2ZCVA

Crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
283
Chain Sequence
MIAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALAAQGITVRQADYGDEAALTSALQGVEKLLLISSSEVGQRAPQHRNVINAAKAAGVKFIAYTSLLHADTSPLGLADEHIETEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQNLSEADFAAALKSVGLPDGLADMLADSDVGASKGGLFDDSKTLSKLIGHPTTTLAESVSHLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized oxidoreductase ytfG
publication title Crystal structure of a new type of NADPH-dependent quinone oxidoreductase (QOR2) from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 99
structure length 283
sequence length 283
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zcvA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2zcvA02
4W9NA 1ZIDA 4B3JA 1JVSA 1YVEI 5T5QA 1Y6JA 3U62A 1IL0A 4MKXA 3TOXA 3E9NA 2GNAA 2AQHA 4RO0A 4CM4A 5A04A 2WYWA 1YQDA 3SBOA 1ISJA 4RVUA 4MVJH 1X7DA 5ITVA 4RORA 2FPGA 3TJRA 2ZYAA 1EVZA 5JW6A 2GGSA 4CL3A 4CJXA 8LDHA 1VI2A 2DBVO 3RUCA 1T4DA 1B8PA 2FOIA 5JCJD 3TFOA 4Q3NA 4UUOA 3JYNA 1R0LA 4N18A 4E12A 2Q50A 3ONFA 2VQ3A 1NVMB 3BTVA 2GASA 3ZU2A 3ASVA 3QP9A 4UREA 1SPXA 2EJVA 3RFVA 4BMNA 1UR5A 2D0IA 1N9GA 3DMTC 4J9VA 4ALMA 2DBQA 2F1KA 2GRAA 4JROA 2DU8A 5A3JA 2G5CA 1IOLA 4PLYA 3MTGA 1HDXA 5B12A 4QO7A 4DA9A 4BNZA 1DLIA 2OL4A 4PLPA 5CDUA 4TRRA 2ZTLA 1HKUA 4YQYA 4GKBA 3K73O 5AYVA 4HY3A 4WASA 2BFOA 4DXHA 5ER9A 4NPCA 1P33A 3MTJA 5G0WA 1VSUA 4E3ZA 5KIAA 4B79A 1YXMA 1HE5A 5FI5A 4CLDA 7MDHA 4NU5A 4BQRA 3VKVA 2QQ5A 5AQ1A 3ON5A 3KUXA 3HDJA 3WX0A 2J6IA 1PQWA 1YRLA 3AFNA 3S8MA 3DDNA 2O3UA 5B4VA 3TDKA 3W1VA 3I23A 1K6JA 2EHDA 4YRBA 3DWFA 2X1HA 3GPDG 4NJMA 4MDHA 3T7CA 3ZHXA 1YB5A 5EMHA 3V5NA 4IDDA 4ND3A 1QLHA 3QSGA 5JMPA 3RBXA 3WGQA 3PI7A 1P1IA 3I9MA 2NNLD 3AI1A 3RAJA 5EQFA 2NU9A 4GLOA 4I9NA 5CG1A 1PIWA 2GN8A 5FYDA 4YDRA 1H2HA 3JQAB 3A14A 5JO0A 2AXQA 1EE9A 1JVBA 1TXGA 3BXXA 4F6LA 1JTVA 5CP8A 3DZJA 3WGGA 2NADA 1VJTA 2RH4A 3GNQA 2VZ0A 1QSGA 2PKQO 1G0OA 1R4MB 1XYGA 2PGDA 4YRDA 2CF5A 2O3JA 3PJGA 1WDLA 5L7YA 1IUKA 3WGIA 3OJOA 3DTYA 4OXYA 3OF2A 4HADA 5EJ2A 4IGEA 3HFSA 5EINA 5G4LA 2FWMX 4PVDA 1I2CA 5U9CA 3JQAD 2GSDA 1E5QA 4LCJA 3F4LA 1D8AA 4TMFA 2GERA 2OXIA 4L8VA 1SEVA 1U5AA 4BV8A 4OXNA 4YJFA 3ZV6A 3LQFA 4W82A 1HE3A 1B26A 3FNFA 3GZNB 4FW8A 1F17A 3L6OO 4GKVA 1RM0A 1VL6A 3UOGA 4AJNA 2FPIA 4CMEA 1EEHA 3PIIA 1Z75A 4ZN6A 4E5MA 1O94A 3D5TA 1Y9AA 4CV3A 2Q45A 4U6SA 5ENDA 5L7WA 1XHLA 2X9NA 2DM6A 1PQUA 4NIMA 3Q2IA 3SX2A 4NBUA 3JYQA 4PIVA 3NJ8A 3QWHA 1Y8QA 2I76A 4BKRA 4RDIA 4EITA 1GCUA 2PK3A 1QORA 1U1IA 2GD1O 2J5QA 2PTGA 4PG4A 5T8KA 3ZWPA 1Y5MA 4B8WA 4DTIA 3ZCXA 5IDWA 1FDSA 4FJ1A 2Q4BA 2C82A 4KUEA 4BUCA 4B7UA 3G49A 4CODB 2OBYA 2X5JO 3MCVA 1HDYA 3GHYA 3K9QO 4H7PA 4BNHA 3IIEA 3FCOA 4OKIA 3LT2A 3FN4A 4DMLA 1HE2A 3FTNA 1YONA 3VTZA 3GUCA 4W7HA 2C2YA 2BGKA 3CE6A 1DB3A 4BMVA 3WDSA 5F5NA 3IS3A 4GVXA 1A27A 4EJMA 4Y9DA 4D0SA 4OJNA 3UHAA 3U09A 5F1KA 3BMQA 3TQHA 4BGEA 2X4GA 3VC7A 2ZYDA 5I7EA 3D1LA 3WYBA 3UUWA 1PTJA 1Z45A 2CFCA 2X9GA 4Y6SA 3RD5A 2HMSA 3K30A 3MJEA 3OJ0A 1B14A 1WZEA 3JD2A 1DLJA 3EGOA 4Q3BA 3FNGA 2AQ8A 5T6BA 4R41A 3TZQA 3K2EA 1GV0A 2GZ2A 4I5EA 3WLFA 1JDJA 5C37A 4QO8A 2VUSA 1FDUA 2EIHA 3IAHA 5IF3A 1GCOA 3CMMA 3G1TA 5JSFA 1PJBA 2ZIZA 3UW3A 3EZLA 4GLLA 5JCXA 4NBWA 2J3JA 5CAEA 5KWEA 4IS3A 1GADO 4BO1A 1KBZA 2W4QA 2IEDA 4MVJI 1UUFA 3KYBA 4II3A 5L4LA 3JQ7B 3V1UA 1HZZA 3DQPA 3PWSA 2YHUA 1NBOA 1UP6A 1HDZA 1R0KA 2A94A 1EBUA 4XD2A 4DUPA 4FFPA 2J5RA 2ZB4A 1PGPA 3IL2A 1WDMA 2BF7A 9LDTA 3FBGA 1HYHA 3JQ6A 1V9LA 5A06A 4E4YA 2OHXA 3K5PA 4ZQEA 3UFXA 1G6KA 1CF2O 1NFFA 2I99A 3S55A 1I5RA 2CZCA 2VYND 2CVZA 1GFSA 3HDHA 1NXQA 1XGKA 1EMDA 1BXGA 1YB1A 2GF2A 3JQGA 1UXKA 3DOCA 4QT0A 1GYRA 5CEJA 4A27A 1R4NA 4EGFA 5HTOA 3ZWAA 4D44A 3DBHB 2C20A 2VNAA 3S2IA 1J5PA 1PWZA 3KXDA 4E5PA 1YB4A 3LC2O 5KTKA 2GN9A 4JGBA 2I5PO 1X0VA 4P38A 1FF9A 1F06A 2AEJA 1PJLA 4NBVA 5C3MA 2EP7A 4WCDA 5JDCC 2QZ9A 3GGOA 3CIFA 3RUEA 1JKJA 4E2YA 4RVGA 1JN0A 4PRLA 1M6WA 1ZSVA 1GEEA 2G1UA 1U3WA 5EN4A 3W6ZA 1KC3A 4I5GA 3GEMA 1P1JA 5C7LO 3W6UA 3RKUA 3F6YA 4GX2A 5MGBA 5KKAA 1GYPA 4ILKA 3NKLA 1DAPA 3Q2KA 3ZNQA 5A9TA 1HWYA 3IP1A 5A5EA 4NH4A 3L4SO 2BH9A 3GA0A 4OQYA 2RBEA 3DONA 4GWGA 3VZSA 2NQ8A 1MP0A 1NYTA 1GU7A 3D4NA 3GG9A 3ICCA 2VRBA 4WCFB 1B2LA 4XQ9A 3GMSA 4DWVA 1E1MA 1CJCA 5DOVA 1ADGA 1YJ8A 1E1NA 3EDMA 3H65A 4K26A 4WLNA 3AWDA 3BHMA 3PWKA 1QYXA 4OHUA 1FMCA 3JQFA 1E3IA 3V2GA 2UUOA 3UGKA 2RHCA 2EV9A 4YYZA 4CM8A 1QRRA 3TNLA 3PJFA 1XQ1A 2JCYA 3F3SA 4WOJA 3V8BA 3ETEA 4YT8A 1XELA 4CMIB 2D5AA 3BMCB 1E6WA 3PZBA 4GMGA 2B4RO 2P9CA 3IMFA 4URFA 2Y05A 3RUIA 1F12A 4U5QA 5ES3A 2HMUA 4XR4A 4U8GA 5KJ1A 1WW8A 2WM3A 5DULA 1U9JA 2VYVD 2ZTVA 2O3QA 5LC1A 4IDAA 1LU9A 1QYCA 1QV7A 2FRDA 2QHXA 1O89A 1O95A 4YVFA 4CR8A 4BO2A 1HYGA 4XYMA 2ZQZA 1RKXA 1YDWA 3OFSA 1N2SA 1YJQA 3JYLA 4DLLA 1ZEMA 1UXJA 2P4HX 4WGGA 1O0SA 4PFJA 2P5YA 2ZTUA 3H6KA 4S3MA 4A5OA 5K9ZA 2DPGA 3RU9A 2P2SA 4HUJA 4FN4A 4CMKA 4AVYA 3M2TA 1I3MA 3WICA 1KY5A 4QUKA 5KOIA 3IJRA 1LEHA 3GEDA 4GSKA 4RDHA 4I1IA 1MC4A 1LLQA 4UVEA 4CM4B 5CHEA 1NHWA 3GUYA 1ADFA 3ICPA 4OXKA 3RC2A 4XDYA 4P4GA 2YV1A 3O8QA 2J3KA 1EK5A 2VOEA 1I01A 3CZMA 2WE8A 1Q1NA 3GEGA 4JP3A 5I9MA 4AJLA 1LXCA 1TI7A 3WFIA 4JBIA 1J6UA 1E92A 1QLJA 4N5MA 1P0FA 2VT2A 3OJFA 3WGTA 2AE2A 1T26A 3GN1A 2Y1EA 1P1KA 3PJDA 1BSVA 1N9GB 4YPOA 1Z82A 1NVTA 3FNHA 4YCAA 4CQLA 5L45A 5ENVA 4ALLA 1Z6ZA 4K28A 4QX6A 4XB2A 4CPDA 1YO6A 4E21A 2PGJA 3JQ8A 1PSDA 4JJIA 1KVRA 4Q3DA 3ZWCA 2JD1A 1KERA 2X0JA 4BKPA 1MC5A 4XRGA 2NU7A 4B4OA 1OC2A 4CQMD 2GR9A 5G0UA 1GZ3A 4CM3A 3RFXA 2HK8A 4PZCA 2C0CA 5DBGA 1U5CA 2DBRA 1LDYA 5KVCA 3DEYX 5A4DA 3MJCA 4PLFA 2I65A 3NV9A 1PR3A 4IJUA 1NVGA 4D43A 4AG3A 1XWFA 3RC7A 3FR8A 5U4QA 1GPDG 3FWZA 4ND2A 4WKGA 5KJFA 3KYCA 3ROPA 3X2EA 4NJMB 3Q3CA 4Q39A 3INTA 1ZH8A 3AJRA 3C1TA 4WLOA 4BNMA 1YL7A 4OQZA 4J90A 4IQ0A 4ROSA 4D41A 1L1FA 4TVOA 5DF1A 4JJFA 3TZKA 2DUUA 2FR0A 1U4SA 5LDGA 3C24A 3LDHA 1ISMA 1ONNA 1UDBA 2AQKA 2XPCA 2P9EA 3Q9UA 1JWAB 3ZI0A 4CUZA 2NTVA 3W8FA 1G0NA 2QYSA 3LT1A 4TVBA 4B3IA 4U7WA 5TC4A 3UCEA 4E30A 1A5ZA 3AI3A 2VWHA 4WCFC 3C85A 4Y8VA 1GAEO 1ORRA 1XKQA 4Z0TA 2GZ3A 1M66A 4ZQGA 2PFGA 3KM0A 1EK6A 3PFWO 4RL6A 1P74A 4J3FA 4XRRA 3I3OA 3NTQA 1PU2A 4YJFB 4D3SA 1VSVA 2NU6A 4ZQBA 1B15A 3GVHA 5I8WA 2ZKLA 3RI3A 3HSKA 3JTMA 4QXMA 3E03A 4LW8A 4OSPA 4KP7A 1MV8A 2DTDA 4L74A 5J23A 1ULUA 2RCYA 1U2DA 3GGPA 1C1DB 1QV6A 4G65A 1YWGO 3GLQA 4IM7A 5L51A 2IE0A 1LDBA 2G0TA 4II2A 4RJTA 5B37A 2Q49A 3TFQA 3WTCA 4BMSA 2VRCA 2UV8A 2D1YA 5DP2A 2YW9A 3Q1LA 1DRUA 4R5HA 1Y8QB 3BMOB 3UVEA 2X22A 3OA0A 4MOWA 1RM3A 5DP1A 4WK6A 1PZEA 3IQDB 3INRA 4IUYA 3I9OA 3DO5A 3RWBA 1ZK1A 4HWKA 1GR0A 2GZ1A 2VWPA 3NGXA 5BSHA 2HUNA 1P3DA 2BI7A 1OC4A 1NQAO 1GZ6A 4Z0PA 2CVQA 4JNKA 1PGJA 4L4RA 1HLDA 3IC5A 2DUWA 3KEQA 4WPGA 3UH1A 3E9MA 1EDZA 3JD4A 1E3JA 3PDUA 5I8ZA 4J7UA 1DO8A 3QVSA 4CMHA 2H1SA 4J91A 3JQEA 3L4BA 4QSMA 1ONPA 3BMQB 3ZZNA 3VH3A 3ZWVA 5EERA 3ANNA 3H2ZA 1HT0A 3KTDA 4W9NC 4E33A 1PWXA 3FTPA 1KEWA 1BHSA 3CPSA 2X6TA 3EC7A 1PZGA 2ZB7A 3HB4X 4R4JA 4M86A 4IINA 4NQZA 2D59A 3DBRA 1GEGA 3HFGA 1BDBA 2C5AA 1YBAA 2VHWA 4NMHA 2EWMA 1EDOA 1J4AA 4Z3DA 1PGOA 3RUDA 4M1QA 3GVPA 5IAAA 1M67A 4NJOA 4D7AA 1YQGA 3AFMA 3BA1A 4ITUA 3ZN2A 4FOOA 4HFNA 1WP4A 4XZ3A 2V65A 4D0RA 5LDHA 4ID9A 4N5LA 3KSDO 4CM5A 3RFTA 3H9EO 3DAFA 4YACA 3U3XA 2JKVA 3C1AA 5F1OA 2HRBA 3LSYA 3QY9A 2YQ5A 2QRKA 4PLHA 5JC8A 3EAGA 3DBVO 3O26A 5A02A 4IPTA 4BGVA 2G17A 1C0KA 3WGOA 4BO8A 4B7CA 2O4CA 3WTBA 2AW5A 4IJKA 4NHEA 3FSRA 3MWDB 4BS9A 1EUZA 4BO7A 1NHGA 2DFDA 3AOEA 3FR7A 3U5TA 1S7CA 3NT5A 1BXGB 3I4CA 3JQGB 4CV0A 1H5QA 2P68A 1R4NB 2O3RA 4RF4A 1X13A 2Z95A 1UDCA 3KHUA 2EXXA 4CR6A 5I7FA 1I8TA 2VUTA 1AXEA 5CPFA 3BZUA 5TS3A 1LLCA 2FR1A 4J2HA 5DCYA 1T2DA 1QG6A 2IEBA 1EE2A 1E7QA 1MB4A 1W73A 3M1LA 1NQTA 1WZIA 1LA2A 4AJPA 3KLMX 4RLHA 3QWIA 1DIAA 3WOHA 1SEPA 2JD2A 3VHRA 2PV7A 2BFAA 2WD7A 4Q3AA 4RF5A 4E2WA 4HX5A 1D1SA 1XU7A 2G76A 5TT1A 1A9YA 1D7OA 1LQTA 2GDZA 3D4PA 1MXFA 3WJ7A 3WJAA 1V8BA 1JAXA 1Y81A 2AHRA 4DC1A 3GK3A 3OQBA 3A9WA 4GI2A 4R68A 3KYDA 4HFJA 1UDAA 4PLVA 4F46A 3H3FA 3BTUA 4MP3A 4XQGA 4RQUA 3AY6A 3PHHA 3WQSB 4BO4A 5ILOA 2VWQA 1E1LA 3HNPA 1LRLA 2W98A 1KEVA 3IUPA 4K9DA 4BNUA 1ZUD1 1KEPA 4UAGA 4YEDA 3G1UA 4RPHA 3EYWA 1GUYA 3VZRA 4CMEC 4Y98A 2Y1GA 4CM8B 3WS7A 1ENZA 2Y1FA 1K3TA 1HRDA 3PYXA 4K6FA 4ZQHA 2XXBA 1RYDA 2AQIA 2BGMA 2FHSA 3DAPA 4O63O 4ALKA 2DC1A 4BO6A 4IIVA 3CEAA 5KVVA 4GX1A 4I9HA 3DB2A 3PHIA 2HU2A 5KJ6A 4BKQA 4XQCA 3RBVA 1LSJA 3ZGYA 5T8KC 3C7DB 1C1XA 3GAZA 1BWSA 1AXGA 2PNFA 1KVTA 1MG5A 2I3GA 4AJOA 3JYOA 4XQEA 4EYEA 3CUKA 1UAGA 1WAMA 5AXDA 3E18A 4FOSA 1E3SA 2FP4A 2Q99A 1UXGA 2XOXA 3OIDA 4KUHA 2NUAA 4M87A 4I9UA 4WLVA 4Z0HO 4LVUA 4R1NA 4OYRA 3HN2A 3KV3O 3QHAA 3GRPA 5TSDA 3OEWA 1LDNA 2B37A 3QWBA 4FGWA 4H16A 3CTMA 4RPLA 3W8EA 2YUTA 1I10A 2NVUA 1VJ1A 1F8GA 3W4KA 3GH3A 3GVIA 4IBOA 3F1KA 3E48A 3IUSA 4LMRA 5T67A 3SLKA 4E5KA 2AG5A 2DTXA 3MOIA 1NAIA 2E37A 3GRKA 4FC7A 5DBFA 3U49A 1Z74A 1M2WA 1RPNA 3O8QB 3ZHZA 4BNTA 5COAA 3F5SA 2Y0DA 3TZ6A 5I9NA 4JX8A 2VNSA 3PWZA 2IRWA 4H3VA 5I9LA 4R16A 4CR7A 3LK7A 1D3AA 4MVJD 2UUPA 1CIVA 3F9IA 1DPGA 1HSZA 4ALNA 3GN2A 4L9RA 5CPBA 5JAZA 4IS2A 2HQ1A 4H15A 4MIYA 1OZAA 5K6AA 1H9BA 3NTRA 4MIOA 4CQLB 1C0IA 2FPPA 4I5DA 4WNCA 4RPGA 3U4DA 5JDIA 2CNBA 1SBYA 4RLSA 4ZU3A 2X58A 1E7RA 2Q1TA 4FBGA 4RVHA 4EUEA 3JQ8B 3DZFA 4OOEA 1Z73A 4BNXA 3K31A 5B4UA 1UP4A 2VOJA 3FNEA 2B5VA 2I6TA 4M55A 2POQX 3VPFA 3LZ6A 3UICA 5GY7A 3ZWWA 3AUSA 1XA0A 2EGGA 4PCVA 5IZ4A 5EIOA 2JFHA 4JIGA 1B16A 4A2CA 1VJ0A 4FGSA 4YTEA 1B7GO 3SJ7A 5DT9A 3WR5A 3ABIA 1U28A 2BFPA 3TL3A 3GVXA 1VKOA 3ULKA 4KQXA 1C3VA 3ZDFA 3C8MA 3B70A 1E7SA 3QVTA 5DNAA 3TOZA 5L40A 2WE7A 4Y6RA 3DR3A 3FI9A 1LI4A 1PJSA 4JN6B 3GGGA 5IN4A 1DJNA 1YOVB 1DEHA 3S2FA 4E2XA 1EFKA 4NI5A 2I66A 3OSUA 4IDCA 3EVNA 4QFDA 1LLDA 1Y1PA 4PGFA 2JFGA 2Y1OA 1TVEA 3UN1A 1R0SA 2DTEA 3GY0A 3KSZO 3RJ5A 2YDXA 4PG8A 5MDHA 2Y1DA 3AUAA 1NNUA 4BB5A 2LDBA 3I9JA 5JNLA 2PA3A 1DAOA 1WMBA 5EQDA 5JPIA 1Y8RB 2EG9A 3SC6A 1KC1A 1JW9B 4BNKA 1Q7GA 1PS9A 2PD4A 8ADHA 1TLTA 1P9LA 2YV2A 3O4RA 3QWFA 4BNVA 4E5YA 2EJWA 1XEAA 3G3EA 3NJ4A 2VN8A 3ADOA 4U0JA 3RASA 1Q0LA 2BKAA 2Y67A 1IE3A 4A10A 3QW2A 2B69A 1VC2A 1HDRA 4BGUA 3ROMA 4Y6PA 3D0OA 3H9GA 1NM5A 1TB4A 3PIDA 4BO9A 2ZCUA 4WUVA 4AJ2A 4FDAA 3D64A 4RZIA 4LGVA 5A3VA 2P91A 2B0JA 3ZV3A 3WGHA 1HDOA 3JQFC 3UXYA 4IDBA 1ULSA 4W6ZA 3FHLA 3RSHA 2ZB8A 4MVJG 4M49A 5F5LA 1ZXLA 1B3RA 4Q9NA 3DBLA 3DAGA 4YT4A 4GH5A 3UCFA 1K2WA 4WLEA 4DBVO 3AY7A 2EGHA 3QJ5A 5CFZA 5EPOA 1ZEJA 2Y93A 4KOAA 3WSVA 1E3EA 1WMAA 4CM9D 2VHXA 4ZA2A 1NR7A 3P5SA 4LSWA 4PG5A 3ZV5A 2HDHA 3SC4A 3WNQA 4DC0A 2NTNA 5HA5A 1DBVO 2CDAA 3ZWYA 3ZWBA 2B83A 4NZ9A 4CMBA 4PZEA 3TPCA 4DVJA 2NWQA 3A1NA 1LC3A 4ND4A 1NP3A 2C5EA 3HQ4O 4W7IA 1HF3A 3KETA 1HXHA 4EW6A 3A4VA 4WEQA 4TRNA 3WMXA 1H6BA 4EUHA 2ZATA 2V7PA 4XA8A 4OOFA 5HRUA 4R5MA 3K2BA 4IJVA 1SOWA 1CWUA 2ZCVA 5DZSA 4D45A 1HEUA 2ZB3A 2CSUA 4YA6A 4RPJA 3UF0A 3LF2A 3VAZA 3OEYA 2W2LD 3U0BA 5C7IO 4DGSA 4J1TA 1AE1A 1JU9A 4R1UA 4XGKA 2PGLA 3DBRB 1N5DA 4AJ1A 5CDYA 3KO8A 4BB6A 4DBZA 5HS4A 2LDXA 4FCCA 1DSSG 2AEFA 1P1FA 5BNTA 1DC5A 1T1SA 1YH3A 1PGQA 1PJ3A 4FB5A 3EVTA 3BAZA 3I52A 3N74A 4R3NA 4CL8A 4D3FA 2O7QA 3EMKA 4BIIA 3NDIA 1IULA 2CMDA 3I83A 4YAGA 1JWBB 3F47A 4J43A 4CM6A 3R3SA 2OGUA 5BSEA 1LRJA 2HLPA 1W8DA 4P8RA 3TWOA 3LYLA 4YRAA 2D4AA 3VPXA 5JCJA 1NTOA 3WB9A 4A73A 1XG5A 4D3DA 4J4HA 5JO9A 1X0XA 5TIIA 2B35A 2XAAA 4W4TA 1YE3A 3E82A 2EF1A 3K92A 5KVSA 4E13A 1KVUA 5DN9A 4OH1A 4EEZA 3ETGA 3EUWA 3WYEA 4EJ6A 4KZPA 4WJZA 1VKNA 3WYCA 1T25A 5TNXA 3VZQA 3MJTA 1H94A 4TRJA 4KWHA 5U1PA 4IMRA 4UVGA 4YJGB 3AUTA 3VVBA 2QRJA 2UDPA 1PJTA 1DFIA 4FPXA 2H5LA 1I36A 4IZHA 3PPIA 4PLCA 1YL5A 4QQRA 1SOVA 3L77A 1ZJYA 1DOHA 4KTVE 1K0UA 2VWGA 2E82A 2WD7B 1YBVA 4FJ2A 1SCUA 4ZQFA 2WYUA 3HHPA 2O3TA 4CLRA 1UXHA 1ZBQA 4PLGA 2B4TO 3AK4A 3DFUA 4Q3EA 2QW8A 5TJHA 2C7VA 4XYEA 4J7XA 4EBFA 3KYDB 5H81A 2X0NA 3BTOA 1EQ2A 4OAQA 1GQQA 3CZRA 4TRMA 3R0IA 4A26A 2D3TA 4I5FA 4DYVA 1DFHA 1ZMTA 4B7XA 3WXBA 3H8VA 5H82A 4YJDA 1KYQA 4Z9YA 3W4JA 4FSHA 1WVGA 5CEEA 1GUZA 4KQWA 1KOLA 3LU1A 4GSLA 3ZHYA 4L73A 3JQ9A 5THKA 1D1TA 3HZZA 5JY6A 3ZWOA 3M2PA 5F1PA 3OHSX 3S1LA 2WYVA 3RC9A 1MLDA 4AFNA 3KSUA 1V3VA 3DL2A 3M1AA 3W4IA 3HDYA 3D3WA 2A92A 3ANLA 4ZVVA 1C14A 5KKCA 3JQAA 1RJWA 4UEJA 1M75A 5IDQA 1BVRA 3IJPA 1LDEA 4GWKA 2JHGA 2EEZA 3K96A 1OOEA 2C7GA 1I3NA 4UEKA 4XX0A 1KIFA 5AXAA 1R4MA 3DOOA 3ROQA 2HJRA 5I7VA 3H9UA 3OQ1A 3D4OA 3ONEA 1C1XB 1LJ8A 1KY4A 5FF9A 2VHVA 2X5OA 5F3RA 3ST7A 3FPCA 2VTEA 1LDGA 1EFLA 1V35A 3CH6A 4E32A 5ITWA 4J1SA 4WLUA 3INGA 3MOGA 5B4TA 3LC1O 1E77A 4IDFA 2SCUA 4JBHA 3X2FA 3IKVA 4KMSA 1IB6A 4GBJA 3L4BC 5CDTA 2IZ0A 4CMJA 4HFRA 4ND1A 4GPD1 1AHIA 4FS3A 2Y0CA 4UUNA 3W8DA 2NVUB 5IZCA 3GMDA 3GNTA 5CG2A 1ZO8A 3DMYA 1JQBA 1U4OA 5AOVA 3BIOA 4J1NA 4OGWA 1P1HA 3QQPA 2JJYA 3U4IA 1DHRA 2ZK7A 4JJGA 3UCXA 5GZ1A 1OMOA 2EKLA 2J3IA 4WECA 1PS8A 4ZD6A 3L9XA 5C5IA 1ADBA 2P9GA 2P5UA 1SMKA 1Q7CA 3L6DA 1HL3A 3A06A 3NEPX 2ZJ1A 4GQAA 4PLZA 3ZV4A 4XJSA 5HM8A 1V6AA 1DRVA 2P4QA 1UXIA 5L95A 4B4WA 3GFGA 1TT5A 4FJ0A 1M6HA 2GPTA 3NRCA 4NBTA 4R9SA 5HS6A 1N1GA 4BO5A 1VL8A 2X0IA 3QWAA 4FFRA 3ZHBA 1H0KA 1VRWA 3GZ4A 3V1TC 3BMNA 4B3HA 5JFOA 3OP4A 1L7DA 4IXTA 4N54A 2WMDA 3EK2A 3WBFA 4D79A 4ZJUA 3I6IA 1N7HA 3AU9A 3KZVA 4GX5A 4NDNE 1IPEA 1EVYA 3SEFA 1ZXBA 4AJKA 1LSUA 4BL5A 5A5FA 1LTHR 2JAHA 6LDHA 1U7HA 1W6UA 1AHHA 3AOEC 1PQPA 3Q9NA 3DTTA 4BNNA 4BVAA 2CDBA 2YQ4A 1B0AA 1M76A 4CUJA 4DQXA 1ZSNA 4CLOA 2B4QA 4YAIA 1CERA 3EZYA 4RF3A 4K6CA 3R1IA 2X86A 1UP7A 4TWRA 1PJ4A 1QYWA 2Q46A 2VYNA 1H6DA 1H9AA 5IDYA 4WE3A 2RHRA 3GHHA 3CSDA 3QIVA 1NFRA 1NAHA 2PD6A 4D42A 1SAYA 3H5AA 3RCBA 1YS4A 4YAEA 5TGDA 1E0DA 3I9LA 3IOYA 4GL4A 1WXDA 5DDIP 3DHNA 1ISFA 3KEOA 2CY0A 3MJ4A 2WJPA 1BXZA 3VPGA 3QE3A 4FR5A 5BT9A 4UULA 4PG7A 1GPJA 2C59A 1N1EA 1HE4A 3LLVA 2DKNA 2PKRA 2FZEA 4FIZA 2O2YA 2WEKA 4E31A 2EW2A 5CDSA 4E5NA 4YJHA 4D46A 4EJ0A 3DXFA 4HV4A 1JAYA 4R3WA 2JFFA 4J16A 4J4TA 1HDCA 1R16A 2PR2A 4XEHA 1LLUA 1U8XX 2HKIA 2GYYA 3IKTA 3WGZA 1NPDA 2G82A 1E3LA 4KTTE 5JBIA 4CLXA 3AM3A 3U4CA 1MG0A 4NK4A 4CMAA 5IXSA 3DBLB 1ISIA 3RJ9A 4O1MA 1YL6A 3O9ZA 4DRYA 1IZ0A 2H63A 3IP3A 2OZPA 2EW8A 4J0EA 5TRTA 1LNQA 3PP8A 2CF6A 4RPKA 1V0JA 3KB6A 4RF2A 4XWYA 3OH8A 2AE1A 4YAJA 1I32A 2Y66A 2IODA 1ML3A 2V6FA 4R9RA 4YQZA 5AXCA 3VH2A 3PVZA 4YT5A 3L0DA 1A7AA 1X1TA 3L9WA 4L4SA 4R69A 2WWRA 1UJMA 3EHEA 2IXBA 2WTBA 3JCZA 2OORA 3NX4A 3LF1A 2QG4A 5ADHA 3Q0EA 4ZICA 4JLWA 4J9UE 2VYVA 1RWBA 1V3TA 1IY8A 3SLGA 3B1JA 3F4BA 3RIHA 1XDWA 2BELA 2A35A 1CDOA 1P1RA 2W2KA 1KVSA 2O48X 1RM4A 2YZ7A 4GX0A 1K89A 1K6XA 3DHYA 5A03A 3E5RA 1A72A 1N7GA 4YXFA 1R37A 1WNTA 1B3BA 4MVJE 4FFNA 3DHEA 2WDZA 3JYPA 3R6DA 3QV1A 1HDGO 4AL4A 2DFVA 3PK0A 1PL8A 3TRIA 1I2BA 2NQTA 4PZDA 4TQGA 2QRLA 1VLLA 5K6AC 2ET6A 1MFZA 1VPDA 5A9RA 1CQJA 1RYEA 1NQOA 1U3TA 5JDIC 1GV1A 1X7GA 4R1TA 1ZMOA 1I3KA 2HO5A 3OIFA 3WMWA 4OKNA 1PJ2A 3H2SA 5COQA 3RUAA 1DIRA 3ORFA 5G0SA 3I4FA 4JBGA 4DPLA 1FJHA 3GDFA 4UVIA 4IJWA 3BHJA 1OFGA 5G0TA 1BDMA 4Z9XA 2BGLA 1JKFA 1FXSA 3P19A 5JLAA 4FQ8A 4NU6A 1Y7TA 2D8AA 5I7SA 1AUPA 2NTJA 1PL6A 3NT2A 3JQBA 5HWSA 1E7WA 1J49A 1HLPA 3VOSA 1EVJA 5H83A 4PN3A 4YWJA 3P2YA 1E3WA 4CQMA 4HBGA 1H6AA 1IHYA 1MGOA 1JLLA 1P77A 2GUGA 3ENKA 3V2HA 2Y0EA 2DVMA 1ENPA 2H6EA 2GN6A 3PHLA 3PLRA 4BGIA 1C0LA 4WOKA 2YYYA 1PZHA 4CLRB 2I3AA 5DBIA 3WQQA 3H5RA 1ENYA 3TZCA 4FFMA 1J0XO 2FR8A 3HN7A 4FFOA 3O38A 4N7RA 5F21A 3VZPA 5IDXA 2GN4A 2PY6A 1E7MA 5DOZA 3GC6A 5JYDA 1ZK4A 1OI7A 1NFQA 1HYEA 2NSDA 4NFHA 4XCVA 1DC4A 1LC0A 3ZW8A 4WEOA 4CV2A 4F3YA 4BNWA 3FF4A 3HJAA 3PQDA 1IPFA 1UZNA 2B5WA 3KBOA 2HSDA 2R00A 4DYDA 4CMGA 2Q1UA 4ZHSA 3G0OA 5A1TA 4K1LA 1R6DA 1YQXA 2FSVA 3PJEA 3RVDA 4CV1A 3D3WB 1A71A 2BLLA 1EQUA 2CD9A 2Q1SA 5A05A 3TN7A 3ZH2A 3WG9A 1GY8A 1SNYA 1T2EA 1ZKMA 4TKLA 4BNIA 3B6ZA 3DZGA 3M6IA 5L4NA 3PYMA 1F14A 1C0PA 2JHFA 5G0VA 3WIDA 1ENOA 2PH5A 4KDEA 4RVDA 3P2OA 4XGIA 3V2UA 5B1YA 4JXKA 4IXWA 3TF5A 3MEQA 2YV3A 4M8SA 1Q7BA 2JD0A 4QECA 4M54A 3PGXA 4Q3CA 5KJEA 2R6JA 3VDQA 1EUCA 2FSSA 2EKQA 2W8ZA 4HP8A 5AXBA 2IYOA 3U9LA 1NPYA 2PD3A 4J7CA 2BMAA 4B4VA 1YGYA 4AJJA 1BW9A 2CDCA 2YJZA 3NUGA 2HK7A 3F1LA 5DCUA 3KYCB 4KWIA 4AJIA 4PG6A 3LT4A 2YHIA 3DMTA 5FEUA 4C7JA 3VTFA 1P0CA 1C1DA 4EZBA 1TT7A 5G4KA 3EY4A 1H93A 2IXAA 4Z3KA 3UAGA 2HMTA 2QX7A 1GUFA 3PLNA 1KS9A 2HMVA 2VTDA 4CM1A 3JD1A 4CLEA 1LRKA 3BMOA 3OIGA 2I9PA 5IG2A 4HNGA 1X15A 3NDRA 3LVFO 4QTZA 4U6QA 4AJ4A 4A03A 1MUUA 3PXXA 1W0CA 3ZW9A 3PTZA 2PZLA 4NBRA 4UUMA 4AJHA 1O8CA 4LVCA 4U0KA 1VM6A 1ADCA 5EL0A 2E49A 2ZQYA 2OFPA 1Y9EA 3TZHA 2BD0A 3WGYA 4YR9A 1TT5B 3FBTA 3CXRA 3L07A 1U2GA 1SO8A 1T24A 2O50A 4EDFA 1VE9A 4OIMA 2J5KA 3LT0A 4IY1A 4PLWA 4J0FA 4DLBA 3BMNB 2HMWA 4IDEA 5T57A 1DXYA 3H5NA 3QVOA 5BNIA 4J4BA 2Q3EA 4DQUA 3NDJA 2OUIA 1A4UA 2CVOA 3ZU3A 1ZVMA 2FMUA 1H2BA 1X7HA 2O7SA 3ADPA 3GAFA 4DREA 4DMMA 3GQVA 1I30A 4OL9A 2DT5A 3MZ0A 3NTOA 4E2ZA 7ADHA 3QRWA 1NASA 1XLTA 2O3SA 4XIJA 5AVOA 2Q2VA 4A0SA 3NT4A 1YDEA 4L0QA 3DC2A 3N58A 4GAEA 1O9BA 5GMOA 3HADA 4BKOA 4CLOB 3E1KA 4I08A 3KOUA 3AOGA 3FPLA 4C4OA 1RM5A 4LCEA 1A7KA 1F8FA 4XR9A 3P7MA 1L7EA 1ZNQO 2O2SA 4JQCA 1FDWA 3HE3A 3PYLA 5IN5A 3PHJA 3I1JA 3PZRA 1LUAA 2VRCD 1DHTA 1R66A 2E4AA 3JSAA 2NVBA 3B20A 1E6UA 5A9SA 3T7EA 2TMGA 3ITDA 1A4IA 4CMCA 4BOYA 5JY1A 4MIEA 1LX6A 1GQ2A 1DC3A 1EZ4A 3I9NA 1HSOA 2FZWA 5FI3A 2TMDA 2NACA 1FDTA 3PDJA 2B36A 4PRKA 5ICSA 2UAGA 1LQUA 1E6EA 3EW7A 1KVQA 4E0BA 2HAEA 1Z7BA 3RUHA 2R2GA 3COSA 2C2XA 1XQ6A 3VH4A 1N92A 1I2ZA 3OICA 2FN7A 1Q0HA 2UVDA 1QKIA 4YJHB 4MVJF 4R54A 2Z1NA 5L53A 1TA4A 1CETA 1P31A 1DFGA 4BNYA 1XCBA 3OQ6A 3LLSA 4S1VA 1QYDA 3C3XA 3JQ9C 2Y99A 1TEHA 5DCWA 1GDHA 5TQVA 1SB9A 3HDQA 4LN1A 1NWHA 4L76A 3T4XA 2AMFA 1KETA 2PZKA 5K0ZA 3HUDA 2JAPA 1VL0A 2OMEA 2Y68A 3PEFA 1ZFNA 3OJLA 1NX6A 3CMCO 3DFZA 4XYGA 1CQIA 1HZJA 3KLPX 3ZWNA 1AN9A 4B4UA 2GLXA 1D4FA 4RCVA 5GZ3A 1PR9A 3H3JA 4N5NA 4ESOA 2BI8A 1GL3A 1SB8A 1NQ5A 2DAPA 4OO3A 5JE8A 3I5MA 4R1SA 1FK8A 1UZMA 2NU8A 4BNFA 2O23A 5TLSA 1U8FO 3JQDA 3ZU5A 4DLAA 1H6CA 4BNJA 3AU8A 1GQYA 2PLAA 4HNHA 1CYDA 4PLTA 1X1EA 4TKMA 5KCZA 4AJEA 3RU7A 4WLFA 4O6VA 1Y5RA 2Q2QA 3E9QA 1R12A 3GG2A 4LK3A 1V3UA 5TT0A 3ZWXA 5IZCC 2Q4EA 1U7TA 2PH3A 1IYZA 3RC1A 4MVJP 1ONOA 2W2KB 2NM0A 4DPMA 2EERA 2Q2WA 1WPQA 3I9KA 4YAKA 1T2CA 3C7CB 2Q1WA 2H9IA 3ONDA 3AUUA 1ZK0A 4BQPA 3GOHA 4R51A 4RVSA 3ZWMA 5L4SA 2PZJA 1QXSA 2C29D 3C1OA 5TF4A 4O5OA 3DOJA 4NNJA 1F0YA 4J2OA 4GGPA 1JKIA 1BTOA 4Y67A 3DZIA 2I67A 1PJCA 2E48A 1DC6A 1KEUA 4GVLA 3ZU4A 4I8XA 5JAQA 2X7HA 4QFCA 4UVDA 1HETA 2VZ8A 3ZNOA 3AW9A 1NR1A 2RH8A 1N8KA 4ALJA 1CEQA 3KRTA 1JA9A 3JV7A 1LSSA 2E6UX 2AA3A 2OOSA 2ZTMA 2RIRA 5BR7A 3PQEA 1IHXA 3VH1A 4G81A 4LISA 1DJQA 5JDCA 1ISGA 4MKZA 3GDGA 2QYTA 2O4UX 2OO5A 4MVJA 4BKUA 3TSCA 3NGLA 3CINA 4X54A 1XSEA 4DIOA 3OM9A 4P4NA 1OBFO 4YB8A 3IDSA 3SXPA 1NPTO 2W90A 3B1KA 3MJSA 2JCXA 3CKYA 1GYQA 4MO2A 3SVTA 3VPHA 2YDYA 3WNVA 4KDFA 5L7TA 3G79A 4ZRMA 1K6IA 3S2GA 4PVCA 3WLEA 4ALIA 1ZCJA 3PRJA 2VUUA 4DPKA 2BFMA 4IQ8A 3E6AA 2VHYA 4MP8A 1E3WB 3FD8A 3JD3A 4CQMB 4XGNA 5BSFA 2IDZA 4JK3A 2NLOA 2Z1MA 1QYVA 1DDOA 4LRTB 1Q2XA 3RBZA 3V1YA 4LMPA 4BHTA 5JAMA 2JCVA 5JMWA 4DL9A 4UUPA 2EKPA 3GNSA 2A9FA 2JL1A 3Q11A 4RGBA 2XXJA 3VVCA 1ID1A 2X5KO 4IDGA 3GZNA 1OAAA 1BXKA 4GMFA 1E7YA 1EVIA 1U3UA 2FY8A 4G2NA 3RQSA 4W99A 5L3ZA 1S6YA 3D3EA 4MP6A 3OBBA 1BMDA 3FWNA 4NK5A 4F6CA 2J8ZA 4E6PA 1DRWA 3BTSA 3STHA 1U3VA 5ER6A 5GZ6A 1MXHA 4J1QA 2VCYA 4AICA 4BNGA 4EUFA 2IZZA 3F46A 3MWEB 5HBRA 3F5QA 2GCGA 2IZ1A 5LCXA 3VDRA 3RKRA 1ZJZA 3GVCA 1A9ZA 1DIHA 3Q6IA 2X23A 3NYWA 1LDMA 1B8VA 4BNLA 3DZBA 3GFBA 1B8UA 4WNIA 1YOVA 2ZYGA 2Z5LA 1ZK2A 5BNFA 3JD0A 1NWCA 2YY7A 6ADHA 4NFYA 1WDKA 4HKTA 1BRMA 4J49A 1PL7A 1T2AA 4G5HA 2NV6A 3H9QA 1UZLA 1XIVA 2CUKA 3H4VA 2ZJ0A 4IMPA 3QVXA 2OBNA 5CDGA 5JXWA 3WSWA 1PS0A 1MA0A 1BGVA 1Y8RA 2DBZA 1I24A 2VHZA 4L4XA 1XU9A 1PGNA 4TZTA 1O5IA 4BV9A 1X14A 2Y1CA 1MX3A 3GR6A 3ETDA 3RROA 3GPIA 2AEMA 1ZSYA 4XDZA 4TROA 4FFLA 2YFHA 5IFLA 4QEDA 4XKJA 1HTBA 4XB1A 5IJZA 9LDBA 3GF4A 1BW9B 3UKOA 4ZGWA 3ROKA 1DIBA 1XR3A 3KVOA 4MPDA 1MFPA 1FDVA 2YHIB 3OETA 3PFFA 4NG5A 4CM9A 3HG7A 4F45A 1GTMA 1K5HA 1CRWG 3JQ7A 5G4KB 3GT0A 3PQFA 4HFMA 3E5MA 4O0LA 1ZW1A 3S2EA 5COBA 1T2FA 2AG8A 2V6BA 3B1FA 2C54A 2PZMA 3TL2A 4NR0A 2HRZA 1UAYA 4LRSB 5TJ9A 2X9VA 2F00A 3QVWA 2VZ9A 3L6EA 4DQVA 1IZ9A 3H7AA 4DIBA 4XJTA 2DQ4A 4RZHA 5JAIA 3G17A 3ZNPA 3D5QA 4OSOA 4XYBA 4OM8A 5C7OO 1QP8A 3BHIA 1BG6A 3DZKA 1I33A 2PKQP 3GDOA 3OA2A 3PHGA 4O59O 3OMLA 3DBHA 3NAQA 3U4HA 2W2LA 4ONEA 3WIEA 4IQGA 3VPSA 1T4BA 2UYYA 1YBMA 5TX7A 1ZZEA 4EEXA 4P22A 3JQCA 4MINA 4BO0A 2PWZA 4A7PA 3E8XA 1SC6A 4RVFA 2EP5A 3RUFA 2OP1A 2A4KA 2D5CA 3ITKA 3OECA 5FFFA 1ZK3A 4ND5A 1W4ZA 3DZHA 5KVQA 1EBFA 4RV9A 4B8ZA 2X0RA 4KUGA 5KNLA 3AI2A 3BYZA 1BVUA 4IZIA 1E1KA 4OMUA 3C7AA 4CLHA 4XIYA 2BHLA 2QZZA 4LSMA 1I0ZA 4BO3A 4JCOA 4C7KA 3PGJA 5EESA 2ILTA 3ANMA 1PEDA 2HJSA 1QMGA 1YKFA 4Z9FA 3JQBC 1T1RA 1ARZA 1P45A 1ISHA 5L9AA 4JP2A 3R3JA 4FD3A 2C07A 1DIGA 5JYEA 4UVHA 2BRUA 4YT2A 5ICMA 2HCTA 4WCFA 4TSKA 2HK9A 1Q0QA 4RQTA 5THQA 4FC6A 1SZJG 1UH5A 3HWRA 1R15A 1E5LA 3H9JA 3MJVA 1EUDA 3QLJA 4YBZA 1PX0A 3WQRA 1PJQA 5A9SB 3HB5X 3K8ZA 4ZRNA 5JS6A 2D2IA 1GD1O 4EI2A 5ILGA 2VT3A 3I6QA 4L75A 3WWZA 3ZNNA 4MJLA 1PZFA 4R01A 4GGOA 4IGFA 2V6GA 4NFSA 2IYPA 1P44A 4CMIA 2OP0A 5BSGA 3BMCA 3K6JA 4J6FA 3SJUA 4Z6KA 3N7UA 4HXYA 4MVJM 5T64A 3AM4A 4M89A 5KJCA 3D7LA 2QIOA 2DLDA 3A28A 1WWKA 5BQFA 2DPHA 2V6MA 3AM5A 2YFQA 5G2OA 1Z7EA 4YJGA 3O03A 1LBEA 3FRJA 2RAFA 1AGNA 5JC1A 3ASUA 4IIUA 1I3LA 4TZKA 1G1AA 1QR6A 2J3HA 4UEOA 1O6ZA 3WBBA 5IXYA 2WD8A 2XF8A 3WFJA 2R00C 1GZ4A 1WLYA 2X8LA 3ENNA 3T4EA 3LC7O 2NVWA 5CEFA 2GO1A 4CUKA 3AY3A 4DIFA 3VKUA 3QA9A 2WSBA 4P4LA 4MKRA 4INAA 4XYLA 5FWNA 3WWYA 4CM7A 3OJEA 1LSOA
chains in the Genus database with same CATH superfamily
2DHEA 2IHUA 2Y6UA 5DGIA 1F2UB 3SOZA 5DEOA 3K1AB 1V8OA 3QJYA 1M0WA 2PZGA 3ESAA 4QG7A 2QVZX 4Q9KA 4M46A 3OJWA 5AW3A 5K8VA 1GOTA 4MKXA 2DCUA 3TOXA 4Z4GA 3E9NA 3AEUA 4M1ZA 4Q1FA 1IG3A 2ORWA 4UZFA 1YQDA 4F3KA 1NVXQ 4JQSA 4RVUA 2HNAA 2PM8A 4ZO7A 3GYBA 1NYLA 4DLAA 1FS5A 1YR3A 4RORA 3PRYA 2FPGA 4KN6A 5K45A 4RHCA 4CL3A 2V59A 4ZDWA 2NU8B 3AJAA 1Y1KE 3A25A 3L6UA 5TARA 3W2IA 4ARSA 3TE7A 1DI0A 3LX6A 1B8PA 1WB6A 2O2ZA 4D9EA 1CVIA 5JCJD 2AZXA 4DR4B 3B1VA 4QOIA 4IIJA 4N18A 3OPYB 3ONFA 4UTNA 2VQ3A 3BTVA 4RZ3A 1ZHFA 1FP4A 3LDUA 3T0GA 3ZU2A 2OUKA 5C4MA 2IK8A 3ASVA 1XQXA 3IRUA 1SPXA 3N8DA 5H1YA 2C1XA 3RFVA 9GPBA 1WBJB 4LECA 3GA7A 3DMTC 4L85A 4M0DA 1IBSA 4ALMA 2DBQA 2DU8A 1PLKA 4OXXA 3ES9A 4PLYA 3MTGA 1XL0A 3F8WA 4QO7A 4BFWA 4FCVA 3V1NA 2HF2A 4PLPA 5CJ2A 2JGAA 4NEGA 5CDUA 1P81A 1EX1A 1G19A 2Q3CA 2ZTLA 3RTBA 3ZZUA 2DYKA 5C7YA 5A0TA 2HDWA 1PHPA 1OXKB 2OV1A 2OYSA 1CJTC 3K73O 1KH2A 3Q7EA 4HY3A 4KI0A 1RR6A 2BFOA 3DD5A 4AZ0B 2XZLA 5ER9A 1E58A 4M9RA 1Z0UA 1GPMA 2XA1A 3E2MA 1P33A 4NPCA 3SJZA 2DWPA 2O8NA 1MJHA 4JP1A 4WXEA 3D3KA 4G4SO 4U9UA 4Q15A 5U4XA 1HE5A 4KJZA 2NZYA 1AA9A 1M8KA 2XEDA 1EM8B 2BHTA 3OQNA 3KUXA 1JA0A 1G8AA 3GCZA 1PQWA 2BEJA 1DKMA 1UC8A 3AFNA 1L5KA 1XALA 5B4VA 4NEHB 1TKAA 1QDEA 3K94A 3QBVA 1GNSA 5JSKA 4R2WA 5YASA 4DMHA 2YJ5A 3S8EA 4K7JA 2Q3BA 3AF1A 1AXRA 2YV4A 4QKQA 2A9JA 3I2JA 2AXPA 4NJMA 1PV4A 2PFKA 5EMHA 1OIWA 3V5NA 2WRZA 1BA3A 1QGOA 4IDDA 1QLHA 2AEEA 4ND3A 4OUDB 3FYUB 4QAQA 5JVDA 1ZD5A 1US8B 2GI4A 5JMPA 1QRAA 1P1IA 3I9MA 2FPOA 2ZXFA 2KYRA 4NNPA 5EQFA 3KAJA 2WWVD 1J9EA 4JXXA 2HF7A 1PIWA 3W2TA 4AUNA 2PKEA 2NG1A 3R5HA 5FYDA 2ZI6A 1H2HA 2M9MA 2QUKA 4BN4A 1OXMA 5JO0A 4PGMA 1JVBA 1WCWA 3E3OA 1JLKA 5BVGB 4N6GA 4YJ2A 3A6EA 2VJPA 3WGGA 3KCQA 1HG1A 4FCWA 2RH4A 3I0NA 3GNQA 4K0KB 1QSGA 3KZMA 5AJZA 1G0OA 2FPMA 4EJ2A 3WZMA 4BLWA 3Q6MA 3R74A 5KTMA 1XT6A 1XYGA 4MYRA 1J5XA 3H1EA 4GZMA 3DTNA 5E9AA 3PJGA 3HU3A 1IUKA 3SX4A 2RHDA 4CF3A 1JL3A 3PB3A 5EJ2A 1NU6A 4IGEA 3TIFA 3LBNA 1EP1B 1TM2A 5U9CA 2X0EA 1T35A 3JQAD 4RVNA 3CR8A 1VCIA 4B6PA 1E5QA 2HQOA 4LCJA 2GCIA 5HIKA 5A4AA 4HAVA 2OXIA 3RGGA 1SEVA 1EGMB 4QU8A 4BVEA 1ZCFA 4BV8A 3UJNA 3ZV6A 3CH7A 5J1TB 1MIHA 1ES9A 3S5JA 2Z2XA 1V7QA 1NJ5A 1HE3A 1B26A 4N7JA 4RTPA 2PNJA 3GZNB 4FW8A 1OAOC 3T3HA 3OAAD 4LWPA 4BFLA 1K7EB 2PZ8A 1T3SA 2EYQA 4U4AA 1FXWF 5BW5A 1MZVA 1R8XA 3LW7A 5IUJC 2ZUFA 3BF8A 3CJQA 3TL6A 1O94A 1KZ7B 3D5TA 3EZGA 2HLDA 3W34A 2Q8NA 3IBSA 4ENUA 2MTBA 5DWQA 3TTWA 4LJ9A 5ENDA 1Y5NA 1NVKA 1P1CA 1XHLA 4CNQA 2P9YA 5HZHA 1FFCA 2GVNA 5L7WA 1EHYA 2DFLA 2DM6A 2X9NA 3CFYA 3FI0A 3R76A 2ROQA 3JYQA 4PIVA 2JCBA 3NJ8A 2J5XA 2Q7OE 5G1OA 3LOQA 2I76A 4QRHA 4DEXA 4BKRA 1GCUA 5ERYA 5BWLA 4FILA 4FE7A 1XMQB 1U1IA 4HVTA 1J0DA 2PTGA 4B33A 3A6DA 4PG4A 3OPVA 1Y5MA 3Q7PA 3ZWPA 1TVKB 4OJKA 3SDBA 7YASA 5DHAA 2Q4BA 4BUCA 5CVJA 2I2FA 2D1SA 5EHZA 3AZOA 2OBYA 1ZUNB 3Q3JB 4GT1A 4QPZA 3QLVA 2J0VA 4OQ4A 4H7PA 4IFEA 4CWAA 4KREA 1O58A 3IGFA 3O3CA 3FCOA 3KVVA 4B3DA 1SCIA 2BHSA 5C8DA 2YJ4A 1TYAE 3GUCA 3IQXA 2BGKA 4V3BA 2IIVA 1Q15A 2DQKA 4OB7A 1A27A 1TZBA 3DLHA 4LOHA 4XGQA 4UTOA 5FI3A 2QTFA 1E2QA 2Z3WA 3UHAA 5F1KA 3BMQA 3V4VB 4BGEA 4BRWA 1ZESA 3O7MA 3F6SA 3U9TA 3I5YA 2X4GA 521PA 1ZJ6A 2YHAA 4G0WA 4JB0A 3LYHA 5IKOA 4HTAA 3WYBA 1PTJA 2JH8A 1M1YE 4N8EA 2HMSA 4ZDIA 2B61A 3C14C 3K30A 3OHPA 3C6QA 5JCOA 3JD2A 4COOA 2F3TA 3DOFA 3GD7A 3NBUA 4CG2A 3EGOA 4Q3BA 3FNGA 5IC4A 1XLVA 4LZPA 4R41A 3I1FA 2P0EA 1NVVR 1U9CA 2BW0A 2GZ2A 1SKAA 3K2EA 1JDJA 4WN3A 3LKDA 4NL4H 2EIHA 3KVRA 5ULLA 1GCOA 4GI1A 2RAPA 2J87A 1PJBA 1OFHA 1Y6ZA 1G20A 3PFKA 4IEFB 4GLLA 5ESWA 2VF4X 3FJYA 3FIJA 4NBWA 3VO8A 4G0OA 3OZSA 1UT6A 4LX0A 4DG5A 2PS3A 4KO4S 3BD6A 1VI6A 5LN1A 1I5EA 4ZU1X 2Q1YA 5KQPA 1F9EA 3QF4B 3KYBA 4RJIA 3NDBB 4O2AA 4TTIA 2D2FA 5LYJB 1Q7EA 1CP3A 2ASVA 4C06A 1NBOA 1SQGA 1UP6A 4ZT7A 2A94A 5SZJA 5FBQB 3W5IA 2H11A 5IVKA 1IXRC 3TD6A 4XD2A 4X66B 3JWEA 3O3MB 4W1SA 4CL0A 4AZ3A 4CU2A 2V45A 4F72A 4RVOA 5JJIA 1C9EA 1TF7A 4HLUA 4OVKA 4UD2A 4ENSA 3AEQB 1EHCA 1SBCA 1UEJA 4LQDA 3IKJA 1WF6A 1JR2A 2ABWA 4IIHA 4XH9B 3EVGA 3K5PA 4ZQEA 1CF2O 1T8YA 4FUQA 2IHVA 1I5RA 4NYIQ 2FMTA 4AZVA 3UNXA 1HNZB 4B44A 2LE0A 3HDHA 4OMCA 1FZQA 1NXOA 2IYRA 3UFBA 1EMDA 3R6LA 1RJ9B 1ELOA 2DY0A 1E2GA 2XHEA 3DOCA 3FGOA 4QT0A 5FR1A 1GYRA 3DOEA 3QTLA 3ZY3A 3SS7X 4DKXA 1MVLA 4EGFA 2Q4TA 5KMGB 1U2PA 1J0CA 4BDTA 1HEIA 4G3XA 1J5PA 1CHNA 3S5UA 4US1R 3KXDA 3PC8A 3LC2O 4TUYF 4YCNA 1KK0A 1X0VA 4P38A 3FDZA 4UQLA 3PXUA 5AJXA 4D81A 1MO5A 2MSKA 3IFSA 3DEZA 1YFKA 4ZT3A 4WCDA 4D3XA 3PX7A 5T4BA 3DWGA 3B6IA 4ESHA 3H4TA 2QG9A 3HCAA 3KB1A 1GEEA 2C5LA 4LHZA 3SPXA 4YRNA 5F51A 1J2UA 4L5YA 5DRTA 2PZBA 2TRSB 4Z3OA 3W6UA 1RXVA 4GM1A 4JVSB 3WBJA 4MEBA 4EI8A 5FCDA 2I2AA 5I7RA 1SQSA 3V8RA 3NKLA 2QLJA 4J8PA 4POAA 1GIAA 4G1VA 4JJ8A 2E4UA 4KHPB 5LP6A 3VSEA 4G8BA 4L6AA 4BV3A 2QRGA 1JWLA 3D4NA 3JSXA 1DQRA 1OBHA 3NCTA 1EZZA 3M9WA 2BGIA 1P60A 4WCFB 4TPKA 4F5YA 1CZNA 1MQ9A 1UIMA 3KUUA 4C6RA 3GMSA 1I7QB 2PUGA 4MAFA 4X7BA 5HRCA 5DOVA 1QGED 1YJ8A 4WXPA 5H3CA 4QJBA 4DDVA 4WLNA 1T6ZA 3BRWA 4ZT5A 3BZWA 1IJFA 4OHUA 5TPWA 5EKDA 1E3IA 2JAWA 2Q5HA 4IMIB 2WJYA 3B9BA 3IE2A 4G0XA 4UU7A 2IPXA 1Z5VA 1BNCA 2IIPA 2PYZA 5BYAA 3L8YA 1TYDE 2ZJFA 3PJFA 721PA 1SG9A 3PDIA 1Q1QA 3BVPA 1KDYA 3V8BA 3ETEA 1MT0A 3P1JA 1XELA 1GPUA 3LVBA 4UMVA 3WMRA 5ES4B 3NWBA 1ZGAA 1M1NB 3JS5A 2R5NA 5AKHA 2ZYSA 2X3UA 1SXJE 4MTLA 4W5WA 3ZHCA 4FM9A 2B4RO 2P9CA 4JOQA 3TJMA 1MTOA 3UB4A 5KJ1A 1YCHA 2A14A 1DO2A 2WM3A 1GNQA 2JIPA 3GJTA 3I4LA 4EPTA 5JZMA 4G0NA 2O3QA 2JIRA 4IDAA 1FVHA 2RHGB 5TEVA 2FRDA 1YRHA 4G85A 1R4ZA 4I46A 1O95A 5EQJB 3F9CA 3LGAA 4LGMA 4RV4A 4WJKB 4BO2A 1GFWA 2WAAA 1DEKA 1S02A 2G88A 2Z43A 1F8XA 4YDSA 4X84A 4L4ZA 4WCVA 2BFCA 2QL7A 5LKRA 2V96A 2CBXA 2HIGA 4U7TB 2HRDA 3KB8A 5AM1A 2BM9A 2XD9A 3QUQA 1EHIA 2NMVA 4A5OA 4S3MA 4HYEA 1FP1D 3FNBA 4DMRA 4N7MA 3RU9A 2Q3MA 3HXTA 4FN4A 5FA6A 2DRIA 4CMKA 4AVYA 4G23A 2YVKA 1AKWA 2NSYA 1X80B 4HUQA 1I3MA 2XTMA 3AVOA 3GB9A 1KY5A 3H2BA 3PKZA 5KOIA 1Y1SA 3GEDA 3KVNA 4RDHA 5DHFA 1FLDA 2ZANA 4ZV9A 1MC4A 4UVEA 1CUZA 4DCMA 4OG2A 1TTHA 1XTQA 3GUYA 4IRUB 2K2WA 1PFYA 3ORHA 1JPVA 3RC2A 1SCNE 4P4GA 1XZAA 2YV1A 2VQDA 4X41A 5AI5A 2PWAA 2FEKA 5DNUA 5G1NA 3ZVRA 5HGXA 2MDTA 1GG2A 5KNCH 1Q1NA 2X5XA 1AGYA 4JP3A 4U6NA 5TQ2A 2ZBQA 3HMKA 5CYPA 3FSEA 1FDRA 2Q0HA 4X9XA 2Q41A 1IMOA 1SJ9A 2A9VA 5D3MB 4AJLA 3W7VA 5A2QA 1C8BA 5KS2A 4N5MA 1P0FA 3OJFA 3WGTA 1V47A 2NO4A 1QIKA 2CLLB 3GN1A 1SY7A 1Z17A 4LWOA 1RXIA 4KFSA 2PAFA 1ZR4A 1L4HA 4K86A 5C8XA 4YCAA 4A1OA 3FNHA 3LCMA 2FB9A 1L4LA 1RKBA 5L45A 3RFUA 1TYZA 4ALLA 4BX9A 1YKGA 4K28A 3C16C 3PVSA 1NVWQ 1VCMA 3RJTA 3QEBZ 1PSDA 1BH6A 2C98A 1HO3A 1H8ED 3P5BA 4QDJA 4PGHA 5DT2A 2ZREA 3A6GA 4UQOA 4DBLE 5AHWA 4PFQA 3KLNA 2ZE5A 4L6IA 4HAXA 1O1YA 4S1TA 1AQJA 4IDXA 5DM1A 2GR9A 1DKNA 2FW8A 2GLUA 4X24A 5DM60 1B74A 1SKMA 1IU9A 2X5NA 1JG6A 1TCCA 1NL3A 1TZKA 2QM0A 2R0QC 1TGYA 3I1IA 3TRKA 2BE9A 4L0MA 4Y2YA 5LWHA 2DBRA 4MRRA 1X1RA 3O1IC 3UEOA 2I65A 5CW1A 3HR7A 3QE9Y 3N2KB 4HAUA 1QFYA 2OR3A 4YPFA 2ZU6A 4U8HA 4ESOA 2EC5A 4GF5A 4UMFA 4DA6A 1UFRA 3R9XB 3K09C 4B3RB 3X2EA 1DBSA 3Q3CA 5JD5A 4LC1A 2BMFA 1BH2A 3C1TA 4NNOA 4WLOA 3K7EA 4X97A 5LQDA 1Z7WA 2XXAA 1KMHB 5JJLA 3C48A 4J90A 2W9XA 4RY9A 5FUXA 1L1FA 2G5GX 5DF1A 2CXNA 3LCUA 2DUUA 5CVEA 4O5AA 1WUKS 3KQLA 4R1LA 1P2UA 4B0PA 3AERA 3HKEA 1V1JA 3ZHTA 5KYTA 1IY1A 2AQKA 3BWYA 2XPCA 4MV3A 3OE1A 2JJ8A 4MWGA 1JWAB 3ZI0A 2ISCA 2WF7A 2B2CA 2ZE7A 3HM2A 1YQ9A 3KR0A 2I9KA 5HKKD 1PL0A 1QUFA 4F56A 1UPTA 4MWCA 3CNEA 2ZU0C 1G0NA 3W8FA 5CLLA 1KZYC 2XUKA 3COZA 4L2IB 5G3YA 2I2XB 3C6MA 3LT1A 1NP7A 4B3IA 4E30A 4EG4A 5IF3A 2ZI3A 1S2OA 3AI3A 1J0BA 4B3FX 5HNKA 3K6KA 1YS2X 5CIQA 1KJQA 3FIUA 4ARVA 3A1SA 1JHYA 1SVLA 1GAEO 2IOYA 3GLGB 4HGNA 3GW8A 3RT9A 1E2KA 2EFHB 3P2KA 4OP3A 3SE7A 5HG0A 3D9QX 4HTFB 3ZVMA 4J3FA 3UMSA 3NTQA 4NBLA 4QGAA 1MOSA 1XEWX 4D25A 3GVHA 3FTFA 3KQNA 3THWB 3HSKA 1WKBA 2XDQB 4G25A 3T7IA 5D84A 4LW8A 4OSPA 1J90A 1MV8A 3QPDA 1ZKDA 4EPXA 2RCYA 3A4YA 1U2DA 3GGPA 5CNMA 5CA0A 1KI1A 2OENG 3Q9SA 3WK7A 4DCOA 1YFJA 1VJCA 3AESB 3EIWA 2PG3A 3ETJA 4AN0A 3TZBA 5DGXA 1LDBA 1L3CA 3FH0A 2FUKA 2PUJA 3WTCA 2Q1XA 1U1GA 3DVRX 1V4BA 4G01B 2VRCA 1TC1A 4CF7A 2XTAA 2NSHA 5DP2A 2YW9A 5K3FA 3Q1LA 5E38A 1KAEA 1QNFA 1RWKA 4QOEA 3DHWC 2Z6QA 3UVEA 3WKCA 3ACBA 3OA0A 3JZDA 5DP1A 4WK6A 5GGXA 1PZEA 1TU3A 4FTWA 4IOJA 4C5CA 3EBPA 1W1WA 3I9OA 4MW2A 3UKJA 1B93A 3ESRA 4M21A 1ZK1A 2YN2A 4HWKA 2GZ1A 3QVGA 2AC4A 3QBEA 4LKRA 1P3DA 2BI7A 3QBJA 4X6UA 2LCQA 1PV2A 3TXYA 1GZ6A 2CVQA 1DEOA 4L4RA 4L0CA 2DG2A 1DBQA 1JP7A 3IC5A 2P0AA 3KEQA 1GNPA 3ESYA 4KN8A 4NMWA 3RVMA 3E9MA 2FQXA 1EDZA 2G6BA 5IUKC 4P5EA 3UH1A 4UJ3A 4J7UA 3X44A 4J91A 3RW9A 3LXMA 3S4YA 2FX5A 3L4BA 2JBAB 2PRYA 1JVNA 3FVTA 3CNLA 2WLTA 4J0QA 4YMTA 3IAEA 3ZZNA 5ISMA 1JYEA 3ZWVA 4EY6A 3TSWA 3K1YA 3H1GA 1QIEA 3H2ZA 3N5KA 5FPKA 2R5FA 3SE0A 1PWXA 3FTPA 1KEWA 3RSZA 4HDAA 4N9WA 3SWWA 2AXEA 2OCAA 1BQ4A 4I14A 2WBLC 5FTNA 4KSCA 4UDYX 4Q7JB 4ODIA 2CFTA 1T2UA 2R8XA 2VO1A 3H83A 3ZX5A 3RTEA 3DBRA 5BOSA 1GEGA 3HFGA 4GPIB 5C8YA 2IYUA 4D9FA 4PYMA 1J56A 5F12A 1J4AA 4Z3DA 1NBHA 1NT2A 1WHSA 3U61B 1PR5A 3RV3A 2GA8A 4Z9AA 4CV1A 4FNGA 4MUKA 4JLUA 1SU6A 2V65A 2XKKA 1J2RA 1PT6A 4JB8A 3QEKA 4TV9F 1SUPA 3TTYA 1QGYA 3U3XA 4ZEXA 4D80A 2PBLA 3LSYA 3QY9A 3NKFA 4I9GA 1XMPA 4NYJQ 1YUMA 1SVOA 4GKAA 5AW9A 3R0JA 3WIOA 4L5JA 2OD2A 3AWIA 2NZ8A 1MCZA 3ZDQA 1NMZA 3JXEA 5DRYA 1AGRA 1RU3A 5KWIA 4B7CA 3LA8A 4WN9B 4BFCA 1NN0A 1ZI8A 1KAMA 4BTLA 3HBFA 3NP9A 3T7KA 1LCIA 2HQBA 3AR8A 3DDWA 5DWVA 3STTA 3UFXB 3HXOA 1EUZA 1NJ8A 1OXBB 1N1DA 2DFDA 4A8PA 3I73A 4AK9A 4CEIB 3KHSA 4N5DA 3CUTA 6Q21A 2A57A 5AVYA 3ZH9B 2XMCA 4JA2A 1D1QA 3OMXA 3RTGA 1H5QA 1NBMA 3H9BA 4F7WA 5DTIA 1RRGA 1TE2A 2ONZA 5HZGA 3HM9A 3AHCA 5ALDA 2K87A 2Z95A 4GZ5A 1XFAA 2H0RA 3OP1A 2CE2X 3JY6A 3A9CA 5B55A 3FDXA 3PFCA 3Q12A 5I7FA 2VK1A 1I8TA 4YUXA 4LTDA 3ZUGA 1XE3A 2GEUA 3BZUA 5K01A 5TS3A 3ONNA 2WIGA 2FR1A 1OFTA 4Y1FA 3EGXA 1T2DA 2H18A 2IEBA 2QQ0A 1W73A 1JKJB 2ZEJA 3H9CA 1NQTA 1WZIA 1LA2A 3LTEA 3OPNA 3FPAA 4Q00A 2DQYA 4AJPA 1Q74A 1VHTA 3E70C 2YVLA 3DEAA 5BV8A 2H06A 3VHRA 1NI4B 2AKYA 2PV7A 3WO0A 4K9MA 5KREA 1E9BA 4XVQA 5E4YA 3T7TA 4TL6A 3DNPA 4HX5A 4J0DA 1XU7A 5CDFA 4MRMB 3CVJA 3TOCA 2IU3A 3QG1A 4GXQA 4YGYA 5HE9A 5SICE 4KYIB 3WJAA 4M7PA 1JAXA 1F6WA 1A7UA 3GK3A 2JLCA 2A0XA 3A9WA 4R68A 3R75A 2CXUA 3DV2A 3IH5A 3TNYA 3LBYA 4F46A 5B30A 3O1JC 4I6JA 3SZRA 2IYZA 3EIXA 1Z5PA 4MP3A 4XQGA 3R3HA 1QK5A 4D3YA 2FXVA 4BO4A 3ZE1B 4KACA 1JYSA 1T36A 4AW9A 5ILOA 5F98A 3II6X 1E1LA 2ZRCA 5EHQA 3U1VA 2W98A 1KEVA 2W22A 1WNFA 1P7CA 4RFSB 5BR1A 2Q5IA 1KEPA 2CBGA 1M2HA 3NM5A 4UAGA 1IWOA 3CLTD 4TL7A 4YEDA 1II9A 2LP4Y 3I6ZA 3WWEA 5J2UA 1R8YA 2JIOA 4Y3UA 2Q6IA 2IX3A 3E7XA 3IUJA 3KCNA 4CM8B 5IARA 1ENZA 1UPAA 3COWA 2RMKA 4JMLA 1ESZA 4QQNA 1T8WA 1M10A 5JANA 1WOMA 2IU6A 1G1MA 2BGMA 5FNVB 3DAPA 2RCNA 1LBHA 4O63O 3ZLVA 3A2LA 4BLPA 1QO0A 4Z2YA 2CE7A 1CUXA 4UM9D 2CNKA 4BO6A 2IHKA 4GX1A 5EAIA 1M1UA 1UJNA 3I32A 4ZIRB 1VDZA 2HA4A 1NJGA 2HU2A 2BFBA 3TZLA 1Y7PA 3URKA 3TW6A 2VAXA 2ZETA 4BKQA 3D8UA 4Y2SA 5IVIA 3CNQS 4H27A 4IZ6A 4LOLA 5CNIA 3V8EA 2PNFA 4OXQA 4HEHA 4DBLC 1AS0A 1ZN9A 2A3RA 3PC6A 3PFNA 1QO7A 5WRFA 1XTRA 4BWYA 2HR1A 3CUKA 1RLJA 3O2QB 3VMFA 4AF7A 2D5LA 5AXDA 3E18A 4Z1MA 4FOSA 3K0CA 1TMGE 4AECA 1ZLXA 5I7UA 1W0JA 1JEQA 2BKLA 3D31A 4ML3A 2VDWA 3TQQA 4DY4A 3VNQA 3LLCA 1L5LA 5ESXA 1GZUA 1Y6GA 1PFKA 4HLDA 3O84A 5CH5A 3LP8A 3GRPA 3PQ5A 4QASA 3T52A 2GZHA 2O0KA 4FGWA 1CSEE 3ZGZA 1Y8CA 4UOZA 2XBLA 1QPBA 3ZDDA 1CJKC 4AIRA 4H60A 4E2FA 1XHFA 1VJ1A 1F8GA 4NBKA 2DKOA 2RGGA 2VHTA 3GVIA 4LWZA 4YCMA 4RA6A 2PUEA 3GPLA 3E48A 1JQKA 3SLKA 2FPRA 4EB6B 5C46F 1JPJA 3RC3A 2OLEA 3GRKA 1JLMA 3BDAA 4MS1A 1Z74A 1M2WA 5DBFA 3U49A 4FD2A 1N9KA 2WF9A 3QK7A 2QRPA 5LZ7A 3OZUA 5B1DA 1I7DA 1UANA 3JWHA 3KQHA 1A7JA 4JX8A 1PUIA 1V48A 5EMLA 2VQEB 2VNSA 5I9LA 5JQGB 1M0EA 4ZAWA 3LK7A 4EG0A 2PMDA 4RTOA 1CIVA 2RHWA 3D7KA 1DPGA 2CJPA 2NUTA 3RVNA 5C3UA 4ABYA 4BUJA 1U6KA 4H1TA 4ESEA 1EU1A 5BOVA 3TEMA 1E32A 4L9RA 5LUAA 5EFZA 3THSA 5JZBA 2CZGA 3GZJA 3LQ2A 1L7VC 2JEOA 4KQMA 4DMUB 5HZKA 2FPPA 4WNCA 4RPGA 3BJZA 2IIBA 3CO0S 3CVXA 2E5WA 1W75A 5JNVA 4OLJA 4DLUA 4H6XA 2X58A 5DXAA 2Q1TA 3DMHA 2VDNB 3OLCX 3T5GA 1Y3HA 3KJZA 1COWA 1QM5A 3PI6A 2GWRA 2NX2A 1E4OA 4CDRA 1W87A 3IP5A 2UZ1B 2ONCA 4K40A 3W7BA 2VOJA 5JBQA 5CFLA 2VSQA 3CX3A 1EZ1A 4CGYA 2RGNC 1QONA 2X1LA 3NYIA 3IOEA 3LZ6A 3F7TA 5LYYA 4S0XA 4M8IA 3R7AA 1R6UA 2IU4A 1Q16A 2AGVA 3Q10A 4JYZA 1G2QA 1CUDA 2I6FA 2Q27A 3K4HA 1FSSA 2C5GA 3R6WA 4YTEA 5AW1A 1B7GO 1FX1A 1DQSA 3SJ7A 4QFMA 1MQ8B 3QLUA 1U28A 4PRYA 3TL3A 1M34E 5UKDA 1OV4A 3OT1A 3LZDA 3ULKA 4RD6A 1HOXA 1XP8A 3MTEA 1V8DA 4HDKA 1J20A 2OBXA 1E7SA 1ANKA 4Z2AA 5JOQA 5L40A 4KX3A 4Y6RA 1PK8A 5HFAA 1PFGA 1KGSA 2GEFA 3FHJA 1NZDA 3CRNA 4G1BA 4QOHA 4QYTA 1YOVB 4E2XA 5KWVA 1NUSA 2BI4A 2I66A 3H5LA 4YRKA 3LKBA 3PXDA 2JFGA 2AYZA 2Y1OA 4C0JA 5KVCA 1ZUWA 2DTEA 3KSZO 4WKPA 3RJ5A 2IV2X 4G84A 3W3AD 2WILA 2DKFA 4E6EA 1OFIA 5J59A 1K4YA 1OZFA 3WB1A 3QKWA 4ZEVA 4F11A 1JE0A 2C2BA 5IJ0A 5LP6F 3DMDA 1N33B 1T4GA 4B3TB 2GB4A 4MGKR 1JW9B 5EIWA 2NUBA 1X8LA 1AH2A 3FMVA 1EIWA 3ADDA 4TKZA 1W34A 5H70A 2EJWA 4JV5B 1XEAA 3NJ4A 4RTQA 1BRTA 2VN8A 3ADOA 3NHAA 2XNDA 3RASA 4A6EA 1U0NA 3HZOA 3I04A 3FFWA 4FYYA 1UK6A 2AWNA 1IN6A 1HT3A 4NDAA 4ZK6A 2B69A 1VC2A 3ABZA 5LBIA 3K1JA 2JFOA 4GOLD 3ROMA 2DQZA 5AKKA 1WS6A 3D0OA 3HJUA 5IU6A 3H9GA 1TB4A 3PIDA 4BO9A 4EKIA 1N0IA 2AXNA 4V0ME 4DQKA 3QOFA 1YZNA 1RNLA 1FC0A 1Z15A 3D64A 3FSGD 4IV5A 3LUFA 3QOYA 1O5TA 1MW9X 3WGHA 2P1ZA 2YZMA 1D03A 1EK1A 4KR6A 1ULSA 1ZW6A 4FYHA 3PEYA 3FHLA 3IIJA 2I7DA 3N87A 3E15A 3NOOA 1ETHA 4PC3A 1SBQA 2GKGA 3LPNA 1BFKA 1ZVQA 1M8JA 2OBMA 4M1MA 3L4EA 5F5LA 5BO5A 3Q4GA 5K51A 1ZXLA 2H9YA 1B3RA 1QVVA 3MCUA 4LXQA 5HHTA 5B1HA 2O20A 3CC8A 4JKOA 3WSTA 2WQ6A 2FRXA 5JU6A 2VDQB 2EGHA 4DVGA 5IANA 4MVCA 4RSMA 1C3JA 2PO7A 2GHRA 2ZBGA 4KOAA 5F5XA 3RSSA 5FX2A 5IX8A 1LNSA 1E3EA 2JI8A 1WMAA 4CM9D 5HJEA 4XX1A 2QPLA 1H05A 4ND6A 1ZC4A 2ZUCA 4Z4HA 2JB9A 1IBKB 1VPLA 3OQHA 5KPDA 2BR3A 2V4MA 2MMCA 2HDHA 3UTCA 4ICIA 3MQ2A 3FTQA 1CDZA 3UC9A 4DC0A 4R2MA 1DBVO 3S7TA 4MPRA 4NZ9A 4RIIA 1O3YA 1LC3A 2BEWB 2YCBA 4GZ6A 1NP3A 1W30A 5DM0A 4AX8A 4JU8A 1XVTA 4WEQA 5AW7A 2BF4A 5JS7A 1C7FA 4MHSA 4QGSA 2GETA 2NNWB 4L3WA 4H35A 4TXJA 4EUHA 2V7PA 4XA8A 4OOFA 4TOIA 3WYFA 1JKXA 4IJVA 3G5MA 3T95A 2RI0A 3MYRA 3IAS6 1Z25A 2G0NA 3CR3C 3ZHVA 2CSUA 4Q66C 4RPJA 3KWLA 4YXWA 4D4IA 2PBZA 4LDZA 1Y5IA 2VKQA 1Y4DE 3H2YA 2W2LD 3U0BA 3AIIA 1AURA 3TLXA 4I1YA 5D3ZA 4XGKA 1E5DA 1KQOA 2XMZA 1N5DA 4AJ1A 1KYYA 3K8QA 5ALKA 5ALQA 1VJ5A 2ZPAA 1G8YA 3KO8A 4BB6A 4D8VA 4ZCPA 5HS4A 4I4IA 2AEFA 1P1FA 2BFEB 3ZGNA 2P6MA 2CLEB 1YZGA 4QICA 2PH7A 2R1ZA 3EVTA 3KJQA 3N74A 3LX4A 4FB5A 3GEEA 1ZGGA 3R4CA 4QTYA 1JEAA 2VDPB 3NDIA 4OI1A 4CKWA 3OFKA 1E1CA 3CVVA 3F47A 3AVQA 1XCGB 2ZSJA 5BSKA 3UJHA 2OGUA 2BPOA 4QLBA 4X1YB 1W8DA 1A5AB 4QBKA 2Z5VA 3B3AA 3EZ7A 4PR0A 4LRUA 4YRAA 4AB1A 3IESA 1DO0A 1PW7A 1F4VA 2B0CA 1FTGA 1S96A 4M9QA 2YXBA 4A73A 1JEOA 3TQRA 3BK1A 1DTWB 3N2GB 1OQAA 3L7DA 3W5JA 4NMLA 4CCYA 1SUBA 2VP9A 3ZVKA 1JX6A 1T6NA 1I1HA 2QU8A 5A5GA 3L8HA 5IP5A 2EF1A 3K92A 5KVSA 4YK7A 4TM7A 2O1EA 1PYDA 3ZXIA 1J24A 3EUWA 2JLVA 3CPHA 1Z37A 1PR4A 1OV6A 1VKNA 1W59A 2YASA 3WYCA 3OJEA 4IRXA 5TNXA 5J4LA 4Q5IA 2F43A 5E6SB 3DYVA 1CJMA 1S8AA 5KNBD 1MKYA 1USKA 1RWMA 4I1RA 4X45A 1MO2A 3T3EA 2LRHA 2IY7A 1XEXA 2CCGA 3AUTA 4ZVQA 3UJPA 3VVBA 2QRJA 5M29A 1NW8A 2GTIA 3CWZA 4ITRC 5BXYA 1V43A 1REQB 2YIMA 2R6CA 5IVPA 4FPXA 1ZS9A 4BMPB 1R6XA 2H5LA 2B5OA 3PPIA 4IZHA 2DR0A 2G9RA 4P35A 1DELA 3GU3A 5AUNB 1EFAA 3I2YX 1Y9DA 4QRDA 3KPJA 5A3JA 4YGXB 4IH4A 1K0UA 2VWGA 1MQAA 1QJ4A 2WMYA 1YZUA 2ZRHA 3UQYS 3PG5A 4LIPD 4FJ2A 4TT3D 2PQ0A 2WYUA 3M6XA 5HKLA 1W52X 1NQUA 1QP4A 1CJSA 3P0HA 1G6Q1 1BEZA 4IIYA 3VVLA 1KYXA 2NAPA 4WBNB 1GG8A 4S1NA 4J7XA 1C9NA 1VBMA 1TA9A 1G8HA 2Y6VA 2I1LA 3KYDB 3B51X 3EBLA 2QIPA 2ZULA 3ESCA 2QGNA 4HDMA 3CZRA 3TSAA 1N77A 4TRMA 3WGNA 2UYOA 2PVSA 1RC8A 5H80A 5FTLA 1TF2A 5B7PA 4AUEA 4C2BA 2QRQA 1E60A 5K0TA 3H8VA 4B32A 4YJDA 5EWMB 1KYQA 1MRNA 3W4JA 2OMKA 3QKIA 5EQTA 5FHRA 3GJZA 4KQWA 1DNPA 2GAAA 3ND5A 4GSLA 4E1BA 1SHJA 4HD8A 4O4HF 1D1TA 3U81A 5K0FA 3MILA 5EUCA 3LRPA 5LLSA 5F1PA 3OHSX 1RYFA 2C77A 3S1LA 3K9NA 3DGEC 2EIXA 3DUWA 4RD2A 4AFNA 2GXAA 1HTTA 3VR4H 1S2MA 2G9UA 3W4IA 4EF5A 5C1BA 3LCJA 1KAGA 3ANLA 2EQAA 3H1TA 2CVFA 4UEJA 5AK6A 5HKBA 5IDQA 2I03A 4DN6A 3PV0A 2A86A 2JHGA 1WSWA 4EKDA 3IXMA 3Q72A 1OOEA 4B35A 2VJYA 3OZDA 1AHNA 4I8IA 5DBHX 3L7JA 1Z35A 4MMYB 1R4MA 1XNGA 3ROQA 2HJRA 1P61B 4P7KA 1N5RA 5JZVA 4OLAA 3B3QA 1SHTX 3EVZA 3OQ1A 2XV1A 1C1XB 3BQ9A 2UZAA 1LVUA 5FF9A 1E3MA 3AFGA 3L7CA 3H0KA 1HYQA 3E9CA 4FSDA 2JJ1A 3D5EA 2JGDB 2VTEA 2P0YA 2OHVA 3WL3A 2Q3HA 1F2TA 1WUIS 1MNAA 2E85A 4P83A 3ZWDA 3BS4A 3GXBA 3L0OA 2C4TA 5E7JA 1I80A 3LC1O 1AV7A 2SCUA 4HRXA 4CCWA 1JMVA 2LV8A 3ZCRA 4N76A 1L5YA 1SXJB 5EG5A 1ZN8A 2NUAB 3X2FA 5FAXA 1IB6A 5CDTA 3L93A 1WIWA 2IZ0A 1GRQA 4WI1A 4YJ3F 1HMPA 3EA4A 3I04M 4R7GA 3ROXA 1CUVA 1E4EB 1FU7A 5D3KA 4URVR 1XD2B 3TVTA 5AW4A 4GWLA 2J9FB 3W8DA 1P9NA 3OMWA 3N6XA 1FFSA 3GNTA 1TQ8A 1IAQA 3A05A 3FZNA 3NXSA 1D2CA 3HABA 1AF7A 3R09A 4DA4A 4PWYA 2A7XA 5BMVB 1KOGA 1DT3A 3I6BA 3AM1A 2OE2A 2P2DA 5FQNA 3RS3A 2JLYA 1MAAA 3IEKA 3CNOA 3U4IA 4GHWA 2CJWB 2I62A 4MA5A 5BSVA 3HPQA 1OMOA 2WWGA 3DWIA 2Q7DA 3GAAA 1LF5A 2J3IA 2QUBA 2FW7A 2RHJA 5EZ6B 4HO1X 1E2LA 1R10A 4ZD6A 3SSNA 5C5IA 5H9VA 3GJQA 2JS7A 3ITEA 4IKOA 6GPBA 2VT6A 4PX5A 2WM2A 1L4KA 3GJXC 3EC1A 3L6DA 5KI6A 2WMOB 3AHEA 4MS4B 5F4BA 4GQAA 3FGZA 4HCJA 4O4LF 5DPMA 1P0PA 3O8RA 1DRVA 1R0XA 1ZD9A 2MHCA 2P4QA 3L0YA 5FXMA 2VA9A 4KR9A 1PT9A 1TT5A 2XLBA 1DX9A 2GD2A 2YBEA 3TPFA 4DA0A 4C6SA 5BSUA 1RE0A 1OKKA 3TRDA 4DABA 2AYXA 1VL8A 2G7ZA 3CCFA 2QX9A 3QWAA 1DAGA 4FFRA 4QBHA 4QDOA 4IG4A 3ZHBA 1H0KA 1V1MB 2I6GA 4WFIA 2PHZA 2ZUUA 4YP6A 5JI3E 2BSQA 3V1TC 5JFOA 2H0QA 2WWYA 4GFDA 1BN6A 3WBFA 5AFSA 1JHMA 5GIPE 3PVCA 5KX5A 1COZA 2R2AA 3RM3A 3P2MA 1GVHA 1L5NA 3SEFA 1ZM7A 4AJKA 2Y4OA 1ZC3A 5A5FA 1Y3CE 1W6UA 1VLVA 3QPWA 4TXLA 4DDTA 4BGDA 1VIAA 4J03A 1JMYA 2Q5FA 2XWPA 2OYCA 3TNFA 2QENA 1YZFA 3ZCTA 3TQSA 1ODCA 1JAHA 2YTZA 4ILEA 4MVYA 4YONB 5JSZA 3BL8A 1Z18A 4YNBA 2CDBA 3TMYA 1U81A 2BUBA 3ZX4A 2FEWB 4DQXA 1QQ6A 4EYOA 1ZHOA 1L8LA 4CLOA 3JATB 3ND7A 3AKYA 3BL5A 5KPJA 1CERA 3Q8WA 1LH0A 5ALIA 4PF1A 4RF3A 3OQMA 3LQ1A 3GPCA 3RIGA 4ND8B 1O94D 1XVVA 3VU0A 5CJPA 2HLDD 3WGLA 4E5SA 1GG9A 3THYA 2QSZA 3C0KA 2ZW9A 4TWRA 4X7RA 2QZPA 1QYWA 2B8EA 2Q46A 3M4ZA 1E6KA 1H6DA 1H9AA 4YV2A 4YUAA 3KJNA 4YQFA 3K70B 4LTNA 1N5JA 1NFRA 2AI2A 1GL7A 4FQ5A 3LDGA 1L8AA 3EJ6A 5GONA 1ESDA 2PCLA 4NS1A 5EPUA 1SAYA 4N5HX 2OCIA 4KFTA 3NJRA 3I9LA 3IOYA 4K9QA 4Q9DA 4F9EA 4GL4A 5SYMA 1HH4A 1WXDA 3N0XA 1QOZA 3DHNA 3ZCUA 4MUBA 4QU5A 4JYBA 1A0OA 3C3MA 3MJ4A 3TXXA 1BXZA 3HYNA 3IILA 3ZXXA 3VPGA 2TMKA 2I33A 4L5AA 3BULA 4OIFA 3PX3A 2XCSB 1W36C 2FFBA 2DPYA 5K0EA 2FZEA 2CLCX 1FNSA 1ZLYA 3LBAA 5AI6A 2O2YA 1JTEA 2ZDQA 3RHFA 4DLXA 2J32A 2WUDA 2IXFA 4TTAA 4E31A 1GTL1 1G66A 2I6UA 4M7OA 4YJHA 1QS0B 2Q5OA 4EJ0A 1J0EA 1MH1A 1TL7C 1ACJA 5DTEA 3PNPA 3ZVNA 1CR2A 3HC7A 2DEUA 1CS0A 1AJEA 3NBXX 2JFFA 3GGCA 3VU9A 3U1BA 1R16A 2JFYA 1EGVB 3E3LA 1KQNA 4MHTA 3QELB 2VBCA 4FKMA 4ZCQA 3G9ZA 2GYYA 2GM9A 2BL4A 3IKTA 5JBIA 3S27A 1E3LA 4KTTE 4B73A 3C4VA 5D6OA 3OPQA 1DMSA 1YD7A 1FPQA 3ENVA 3PENA 4LJ6A 1AHPA 4NK4A 1FX0B 1SC9A 1JYFA 1ISIA 1WMSA 5LMUB 1B0ZA 1CNFA 1J06A 1WZNA 3O9ZA 4DRYA 2C42A