UN1A 3ICCA 1E1NA 1GFSA 1P1RA 2BLLA 2YV3A 3DTTA 4ZVVA 1GUZA 3V1YA 3ZWMA 4Q3BA 1PJCA 2Y66A 1DHTA 3NT5A 5FI3A 3JSAA 5GY7A 3CMCO 2Q4EA 4GMFA 1ZH8A 3GH3A 4XIYA 1P1JA 5L4NA 1YQXA 2Y68A 4FBGA 4UEOA 3SLGA 1QG6A 1LSUA 5T8KC 1GYQA 4J2HA 1D1TA 3ZI0A 1L7EA 2QX7A 2G1UA 2QHXA 2FSSA 3WGZA 1XEAA 1ZSNA 5BNIA 1BVUA 3ETDA 4INAA 5TSDA 3GFBA 1HYHA 3DDNA 1ISHA 4PG5A 4Z0HO 2AMFA 3RIHA 4EZBA 1GYPA 2OMEA 2Y1GA 2VHZA 1ZK1A 5JO0A 3LT1A 5BSEA 3JQFC 4CMIA 4HV4A 1E6WA 1W0CA 1UDCA 4UEJA 2PFGA 1V35A 4E0BA 3JQ7A 1YQGA 1U5CA 3GOHA 3OQ6A 4BO8A 5JDIC 5TQVA 2UDPA 2VRBA 4B7CA 5ER6A 1I32A 4YT2A 3GEDA 1DOHA 1YXMA 2AQHA 5F5NA 4B79A 4NK4A 3U9LA 3OP4A 5GZ1A 1BXGB 3ITKA 3Q2IA 1RYDA 3ZH2A 1LSSA 3R6DA 1I10A 3DBLA 4Y6PA 3DZJA 3IJPA 1LDNA 2HMVA 2A35A 2V6MA 4FIZA 3GK3A 1EK6A 1F12A 4ZGWA 4R1UA 1SBYA 4XYBA 2IODA 2NADA 4YAJA 4RF2A 4IXWA 4PLWA 4OHUA 4IDFA 4YAKA 4A03A 2OO5A 4GGOA 1XIVA 4XGKA 3QJ5A 3C7CB 3NUGA 1JVBA 4UUOA 2O3TA 3EVNA 3B1FA 3RUHA 1QMGA 1D8AA 3ZU4A 1KY5A 2DC1A 1T1SA 1O0SA 4W99A 3RBZA 1YS4A 1JAXA 2ZYDA 2X7HA 5JYDA 1Y7TA 3PGXA 4UVDA 3UCFA 4CJXA 2I3AA 1WPQA 2D4AA 2D0IA 4WCFC 5L7WA 1CQJA 1UDBA 1HKUA 1IHXA 2G17A 4E5YA 4E5MA 1M6HA 1R4MA 2Y99A 4DIOA 4UUNA 1I0ZA 4CQLA 4OXNA 3SJUA 3G0OA 1Y1PA 4NMHA 3OFSA 1L1FA 4OIMA 3RUFA 5KVVA 5H82A 3VTFA 2BFOA 2UUPA 2ZJ1A 3FBGA 4MVJA 4OYRA 2FHSA 4EDFA 2RAFA 4W7IA 1EVYA 5K0ZA 1ZO8A 1B26A 4PLGA 1SB8A 2AE1A 2BI8A 1V0JA 1ONNA 2A4KA 1WP4A 1YBVA 4PLTA 4GX2A 5JNLA 1LDEA 2Q50A 2FPIA 3GVIA 3TSCA 2ZQYA 4TZKA 4M86A 1CYDA 2AQKA 1A71A 2VTDA 4CQMD 3L9XA 5U4QA 4CLRA 1E3JA 5A4DA 4GQAA 2X9GA 2R00A 3PQFA 3VZRA 4NI5A 2B5VA 2YJZA 4Q39A 1DSSG 4RDIA 3U09A 1E7RA 1P1IA 5IDWA 4RLHA 3WSWA 3IUPA 4ROSA 1SNYA 1T25A 4WLNA 5IZCC 4IDEA 2NU7A 2X6TA 2VN8A 1HF3A 3LF1A 4RPHA 4ALNA 5JSFA 3GEGA 4IDGA 4J6FA 4RGBA 5G0UA 3RJ9A 3QLJA 2WEKA 3B20A 3IP1A 1ISIA 3GHHA 1JQBA 4L4SA 5G4KA 3ZW9A 3QY9A 3H8VA 4B3JA 1ML3A 4WJZA 3IL2A 3BHMA 5IZ4A 2NM0A 2I66A 3KV3O 4ZA2A 2X5JO 1HTBA 1EFLA 2FR8A 1UP7A 5A5FA 4IS2A 3WQQA 1E0DA 1P33A 1Y9AA 3E1KA 3PQEA 3AFMA 1UZNA 1QYCA 1EEHA 3LDHA 1C1XB 3OIGA 4CUJA 4N7RA 1PJBA 4NZ9A 1MG0A 4XYEA 4LRSB 3TPCA 1QR6A 5I7EA 2JD0A 3WIDA 3DBHB 3HJAA 1GZ6A 2ZB7A 3PEFA 4BGEA 3PQDA 4R9RA 2YZ7A 4ALIA 2UV8A 1ZSYA 5DOZA 1P44A 4P4NA 5F1OA 5C7OO 1YKFA 4RQTA 1H9AA 4D44A 3W6ZA 2AW5A 3ROKA 3FPLA 4MVJE 4EUEA 1UH5A 4PG6A 1E1KA 5F3RA 2O23A 5AXDA 5ITVA 2FN7A 5EL0A 5TT1A 1H6CA 3CXRA 3GDGA 2RCYA 1YB4A 3M6IA 3INTA 4ZRNA 4PG8A 3AI2A 1FDSA 3PK0A 1EDZA 3DONA 3GN2A 1O5IA 1PEDA 3F4LA 1SAYA 4QQRA 3U5TA 1U1IA 3ETEA 4DQUA 3BXXA 2I99A 3SC6A 3D1LA 4ILKA 5HS4A 1VJ1A 1E1LA 1DIGA 1DHRA 2PV7A 3MCVA 4CMCA 1J5PA 4DQXA 4OSOA 5KVQA 2Y1OA 1IZ0A 2BGLA 1E7WA 1LA2A 4AJOA 4YRBA 5JBIA 1K89A 3L4BA 2RH8A 3PHHA 4FN4A 1LJ8A 4DRYA 5FWNA 3E9NA 2CDAA 2ZYAA 2DPHA 3NAQA 3N58A 5BNFA 5C37A 2VCYA 5I9LA 2GO1A 2BGKA 1VL6A 4GX5A 2O7SA 1R66A 1MB4A 4MVJH 4EEXA 1GYRA 5ER9A 4Z0PA 1LDYA 3HE3A 1DIRA 1BXZA 4MKRA 1GD1O 2VUSA 2CMDA 3VPSA 4DL9A 4J43A 3L6OO 1JLLA 1UP4A 2O7QA 3WQSB 1VM6A 5JAMA 2W98A 4YB8A 2YDYA 1NAHA 4TMFA 3JQGA 1VRWA 4GLLA 1BGVA 3JYOA 2GUGA 3GAFA 4D3DA 2X8LA 4WK6A 3VKVA 2Q3EA 3W8EA 3DBRB 5BNTA 3R3SA 2P68A 1Z7EA 3LT0A 3S8MA 4EUHA 2GRAA 3JD4A 2PGJA 2DTDA 4FPXA 5G0VA 4IS3A 2X4GA 1ID1A 4IJWA 1J4AA 4XA8A 4AJNA 2VWPA 4WKGA 3GDFA 4II2A 3VPFA 1TVEA 4E5KA 4ZN6A 1E3IA 1LX6A 4WOJA 2NLOA 5KIAA 2EP7A 3CTMA 2FMUA 4BNMA 4FFNA 2I6TA 2RBEA 4FFRA 1DAOA 3G17A 4IM7A 3IDSA 4PLZA 4DGSA 4EBFA 1I8TA 3DC2A 3NDRA 3BYZA 3NX4A 2NSDA 3OIDA 2NWQA 3EC7A 5JY1A 3KHUA 3RBXA 1PQWA 5JYEA 4AJJA 2YW9A 3W6UA 1NYTA 4EEZA 1HETA 4D3FA 1E6UA 4O59O 4IDBA 1Q1NA 5AXBA 2ZB3A 1UXGA 4DC0A 3WYBA 4MIOA 2BELA 4IDAA 3AY6A 3WFJA 1JVSA 3AOEA 4K1LA 5ICMA 3LZ6A 4U0JA 5B4UA 3WG9A 2QW8A 4FGSA 2Z1NA 2Q49A 3VPGA 1J0XO 1JW9B 4BO0A 1IHYA 4DIBA 1R0LA 4PLFA 2ZYGA 4WASA 2GDZA 3PYLA 1ZMOA 2PZLA 1PIWA 2GN6A 1MA0A 3BHJA 4DBZA 5BR7A 3ST7A 2Y0EA 1TT7A 4ZQHA 4L75A 2J3KA 3PZRA 2B83A 2V6GA 5F21A 1VL8A 3ANLA 2D5CA 4IMPA 5T6BA 1XCBA 1NFRA 1SC6A 4ZQFA 5CAEA 3H5NA 2Y0CA 2R2GA 2AEMA 4LRTB 3RU9A 4OKNA 1AHIA 1DAPA 4W4TA 3ZN2A 2PTGA 3SVTA 1GEEA 1LLDA 2J5KA 5L53A 2PA3A 1GADO 4ND2A 2PR2A 1NPDA 4NJOA 2CD9A 3HN2A 3ADOA 2NU9A 4E33A 5CPBA 2VYVA 5I7SA 2JCYA 3KLPX 3ZW8A 2B4TO 1U4OA 4PFJA 4I9HA 4WLOA 4KWIA 3KO8A 1J49A 4IDDA 3GAZA 3PTZA 4E3ZA 4CM8B 1I30A 1E7SA 5IN5A 2YHIB 4EGFA 2WJPA 2P4HX 1WWKA 2Q45A 1D7OA 4Y6SA 4OM8A 1GPDG 3I9NA 1B8PA 3KSUA 4YAEA 7MDHA 5EMHA 4LN1A 1XQ6A 4RQUA 3WBFA 1BDBA 4L4RA 4FFMA 5A9TA 2J8ZA 3IP3A 4HY3A 3C7AA 1HSOA 1PGOA 4JBHA 4MKZA 1EMDA 4QEDA 1H9BA 2DT5A 1UJMA 5A04A 2C2XA 1PZHA 3TZ6A 4RL6A 1O95A 1K2WA 1IYZA 4Q3CA 4CUZA 4GLOA 5TNXA 3BMCA 1DEHA 1JWBB 2IZZA 3L6EA 5BSHA 2JAHA 3EY4A 4NH4A 3PP8A 4FFLA 1DLIA 1NM5A 3AJRA 3OM9A 1V3VA 4EYEA 2DLDA 3VVBA 3M2TA 4BO2A 3GVPA 2YHIA 5DNAA 1LC3A 2JFFA 5TF4A 2BFAA 4XJTA 1T4BA 1B2LA 4BVAA 1X0VA 4MVJM 4YR9A 3PFWO 1KEWA 4XR9A 2XAAA 3P7MA 4JIGA 4KUEA 1HDYA 3D4PA 1ZJYA 3BTSA 1IPEA 5DBIA 4BKUA 4CLOB 4TZTA 3PRJA 3RSHA 3VH4A 4LVUA 2FOIA 3GY0A 3VAZA 4FQ8A 3I52A 2HSDA 3OEYA 2CZCA 2Y05A 4KUGA 4CLDA 3PJEA 1RM3A 3KTDA 1E3WB 1UZLA 2QYSA 2EKLA 2VNSA 1CF2O 2J3HA 3WGOA 2EERA 4G2NA 3KYCA 4GVLA 4IDCA 3GPIA 1FDTA 1XR3A 3K5PA 4DMMA 3S2FA 3HB5X 3DBRA 5DCYA 3GEMA 3TWOA 3DHEA 3MWDB 4I9UA 4N54A 3AU9A 2JJYA 3IAHA 1DJNA 3OIFA 5TC4A 3QVSA 2VUTA 1H5QA 3FNEA 4KWHA 1V6AA 1N7HA 1PSDA 1NR7A 1SEPA 4RVGA 4Z9YA 1Q7BA 1AXEA 4L8VA 1G0NA 4JCOA 2YFHA 1XLTA 2LDBA 3OF2A 2CY0A 5G0SA 1VJ0A 4WNIA 4JBIA 1LUAA 1WNTA 4BO4A 2CF5A 5JDIA 3T4EA 1X7GA 2I5PO 4W9NC 3LC7O 4C7KA 3GNSA 3VKUA 2GN8A 1Z74A 2DTEA 3OEWA 2XXBA 5JDCC 4J1NA 4G65A 2OFPA 3K92A 4FDAA 2W90A 3W8DA 1OC2A 2WWRA 3GR6A 2Y93A 1BG6A 3BMCB 1LQTA 4KZPA 1VLLA 1Z73A 3FF4A 4E31A 5DT9A 4BGVA 4HP8A 5IFLA 1HSZA 2BHLA 3HDJA 1SMKA 4NFHA 2J3JA 1DXYA 4UVHA 2WYVA 4WEOA 5DP2A 4LCEA 2QIOA 4N5NA 4R9SA 4J91A 1AUPA 2JKVA 3SJ7A 5A9RA 5EJ2A 3OQ1A 4NU5A 1GQYA 1RPNA 1TI7A 5G0TA 3H9UA 1LEHA 1CEQA 4I08A 1V3UA 2WE7A 4XDYA 3AK4A 3DTYA 2PGDA 3H7AA 1NVTA 3JD0A 3TDKA 3FTPA 1I2CA 1YL7A 1W6UA 4XRGA 3JQFA 2O2SA 4HKTA 1A9YA 1T2CA 3DFZA 2A92A 3RVDA 1B8UA 5G0WA 3ZDFA 3LC1O 5HS6A 1DBVO 1SZJG 3I23A 2LDXA 1JWAB 2GF2A 1KIFA 2Z5LA 1LSOA 1S6YA 4HFJA 2UVDA 5U9CA 4BOYA 2IE0A 3RC9A 1ZCJA 4WCDA 3WGYA 3GFGA 1A5ZA 5ENVA 4UVEA 4A2CA 3ROPA 1LDGA 1NNUA 1YQDA 3NTQA 4M1QA 5IF3A 2H5LA 2I65A 4FGWA 1HL3A 1HLDA 4KP7A 4A73A 4B8WA 4KQWA 5BSGA 1RYEA 1BVRA 1PGNA 4I5EA 4IPTA 2B4RO 3GA0A 3SLKA 2EHDA 1ZXLA 2FR0A 3CKYA 2VHYA 1ZNQO 2X22A 1UP6A 4E5PA 3D3WA 5AVOA 3GHYA 5IDQA 5DBFA 4DQVA 4OSPA 1CIVA 1O89A 3AOEC 4ITUA 3ANMA 3EVTA 4DMLA 3MJEA 3KYDA 1Y9EA 4XCVA 3U4DA 1N9GA 3WX0A 5G2OA 3AI3A 4CODB 4U0KA 1GR0A 4BNYA 4CR8A 2P9GA 1QSGA 4YJFB 1Y8RA 3RROA 2JFHA 3PFFA 3G79A 1E3SA 1SOVA 1HE3A 1KY4A 4OH1A 2YV2A 5CDUA 2CVQA 3ONFA 4DYDA 2HDHA 1DRWA 3PJDA 4C4OA 1PS8A 1T2DA 1IL0A 1T2EA 5IXYA 1HDCA 5ES3A 1ZZEA 1A4IA 3EAGA 4CMJA 4PRLA 5FFFA 4N18A 2DUWA 2BGMA 1N1GA 3FR7A 4DLBA 1W8DA 3V1TC 5DOVA 3GDOA 4CPDA 2NV6A 3OJOA 4D41A 4LK3A 1XU9A 1EVZA 4J0EA 2OZPA 3ZHZA 1ZBQA 1RM0A 4AL4A 2VOEA 5C3MA 1UXJA 4WUVA 2C20A 4R1TA 4YRAA 3RFTA 4B4WA 4IJKA 2JHFA 2H63A 4A27A 2NQ8A 1K3TA 4KMSA 4EUFA 3LF2A 2YHUA 3EUWA 2AXQA 4CR6A 1OFGA 3HZZA 4UVGA 5T8KA 1E92A 4R41A 5KWEA 2C5EA 2TMGA 2WE8A 4J7CA 3OICA 5KVSA 3AM5A 1X1EA 3LLSA 4TKLA 5I8ZA 3VPHA 2C7VA 3KSDO 4P4GA 4Z3KA 1EFKA 1LLUA 3I4FA 4FC7A 3PJGA 3U0BA 3OETA 1IB6A 3RUAA 3WWYA 5JPIA 4U6QA 2WMDA 2X5KO 3CEAA 3IKTA 2D5AA 3OBBA 4PRKA 2C07A 3D64A 2X0JA 3GG2A 2Y0DA 1R15A 1KOLA 4XYGA 4BO1A 2P4QA 1EUDA 2RHRA 2YYYA 3NJ8A 1LDBA 2O3QA 5A06A 4OGWA 1UAYA 3I3OA 1OZAA 4BUCA 4XRRA 4E32A 2AE2A 2D59A 1MFPA 2CDCA 3RAJA 5CHEA 4RCVA 3BZUA 4IIVA 3BMQB 4CR7A 1BHSA 1CERA 3F5SA 3KOUA 3SX2A 5JFOA 1VJTA 1NWHA 3B70A 4IJVA 3NT4A 1H0KA 3K73O 3Q9NA 4PVDA 5KJCA 1ULUA 3JQBC 1GPJA 4YXFA 4HADA 2F00A 3ZU2A 5TS3A 1TB4A 1U4SA 3MEQA 1NPYA 3DOOA 5JDCA 1PQUA 2VRCD 5T67A 5TRTA 3RUDA 5A9SA 2W2KB 2Y1EA 4YQYA 1EE2A 1C0KA 4CM1A 3F6YA 1CWUA 1MX3A 1ZEJA 1YVEI 3A9WA 3FN4A 4OXYA 4BKRA 1IY8A 2GLXA 1ONPA 2JCXA 1AGNA 3UFXA 4XYLA 5LCXA 1E7MA 2V6FA 4KDEA 3MOGA 3O4RA 3ZWWA 4U8GA 4RVUA 3V2GA 5CEFA 3QWHA 1M6WA 1P77A 5JY6A 3T7EA 1EZ4A 3KB6A 1WZEA 4R5HA 5EINA 1KEPA 2UUOA 1EBFA 2VZ0A 4RV9A 3RKRA 3L4SO 3GRKA 3M2PA 3RFVA 4KOAA 5JCJA 4WECA 1DO8A 3F46A 4BNZA 2ET6A 3UW3A 4MOWA 4O63O 4Q9NA 3RD5A 3K2BA 2GCGA 1I2ZA 4BV8A 1UR5A 1K0UA 3EZLA 2POQX 4J1TA 4DBVO 1WXDA 5L45A 4PLVA 4GKVA 3C8MA 3EMKA 3PHGA 1GV1A 4XGIA 4NU6A 3PYMA 1PR9A 4FJ2A 2NVBA 5HBRA 2BMAA 3RC2A 5JW6A 3HQ4O 4CQLB 4A0SA 1R12A 1U5AA 5JC8A 2ZK7A 1YJ8A 2W2LA 4NBTA 5DULA 4D0RA 3ETGA 1HWYA 4YT4A 3MJVA 3G1TA 2C82A 3RU7A 4BGUA 3NJ4A 3NRCA 2CUKA 3WGTA 4FFPA 2TMDA 3E6AA 4XQGA 4BNWA 4LVCA 1X15A 3P2OA 5A02A 4BQPA 3JQCA 2AA3A 1OMOA 3UICA 5LDHA 1U2DA 4O0LA 4JJIA 5TLSA 1DFHA 1QXSA 3JYPA 1QKIA 3OJ0A 1PS0A 1PGQA 3FBTA 4AFNA 5JMWA 3LT4A 2FSVA 3EK2A 1ZK2A 1R4NB 2B36A 4PG7A 3I9MA 1ZEMA 1PGJA 1ZXBA 5GZ6A 3DBVO 5A9SB 3NT2A 2FPPA 1GDHA 5K6AC 1NVGA 3RWBA 2I76A 3W4IA 2B37A 2JFGA 3D4NA 3PWKA 1ADCA 3TFQA 4Q3NA 1LBEA 3UCEA 3CIFA 4HBGA 1BW9B 2H9IA 3D5QA 3BTUA 3K2EA 3P19A 4JP2A 4JX8A 5KKAA 1NR1A 2AEJA 5ENDA 2XPCA 3E9QA 4L76A 1HEUA 1PU2A 5JCJD 3JV7A 3GC6A 5CP8A 3ZV4A 4YBZA 4CQMB 2CDBA 1BWSA 2GSDA 4Y67A 4S1VA 1IOLA 1ZMTA 3IQDB 1R6DA 1PJ2A 2Z1MA 1B16A 2E4AA 4CV1A 3JQ9A 6ADHA 4DVJA 3G49A 1F14A 2O48X 4MVJD 4ND3A 4ESOA 2G76A 4QFDA 4MVJI 5TGDA 1R16A 4FC6A 3NEPX 4MPDA 1A72A 3UCXA 4JBGA 1EUZA 4E6PA 3A14A 4RF3A 3O03A 1R0SA 1XQ1A 5I9MA 5C7IO 1WAMA 5ADHA 1XHLA 4ND4A 4B3HA 3ROQA 3WJ7A 4PIVA 1DC5A 3K8ZA 1WLYA 3Q1LA 5CDTA 2DQ4A 2DVMA 1FMCA 3H5AA 3ZWVA 2PH5A 1KVRA 4QXMA 3H6KA 4HFRA 4Z9XA 3FPCA 3B1JA 3KUXA 4RLSA 5BSFA 1DIAA 1GEGA 1J6UA 4BNJA 3GLQA 4P8RA 4CLOA 2CFCA 4L0QA 4BO3A 5L3ZA 4BNIA 4IY1A 3GN1A 1E3LA 2VZ9A 4F45A 2ZATA 4UVIA 4NIMA 2H6EA 3E48A 3UGKA 3FTNA 4XEHA 5CG1A 3GGGA 1I3KA 3H9EO 3DMTC 4YVFA 3ZZNA 2IXAA 5CDYA 3WB9A 4E4YA 1YE3A 4FS3A 5DP1A 4DYVA 1E5LA 1U8XX 1GL3A 3ON5A 4UULA 4CLRB 5JO9A 2PKQO 1Z82A 3DZFA 2NVWA 3TZQA 3I6QA 3ABIA 4XJSA 3VVCA 4E5NA 1N8KA 1IZ9A 4NHEA 3DAGA 3Q11A 1JKIA 1TT5A 1D4FA 4G81A 1C0IA 3VH2A 3ROMA 1PWXA 3FSRA 3WOHA 3E5MA 3G3EA 1LQUA 4RPKA 5T5QA 2VZ8A 3R0IA 1VSUA 1G6KA 3LC2O 1EVIA 3DZIA 2VT3A 3NTRA 1EBUA 4M49A 2VYND 3L07A 1DLJA 2QZ9A 4IMRA 2P5UA 2P5YA 4W7HA 5A05A 4QO8A 1DIHA 1DFGA 1WMBA 1VKOA 5COAA 2EKPA 3WTCA 4EJMA 3U3XA 5ICSA 3WGQA 4KDFA 2ZQZA 1PJQA 4TKMA 4DA9A 3QP9A 1UDAA 3K9QO 1RM4A 3PVZA 1MGOA 1PL7A 2VNAA 5L40A 4XIJA 2YQ5A 1H2BA 4RZIA 3INRA 3B1KA 2ZTMA 3DXFA 3S1LA 3ZV6A 5U1PA 3OJEA 3RBVA 1ISMA 4BMSA 4BNFA 4IZHA 4R1SA 3RC1A 1DC4A 3GGOA 2EP5A 1AN9A 5EESA 2X23A 1T4DA 2DKNA 4R16A 5JLAA 4JN6B 1C0LA 1P1HA 3I4CA 2HAEA 5LDGA 3IUSA 5FYDA 2HMTA 3HFSA 3CE6A 3DHNA 5COQA 5IAAA 4YEDA 3GZNB 3QE3A 1LLCA 2AEFA 2W2LD 4BS9A 1O8CA 4W9NA 3T7CA 2AQIA 3A06A 4JJFA 2IYPA 2FWMX 3H9QA 4I1IA 3ZCXA 4IGFA 1U7TA 2P9CA 2E48A 3F5QA 2XXJA 2B35A 3ITDA 3R1IA 4RJTA 3WLFA 4CLEA 4BB5A 5EN4A 3I9LA 2DFVA 4YPOA 5DN9A 4MVJG 1FXSA 1UXIA 1P0FA 3VZQA 1P31A 4ZJUA 2BI7A 4CM7A 3MZ0A 3GGPA 4OOFA 1NQAO 2IEBA 5KKCA 4NNJA 4RO0A 2OBNA 3BIOA 3JYNA 3VC7A 1TT5B 4X54A 4ZHSA 1NAIA 2GZ1A 1QYDA 5HRUA 1E1MA 2PD4A 4YQZA 1GCUA 3HFGA 3WSVA 4E2ZA 1PZEA 1Y8QA 1QYWA 5B12A 3TL2A 3I9JA 3LK7A 1JA9A 3ONEA 3WFIA 4BO6A 4FOOA 1JKJA 3UHAA 3HG7A 4R51A 3DB2A 3L9WA 1RWBA 1U3VA 1PJTA 3EW7A 3BMNB 4R1NA 1MP0A 3AUUA 2IZ1A 1C1DB 2QQ5A 1WMAA 1EDOA 4R5MA 2FZEA 1U7HA 3M1AA 5B37A 4D7AA 3PJFA 1YDWA 3ONDA 2EXXA 5KJ6A 4YJHA 5T64A 1GAEO 3N74A 2C29D 4M8SA 1PS9A 4YWJA 3OJLA 3D5TA 3V2HA 4HNHA 1OC4A 4II3A 4I8XA 1Y8QB 2IXBA 2O4UX 2IDZA 1GV0A 3Q0EA 3C1OA 3HNPA 1B3BA 2X5OA 3O8QA 4F6CA 5A1TA 1DC6A 1DRVA 4BB6A 2EJWA 5A03A 4FFOA 3L0DA 5I8WA 5C5IA 5JS6A 3TZCA 2OP0A 1KC3A 2FRDA 3QHAA 4J3FA 3SEFA 3K6JA 4J90A 1P1FA 1VC2A 3ZNQA 2V7PA 3JYLA 1T1RA 1V8BA 4YJGB 3VZSA 4RPGA 4FB5A 2GGSA 4PGFA 2J5QA 2HK7A 4YACA 1YWGO 2WM3A 4WLFA 3L6DA 5EIOA 3FNGA 1SOWA 1PJ3A 5CPFA 1NX6A 5AOVA 3LLVA 3AY3A 1YL6A 3EGOA 5DCWA 4XZ3A 3ICPA 3QVOA 4H3VA 4IXTA 4JXKA 3GF4A 1GQQA 2CSUA 4Q3EA 4WLUA 4BMVA 4W82A 1R0KA 3V5NA 4E2WA 3TZHA 4FCCA 1IUKA 1PQPA 3O8QB 1BXKA 2FY8A 4QT0A 4TSKA 3H65A 6LDHA 4B3IA 3NGLA 3UH1A 1H6DA 1C1XA 2DFDA 4L74A 3V1UA 3TOZA 3JCZA 1NQ5A 1HYGA 5KJEA 2NU8A 3RI3A 2R00C 3ZNOA 1GY8A 5EQFA 5I9NA 3AWDA 1R4MB 4JP3A 4WCFB 4AJEA 3AUTA 4CV3A 3U4IA 8LDHA 5GZ3A 2NTVA 4MDHA 3TJRA 4NQZA 1QLJA 4BNXA 5G4LA 1PGPA 1S7CA 4QTZA 2DPGA 4MP6A 3VH1A 3NYWA 1U3UA 2I67A 3ZWCA 1JDJA 3G1UA 1M2WA 4GSKA 2E37A 2OORA 2JCVA 3KLMX 1U3WA 2HUNA 2AG8A 4HNGA 1ADFA 4U5QA 1HT0A 3FR8A 4PG4A 4FW8A 4J1QA 4XWYA 2OXIA 3QW2A 3NGXA 1MC5A 4MKXA 1E5QA 1NQTA 2EEZA 5THQA 3STHA 4LMRA 3GVXA 3UKOA 3LT2A 3ORFA 5L7YA 3ZWBA 4JQCA 3JD3A 1ENZA 4J4BA 1UXKA 2FR1A 3F1KA 5CFZA 1F8FA 4A26A 2NTNA 4BO9A 5K6AA 1N1EA 3QWAA 3RUEA 3SBOA 2BFMA 4GBJA 3D7LA 5K9ZA 1DPGA 4UUMA 3ZWYA 3TN7A 4ZU3A 3H4VA 4Y9DA 4H15A 3ZV3A 1YOVB 2HRZA 3OJFA 5L95A 1QYXA 3I9KA 2A94A 1LDMA 1NP3A 7ADHA 3WR5A 2XOXA 2EW8A 3CZMA 4PLCA 2G82A 1N2SA 3PLNA 2X0NA 5IN4A 2X9NA 4AJHA 1A7AA 3H9JA 1PX0A 2FPGA 3JQ7B 4RVFA 1MXHA 4BNVA 2E82A 5FI5A 3TF5A 4BNHA 2PZJA 2Q2WA 2B0JA 4J4TA 3I5MA 1BDMA 3S2IA 1AE1A 1KVQA 3HSKA 1AXGA 2Q99A 1Y6JA 4BHTA 5DDIP 4J0FA 1U28A 3ULKA 3GVCA 4L9RA 4CM9A 2C0CA 3FNHA 4MO2A 3KRTA 1X0XA 4DIFA 4OO3A 3X2FA 4AJ1A 3H2ZA 1H93A 1MFZA 3HDQA 4TRNA 3WTBA 3CH6A 3E82A 5CG2A 1BSVA 2X0RA 3WMWA 1PWZA 2PNFA 3Q9UA 4D42A 4Z3DA 1EQUA 1E77A 4Q3DA 3KETA 3C1TA 4Y8VA 1GUYA 1C1DA 1KS9A 4BNNA 4H16A 4BNLA 2BF7A 2DAPA 5L7TA 5MGBA 4BNUA 2HCTA 3TL3A 2PD3A 1N9GB 3I1JA 3JQAA 1KEVA 3MWEB 4EW6A 2X0IA 3H3FA 3QVWA 4L4XA 4R4JA 1X7HA 1P3DA 2IZ0A 4NK5A 3GT0A 1FDWA 4KQXA 2VWGA 5HM8A 4ID9A 1LSJA 1M66A 2I9PA 3PHIA 4CLXA 3C24A 3DHYA 1U3TA 3GMSA 2JL1A 3O38A 3PIDA 1B15A 2HJSA 2HKIA 4J9UE 4WPGA 3C85A 3WLEA 3PZBA 1IULA 1P0CA 2WD7B 2YFQA 1E3WA 3ZWOA 1YRLA 2NUAA 2DUUA 3KEOA 3NDJA 1LU9A 2Y67A 4F3YA 3KYCB 3WBBA 1A27A 3NTOA 4LGVA 1F8GA 4PLHA 1QV6A 1VSVA 4YJGA 4RVHA 3MJCA 1T26A 2NACA 2Q2QA 2YV1A 2EKQA 1HDZA 3ZU3A 4QO7A 4CMIB 1NVMB 3QVXA 3GMDA 2Q1SA 4E12A 1MXFA 1HE2A
chains in the Genus database with same CATH superfamily
3DVAA 1JHYA 4EJ0A 3EUEA 1XZIA 4A36A 1OIVA 4WLVA 3KJXA 2ZAOA 3RKUA 4E88A 4P0QB 3P9QA 2P9EA 1SO8A 3IT1A 4P38A 4Z1OA 3CUYA 1QO9A 4NMXB 1CS0B 4QIHA 5CA0A 1N6RA 2ADMA 1BMDA 1JT9A 4JB8A 3R3VA 5K8UA 1Y6GA 2B82A 2VT7A 1WXEA 3PUHA 4IIEA 1PFVA 1WNFA 3O26A 1BJKA 4BL5A 1F51E 2ZI3A 3H2GA 5IS2A 2OUIA 5H8WA 1JR3A 1TD1A 8ADHA 3ESAA 3HXLA 5LQKA 5KQLA 3H13A 2SCUA 4RSRA 5I7FA 4L50A 1K3UB 2Y1KA 2BGJA 2XCRB 4PZZA 2XSZD 2FSVC 2NQTA 4R71A 5F1KA 4JVMA 5F2OA 1CNFA 2DPXA 2GERA 3ZVKA 2ZJ0A 3OQHA 4DSZA 1E2FA 2CNBA 1GG2A 1ZIXA 5EP1A 1P29A 4AICA 4MICA 1Z8NA 2O2YA 5KYYA 2XWPA 3FF1A 3L0SA 4JBNA 1M1UA 4D92A 1FX1A 4LXXA 2VRNA 4FGKA 1IATA 2DERA 1SVNA 3IVAA 2H0RA 5E6UB 2VJYA 2MT9A 1K6XA 3QQ5A 2UXDB 4JJAA 4M46A 1NBHA 1OA1A 4OQZA 1C3VA 3JQEA 3W3AH 4DCPA 4BVKA 2B2XA 3JQAB 4ZVMA 1GQRA 3L8MA 5H16A 1H2RS 1T13A 1UBHS 1LTKA 2GS9A 4XTCS 1TTQB 2C42A 3OPYI 5IAEA 4A23A 3RIGA 1VXOA 5D85A 3RVBA 3W5UA 3U61B 1SCUA 4JY7A 4FT4A 2PKQP 5BQFA 4H4CA 4RVSA 2FEMA 4KQEA 1GAJA 3SVLA 2R85A 3TYXA 4DDKA 1H5NA 3BWVA 2WD7A 4R01A 4ANFA 1A96A 5L51A 1K63A 2VQDA 1GTRA 2H1IA 4LMPA 5DSZA 3NWPA 2II6A 3PXXA 3BWCA 1Z4MA 5IBRA 4CDMA 1Y5RA 1F8XA 4BO7A 2AG0A 4JEIA 5IPFA 2W00A 4AG3A 2CXXA 1FYXA 2ABWA 2HWWA 5CCBA 1DRKA 2P7IA 3RC3A 2W7TA 1DAGA 2C5AA 5KOJA 5G40A 1YASA 2E4XA 3QBJA 1Q21A 3VMMA 2JIZA 3W7VA 3PC6A 4EFNA 1JL3A 3OFKA 1UKAA 4MW2A 2VTBB 3THWB 2WD9A 1QV7A 4XYMA 3D6FA 2V6JA 2QL6A 3IAFA 3W4KA 2JIMA 2QMHA 3HHEA 3BS4A 3AHJA 1MQAA 2I7XA 1GGFA 5H59A 1A8HA 4B4DA 2XODA 3D3KA 4UUBA 4YGXB 4ZCLA 3FWPA 4Z6KA 5C80A 3STXA 2ZTVA 5IXSA 4PCVA 3ZWQA 1R37A 4GI3A 4YAIA 1ZSVA 1CIPA 3KQMA 1EUDB 1PEAA 4N6OA 1E0JA 1EVJA 3KAKA 4KJZA 5DGIA 4EELA 3JQ8A 3CZ5A 2WC1A 4K6KA 1RCTE 1XD2B 3T5MA 2GBLC 5AW5A 1BOOA 4CGZA 1XCMA 3GA5A 1Z8FA 2IOYA 5LQAA 1DT5A 1RJFA 3W4JA 3GJZA 4MW9A 4ND1A 1A4XA 4RTRA 2QDXA 5LIRA 4XR4A 1AY0A 1PI3A 2BKXA 2ZTUA 5GM2A 4NCKA 2GBLA 1BVHA 1Q1ZA 5ANRB 2QQGA 1P9WA 4BZZA 1NVDA 1WZNA 4YJ2A 1UMCA 1JHAA 3KEQA 5JCPA 2O8BB 1G7CA 2NNWB 1TTPB 4WFKA 1KFJB 1NRXA 2DE0X 2Z6UA 3CH7A 4DCGA 2D0DA 5B3KA 1AK1A 2FLKA 5EIEA 1U8CB 3R44A 3QF4A 2VWHA 3WLQA 2FN8A 2X13A 1YR8A 5THXA 821PA 1I1QB 2VDKB 5LP6F 3H6GA 4BP9A 2YXBA 4QSMA 4YRZA 2D5BA 1DGQA 2ONKA 2Q07A 4JMLA 1PYDA 1LJUA 4M87A 5B55A 1E7YA 1ZINA 1REQA 1T1EA 1ZK0A 1JIIA 2OVFA 3QG1A 2UYCA 2A7XA 1SVUA 1EP2B 2QAGC 3JYQA 3LDAA 4KGVA 4POOA 3WA7A 3PBKA 1FSPA 5BN3A 3URKA 2IPLA 1YRWA 4UQOA 1VQ1A 1WMDA 4NTZA 2FZVA 3UMYA 3GUCA 2P9FA 2IY9A 4IUCS 1L3BA 1OZ0A 4UBNA 2EIHA 4MI6A 3G88A 4M7WA 2YYZA 2Q3CA 3ASUA 4NCNA 1XZ8A 2H2DA 1RJ9A 2ZBQA 1A9PA 3DT6A 3ZW7A 4C01A 4MVCA 1YZVA 2HXYA 2P6OA 4DV5B 1EM8B 4OQXA 2N46A 3F0TA 3EGWA 3JATB 1WY7A 1IBKB 2CUTA 2OCKA 1MC8A 2P1RA 1IPHA 1SBQA 2VJCA 4LDZA 1GTVA 1RMTA 2BDEA 3RG2A 5J1SB 3AI1A 1B1CA 2JA1A 1ZCZA 4OAOA 4RH3A 2VAMA 2PT5A 2BFDB 1G7TA 3RTEA 4DLAA 5KOJB 2B9EA 5J47A 4Q9DA 3VR3A 4IIFA 2CXSA 4NCBA 3LUKA 4CN9A 3LVFO 4DLWA 1Z45A 5G4KB 2OPBA 3W1EA 2G40A 2FRXA 1DWQA 4ITRC 1F2TA 2C61A 3IAUA 3MTQA 4KVGA 3REGA 4CQMA 5LQNA 3MW8A 3N53A 1YCGA 2D2FA 4QU5A 2FSPA 2FMHA 1G5HA 2XCQA 2ZWAA 1BXRB 3FYSA 3H5IA 1H4TA 1DINA 5H81A 2IPNA 4KV7A 3F3SA 1RP7A 1Z4IA 3VR5H 5L4LA 3EZ6A 3G8CA 1MC1A 4D3ZA 2ZTLA 1HXHA 4GI7A 3SIXA 4FDUA 4DRXB 2AR0A 2QSZA 2R66A 4IKEA 3U49A 4DV3B 4NENB 4JNKA 3NMUF 1BHO1 3FWYA 4EHDA 3JARB 5DSXA 4B4OA 4BFYA 3BDAA 2H57A 3A1WA 3IXQA 9LDTA 3FVQA 1V9LA 3UTCA 5CEEA 5IH3A 3D8UA 5IC5A 3U7QA 3QKRA 3S8YA 2OKGA 1WVGA 1CY4A 4F5WA 3BWXA 3X2SA 4QPPA 1YCFA 1OLOA 1OAOA 3R4CA 5E2BA 2QMZA 1ZFNA 3B3QA 4QLAA 3GDWA 4N3GA 2PLFA 3DGFC 3SF8A 2DLCX 4BY9E 4M9XA 1KQGA 3QVTA 4R69A 1UMCB 1Z38A 9LDBA 1Y6FA 4MZDA 2XE6A 1YS1X 3KXLA 4AMUA 4G9EA 1RQLA 1SD2A 3UMGA 1TTHA 4J94A 3B1VA 3BA1A 3BORA 3ACCA 1XELA 2QTBA 3CVJA 1Z25A 1Z13A 3OTOB 3TRJA 3CZ4A 3NP7A 1N4DA 3NDIA 1KI7A 5D7NA 1EGAA 2BCJQ 2EV9A 2F67A 2G7MC 2IYRA 2PK3A 1FLNA 3UO8B 1QLHA 1WCWA 3PV0A 2JANA 3JQ6A 3NQ41 3WC4A 3OCXA 4R1MA 1ODIA 5K0CA 3M1YA 1V7PC 4LBWA 5G3YA 3P0EA 3EDOA 2ILTA 4KUHA 5AD1A 3LCMA 2VYVD 4DPLA 1JECA 5HJEA 4ENPA 5CBPB 1M83A 3AERA 1UWCA 4X44A 2R7MA 4LXGA 3WL5A 3GUZA 1HLFA 1KDOA 1YRHA 1IPFA 2HSGA 2KBFA 4LQCA 3RUIA 4RD1A 1ENPA 1LLFA 3DAHA 4B71A 5K4AA 1FVHA 3D6MA 4FR5A 2CHUA 4B7UA 3W2FA 4NONA 1ODCA 4PCAA 4X6XA 5EJAA 5H9VA 5J3JA 1ZM9A 3HUDA 3KE9A 3TI7A 3CXUA 3WDKA 3N7UA 4OXKA 1H1TA 3DMTA 1DVRA 3T41A 2PQ6A 1N8NA 1BDHA 1OXSC 1KMIY 3HMQA 3B48A 2P40A 2I6QA 1KJ8A 1RPJA 4N5DA 1I4EB 3T4PA 4WKCA 2FN9A 4HDRB 2TSYB 4OMUA 2W43A 2GQ0A 1Q16A 1U98A 2XZOA 1A7JA 1E6EA 3C3MA 2QD1A 1THTA 1Z6QA 2XQFA 3TCXB 4QOIA 1G3MA 2R6R1 3R0ZA 4JU9A 5AW7A 1E60A 3IP9A 4NV0A 4MUBA 4OGGA 5DK4A 1R5JA 5KDLA 1BTOA 3A10A 4W63A 2WVAA 4Y2SA 4JOSA 3WHIA 1U0JA 4F5EA 4KJXA 4QGGA 1AZLA 4C2UA 1EE9A 1IEWA 1M54A 3DEJA 2WYWA 1FX0B 3BTVA 1KGDA 1T8YA 4FEEA 4KE7A 4M9RA 1T2FA 3AHGA 4FHGA 1Z7BA 2GBFA 4NJMA 3B6JA 1A8IA 1MOZA 1Q2XA 1W5BA 1WUKS 1V48A 2XE4A 3IPRA 5IARA 3C1AA 2FUKA 3RJMA 1NSTA 5DBEX 3PFCA 4MVXA 3RRFA 2QZPA 3UNXA 5FUQA 3IR6A 1E79D 2IU3A 4HAIA 3H18A 4Q7MB 4BFTA 3E03A 4XB1A 3SNKA 4E1BA 4NYIR 3T3MB 3HADA 1EK0A 4BIIA 1ZGGA 4BX8A 5JBNA 3QVVA 1EXWA 1U7WA 3GZ4A 5K0TA 4MITA 3G6KA 1R5OA 4QZVA 1ZD9A 1EXDA 3D0RA 4KTVE 2VK1A 2G0TA 3NVMB 4UUQA 3ZX4A 3BL5A 2H92A 2NZJA 1EK5A 3KT6A 5KNLA 3ZTTA 1XXHE 4QDUA 5DBHX 4IVRA 1BW9A 3FRHA 5HA5A 4I8DA 1FNDA 1TO6A 4TMVA 2HYIC 4K03A 1JHUA 1Y6RA 2PL5A 3E7FA 3ZQKA 3ZDYB 2QMUA 3RYHA 3BMXA 3C3WA 5FL7D 1UEJA 1ZRHA 2Q3MA 1XPOA 4CEHA 1ABEA 3LY8A 4F5DA 3PHJA 1R3DA 3PDIA 1VGQA 3RT7A 3ZDRA 1PJSA 2HK9A 1SC4A 4YO8A 1NFQA 3GG9A 5HE9A 5HQ3B 2FGJA 3NV9A 2V4MA 4UBKA 3H0KA 1AM4D 3UHPA 1USIA 3D02A 3CSDA 3A4TA 1Q17A 3KC2A 1JQEA 1Q50A 3PRHA 3QSGA 4H7IA 4ZVPA 4DWJA 1W76A 1PK9A 2MR6A 1L7NA 1YL5A 3QKTA 1BD3A 3QA9A 5A3VA 4Z7NB 1I33A 4R6XA 2EOAA 2OWDA 1E9AA 1U1DA 4I5FA 2FK8A 1IQUA 4R0VA 3TQRA 1Z5OA 1T36B 1A9ZA 1NBMA 1Q0QA 4MUNA 1QRAA 3KELA 1ECLA 2QK4A 3BB1A 1RI5A 4FJ0A 1M2KA 1SQGA 4HX5A 4IXMA 1F2TB 1GKLA 2H0QA 4I4IA 1XKXA 4MRRA 1XRRA 3TLAA 4O6VA 4HDRA 2ODWA 2NN3C 5LMNB 1X7XA 2NYUA 4A82A 4O4IA 4JC0A 2A0WA 2J5BA 4KLCA 5KDDA 3TDNA 3GIWA 2WZQA 2W4IA 3AV3A 1LLQA 4PYIA 3JTEA 1Q1QA 4LSMA 3USES 2AZ4A 3GT4A 4MS4A 2QRJA 2OD7A 4GSYA 5CT5A 1D07A 4CL2A 2PXHA 5FR2A 4QGFA 1Q3HA 1EFTA 1PKXA 4KFRA 4IVNA 4AW9A 3QE9Y 1MH1A 4HLUA 3I2KA 1KY3A 5IWCA 5KCZA 1RKXA 4JUBA 3CV3A 4LK2A 2Y77A 4JC8A 1P0IA 3W9YA 1COWD 2WSBA 3KB8A 1UQTA 3TFOA 3NRBA 4KGDA 4OOEA 5KOIA 2OR3A 4TMTA 2A33A 1YV9A 3QMPA 3MBKA 3GA7A 4KYIB 2J5RA 3PF9A 4MW6A 4O2AA 5AOAA 5I7VA 1AA6A 4F1KA 4NR0A 1L8OA 1WDLA 3SSOA 4AECA 2A5FA 3ACBA 1Q1GA 2CV2A 3VC2A 1QRUA 1MLDA 1R0BA 2OV2A 2VPIA 3O7WA 2QRLA 2WAOA 2QX4A 4D9IA 5F3WB 3S81A 1HGXA 1FNSA 5P21A 1JQKA 3VVLA 3KQHA 1O6CA 4E22A 1YQQA 1KWKA 4O1MA 2H4HA 3U39A 2JGNA 4Y6OA 1EP3B 3S55A 4HSEA 2G5GX 1I7LA 1YB7A 1NVVR 5KWJA 1SKYE 3DFUA 1L4FA 2WYOA 1WQ4A 2B3TA 3BMNA 3B8EA 1KIAA 2WA2A 1QVZA 2I54A 1A9XB 3Q7SA 1GPH1 2B21A 4URVR 3RIMA 1K7CA 1NW4A 1T1GA 2IDMA 3ZEAA 1D04A 2VPYA 4MH0R 3WIEA 4JI0B 4EMUA 4GX0A 3P5SA 2Z6AA 2GXQA 3PGJA 2P9YA 3FVTA 4D2IA 2R7NA 4QTXA 1OU4A 3E1GA 2MYTA 2RH4A 3HWRA 6PFKA 4WLEA 1N5MA 2VJDA 4XLZA 4MW4A 5AKXA 3TFWA 1ML4A 1TYBE 2GJ8A 4IINA 4XD7D 5C7LO 1KZYC 3IC5A 3TRIA 2IXFA 4BFZA 4QJ5A 1QG0A 1L4NA 3ZQ4A 1EAYA 1LF5A 4DLSA 1SUCA 3ADPA 4DG8A 2JD2A 2EWMA 3BMOA 3BWMA 3O8OB 2ZU0C 2DFNA 4J49A 4AJIA 4CHTA 4YK7A 2PGLA 4ZI7B 3AB7A 1JS1X 1YIOA 3ASZA 3RSZA 1TZBA 4CEIA 2H3HA 3D4OA 4NBUA 4B7AA 4LBVA 2Z83A 2UYQA 3VGJA 1HZZC 4A15A 2GZSA 1JSCA 2PRYA 4WERA 3QX8A 1TEZA 5ENZA 3WLJA 3HDYA 1K5HA 4COKA 1E2QA 3ZIUA 1V5WA 2LV8A 3OPNA 2I4MA 4ND6A 5E8JA 5HUQA 3G2QA 3WJ1A 4CM3A 4OHPA 1MAVA 3DA8A 4KR3A 4YT5A 1H42A 1D9XA 2N47A 1JYSA 1MO3A 2CL6X 4H18A 3ZR4B 2Q1WA 3FJYA 4M54A 3KSBC 3H5VA 3QPVA 4N12A 1H5UA 4R7TA 1CNMA 3GNTA 3USZA 1VCMA 2J3EA 2I7CA 4M1SA 4S1PA 4S24A 3SDBA 2IH4A 2VYNA 5AMXA 4N03A 2QOEA 3WNQA 4NJEB 4B4KA 3FGOA 2O06A 3F97A 3VH3A 1NN1A 1R5BA 1R6BX 3ISJA 3MLBA 4DCSA 1CQXA 3LX8A 3H99A 4KTTE 3AFNA 3JQGB 3JD2A 4YCNA 2CXTA 2H65A 1RAGA 5DI3B 1Y1TA 3U3ZA 1X1TA 2YHSA 1UIRA 2B1IA 4MB2A 1WPRA 4PGMA 5E4YA 3AUKA 4UMFA 1L5HA 4D9KA 3GFPA 1UKEA 221PA 4NOLA 2VTEA 2YWCA 2BAGA 2XXAB 4D46A 5IH7A 3RANA 1TLTA 2EBWA 5F1PA 4OHCA 3GUHA 4QXQA 5AVQA 5KU1A 2J0EA 5IWAB 1EBBA 3Q8MA 2GLUA 1Q0SA 3R6GA 4JL8A 4D4GA 2BP7A 3K31A 1YOBA 4J4HA 4DPKA 3PQCA 2AKEA 3RU3A 2HMUA 3JW8A 1P8JA 3WWOA 2IYZA 5BURA 2YRWA 3KXDA 3OMWA 1NHGA 1PZMA 1LCIA 1ZCBA 4L95C 2IYNA 5ALXA 4CXMA 3SYTA 1MG5A 3G8DA 2IX3A 3V2UA 5DM60 2VPQA 5BMVB 2NV0A 4M6WB 2IPXA 5H1YA 1IEXA 2CJWA 3HJHA 3QI7A 2Q27A 1ZONA 2EF0A 2NPIA 2ZIXA 3U56A 2G9VA 2LTAA 3X43A 1VYVA 4HRYA 2PLAA 2BH9A 3B9BA 5T41A 3W6NA 2H48A 4E2WA 1TU4A 5C9ZA 4ZICA 2O0JA 1ORDA 3FGZA 4NBWA 3KJFA 3OA0A 1D8TA 1QIHA 3HRIA 2HPVA 2C59A 2NO6A 3BERA 1IZ8A 4F5ZA 3S1SA 1CUIA 4EVIA 3UYLA 4L1KA 4P7JA 3R3WA 1EGHA 4UCQA 1BS2A 1S9DA 1H1LA 2B94A 1JHPA 1IUNA 1FU4A 2QMEA 2YQ4A 3HA7A 4H4DA 4JP5A 1NG9A 2FZWA 3DOFA 1GZ3A 4WDQA 1CQIA 4W1RA 1VBMA 1TFRA 3JY6A 2DWOA 5EGSA 4BQSA 3TW0A 4Z7QB 1ZJWA 4QGAA 1OOEA 2JF0A 3BX1A 3WMGA 4XQCA 2R1TB 4EG5A 3R75A 1IRXA 3GD5A 2HDWA 1FFXA 4L0MA 2A0FA 4PN3A 4YDQA 3WK8A 2A78A 4WNCA 3KUKA 3H0CA 1V3TA 2HQSA 3A9UA 1I6WA 2CYCA 3AEUA 3BAZA 4WV3A 2PJDA 1UEIA 2E49A 2G5TA 2IXDA 2QY9A 3CEJA 1N1MA 2XCLA 4IJQA 1EQ2A 1YI0A 2AW3A 1ZIDA 4AUNA 1M72A 4HGRA 4CCSA 4OXQA 2I71A 1T0IA 1VHDA 3JWJA 2O2XA 3L8HA 3TXXA 2XUZA 5E7MA 2C9YA 2IUYA 4WZZA 3MRVA 3SIWA 4BLPA 1KQPA 3KSZO 4YBRA 1LVUA 1M1NB 1L1EA 1KEZA 1D6MA 1H65A 3IJ5A 5EIAA 1D3AA 3AJAA 2X0DA 2J45A 1FFEA 2R5WA 3JWIA 1D2EA 3UJ8A 4EO4A 4O4JA 3M6UA 1RXCA 5GAJA 1Q3TA 3B6ZA 3HB4X 1B0AA 4WBSA 4KN8A 4ESVA 2D8AA 3KZNA 2BRUA 1JIKA 3AFGA 1U80A 1TZJA 3PHCA 4DT1B 2X8JB 2Z8YA 4DEYA 5ESRA 1NQXA 2HMYB 3S2UA 4FXOA 4CM8A 5B5SA 4UDXX 1GQ2A 2ATIA 3HB0A 1GCIA 4FSXA 1CP2A 3UATA 5IHPA 2OK7A 2H2IA 2VJOA 2WTBA 3H5OA 2CK3A 3N8GA 2PLWA 4NG5A 2QL9A 3LQ4A 1A88A 1GGHA 2OHXA 3ONWA 4TSRA 3UAZA 5JQGB 3UN1A 1V9SA 4UNRA 4DMGA 4XDHA 4PQYA 3E9EA 1TEXA 1QU3A 5D87A 2YV3A 2PIAA 3C1UA 3FDXA 3FNIA 5H02A 1N2GA 1XUOA 2IYXA 2JFNA 3B38A 4EKGA 5HSGA 1DHTA 3DW3X 3FDJA 2C7QA 3P5BA 3DM5A 2XW6A 4Q4JA 2ODPA 4QM7A 1I7SB 1A82A 3B7PA 1KQOA 2CE7A 2DWQA 5CFOA 4IV8A 2PBFA 2GK7A 1RABA 5JV5A 5L4NA 2Y68A 2JEOA 4FBGA 3ZJYA 1A2KC 1L7EA 1CP3A 3NALA 4R98A 1TRKA 5LM3A 3LMKA 1PNOA 4D25A 1ZSNA 4EG3A 1BVUA 3ETDA 5TSDA 3BJIC 4G86A 1OXKB 3DDNA 1ISHA 3P4YA 1WZCA 4FFVA 4HDSA 3LW8A 4PG5A 2E4UA 4I3HA 5AHWA 4B3DA 4BATA 1RHKA 3OU6A 2OMEA 1IHUA 2GB4A 1FDIA 1M5UA 2HZBA 2R8EA 2V5AA 2Y1GA 3A0RB 4G9BA 4XUEA 4HB0A 3CNLA 2HGSA 3OWHA 2L69A 1BOFA 3MCWA 2PFGA 3GFRA 3OQ6A 5AI6A 3G5TA 3C4QA 3G8AA 4YWHA 4NNPA 1I6KA 2RAUA 4B7CA 5ER6A 16PKA 1PHPA 2XDQB 4OA5A 5FOXA 2O2EA 2AQHA 1J2RA 2O0MA 2AX4A 1M8PA 2FPKA 2H5JA 2PBZA 2W37A 2V3WA 4FINA 3AEXA 4O3FA 4Y9TA 3P45A 4OGFA 4HG2A 2VA9A 1BXGB 1UBUS 2GHIA 5BV0A 1QDUA 1BCSA 1RYDA 3B13B 4JLDA 4RTSA 4QGHA 1EFUA 1LBQA 3DZJA 2OA0A 5ALYA 1LDNA 2GJAA 1U6JA 2A35A 2DB3A 2F17A 1B4DA 3C3PA 3DZ8A 3PNBA 2XNDA 2IODA 3A1DA 2NADA 3U3RA 1FVOA 4OHUA 1XOIA 3I4LA 2QAJA 1V5IA 1XIVA 2Z09A 2AFIA 2P30A 3QBTA 4RVNA 1SD1A 2IDKA 3NUGA 4OATA 1FTYA 1NJ6A 2JLRA 3HEMA 3K1AB 1EA5A 1CXZA 3JX9A 3AIMA 3DLBA 4MHSA 1WHSB 1H2FA 4P35A 4ZOLB 1T5HX 5EXSA 4C14A 1Y98A 3TTTA 1SXJA 1O0SA 1T1SA 4IO1A 4W99A 2PHZA 2REQA 3WK4A 2ZYDA 3PGXA 3P2KA 4FCWA 5IBPA 4AKHA 3ANTA 2ZSDA 3OZAA 4G0YA 1WPQA 1XVLA 3D7SA 3T7KA 2LBPA 4CJXA 4PQEA 2HRCA 4GZMA 4Q7KA 5L3SB 2H4FA 1CQJA 1OKKD 1UDBA 2SKEA 1UBCA 2AXPA 1IHXA 3K5WA 4AXXA 4YR7A 4E5YA 4E5MA 4RA9B 4DIOA 2CL7X 3RFFA 1KOFA 2BEWA 2F1RA 2H06A 1P5HA 2OBBA 4PC1A 1GTJ1 1VYUA 2VAWA 4NMHA 2ZU6A 4CN8A 1CHDA 1WKBA 3U19A 1P4JA 3TVTA 2JC3A 1KEKA 3KXKA 3NBMA 3VTFA 4MVJA 5E3IA 1YZLA 1I14A 1PUXA 2C3OA 4YN3A 5AK4A 1Z2AA 1ZO8A 1JT2A 3K1AA 3FYDA 4B40A 3EVFA 1P18A 2R79A 2BI8A 4P2GA 4PNHA 4WVLA 1ONNA 3HJGA 3QZUA 3QLTA 3OZRA 1VCHA 1OCEA 5JNLA 4TYPA 1Y42X 2PMDA 4Q9KA 3SQMA 2Q50A 3ABQB 4O0MA 4L9AA 4B82A 5BRNA 2JFZA 4TV9A 1E2DA 1SBIA 2ZQYA 3AVQA 4P92A 5KINB 3SWWA 3THWA 1R10A 3ITNA 1A71A 4DILA 1ZYUA 1T5BA 4TXLA 2I2BA 2LCQA 5BYAA 1LFDB 5KTSA 2D1SA 1DX6A 2R11A 4E4RA 4CLRA 5A4DA 5EP4A 1PLKA 3PQFA 3VZRA 2P9ZA 4NI5A 5DNDA 2MJLA 4BLQA 5FEMA 3PD7A 1JDBC 4F9FA 4MDYA 1X1CA 4LZLA 3AKDA 1P1IA 3FPKA 3R9IA 3WSWA 3P9RA 3RG8A 2ZYHA 4E09A 1PR5A 1VE7A 2MYPA 3THRA 4Y1RA 3ZD9A 1Y5LA 4ZI7F 4IDEA 4Y2JA 1V3QE 4YFYA 4DBLC 2Z8YM 5IT0A 2PUEA 4HVCA 1R2QA 1ID8A 2DPMA 3RBVA 3RWMB 3LF1A 2E7ZA 4QVGA 4C04A 5K05A 1IBLB 5CFNA 2GD2A 2J32A 3GEGA 4PC6A 5HJ7A 3PKIA 5CU7A 4EGJA 3Q3VA 1DZ3A 2IYEA 4RGBA 5FNZA 3SFTA 3ZUGA 4TV9B 1PKEA 1S2MA 2WEKA 2OM6A 1XEXB 3B20A 3O2QB 1ISIA 4BU0A 3U1TA 4LS3A 4I8IA 4DNQA 4KE9A 4MTLA 3SYNA 2JLQA 2V03A 1ML3A 4FUQA 4HATA 2C9DA 3BHMA 5IZ4A 2FG5A 4LYDA 2O19A 1XZGA 4F06A 3TB6A 1RT9A 1K86A 3OCCA 3GAAA 2NM0A 1QPZA 2R1UA 2DFKB 2Z98A 2CHEA 4MYTA 1GPKA 4ZA2A 3RRXA 2BBSA 2HN9A 2PU5A 3T7RA 1CJVC 3N0RA 1Q7EA 1XTIA 5EXDA 3FIUA 1U0TA 1UJNA 4D0LB 2COKA 3CNEA 2ZUTA 2H85A 1DWOA 3DDZX 1E0DA 3P9NA 3QE0A 4LNAA 4RELA 5CAEB 1CUVA 3PE6A 4FBMA 1JXMA 1NOIA 3QFCA 4YYEA 3LDHA 4PBSA 3AINA 4B6GA 1C8KA 3HEAA 3SX4A 4QM6A 1YI8A 3LHDA 4FNGA 4LRSB 4MWCA 2JD0A 2WWFA 4U9IS 3HGMA 2BJWA 1L7AA 2PWAA 2CE2X 2YJ5A 3FH0A 2CBXA 2M2IA 2ZB7A 3G5AA 4BGEA 4GGMX 3N6VA 4MDEA 4FWIB 1J42A 5DOZA 1T4CA 4WJKB 3ERCA 1RRPA 2ETXA 4IIBA 4RQTA 5LQUA 4RFLA 5C4GB 2C2MA 3RTAA 1US8B 4J2TA 1T9GR 1P73A 2BZ1A 4EUEA 2IUEA 1J7KA 3E05A 4IL5A 2FPIB 5BXQC 4PG6A 5AXDA 3IHLA 4HYYA 3PNSA 4Q7JB 1TOAA 3A27A 3D2BA 4HAYA 5TT1A 3WGJA 4HVLA 3CXRA 2PMBA 2IQIA 1WMFA 2RCYA 2XMSA 1NNSA 4E5DA 2WU0A 2QLFA 1YZTA 4AS2A 3A05A 4UDNA 5FOWA 3AI2A 1NW8A 1EDZA 1L8LA 3CISA 4ZZ0A 2K6GA 5A5VA 1CUAA 3LRTA 3ME5A 4JI8B 2V55B 1PEDA 1EU1A 4L6CA 3MT9A 2GETA 3O83A 4QQRA 3ETEA 3PT9A 4DQUA 4K9QA 2QN8A 4MV5A 4EYQA 3ICQB 1G21B 3FMVA 1AUOA 5HS4A 3SSAA 4Y1EA 1JEJA 4KNWA 4ZCQA 4DLZA 4X7BA 2PV7A 4TUYA 1TPZA 1YS2X 3MGKA 1IZ0A 1X70A 2Y1OA 1E7WA 4QPZA 5JBIA 2JAXA 3PUKA 4YLGA 4DRYA 3PHHA 4FN4A 1LJ8A 4BLUA 2ZJ3A 3IPLA 3SF0A 4ZI2A 1QQBA 3UB3A 2SECE 4BLVA 3J7TA 4G0WA 3GT7A 3T8YA 3SN6A 4BCBA 5I9LA 2WUEA 2GO1A 2ECFA 1EGVB 3TQOA 4ZDJA 4C7OA 2XUDA 3Q2OA 1LDYA 5BV8A 3GLGB 4EHHA 2FXIA 2M32A 1IM8A 4Q4DA 3FUWA 2CMDA 1T5LA 3VDMA 2PH7A 4J43A 4N8EA 3J81k 1O0BA 2VDPB 1JP7A 3WQSB 5JAMA 2IYFA 5CYPA 3SE7A 3PL1A 4EQ6A 1TK3A 4TM7A 4YB8A 5EKSA 3C39A 1WEHA 4MKFA 3AESB 5D1HA 2RHGB 4IHAA 1NW3A 2ATXA 5EE3A 3WE7A 4GLLA 3X1ZA 1DUIA 1JG3A 2V6IA 2CWWA 4V24A 2V7TA 5DTMA 2W8BB 4HS4A 5K2MA 2X8LA 4CKZA 4G1CA 3EGVA 1U0SY 2A5GA 4L2IB 1TIBA 3JZAA 3LL7A 4HWTA 2P68A 2W6NA 1IQ0A 4D6PA 4MW5A 4BNDB 1L5GB 1PFKA 4H4EA 5I9IA 5K01A 1Y7IA 2ECPA 5C1BA 2PVSA 4M9QA 4OQNA 3QNWA 3Q7TA 3JU3A 3DM9B 4CU2A 5FL7A 1J4AA 4XA8A 1TUEA 3CU5A 2XQJA 1XBTA 1H0RA 5DSTA 2H29A 2VWPA 3FNRA 1TVEA 1ULZA 1VL2A 1Z0SA 1E3IA 1LX6A 1UIMA 4WOJA 4XI9A 1U99A 2B5OA 2B1JA 3ECAA 1PX2A 4IX9A 3GGCA 4KIGA 4CTJA 5DX0A 1W96A 4X0EA 2BM9A 2I6TA 2RBEA 3F71A 3ICVA 1CE8B 2PXCA 2XF2A 3DC2A 2FQQA 4K9OA 3NX4A 3HBJA 4MWOA 2IS2A 3UIEA 4GUDA 1ESDA 2ETVA 3KHUA 2P8SA 2G67A 4JLPA 3RBXA 5HCUA 5BVGA 3LZDA 1ECBA 2Q2OA 2UKDA 5L6MB 3G2OA 5FUVA 4AMYA 1FTSA 5SV2A 2JFYA 2JLCA 3DPIA 3W6UA 2YTZA 4EEZA 1E9SA 1E6UA 4O59O 4IDBA 1Q1NA 2XTMA 1XPUA 3WYBA 4Y9UA 4IDAA 3AY6A 3NETA 4YP5A 2J9FB 3S2ZA 1JVSA 4K1LA 4Q1EA 4GR9A 5J2UA 3QW4B 2FA9A 1CZNA 3ILXA 2AFHA 1ZMBA 5DX1A 3WWDA 1J0XO 1JW9B 1QANA 1FRNA 3ID6C 4XPIB 2V1UA 1C4WA 5KTTA 4K9SA 2IBSA 1ES9A 1VBKA 2YFYA 1JHOA 4GG1A 3PYLA 4JUFA 3U31A 4DQ0A 3JYHA 3QEKA 4WAUA 2PZLA 3ZDEA 2OSBA 3IAS6 1Z2PX 2EQBA 3EJWA 2QM8A 3ETJA 5BR7A 1JEYB 2FW8A 1O97D 1PDOA 2WG1A 1AIPA 3CBQA 3M6MD 3QBEA 4KPUB 3RVNA 3PZRA 3W3AD 2G9QA 3UWDA 1EWTA 1PD0A 3ZJ4A 4C2AA 2B8WA 5DO9A 1JQAA 3IVXA 2D5CA 1E61A 4K3UA 4ZYYA 3D7MA 1NFRA 3T1QA 4QBGB 4V0SA 4J0QA 2Y0CA 2FYTA 1I0LA 1KHTA 2R2GA 3B6MA 4LRTB 5EE5B 2J67A 4EFKA 1JR6A 4DDVA 1Z6XA 3FPHA 5ICGA 1NP7A 4MWEA 4OKNA 1JHXA 2VDWA 3A2NA 4QBKA 5YASA 2HR1A 3L41A 2HBQA 1QH0A 4WA7A 4F1JA 5J2UB 4M8LA 3R7FA 1ODTC 2MR5A 2AVNA 4L4ZA 1NPDA 1C50A 2CD9A 3HN2A 3OIYA 3ADOA 5F64A 1SVWA 1MO2A 5CPBA 2QYHA 4E14A 2JCYA 4PFJA 4GXTA 3WRYC 2O7VA 4KWIA 1LPBB 5FUXA 3KHSA 3LT5A 3L7CA 4IDDA 3D54D 3N7TA 3PTZA 1UC5B 3Q3EA 4FEAA 4HH0A 4E3ZA 1E7SA 1QIJA 4Q16A 1E1YA 2P4HX 2WJPA 4P0TA 1BZYA 4Y6SA 2IV2X 5BPFA 4B7ZA 4I66A 2XUKA 4OM8A 5GJBA 3MGGA 1Z39A 3C14C 4QA9A 1OU0A 3WGKA 1XQ6A 4JDPA 4L4RA 3EBPA 2YW2A 2D1RA 2HWXA 5A9TA 3FWHA 4FB4A 2VF5X 2R48A 3CVWA 3IP3A 4HY3A 5BW4A 3DCYA 4MKZA 1HQKA 1EMDA 2IP1A 1EAMA 4TV9F 1VB5A 4G4SO 5CA1F 5A04A 1KRXA 1PFWA 1KAHA 5BYKA 3OJXA 5HE8A 3UK0A 5KKNB 4BQQA 4LTNA 2BPOA 2QLJA 5SZKB 3COVA 1E2GA 1WX1A 3F8SA 4YMIA 6NULA 5EHXA 5HUJA 3BMCA 2IYAA 1JWBB 3L6EA 1J20A 4PAMA 2YICA 3H19A 4BPRA 3INYA 1YZYA 3TD2A 2WQ7A 2GNPA 1VG8A 4BO2A 4F71A 2BFDA 1YRYE 1TL7C 2YHIA 4HEJA 5DNAA 5KWVA 4LAFA 3A9CA 2JFFA 4G5SA 4ZREA 2J4CA 1ZNWA 1I4WA 4Q1FA 1T4BA 2G9UA 5HDQA 1E9FA 4OLHA 4BVAA 4RJKA 3GJ3A 3PFWO 1KEWA 2YC2C 2Z08A 5BORA 3WLTA 1JU3A 4GNRA 1ZJYA 1K0FA 1W75A 4G56A 2ZCJA 2IHKA 4FOTA 5DBIA 1M0WA 2IY7A 1NYLA 1RD4A 2XZLA 4LVUA 2WKSA 1L5SA 1UWVA 4FQ8A 1ZCFA 5JSQA 3I52A 5JMOA 2HSDA 3HJNA 2NO5A 2CZCA 1XLTC 3A36A 1KMHA 3BGDA 2O52A 4GOOD 4KUGA 4PW0A 1EEXB 3PJEA 3FZQA 3JARA 5CFPA 3KTDA 3DOHA 4DCUA 2QTGA 3WGOA 2OV1A 4ARIA 2ACKA 1CF2O 2J3HA 5J1TB 4D56A 1SOAA 3KYCA 3QVGA 4HBZA 4MV8A 4ENRA 1XMXA 2P2GA 3OOHA 3G89A 5ALMA 3S2FA 2B4YA 5FJIA 3W2EA 1R88A 3DTVD 2GHRA 5KYVA 4JJKA 3AFHA 4BJ5A 3UK2A 3GEMA 3DHEA 4AIIA 4I9UA 3ETHA 3HY3A 4RIHA 4JI5B 2JJYA 2OLEA 2L0XA 3G2HA 1P4RA 2WA1A 3OIFA 1TJ4A 5TC4A 3UJAA 3SOPA 1H5QA 1M10A 3LBNA 1IXRC 1V6AA 4KWHA 2E4WA 2Q4RA 4MEJA 5LUBA 2OQ2A 1BX1A 4L8WB 4UJ3A 3HA2A 3N0XA 3S68A 8OHMA 1PWHA 5ICCA 4V0KA 4Y7CA 1VG1A 3BFVA 5FPQA 1HOTA 5TMBA 2ZAMA 4X24A 3TZLA 1HX7A 1G0NA 5A0TA 1A2BA 1ELOA 1D4AA 1OFHA 1ECGA 2P78A 2YFHA 2ZS8A 2I8CA 3BCHA 3HCRA 3OF2A 2DLNA 3OLVA 1JEAA 1VJ0A 3PDWA 3DUFB 3H17A 5CM8B 4Z9BA 5G0SA 4CVNA 3P9ZA 5JDIA 2CF5A 1K92A 3EPJA 2DECA 4RFSB 1TM3E 3O3NB 2RG7A 1G8SA 3I62A 3RFUA 1VGVA 4HWOA 5BSTA 3ZKAA 2GNOA 4Z51A 3WZMA 1UJBA 1Z74A 4LOHA 1SA0B 3AEQB 2QTTA 4I36A 5AM1A 5IKOA 2YY6A 4FDAA 2W90A 3W8DA 3N8IA 5JD3A 2NTYC 2ZUVA 1QCCA 5DMHA 1BG6A 3DH0A 2LRHA 4W5RA 1PQ4A 1V8DA 1VLQA 2JH9A 3NOOA 3RRBA 4NZMA 1OV6A 2WSLA 3ZZMA 1P81A 4WA8A 3FF4A 1CUDA 1EFCA 1KF0A 2QYOA 3UGQA 1M6YA 1TQ8A 3LFTA 4LGMA 4PSUA 4WZ6A 5IFLA 4NFHA 2ZYVX 1BQ4A 4ZANA 1G6HA 4UVHA 2XWBF 4KLNA 2FVXA 3BREA 4GYWA 2DR2A 1NLYA 1MAAA 1VE1A 3UANA 4BRSA 4ZAYA 2QIOA 3ZE1B 4C43A 3PJRA 1LH0A 2AYYA 2WFAA 2JKVA 3ET4A 3SJ7A 3SYKA 1AF4A 2I3DA 3VR0A 5SYNA 4NU5A 3CT4A 3H9UA 1CEQA 2R6DA 4JH0A 4KAXA 3A1UA 3VJMA 3PEVA 1SIOA 4HWPA 1K8XB 1K6MA 2A9VA 2O1EA 2HI0A 2VDJA 3A31A 4JGIA 1W6UA 4PAOA 2OT3B 3KD3A 2YIMA 2JLSA 3JQFA 5EKXA 5G41A 4HKTA 1WOYA 5ALWA 1A9YA 1T2CA 3CUUA 3CNQS 3V8EA 2VCEA 2NUPA 2A92A 1WDWB 2IUSA 2KX7A 1OZFA 3L7JA 4EPYA 1W85B 2OXFA 5B58C 1IMJA 4LNUA 3D1JA 1ZU5A 1SZJG 2G63A 1I4LD 2O14A 4U2FA 4MCIA 3KALA 2PANA 3I6MA 4DLXA 5FLXA 1LSOA 1S6YA 1RI4A 1Y4ZA 5EIBD 3RC9A 3KQVA 5DHPA 4AM8A 1UBJS 3V32A 4KR0A 3E7DA 2JCGA 1A5ZA 2AJTA 4RJIA 4YCMA 2O8DB 3KOYA 2Q6OA 4W1PA 1YQDA 1BQEA 3NHWA 4JNCA 4L7QA 4M1QA 4BC1A 4LF5B 3NC1C 1SURA 1D03A 2GPYA 2I65A 3GD7A 1HL3A 4W1QA 2WRZA 2XD4A 3V1NA 4JLJA 3QKUA 3ZBPA 3VR2D 4IPTA 1E96A 1Q2UA 3L6BA 4EARA 1JFFA 3KUDA 2EHDA 3OBIA 3OVMA 421PA 1TAQA 1ZXLA 3BJEA 3CKYA 1OR8A 4H9GA 1ZNQO 2X22A 1CF4A 1UP6A 4E5PA 1JFVA 2H4WA 4KV9A 3PPXA 1B6GA 3FMPB 1XAIA 4LCBA 1ZUIA 3GZJA 5AVOA 4NYM