4AJPA

Human ldha in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol- 6yl)amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
329
Chain Sequence
ATLKDQLIYNLLKQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 116
structure length 329
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajpA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajpA02
1Y8RB 1KC1A 1NYTA 3B1JA 1HDCA 3QJ5A 4KQXA 3JYPA 3UAGA 4M49A 5ITVA 4N5LA 2POQX 4FJ0A 3ZWXA 3GN2A 1Z7EA 4WCDA 3I6IA 1M75A 1FDWA 3QWAA 3C1OA 4MO2A 4GGPA 3CH6A 1R4MA 3H7AA 6LDHA 5T64A 4OOFA 1PJQA 4GPD1 2WWRA 1NQAO 3ONFA 3PQDA 1BXGA 1Y9EA 4CLRA 3ZH2A 3JQFC 2VTEA 4YJGB 1IUKA 1GAEO 4G81A 3D3WB 1PGNA 1Z7BA 3INRA 2OXIA 2YQ4A 3JCZA 3W4JA 2CMDA 3VKVA 4OXNA 4BO8A 3LZ6A 1HYEA 4W9NC 2JHFA 1XYGA 4EITA 1DFHA 1L7DA 3GT0A 1H6DA 1D7OA 2JD2A 1DO8A 1PGJA 1M6HA 4BKRA 4CR8A 4E21A 2D8AA 3UGKA 4TRMA 3LK7A 4DYVA 1NFRA 3IQDB 4NG5A 4BMSA 2I99A 4O1MA 3KYBA 4ALMA 2IZZA 4CLOA 4E5YA 1JWBB 4CM5A 3IC5A 3JQFA 3S2EA 3S2GA 1NASA 2PZLA 3O9ZA 3P2YA 2LDXA 2Q3EA 3AW9A 3H5AA 1MX3A 3FNGA 5L7YA 3ROQA 1BDMA 4J6FA 4K6FA 4DMMA 2ZTMA 5T8KA 4U0KA 3RUFA 2XXBA 1ZXLA 1VKOA 2O7QA 4PLPA 4WCFB 2RHCA 3FN4A 4ZN6A 4EUFA 1X1EA 4RVFA 3FPLA 3HDJA 1PIWA 2WDZA 1HF3A 2BH9A 4I5DA 5FYDA 5I7SA 2CVZA 3JQAA 4UUPA 1CERA 2VRCD 5TNXA 1GU7A 3UN1A 4BKPA 2NTJA 3WNVA 3UICA 2B69A 2HJSA 1PWZA 3A14A 4YXFA 1N1EA 2O2YA 3SLGA 4B3HA 2RAFA 3SEFA 4OIMA 3TSCA 2P9CA 4RLSA 1YBVA 1BG6A 3N58A 4FJ1A 4UEOA 3ZI0A 5AYVA 3RQSA 2BFOA 4BS9A 2PY6A 4QEDA 2P9GA 1EVIA 5JO9A 5T57A 4A73A 1O94A 3JQ8B 4CMJA 4EUHA 2PA3A 2AE1A 2JD1A 2JCYA 3G1UA 3GZ4A 5ICSA 4PCVA 3AUTA 3GFGA 2ZTVA 4JROA 3WYCA 1LBEA 4PIVA 3I9LA 2FMUA 3RC9A 1ORRA 1PS0A 4PLZA 4D3DA 4J2OA 1ZVMA 1ML3A 2G17A 1TXGA 1E1KA 2GN8A 4AJ4A 4BNYA 4J16A 3O4RA 2TMDA 4D0SA 1UXJA 2OOSA 3GVHA 2NU8A 3ITDA 4DQXA 4ITUA 1CEQA 3GPIA 5IF3A 2HDHA 2O4UX 3LQFA 1ISIA 2AE2A 1I01A 1ZBQA 2JFGA 2ZB8A 3NKLA 4RF5A 4DL9A 1F8FA 2Y05A 1BVRA 5JE8A 3LT4A 3KLMX 1QMGA 2Y66A 2YDYA 4BNNA 1RKXA 4N54A 2W2KB 1DC6A 1C0PA 3GA0A 2PD4A 1I5RA 1NTOA 1E1NA 4UUOA 1OMOA 3L4BC 4ZD6A 3VZPA 3JSAA 3T7EA 3M2TA 3NUGA 4HFJA 4Y9DA 4LSMA 5G4LA 3ZCXA 1AHHA 2I65A 2Q99A 3I5MA 5DCUA 2D5AA 2PGDA 3KVOA 5EESA 3M2PA 5KKCA 3UHAA 4RF4A 1LDYA 5HWSA 2HMVA 4NQZA 2A94A 2Y1FA 4RVSA 1EVJA 1NAIA 3VTFA 1D1TA 1ULSA 3DOOA 1LNQA 2CUKA 2VUUA 1LRLA 4W7HA 4DQUA 1Y8QA 5DBGA 5EINA 4IMRA 1JW9B 4E5NA 1WW8A 1P3DA 3ZHXA 4J0EA 1GUZA 4CQMA 2VWPA 4MVJG 5IJZA 3F9IA 5JCXA 3PHJA 1RM4A 2BRUA 4U5QA 1Q0QA 3IJRA 1QRRA 4BQRA 1U4OA 2IZ1A 4R1SA 1R16A 3A06A 5BNFA 2ZB4A 3WMXA 2UV8A 1Y5MA 3GHHA 2QZ9A 3WX0A 1R4NA 3OF2A 1JA9A 1XELA 4L73A 1Y7TA 3PFWO 3D5TA 1P1IA 2NM0A 4CLEA 5JSFA 4XIJA 2DQ4A 3ZV3A 3UUWA 4CUKA 4DC1A 3PK0A 1KETA 1U3WA 5ENVA 3LC1O 3D3EA 4J1QA 3TNLA 1MV8A 4CR6A 2JAPA 3ULKA 2H6EA 4W82A 1BSVA 3ZV5A 1B16A 3HHPA 3VZRA 1T1SA 1DB3A 2Y0DA 3U3XA 3WGHA 3DMTC 1VJ0A 3NJ8A 4GWGA 4QQRA 4A27A 4KUEA 1M66A 4ZU3A 1BWSA 1JKJA 3PP8A 4YVFA 3RC7A 3JV7A 3EZLA 2PGJA 3VPFA 3LLVA 4FFOA 1GCUA 3Q11A 1EUDA 4HP8A 3G1TA 4L76A 1JWAB 2IEBA 4RORA 1P9LA 1N9GA 4FFRA 3C7AA 4OSPA 5JC1A 2UVDA 1TLTA 4FD3A 1ENPA 4YACA 2EV9A 3DHEA 3AI3A 2VHVA 4YJHB 1T24A 1EEHA 1QYDA 3C8MA 2O3JA 4MDHA 1H6AA 3KRTA 3MWEB 1E3LA 3WGZA 5J23A 1CETA 3Q6IA 5H82A 1EDOA 2JFFA 4O59O 3RBVA 3AWDA 5C5IA 4QSMA 4BO5A 1HLPA 2B5VA 4F6CA 5JNLA 4YEDA 1ARZA 3QVXA 3UVEA 4GSLA 2C2YA 1LSJA 2PZKA 4IPTA 1GQQA 2OGUA 2R2GA 1UH5A 3BMNB 1UDCA 1VPDA 3C7DB 1C1XA 4YT5A 5IAAA 3O8QB 2BGKA 2X22A 1SOWA 1ADBA 4FFLA 3GPDG 1B3BA 4DRYA 3FHLA 2AG5A 5EIOA 4B3IA 3P7MA 3TN7A 4CV0A 4LRSB 4Z3KA 3O8QA 4FQ8A 4ZVVA 1GQYA 1J6UA 5GMOA 3F1KA 2C29D 2UYYA 3ADPA 2NUAA 2ZQYA 3OIGA 4Q39A 4B7XA 2GSDA 5G0VA 3KYDB 5JY6A 5AVOA 4XB2A 1U4SA 4CMIB 2GR9A 5HS6A 4E13A 1G0OA 1LQUA 5A06A 2VTDA 2I9PA 4U6QA 1GPDG 3H9GA 4B7CA 1J0XO 3A1NA 2VYVA 4OM8A 3W1VA 5U9CA 1T2CA 1ENYA 3MWDB 1PGQA 4PG7A 4W99A 5EMHA 3L9WA 4I08A 4BKQA 3HUDA 4XYGA 2VOJA 3DAFA 2WD8A 4L75A 1LDBA 4WOJA 1ZUD1 4Q3DA 1J49A 1XDWA 3NDRA 3OBBA 4YJFA 2HRBA 3D64A 5G2OA 4FCCA 3LYLA 4FJ2A 1UP4A 2D2IA 5G0WA 3GMSA 3INGA 5LDHA 1QG6A 3EHEA 2I5PO 1MB4A 5K6AA 4MIYA 3OETA 2DLDA 2J6IA 4BO0A 1U2GA 2X9NA 2AHRA 4BKOA 5GZ6A 5KJEA 3PHLA 2G1UA 4FSHA 3PFFA 4IJUA 4PLCA 3Q9UA 3UF0A 2YV3A 1YXMA 4AICA 1JTVA 2FZWA 3AM4A 3KSUA 1K6XA 2IEDA 4OQYA 3F5SA 2Q4BA 3JTMA 3RC2A 3VH3A 5MGBA 5TJ9A 1KS9A 1PJ3A 2HRZA 3AUAA 2Y1OA 4WNIA 2OP1A 3H4VA 1EBFA 1ZIDA 1T1RA 1Q2XA 3H2SA 4WLFA 3WGQA 1RYEA 3JQEA 1BW9A 1ZK0A 1YL5A 4TRJA 4LMPA 4XGKA 2J3JA 4P22A 1PJ4A 1U7HA 2GASA 2Z1NA 1HDZA 4UEKA 5EQDA 1ZXBA 3GDOA 4TVBA 3RU9A 4BO9A 5JY1A 1T4DA 2YHIA 2ZJ1A 3JQCA 5A4DA 4CQLB 4A26A 4OKNA 3FF4A 4ESOA 1NFFA 2GCGA 4CQMB 1I3MA 4NJMB 2NQTA 1SB9A 4Y98A 2Z5LA 4XQEA 1UXHA 4WK6A 4IZIA 1OC4A 4HNHA 2X5KO 3ZWBA 4NH4A 3TZHA 1GD1O 2YFQA 4PVDA 3PEFA 4IDAA 4J9UE 5G4KB 3V1YA 1KIFA 2O23A 2NU6A 1HE5A 3NRCA 4UVDA 1NQTA 4XQCA 4CMCA 3Q9NA 3H2ZA 1H5QA 1N2SA 1RPNA 2A92A 1MG0A 3WGIA 2A9FA 1I8TA 1IZ0A 1Q7CA 3HNPA 4IXWA 3L0DA 3WSWA 5DN9A 4CV2A 2QG4A 3F5QA 3W4IA 2CY0A 3EGOA 4R9SA 4PGFA 1PQUA 1ZJZA 3EZYA 4KUHA 4BGVA 2NU7A 1FK8A 3PI7A 5T6BA 3SXPA 4C7JA 1GV1A 3MJCA 4R51A 1GQ2A 1LA2A 2NSDA 1WDMA 2PTGA 3A4VA 3QRWA 4W6ZA 5COAA 4UREA 3ITKA 3RUHA 5AXCA 4P4GA 4E5KA 3COSA 1EE9A 2NU9A 2CDBA 4OOEA 4XKJA 4M89A 3TF5A 2OP0A 4Q3NA 2VYVD 2DTXA 2HU2A 3PLNA 4NBRA 4DQVA 1VRWA 3V1UA 4E2ZA 5COQA 1LQTA 3IL2A 3W8FA 3GRPA 4IDCA 2WYVA 1CDOA 3G49A 3CIFA 3DFUA 3DEYX 1VL6A 1FDUA 4IUYA 3K92A 2B0JA 3P19A 4R41A 3OSUA 3W8DA 1XSEA 1WLYA 3UXYA 1I3KA 3WS7A 5FF9A 1TEHA 3GDGA 3KUXA 3LT0A 2Y1DA 1WDKA 1H9AA 1EK6A 1CWUA 1V3VA 3DBHA 2PV7A 2SCUA 1UXGA 5DBFA 2Q2QA 4K6CA 4PZEA 1NQOA 3HADA 1ID1A 1LEHA 5TLSA 4KQWA 1JAXA 3DBHB 4FGSA 1PZGA 1C1XB 3TFQA 1HZZA 3HDYA 4QECA 1GZ3A 5THQA 1HSZA 4LISA 4I5FA 2AA3A 2X0RA 3ZWOA 3LC2O 4YRBA 1VSUA 4J91A 4LMRA 3WJAA 2EERA 4B79A 4QUKA 4YRDA 4BKUA 4YAGA 3DBRA 1O8CA 4QFCA 5LCXA 2PKRA 1G0NA 1HWYA 3PWSA 3PIIA 1C0LA 2Y99A 4LVUA 4NNJA 5U4QA 5LC1A 4II2A 4JP2A 3H9EO 1NR1A 2E49A 4N18A 2VOEA 3MJEA 1ENOA 1HXHA 4QX6A 4Z3DA 3ZNNA 4EJMA 3DTTA 5JCJA 4YAIA 3RI3A 1K5HA 3GVPA 4XD2A 4TMFA 2OFPA 1MA0A 1YONA 4CL8A 1P1RA 2JFHA 2CSUA 5JYDA 2E6UX 3ZWAA 1E7MA 4OJNA 1LC0A 3BHJA 3BAZA 1PJBA 2H63A 3ZWYA 4BO7A 1K3TA 5L7TA 1U8FO 1N7GA 4DBVO 3OJOA 2VT3A 4J7CA 1SOVA 1VL0A 4TRRA 5IFLA 1WP4A 3GG9A 2VZ9A 3LDHA 3GHYA 3JQDA 1GEEA 3LU1A 1LI4A 3DWFA 2UUOA 1DIHA 3AY3A 2ZYDA 2DT5A 3PGXA 3JYNA 3OJLA 4E12A 1X0XA 1I0ZA 5C7IO 2HUNA 2RH4A 1XKQA 2G82A 2EGHA 4UEJA 1E3JA 1WZEA 4E5PA 3BMQA 3AUUA 4Z9YA 3PWKA 3QWIA 4DLBA 1A7AA 5BR7A 2VZ0A 2WJPA 3KV3O 3D1LA 4XR9A 4XDZA 5BT9A 4NMHA 2P4HX 3BMCB 3CE6A 3E9NA 4ALKA 3EY4A 4WPGA 2VN8A 4R1TA 2XAAA 2EP5A 5K6AC 4IM7A 2B36A 4MOWA 3EVTA 2YDXA 4BO6A 5A9SB 5JDCA 1IPFA 4OL9A 3QV1A 4OSOA 1YRLA 5IZCA 4ND4A 5IN5A 1R37A 3V2HA 3U9LA 2C82A 3ZDFA 1ISHA 5CFZA 3KTDA 1CQJA 2RHRA 3WGGA 4C7KA 3JYOA 3VZSA 3HG7A 2EHDA 4Z0HO 2W2KA 4M55A 3AOEC 3DXFA 5CAEA 5CG2A 3U4IA 1IPEA 1D3AA 5F5NA 5JAZA 2X9GA 3OFSA 3EC7A 4GX2A 5KVCA 1MC4A 1DXYA 3W6ZA 4MVJF 2WYUA 3ROPA 4I5GA 1MFPA 4DUPA 1XCBA 2HJRA 4R5MA 2J5KA 3PLRA 3DAGA 3HWRA 5F3RA 1W4ZA 5JPIA 3EDMA 4WGGA 3GY0A 1CF2O 2FWMX 3HQ4O 1DDOA 4FFPA 2NTNA 2BGLA 3ZWCA 5EL0A 1H2BA 3DR3A 5IDYA 3FR7A 4MP8A 4P8RA 4E4YA 1YB4A 3IP3A 3R3SA 3RKRA 3DZBA 2BGMA 3KHUA 3CSDA 1JAYA 4J49A 4YWJA 3I6QA 4LN1A 3ORFA 2Y68A 2AEJA 2I66A 2J3HA 3FWNA 2VRCA 2C54A 1SEVA 4DMLA 3TFOA 3O38A 1U3VA 3E48A 1MC5A 1M6WA 2AQIA 2DPGA 3DHNA 1KEPA 3D3WA 5BSFA 3FRJA 5T8KC 3WQRA 3WLFA 2WD7A 4HWKA 3QWFA 2GNAA 2R6JA 5JDIC 1ZCJA 3IDSA 3Q3CA 2EIHA 2H1SA 1G1AA 2EW2A 3AU8A 2O3UA 4XRGA 2X6TA 2ZCVA 4JBHA 5JMWA 4B8WA 1KC3A 2GD1O 2Y0CA 4MKZA 3IP1A 4RPJA 2HCTA 4HNGA 4I9NA 1W73A 2GO1A 5L3ZA 5I7EA 4RCVA 3ETDA 3F3SA 1XQ6A 3WOHA 3JQBA 3GZNB 4EYEA 4ILKA 3U4HA 3E9MA 1CRWG 2BFPA 3I9JA 4RZIA 2PD3A 4MP6A 3WFJA 2HSDA 2TMGA 3L9XA 5B1YA 3PPIA 4ZJUA 2W2LD 1NR7A 1PS8A 5DOVA 3EYWA 1ZEMA 3DO5A 1R12A 1SNYA 1A4IA 2DAPA 3GF4A 2QX7A 4MVJM 5C7LO 1H0KA 4WASA 4LVCA 1K2WA 1E5QA 2G5CA 5IDQA 3DQPA 1E6UA 3HJAA 3TZCA 5B4VA 1YO6A 3NGXA 3OECA 4MVJI 4WJZA 4CM3A 1QLJA 3E9QA 1U8XX 3BMOB 3GAZA 5A9TA 3OQBA 1PQWA 4JBGA 3WTCA 4CV3A 4BGUA 1KVQA 1LX6A 1XQ1A 2LDBA 1UDBA 5TT0A 3BYZA 4XCVA 1J5PA 1PJTA 4BIIA 3H3JA 3IUPA 1DLJA 2DUWA 1A4UA 3C1TA 4HBGA 4MVJA 2HK9A 3PJDA 1NFQA 3PJEA 1NHGA 2FHSA 1PTJA 4DWVA 3PGJA 5GZ3A 1Q7GA 3LC7O 4GAEA 3AY6A 3LF1A 1DSSG 1T2AA 3BHMA 3M1AA 4TZTA 1QP8A 1QORA 5GY7A 3TL3A 3AOEA 4DC0A 1FDTA 4JN6B 1V6AA 1C0KA 4R1UA 4R3NA 4CM9A 4XYBA 3DMYA 3PYXA 4TVOA 5TGDA 1HE3A 2RIRA 5JYEA 3QIVA 2HMTA 4CMEC 2VQ3A 4E30A 1Y8QB 2ZIZA 4HUJA 5JBIA 4ZA2A 1ZK3A 3WQSB 1NPDA 3F1LA 3F4BA 4J7XA 1K6IA 1T2FA 2ZB3A 1KVUA 2HK8A 1WDLA 3BMCA 1DAPA 1NBOA 5KVVA 3KEOA 4ZGWA 1R0SA 4CM1A 4DYDA 3UCXA 4BL5A 3WGOA 1BW9B 3DBVO 3PDJA 2E4AA 4YTEA 3L6DA 1ZNQO 2DBRA 3GG2A 4XGNA 4M87A 3E18A 1BHSA 1RWBA 1B14A 2XF8A 5L53A 3D4PA 3HFSA 3NV9A 2GGSA 4FR5A 4H16A 4ZQBA 2P2SA 1JVBA 2ZB7A 2X5OA 1PJCA 2A4KA 2B83A 2HMSA 5CP8A 4NBUA 3RUAA 4JIGA 1V3UA 2V6BA 1E1MA 4Z0TA 3OQ6A 1D4FA 3FD8A 2C5AA 3JD4A 4EEZA 4N7RA 4WEOA 4GKBA 1NWHA 1V0JA 3B1FA 4RPLA 3BTVA 3S2FA 5I9MA 2EGGA 1P1FA 3H8VA 3WICA 3EW7A 3ROMA 2VYND 3DB2A 3V5NA 1A9YA 3VH4A 3DBLB 1ZK4A 3AJRA 4BNFA 5DCYA 3OHSX 2D0IA 4WCFC 4XYMA 2PD6A 3TWOA 3GNTA 1MUUA 1U3UA 4ND2A 3OJ0A 1KEUA 3RUIA 1SMKA 4Q3EA 3JQ7B 4I1IA 3F4LA 3HN7A 1N9GB 3MCVA 4CUJA 2D5CA 4UVGA 5A3JA 4D46A 4INAA 2X58A 3NT4A 4OYRA 1NVMB 3ZNQA 3CXRA 5IDWA 1W6UA 1AXEA 3JQGB 1B8UA 4IIUA 5ES3A 2X86A 2Q46A 2J3KA 3JYQA 4J4BA 5DCWA 5I9LA 1ONNA 3GR6A 1V35A 2RBEA 1EFLA 2X7HA 4GVXA 3INTA 4IGFA 5L7WA 3D4NA 3GDFA 1HDRA 1UXKA 3FR8A 4BNUA 2B4QA 2OHXA 4YT8A 2QRLA 4BNVA 1ISFA 3S55A 1H2HA 2JKVA 4YT2A 1E7WA 4MVJH 4FOSA 2JCXA 4BO3A 5IXSA 1ADFA 3H5RA 4WEQA 2I67A 3L6OO 5DP1A 3U5TA 5KJ1A 4XQ9A 2GF2A 1UUFA 2J5RA 3WSVA 2EKPA 4GMGA 4CODB 3EUWA 1DC4A 5CEEA 2Q49A 3WWYA 4H15A 3U49A 3LF2A 2YFHA 4XB1A 3IOYA 4YJFB 1EE2A 2Z95A 3B70A 4D45A 3DZKA 2HO5A 4BNZA 4BNLA 3GZNA 4NPCA 3U4CA 3L6EA 1LRKA 3HE3A 3K30A 5EQFA 3U4DA 1LJ8A 1T2EA 5I8ZA 2ZJ0A 3ETEA 1BXKA 3SLKA 3QVWA 3SC4A 2NLOA 4R69A 4IDBA 4II3A 1T2DA 1C1DB 1BTOA 3UH1A 1VM6A 3HFGA 2ZYAA 4JCOA 5CDTA 1LSUA 4MJLA 4YJGA 1X7HA 3DOJA 2Z1MA 4E32A 8ADHA 2PFGA 3H5NA 1WZIA 3ABIA 2YZ7A 1TT5A 1E7SA 2Y67A 4IDEA 5L95A 3B1KA 3KYDA 4RF3A 5JDCC 1DEHA 4YAKA 1DHTA 1O5IA 2Q1WA 1PJ2A 4YAEA 2VHZA 1E3EA 5FWNA 3V1TC 5KJCA 5TSDA 2AXQA 4F45A 1KOLA 3IAHA 4J3FA 3OEYA 4DPMA 1UR5A 4HADA 1RJWA 2F00A 4DGSA 4KDFA 1XWFA 1G6KA 2X8LA 3I4CA 4DIFA 5I9NA 2C7GA 5AXBA 4GI2A 1Q0LA 4L8VA 4M8SA 1E77A 1OC2A 1UZLA 1JLLA 5I7VA 2UUPA 1ADGA 4NI5A 1O95A 1EVZA 5KJ6A 3AM3A 3E5MA 3K9QO 3JQGA 1X15A 3LT2A 4R54A 2DC1A 4J4HA 3PXXA 1R0KA 2OO5A 1HDXA 4BV9A 1P1JA 4RLHA 4AJKA 1LSSA 4JK3A 3JQ6A 4Y6SA 2ET6A 1IULA 1GV0A 4IBOA 2WE8A 4Y6RA 1Z74A 1PSDA 4NK5A 2GZ2A 5TT1A 3DAPA 3TOXA 5KJFA 1DAOA 1E3WB 1P77A 2GUGA 1LRJA 1LLUA 1LDGA 1YQXA 4ZQEA 1JKIA 4U6SA 1RM0A 3MOIA 4TKMA 4WLNA 1UZNA 3DZJA 3GGPA 4KTVE 4NFHA 3W6UA 1AUPA 3K2BA 3OH8A 5A04A 3MOGA 5G0UA 3FNHA 1N5DA 2O48X 1LTHR 1QV6A 2Q1UA 4J90A 3BHIA 3KSDO 1Z6ZA 4AL4A 1HTBA 3NGLA 5A5EA 4KOAA 1A5ZA 3AI1A 4FN4A 1P1KA 1GCOA 2FR0A 3OIFA 2O4CA 2P91A 4GX1A 3QWHA 1KY4A 4TRNA 2QW8A 1H94A 1B3RA 2QZZA 1NAHA 3HB4X 4NIMA 3NJ4A 1Z45A 5IZ4A 2OBYA 1Y8RA 4PLHA 4PLTA 3NEPX 3R0IA 3QHAA 3V2UA 5KTKA 1H6CA 3UCFA 3MTJA 1WPQA 4UVEA 4CMAA 5A9RA 4D42A 4HY3A 4XR4A 4LGVA 3RUEA 5B4UA 1M76A 3TQHA 4A0SA 1IE3A 2Q2WA 4G65A 4PFJA 3DDNA 3CZMA 5KVSA 3K8ZA 1PGPA 1VI2A 4XJTA 3VH2A 4WLVA 4WLUA 3VVCA 3QWBA 3IS3A 3K96A 4PN3A 2Y0EA 2E37A 4KZPA 4NFYA 1LDMA 3ST7A 1EK5A 3SX2A 3D4OA 2O2SA 3AM5A 5IDXA 4RVHA 3V8BA 2QRJA 3QP9A 2BMAA 4EW6A 5FI3A 1OZAA 2XPCA 5HM8A 3ZWWA 4D3FA 5CDSA 1DFIA 1UAGA 2X5JO 4OHUA 3TOZA 3U62A 1KBZA 4GLLA 1LLQA 5GZ1A 2X0IA 3ZWMA 6ADHA 1P33A 3WYBA 1L1FA 3VOSA 1P45A 3ETGA 3GH3A 1IYZA 1LLCA 4C4OA 2P5UA 3GEDA 5CPFA 2HLPA 1A7KA 5TQVA 3RKUA 1P31A 1ZMOA 5IZCC 3S2IA 2OZPA 1ENZA 2JCVA 4F46A 1Z73A 5A02A 1WAMA 4IGEA 4K26A 1TVEA 1Y6JA 1AE1A 2B4RO 4RL6A 1E6EA 1YL7A 4B4WA 2Q45A 1OI7A 3I9OA 4IY1A 4H7PA 4BNKA 1DIRA 3WLEA 5KVQA 4J1SA 4CM9D 5KIAA 4AJ1A 1GUFA 4WUVA 2ZTLA 3UKOA 5CDYA 3QW2A 4PG4A 2V7PA 1X0VA 1ZEJA 1DOHA 3P5SA 3WB9A 2BELA 2DPHA 4YPOA 5CG1A 2HK7A 3GAFA 5EERA 4CR7A 1H93A 1BDBA 4HXYA 1NHWA 1B7GO 2D4AA 2VWGA 1CIVA 3GGOA 4KWHA 4H3VA 5TRTA 3MJ4A 4BNWA 3E82A 2EXXA 2DU8A 4EDFA 2FSSA 4B4VA 1HYHA 3FBGA 5A9SA 4ALIA 1YQGA 2FN7A 1HT0A 3WR5A 2PLAA 1DJQA 3DTYA 3QQPA 5L51A 2VHWA 4R5HA 5CPBA 1YDWA 3MZ0A 3DOCA 3ADOA 2FZEA 1HE4A 3SVTA 1ISMA 3AFMA 1U1IA 4B4UA 1VE9A 3FPCA 4CQMD 2GDZA 1X13A 1ZK1A 3JQ7A 4GWKA 4KWIA 5MDHA 4IXTA 2WM3A 2HKIA 4R4JA 4NJOA 3VVBA 4F3YA 2VNSA 2AQ8A 2DBQA 1A71A 4CMGA 3Q2IA 3HDQA 1VC2A 5THKA 3QY9A 2RH8A 3OIDA 4IINA 3CMMA 1FXSA 1GY8A 1MFZA 4R16A 2NVBA 3AFNA 2WEKA 4LCJA 4PLFA 3ZU3A 2FP4A 2ZKLA 4Y6PA 3E8XA 4JQCA 4D41A 1EBUA 1XIVA 4E6PA 3ANLA 3G79A 1ZK2A 5G0TA 3ONEA 1E7QA 3L4BA 3WG9A 1XU7A 3TPCA 4GL4A 5F5LA 4HV4A 1U28A 3C3XA 4CUZA 4MIOA 1XHLA 4RQTA 3TZQA 2AG8A 4CLXA 1ZH8A 4P4NA 2BD0A 1HRDA 4AJEA 3A28A 1HSOA 4N5NA 1TT5B 1E3IA 3VZQA 1E5LA 4EJ0A 4Q3AA 5KWEA 2A35A 4L0QA 1YB5A 3VDRA 4RV9A 2R00C 4TKLA 2WMDA 1JU9A 1ZO8A 4YT4A 2C7VA 4ZRMA 4PVCA 4CMHA 3M1LA 1UXIA 2WD7B 4BNMA 5I7FA 2YV2A 4ALJA 3G3EA 4DIOA 4K1LA 3GN1A 4S1VA 1OFGA 4PLVA 1LDEA 1ZJYA 5BQFA 2DVMA 2GPTA 4J1NA 3DHYA 4OXKA 4FS3A 3PHIA 3CMCO 2W4QA 1JDJA 1I10A 2NVUB 3B20A 2R00A 3QVTA 5BSGA 5L4LA 1OBFO 3PHGA 1SB8A 2EW8A 4CLRB 4FB5A 3H6KA 5TC4A 1ONOA 4KTTE 1V9LA 3RIHA 3KZVA 1MXFA 3AUSA 3LSYA 3EK2A 3TL2A 1PL7A 4YDRA 1WMBA 1EMDA 1UP7A 4IQ8A 4DVJA 2PWZA 1CQIA 4P38A 4IS2A 1JKFA 3AI2A 3O03A 1LDNA 1DPGA 2V65A 1A27A 3WBBA 5CDUA 3B6ZA 4J9VA 1YS4A 3WBFA 1EUCA 2X23A 1KYQA 3ASVA 1YWGO 5H81A 1NWCA 2VHYA 5ICMA 2OORA 2OMEA 2GN6A 2BLLA 3PJGA 4RDHA 5G4KA 2YJZA 1E3WA 2O3QA 4YCAA 3AOGA 3SJ7A 5C7OO 3X2EA 3VTZA 1QKIA 2H9IA 2B37A 2FR1A 1XG5A 4B3JA 2FPIA 5ITWA 3LLSA 3ON5A 4GQAA 4NU5A 3NX4A 4PG6A 1PL6A 3FWZA 1AXGA 1I2CA 4XYEA 3UFXA 2VT2A 4D3SA 4L4XA 1ZSYA 2OUIA 1YB1A 4XRRA 4BO4A 4BNGA 1WWKA 4I9UA 3UCEA 1D8AA 4A10A 3K73O 3HZZA 4ID9A 3MEQA 5ER6A 3CEAA 2BKAA 1I24A 5B37A 3RFTA 3ZU4A 3CPSA 5H83A 4XGIA 4CMIA 4EZBA 4RGBA 1QR6A 3VAZA 1BXGB 2X0NA 1Y81A 3KSZO 1KY5A 1Y1PA 4O6VA 4UAGA 1B26A 2X1HA 5BSHA 2C2XA 3RASA 3NT2A 1Z75A 3E5RA 3KEQA 4BUCA 1PGOA 4NFSA 5L4NA 2YW9A 1IY8A 4DTIA 2IZ0A 4E3ZA 4D44A 2EKLA 2CF6A 1DLIA 2DBVO 2NVWA 4R3WA 3AK4A 3T7CA 3CZRA 1DIAA 1TT7A 3R3JA 3ZWPA 2FY8A 4R9RA 1W8DA 4U7WA 3ZU5A 1RM3A 4CLHA 4CQLA 4CJXA 1E1LA 1WVGA 2YYYA 1ZSVA 4RVUA 3U0BA 1O6ZA 5HTOA 5ILGA 4LRTB 1YDEA 4YQYA 1V8BA 4Z9FA 2YUTA 1VLLA 4EJ6A 3EMKA 4NBWA 2CFCA 2X4GA 4O63O 1FJHA 1P0CA 2ZTUA 1C14A 4IJWA 4KP7A 3NTRA 4MKXA 5AXAA 5B4TA 5KNLA 3ZGYA 1EQ2A 4DA9A 2BF7A 4L4RA 2BI7A 1HDGO 3DONA 1DHRA 1YJQA 4QT0A 2H5LA 2VUSA 4ZQGA 3KLPX 2PZJA 3I83A 3SC6A 1PL8A 4XZ3A 4J2HA 3QSGA 4Z9XA 2YHIB 4Q3BA 2I3GA 1UP6A 1O9BA 2P4QA 1X14A 2FRDA 4MINA 5A05A 1FDVA 1RM5A 3UOGA 4J43A 4E0BA 5B12A 1SBYA 1JVSA 3I1JA 3HSKA 3RFXA 4TSKA 1D1SA 1U2DA 4BV8A 3QE3A 3G17A 2W8ZA 4BB5A 1CJCA 4ND1A 3C7CB 1YL6A 3PTZA 4CM6A 9LDBA 4GX0A 1SZJG 4XEHA 2AEMA 4CM4B 4RPKA 1ZFNA 1EDZA 1GYQA 3ZU2A 1YOVA 4YRAA 1UDAA 1B8PA 1U7TA 2OL4A 4WKGA 3T4EA 4FC6A 1GL3A 1FF9A 3OQ1A 4IDFA 4WNCA 3STHA 3RWBA 3RBXA 4P4LA 4HX5A 5F1KA 2Q1SA 3NAQA 2GZ3A 2JJYA 4CMBA 4XIYA 4WLOA 2E82A 2ILTA 5A1TA 3FCOA 2E48A 3ZW8A 3QVSA 1YBAA 1OAAA 1ZMTA 1O89A 4K28A 3X2FA 1F06A 4JJFA 4M1QA 3S1LA 1BMDA 4E5MA 4BNJA 3IJPA 2NVUA 2B5WA 2IODA 3JQ8A 4D0RA 5JAMA 5IN4A 3GOHA 3GQVA 3WTBA 4YAJA 2XXJA 4BNIA 1NPTO 5JXWA 4PRLA 2GRAA 3BMNA 1GEGA 4RO0A 3FTPA 3WWZA 3MJTA 5AOVA 4BNTA 5BNIA 2Y1CA 2Y1EA 2ZYGA 3IKVA 4CM4A 5FEUA 3NYWA 1K0UA 1GYRA 4ROSA 1I2BA 3ZV4A 1GYPA 1R66A 1NVTA 2EG9A 4ZQFA 3FI9A 5LDGA 4AJHA 3VPHA 2VHXA 1P0FA 1PZHA 2EWMA 1KEVA 1C0IA 3ANMA 2ZATA 3GUCA 1R4NB 4J4TA 1DRUA 1MP0A 3ZWVA 4AVYA 3FTNA 2AQKA 4F6LA 1K6JA 5FFFA 1NM5A 4LW8A 3OICA 1LSOA 3DC2A 2ZQZA 3JD2A 4DPKA 1DFGA 1R0LA 4GSKA 5BNTA 2UDPA 1WNTA 5JCJD 1GR0A 1YJ8A 4RZHA 3GVXA 1XEAA 4WE3A 1AN9A 4XX0A 3L07A 5TS3A 4QTZA 3ROKA 1YVEI 4FW8A 4PLYA 2YY7A 3K6JA 5ENDA 2XOXA 1O0SA 1NQ5A 1E6WA 3W4KA 3NTOA 1PJLA 2VZ8A 2BFMA 1VL8A 1P74A 4J7UA 4PG5A 1GADO 4YYZA 3VKUA 3KYCB 4BB6A 2QRKA 4CPDA 2D3TA 2AEFA 4AJLA 5TF4A 2X9VA 3CTMA 5DF1A 4ZICA 3ASUA 3BTUA 3O26A 4QFDA 5T5QA 3KYCA 4YB8A 4MPDA 5JS6A 3RFVA 2O7SA 3SBOA 4E33A 2Q4EA 5F1OA 1X7GA 1QLHA 4IQ0A 3WDSA 4L9RA 1I3LA 3HB5X 4UUNA 3GVIA 2DFVA 3CKYA 2QQ5A 4M54A 5K9ZA 3AU9A 4OGWA 2Q50A 1OOEA 2DBZA 2DKNA 1WXDA 3VC7A 4CLOB 4KMSA 4TZKA 1SCUA 3D5QA 2QYSA 3G0OA 2EKQA 4DLAA 5KOIA 4D7AA 2YHUA 3ICCA 1LC3A 4UUMA 2ZCUA 2BFAA 3WGTA 2IYPA 3C24A 3MJSA 5JLAA 3PZBA 3GFBA 1E7YA 3DZHA 4L74A 2VCYA 3EAGA 4DREA 5JDIA 5ER9A 3WQQA 3PQEA 4XYLA 3I3OA 3OMLA 3GLQA 1P44A 4U8GA 2IRWA 4W9NA 5TX7A 1FMCA 3DBLA 2FOIA 1LLDA 3BA1A 1AGNA 4RQUA 3VHRA 4R68A 4FPXA 2Y93A 3BTOA 2G0TA 1IOLA 1PU2A 3JYLA 1N92A 2EEZA 3L4SO 4G5HA 4DIBA 1GUYA 2QIOA 4WOKA 1CYDA 3GGGA 2AMFA 3H9QA 2J5QA 3EVNA 3BMOA 2IYOA 3KBOA 1N7HA 3BXXA 1SEPA 3F47A 5TIIA 1M2WA 3WNQA 2PKQO 2VRBA 3I52A 4PRKA 4CLDA 1GPJA 3OM9A 3H3FA 4FFNA 3VPXA 1B8VA 1PZEA 4NBVA 5IXYA 5L45A 4Y8VA 1IZ9A 1N8KA 4RPGA 4BOYA 4O5OA 4DXHA 1QYCA 1XR3A 4YBZA 3Q0EA 4UVIA 3VDQA 4DLLA 1E0DA 3KO8A 3ZNPA 4GLOA 1T26A 1KERA 3MTGA 1HKUA 4A5OA 3GNSA 2VWHA 3F6YA 4JP3A 1SC6A 3OA2A 4R01A 2DTDA 4IDGA 4W7IA 3I4FA 4AJ2A 1I36A 5A5FA 1SAYA 3WXBA 4PZCA 8LDHA 1GTMA 2CF5A 3A9WA 4R1NA 4NK4A 3GEGA 1AHIA 3F46A 4WLEA 3I23A 4O0LA 4RVDA 3CUKA 3PYMA 1Z82A 1U5AA 2C20A 2PH3A 1MG5A 4GH5A 4ND3A 3ZZNA 4MKRA 5JAIA 3NDIA 2FR8A 4IDDA 3H65A 1BRMA 1I30A 3ENNA 4Z6KA 3TJRA 4QO7A 3TZ6A 1ISJA 3TRIA 3LT1A 4AG3A 2AW5A 2C5EA 5JMPA 3ZWNA 1HDOA 3DZIA 3PRJA 3DZFA 4AJPA 2B35A 4CMEA 3E6AA 4YR9A 1I3NA 4FC7A 1A9ZA 4G2NA 4UULA 1GZ4A 2O3RA 4PLWA 4PG8A 2CVOA 2DFDA 3TZKA 4B7UA 2P5YA 3FNFA 3OA0A 4GBJA 5TJHA 4MP3A 4RDIA 5KCZA 2CZCA 2NACA 4M86A 2CD9A 1QV7A 4OXYA 4IS3A 4EI2A 2NNLD 1PEDA 1N1GA 5G0SA 4YJHA 1EVYA 2NTVA 3PJFA 2ZK7A 3KM0A 2UAGA 4AFNA 2AQHA 2IXBA 1R6DA 2O3SA 1NNUA 2YV1A 2V6GA 3H9JA 4Y67A 1S6YA 3FBTA 3RC1A 4B4OA 1WMAA 1YOVB 3QA9A 5DOZA 4XWYA 1QXSA 2EF1A 4FFMA 3VPSA 4UVHA 4BGIA 4GKVA 9LDTA 4IMPA 3P2OA 3BMQB 3M6IA 1T25A 3GC6A 2HQ1A 3DL2A 1YGYA 3R6DA 4CM8A 3QVOA 2GZ1A 4ZQHA 3RCBA 5COBA 5A03A 1ISGA 1YH3A 2FSVA 3OEWA 1HYGA 1GZ6A 3HN2A 2HAEA 4IIVA 4RF2A 1GFSA 2IXAA 4MVJD 2VUTA 1L7EA 5KKAA 3GVCA 3WMWA 4PLGA 5JW6A 1HETA 2EJWA 2IE0A 4E2YA 4JNKA 3I9NA 3DMTA 3Q2KA 4IJKA 4TQGA 4RPHA 3VH1A 4OKIA 4MVJP 4J1TA 4CV1A 4NR0A 3N74A 3RU7A 4FIZA 1U5CA 4OMUA 3UW3A 4LK3A 4BO2A 4U0JA 4BGEA 2GERA 3L77A 3VPGA 1MLDA 2PR2A 2J8ZA 4XDYA 3WIEA 1P1HA 1H9BA 1HE2A 4TROA 4D43A 3ICPA 2C07A 3JQBC 3JQAD 4BVAA 5JFOA 4BNHA 4BO1A 1EQUA 2HMUA 4JGBA 4B8ZA 2PK3A 2W98A 1PJSA 1PR9A 3AY7A 3LVFO 4YJDA 3JD0A 3WYEA 5AQ1A 2VNAA 5DT9A 3PVZA 5EPOA 2CNBA 2PNFA 2NV6A 5EN4A 3DBRB 4OAQA 4JJIA 7MDHA 3U09A 1TI7A 1XGKA 1UJMA 1XLTA 3WGYA 3N7UA 4FOOA 2Y1GA 1S7CA 1PR3A 4XQGA 3K5PA 1DIGA 4W4TA 1UAYA 5DULA 1DRWA 2QHXA 4NU6A 3GMDA 4Q3CA 1ADCA 3CINA 1DBVO 1YKFA 1SO8A 3H9UA 1MXHA 5CEFA 4N5MA 1ZSNA 3IKTA 4S3MA 2X0JA 3DZGA 1NX6A 3IMFA 4JJGA 2RCYA 1VSVA 3JQAB 3ZHBA 3IUSA 1QYWA 4RJTA 1B0AA 1C1DA 5FI5A 5CDGA 1F17A 5DP2A 3RSHA 1TA4A 1YBMA 3NTQA 3ENKA 1U9JA 3KXDA 3FSRA 1PS9A 2C59A 4URFA 1NXQA 1BVUA 4EEXA 3GEMA 2F1KA 2PH5A 3E1KA 5U1PA 5JC8A 4WECA 5JO0A 1IHYA 4GGOA 5L40A 3NT5A 1QYXA 1KVRA 4D79A 5DZSA 2O3TA 1EZ4A 4HFMA 3S8MA 3QLJA 4QXMA 2JAHA 4HFRA 4A2CA 4E2WA 2GLXA 3K2EA 2I3AA 4I9HA 4JXKA 1F0YA 5IG2A 4IZHA 2J3IA 1Q7BA 4XA8A 3ZN2A 3OJFA 4ZRNA 1BGVA 4XJSA 4E2XA 7ADHA 2P9EA 4PZDA 1F14A 1X1TA 4YA6A 2P68A 4Q9NA 5C37A 1PWXA 1IHXA 2W90A 1DIBA 4MIEA 3I9KA 1LUAA 2JD0A 1VJ1A 2BHLA 3D0OA 2JL1A 3WFIA 1LXCA 1Q0HA 4CL3A 2WTBA 2WE7A 4AJJA 2FPPA 4JLWA 1GDHA 1XU9A 2CDAA 2IDZA 2CDCA 2D59A 4DBZA 5L4SA 3E03A 2VYNA 1DC5A 2VWQA 5EJ2A 1QYVA 2OBNA 1R15A 1ZW1A 2O50A 1UZMA 3C1AA 5DNAA 4EGFA 4JBIA 1JN0A 1E92A 1V3TA 3ONDA 5CEJA 5K0ZA 4OO3A 2GN4A 1NVGA 5AXDA 1NPYA 2C0CA 4IJVA 1XA0A 3WJ7A 4I5EA 3PQFA 3IIEA 2NWQA 4FDAA 3FNEA 3RBZA 2V6FA 3RJ5A 3OP4A 1F8GA 2DUUA 3W8EA 1FDSA 4KUGA 3RJ9A 4EBFA 1JQBA 5I8WA 4AJNA 3ANNA 5F21A 2BI8A 2NADA 5DBIA 4A7PA 4GMFA 3MJVA 1Y9AA 4BNXA 3V2GA 2GYYA 1TB4A 1HZJA 4ALLA 5A3VA 3RAJA 2DM6A 3I9MA 3KB6A 4KDEA 5JAQA 1J4AA 3GNQA 3OJEA 1HEUA 4QO8A 3RVDA 1U3TA 2PKQP 1KEWA 5HBRA 2JHGA 3BTSA 4BHTA 1VJTA 3KOUA 1YE3A 4HFNA 3BZUA 5L9AA 1E7RA 4HKTA 3JD3A 4MVJE 3PHHA 4NBTA 1I32A 4ONEA 3RUCA 1KVTA 1BXZA 1R4MB 4NJMA 1Y5RA 1Q1NA 1EUZA 1I33A 2G76A 2PGLA 5HRUA 2Q1TA 3R1IA 3K31A 1F12A 4CMKA 3C85A 1PQPA 2I76A 2I6TA 5CHEA 3TDKA 2FPGA 1HLDA 3PWZA 3NDJA 4GVLA 1ZZEA 3T4XA 1I2ZA 3Q1LA 1H6BA 2Q2VA 1QSGA 1ULUA 4EUEA 4IQGA 2WSBA 1HL3A 1MGOA 3ZHYA 2WYWA 4Z0PA 4OH1A 2NQ8A 2PZMA 1LU9A 1B15A 3RD5A 1DC3A 3HDHA 4AJOA 3PZRA 4NDNE 3GUYA 2EP7A 4LSWA 1T4BA 3RROA 1DJNA 1K89A 4I8XA 5F1PA 1X7DA 1HDYA 3ZNOA 4NZ9A 1IB6A 5ADHA 3WIDA 3PDUA 5T67A 4AJIA 4FGWA 1RYDA 2D1YA 1KVSA 4BMNA 1A72A 4WCFA 5HA5A 3JD1A 4TWRA 1EFKA 1IL0A 1SPXA 1B2LA 3GK3A 4BQPA 4X54A 5HS4A 3PYLA 1ZKMA 4A03A 3ZHZA 1NP3A 1YQDA 5DDIP 1PZFA 3JQ9A 4DPLA 4CM8B 3PIDA 4FBGA 3D7LA 2DTEA 1C3VA 2EJVA 4LCEA 2CVQA 5ILOA 2HMWA 3SJUA 4NHEA 4ALNA 4ZHSA 1VKNA 1W0CA 4BMVA 3DFZA 3KETA 2W2LA 5BSEA 1ONPA 2GN9A 3BIOA 1E3SA 1DRVA 4GX5A 3ZV6A 1PX0A 4RVGA 3JQ9C 3RUDA 4YQZA 1M67A 4K9DA 4ND5A 2V6MA 4CM7A 2B4TO 3GRKA 2QYTA 2YQ5A 4OQZA 4L4SA 3ZW9A 4J0FA 4E31A 5C3MA 4JX8A
chains in the Genus database with same CATH superfamily
1Y8RB 4HNUA 5BVGA 1D07A 3GRUA 2H7VA 3P9QA 5DTJA 3EXIA 2ZVJA 3HM9A 3ZWXA 3GN2A 1UPBA 3CWQA 3DD5A 5AKYA 5EHZA 1AJEA 1NQUA 1J2TA 3NIDB 2OSVA 2QTAA 4G0OA 4WCDA 2NP7A 1FSPA 1T15A 1AZWA 3QWAA 3QLEA 4DMKA 1GZHB 3WQHA 3IPXA 4JI3B 4MICA 1IJKA 3CH6A 1WUHS 6LDHA 1OAOA 2OE2A 4TV9A 5T64A 1KEZA 5LXTA 4E51A 2Q4TA 1PJQA 1XEWY 4GPD1 5LQAA 1NQAO 3R3XA 2CE7A 5JWOA 2QY6A 1D2RA 3AVUA 3N8NA 2F3UA 4J0CA 3ZH2A 3VM6A 5FBLB 1N78A 2HCRA 2A0WA 5K5EA 3TR0A 5IT0A 2RC5A 2BJWA 1NUPA 3HVIA 3FNRA 3ROGA 3QKSB 4LY6A 3UA3A 2WB2A 4RIIA 2JCGA 4XWAA 1S7GA 1E60A 1AQNA 2QTGA 3JCZA 2DYKA 5J5VA 2FNAA 4G86A 4IIXA 2D1RA 3V2IA 1PQYA 3PQ4A 4LWPA 3DEHA 1HYEA 4W9NC 2JHFA 3UMVA 1J7JA 4F60A 5I4KA 3ICWA 3K0AB 1N6HA 3EC1A 5EGSA 1JQ3A 2JD2A 3PICA 1T0BA 4E21A 1Y1TA 3M6VA 2D8AA 1C7RA 3HCEA 4PX3A 1N0WA 4URWR 2H1LA 3LK7A 2Q4DA 3LM8A 4KI7A 4POOA 1JFRA 4Q00A 3QXXA 2BMWA 3A36A 3UJ8A 2WTUA 2WHEA 3HYNA 3X1DA 3N3BC 4O1MA 2C92A 2I1LA 2PO5A 3ZYCA 4YLYA 3I9FA 1TYCA 3LA6A 3MELA 1SU8A 2X13A 2OQRA 2ZIWB 3C8UA 3JPYA 1JKXA 2OTCA 3NHUA 4GRDA 4XLZA 2LDXA 1H1DA 2OC4A 5F9MA 1MX3A 3FNGA 3WWCA 1FLDA 1BDMA 1SVIA 4J6FA 3RUFA 1PW5A 2B61A 4EKIA 1VKOA 1FRZA 4WCFB 2RHCA 2XXAB 4EUFA 2VHTA 1E2HA 2GILA 2P3OA 3QKSA 4RVFA 3HDJA 3MD9A 2IIQA 2WDZA 3AKEA 4P7BA 4EO4A 2CVZA 3JQAA 4UUPA 5DH9A 1O97D 2OO5C 4XVRA 2HRQA 3MT0A 2NTJA 5EWJB 1WDTA 1ZI6A 5JSYA 3UICA 3UM9A 3THXB 2PQMA 2O2YA 3HKDA 3CR7A 1YE5A 4OIMA 2P9CA 3ABOB 4QU8A 1P7CA 2VKQA 4RLSA 2HGSA 5DIZA 1BG6A 3N58A 4FJ1A 4DBLE 1XTJA 5AYVA 3ZOZA 1FNCA 1R3DA 2ZE8A 2ZSDA 4OREX 1GVNB 2BFOA 1BVYF 1Q7RA 2PY6A 2GI4A 1H2YA 4NZNA 2FW9A 2E5WA 4X20B 4GM4A 2ZPUA 5MFPA 5ALRA 1K9VF 4CMJA 3Q0TA 4TTRA 2P4UA 3G1UA 4YCMA 1RYHA 5ICSA 1EM6A 3QLTA 4PXAA 3GLHA 4ADSG 2XIQA 3L8DA 1N1DA 3KELA 3V8PA 2ZTVA 2P40A 1FFXB 1O9HA 4JROA 1LBEA 2C97A 1Q11A 3AIOA 1L5YA 4IVRA 1DKMA 1UWVA 2AOUA 3KXLA 1R0XA 4J2OA 2G17A 2GKOA 3H18A 4KXVA 4AJ4A 4DA0A 4J16A 4JVSB 5KQSA 5LD2B 2NXCA 2QY9A 4KKXB 1KAMA 3QU2A 1QHIA 3ITDA 4MQ4A 2IUYA 4AY4A 2HNAA 5HE9A 4DQXA 1Z2EA 2OMKA 3H11A 1IM2A 3KKPA 3PEVA 4KK3A 4EF4A 5ISMA 1XRLA 4TYWA 2B3TA 1ISIA 5CK5A 1I01A 1YBHA 1ZBQA 2PO7A 3PNSA 4DL9A 3K0EA 4HUTA 3KQKA 3I9V1 1ZN9A 4ZI7B 4HZUA 1BVRA 1CQIB 1QE3A 1V7CA 2SHKA 4HCJA 3H8WA 5JE8A 3R7WA 1PKXA 2EZTA 3OBIA 1FVFA 2ACVA 2ZE7A 4ETIA 1FXUA 2C00A 3QSYA 1QMGA 2Y66A 2GETA 3I01M 4YRZA 2QU7A 2GD2A 4X7PA 4Q02A 3TLKA 2BEUB 2YXEA 3LIIA 1X87A 1XVVA 5LD2C 4TTPA 4AS2A 5MF6A 4ZD6A 5TGTA 1PBTA 3L4BC 2C3YA 4A9AA 3DWGA 4JMPA 3M2TA 5DXJA 3G2LA 2FSFA 2XGSA 1CZKA 4Y9DA 2I65A 2JFZA 1IDOA 3LLUA 2X42A 5DCUA 4EYSA 4KQ6A 4AWBA 4DLUA 3PNLA 4BU0A 2PUWA 4NQZA 4BN0A 4IFBA 3FSGA 4WI1A 1OFVA 4RVSA 4D4JA 1NAIA 1RHKA 4QDKA 3BVPA 1RABA 4HDAA 2VUUA 2D1SA 1PN3A 1DUVG 1LRLA 3EFBA 3FXAA 3ME5A 4W7HA 4O08A 5JNTA 2DRIA 1V5GA 4QDOA 4MGZR 1U8UA 4IMRA 4E5NA 4ZYVA 3DVRX 1WW8A 2WT8A 3NR2A 4J0EA 1GUZA 2I1WA 4CQMA 5FD8A 1EK0A 3RG8A 3N0XA 2YWDA 5IUJC 1G41A 3U44B 4CZ2A 1LVHA 3NJRA 1AMNA 1Q0QA 2C57A 1IN6A 1JSLA 3EZXA 3IJRA 1RZ3A 2AV6A 4PRZA 4Q4HB 3BGIA 4YV7A 2BJHA 2R8OA 5C1DA 1ZIPA 2AZTA 3ZDZB 3A06A 2R86A 3KD2A 3GCXA 1W88A 4IL5A 3NZEA 1PR6A 2WYIA 2UV8A 1Y5MA 3GHHA 4ENWA 3WNDA 1M0WA 1YZNA 1N2JA 4MAFA 2ZJZA 3VGPA 1OJ7A 3OF2A 4W7SA 1H2XA 4L73A 4FIDA 1R6XA 1Y7TA 2P2CA 5T4HA 8AT1A 3GMIA 3D5TA 1F2TA 1N6IA 3AKYA 2WMYA 4CLEA 5JSFA 4F86A 2W6JD 3IKMB 3UUWA 2PDAA 3TMAA 2FWNA 1TCCA 1X1CA 5ENVA 4P4TA 4YP0A 4CKBA 2CV1A 4ICIA 1MV8A 1QH8A 3DF9A 4ZGBA 4DHEA 2ANCA 3EQZA 1NDQA 4OHWA 4CT5A 3HHPA 1Z7YA 1XXHB 1XYVA 2EFHB 4OFZA 2F3TA 2IHZA 1W96A 3AZQA 4KEAA 1VJ0A 3DXYA 4HDQB 4C0LA 2WIKA 5A2QA 3U16A 4QQRA 3N76A 4KUEA 1M66A 1QIGA 1BA2A 1BWSA 1N6KA 4BWGA 4YVFA 4N7MA 1DCKA 2JDIA 3ISVA 5H9WA 3EZLA 2PX4A 4G1VA 3TCKA 3LW7A 3Q11A 1N57A 1EUDA 3WWEA 1VI6A 1J9ZA 3H11B 4YDQA 4L76A 4WZAE 4OP2A 1JWAB 3TECE 1P0MA 5E2AA 1P9LA 1OLUA 3GXOA 4JLAA 3C7AA 4OSPA 2R66A 1T5TA 1ACMA 2Z9CA 4FD3A 3BOSA 4QL3A 1N6NA 4FKZA 1XEWX 5ALKA 3DHEA 1O03A 3QHPA 2NYVA 3AI3A 1ABBA 2VHVA 1IM5A 3O1HB 1N2EA 16PKA 2EYQA 4B2PA 4BC0A 5ITZB 3GLHB 1SBQA 1KMCA 2R7MA 3MLAA 4WY8A 1EDOA 1KF0A 3RBVA 5G41A 1VG0B 1HLPA 3QPBA 2F8LA 5JNLA 1J0AA 3L01A 3AHCA 3Q8XB 1V1MA 5AVXA 3UVEA 4GSLA 5CJ2A 3NBMA 4URXR 2ZAMA 3O93A 2JFNA 4INJA 4LF8B 2QLJA 2OGUA 4Q5IA 3N28A 2CVFA 2G1AA 3C7DB 3TSWA 4FT2A 1G3QA 4YT5A 5IAAA 4QGSA 4XVUA 1TMKA 3GLGE 3G5LA 4GKJB 2BGKA 2QJFA 5IJ0B 3DVLA 3GPDG 1RZRD 5ESXA 4LVOA 4TVKA 1F5NA 5EIOA 3P7MA 5F3DA 4Z53A 3V8RA 1HOXA 2FSPA 4DWJA 3R7WB 5GMOA 3F1KA 2CE2X 5KYUB 4LKOA 4V0OA 3ZZ0A 2G72A 4TWJA 4Y1FA 1PNQA 1EHIA 2GSDA 2GXSA 1MENA 3EN0A 3FLEA 5BQ5A 3IV7A 1I0LA 1U4SA 1L3CA 3P2JA 3RHTA 4BBPA 5HS6A 2OFXA 4E13A 3RYHA 1M2NA 1OR8A 4V2IA 5C80A 1PV2A 1MEOA 2PMDA 3R9IA 1LQUA 1VFPA 4P5PA 3H9GA 2D0PB 2OXRA 5FFNA 2W6ZA 5ENZA 3O8RA 4XGQA 3DE3X 1T2CA 1YTLA 3NCHA 2ZJ5A 3PNOA 1WBDA 4HYTA 4MRPA 1PT9A 4UM8B 4V0SA 2R5NA 2WFMA 3HUDA 4P93A 4O1IA 4XYGA 3W5BA 3DCYA 3DAFA 3M6FA 1SCNE 1UKZA 2H5JA 2XVXA 2QZ4A 4P92A 4Q3DA 1IM8A 5EUQB 4KO1S 3OBBA 1YI8A 5FIUA 2AOTA 1G7CA 3S6JA 1VHLA 3DH0A 3WZMA 4Y0VA 3A3YA 4FJ2A 1FB5A 4LV5B 3AC0A 3F5MA 3R0VA 2H1WA 4Q0MA 5G0WA 4Z51A 1GRRA 3W3AD 3V7FA 2R751 5LDHA 2W6IA 5BY2A 4DR7B 2VQDA 2I5PO 3DMFA 5C9ZA 2Z3WA 5HFNA 5K6AA 4AM8A 1FFDA 2REBA 3LP6A 1U2GA 2ZSBA 4RS3A 2GBPA 4G5XA 1PUIA 3U7QB 4Q7MB 4I50A 4CCWA 4ZJZA 1S8AA 2G1UA 3TZBA 2JZNA 4U9UA 3UF0A 1ES9A 4N39A 4GZ6A 2XDQB 3L8MA 2D0OB 3AM4A 1K6XA 1FDIA 4GZLA 5IKMA 5GVSA 3F5SA 3ZW7A 1QOZA 4CEJB 1T8SA 3AL0C 1KO5A 5MGBA 1VI5A 1EXVA 1PJ3A 2HRZA 3EISA 4KLAA 1ORVA 1TZ2A 1KMQA 3KFXA 1YS1X 1XA3A 4BWFB 1ZA2A 1JX6A 2ONYA 4C14A 3W3AA 1ZAKA 2W2MA 4OFXA 4MQ6A 1C4OA 3JQEA 1P5RA 2J30A 1L5MA 4Q1AA 2ZAIA 4YH1A 1X42A 2PBLA 2WR8A 2Z8XA 4HMOA 2XWBF 5CAEA 4P22A 4UEKA 1PJ4A 1U7HA 2ONCA 5FPTA 4OBWA 1X7XA 1ZXBA 1IEXA 4N47A 2X3UA 4EELA 2XTMA 3CC8A 2OWDA 2YHIA 4Q1EA 3D6UA 2E89A 4TKUB 3QVJA 1TMOA 2GN2A 1AO0A 2NQTA 1JAIA 2A1TS 4W5OA 4L5CA 5KVAA 5CLIA 1T9ZA 5IK2A 2FPLA 4YRIA 3LDGA 4IZIA 1OC4A 2X5KO 2J3EA 3OCWA 1DT3A 2I2BA 3D54D 1UFRA 3QU9A 3ZWBA 5I9IA 1GD1O 1S8FA 3ANSA 4C01A 3C16C 2HIAA 8GPBA 4IDAA 5BR8B 2BE7A 2W9XA 1OBVA 2A9KA 2F1RA 2O23A 3PD0A 4WOCA 5EYPB 4ASUA 4PNZA 1UDRA 5BVHB 1KTIA 3NRCA 3QPAA 3BF8A 3VBCA 2CL5A 3QX8A 3ZVMA 3V4PB 9MHTA 4WQMA 3Q9NA 3DDZX 3QTBA 2V9ZA 3C3AA 4RULA 2QTLA 3WL3A 3W5JA 2A9FA 4L6CA 1XQVA 1K8ZB 1STOA 2ZWOA 3KE9A 2CJWA 1H8EA 3FOCA 3B6JA 3HNPA 2VP9A 1MQSA 2H06A 4INZA 1JTFA 4FILA 5DN9A 3WSWA 2I2CA 4CV2A 3CJRA 2ZTHA 3IV6A 4FKBA 3VI3B 4BRZA 1PK9A 1PQUA 1TO2E 4BGVA 1SZCA 4GG1A 3K1TA 4HDCA 1UFVA 1POXA 3SXPA 2WKPA 3UWOA 1XXHA 2V6IA 4PPGA 2QTVB 3M34A 3IQHX 1Q84A 3A4VA 4I2VA 2PBZA 4GBGA 1JGTA 1OXKB 5D2CA 5KX5B 3ITKA 3L6RA 4B75A 4BE4A 4NF2A 3IAEA 1Z8DA 3LZDA 3KOXA 3W5VA 4Q21A 2H2WA 1QP4A 1CY1A 1TZKA 3TF5A 2OP0A 2BEWB 4BWVA 4KV7A 4NBRA 1OFIA 1SKYB 4R8LA 1AN0A 1Z47A 3K2IA 3RBAA 1ZQ9A 2J3DA 3M1IA 5COQA 421PA 4E2ZA 2V1UA 2R85A 1EFHA 4QU0A 4EUKA 2G04A 2QDXA 1CDOA 1LV8A 4M8IA 4M0MA 2BGTA 1ILEA 3CIFA 4MS4A 2X0FA 3TTXA 1P7WA 2MYNA 3WNCA 3OUUA 1E5VA 5BQPA 3FSGD 3KEMA 4EYGA 1TJ4A 2ADMA 3GRYA 4UUQA 4C2UA 5LP6A 1BO6A 2CLFB 3UXYA 2JGNA 1WMEA 3L7NA 4OTZA 4Q9IA 4KX5A 3O2NA 4KLCA 4MV8A 3SJAA 4WXRA 5C8VA 2Y1DA 4YPFA 4EABA 5E4TA 1HFWA 1GNQA 1FP1D 3OZBA 4ZV9A 4EY3A 4YV1A 3CRW1 1ZUWA 2G4VA 2OCKA 4GW3A 1SUAA 2PV7A 1SUSA 1Z2NX 2KB0A 1W76A 3V4SA 1UQRA 5TE9A 4A6DA 3M3DA 3C15C 4PZEA 1NQOA 3E9YA 3K1AB 3VNRA 3ZD6A 1FQKA 4QZVA 2ODWA 4QUAA 3X1YA 3HXMA 5TLSA 4QXAA 2QRUA 2BE9A 4F9FA 4FU0A 3AP3A 3RVQA 3UXEA 4Z9BA 1G59A 5AI0A 1CUVA 2YJ6A 1PT7A 1RMYA 1HSZA 4H31A 4EAAA 3IAM1 3LC2O 3ZDCA 3RYFB 1VSUA 4UTXA 3CUWA 4J91A 2FQ1A 4KSYA 1NONA 2WK1A 4ZREA 4OLJA 3VR3D 3WJAA 5HG0A 5DWQA 4CIDA 3VZCA 2PMCA 4QUKA 5C8XA 3EUEA 3ZHOA 1P61B 1SZDA 1TAGA 4S0ZA 4RA6A 4DFDA 3HYSA 1W29A 3CR3C 4LYHA 4DQKA 1JKMA 4QFCA 5C3UA 4RY9A 1G0NA 2EL7A 2WZQA 1KE1A 2PUBA 2HXYA 1SCIA 4WK2B 3TZEA 3F9RA 1BC5A 4ON9A 2HN9A 3KPUA 3IXQA 4O33A 4RFVA 2WJGA 3O74A 4LVUA 4MIKA 5U4QA 1UODA 4II2A 2O2ZA 3WL6A 4MXDA 2E49A 3ZNNA 3MJEA 4EBBA 1ADYA 1QFSA 3DTTA 1YJ5A 4YAIA 2K2QB 3QX7A 3RI3A 1JR3A 4XD2A 5E4FA 5IT5A 4TMFA 1YONA 5THXA 3L05A 5JZBA 1EUDB 1P1RA 1SKUA 3PC6A 5FOUA 2J0SA 1NE2A 1AKUA 4JYAB 1DBIA 1GWNA 2LBPA 3BAZA 3BHJA 3D3NA 3KUUA 3ZDEA 3QPUA 3PKIA 1K3TA 4CNBA 4D57A 1E64A 2ZS9A 1U8FO 3WLQA 4DBVO 3K0FA 1E6MA 3RTCA 4EPXA 1J07A 1WEHA 1Q0PA 2VT3A 3BT7A 1KO1A 2C8VA 3C98A 4YRTA 2OYSA 4K9OA 5T3YA 3LDHA 4F1KA 4CKCA 3QXSA 3HPRA 3KPWA 1Y7HA 3LU1A 2JA2A 4HXFB 3QMMA 1E1RD 3DWFA 4PSCA 1ONSA 3AY3A 1UMDB 1A5BB 4ZXPA 3Q3HA 3TQCA 2P4EA 3F6PA 4C6RA 3JYNA 4Q1BA 4BLQA 4L15A 4URHA 4NV0A 4E12A 4UTVA 8MHTA 2GPBA 1II8A 3T3EA 1NUSA 1E2UA 1ORWA 2RH4A 3OFND 3IVGA 4GHWA 1VL5A 4LRWA 3P32A 3WRYA 5C8YB 2B1GA 1Z6GA 4BCDA 4DEYA 3ABRB 1PR1A 4M21A 1JL3A 4HZIA 4QYTA 1S2OA 2WUWE 1FRFS 3K8YA 1NC1A 1A7AA 2WWXA 1HUQA 4OQNA 3T5BA 4KVFA 4QUJA 1F51E 5BT9A 4O3MA 1ORHA 1AKVA 1RE1A 2PU5A 3OLCX 3GLTA 3TTWA 2HHCA 4EDHA 4ALKA 2O57A 1PBNA 5JS2A 5JARA 3R5KA 1DAKA 4WPGA 2VN8A 2ZI7A 3SKXA 5K6AC 1W6RA 3MUOA 4RQAA 4TLLB 2YJ5A 3EVTA 2I6UA 3V6MA 1RYNA 2I54A 1U80A 2DPXA 3ILSA 3R6TA 2P2YA 1UDXA 3A9TA 3KU4A 5DHAA 4GYJA 3VNUA 4RM2A 5IN5A 1TRHA 1R37A 3T0FA 2FZ4A 3B8EA 1PSZA 2C82A 3NBKA 2IU3A 1AS3A 1W25A 3UWMA 3VJMA 5LYJF 1N2ZA 1P19A 1U99A 2RHOA 1JHQA 4ER6A 5FPYA 5CIYA 3VZSA 1KZYC 3DUFA 3EZFA 1OH8A 4JYZA 4XTRA 3J81k 4HAZA 2W2KA 4BAZA 3EXEA 3W6NA 3RSCA 5JNVA 1I2DA 1RS0A 1SXQA 2CJYA 1IPEA 2NYRA 3PQ6A 4CDGA 2I78A 2X9GA 4PONA 4BTLA 3K9FC 4G5RA 1L4LA 4RZ2A 2JFPA 5AVSA 3OIWA 5CLHA 1DKLA 3KHKA 4CTNA 3BE5A 1KMHB 5D7BA 1ZGBA 1NVBA 1SKQA 2FVYA 1JI3A 3ESRA 3RAEC 1XCBA 3UA4A 4DXDA 3C4VA 1B76A 1RRMA 5FUBA 2UU9B 5JHGB 2J5KA 3GT7A 1OPXA 3CN9A 1MT3A 1XU4A 3AG5A 3Q85A 3WADA 3N8KA 1BIFA 1V11A 4JT4A 1ODJA 2OC9A 4LJ9A 2WJHA 4OK3A 4UBKA 1LPMA 1QLWA 1H2BA 1T9GR 3JS5A 2QRQA 3G8BA 4MP8A 1QGYA 1LTQA 4MQEA 4ZCRA 1B73A 3W78A 1ZUNB 1JIQA 3CSDA 5FL7D 5IKEA 2ZAYA 1K7CA 3O90A 1OV4A 2RAUA 3M9LA 3IXMA 2I66A 2O52A 3H1TA 1X1RA 4FQ7A 3KZCA 1TUIA 4X44A 4EGCB 1Q21A 1AUOA 5IC6A 1SEVA 3SM3A 3IP7A 3ZJTA 2XY4A 2VL7A 3KKKA 3WLHA 3E48A 1MC5A 1M6WA 1G6HA 2DPGA 2A86A 2GX6A 2Z2IA 3D3WA 4O4LB 4JT8A 4YX9A 2DLCX 2NW6A 3WQRA 3U7GA 1F9EA 2PWAA 3KJNA 3SHWA 3QKUA 2OENG 4WFKA 1MIHA 1UC9A 1FXWF 3IHTA 5TS2A 4JAVC 5LA6B 1ETHA 2IC5A 2EIHA 1XLUA 4C30A 3I76A 1G1AA 5FPPA 1DO2A 2O3UA 2VAMA 4NABA 4K9PA 4BLUA 1FOEB 4LK2A 1VIYA 3L2OB 3Q3IA 5CDHA 1JG3A 4EA8A 3J7TA 2XV1A 3UJ7A 2HCTA 3EWSA 1WY5A 5HNKA 1ITZA 3V7UA 4I9NA 1S2IA 1W73A 2GO1A 2M6KA 3ETDA 3FWKA 1U8EA 2R7AA 4CHGA 1CNFA 2BAGA 3FETA 4K3VA 1FQJA 4ILKA 5D84A 5FH9A 3MYYA 4E7OA 2NUPB 4KN8A 2VJLA 1IXYA 4F4IA 4IV0A 3A27A 3I9JA 3FGNA 3OQIA 2AOTB 1GZVA 1K4KA 4RX1A 3KNZA 5B1YA 5KTPA 2XMDA 3PPIA 1OFUX 5CJJA 1UM8A 4LZPA 4QSHA 4U5XA 3LCJA 1TUEA 3U3RA 4ZI2A 5L6MB 2I87A 4P53A 4Q4AA 4CGYA 2REXB 4HEA1 3STUA 1R12A 1SNYA 2FRDC 3OX4A 5BOVA 4QPJC 3WHKA 4MVJM 1H0KA 2YKGA 5DI9A 5GONA 1BX0A 3DCJA 2GZRA 3W1WA 5KYYB 2G5CA 5IDQA 1W2GA 3FFXA 3PDCA 3HJAA 4YALA 3EJWA 2ZYUX 4WW0A 4GXTA 4I4IA 2KYRA 1YO6A 3OECA 4BVJA 1AV6A 1OY1A 1L5FA 1YRHA 3VV2A 4CM3A 3JAKA 1YCGA 1H8HD 1HC7A 1OZHA 4DSAA 2AJCA 4Z7JA 1A88A 1U8XX 4RIHA 1NU8A 1ZD3A 2HT6A 5A9TA 3SS8A 4AKIA 3HY4A 4LTMA 1JG2A 1E94E 1XA4A 3C3BA 3IALA 5J2UB 3KOWA 4LHYA 4BGUA 4D9MA 4U7TB 1W19A 1UC4B 2LDBA 2IUTA 4FMBB 2YWBA 3BIJA 4BIIA 1LH0A 4W1SA 2Z56A 4PNHA 3ICOA 3RIYA 3VTKA 3SMVA 1DLJA 1R5NA 5JZSA 3FMOB 3GJ8A 4HBGA 4QXOA 2R47A 4ES6A 1WL8A 3LY9A 3PJEA 3QLUA 4YFVA 1SHZA 2FHSA 1PTJA 5HKAA 1CUFA 1GFZA 2QR2A 2VHJA 4MJXA 1T36B 3LC7O 4H7EA 3BJZA 5EFZA 2XEDA 4RSMA 2XTAA 4I1YA 3WIUA 3BHMA 3LUPA 4GI7A 2ZIFA 1QP8A 3I6MA 4NCIA 4TZTA 3EFOB 4C7XA 1SU4A 4BJ1A 3D3JA 1FDTA 2O2JA 4Q48A 1C0KA 3RW9A 4GYKA 3VNVA 4TV9F 3LTNC 4XYBA 4H6XA 1ZAYA 2GPJA 3WMRA 3ZXSA 3WGMA 1HE3A 3A04A 2YVQA 4GS5A 1EFCA 5AM4A 2VQ3A 5ICCA 2MSNA 5BN3A 4PZZA 5IJ9B 3C48A 3U1VA 1M33A 2R4UA 5FKJA 4M1ZA 5LQCA 1ECGA 1MJGA 4FSDA 3DPSA 1K6IA 4TYYA 1IJEA 4HEHA 1VRVA 1WDLA 3TOCA 1DAPA 1JQAA 2R6HA 2WHPA 4OJTA 3KEOA 3IQEA 5F76A 5KVVA 1ZCFA 3MLBA 1SWVA 2P11A 4CM1A 2A2ZA 4BIMA 2GPSA 1X9GA 4LYFA 5BV7A 2AZ4A 3W2FA 2YJNA 4YTEA 2E4AA 4XGNA 2DBRA 3OLWA 5EXPA 1MOQA 4HWPA 4M87A 4NYJQ 2XTJA 4PAOA 2KBEA 3TZLA 1CPYA 3KQSA 1KFBB 3ZQUA 2GGSA 3HZOA 4H16A 1H2WA 1JAZA 3BDIA 3B3AA 2A4KA 2RI0A 5HZMA 1WDWB 2V8BA 2XQFA 4NBUA 3I8XA 1AGRA 1JXOA 1V3UA 2V6BA 2W2QA 1XTPA 3L5OA 2YV4A 4JIGA 4LV6A 4AXXA 4M0KA 3ZKWA 4M37A 3T1VA 1SFRA 1IHOA 1D4FA 1RQPA 3JD4A 2YY5A 3EB9A 2Q21A 3G2MA 3O8NA 2I7CA 1G5QA 3EVEA 3R5SA 1U7DA 4RJJA 4BFUA 1SXJA 2HF7A 3GT3A 3S2FA 4PNPA 5I9MA 2EGGA 1S2DA 2OO7A 4G1UC 5KDDA 2XE8A 3EW7A 1VG8A 5HRAA 2HRRA 1A9YA 1XLTC 3VH4A 3U19A 1ZK4A 2BR3A 1IN1A 4UM7A 3C6BA 5JWHA 4QTYA 1TAQA 4EA9A 3UPDA 3VO2A 3CH4B 3KPVA 3TRKA 4BGDA 5CTJA 4ND2A 2VNJA 3TAHA 2B8NA 3OFJA 2GBLA 3BK2A 2IPXA 1F3OA 1KY3A 2MSLA 2EARA 1NW8A 3STTA 1T6XA 4I1IA 3HN7A 4MJ3A 4EFKA 3EW9A 4MB6A 2FG5A 2FA9A 1OFUA 4D6XA 1YUBA 4UVGA 2BUBA 2DB3A 4AY5A 1QTQA 3CBQA 1K3FA 2AXNA 4HWGA 1KDPA 3B6KA 2H8GA 2GK7A 3R9XA 3IQXA 5NLLA 5C4GB 1EU1A 5KTTA 3E8SA 4MEBA 1JS1X 2Q46A 2X86A 2J3KA 2X40A 3GQBA 5DLPA 1Z8FA 5BOSA 3GR6A 1RRCA 4MA0A 2RBEA 1D2CA 1QRDA 1X2EA 3SGLA 2NX2A 1Q0SA 2DULA 1E4OA 1ZNZA 2D0DA 3GDFA 2XCLA 5JFGA 3VI4B 2PKWA 3FR8A 4DG9A 2B4QA 3OJWA 1PJAA 4QBHA 3IYLW 4G97A 4YT8A 4QOJA 1S1CA 1ISFA 2KLBA 4LQDA 3ILHA 4QARA 4QG7A 1RWMA 2JCXA 4BO3A 4FGLA 1DTWB 1L7XA 4ZYLA 2IHNA 2I67A 1VJ5A 3U5TA 3ZZTA 5KJ1A 2D54A 4XQ9A 1NLFA 1JHRA 1LPNA 5AJHA 4EFMA 1N5KA 2J5RA 1DQZA 4GMGA 2PMWB 2VIIA 2VPWA 4P58A 2CJPA 1PDOA 4K6GA 5CA0F 4QGGA 4HDRB 3IHWA 3T1OA 4GP7A 4PQEA 1QFYA 2J5XA 4IXNA 4D45A 4BNLA 2R6GA 1OAOC 1VGQA 2PEYA 3MT7A 1CUWA 1Z0SA 4GXRA 2C61A 3FTEA 3HE3A 4FCWA 5EQFA 5F9FA 2H0AA 1JSXA 1V4NA 2PIAA 4YCLA 2BONA 4OG2A 4PSAA 5I8ZA 3ETEA 1QIDA 3F4KA 1JQJC 2NLOA 3QVWA 5IU6A 5CCDA 4WFQA 2GM3A 2GM4A 1YVPA 2A9VA 1BTOA 4B80A 1XB2A 2ZYAA 4C1NA 5KNCA 1M2OB 4JCOA 1PYDA 2NTYC 4MJLA 3T7IA 3W6OA 2OM2A 3OE5A 4QLAA 1NMSA 2QMQA 2Z1MA 2IF0A 2BZ0A 2PFGA 4HNAA 4F9TA 3ELDA 2VDUE 1J8YF 4ZV7A 5JIBA 1BE0A 1N0VC 2XMGA 4IDEA 1JKJB 4K40A 4DF3A 4DCNA 5KNBH 3KYDA 3AVYA 1X70A 4RF3A 4RK5A 4OMCA 5MN4A 1DHTA 1O5IA 1VCOA 2DWUA 1PJ2A 2ORIA 3IAS6 2Q5CA 2VHZA 1E3EA 5CVDA 5K01A 2QB5A 1TF7A 4EWLA 2DJIA 1M1NA 1YIOA 2O0MA 5EWJA 3V8NA 5KJCA 3R0ZA 3ABZA 4HLQB 4C5CA 4CIVA 4E4RA 1DBQA 3U3ZA 5JS1A 3FZYA 4PTYA 2W6NA 1WSDA 4LECA 4UFPA 4DGSA 4KDFA 4GR5A 2IYFA 1HT2E 3ZC3A 1VYUA 4Q7KA 1KIAA 5DNUA 5I9NA 5JRDS 3SSOA 1DKRA 4TTAA 3ZK8A 2W83A 4GPIB 1Y42X 4MRRA 4L8VA 1N6LA 4M8SA 1KAOA 7AT1A 4NWIA 4EJSA 1CG6A 1UZLA 2LV8A 3PC4A 1JLLA 2NO1A 4FFSA 4OXRA 4L0MA 5KJ6A 1R00A 2XI4A 3K9QO 3JQGA 4RYDA 3SR0A 4L51A 2VTBB 2IX3A 1E9BA 1HDXA 4TT3A 5G1OA 1ZUNA 1JIXA 1NM5C 3KR0A 4RLHA 4AJKA 4RYLA 4JK3A 4MGIR 4Y6SA 3HWWA 3NM6B 1GV0A 2ISQA 1T5HX 2GZ2A 3KP1A 1CUBA 5EKXA 4AJ9A 4AF8A 2WUFA 4PC7A 1B41A 2HNBA 3FRHA 3B7GA 3JVUA 4RGYA 5REQB 4Q1VA 4QT4A 3CM0A 2REQA 2Z04A 1JKIA 3ORYA 3CEJA 1RM0A 1IJBA 3IBGA 3LX5A 1PUXA 4GPAA 4DSNA 1PT6A 3KSRA 3W6UA 3W05A 3CLUD 3SZMA 2WJAA 3OH8A 4O2BF 1NZFA 4R7GA 1DAGA 5LIRA 2OR3A 2P35A 3KOMA 4LYGA 1QV6A 2B1IA 1HTWA 1Z33A 2Q1UA 4RKEA 5D86A 3RTGA 1UBNA 2IIBA 3MQ2A 2ONJA 4X5OA 3NGLA 2YIJA 1GVHA 5K3SA 3WMGA 4X6UA 4ME6A 1JR2A 1P1KA 3NP9A 1HMPA 5H3CA 4IJ6A 2QJRA 4D9JA 3EEIA 3WHIA 2NSLA 1X2BA 4ZOLF 2PFKA 4RGVA 4EZIA 3KLBA 1BOFA 4AD8A 1Y9ZA 3CKMA 3DW1X 4IO1A 3QBTA 4M1SA 4W1PA 3ZVRA 3B13B 1TTPB 1Z45A 3NTUA 1JMVA 2OBYA 1Y8RA 4PLHA 3UATA 3V7NA 3RQIA 1IK4A 5BVGB 3QHAA 3SC3A 3ONVA 2F1OA 4YMSA 2GLUA 3QEOA 5A9RA 2PYZA 1AHNA 3SFTA 2ECKA 4D42A 3VU3A 1UXOA 1XF9A 5IW8A 2ES4A 2X8BA 2WIDA 4A0SA 4Q82A 3TIFA 1ANKA 4G65A 3TNFA 1DWQA 2IUFA 4J0HA 2YFYA 4OHZA 2H9YA 3IBSA 5K0TA 3CB2A 1SULA 3CNLA 1JYSA 4H1UA 3COWA 5HGXA 2CCGA 2J9FB 4WLUA 3HWSA 3OKPA 1VBKA 3QWBA 4FI3C 4FYJA 4TMTA 2FEXA 4WOBA 4KZPA 5JAOA 4D5GA 1BZYA 4NFYA 5HK8A 4D81A 1FS6A 2HWUA 1O87A 1Q50A 2HMAA 3BRCA 3D4OA 4I81A 4Y7DA 3T3MB 2G7ZA 4FZ5A 1CE8B 3ZZ1A 2PE5A 4E15A 3IRUA 4V3BA 2XPCA 1BN6A 2HCJB 1CEXA 2XUZA 5HM8A 4Y9TA 3EBLA 4D3FA 3N3AC 4HLUC 5CDSA 1DFIA 2X5JO 5JH7A 4UU8A 1US8B 5BR4A 4G0VA 2IYYA 1X1DA 5EPEA 1NNI1 4ITVA 3KUDA 3A1VA 3VSEA 3WYBA 1L1FA 1MD9A 2LZ0A 4ZAWA 1Q44A 3FBWA 4C1BA 4TWIA 1PDWA 3FUUA 1LLCA 1ZUIA 4Q6WA 4C4TA 3N53A 1RFLA 3T4UA 3FSJX 4KWCA 1NF9A 4YXFA 3D6JA 3RNLA 2FDCA 2R1UA 1ZOPA 5HF5A 2W4IA 1I1OA 4I1UA 3TW8A 4QUIA 2X77A 5EXDA 3FNBA 3T41A 4IIFA 3H42B 1ECPA 4JVMA 4HXGA 2ZIAA 4C5BA 3LGSA 2PJRA 4PM4A 1KSFX 4KU4A 4RIGA 4IGEA 1IBRA 1F2UB 2YMLA 2ZJOA 4KHZA 4UZSA 4FR0A 4EKYA 2ZDGA 3OT1A 1DBSA 2DHEA 3L0ZA 1GZSA 1P9NA 4PO8A 5J2UF 4QJIA 1BHQ1 1PFVA 4J1SA 1P1CA 2EG5A 3ANXA 5A71A 3QOYA 4NTZA 4HJRA 1FL9A 4F8EA 4OJMX 2IBSA 4BMCA 4WUVA 2QTCA 1II8B 1NYLA 3F8SA 4DUYB 2QE6A 4R9NA 3GFOA 4MQLA 2DFTA 3H7IA 1M72A 2UVPA 1UMBB 2O1SA 4IRMA 4Y6GB 5D3QA 5KMGB 3WB9A 1SC4A 3K1YA 2APJA 1KAQA 2HK7A 3LPLA 5FP0A 5EZ5A 3TIXB 3RANA 4MW0A 1AS2A 3TSOA 1CQWA 2GT1A 4YMTA 1B7GO 1OH5A 3I6BA 1DL5A 3RU2A 2IX9A 2JLVA 2C99A 2XB6A 3RRMA 5K0GA 4EHKA 3D7KA 4RADA 4MRAA 3E7XA 3LHDA 2Y92A 1PD0A 2YN4A 4LZOA 5M34A 3FBGA 4ZCIA 3B85A 1SM4A 3OQJA 3OFVA 5CVEA 2ASVA 4HNVA 5BORA 1XLVA 2ZSHA 4X90A 2P9TA 3LHIA 5ELMA 2PUCA 2VP6A 2XUFA 3WR5A 4DB4A 1CY2A 2FZGA 2ZSJA 4IEEA 4D9EA 2O8FA 1WPGA 1DU4A 3MZ0A 4OQQA 1V8DA 2C03A 3KCNA 3R9XB 4DSTA 4DR4B 3AFMA 1L5GB 2VAPA 1OV6A 2Z8YA 4PHFA 1Z06A 4N01A 1X13A 3JQ7A 4GWKA 3KT0A 4FMDB 1T8UA 1UDWA 5EJ6A 2J0UA 4NJOA 3VVBA 3KFVA 1PV4A 2ZUEA 1RJ9A 2B6NA 4HTFB 3CEMA 3HDQA 2PUDA 5LQDA 4RY8A 1ZM7A 1DMRA 3AHJA 3QFSA 4QVGA 4UCWA 2H2HA 2IOQA 1LS1A 1MFZA 1O6BA 3HBFA 3SE0A 3W2IA 3ZU3A 2NVBA 3AFNA 4PLFA 3AFHA 3DQQA 5K6RA 4KR7A 5T41A 2OYCA 4JQCA 3G82C 3ER8A 1T2NA 1K8XB 3V55A 4RCYA 4E6PA 1A4RA 4QNMA 1ZK2A 5G0TA 3ONEA 2JAUA 2CXHA 4ZI3A 4JL5A 1E7QA 2ESRA 3L4BA 3TPCA 1J2EA 1G9XA 1GHTA 4JLNA 2C4TA 4N82A 3URKA 1GG5A 1Z37A 1Z6XA 3ASYA 1QIMA 1P6XA 4U3JB 1IOZA 2XE7A 2JVIA 1FJXA 4TKZA 4ZU1X 1JLRA 4XIGS 4Q05A 2GNPA 1A95A 5FV4A 1T3HA 3TZQA 2LD4A 3HNOA 2A7XA 4CLXA 1ZH8A 2LXNA 4EJSC 1VKZA 2BD0A 1HRDA 3CYFA 1AQLA 1QHHA 3ZXIA 3BH7A 4H0CA 4AJEA 4LOHA 2I6FA 3S2ZA 2E4VA 2QRZA 3N39C 2BTOA 3MRVA 5KWEA 5F78A 2DUJA 1YB5A 2ZIXB 4RV9A 1LZKA 2AD5A 1G21E 3P4XA 1RI5A 1RIIA 3HC7A 3RVMA 5AVJA 1AUQA 1JU9A 2OK8A 4KXXA 1U8TA 4JBXA 3VYWA 4K5QA 2HA4A 4M38A 1AF7A 3OOWA 4KQ9A 4LBYA 1Q19A 3PD7A 2G70A 5I7FA 3BH6A 2YV2A 2NV0A 4P80A 3AGQA 1DPFA 1Q7TA 1OFGA 1USKA 3CLVA 1SXJD 4UQOA 1KQ3A 3QE9Y 3L0CA 1T6YA 2GVZC 3JQPA 4J03A 5SICE 4RJIA 3DHYA 3RTEA 5BQFA 1QZXA 3RUPA 5FJIA 2BLNA 3PBKA 2NVUB 1I10A 3C6XA 1FFXA 3B20A 4F4UA 1B0ZA 1XKTA 4NHOA 2B82A 4WZAA 5KX5A 1SB8A 2EW8A 4FB5A 3H6KA 4ARUA 1L5OA 1ONOA 3BWBA 4KSBA 1V9LA 4Q16A 2XUOA 4JQOA 5GOZA 3WO0A 3ZTWA 1XVUA 2BFDB 1Z28A 2WB4A 2GEKA 3AERB 4KGXA 7ABPA 2JKZA 2IW3A 3HHEA 1EMDA 1MOPA 3LKBA 1PV1A 2EKZA 5CA1F 2H7XA 3L7MA 2OCXA 4MTLA 1H4SA 4DVJA 2AI3A 3ZY5A 1N2IA 4B71A 2J9YB 4ZVLA 3VV3A 1JKFA 4RD0A 3SFZA 4YQEA 1X7YA 5AVWA 1VMDA 4KXQA 2WKWA 4BE9A 5EYPA 3B6ZA 1NXWA 3N5KA 5BVHA 1WE2A 1P2VA 5CDUA 5JBNA 3DE1X 1EZ1A 4IUBS 4NCJA 3ZDXB 2H4HA 2O0HA 2X23A 4X0EA 3TLEA 3ASVA 4HS9A 3U3OA 5JWRA 2QRVB 1X7YB 5A4KA 5ICMA 3GLGA 2BGGA 2GN6A 3ZY6A 2EZ8A 2HSZA 3PJGA 3GZJA 3C4JA 5CX1A 3UT5B 1P4GA 5K05A 4YCAA 3AOGA 2PSSA 4XFKA 1RI2A 5GPBA 4FCTA 2FMHA 4OI4A 4DV0B 3KU1A 1JXMA 2FR1A 5ITWA 5FWYB 3SSMA 3VSAA 2O8CB 4GQAA 3SZLA 2L19A 4G4IA 2O5RA 4C0HA 3GA7A 5A4IS 1O6FA 3AZPA 2RGUA 5DGXA 2RB5A 2YOFA 4DV3B