2ZCVA

Crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
283
structure length
283
Chain Sequence
MIAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALAAQGITVRQADYGDEAALTSALQGVEKLLLISSSEVGQRAPQHRNVINAAKAAGVKFIAYTSLLHADTSPLGLADEHIETEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQNLSEADFAAALKSVGLPDGLADMLADSDVGASKGGLFDDSKTLSKLIGHPTTTLAESVSHLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized oxidoreductase ytfG
publication title Crystal structure of a new type of NADPH-dependent quinone oxidoreductase (QOR2) from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 283
sequence length 283
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zcvA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2zcvA02
3TZKA 1WZIA 1GTMA 2ZJ1A 3KO8A 3KM0A 1HF3A 1O95A 4L8VA 3VHRA 1P1RA 5F5LA 1PS0A 3SC4A 4CL8A 4AJNA 5L4LA 1LLCA 4IJUA 4I8XA 2B4RO 1ZCJA 2RH4A 1YONA 1AUPA 2YQ5A 3PI7A 3E9MA 3QQPA 3WYCA 4JJGA 4TRRA 3QSGA 3OQBA 1B8UA 4XEHA 1E3EA 2SCUA 3U3XA 3PHIA 4TKMA 3AU8A 3SBOA 3IIEA 1E6EA 1EFKA 4EDFA 1S6YA 3TRIA 2ZYAA 2C7GA 2E48A 1I3KA 3GT0A 3VKUA 1PJ4A 1NFQA 3UVEA 4RL6A 4ZQEA 5IF3A 4IGFA 4R69A 3KRTA 6ADHA 3SVTA 3AUUA 2EKPA 1H94A 1HDXA 1ZK3A 3H9EO 4QSMA 5T5QA 3CMCO 3NX4A 2JFGA 4BNTA 4OKNA 5CEFA 1LC0A 3JYQA 1T4DA 3JD4A 1NWHA 3OFSA 3H5NA 1PU2A 3KZVA 4E30A 4O6VA 1FXSA 3LLSA 3RUDA 1ENPA 1GDHA 3GHHA 3PGJA 1ZK0A 2H5LA 4YRAA 4KQWA 3WB9A 3C1AA 4ZICA 4EJ0A 5H83A 4D3DA 2AQIA 3QVSA 3K6JA 4RF3A 3DZKA 5CHEA 3ZWYA 2HAEA 3S8MA 3WQQA 1Z82A 3CEAA 3CSDA 3EW7A 4DXHA 5BSFA 3PYMA 3A06A 2WE7A 3PPIA 4I5FA 1RM4A 3RVDA 4K6FA 1K89A 3EVTA 4YEDA 4M49A 4ZA2A 5DZSA 3B1JA 1GEGA 3WNVA 2C07A 3FN4A 2NADA 4FR5A 5J23A 2J3KA 2UYYA 1EUCA 3I4CA 4QFCA 4XGIA 1HL3A 4NZ9A 4FBGA 3DDNA 4BHTA 4Z0HO 1P74A 4EEXA 2WTBA 3ITDA 3I83A 3V2HA 5TIIA 5DF1A 1UUFA 4OMUA 4YCAA 1RWBA 4D44A 3FRJA 1GU7A 1UP4A 3VH3A 2I76A 4IZIA 5FI3A 3DZFA 4BB5A 3RROA 3UFXA 1ZEMA 5DBGA 4BO7A 1B15A 4PRLA 3TF5A 2NVWA 4E2YA 4PG7A 3P7MA 4WK6A 5JC8A 2WYUA 3JQ7B 5JDIA 2PD6A 3R3SA 2OBNA 3GG9A 1NTOA 2O7QA 3G79A 3ROKA 3C1OA 2YFQA 3DBVO 4D46A 4EUEA 4IMPA 3KUXA 3Q0EA 3AI1A 2C2YA 4E12A 2R6JA 1UAYA 3L9WA 2PZKA 5CFZA 1EEHA 4CUJA 3PFWO 5A9SB 4FD3A 1PWZA 3OJFA 4HFNA 1UXKA 2OHXA 3WFJA 4J91A 3AY3A 5BNIA 5TLSA 1T2FA 5AXCA 4B8WA 3E18A 3I6IA 1NAIA 1F12A 2VOEA 2IYOA 3WJAA 2A35A 3MJVA 2NQ8A 1I10A 3W8FA 1KEWA 2H6EA 3AOGA 3WX0A 3DFUA 3MJCA 3PHHA 1PR3A 1RM5A 4XB1A 2D2IA 1H9BA 1ENYA 4CMJA 1E5QA 3W8DA 4EBFA 3D3EA 2Q2VA 4XB2A 1E3WA 4BNWA 4UUOA 2JCVA 3F47A 4TKLA 1J0XO 1QYXA 3ZHBA 1C0PA 2VOJA 2EGGA 1ADFA 1DJNA 2VWGA 1Y9AA 2P91A 2EW2A 5G0WA 4NJMA 2IYPA 3HG7A 3DOJA 3UCXA 1X7HA 3L4BA 4CM8B 4D42A 5B4VA 2BH9A 3VZQA 4E21A 3I6QA 4FFLA 5L53A 1ADGA 2Y93A 1LUAA 2Z1NA 3H4VA 4UVEA 5ES3A 1ENOA 1F06A 3CUKA 3FD8A 3PHGA 2P4HX 2YHUA 3ZHXA 3E5MA 1HYHA 1YBVA 5T57A 1AXGA 3DBHA 5IZCC 5CPFA 1WNTA 5ILOA 1BWSA 1B26A 3HFGA 2O3SA 4BNIA 1PJSA 1CRWG 1LQTA 2OMEA 3UHAA 2JAPA 1FDWA 4FFMA 1A5ZA 2Q1TA 3T7EA 4L76A 4AG3A 3U4DA 3ROQA 1ISJA 4J16A 3VPGA 1M75A 2NU9A 4RJTA 4IIVA 3GFGA 1JWBB 4CM1A 1KOLA 5IFLA 2JD1A 1WWKA 2CMDA 4DIBA 3UGKA 4OIMA 1IE3A 1VL8A 3S1LA 4WEOA 3DZGA 3C85A 3HFSA 5JNLA 3HDQA 4GVLA 4IJKA 1BVUA 4GSKA 4NG5A 4BO5A 3NKLA 4P8RA 3VH4A 4EUHA 2W2KB 3WGTA 1PJQA 4BVAA 4XR9A 1SO8A 1IHXA 2FPPA 2GD1O 4YJFA 1GV1A 3H5RA 3ENKA 3UKOA 1Z75A 4QQRA 3H2SA 2Y99A 4JP2A 5BSGA 4MPDA 4RV9A 3QVOA 2BGLA 2CVOA 2EP5A 2BFPA 3G17A 5U4QA 2X5JO 4U0KA 1BW9A 1HYGA 2YJZA 2YQ4A 4B7XA 5JAQA 4N5LA 1YQXA 1E0DA 1LRKA 3FSRA 4LMRA 4ONEA 3WWYA 5MDHA 3D5TA 5LC1A 4XD2A 5U1PA 2FSSA 3QJ5A 1B8PA 4NBVA 1LC3A 1R12A 3IMFA 1EK6A 2GR9A 1PTJA 5K0ZA 5IN5A 4PLZA 1E3LA 4OL9A 3BMNB 1DEHA 1J4AA 4B4OA 3CKYA 1ZMTA 1YVEI 2D1YA 4G2NA 3O26A 4JBHA 4IXTA 2AQKA 4XQCA 1XU9A 2X7HA 3DTTA 5LDHA 4KTVE 3OP4A 3FR7A 1KIFA 5KJEA 3M2PA 3T4XA 5I7SA 4LRSB 3LT0A 1LJ8A 1TI7A 2AG8A 3I23A 3F4BA 4RDHA 8LDHA 1BDBA 3HZZA 3HE3A 4YRDA 3W6ZA 2ET6A 4W6ZA 1HETA 4A03A 2HRZA 4CR6A 1XQ6A 3ZZNA 4BIIA 4BO3A 5HM8A 2CVZA 2X9NA 1R37A 1Q7GA 3DMTC 4E32A 3WTCA 3Q2IA 4MDHA 2VCYA 3WDSA 1T25A 4CMGA 5DBIA 3OH8A 3DFZA 1YQDA 2VYNA 4Z9FA 1GCUA 4BB6A 3RUIA 3V1YA 3O8QB 1ULSA 1ZZEA 1WAMA 5KNLA 1VI2A 1QXSA 3JQ9C 2O2YA 5DCUA 3ZWOA 2HQ1A 2WWRA 5ER9A 4FS3A 5TF4A 3U4IA 3WMXA 4CMKA 1EMDA 2EWMA 2EHDA 4FFRA 3ZU3A 5JBIA 1ARZA 1YB4A 1G6KA 3O38A 3ZGYA 3BHIA 1ORRA 5IDYA 3QWHA 4RQUA 3VZRA 5JCXA 4QXMA 6LDHA 3OA2A 4WOJA 1OBFO 1UP6A 3L77A 2JD2A 5DNAA 1BXGB 1QLJA 3G49A 5U9CA 3JSAA 3EZYA 2NV6A 2QRLA 2R00A 1IPEA 4BNHA 5FEUA 5KJFA 3F4LA 1VC2A 1NWCA 4L0QA 1XQ1A 4CV0A 3UW3A 2Q1UA 4H3VA 2DKNA 1QSGA 3NYWA 3FNGA 2AG5A 4W82A 4NU6A 4RZIA 1N92A 1I8TA 1W73A 4KQXA 3PXXA 2FWMX 2A9FA 4XCVA 5A04A 1BGVA 2AQ8A 4I08A 3W6UA 3Q3CA 4A27A 5CG2A 3HDHA 4DLLA 2IEDA 4EJ6A 4DYDA 1LDYA 1QG6A 1QMGA 2RIRA 1PQWA 3NT5A 3RBXA 5FFFA 3DBLB 1TLTA 1ULUA 5AQ1A 4PG4A 1EQUA 2VZ0A 4AJJA 4EZBA 1AHHA 1U5CA 2NLOA 2Y0DA 1W6UA 4E5PA 1XIVA 2E6UX 4LVCA 4J1SA 1B16A 1NXQA 1SOVA 1OAAA 7ADHA 1DPGA 4RVSA 2OOSA 3PWZA 2YUTA 3RWBA 3LLVA 3BXXA 3TZQA 2VUUA 5KJCA 4GKBA 4PZEA 1YL5A 2J3JA 3GR6A 5DCYA 4Z9XA 2RCYA 1TXGA 2FOIA 3IOYA 3OM9A 4XX0A 4UULA 1YOVA 4BQPA 4Z3KA 3BYZA 1ISIA 1U7TA 4RPLA 4YPOA 2P5UA 3GVIA 4KDEA 2GN8A 5G4KA 2VWHA 1LA2A 4BNZA 1PGPA 3ROMA 3I3OA 1N2SA 2ZCVA 4PCVA 1NPYA 5F3RA 4CLRA 1P33A 1Y8RB 2W98A 1HSOA 4PLFA 3JQBA 1JA9A 1A27A 4F6CA 5KVVA 1PJBA 3LT1A 3ST7A 2FR8A 5BSHA 3FTPA 4YJDA 4ZRNA 4OGWA 4DQVA 9LDTA 4WCDA 1P1IA 3KTDA 1I2ZA 2G5CA 3OJEA 4RPJA 3UICA 3TN7A 3WS7A 3HUDA 2G76A 4YDRA 4CM5A 2WJPA 1Z7EA 3EAGA 4N5MA 1L1FA 3NDJA 1LDGA 1KVUA 1PJ3A 4PLWA 3U5TA 1BG6A 4DQUA 2VNSA 1KYQA 3B6ZA 4R01A 1JWAB 2QIOA 1YS4A 4K9DA 5DP1A 2BFAA 4CQLB 4XIYA 1CF2O 1U7HA 1VLLA 1XKQA 3S55A 3AM5A 2B5VA 5G2OA 1HXHA 4ZRMA 4NK5A 1T2EA 4R1TA 3ZWVA 3HNPA 4HX5A 1VRWA 2BFMA 3OECA 2BF7A 1YBMA 3JQAB 4U7WA 4FN4A 4FJ1A 2FR0A 2BI8A 1GQ2A 2IXBA 2WYVA 4ITUA 3L07A 3W4IA 1X14A 1UZNA 3FBTA 1T1SA 4GMFA 3IS3A 2AEJA 4TRJA 1NR7A 1ZKMA 3JQAD 3WSVA 1WDMA 1OI7A 2HKIA 3HB5X 1PQPA 3LDHA 3WOHA 3U09A 3FPLA 2PKQO 2Y66A 3GVPA 4MVJG 1U2GA 3FCOA 2VT2A 4B4VA 5THKA 4CPDA 1Y8QA 3JQ8B 2PZJA 2NVUB 3D3WB 4Y6PA 4BL5A 1B0AA 4C7KA 4PLCA 5JDCA 4OOEA 1FK8A 2NTJA 4E31A 3HN7A 2CFCA 3RCBA 3ANNA 5I8ZA 2YY7A 1GZ3A 2IODA 2JFHA 3D4OA 4CQMB 4IMRA 1GQYA 3MJEA 2P9GA 3WMWA 3FWZA 4KOAA 4FIZA 4YJGB 4YR9A 3BMQB 1N5DA 5C7IO 1SZJG 2E49A 3LU1A 4Q3CA 5JDIC 4NH4A 4R54A 1YL6A 3GNSA 2J5RA 2VTDA 3OQ1A 1QYVA 2HSDA 3PQEA 1G0NA 4J0EA 3FPCA 5JYDA 1E1NA 2ZYGA 4CQMD 1DIHA 3PJGA 2UDPA 3AFNA 4XGKA 4F46A 5AVOA 3I9NA 3JYLA 2OP1A 3GMDA 3EC7A 1DAPA 1Z73A 3ZWWA 1VL0A 3PDUA 2NTVA 3RFVA 2Y67A 2WDZA 2Q45A 1KVTA 3ONEA 4TRNA 1XSEA 3VOSA 3B1KA 2Z95A 3E82A 2PGLA 3IC5A 5HWSA 1WXDA 3CE6A 1CDOA 5AOVA 1YH3A 2YZ7A 4BO2A 4CM9A 2E4AA 2NVBA 4XYLA 1W4ZA 3KHUA 3NTRA 1PZHA 5L7YA 4BNKA 3ZWBA 2PH5A 3JQFC 1KC3A 5EQDA 1SB8A 4BS9A 1DC4A 2GRAA 3PQDA 1ONNA 1NR1A 2HU2A 3DZBA 4BQRA 1TT5A 1NQAO 1NVGA 1GEEA 1EE9A 1GZ4A 1MG5A 2Q46A 3B20A 3DZHA 3H9JA 4PLGA 4F45A 3LC7O 1YJ8A 1EDZA 2VNAA 3IJPA 4N54A 4BGUA 4XJSA 3FNFA 1YRLA 3JD0A 2PZLA 3CPSA 2CY0A 4O1MA 1HDYA 2W2LA 5CDUA 1LRLA 3H9UA 1PEDA 1U3UA 1O0SA 3BMOB 3I9LA 3WBBA 4ESOA 5L7TA 4R5MA 3ZI0A 4DWVA 4MVJP 3AFMA 2PGJA 1O89A 4PVDA 4XYEA 3VVBA 1BHSA 3AM4A 3O4RA 1MX3A 2IDZA 4XYBA 3X2EA 3L4BC 1KERA 2CNBA 3RJ9A 1P1JA 4LMPA 3RSHA 1QYCA 1EBFA 3GGPA 3NV9A 2HK9A 3WLEA 5BSEA 1I24A 1QRRA 3LVFO 1NBOA 1WVGA 4J4TA 4GSLA 1UJMA 2ZB8A 4RZHA 2X58A 1QLHA 3WXBA 3EZLA 2DM6A 5L3ZA 3ZH2A 2IZZA 4YRBA 1GYPA 4DTIA 4R1SA 2P9EA 5EQFA 3UXYA 1ISHA 1XWFA 2D5CA 2PH3A 4WLOA 2XF8A 4M55A 5L95A 1EVYA 3JQGA 4CMAA 3PHJA 2GN6A 1GD1O 3R3JA 4B3IA 4WEQA 2FHSA 1EK5A 1JW9B 1VM6A 4OHUA 3ASUA 3SX2A 4RVFA 4J4BA 1TVEA 2AW5A 4J1TA 1UDAA 1AHIA 3K31A 3PRJA 4ZQBA 4WPGA 2DTXA 5JAZA 4E4YA 5T64A 4UAGA 3TL3A 3AK4A 1HLDA 4J9UE 2VUTA 3TJRA 2DBQA 2DBVO 4Y98A 2PNFA 4HUJA 2O3QA 4RDIA 4D0RA 4PIVA 4JBIA 1DSSG 3E48A 3OSUA 4MKXA 3VVCA 1NFRA 1W0CA 2VUSA 3IAHA 1DXYA 3K96A 4Y6SA 1T2AA 1E1KA 3R6DA 4OH1A 4GX5A 3HDYA 1K6JA 1QP8A 1B8VA 4GGPA 2EXXA 3WYEA 3HDJA 3TOXA 3ZV4A 4CM4A 2DPGA 4YAGA 1DIBA 4H15A 5EL0A 1PS8A 4FGWA 4J49A 1XDWA 3RFXA 2P4QA 4AJKA 1ZMOA 4CLRB 4AJ2A 1Y9EA 3KYCA 2O23A 3TNLA 1X13A 4RVHA 4GLLA 5ER6A 4GLOA 2C7VA 5EN4A 1E7RA 3SJUA 4DPKA 5H82A 1CETA 4G81A 1DIGA 1PQUA 3AUAA 2E37A 4IY1A 2GNAA 3Q6IA 4CMIB 2WD8A 4E3ZA 3KYBA 4YWJA 3RFTA 2R2GA 1IZ0A 2DTDA 4JX8A 1F8GA 3GGGA 4L74A 3IUPA 3RC2A 5MGBA 1LDNA 4DIOA 2NNLD 4YQYA 4Z6KA 3GN2A 5DOZA 3ETEA 4IPTA 4NFYA 5KKAA 1ML3A 5AXAA 4DREA 5BNTA 3AWDA 4A5OA 4RCVA 4CV1A 1P44A 1EE2A 4FB5A 3V2GA 4PZDA 1E1LA 4NBRA 4Q9NA 3DO5A 4YJHB 3UCEA 1DAOA 1FDSA 5F1PA 3NJ4A 1C14A 4JBGA 1PL6A 4RLSA 4A10A 1Y5RA 5DBFA 3BHJA 4XRRA 3S2IA 3ANMA 4PLPA 3TZHA 1C1DA 4LSMA 4DBVO 4DL9A 3GRKA 3UOGA 4ND5A 5C3MA 1HT0A 2DBRA 3KYDB 4M54A 4MP6A 3DB2A 1DLJA 1VKNA 4IBOA 2EF1A 5JE8A 3DAPA 1J49A 1VJ1A 3PIIA 3DL2A 3OIFA 3WR5A 1VPDA 1E5LA 2LDXA 4TVOA 4U0JA 3ZW9A 3UCFA 2PZMA 4S1VA 4QTZA 4PLYA 1RJWA 4JGBA 5L51A 2IEBA 3OEYA 2FP4A 4BKOA 4YVFA 3NUGA 1IL0A 3JYOA 1RYDA 3HWRA 4YT5A 3LC2O 4E5MA 2C59A 2HDHA 3VDRA 3GZNB 1HEUA 5GZ1A 4GL4A 8ADHA 2QG4A 4YT8A 4TROA 2XXJA 3COSA 3VZPA 3M2TA 1EUDA 5GZ6A 4XZ3A 3RKRA 1BRMA 1H6DA 1P1KA 4B4UA 2I66A 2V6BA 1ZSVA 4FGSA 2PD3A 1H5QA 3JYNA 2OXIA 4P22A 5I9NA 4BUCA 1N9GA 1ZK2A 1U9JA 4ND3A 4EJMA 3JTMA 5JCJD 1HRDA 1BXKA 2XPCA 1Y6JA 2VHVA 4J4HA 2OP0A 1ZO8A 1K6IA 5KCZA 1E7WA 3IKTA 5IG2A 2H1SA 4R16A 2VRCA 3GAZA 5KWEA 4DGSA 4FFNA 1ADBA 1FDUA 1H9AA 1YE3A 3NDRA 4UEJA 2ZATA 1GADO 2AMFA 5IDQA 4D3SA 5CAEA 5G0UA 1GUYA 1HSZA 3T7CA 3WGZA 5JYEA 5CEJA 2VRBA 4ZQHA 2CF6A 2CVQA 4L73A 2X0RA 3BTVA 4N5NA 4CM3A 4PFJA 4CUKA 4W7IA 2HCTA 1JTVA 5HRUA 1T4BA 3HJAA 1N7GA 4R51A 2LDBA 1LRJA 4BO4A 4CM9D 5JO0A 1T26A 4NHEA 2GZ3A 4LISA 3NT4A 5IN4A 4WCFB 1DFHA 2RH8A 1R16A 2VYVD 4WNIA 3RASA 3ANLA 1PWXA 4CLHA 4N7RA 1R0KA 1GFSA 4I5GA 3K2BA 1OZAA 2DFVA 3BTSA 4J1NA 5T8KA 2AE1A 1NAHA 1NASA 3A4VA 4M1QA 3ASVA 1CJCA 4QECA 1F8FA 3QWFA 2WD7B 4IDEA 4FCCA 4MIYA 1D3AA 3OJOA 3VZSA 1ZH8A 2W2LD 3MTGA 1PJTA 3LC1O 1PGJA 4P4GA 1IY8A 4AJOA 1NYTA 1SC6A 3ROPA 2Q4BA 3GOHA 1YL7A 1C3VA 3ZV6A 4BMSA 5COQA 2VTEA 5TNXA 4BO6A 5L45A 2EP7A 3EDMA 2OUIA 4S3MA 3RUAA 3BTUA 4W9NC 3RC7A 4GWKA 3ZU2A 3ZWNA 3GN1A 1O8CA 2DUWA 4KUHA 4JIGA 3I52A 3PP8A 4I1IA 4UUMA 4ZQGA 5A5EA 3GEDA 1LSSA 2RAFA 1FDTA 1LNQA 2ZKLA 1VKOA 4WLUA 4BGIA 1W8DA 1V9LA 1K6XA 2A94A 3ADOA 1AN9A 1NX6A 2NU6A 5B4TA 4NPCA 2O3RA 4OYRA 2DTEA 4IZHA 3E5RA 1SB9A 1N1EA 2IE0A 5KVQA 4OXYA 4DLAA 1E3JA 3F3SA 3DBRA 2JJYA 2QRKA 4CODB 2X23A 5TSDA 5BR7A 4IQ8A 1R4MA 4NDNE 1HZZA 1A4UA 4EGFA 2DAPA 1WW8A 4IS2A 4WNCA 4DPLA 3KVOA 3D5QA 2BGKA 1ZUD1 2X0JA 5KVSA 3WIDA 4YBZA 3DONA 3GPIA 1C1XA 3B1FA 5GY7A 3L6EA 4URFA 5THQA 2B37A 1JVBA 5JDCC 1NHWA 3IJRA 4OQZA 1LSUA 2C5AA 4MKZA 1BSVA 3GUCA 1R4NA 5C5IA 2C20A 4CLOA 1R0SA 1H6BA 1P1HA 3BAZA 4BO0A 4J90A 3LT4A 4YAEA 3KLMX 5F5NA 4MJLA 3KYCB 5IJZA 3PEFA 1C0KA 3O9ZA 3UN1A 3GC6A 2CUKA 2YHIA 3D1LA 1I30A 1DB3A 2HK7A 4R9SA 4CM7A 3GA0A 3FBGA 2ZIZA 1X0XA 4QUKA 3OJ0A 4EUFA 4GX1A 3K8ZA 3ON5A 3OQ6A 4TZKA 3GEMA 5JC1A 1QV6A 3VC7A 3NEPX 4CMBA 1JVSA 2DFDA 4L75A 2QZZA 4HFMA 2C0CA 3F1KA 3IP3A 2EIHA 1YGYA 3TFOA 4GQAA 4EITA 5CG1A 3WG9A 5JY6A 1DBVO 4RLHA 1LLQA 1OMOA 1UP7A 1YWGO 3AY6A 4QO7A 4ALMA 4CLEA 3WQRA 1ISMA 4QX6A 4HXYA 5LDGA 2X4GA 4DC0A 3BA1A 1JLLA 4JCOA 3RAJA 4C7JA 5K6AA 4MINA 1DDOA 2ZQZA 4J2HA 2VHWA 2POQX 4MIOA 2Q49A 3PDJA 4FC6A 2YV1A 3WGHA 3ZU4A 4BNXA 4WCFC 4P4LA 3PZBA 4GI2A 4PLTA 1PL8A 3N74A 3PWKA 4I9NA 4QO8A 5JLAA 1P0CA 3QHAA 1I36A 4AFNA 5TS3A 4J43A 4ZJUA 2JKVA 1HE2A 2IZ1A 1HDRA 3F9IA 5G0TA 3TOZA 4CL3A 3MCVA 2GYYA 4IUYA 1Y7TA 1GL3A 1KY5A 4PLVA 4TWRA 1PR9A 1LDMA 1UZMA 4GX2A 4P38A 3DZIA 4U8GA 4FOSA 2O3JA 2NACA 3AW9A 3L6OO 2BFOA 2PK3A 2V6GA 2Y1OA 4INAA 5IZ4A 3TPCA 1H2BA 1I5RA 1E6WA 2GO1A 4R1UA 2DC1A 1L7EA 5COBA 1YKFA 1U28A 3R0IA 5TJHA 1VE9A 1WMBA 2VHYA 2VQ3A 3FR8A 2Y1CA 4KUEA 2X6TA 1KBZA 1ZSNA 3JD2A 1ZBQA 4UREA 4Y67A 3IL2A 2O3UA 2VN8A 4G5HA 4B3JA 1ISGA 3RI3A 4MVJA 3S2GA 4JK3A 4YYZA 2B0JA 5A3VA 2EKQA 1LTHR 4WLEA 4YAKA 4OJNA 5AXDA 1N8KA 4TZTA 3HADA 4A26A 1H6CA 1MGOA 1EVZA 4DRYA 3ULKA 1NQ5A 4OQYA 4AJ1A 1GPDG 1HE3A 2HMSA 3K73O 1DC3A 3CINA 1MFPA 5B1YA 1GZ6A 3PFFA 3F1LA 3ZV5A 1D1SA 4XQ9A 2G1UA 3U0BA 3MWDB 1M2WA 5JPIA 4B79A 4D3FA 1O94A 2AA3A 4JJIA 4XYGA 3MTJA 2VT3A 2ZYDA 3QVWA 4X54A 3Q9UA 4XWYA 1NHGA 4R68A 1NP3A 5L4SA 3GNQA 4RVUA 2GPTA 4RO0A 2FY8A 5EJ2A 3GVCA 4XKJA 5EMHA 3DHNA 3ETGA 5ICMA 2UAGA 1XLTA 1E3WB 4BNGA 3DHYA 1WLYA 4RVGA 4ZQFA 2Z1MA 3TZCA 1SCUA 1I3MA 4CMHA 4E5NA 3OETA 2D5AA 3I5MA 4NJMB 2Q2QA 1VJTA 3QE3A 4NMHA 1Q0HA 3JQCA 2GUGA 4FC7A 4XJTA 1B3RA 2P68A 4EEZA 4BNNA 3NGLA 2FR1A 1CWUA 1V35A 1JKFA 1Q7BA 3DWFA 3E8XA 4RQTA 3VPHA 4Q3EA 5IZCA 3DBHB 3VKVA 2OO5A 1TB4A 3QW2A 2FZWA 4K1LA 2A4KA 5FYDA 1Q2XA 3LQFA 5B4UA 2JD0A 5B12A 1SPXA 2Y0CA 2Q4EA 2C2XA 2WSBA 4RGBA 4DMLA 3INGA 4J7UA 2DVMA 3GAFA 3G1TA 5JXWA 4IDFA 1XHLA 3G3EA 4B8ZA 4NNJA 1C0IA 3FHLA 3WBFA 4A7PA 1Y5MA 4JXKA 2AQHA 2W4QA 1X7DA 2BMAA 4YQZA 1WP4A 3QY9A 4FPXA 4O63O 4BNFA 5L7WA 4JLWA 4OAQA 1TEHA 4XYMA 1R66A 1E7MA 3DTYA 4BNYA 4QFDA 4MKRA 2Y0EA 4IQ0A 4YT2A 5K9ZA 1H0KA 4FJ0A 3HQ4O 1GAEO 5T67A 3UH1A 4BGVA 4NBTA 3RKUA 2QRJA 1DO8A 3EGOA 1MXFA 3U49A 1Z7BA 1R15A 1L7DA 3H2ZA 2B69A 4AVYA 1LLDA 3A1NA 3MOIA 4YJFB 1RM3A 3PK0A 5FI5A 4AJHA 1LQUA 2YDYA 4BKPA 1IB6A 3GVXA 2YV2A 1DFIA 2VZ9A 5FWNA 4CUZA 1J6UA 5F1OA 1YJQA 2NWQA 4RF5A 3WGQA 4Q3NA 1S7CA 5COAA 1BW9B 5C7OO 5TT1A 1AGNA 1JKIA 2X86A 4FW8A 3X2FA 2YDXA 1TT7A 1YBAA 2J3HA 3EYWA 1Y1PA 4WASA 5JFOA 1EVIA 5A06A 4R1NA 1WDLA 3EK2A 3QRWA 1RM0A 3F5SA 4DC1A 2EERA 3QVTA 5BT9A 1SEVA 1F0YA 3CZMA 3DR3A 5I9LA 5JAMA 3OHSX 1U3TA 2GN9A 3JQ7A 1NVTA 1B2LA 1UR5A 3KSZO 1AE1A 2BKAA 1ZVMA 1D1TA 1DFGA 1XR3A 1XELA 1ZJZA 1NPDA 4JQCA 3GLQA 5JO9A 5GZ3A 2V6MA 4BMVA 3AOEA 4ID9A 2Y68A 1LXCA 5EERA 1B3BA 2Q50A 3LF1A 1P0FA 4YT4A 5A9SA 2VWQA 4ND1A 3ZWCA 5I8WA 1LBEA 2Q2WA 5G4LA 5FF9A 4IDGA 5T6BA 1U3WA 3ZNPA 1LLUA 4MO2A 3QWAA 3A28A 2B35A 1GUFA 1C0LA 2YHIB 1XEAA 3FNEA 3GNTA 1FF9A 1YXMA 2WYWA 1CIVA 3GHYA 4MP8A 1ID1A 3VTZA 4HNHA 3P5SA 1UXGA 1YQGA 2J8ZA 2C29D 5A05A 2EJVA 3JD3A 1R0LA 3SEFA 2DLDA 2PLAA 3CTMA 4ND2A 4Q3DA 4D43A 2D0IA 2YFHA 1OFGA 2QQ5A 3ABIA 5TQVA 3K92A 3JQ9A 2OFPA 2V7PA 3OF2A 1ZK4A 2IXAA 1FMCA 2O48X 3DOOA 2GN4A 3N58A 2FN7A 2HUNA 2OZPA 1B7GO 2OBYA 1M66A 2NU8A 3RC9A 2ZTVA 2AEFA 4DYVA 2I5PO 3F46A 4HNGA 2CSUA 4KUGA 1XA0A 4LGVA 2VYND 3OBBA 5B37A 1UH5A 1JDJA 2D4AA 3WGOA 4CM8A 3PQFA 1DIRA 1MG0A 2PY6A 1Z74A 2ZQYA 4PG6A 4D7AA 3U4HA 1GUZA 3ZWAA 3OJLA 3ETDA 4PG8A 1Q0LA 2BRUA 1I32A 3NT2A 4EI2A 1NNUA 2GF2A 5F1KA 4LSWA 1WMAA 4MVJI 3JV7A 1KC1A 1X7GA 4NR0A 3H9QA 4BNUA 2X9VA 1DC6A 1KEPA 1D4FA 2X9GA 4K6CA 3Q9NA 3S2EA 1PGOA 5DOVA 4HY3A 4CV3A 1E7QA 1I01A 3Q2KA 1U2DA 4RPKA 3ZU5A 3AJRA 3TZ6A 2HMWA 3IQDB 2OORA 4DMMA 4E0BA 1G1AA 1LSJA 3GH3A 3ORFA 1DOHA 4NU5A 4LN1A 1X1TA 2I3AA 1XYGA 1BVRA 3RBVA 3C24A 1IOLA 2W2KA 2CDAA 2B4TO 3EMKA 3U4CA 2A92A 3ITKA 3ICCA 3V2UA 3ZHYA 3I9KA 3TWOA 4IS3A 1LDBA 3IP1A 4UUNA 1LU9A 1A7AA 5ITWA 1MXHA 2PFGA 3PIDA 3JCZA 4GMGA 5LCXA 1MC5A 1YOVB 2W90A 2PTGA 3GQVA 4I9UA 2VHXA 4FFPA 1VJ0A 1KEVA 1PL7A 1E7YA 2B4QA 5JMPA 1QV7A 2YYYA 4U6QA 3VH2A 4M87A 3NTOA 5G4KB 1SMKA 3VPFA 2WEKA 5C7LO 4CMEA 3I9JA 4OXNA 1IPFA 4KMSA 1SNYA 3QP9A 5ILGA 3SLKA 3BMNA 1LI4A 3D0OA 4MIEA 4HADA 4XDYA 4MVJM 4IJWA 4OO3A 2GZ1A 4Q3BA 3SXPA 1Q0QA 1FDVA 4F6LA 2PKRA 1E1MA 1IUKA 3QV1A 1BMDA 4LK3A 3WNQA 2JHFA 4ALJA 1A7KA 1I3LA 4WUVA 3OA0A 1A71A 3ICPA 4QEDA 3D7LA 3HB4X 4AJPA 2BLLA 3W4JA 1BXZA 1P9LA 4MOWA 1M6HA 3ONDA 1DIAA 5CDYA 3WWZA 2IRWA 5EINA 2CD9A 3FTNA 1X0VA 4EYEA 1GV0A 3BTOA 1H6AA 2X0NA 4BKUA 1H93A 3STHA 4L4SA 5I9MA 4CLXA 4WLNA 2RHCA 3GGOA 4BO1A 3HHPA 3DEYX 3PZRA 3FI9A 1O6ZA 3WFIA 5DDIP 9LDBA 5IDXA 4GPD1 3DQPA 3VAZA 3N7UA 2AE2A 4D0SA 1QYWA 1GR0A 4PG5A 1NQTA 3O8QA 1I2BA 1ZW1A 3H5AA 3LT2A 3RUEA 4DPMA 1JAXA 3MJSA 3MWEB 1X15A 4E6PA 1OC4A 1DRWA 2Y1EA 3LYLA 4ZHSA 2ZB3A 1DRUA 2ZK7A 4XDZA 1XGKA 3QWBA 3PHLA 5CDGA 1V8BA 3QIVA 5KJ6A 1GYQA 4I9HA 1O9BA 5K6AC 2I65A 2I9PA 5IXSA 1E77A 2O2SA 4RORA 3ZV3A 1BXGA 4N18A 2WE8A 3ADPA 1Y8QB 3RIHA 2R00C 4PRKA 4J3FA 1P1FA 4WKGA 5CPBA 3Q11A 2C5EA 3D4PA 5CEEA 3NTQA 1XG5A 4TSKA 1LSOA 4JN6B 4YB8A 3C8MA 4WLVA 3I4FA 4D41A 2Q3EA 3FWNA 1YB1A 3KBOA 3C7AA 1PGQA 3LZ6A 3KLPX 5JW6A 5KIAA 3DBLA 1CQJA 1SOWA 2CF5A 3C1TA 1PGNA 4I5EA 3GDOA 5F21A 1KETA 2QZ9A 7MDHA 1GCOA 1HE5A 1JN0A 3G1UA 4ZU3A 1SEPA 2XOXA 3GDGA 3AI2A 1U8XX 4ILKA 4XRGA 2OGUA 5HA5A 2J5KA 4UEKA 3RBZA 4TVBA 3NRCA 4CLDA 2X0IA 1EQ2A 2C54A 1VSVA 2E82A 3D64A 3AUTA 3JQFA 5TX7A 2HMTA 1UXJA 1B14A 1UZLA 2YV3A 2BI7A 4XQGA 3ZN2A 2TMDA 2Y1FA 5G0SA 2P2SA 1OOEA 4GGOA 1XCBA 4J9VA 4NIMA 5CP8A 3DXFA 1TT5B 2W8ZA 5KKCA 4CM6A 1EBUA 2RBEA 2ZTMA 4H7PA 1MLDA 4TQGA 3W4KA 3MZ0A 2PV7A 4YTEA 4BV8A 1IULA 1ZXLA 3EY4A 4Q39A 4DBZA 2AEMA 2HJSA 1Y8RA 2ZJ0A 3JQBC 1KVRA 3DMYA 1DC5A 1ZIDA 4FDAA 3U62A 1P77A 1QYDA 2WMDA 3IDSA 5KJ1A 3L9XA 2EV9A 1IYZA 2EJWA 3WGIA 4AJEA 3ZWXA 3JQEA 3UUWA 4DVJA 2UV8A 2FPIA 4ROSA 4B7UA 1OC2A 2HO5A 2EW8A 4JROA 4J2OA 1U1IA 3JD1A 3INTA 4RVDA 1HYEA 3BIOA 1V3TA 5KOIA 3E03A 1HDGO 3UF0A 5HS6A 4BGEA 3GUYA 3VH1A 4U5QA 3WQSB 1HDCA 4ZVVA 1MC4A 4GKVA 1WPQA 3WGGA 2PA3A 3TFQA 5I7VA 1MUUA 4J1QA 5TC4A 4Z9YA 3MJ4A 1ZSYA 4CQLA 4D45A 1SAYA 3JQGB 5JMWA 1JKJA 4CV2A 3MEQA 3ZHZA 4IM7A 1ZXBA 2Q1SA 3ZNQA 3VDQA 5DN9A 3K9QO 3EVNA 4YA6A 4IDBA 2RHRA 4FQ8A 3JQAA 4NBWA 3KEOA 1KVQA 3JQDA 2GZ2A 3E9QA 3DZJA 2BGMA 3UAGA 1ONPA 4Y6RA 5IAAA 1QKIA 3QWIA 3AUSA 4Y8VA 4BV9A 4I5DA 4K26A 1D8AA 1DJQA 5BQFA 4LCJA 2CDCA 5ITVA 4AJIA 1HZJA 1E3IA 1PJ2A 4HBGA 1F14A 2QYTA 4NJOA 1KS9A 2EG9A 5CDSA 3FNHA 3JQ8A 3P2YA 2NVUA 3M6IA 4CR8A 3D3WA 1E6UA 4J0FA 1CYDA 5AXBA 4CM4B 5CDTA 4CQMA 5BNFA 3OICA 2J6IA 4YJGA 3BMQA 1HDZA 4FSHA 4W99A 3CIFA 4AJLA 1V3UA 5TT0A 4KDFA 3AI3A 4JJFA 4HP8A 2GCGA 2PD4A 4G65A 4IGEA 3BMCA 2X5KO 1QR6A 4PN3A 2QW8A 4KP7A 1RKXA 2DQ4A 3F5QA 2J5QA 1YDWA 4LW8A 5DCWA 3S2FA 3AOEC 2FMUA 3L4SO 4J7CA 4WGGA 3B70A 3TL2A 4MVJH 3QLJA 2TMGA 5EPOA 4AJ4A 4A2CA 3H7AA 4RPHA 2AHRA 3O03A 3E1KA 2QHXA 1WDKA 4KZPA 4ZN6A 3I9OA 3TQHA 3M1AA 3CMMA 2DPHA 1MA0A 3WLFA 1HE4A 5AYVA 4IDAA 2O50A 4BO9A 3L6DA 1JAYA 1K3TA 1MV8A 1NQOA 4NK4A 3QA9A 4LVUA 2P5YA 5EESA 2PGDA 3HN2A 5A03A 3WJ7A 4II2A 3A9WA 4XIJA 3VTFA 4XR4A 5ADHA 1EUZA 4R41A 1C1DB 4ALLA 1LX6A 3GZ4A 3KXDA 2I99A 3RUFA 4IXWA 3BZUA 1CERA 3PTZA 3DHEA 2FZEA 3PLNA 3BMOA 3WYBA 3W1VA 2NU7A 2B5WA 1M76A 1YO6A 4IDCA 4R3NA 1ENZA 5A1TA 1NFFA 4WECA 3V1TC 4OSPA 3KSDO 4ZD6A 2D3TA 5EIOA 5JSFA 3VPSA 5A5FA 4R4JA 3IKVA 3KETA 4LRTB 5GMOA 3EUWA 4HWKA 4ND4A 2O7SA 5A9RA 3ZNOA 4NI5A 1VSUA 4GH5A 2XXBA 2DUUA 3LF2A 3RD5A 3CXRA 1X1EA 1ZFNA 3OIGA 1U5AA 3DOCA 3H3FA 1MP0A 4O0LA 2ZB7A 2VZ8A 4UEOA 4ALKA 4GBJA 3ZW8A 1P3DA 3E9NA 2IZ0A 3EHEA 1Y81A 4M8SA 3H3JA 5TGDA 2GASA 4YACA 2D59A 3ZNNA 2V65A 3A14A 3IUSA 4A0SA 2ILTA 2AXQA 4FOOA 2QX7A 3TSCA 1N9GB 3INRA 1Q7CA 2H63A 3JQ6A 3PJDA 4BNLA 1PZFA 2V6FA 3F6YA 5KVCA 4WOKA 4WE3A 1DLIA 4J7XA 1Q1NA 4HKTA 1ISFA 1M6WA 3ZCXA 1KY4A 1E3SA 2PKQP 2X1HA 2HMVA 4BKRA 4F3YA 4Z0TA 1Z6ZA 4ALIA 5L40A 1U8FO 2OL4A 2HLPA 3C3XA 3WTBA 2P9CA 4J6FA 4UVDA 4IJVA 4AL4A 2JHGA 1PSDA 1T2CA 4GX0A 5HTOA 5TJ9A 1HLPA 1PS9A 2BD0A 1E92A 2JFFA 4U6SA 2D8AA 2I3GA 2WM3A 4E13A 3K2EA 3PYXA 1PIWA 1A9ZA 5ENVA 1PZEA 2B36A 2VRCD 4BKQA 5L4NA 2EKLA 3PLRA 4YAJA 3GPDG 2NM0A 5DULA 5JAIA 4TRMA 5JS6A 1R6DA 1YB5A 3GVHA 3WICA 3GG2A 1H2HA 3L0DA 1PJCA 2BHLA 5G0VA 3NGXA 4MVJE 4B3HA 3KOUA 4EW6A 4R9RA 4CMEC 2Y1GA 1F17A 1V6AA 2NSDA 4K28A 4Z0PA 2C82A 2GERA 1IZ9A 1P31A 1RYEA 3OMLA 1CQIA 3V1UA 1GYRA 1HTBA 2Q1WA 4DA9A 2HJRA 2XAAA 4TMFA 1A4IA 4NFSA 4Y9DA 3GEGA 1ZJYA 1D7OA 3NDIA 4KTTE 1I3NA 3Q1LA 4CMIA 4H16A 3V5NA 1MB4A 2B83A 4XQEA 2EEZA 5KTKA 2HMUA 3PJEA 2VWPA 1A9YA 2CZCA 3E6AA 1O5IA 1G0OA 5C37A 2FRDA 2ZTLA 4W9NA 5HBRA 2UUPA 1UXIA 4O59O 4UVGA 2QYSA 2ZCUA 2GSDA 4CMCA 3P19A 1A72A 4B4WA 2O3TA 3ZWPA 4YJHA 4A73A 3ZDFA 4ALNA 3VPXA 1J5PA 2NUAA 3K30A 2F00A 3DAFA 3H6KA 3DAGA 4DQXA 3GY0A 3K5PA 3SJ7A 4B7CA 2ZB4A 2JCXA 4BNJA 4DIFA 3FF4A 1M67A 4E33A 3AY7A 2Y1DA 3PVZA 3ENNA 2I67A 1DHTA 3KYDA 4IQGA 3RUCA 1V3VA 1KEUA 2PWZA 3TDKA 3DBRB 2Q99A 5TRTA 1GY8A 1UDBA 3KB6A 1YDEA 3GDFA 4E5YA 2O4UX 3H8VA 3CH6A 1R4MB 5JY1A 1U4OA 4M89A 1T2DA 1T1RA 3GMSA 4KWHA 3RJ5A 3SLGA 4R3WA 3H65A 5DP2A 3G0OA 3QVXA 2GLXA 2NQTA 3WSWA 4CJXA 3KV3O 4OM8A 1C1XB 4UVHA 4BO8A 4D79A 5L9AA 1I33A 4GAEA 3RU9A 5A02A 4Z3DA 1BTOA 1EZ4A 3AU9A 4BNMA 1UDCA 3GZNA 4NQZA 4WJZA 5JCJA 1CEQA 2NTNA 2EGHA 1R4NB 4L9RA 4CLOB 2JL1A 1U3VA 2PR2A 1GQQA 3NJ8A 4HFRA 4IINA 3ZWMA 4YAIA 3GFBA 4M86A 1UAGA 3PWSA 1HKUA 2Z5LA 4QT0A 1JQBA 3C7DB 4PZCA 1I0ZA 3CZRA 5ENDA 4WLFA 3RQSA 1PJLA 1E7SA 4E2WA 3SC6A 4UUPA 2X22A 3BMCB 3H9GA 3DMTA 3I1JA 3RC1A 2J3IA 1DHRA 1SBYA 5DT9A 1ZEJA 2UVDA 4HV4A 1NVMB 4ZGWA 3C7CB 4W7HA 3D4NA 1PX0A 2HRBA 4GVXA 5A9TA 1KVSA 2JAHA 1N1GA 4IIUA 4XA8A 2HK8A 3LK7A 1EFLA 1HDOA 2CDBA 4RPGA 2DU8A 4OXKA 3M1LA 1AXEA 1Z45A 1ZK1A 3DC2A 3U9LA 3PGXA 4P4NA 2GGSA 4PVCA 4JNKA 3T4EA 1FJHA 4PLHA 5A4DA 1EVJA 2VYVA 3GRPA 1MFZA 5IDWA 1HWYA 1K2WA 3ONFA 2DT5A 1U4SA 3HSKA 3AM3A 1UXHA 2GDZA 3KSUA 1NPTO 1XU7A 3OEWA 3KEQA 1GPJA 2DBZA 2FSVA 4II3A 4LCEA 4BMNA 2JCYA 4IDDA 4UVIA 4WCFA 1V0JA 1JU9A 3MJTA 1QORA 5ICSA 3JYPA 4NBUA 3RU7A 4CR7A 1I2CA 2X8LA 1LDEA 4HFJA 4L4RA 4BOYA 1BDMA 1ZNQO 4L4XA 3PYLA 2X5OA 5I7EA 3LSYA 4RF2A 5T8KC 1P45A 4RF4A 2G17A 2WD7A 4R5HA 4W4TA 4E5KA 1K5HA 3GF4A 3WIEA 4MVJF 5A3JA 4E2XA 1TA4A 1WZEA 1PZGA 2ZTUA 4FJ2A 4JP3A 4OKIA 4DUPA 3MOGA 4Q3AA 4NFHA 3PJFA 2G82A 1N7HA 3R1IA 2H9IA 4E2ZA 1IHYA 2G0TA 4BNVA 3NAQA 1RPNA 1VL6A 4OOFA 4PGFA 1T24A 1NM5A 2Y05A 1K0UA 5H81A 4C4OA 4DLBA 1ONOA 2F1KA 5IXYA 2I6TA 4KWIA 4XGNA 3I9MA 2BELA 4GWGA 3P2OA 3W8EA 1LEHA 2VHZA 2YW9A 4AICA 3OIDA 4MP3A 4O5OA 2FPGA 3V8BA 5HS4A 1DRVA 1ADCA 5I7FA 4YXFA 3WGYA 3BHMA 4FFOA 4MVJD 4OSOA 2O4CA 2UUOA 3GK3A 1EDOA 3RUHA
chains in the Genus database with same CATH superfamily
4DIEA 4TTTS 3AG5A 2AZ4A 3TZKA 1LBTA 3Q6MA 2ZJ1A 3SFTA 1O95A 4P84A 8ABPA 4L8VA 4BIMA 5BNZA 2JW5A 5JSHA 5F5LA 3IBCA 1D0IA 5K20A 1M0EA 5FA8A 3BJMA 4CL8A 1Z2DA 3DUFA 2RI0A 3GD7A 3DJFA 4I8XA 1L5YA 3QMVA 1BX3A 5DW3A 1AUPA 3PI7A 3QQPA 2P78A 1EFCA 2VEDA 3QSGA 4Y7CA 2H06A 2JA1A 2RGRA 4ZPXA 3RTGA 1E3EA 3U3XA 3RTAA 1A77A 2XCTB 5CVDA 1E6EA 2W5UA 3RLFA 5HUJA 1QPGA 5ECGC 5FLKA 4OBWA 5LDDC 2E48A 2N9UA 1Z37A 1PJ4A 2HSJA 3D6MA 3KJXA 2ID7A 2ZS9A 3BKXA 1G291 2ONZA 1A8HA 4KFUA 4RL6A 5CX4A 4HWOA 5B57C 1CG6A 1KL7A 3PFKA 1CUCA 3AUUA 1H3FA 4QFBA 4PGGA 2EKPA 4JU8A 1HDXA 5T5QA 3NX4A 4YP5A 2XQGA 1JEDA 4BNTA 1KDRA 3OMXA 3PNSA 1T1EA 3U3KA 1IG3A 4MV9A 2AH5A 1VJRA 1BN7A 3MHPA 4LQCA 4X8OA 1T5SA 3H5NA 3QVGB 4FYYA 1CC1S 3KC2A 3KZVA 3J80A 2Q07A 3B1WA 4O6VA 5DTJA 4B2PA 3RK0A 1Z06A 1ORHA 3MHTA 1VSQA 1EH5A 2PUWA 3DCJA 2H5LA 4YRAA 1UFKA 3M4NA 3LPLA 4JBNA 2DWQA 1XN1A 2INGX 1JPNA 1V39A 2GAIA 3QVSA 3RRYA 5IM4A 1NRXA 1G3MA 3O4IA 4RF3A 4HTAA 5CHEA 5FOUA 5C4GB 3S8MA 3B53X 3WFZA 2ZRQA 4IDXA 5GJCA 3CSDA 2TS1A 3R5XA 1ZUWA 4RANA 4DXHA 5BSFA 1NG9A 5AHWA 3LQQA 3FROA 2WE7A 3RVDA 4P0QB 4PGHA 4XVQA 1N2HA 5EJAA 3O1IC 1JR3A 2IXGA 3GUHA 1YRWA 4GXRA 4MR8A 3JVUA 4EK9A 5DWVA 2QP3A 2MSLA 2V7UA 4LOHA 4K9KA 4L4YA 1FTNA 2VBIA 3BDIA 4H7EA 5LLSA 1G8YA 2WD9A 4Q12A 1LFAA 3I0ZA 4MRMA 4Q6BA 4AURA 4ETIA 1RYNA 4FBGA 1T0HB 1JX6A 1G8FA 1JFFA 4KQFA 1J8YF 5CCDA 3UENA 4YRMA 4CIBA 3AIKA 4Z0HO 5GVRA 2IUSA 2RHWA 1NF9A 2ID9A 3GA7A 3ITDA 4V02A 3WMEA 4EHFA 6AT1A 4ABTA 5K4HA 3I83A 3W3ZB 1JQ5A 4KFRA 5TIIA 3G02A 1FEZA 1UUFA 4FHFA 2P67A 1GPKA 2AF4C 4DR7B 2PX5A 3W8NA 4GWLA 2NQ2C 5SZJA 2LCFA 1MX5A 1XDZA 1D2EA 3HYTA 4IZIA 5FI3A 2IEAA 3DT9A 3LPDA 4UM8B 1KS2A 3A3OA 5DBGA 3EDYA 3RROA 4BQNA 4EMSA 1IN4A 4OUDA 4E2YA 3ZXSA 1W8IA 3X1KA 1MVOA 1KP3A 3UPUA 2A9KA 2JBWA 4TVSA 5C8YB 1QU3A 2WC1A 4G0OA 4LHWA 5BRJA 2NO7A 3P7MA 4G8JA 1K5DA 2QT9A 3VKGA 5BV7A 2Y1LA 5FBRB 2AUTA 3B8HA 2JANA 2Y1KA 3R3SA 5HJ7A 3W5IA 1K4MA 5ETJA 3C1OA 2BLNA 2FXIA 3PNQA 1JHXA 3H5LA 3DBVO 4US1R 1W9MA 2XKBA 3AR6A 1E2DA 3DD5A 3G2HA 3NETA 3Q0EA 4IMPA 4EUEA 4RTOA 1BDHA 2SKDA 4QUIA 3DNFA 2QTVB 4X7BA 2C2YA 1JIIA 1QO9A 4HGPA 5B3AA 2OGTA 4KPGA 2R6JA 1FTYA 2GN1A 3GAMA 3MCWA 1Y1RA 2PZKA 4WI1A 4FMPA 1Q7EA 2CKDA 2OWDA 4LC1A 4IDOA 5A9SB 4FD3A 5AJZA 5D2CA 4JJ7A 3R7WA 4F60A 2D5IA 5BNIA 1SOUA 2J4CA 3AY3A 5TLSA 3X44A 1M2FA 5DGCA 3A04A 2VK2A 2PWYA 3QLUC 5CU7A 3PITA 4B8WA 4Y3UA 1GRRA 1M8FA 3E18A 5FI0B 5CNMA 2HWXA 1RQ2A 5J2TB 5GIPE 2IZ6A 4V2IA 4WKOA 1YE8A 2A35A 4KR0A 4BE4A 4V38A 1IJEA 1I10A 3P32A 1N8SA 4U9IS 2J3LA 3GRCA 4B3DA 4DLZA 2QTBA 3HCRA 3TKAA 2A1TR 3LUGA 3LK6A 2GPNA 1KEWA 1EJ2A 2FPLA 4UATA 2V9PA 4HRXA 2A5FA 1VHJA 1XZPA 1RM5A 4QKQA 4GEGA 2P9YA 1M1UA 3DTVB 4HT3B 2C58A 3BRWA 4JP5A 1XTUA 1L2TA 1E5QA 2V7WA 2BGGA 3LY7A 1PT7A 3GFTA 2Q2VA 1Z17A 5T3UA 2YXEA 4UUOA 1FRZA 2JCVA 1ULBA 3F47A 1QYXA 4DRXA 2EYQA 5IP5A 4ETNA 5BVGA 1ZA1A 1JPUA 2V6JA 1ADFA 3L0PA 1DJNA 2CXTA 3H0CA 1RE1A 4ZREA 3VU0A 2VXOA 3EGXB 2CD7A 3PS9A 3DOJA 3A1SA 1X7HA 1QHSA 3K09A 1AQIA 3GEHA 5B4VA 3IT0A 3L1IA 3VZQA 3HP7A 4X6XA 3I6QA 3CLUC 3HO8A 3CRZA 4FFLA 2Y93A 3SR3A 3UAYA 3H4VA 3UJHA 5HOEA 2PLWA 4XSHA 2J3DA 1F06A 4TKVB 4WAUA 1REQB 1JHVA 4YXWD 2P4HX 1Z2AA 2YHUA 3ZHXA 1NN0A 1S2MA 4P3PA 1CEYA 3HU5A 1YBVA 3TW8A 3KDPA 3EGCA 1QGZA 3QE2A 4BEJA 5CPFA 4H1TA 1WNTA 1XZJA 5ILOA 2M6SA 2P9HA 1AG9A 3I2IA 3OM0A 4R05A 3USES 2KB0A 1VPWA 2YN2A 1XALA 4IVNA 3IT2A 3IDQA 1A5ZA 1QGAA 3EXHA 4AG3A 1QVVA 3FSJX 4L76A 4LJSA 3ROQA 5I7WA 3D6AA 3FOBA 1IEXA 2WB2A 1Z36A 3N59A 3PCRB 1EU1A 1YOBA 4RJTA 5CITA 1KOLA 2OHJA 3SDSA 1WWKA 1W581 4UTXA 2ZI6A 4Q82A 3BF8A 1JE1A 2XNKA 1UBOS 2DR3A 3AHCA 1WV0A 4LWPA 1IE3A 1VL8A 1FX0A 1TZMA 3NHAA 4XUEA 5FLYA 2DULA 1G7SA 4PONA 5GJWC 5ECWA 4GVLA 1H0RA 4IJKA 5EYPA 4FD2A 1PTKA 2XT6A 4GF5A 3W8FA 3UT5A 1CD5A 4UM9B 3EOZA 4QXPA 4AXBA 4OU4A 3T4UA 5CA0F 4WDQA 4I55A 2W6OA 1RDFA 4X7RA 3ICQB 1SO8A 4AIRA 3OZBA 2FPPA 3QEMA 4YJFA 1H2XA 1GV1A 4RH1A 3FAKA 3H2SA 2XLBA 1IMOA 4MPDA 1EP3B 3I04A 4BTLA 2RGNC 3M4ZA 2ZREA 1JFTA 2EP5A 3CJQA 3G17A 2NV2B 3AP2A 3LUFA 1BE1A 4U0KA 5DHRA 1HYGA 5DTQA 4MS1A 1G7TA 1KAQA 4B7XA 2I91A 2DJIA 1M8GA 4ACBA 3L0SA 4LMRA 3NR2A 4PPQA 4IHJF 3VJLA 4DSNA 3TTXA 3OZIA 1X74A 1U7WA 3DLTA 2IDJA 1IBLB 1N2XA 1R12A 1JJFA 1LI5A 1LD3A 1WB5A 1F4PA 1GVNB 4BWVA 1FOEB 3E1GA 1ONBA 2FWJA 3U26A 3FMGA 1J4AA 4Z7NB 1GILA 621PA 2Q3LA 4FNGA 4GQBA 3KTAB 1P18A 1GL9B 1SHUX 3CLVA 4FXPA 4M8IA 1BXRB 4YK7A 3KQLA 3FUVA 2RIPA 1BCRB 3DKPA 3H87A 3O26A 4IHJB 4IXTA 1N1DA 4JBHA 5HHTA 2HRCA 5J3JA 2CLLB 5IHXA 4HEA6 2PSEA 4KTVE 3OP4A 4KX3A 2BUBA 5FA6A 4URVR 4IDHA 2MDTA 3EIOA 3FYHA 3LT0A 1J00A 3I23A 2AG8A 3SDBA 3F4BA 1Z6GA 3DEAA 4I81A 4RDHA 4HDRB 1RZUA 3E7XA 4A15A 1G98A 1J8MF 3WYDA 3W6ZA 2GN0A 1OX4B 4JA0A 4DMKA 5BWBA 3EARA 1R0CA 3GEPA 1HETA 4TWIA 3G68A 1NYLA 1XQ6A 2F1RA 5HZHA 4OKSA 1W4BA 1D2NA 1ECBA 2CVZA 3N2NA 1I0LA 2X9NA 3Q98A 4RC9A 1JTEA 4UBIA 4V0QA 3L6BA 4BEBA 1H0SA 1SQ0A 1U3GA 1YZFA 4ROTA 3L46A 4J0HA 3RC3A 4GPIB 3VV2A 3WTCA 5INTA 1QRSA 3KUKA 4M7RA 1QGUB 5E3JA 4LF4B 3K4QA 3HYLA 1K75A 1RJFA 4Q1FA 1KYZA 1W36D 1FMTA 3DFZA 2ZSBA 1YB6A 3BCSA 1GCUA 1DQNA 1KU0A 1UJ5A 1K4KA 2FQWA 5I01A 3O8QB 2W2PA 4NX2A 4CKEB 2M32A 1VI2A 3DYBA 3JQ9C 5DHPA 3T6KA 5HYVA 3OZSA 3RTBA 2HQ1A 4B6FA 3EB9A 3P9NA 3I2GA 4KQHA 3ONVA 3FTDA 2LKDA 3U4IA 3NRBA 4GP7A 5ESRA 2GK6A 4CMKA 1WB4A 1G20E 5FULA 3N2EA 2R6AA 2BMVA 4P7GA 2J0SA 1IN5A 1ARZA 1YB4A 4AY3A 4Y0VA 2QSYA 1G6KA 3CNHA 5AW1A 1DU4A 2CNWD 1PKXA 3TTSA 3AJ9A 3I32A 3FCEA 3E61A 1O77A 3DVAA 1ORRA 2AG0A 3QWHA 4RL4A 4RX1A 1O5OA 2W6PA 3VZRA 6LDHA 1V95A 5JCXA 3QTLA 1M6VB 1GL6A 2J6HA 4UBKA 3DFFA 3PFHA 1SWVA 4LVNA 1A9SA 2AD1A 1PZXA 3G8BA 2NV6A 2QRLA 3FPJA 5ALLA 2F17A 2R00A 3KB8A 3KS9A 4B32A 1NWCA 2VA8A 2FPOA 3UW3A 3K9CA 1KYVA 1J5XA 3OCJA 1RVDA 1OYVA 2V74B 2DKNA 3WBKA 4CYMA 4Q15A 1VHDA 2PO7A 3O3NB 3DV0B 1PG2A 3S68A 2OUKA 4HNAB 2OB2A 3GJ4A 1FFHA 2J7PD 4OI2A 2Q0HA 1T4GA 2FWMX 3PXXA 3TD2A 2ONCA 1F9AA 1F2TB 1K6MA 2H0QA 2OO7A 4IZ6A 4FZJA 3B1VA 3S99A 2PMWB 1FFBA 4ND8B 3W6UA 3I53A 5GVSA 5EZYF 4N48A 5CG2A 3HDHA 4F8YA 2QORA 4EJ6A 2GJ4A 4DYDA 1LDYA 1QG6A 3ESYA 3O47A 3WYGA 1U2DC 3NT5A 2FDRA 3U48A 1TMGE 4KRFA 4K9QA 1X1RA 2VDVE 2GKSA 3OPYB 5AQ1A 2A9JA 1CQJB 2FUKA 1R0ZA 3D3KA 3M5PA 2R25B 3KOZA 1EWTA 2HHLA 2VAXA 1AHHA 2PMCA 2WJIA 1QTIA 1MD9A 2PX6A 4BKMA 3CPJB 3V34A 2WM9B 3VC3A 1E6CA 4LVCA 2PL5A 1B16A 3AC0A 3L6CA 7ADHA 3F8SA 2C5GA 5EZYB 4RVSA 1YDMA 3ZBUA 2OOSA 4Y7DA 4V39A 1XTJA 5H5JA 4L3OA 2OAP1 1ZC3A 2P4UA 4OATA 5G1PA 2EW1A 2QD5A 3RWBA 3BXXA 5CM8B 5HSGA 1YL5A 1VIMA 3HJNA 1Z6XA 2J3JA 4FINA 4XCXA 3TIFA 2QUBA 2NVOA 4IHKA 5K01A 1D04A 3IBGA 2RCYA 4PZLA 1TXGA 3CX8A 3OF3A 4QU8A 2FOIA 1JG2A 3I72A 3IOYA 5IJ0B 3NI2A 4EG7A 4UULA 1P3Y1 2Q5IA 4DNQA 3E53A 3TR0A 4QQKA 4BQPA 4YUWA 4EATA 1AIPA 1VSTA 5KB3A 4OQQA 1SU7A 2CVHA 1LTKA 3AI7A 2R47A 5G4KA 3T99A 4ZJYA 1P5FA 3IR6A 3K8OE 4LZLA 4YY3B 3D4IA 1LA2A 2D62A 1P81A 3QYPA 2BFDA 4OXIA 3TLGA 3T1QA 4LHEA 4BNZA 4C06A 2QV0A 2JLXA 4RXMA 1NC3A 3LA8A 2W8BA 3IMCA 5REQB 4H7JA 2GCPA 6PFKA 1TZ2A 4DUYB 1HOXA 1HSOA 3HCOA 3JQBA 2IHTA 1Q92A 2R2AA 3LT1A 3RIXA 3ST7A 5JASA 5BSHA 3CEJA 4YJDA 4ZRNA 4YREA 4AP9A 4OGWA 1BKDR 1J2RA 4CIXA 1PWEA 1EB8A 3AW8A 3RTCA 3TLKA 1EA5A 2WA2A 3DOEA 4NDZA 4DCGA 5EHZA 1TYDE 1Z8DA 4RPJA 1WG8A 2G8NA 3HUDA 4G1BA 4YDRA 5EI5A 2JGIA 4KIJA 3H3XA 1WD7A 4LF7B 3EAGA 4RD3A 2IYEA 4CKCB 5H4HA 3FGNA 3NDJA 5K2OA 1Y3BE 5HM6A 4C2UA 3V1KA 1BO6A 3EEIA 1V2HE 4PC6A 3K71B 5KMGA 3LFHA 3P71T 2QGFA 2C0PA 4DQUA 2P7HA 1GAXA 3KZ1E 1XDGA 3FB1A 1Z9BA 3LWZA 3TRHA 4B6QA 2H5JA 2WWYA 1M5RA 2OCYC 2RGEA 4IFEA 4E70A 1EWQA 1LV7A 4CL2A 1RRFA 3TTUA 4XIYA 5TPWA 4YCLA 2W0SA 1GLNA 1I1QB 2D0DA 2XMDA 3CWZA 2YRXA 1ZN8A 4OQMA 1XMJA 1E2GA 1NJSA 2ZSFA 3OU6A 1G18A 3K0AB 1SR8A 5BURA 2RC6A 4HX5A 1JEJA 1KO7A 4S1WA 1ULHA 4QUAA 1T8RA 2H4JA 3P8ZA 1KBOA 1QUFA 3D6FA 1TO1E 3IPAA 3KB1A 4G41A 5F76A 5J5AA 3RHFA 4AP6A 4DN6A 4DA0A 2RE8A 1BWQA 3W3AA 5H3LA 2HSZA 2CB9A 3IP9A 3L07A 1MNQA 1V4VA 2JFZA 3X3HA 3H16A 1U2RA 1Z3CA 4KQ2A 1A82A 3Q7QA 1CB0A 1KEZA 1M34E 3FW1A 4DV1B 1SG9A 2JGRA 2VI5A 3B6IA 3OTIA 1NR7A 4MVWA 4OHBA 4TRJA 4TV9B 5IHPA 1UPUA 1KKMA 3ER6A 3HEAA 5HZKA 1V5WA 4DLTA 5LZ2A 4Q4HA 1FTWA 3U09A 3RVSA 2PKQO 1NIJA 4EENA 3LUCA 4FR0A 5ERXA 3LV8A 2OCKA 1JHPA 3TQCA 1U2GA 3FCOA 4D9JA 4YRTA 4CPDA 5AWFC 5B7NA 4U39A 4K87A 2DFTA 3TMYA 2IHBA 2NTJA 4D9HA 4HRVA 1XVAA 3T3DA 3Q88A 1ZIXA 4DHEA 3DV9A 1GO2A 3Q8MA 3UJ6A 1NVUQ 2YY7A 2OBLA 3R75A 1GZ3A 2IODA 4IMRA 4FMCB 3WMWA 4FIZA 1QC5B 1L4EA 3BMQB 2E89A 5FORA 1SZJG 3P2KA 3SBEA 1H23A 4I4TF 4Q3CA 4YRJA 4NH4A 4R54A 4UHEA 1U1GA 3LBHA 3GNSA 4NPHA 3PQEA 2HSDA 1G0NA 3ZDZB 5GP1A 2JVKA 3BE8A 3PPXA 2J1LA 4CQMD 1K7YA 4W9RA 5JQGF 4XARA 5LSAA 4WK2B 1PWYE 3AFNA 2YMLA 1FFCA 4F46A 4YV1A 2BKEA 4MPTA 2OP1A 3GMDA 1AGPA 1DAPA 2VHEA 5FPHA 2XRFA 4MZXA 2G6TA 1NKVA 4H7DA 1P8JA 2Z2IA 5TXGA 2P6NA 4LIPD 5I7OA 1XPUA 2NTVA 4F4JA 4I4TB 4EVIA 3ONEA 1KRWA 4LY6A 1GPAA 3B1KA 4ZU6X 2PGLA 2RHHA 1WXDA 3OKPA 2YZ7A 2CJPA 2YOGA 2E4AA 2BGUA 1FNBA 1W4ZA 2A0YA 3MSCA 5H16A 5IC5A 5T41A 5JQGB 1DGQA 1PZHA 4B17A 2QJRA 4MYUA 3JYHA 4HAIA 1K92A 2NYRA 5FBHA 2AOUA 3N2YA 3ZWBA 3BRCA 1SB8A 4AS3A 2AR0A 1EX7A 2UYGA 1NV8A 2GRAA 3GJ5A 3PQDA 4IGAA 4BQRA 4M0CA 5BR1A 3H9JA 1M2OB 1EE9A 5F7OA 1S4MA 2NSLA 4HPXB 4F45A 4DV0B 3LC7O 2FWNA 4AMBA 1UT8A 3NDPA 2YN4A 4XJSA 4EHLA 3K9GA 2C4NA 1YRLA 3JD0A 4G0ZA 4HDNA 1HURA 1E9RA 1RLUA 2QN8A 4JX9A 4XASA 3CVUA 5G40A 3QMPA 4O1MA 3ZZUA 5CLFA 1RR6A 3RF6A 3U56A 1PEDA 1EVEA 1U3UA 3Q2OA 3TSWA 1NZFA 3I9LA 4UFNA 3W1WA 2NUBA 5B1SA 3WBBA 5L7TA 2XD9A 4R5MA 3EQZA 1P7YA 1S1CA 1RXEA 3A1FA 4PC3A 3WAKA 4DNFA 5HMLA 4Z4FA 3AFMA 4R7TA 4EPTA 4PVDA 3ZHUA 3AM4A 3O4RA 2NO6A 5EEHA 2IDZA 3JZAA 4XYBA 1KRXA 2VSNA 4K6GA 3ZDDA 3NMUF 4LMPA 3RSHA 2DEUA 1HLGA 4RVOA 4TN5A 4TZ0A 1OX5A 5TMPA 1OZHA 1GNTA 1B41A 1X1BA 3E22B 2ZB8A 3HKEB 4ES6A 2UZ4A 1RZRD 1L1RA 1QLHA 4M1SA 4D92A 1W76A 5AHXA 2IS6A 2DKOA 4DCNA 1JXMA 2IZZA 2YMQA 1SRRA 4OGGA 4YRBA 1TIKA 2JIBA 4ZAVA 4D1YA 3MINA 3WP1B 4BLWA 4IIJF 2I1WA 3HP4A 1XWFA 2PH3A 3B3AA 4D74A 3BZWA 4WLOA 3IBTA 5JBNA 2XF8A 5TVKA 4JKIA 221PA 4CMAA 3PHJA 3I6ZA 1GD1O 1ITZA 3R3JA 4B3IA 3IQZA 3THXB 4KAFA 3PLAE 3DH0A 1EK5A 3OE7D 1JW9B 2V7QD 4XOUA 3ASUA 4BE7B 1KAGA 3HH8A 3ZG6A 1YR2A 3A11A 1TVEA 3ICOA 5IANA 2XQKA 1A8IA 2Y27A 6Q21A 4IIJB 3MYYA 2CYAA 2J4FA 3PRJA 4HB2A 2ODEA 2BGTA 4N03A 1PT5A 1MAAA 4OHOA 1HMYA 1RLOA 2DTXA 1J56A 3AK4A 4RS4A 3ZE9A 3P1JA 5E7JA 4WY8A 4JBYA 4Y98A 2DBVO 3II6X 2NV0A 3MF4A 2PIDA 2O3QA 4KQIA 3EQ9A 2XYRA 3R9XB 1J8VA 1E5VA 1QPBA 4IGIA 4D0RA 4JZKA 5A3SA 3HVJA 1C9YA 3OSUA 4LJ8A 3MQFA 4P4UA 1ICIA 3AQIA 3VVCA 2VUSA 4LE1A 1B4DA 4ZALA 3GX1A 5D1NA 4OLFA 4W8HA 3U4GA 3K0EA 3VAAA 2W71A 1C3OB 1JF8A 2OFXA 3FZEA 4A6DA 2NZJA 2XWQA 2YWCA 2REBA 3KAKA 2VSQA 3MMXA 1P60A 2R68A 4CRWB 4GX5A 3HDYA 4C6RA 1B23P 3PUKA 1Y3HA 1ELOA 3H2JA 2DLNA 4JU9A 1UQTA 3ZV4A 2GAJA 2DPGA 3CUUA 4B2YA 2NNWB 3Q12A 3G0IA 3K94A 1WXFA 4JFAA 2P4QA 4AJKA 3IAFA 3CLUD 3ZHOA 3DE5X 4C21A 3MLAA 4FYIA 2H1HA 1WDTA 3DOHA 2V5AA 1VP9A 4IOLA 1EINA 4GLLA 2Z43A 1A95A 4GLOA 5JV5A 3WE7A 1CFZA 1I0IA 2J07A 2C7VA 1LW6E 1E7RA 5EN4A 3VHXA 5AVQA 5IYZA 3AVYA 1FTSA 2EZ9A 2PQ2A 2GEKA 4XD7A 4RPCA 4ZCRA 5CVTA 1KQ3A 1T3GA 4WINA 5FV7A 1XDBA 4CI0B 1PQUA 5IBRA 3WP0A 3FSGD 4XM0A 1YFLA 5HJEA 3NYRA 2R2GA 4L8WB 1F8GA 2NZVG 2VFAA 3GGGA 2J3MA 4L74A 3IUPA 4P9NA 4QE3A 3E2PA 4KQ1A 4YIKA 4DIOA 1S8AA 1NE2A 4AZWA 4X3CA 3WL5A 2NNLD 2ZSJA 3OQNA 2AIRA 5B1DA 4Z49A 3HCNA 4EZIA 1FQKA 4WKNA 3NKFA 1GITA 3WL6A 4CV1A 3OESA 3DEJA 3DE2X 4GI5A 5AW6A 4PZDA 4MLCA 2PUAA 2VTKA 4NBRA 3LI2A 4IIYA 4Q9NA 3UCEA 2H7VA 1DAOA 4HD8A 4NNPA 1D2AA 1PL6A 2VATA 4JBGA 4ZAYA 1Y5RA 1UBSB 2QVZX 2ZUDA 3BHJA 3FNIA 4QU9A 4XRRA 3W05A 1YDFA 3TZHA 3RRMA 3SIPA 3F9RA 3UC9A 4D81A 3WA7A 1OREA 3NANA 1N0WA 3GRKA 1D4OA 2PUHA 3M3PA 3RBAA 1QOPB 4ND5A 4B71A 5BVHA 1MORA 2XUDA 3KZOA 2GX6A 5K0SA 3F0TA 3G7NA 4GPAA 1H2AS 4BVFA 1C2YA 3ZIAD 1Z7GA 1GN9A 3OU2A 1Y89A 4ZQCB 1WRBA 1AMUA 4J1JA 4WBXC 3DAPA 5FWXB 1E69A 3CRRA 5FOQA 5E7MA 5EWLB 5EWMB 3VM6A 1XEWX 3L18A 4P1ZA 4QPDA 3ZDRA 2VC2B 3FZYA 1CJBA 4PN7A 4U0JA 2FW1A 2QTRA 3UYLA 5FTLA 2FJUA 4EARA 1NBIA 1WM1A 3AF0A 2DYKA 2PZMA 1Q0RA 3UMMA 4PLYA 2W9XA 1SVKA 3KPYA 3G9QA 1RJWA 2QN1A 5L51A 2IEBA 1SD5A 4BKOA 1UMDB 1SOAA 3NUGA 1R74A 3CHYA 4YVFA 1I7QB 4ZHQA 1Z4IA 3IUBA 4CGYA 2J30A 5JEDA 2POCA 1ZY2A 2PKXA 3LHIA 3GZNB 3VDRA 2B9VA 3MA0A 3SM9A 1EJ0A 2QG4A 4IIEA 4TROA 3AYZB 4RFVA 1U9CA 3OOJA 3RRFA 4ZO8A 5J1TB 2CVFA 5FV4A 3SFZA 1H6DA 1P1KA 4B4UA 5HEKA 4V1CI 2PD3A 3JWPA 2MTBA 3JYNA 4RHEA 2OXIA 2HMYB 3U37A 5BNWA 5CDHA 3KFXA 2AOXA 4FR2A 2W2VA 1ZK2A 2IYAA 2FPUA 3ENQA 5B2ZA 1V47A 1Y6ZA 1G8JA 3I6MA 4TQUS 3DMNA 2XPCA 4N3AA 2FPXA 1ISSA 1FX1A 2OP0A 4ZT4A 1TA0A 3R23A 4PCUA 1AUXA 1U8AA 2ZUBA 1BQ3A 3T1HB 4R16A 5K4GA 4UDNA 2YKGA 4OP2A 2VRCA 5T4BA 2YS6A 1HT3A 1DAGA 3PXGA 2ZATA 1KMCA 2AMFA 2IX9A 2FZ4A 1JXOA 4U3JB 2AR7A 5G0UA 1GUYA 5TQJA 1VE7A 3WGZA 3SC3A 2MMGA 5JYEA 2JJQA 4OL0A 3H2KA 2AWNA 3MMZA 4ZQHA 4K9PA 3UKDA 4A2QA 4X3OA 3AF4A 4DUGD 1FFXA 4V1CB 4PFJA 4MRNA 2GZHA 4W7IA 1JTVA 1PR1A 3ZCQA 1TTTA 1Q1EA 1QIJA 3B1XA 4BFLA 1XT6A 3OEEA 1OFHA 4R51A 1GT91 1VBMA 3ZUGA 5EJ6A 2LDBA 1IONA 5JAPA 1LRJA 5JO0A 1PCXA 3WJ2A 1P7VA 1J8FA 1RLMA 1TF2A 1D2GA 4TTJA 3ASZA 4YDSA 1E9SA 5DHSA 3R7AA 3S27A 4BMCA 5IN4A 1UF9A 2LVBA 2VYVD 2XMPA 1A9PA 4L5JA 1O6GA 3HKDB 4N7RA 3WRXA 3UJNA 5L3SB 3CVXA 3H1AA 5SYAA 2H9YA 2QV7A 3B13B 4AYXA 2XMRA 2DFVA 5B30A 2FK7A 1XTSA 3A4VA 2FR8C 3Q15C 3AHEA 4QECA 3UW1A 4IUBS 3VX3A 1TYCA 3QXSA 4EOGA 2C9OA 4WNYA 2WD7B 4Z4CA 4JEIA 1U2PA 4OU5A 5AHKA 4TMWA 4QFMA 1E2UA 1X7WA 4EAQA 1PGJA 5A3RA 1IY8A 3Q5DA 4C29A 4JAVC 2G9QA 3JX9A 1QS0A 3B78A 2PLFA 3R0VA 3GOHA 1C3VA 1XZQA 2HU5A 3GLHA 4FYKA 3ZV6A 4BMSA 4PHGA 1TUBB 3QOYA 4MV5A 5A4IS 1P19A 1VGVA 2OUIA 2EYUA 2HCJB 4C6TA 3RUAA 3RIGA 1UXOA 4Q7EA 4GWKA 3RC7A 4ETMA 5K7SA 2HPVA 1AQJA 2AV6A 1ACLA 3DEIA 2F1OA 1QLWA 1P9NA 1TEXA 4NC9A 5A5EA 1US8B 1J70A 1KJZA 2ZJYA 3GEDA 3KL4A 4HK4A 1F20A 1K3FA 4JVNA 2PL9A 2RAFA 5K0EA 3FPGA 3QW4B 2BZSA 1XLWA 1VKOA 2QYHA 2ZKLA 1W8DA 3TVDA 5FL3A 2FPGB 2H3HA 2J59A 4LXXA 4PYRA 5GAJA 4XWOA 2OVBA 3UB2A 2A94A 3IPXA 3IQHX 3JVIA 1V1RA 2VS1A 3A25A 2NU6A 3C4JA 3LJKA 2JJ2D 1T9KA 1ZJ6A 3HCWA 4FBMA 4G0UA 2I8CA 2WSSA 2PJZA 1THZA 1XP5A 1V26A 2DTEA 3LSTA 1KH3A 3Q7TA 1N1EA 2A0KA 2XT0A 1E3JA 3O4JA 1R1DA 1SXJE 2WFZA 1IN1A 2QRKA 3OZTA 1UM8A 3DGEC 5K3FA 2BWJA 1XQYA 3E9RA 3DUFB 2CJWA 3DNMA 3TQFA 1SUAA 5GV8A 3QMWA 1F4LA 2NYAA 1FS5A 2I6XA 2GPBA 4IS2A 4AZ0A 4WT7A 5EP3A 2QQFA 5IKMA 5DM70 1K97A 5F7XA 1BX0A 4IEFB 3HMQA 3GGCA 5KVSA 4YBZA 1J1UA 3GPIA 2Q1XA 1C1XA 4GZ6A 1U0BB 5DTRA 1PDWA 2VKQA 3G59A 4GOLD 4ZANA 5JDCC 1DWUA 4MCJA 3IJRA 1RW4A 2QPLA 2C5AA 3SSAA 3GUCA 4MYSA 1G6OA 1JB1A 2V55B 2C20A 4PAWA 5DCLA 4BO0A 5JXGA 4Q1CA 5IM4F 1GG2A 3BG5A 4YAEA 2C9BA 5TE9A 1NF8A 3PRYA 2F3QA 1EE1A 4MJLA 1GVHA 2H59A 4C05A 3KSAC 4IX1A 3PEFA 4I0WB 1C0KA 2P90A 1F1BA 2JFWA 2Q6IA 1GQRA 3GU3A 2DKFA 2HK7A 2F8LA 4RSGA 4CM7A 2IDMA 3WLHA 1WZUA 3FBGA 2ZIZA 3GCGA 4ZJPA 4EB8A 5ELLA 1QHIA 1RYFA 4WCVA 1FUYB 4GX1A 2FYTA 2ZUCA 3K8ZA 3ON5A 4QLOA 5FRDA 3M3HA 5J4YA 3MWYW 4GR4A 5JC1A 4Q4CA 5IVHA 4LV5B 1VBNA 4J0JA 1TLFA 5DI3A 4C5AA 2XA1A 3A6FA 4KYTA 2QZZA 4HFMA 3U17A 2C0CA 3F1KA 4WFIA 4EI9A 5KREA 3E81A 5JNSA 1YGYA 4HLUA 3TFOA 4MR8B 3W5UA 2WY2D 2A1UA 3CSUA 5JY6A 2RGBA 2WJHA 3WRVA 1UP7A 4CLEA 3AY6A 2WIDA 4MRMB 1M2VA 1S2LA 3I2FA 3LMKA 1JLLA 1I1OA 1JFFB 3H6HA 4KN9S 4C7JA 1DDOA 1G3UA 1C3XA 1BKYA 4KNVA 3TIXB 2AYZA 4MA4A 3SKXA 1PEAA 1C9EA 4WSOA 1E4VA 4MIOA 4UE2A 2Q49A 1VGQA 3BCUA 5DM1A 1ILEA 4EJSA 4KR6A 4GI2A 2AC2A 2OC9A 2ZQ5A 3PWKA 2QUZA 5JLAA 2Q8NA 1PR6A 4MS4A 1VCOA 3H5OA 4QGHA 4UD6A 5DNVA 3QE0A 1U63A 4J43A 2JIOA 2TMKA 3ZHSA 4ZJUA 2PX0A 3HNOA 3AF5A 1HE2A 2C2GA 1HDRA 3F9IA 4BBPA 4CL3A 4OUDB 1PD1A 2GYYA 1Y7TA 3K4HA 1GL3A 1WETA 3B8EA 4MW0A 2Q8PA 1U0TA 3V3KA 4RY2A 4IFTA 2EJTA 3M5WA 4GX2A 4DLSA 1PD0A 4WK4B 1XCLA 1MIOA 1SBIA 1A5TA 2FEMA 2O3JA 4BZXA 4P08A 1DVRA 2Y1OA 4ARVA 2BAGA 2Z6VA 3QLTA 1C9MA 1SIOA 4INAA 4KAJA 2EKDA 3ZK9A 4S35A 1H2BA 5IZ4A 1E6WA 3KEGA 3OQPA 4NPAA 3UWSA 1L7EA 5COBA 1WPGA 2H4XA 4DDKA 4I4IA 1WSDA 3LOPA 2R0QC 1ZYUA 3FR8A 5HFJA 2Y1CA 1AKVA 1PF7E 2X6TA 4PX3A 1KJNA 3RFUA 4LWQA 1DCTA 5DNDA 4UREA 2O3UA 2VN8A 2AXPA 1GOTA 4B3JA 1ISGA 4AF7A 3DE3X 3IAS6 4MAAA 5CUQA 4YYZA 2B0JA 5A3VA 2EKQA 3R7WB 1H2WA 4POOA 4OJNA 5AXDA 1DPFA 3I1FA 1GAWA 1TF5A 1EVZA 3A6LA 4DRYA 5BN3A 1NQ5A 1XZIA 2IIVA 2OCGA 1U0HC 2HMSA 3ENVA 1DC3A 3CINA 3HU3A 3MS2A 1WOMA 4Z9BA 3OCUA 4D02A 1SXQA 1QU2A 4FOLA 1CUEA 3PXUA 4IQ4A 1NBMD 1YMQA 2I62A 2QRUA 1FRFS 3S5JA 5H9VA 3CW9A 1WXWA 3W3AH 2ODTX 1UKZA 1RHJA 4ZI7F 4D3FA 4UCXA 4XYGA 1C0EA 2ZRCA 4NVRA 5IDVA 2BUAA 1O95C 3QVWA 5EP4A 4DLKA 2OCIA 3PC8A 5KHAA 4CGZA 4XWYA 2OV4A 1TEVA 1KARA 4R68A 1ZKDA 5L4SA 4LYJA 4B3GA 3GLVA 1Y33E 1N34B 4YUAA 5EJ2A 4KYUA 4XKJA 5ICMA 1QYRA 1LPAB 1GZSA 3N87A 4RKQA 1FMJA 3OQHA 1CB7A 2QL9A 1B0ZA 3DHYA 3PD7A 2PKWA 3UQYS 1XZAA 4ZQFA 4DRXB 5BVGB 1LF5A 1Q1GA 2BM0A 1SCUA 1I3MA 2ZAIA 3ABQB 3KT3A 5JI2E 4QTUB 3KQTA 2IV2X 2D5AA 4NP6A 1D9ZA 3CNLA 2RCNA 4TWBA 4WN9A 4EI8A 5GADl 2IP1A 4DR5B 2IXTA 3MSXA 3RK1A 2GS9A 3I0MA 3JQCA 3LL4A 1NKSA 5JEEA 2XUQA 3L8CA 3UYKA 3E7DA 4EEZA 5I4BA 5M34A 4DNPA 5AP9A 4RTLA 3O9VA 3KQNA 1FE8A 2PGAA 3E8XA 1FTQA 3IILA 5E1BA 3TW8B 3VPHA 4AMYA 4RTRA 1KOGA 1V1MA 3QW2A 1QAMA 4HLDA 1EAMA 4LJ7A 3D8BA 5D3KA 1I80A 1M72A 4KNWA 5B12A 1M1YE 2VZLA 1OE0A 1WTAA 3LO8A 2C2XA 3QXCA 1MEJA 3EXHB 3OWXA 4RGBA 3INGA 3T0GA 1ZNWA 2HO4A 4MA0A 1WMDA 1LW7A 5DHTA 1P61B 3ZXUB 1XHLA 4B8ZA 3AKYA 4W5TA 3FHLA 4X61A 1B1AA 1G3RA 2FUEA 2ORVA 2VQFB 1LF0A 1QFSA 2R96A 4I55F 3EQ6A 3GJTA 4Z4IA 1BEEA 4O63O 3WKDA 4BNFA 4OAQA 1T9GS 3H1PA 2ZW9A 3LGAA 1CRLA 3VGJA 2VSXA 2QTHA 4NMWA 1SXJD 2PZFA 3AEQA 1FX0B 4J94A 4JVOA 4A8HA 4BNYA 2UUAB 1UBKS 3JU3A 4K6KA 2ZCJA 1MHTA 3REGA 5AR1A 5FL7A 5TMEA 5EYPB 1AU9A 3UT5B 2BE9A 4TTRA 1OW3B 4BC0A 3RB8A 3UHPA 4I55B 2QPAA 4KE8A 3KOXA 1AXRA 4RYLA 1NDQA 5AW9A 3LAWA 1M2HA 2FPPB 2COKA 3QEMB 4YJFB 4MCAA 2JFYA 4BVJA 5FI5A 1EK0A 4JH0A 2YDYA 1RZVA 3AFOA 4B1FA 1IB6A 4DY4A 2VZ9A 1GFZA 4CUZA 4GICA 3WRYA 3V42A 1YJQA 2NWQA 4BPRA 2CEKA 1RRKA 2WIJA 3LGXA 4XWTA 1VG9B 1H66A 2ZUEA 3PF9A 4HEJA 1OUMA 1EFRD 4OHXA 4ZAWA 5C7OO 1AGNA 4MS1B 3E2MA 5NULA 3SZUA 3X2FA 3D31A 3B1ZA 1YBAA 3EYWA 3GP8A 4KVAA 2JS7A 3HXQA 3QU4A 4JLJA 3KSRA 1IY2A 1WDLA 1DL5A 2C4VA 1HNNA 2XD4A 4GQIA 4OFZA 4MWOA 4X0EA 1Y63A 2R6GA 5IJAA 3HA2A 4NU0A 3A2LA 2JH3A 3QEJA 2GN9A 4G86A 2Q7XA 1YHNA 4R2MA 3R77A 5LVAA 2J08A 1UC4B 2M2IA 1SHKA 2BCGY 2F9FA 2XUIA 3BWVA 4RKEA 4BWGA 4EL0A 2QUJA 1D1TA 3Q5EA 5C7YA 4BP8A 1QZXA 1NPDA 3R76A 1N32B 5JO9A 1Z33A 5GZ3A 4KB5A 4BMVA 3FTQA 5KZMB 2OK8A 3EA0A 4QXQA 2GPWA 4QUHA 2QZPA 1VRCA 1C7ZA 2D7JA 3LF1A 1ZR2A 3NOOA 4YT4A 1V9SA 2WFAA 1G2PA 3VR2D 1V37A 1VMEA 2A9PA 2VWQA 3KCQA 1CT9A 1U99A 2O2IA 1TUGA 1ZZGA 2Q2WA 5G4LA 4EHBA 5I8WA 3PC4A 1FBNA 1DC8A 5T6BA 1N2IA 4GD3Q 1XJ0A 4UAJA 4C4YA 3LCVB 4HMPA 1KSJA 2B35A 1LK7A 1QH1A 2YHIB 1XEAA 4IMJB 3RVMA 4TMXA 1DEAA 1II8A 1CIVA 1NZJA 2MSDB 1HMPA 3I28A 3TYXA 4D9NA 1SULA 2ZKIA 3F6EX 3P5SA 2DWUA 1TDJA 1UXGA 4K05A 4QNRA 5EXPA 3A7EA 1WB9A 3ZOZA 3N2ZB 4Q03A 5CXSA 5EMLA 1GLGA 1PT9A 5KDDA 1PNOA 3H97A 3UJ7A 2PVPA 3CXUA 4IJ5A 4Q3DA 3P2MA 2PT5A 2BFEA 1U8YA 2YFHA 3L5KA 1J42A 2FWPA 5TQVA 1YMVA 3PBKA 3IEPA 2YFYA 1QIMA 3HS3A 2XDAA 4E07A 2YJ3A 4ZEVA 1JEYA 3N58A 2NU8A 2FN7A 3T7CA 4DIFA 2PEYA 1KDPA 4DYVA 2ZR0A 2X7XA 3F46A 3RREA 1ODTC 1UODA 4FI3C 4KUGA 3R9IA