4AJPA

Human ldha in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol- 6yl)amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
329
Chain Sequence
ATLKDQLIYNLLKQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
total genus 116
structure length 329
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajpA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajpA02
2ZIZA 4CM4A 3WJAA 4IPTA 4WKGA 4FJ1A 1N9GA 2OOSA 3M1AA 4BNLA 1P31A 1VJ1A 3BMQA 3INTA 3ZDFA 2CVOA 3WGYA 4MIEA 2AQ8A 2B4TO 4KOAA 1VKNA 2Q50A 3BMCA 1D7OA 2HMUA 2D59A 3AWDA 4JNKA 3F47A 4YYZA 2FRDA 1P3DA 1HYEA 4FS3A 4MVJD 1WZIA 2YQ4A 1ZK0A 3DO5A 1P1JA 2JCYA 3P5SA 1GR0A 4ID9A 4PLFA 5EPOA 2FZEA 2DVMA 2IYOA 1IHYA 4Z9FA 1UAYA 4HKTA 3ZW9A 3WS7A 2Y1CA 3EUWA 4CLOA 1LBEA 3PPIA 1BVRA 2B4QA 4XYBA 2OUIA 4BO1A 3GK3A 3U0BA 3GGOA 1BVUA 1IE3A 1ENZA 1NQ5A 4F6LA 4L73A 1PQWA 1T25A 2VHWA 1GYRA 2A9FA 3DHNA 3GUCA 3VAZA 2X58A 3ZHBA 1NWCA 3Q1LA 3G79A 3W4KA 5CDTA 3D64A 2DAPA 1YQDA 2ZTMA 3GRPA 7MDHA 4JK3A 1VJTA 2NTJA 5HTOA 1TB4A 1KVRA 3V5NA 5AXAA 4LSMA 3UF0A 1UZMA 4ZVVA 1V35A 3PFFA 1JVSA 4B7CA 5BT9A 3KYDA 4GMGA 4IQGA 4Q3EA 3ZI0A 1PJCA 1YBVA 1IYZA 1L7DA 1U3UA 2EGHA 2WD8A 2EP7A 1PZHA 1JTVA 1ZZEA 2GN6A 1GY8A 4RV9A 3I9KA 1NPYA 4NU6A 1UDCA 2VHXA 2JAPA 2HSDA 3PHJA 4TZKA 1C0IA 4BO8A 1Q0QA 4R1SA 3E82A 5K9ZA 3RKRA 3I6QA 2I6TA 2DTDA 1SPXA 4J9UE 4IGEA 1Q0HA 1QV7A 2P9GA 1UDAA 2Q2QA 3ROKA 3S2GA 2EP5A 3PDJA 2C2YA 1E6WA 4L4SA 2CDBA 3L6OO 1W73A 3WLFA 3VC7A 4G2NA 1DRUA 3TSCA 2X5KO 4NMHA 4MVJG 3D1LA 3WWZA 2ZB4A 5GY7A 4QO8A 4J2OA 5B12A 4DGSA 1BW9B 3H7AA 4LMPA 1DXYA 2HKIA 1ZMTA 4PGFA 3UOGA 1U8FO 3MJ4A 2NNLD 1EVIA 1DB3A 3LDHA 3WQSB 3AOGA 3VKVA 3D4PA 4RPHA 1YS4A 3ROMA 3ZWPA 3PWKA 4FPXA 4PRKA 5CP8A 8LDHA 3LT1A 1IOLA 2QX7A 3H9EO 5JO9A 1SBYA 2HO5A 4CV1A 1G0OA 1YE3A 1QYWA 4FFPA 1NR1A 3H6KA 1ID1A 3GZNA 3G3EA 5I9MA 5GZ6A 3HZZA 4MVJH 2VZ0A 1YDWA 2AQIA 4NBRA 3RU9A 1TLTA 4IDAA 4EJ0A 4RF4A 2ZYGA 1LDGA 1VM6A 2ZQYA 5JNLA 3X2FA 3TOZA 5LCXA 4ND2A 2VHVA 3ZWOA 4QXMA 3GG2A 4IQ8A 3FI9A 1E3EA 1U5CA 1ZXBA 3JD4A 5I7SA 1RM0A 4NJMB 3BMNA 3WWYA 4DPLA 1F14A 5EL0A 5EN4A 3DMYA 1B16A 3JYPA 4GBJA 5A1TA 3I6IA 1QP8A 4N18A 4MJLA 4EBFA 3WG9A 4L8VA 2OP1A 4WOJA 3VPFA 3OQ1A 2QIOA 1H6CA 1MX3A 4TKMA 4BIIA 5CEFA 2QYTA 3K30A 1E7WA 3LVFO 4XR4A 4ZN6A 1V8BA 2X8LA 3AU9A 1YONA 4E5MA 2JFHA 3WGTA 2D2IA 3RCBA 2B37A 2HMSA 4CQLA 4C7KA 1HTBA 1XG5A 3PDUA 3TL2A 4M55A 1LDBA 4CLRB 1NPTO 1B0AA 2QRJA 4HX5A 1Q1NA 2Y1GA 2NV6A 4LSWA 1MXHA 4JJIA 4YB8A 1PZEA 3QSGA 3I9LA 3DEYX 4M87A 2C5AA 2OXIA 2PA3A 5ICMA 2YDYA 5TQVA 1GU7A 2PH3A 2IEBA 3DBHA 1KVTA 3C3XA 3JQAA 4CM8A 1DAOA 3EYWA 4KDFA 3VH2A 5JFOA 1ZFNA 1R66A 4OL9A 3S2FA 3ZWBA 3QJ5A 3M2TA 3PZRA 5DCUA 4L75A 1R4MB 2IEDA 4EDFA 2VTDA 5FF9A 4CMKA 1TVEA 2WE8A 5F5NA 2EEZA 5CDGA 1F17A 4BGUA 4FFLA 3O38A 4AJNA 1PS8A 3PIIA 4MP3A 4L9RA 2HUNA 4RVUA 1PL7A 3PFWO 1J49A 2B69A 4Y6SA 4Y9DA 3S55A 1HE2A 5G4KA 1VC2A 3OQ6A 3RFVA 3ANLA 4CM3A 1V3UA 2H9IA 4XRRA 1E7MA 5JDCC 5G0UA 1B8VA 2Q45A 2B36A 3DAFA 3RUHA 1BXZA 1E0DA 1GCUA 3F6YA 4INAA 4CL3A 3DFZA 1U4OA 4IBOA 2EGGA 1DC3A 2IXBA 4RPKA 3H3JA 4OOFA 1FDVA 1WNTA 4QO7A 1T1RA 4YXFA 1UP6A 1X1TA 1LNQA 4YT8A 2C0CA 2I9PA 4L0QA 4UVIA 1I24A 3FNGA 3PIDA 1R15A 3HNPA 1LLQA 3DBVO 4Q3NA 4IIUA 1C1XA 3PHGA 1YO6A 2YZ7A 3SC6A 4ZJUA 1I3NA 1H93A 4TRRA 3E8XA 1B2LA 2C2XA 2ZTVA 3W4IA 3WGOA 3MCVA 4BNYA 1P33A 1PJSA 4E13A 3DZBA 2VHZA 5I8ZA 5G0WA 1PU2A 2ZJ1A 2JCXA 3Q9NA 5DZSA 5IAAA 3DZKA 1Z6ZA 3HB5X 4P4NA 1GTMA 3LQFA 5BSFA 3RBXA 4IZIA 3L4BC 3LC7O 5T6BA 1DBVO 1ISJA 3FN4A 3JD0A 3OIDA 4FJ2A 5A9SA 5C3MA 1IY8A 1G1AA 1GCOA 4DLLA 4W99A 4YJFB 1H9BA 5A03A 3WGIA 5JDIC 3E9NA 4CODB 1NASA 3LZ6A 2GLXA 1LRJA 3GFBA 2I65A 1Q7CA 3GN2A 2O7SA 2IZZA 1RM5A 3BTVA 3VZSA 3NEPX 1BHSA 1EK6A 2OZPA 3GH3A 3GVCA 4JBIA 3BTUA 4GLOA 4HBGA 1EVYA 4PLVA 5BNIA 1H6BA 1KEVA 4BHTA 3RD5A 4CLRA 4R69A 2Y67A 7ADHA 2RH8A 1IHXA 4FFOA 2NU7A 1HETA 3GVPA 4FBGA 4KQXA 3KVOA 3GDGA 3WTBA 2CNBA 3OFSA 2WEKA 1R37A 5L53A 4WLEA 3VTFA 3EGOA 4RVGA 4HFRA 1YB4A 5LDGA 1DRVA 4IDCA 2NUAA 2VUTA 2Z1NA 3BHMA 2NU8A 4P4LA 3HWRA 4FFMA 4UUNA 3EY4A 4OKIA 1ZH8A 3TOXA 3WGQA 3KO8A 4CM9A 4AJPA 1MV8A 2VNAA 1TT5A 2JD0A 1ZEJA 2X0JA 4JIGA 3GOHA 3K5PA 3CEAA 3KZVA 1ZVMA 2J3IA 4XQEA 4CLDA 3JQGB 3K92A 1E77A 4E5KA 1Q7BA 3SJUA 3OJOA 4H3VA 4R01A 5AXDA 3QIVA 3BMNB 3UHAA 2O2YA 2FR0A 4J9VA 2PZKA 1EBFA 4J3FA 4HFJA 3L6EA 4MVJF 3ZHZA 3V8BA 3FNFA 1J4AA 4CMGA 3TJRA 4B79A 1GZ4A 3U4IA 5ENVA 3JQ6A 3QE3A 4CM6A 3DZJA 2POQX 4RL6A 4CMEA 4R16A 4Z0TA 1P74A 2CFCA 3SVTA 4R54A 4WCFC 4TQGA 2PNFA 2NVWA 4J7CA 3FBGA 1DIAA 3JV7A 4DQVA 2OP0A 4E31A 4Y6PA 1FXSA 4YJHA 4RZIA 4HWKA 3EC7A 1DC5A 3U49A 1NHGA 4L4RA 2GNAA 1ZSYA 2EKPA 3GT0A 3PEFA 4I8XA 1ZW1A 4WLUA 4MVJE 4Y98A 5A05A 2X23A 3ONDA 3PHHA 1EFKA 2BFOA 1JLLA 3G17A 3ZNNA 4IJUA 2DM6A 4B4OA 2CSUA 2D3TA 1NVMB 1DIHA 3I4FA 5HS4A 5I7FA 3ZV5A 1HLPA 1OC2A 1XR3A 3MJCA 1FDTA 5LDHA 3PLNA 4CR6A 5TF4A 4ALMA 4CUKA 4M8SA 1LQUA 3ROPA 3B6ZA 4AVYA 3INRA 4YAJA 4ZU3A 2W2LA 2EWMA 1ISHA 1IUKA 1FDUA 3X2EA 4CM7A 4D79A 3KLPX 3M2PA 5B4UA 1CDOA 1KY5A 4D43A 4AG3A 5JMPA 3DAPA 4A7PA 3ETGA 3HN7A 2GUGA 2F00A 5T8KC 1SB8A 4BQPA 3NGXA 5IJZA 3ZU5A 5L9AA 2PD3A 1E7YA 1MG5A 4DC0A 4XYEA 3SXPA 1RM4A 3BHJA 5KKAA 1YL5A 3AM4A 1QYVA 3I23A 1A9YA 4PZDA 3M6IA 1HDZA 3VZQA 1GUYA 4C7JA 4M86A 4P8RA 1GFSA 3F4LA 3UW3A 4EI2A 2V6BA 4EZBA 3BXXA 4FN4A 5DBGA 4J1NA 2R6JA 2P4QA 3KB6A 3U5TA 4FGWA 3WFJA 4P22A 4LVCA 2UAGA 2HDHA 2DLDA 3HDQA 1NWHA 1FK8A 3O4RA 3OP4A 4RLSA 2QRKA 4K6FA 2XAAA 3Q2IA 1KY4A 4BNIA 3F5SA 2VOEA 1AN9A 5I8WA 4TRJA 3PGXA 1ENYA 4OM8A 2E6UX 1NX6A 3PJDA 1C1XB 1E3WA 1XGKA 2CUKA 2XOXA 3R0IA 1PS9A 4DMLA 2YDXA 4YAKA 3GAFA 5FWNA 3B70A 3W6UA 4DUPA 1RKXA 2C20A 1H5QA 5GZ3A 3AW9A 2YHIA 3LLVA 1HE5A 1LXCA 1YXMA 1YJ8A 2GPTA 2ZB8A 1QYXA 1U8XX 4KWIA 4XB2A 4WASA 2B83A 4IY1A 5JPIA 1DEHA 2C07A 4MKZA 5A9SB 4LGVA 2NVUB 1YL7A 1E1LA 3TPCA 3QY9A 3GEDA 5ICSA 3KYCB 3PQDA 1BSVA 1EVJA 2V6MA 5KJCA 1LSJA 1HZJA 2DBZA 3DTYA 1Y5RA 3NKLA 1T2AA 2WD7B 1V3VA 4YAIA 1NQOA 3KUXA 3O03A 2X22A 1GV1A 4MOWA 3MEQA 1E1MA 1IULA 1KYQA 1N7HA 2FSVA 3E48A 4RQTA 3CXRA 5C37A 2BGLA 4R9SA 5CG1A 3MJEA 1PL8A 5IZ4A 1VL8A 1LDMA 4AJLA 3SLGA 3RBVA 1T2FA 4MVJI 4OQZA 1DJQA 2R2GA 5EINA 4CV3A 3TZ6A 1KC3A 4W7HA 5KIAA 3KM0A 1LU9A 4JROA 3S2IA 3EZLA 3JQ8B 4U5QA 4WGGA 1K89A 4ITUA 5JAMA 3SEFA 5TT0A 2AMFA 1RYDA 3HFGA 4K9DA 3JQ7B 3AOEA 2CF6A 2Y93A 3BTOA 5DF1A 3BYZA 1ADFA 2GR9A 3LLSA 1U1IA 4J2HA 5KJFA 1EFLA 3IJRA 4YCAA 1WAMA 3AUTA 1CEQA 1S6YA 1JAYA 1TEHA 5G0VA 3WMXA 3NRCA 1MA0A 1ONPA 2BGMA 1JAXA 3H8VA 2PD4A 3QV1A 4QEDA 4BO2A 4B7UA 3ONEA 4CV2A 2GZ3A 3LT2A 4JQCA 2UUPA 3KETA 1J0XO 1K6XA 2CDCA 5CAEA 3AY3A 2BH9A 1UJMA 3GQVA 2X5OA 3SBOA 3QVXA 4CMCA 2Q99A 3O9ZA 1PL6A 2P9CA 4E5YA 1JA9A 3QLJA 4MIOA 4YJHB 4E21A 3KRTA 3ZU3A 4RVFA 4AJOA 1DFGA 4GX5A 1KVSA 2Q1UA 4II2A 1R12A 4PG8A 2EF1A 1IPFA 1GPDG 4EGFA 1MUUA 1HRDA 1T24A 2P68A 4XGIA 4I08A 3LT4A 4QFDA 1UZLA 1QSGA 1UZNA 1LSUA 5JAIA 2VUSA 2DTEA 3FTNA 1E3SA 1N8KA 4FB5A 4OSPA 5HM8A 4CMIA 1GUZA 1UXIA 2JFGA 2BI7A 5TNXA 3TWOA 2PLAA 2O23A 2NADA 2BLLA 4XWYA 4Z0HO 1Y7TA 1YRLA 3ZWWA 1ZMOA 4NI5A 4AJ1A 3GPIA 4CM5A 1UXJA 4OOEA 1KEPA 3R3JA 2ZYDA 3OA2A 5FI5A 1PWXA 4G5HA 1GPJA 2IZ0A 3ZWMA 3ASVA 1NP3A 1ZEMA 2OORA 2E4AA 3R3SA 4BNGA 4PG6A 3GDFA 1NHWA 2Z1MA 3GFGA 5I9LA 2DC1A 5L95A 5JSFA 1QYDA 3I1JA 2VYND 1PZFA 4BV8A 4L76A 3GZ4A 5KKCA 1DAPA 2X9GA 4EEXA 1RPNA 1I36A 4YWJA 4E5PA 2I67A 3A1NA 4OXNA 3VPSA 2D8AA 3EVNA 4AJHA 3AM3A 2WDZA 2Y0CA 3FNHA 3PLRA 1R6DA 5ITVA 4J4BA 3TFOA 2PFGA 4RVHA 4BNZA 3WFIA 3NV9A 3GGGA 2CVQA 4B8WA 2Q2VA 2NU6A 1UUFA 2OBYA 3WX0A 3VOSA 1DPGA 3BMQB 4LRSB 2VQ3A 4XIYA 3DC2A 5H82A 2R00C 4ESOA 3D5TA 3OEWA 3DHEA 4CMBA 4RPJA 4Z3DA 1XKQA 4FOSA 3V2GA 4YAEA 3A28A 1E6UA 4RORA 3GY0A 3ZWYA 1X15A 4MVJP 2Y66A 4YEDA 4AL4A 4XB1A 5JAZA 3ZU4A 1SEVA 4U0KA 3FR8A 4D7AA 2V6FA 4DPMA 4G65A 4WJZA 2C29D 4BNFA 3Q11A 1E3IA 2BFMA 3OQBA 1LLCA 4MDHA 5EERA 5JW6A 5EQDA 1D3AA 2LDXA 4IMRA 1OC4A 4E4YA 1P1HA 4GGOA 4J90A 4QTZA 1B3RA 1T2CA 1ZBQA 5HS6A 1E1NA 2JHFA 4OYRA 4D42A 3LU1A 3CE6A 2BFPA 4BNNA 5A5FA 2O3SA 4UUPA 4E2WA 3DOOA 3KBOA 4ALLA 4B3JA 2RH4A 4E2YA 4ZICA 1A4UA 3U62A 4N5LA 1YL6A 4YQYA 4JP3A 3Q6IA 3JQBC 2YHIB 1E3JA 3F3SA 3H2SA 4ALNA 2J5QA 2Q3EA 1SCUA 2QYSA 4PVCA 4A0SA 1N1GA 4WLOA 2V6GA 3ANMA 3H4VA 2CZCA 4J0FA 4XJSA 3OHSX 5AOVA 5IDWA 4AFNA 4BMVA 1I3LA 3OETA 2HCTA 3W8DA 3A06A 4GVLA 3SJ7A 5G2OA 2PTGA 2YV3A 3DQPA 3FPCA 3GF4A 1Z45A 3UCXA 3UCFA 3RI3A 4DREA 3VVBA 5K6AA 3OIFA 3ZN2A 2NVBA 1UP7A 2HK9A 4ZQBA 1WPQA 1A9ZA 3TRIA 4MIYA 4XYMA 1OI7A 1QRRA 3NGLA 1N1EA 2GZ1A 2C5EA 3TZQA 2D5AA 1OFGA 4ND4A 1BDMA 4R3NA 4BO7A 4N7RA 2RBEA 3WIEA 4O63O 2TMDA 1DJNA 3ASUA 3HB4X 3RBZA 1QORA 2FZWA 5JO0A 3RSHA 3H5NA 3JQGA 4WECA 4AICA 1C1DA 3RUCA 1V3TA 1MGOA 3RU7A 4IINA 4OO3A 4EUEA 2XPCA 2YQ5A 3C85A 4UVHA 4DIOA 2FSSA 1UXHA 1ONOA 1PR3A 1RYEA 1CYDA 4GWGA 5ILOA 3H2ZA 1A71A 1I01A 3DBLB 4W82A 5DOVA 5ITWA 3D5QA 2JJYA 3NDIA 4NNJA 1PTJA 1I2BA 2IODA 4NIMA 5KVSA 1C0PA 4PFJA 1XU7A 3UH1A 2A35A 3DDNA 2I3AA 4BGEA 3AFNA 2BRUA 1QLHA 2DUWA 3CTMA 1B8UA 1BXGA 2AW5A 2BMAA 3WLEA 4QFCA 2H5LA 4W6ZA 3GA0A 1XDWA 3IP1A 1BDBA 1UXKA 4HY3A 4D3FA 4TZTA 4Y6RA 4RO0A 4ZQFA 1ULUA 3DZFA 4PLYA 4HNGA 3WYCA 4WUVA 1NYTA 3AK4A 4I5DA 1JQBA 1WXDA 4CLXA 1YB5A 3K31A 5F5LA 9LDTA 3FPLA 3SLKA 5HBRA 4II3A 4XA8A 4TVBA 1R4MA 4DIBA 4FSHA 2BHLA 3COSA 1SC6A 1DHTA 3NTRA 1QG6A 1LA2A 3JD2A 5TRTA 4CMEC 5A3JA 4J6FA 1WZEA 2NQ8A 1NAIA 2CMDA 4J7UA 2O3RA 1YBAA 2YFQA 2ZCUA 3H5AA 2Q1SA 4BGVA 4Z3KA 5IF3A 4CUZA 2X9NA 1ISFA 2BI8A 3ICCA 4OHUA 4DXHA 2Q2WA 4IS2A 1MC5A 1HSZA 2GF2A 3PRJA 4HNHA 2HQ1A 4CR7A 1UDBA 3F1LA 1EDOA 5EMHA 2VZ8A 2P4HX 2PKQO 4FGSA 3E9MA 2AQKA 2VT3A 4UREA 2PZMA 1W4ZA 4TRNA 3K73O 1EMDA 3FWNA 2D1YA 1M75A 1IZ0A 1Y1PA 3KTDA 2JKVA 3B1FA 1NQAO 1LJ8A 1PJLA 2ILTA 4PLHA 4PZCA 5A02A 3H9QA 3CMCO 4OIMA 1EVZA 3B1JA 6LDHA 1PS0A 3EMKA 3DOJA 4LCJA 1GL3A 3IUPA 3V1TC 1WP4A 1VKOA 5IFLA 3KLMX 1CWUA 1E5LA 3EAGA 2B35A 1GV0A 2O4UX 4GX2A 3CIFA 4BNUA 3WXBA 3NT2A 5EESA 1GADO 4ROSA 2DPHA 1LLUA 4B4UA 3ZNPA 2V65A 1R0SA 1GQQA 1YB1A 3DB2A 3PXXA 3HG7A 1SOWA 3PK0A 1SO8A 5JCJA 3RFTA 6ADHA 2VCYA 2AG8A 4CQMA 1XELA 1MB4A 1K2WA 2CD9A 4AJJA 3VTZA 3PI7A 1ADGA 1QLJA 1EUCA 1H2BA 4R5MA 3AOEC 2F1KA 2ZJ0A 4WCFB 2HMVA 5GMOA 2B0JA 1B8PA 5AYVA 2GD1O 5TSDA 4WLVA 2AEFA 3BAZA 2O48X 3GVXA 4MPDA 1C14A 4J91A 1BGVA 3KSZO 3WR5A 3IL2A 3IOYA 1K6JA 1KETA 1OOEA 4A73A 4RDHA 3NT5A 4XR9A 4DLBA 5IG2A 4NDNE 2FHSA 3LYLA 1M66A 4W9NC 3FRJA 1N7GA 2PV7A 4HV4A 3GDOA 3I9NA 2FWMX 3IAHA 5KNLA 2H6EA 2HK7A 3CPSA 4B4WA 2OMEA 1Q0LA 3U4DA 1HF3A 3A9WA 2I3GA 4PIVA 1OAAA 1DC6A 2UV8A 3KOUA 4KZPA 5BNFA 3VZPA 2HJRA 5F3RA 4UEKA 4YAGA 2ZYAA 4AJEA 2C82A 4NU5A 1PJ3A 3HFSA 4ZRNA 3E6AA 1TT7A 2UVDA 4A27A 1FMCA 1LI4A 4DL9A 2G76A 3QVWA 4XYGA 5TJHA 1AHIA 3LC2O 2E82A 1E6EA 1T4DA 4JBGA 1XIVA 2PZJA 1CRWG 4IUYA 4QUKA 3F9IA 5COAA 2X6TA 4B7XA 5JYDA 3E9QA 4UULA 4R9RA 2WYVA 5DDIP 5TIIA 1Z7EA 4RLHA 5KVCA 4BL5A 3JQEA 4BKQA 5JCJD 1CJCA 1EE9A 1PGOA 4WCFA 4K1LA 1MXFA 1W8DA 2TMGA 4BB5A 1UAGA 4XQ9A 4BNKA 1I3MA 4BKUA 4ALJA 4BNWA 1TXGA 2PWZA 4WEQA 1P0CA 2NQTA 4RPLA 3OICA 4NFSA 3GUYA 3GGPA 4B3HA 1I5RA 5G0SA 5IZCC 1JKFA 3TZKA 3HE3A 1BG6A 2J3KA 3PHIA 1ZK1A 1HE4A 1CERA 3EW7A 3BMOB 2R00A 1F0YA 2NACA 2QW8A 3WOHA 4EJMA 5L40A 5L51A 3A4VA 1ONNA 5DP2A 3NDJA 4IXWA 3WTCA 2DFVA 4DC1A 3C8MA 4D3DA 2AHRA 1ULSA 3NX4A 4QQRA 4HUJA 2H63A 3PGJA 5B37A 3L77A 2X0IA 3P7MA 3ETDA 4OGWA 4BNTA 3CMMA 4DLAA 3ADOA 4IIVA 2C54A 3LT0A 1M67A 4L4XA 2C7GA 4BNJA 4NJMA 2PK3A 3C7CB 3GG9A 4QSMA 4EYEA 5ES3A 4ZHSA 1V0JA 2RAFA 3CINA 3ZV6A 3KYCA 4EUFA 3BTSA 2B5VA 1SZJG 1NR7A 4JGBA 4CQMB 1ADBA 3I9MA 1WW8A 3K96A 2DPGA 5JDIA 4YT5A 3CSDA 2FMUA 3JYQA 4L74A 3R6DA 1PGJA 3N7UA 2WWRA 4UUMA 4XDYA 3S2EA 4ZRMA 4BUCA 2O3UA 3E1KA 2DBQA 5G4LA 1F8GA 2QG4A 3JQ9A 1EEHA 1JKJA 2VWPA 3GPDG 1C0LA 4YRAA 5K0ZA 1YBMA 4JJFA 2PGLA 5CHEA 1E7SA 3OM9A 1AXGA 1YGYA 2HRBA 3E18A 4IXTA 4EEZA 5A4DA 5FYDA 2PD6A 4CL8A 4D41A 4RQUA 2BGKA 1HWYA 3I52A 1GYPA 5TS3A 3KSDO 4DQUA 4E32A 1JWAB 1PJQA 1B15A 3VKUA 2JFFA 3JQBA 9LDBA 1YKFA 3ENNA 4WNIA 1GDHA 4Q39A 1AUPA 4IDDA 2EW8A 2FPPA 3ZWNA 2AEJA 4AJ2A 2PGDA 1WDLA 1ZSNA 5IXSA 8ADHA 1M2WA 2GERA 3I4CA 2I5PO 4GX0A 4XDZA 1Y9AA 3DAGA 5AXBA 1NTOA 3RC1A 2O2SA 5F1KA 4BO0A 2H1SA 3E5MA 2YHUA 4GWKA 5JBIA 3ULKA 1HDCA 2HRZA 1NFFA 3PTZA 3MZ0A 2BKAA 2FPIA 5F1PA 3PJEA 4O59O 4HP8A 4AJKA 1DFHA 1DRWA 4XIJA 5CDSA 1P1IA 4WLNA 4PN3A 5L3ZA 4QECA 1Q2XA 3JYLA 3LF1A 3ZWAA 4Z6KA 4NBUA 3RROA 1BTOA 3NTQA 4IS3A 4OSOA 4I5FA 3H5RA 4J1QA 4Z9YA 4P38A 4EJ6A 1EUZA 4Y67A 1WMBA 3GNSA 3LSYA 1X0VA 3OA0A 1ISMA 1H6AA 5KJEA 1DHRA 1X7GA 2HJSA 4CUJA 4EUHA 5IN4A 4PZEA 5JDCA 1RM3A 2DQ4A 1U9JA 3L0DA 4R51A 1NNUA 4LN1A 4BNXA 3LK7A 3RAJA 4CMIB 4FDAA 3ZHXA 3VDRA 5C7LO 3MWEB 2OHXA 1CF2O 4BGIA 2I99A 5JY1A 2FY8A 5A3VA 2JCVA 3QP9A 2VRCD 1F12A 4BNVA 1AHHA 3F4BA 1DDOA 3FSRA 5ADHA 4GMFA 2OBNA 2D0IA 3H9GA 2Y1EA 5ENDA 1PEDA 1VL6A 1T2EA 1KC1A 1ZK3A 3I83A 5J23A 4GVXA 4PG5A 1NQTA 1LDYA 4GL4A 2HLPA 5U1PA 5MDHA 4HXYA 4RCVA 2DBVO 2E48A 2EJVA 3GHYA 4E2ZA 1U4SA 1QMGA 4FC6A 5KCZA 2IYPA 1ZCJA 1SMKA 2NLOA 4ZA2A 3UICA 2VNSA 1LC0A 4YA6A 4XQCA 3ZV3A 3NAQA 4OJNA 5I7VA 1HL3A 1NBOA 3W1VA 4XGNA 2HMTA 3GN1A 2O3TA 1MC4A 2ET6A 1ZIDA 4HFNA 3UFXA 3ZNQA 1H2HA 3GR6A 4B3IA 4R68A 4S1VA 1ZK4A 3PZBA 4R1TA 4ALIA 4GLLA 1XHLA 2WE7A 5DCYA 3FR7A 3GAZA 3WYEA 1VI2A 5GZ1A 3L9XA 5L7TA 1QKIA 3T7EA 1KVQA 1E5QA 1Q7GA 3U3XA 2BFAA 2W8ZA 3WSVA 3L6DA 3KSUA 1BMDA 4D0RA 1TT5B 2PKRA 4G81A 4KUEA 1A72A 2J6IA 5CFZA 3CZMA 3EHEA 4BB6A 4NK4A 2VZ9A 1HZZA 4DA9A 4FW8A 3FF4A 2G82A 1I3KA 3RWBA 3WGGA 1U7TA 4H16A 4U6SA 4P4GA 4YR9A 4ZQEA 3FWZA 3UVEA 2VWGA 1JKIA 3IS3A 3P19A 4GKVA 4OXKA 3RC9A 1T4BA 4PG7A 4JJGA 4RF5A 3K9QO 1R0LA 2EV9A 1R4NB 2Y0DA 5HRUA 2OL4A 3DTTA 2W98A 4ND3A 2PGJA 1L7EA 1XCBA 2X0NA 2RCYA 2FR8A 5G0TA 4M49A 2BD0A 1WMAA 4DBZA 4RJTA 1O0SA 1GEEA 3ENKA 3VZRA 3VH3A 3IJPA 1T2DA 4BVAA 2DKNA 5L7YA 4I9NA 4A2CA 4CV0A 2EKLA 5TX7A 4CPDA 5A9RA 2SCUA 4JLWA 4D3SA 5A06A 1JWBB 3BMCB 1FDWA 3BZUA 3HHPA 3V2HA 2P91A 3JD3A 4MVJA 2Z5LA 3GVHA 3OJ0A 1I32A 4IJKA 3SC4A 4BOYA 5L7WA 4U0JA 2EJWA 1KBZA 1UH5A 3DXFA 4UVGA 3O8QB 1IZ9A 4U8GA 1ENOA 4R3WA 5HWSA 5TC4A 2VWHA 4RPGA 1I2ZA 3K2EA 4LMRA 4CQMD 4K6CA 5HA5A 2W4QA 3JQDA 3M1LA 4J1SA 2NVUA 3AU8A 3DBRA 3NDRA 5F21A 1E3LA 3FNEA 3AY6A 4U7WA 4IM7A 4FOOA 5B1YA 5L45A 5CPBA 1PGQA 3JQAD 2BELA 2FN7A 3EK2A 3QWFA 4DWVA 3KHUA 3PYLA 2WD7A 1GUFA 4A26A 4CLHA 4WE3A 1E92A 1LSSA 1EQUA 4ZD6A 1OMOA 4JN6B 2ZATA 4UVDA 2HK8A 3IUSA 3AM5A 4GX1A 1V9LA 2GYYA 5C7IO 1O8CA 3SX2A 1JVBA 3W8EA 2CDAA 4I5EA 4ZGWA 1WDKA 4R41A 4DIFA 4I1IA 4J4TA 1Z7BA 4KDEA 5BR7A 4JXKA 2RIRA 1U3WA 4ND5A 3JQ9C 1HDOA 1Z82A 2P2SA 3INGA 5FEUA 4W4TA 4J43A 1Y8RA 2EERA 2NWQA 5BNTA 1VSUA 1Z75A 5DOZA 3ZGYA 2DFDA 4DQXA 2FPGA 4RF3A 3EZYA 4YRDA 2V7PA 5DN9A 3K6JA 2FR1A 2EXXA 1HLDA 3P2YA 2NSDA 3KEQA 3G1TA 1VSVA 1X7DA 3KXDA 2UYYA 5EJ2A 4E6PA 1Z74A 2W2KA 1WWKA 1LDEA 1P1KA 3GRKA 1ISGA 4NBTA 5CPFA 3W8FA 5IXYA 1O6ZA 3H65A 3NTOA 4NBVA 1PZGA 3PP8A 4TSKA 3IQDB 3I5MA 3WSWA 1EQ2A 1HDXA 1X14A 3IDSA 1NXQA 3ZCXA 4BKOA 1HYGA 3MOGA 5THQA 3NUGA 5G4KB 2O3QA 1HE3A 1P1RA 5A9TA 1GQ2A 2QZZA 4Q3CA 3UKOA 1KERA 2Y1OA 4KUHA 4RF2A 4XCVA 4BMSA 1BW9A 3Q0EA 3C1AA 1HSOA 3RKUA 3ITDA 1PIWA 4YJFA 2EIHA 4FR5A 1PJBA 1EDZA 1U28A 3KV3O 4W9NA 3QWAA 3EVTA 4BO3A 5DCWA 5IDXA 4WEOA 5DP1A 3H3FA 1T1SA 2Y1FA 2VYVA 3OECA 4JX8A 1YH3A 3QQPA 2G0TA 3P2OA 1XQ6A 2J5RA 4F3YA 1XSEA 5JS6A 3AUSA 3U9LA 1PGNA 2BF7A 3TF5A 2EHDA 2EW2A 3ABIA 4NG5A 2NTNA 1XU9A 3PYMA 4BKRA 4S3MA 3JD1A 3T7CA 5KOIA 4IDFA 3WBFA 4I5GA 1A7AA 3DWFA 1KEWA 2GO1A 4IJVA 4O6VA 1YDEA 3QA9A 4IGFA 1LQTA 4E0BA 2GN9A 1ZJZA 4TWRA 4U6QA 4ND1A 5DT9A 1K5HA 4TROA 2A94A 3AFMA 4OKNA 1YQGA 2DT5A 4OH1A 4R5HA 5FI3A 5ILGA 2FP4A 4BNMA 2ZTLA 5FFFA 4LISA 1AGNA 4Y8VA 1NM5A 1PSDA 4IDEA 1KS9A 2Z95A 2Y0EA 3GMDA 3TFQA 3ZV4A 1H6DA 4M89A 4CJXA 1P9LA 5AXCA 4WNCA 2GN4A 2VHYA 2DBRA 1W0CA 1T26A 1U2DA 3G1UA 3AY7A 3GEMA 1VJ0A 4Q9NA 1N9GB 3ON5A 5KJ1A 1O89A 4YJGA 4D44A 4GH5A 4MVJM 1HDGO 1XQ1A 4CM4B 4GGPA 4GPD1 1L1FA 5U9CA 3CUKA 1SEPA 4PLGA 2EKQA 3WGZA 4FFRA 4XKJA 5U4QA 3WB9A 3QVTA 4RZHA 1K0UA 1WLYA 3EDMA 5ER9A 5A5EA 2WTBA 5KTKA 4GSKA 4QT0A 3ICPA 4IMPA 2LDBA 1GYQA 1EUDA 5TLSA 4PLZA 2XXJA 4KP7A 1HDRA 3TN7A 4UVEA 4OMUA 1RJWA 3C1TA 1N92A 3HADA 3QWHA 4PVDA 4YRBA 3RC2A 2JD1A 3WICA 2AG5A 1K3TA 4JP2A 4A03A 1GAEO 4XJTA 2NU9A 4IJWA 1HKUA 4DPKA 4RGBA 2E37A 5C7OO 4GSLA 3C7AA 2VTEA 3MWDB 4PLCA 1LRKA 3ETEA 3D4NA 2AQHA 3PWZA 3IC5A 4NZ9A 1VLLA 3QHAA 1I0ZA 3HDJA 3TZCA 2VWQA 2Q1WA 2QHXA 2PH5A 3AUAA 4E3ZA 3RUEA 5DNAA 5COBA 4XQGA 3OF2A 2VYNA 3C7DB 5T67A 3TNLA 5MGBA 2ZCVA 3I3OA 3IIEA 1D4FA 4E33A 4KWHA 1JU9A 1BXGB 4CMHA 3RJ5A 2HMWA 3RUIA 2CVZA 3JCZA 3QRWA 4TRMA 3VVCA 5ER6A 5DBIA 4ZQGA 4RVSA 4N5MA 5F1OA 1DFIA 1SOVA 1BWSA 2YJZA 1I10A 2AXQA 4K26A 1B7GO 3JYNA 2GCGA 3Q9UA 4NFHA 3AI3A 2P9EA 2VRCA 5BQFA 1E7QA 1ZSVA 3FD8A 2IDZA 3BHIA 4O1MA 5AVOA 3STHA 2DU8A 1XA0A 3GNTA 3UAGA 4ILKA 4HFMA 3D4OA 1IL0A 1Y81A 1XEAA 2HU2A 2WM3A 5IZCA 1MP0A 1LX6A 3U09A 2VRBA 2Q49A 3WGHA 3RASA 3PQEA 1N2SA 4OAQA 1NFQA 3HSKA 2UUOA 3KEOA 2QZ9A 4FIZA 4NH4A 1RWBA 1U3VA 1VE9A 4KQWA 5L4LA 3L9WA 3L4BA 2W2KB 3JQ8A 5JAQA 1DIRA 1I2CA 2WMDA 4CLOB 3LF2A 4XX0A 4ZQHA 4EW6A 2AE2A 4GQAA 2NM0A 2VT2A 5K6AC 2GDZA 2VYVD 4I9UA 4FFNA 4J49A 2WSBA 3UCEA 5A04A 3ORFA 3MTJA 5DBFA 4BMNA 3FTPA 3E03A 4MP6A 3UUWA 2PR2A 3QW2A 1U5AA 3DZGA 3U4CA 4BQRA 4J7XA 4I9HA 4DYVA 1BXKA 3DL2A 5IN5A 3GMSA 1Y5MA 3OJEA 5JC8A 3ZZNA 1O94A 5JC1A 4CM1A 2XXBA 3R1IA 3WBBA 3BMOA 2X0RA 4TMFA 2Q46A 1D1SA 1CIVA 3NJ4A 5EQFA 2A4KA 1ENPA 3GEGA 4YT4A 1X13A 2ZKLA 3ZU2A 3RVDA 1ORRA 2B5WA 1LTHR 1PJ2A 3F5QA 3RIHA 3OJFA 3DZIA 3G0OA 1P0FA 2VUUA 1UR5A 1F06A 4MP8A 1WVGA 3DMTC 3IP3A 2X5JO 4NPCA 1XYGA 1NVTA 1YOVA 3JSAA 3OMLA 4WCDA 5KVQA 4JCOA 5IDYA 1Y8QA 1FJHA 4MKRA 3WYBA 3BIOA 3QVSA 3ZW8A 1LEHA 4Z0PA 2QRLA 2D4AA 2E49A 4GAEA 1CETA 1ML3A 2AA3A 3GHHA 3ADPA 1WDMA 1F8FA 4GKBA 1K6IA 3QWBA 1A4IA 1PGPA 3GNQA 1XLTA 5BSGA 4R1NA 1OZAA 1P45A 3HJAA 1QV6A 3OBBA 3WJ7A 4NR0A 3ZWXA 3RUFA 2J3HA 2PKQP 1QYCA 1DLIA 1DLJA 1XWFA 3VHRA 4YACA 3T4XA 4XRGA 2Y1DA 2RHCA 4PG4A 4RDIA 4PLWA 4BO5A 3IKTA 3B1KA 5AQ1A 1DSSG 4AJIA 5JLAA 4NQZA 4PLPA 3DFUA 1HDYA 5T57A 3QWIA 4UEJA 1SB9A 1LC3A 2JHGA 3ZHYA 4KTTE 1I30A 2O50A 4LK3A 3PQFA 4RVDA 3H9UA 3L07A 2X4GA 4CMJA 4FCCA 3RUAA 1ZUD1 1U7HA 2ZB3A 2GZ2A 2ZK7A 1PR9A 3ST7A 3VH1A 5I9NA 4URFA 3UXYA 1P1FA 2Y99A 2Y05A 3PJFA 3HUDA 4BO6A 2JL1A 1UP4A 3GC6A 3RQSA 5CEJA 3Q2KA 4KUGA 3PVZA 1EE2A 1Y8QB 1ZJYA 3DBLA 4Z9XA 2EG9A 3TZHA 3S8MA 1ADCA 1P44A 4UUOA 3B20A 3DR3A 4F45A 2VOJA 2AEMA 3JYOA 4E2XA 4CMAA 1PWZA 5BSEA 1HT0A 2UDPA 1ZK2A 1AXEA 2PZLA 3D3WA 1O9BA 1X1EA 5C5IA 3IMFA 1QXSA 3RUDA 1JN0A 1H9AA 2X9VA 4MINA 5T64A 2VN8A 2Y68A 4XGKA 3UN1A 4FJ0A 4EITA 5JCXA 1HXHA 3AUUA 1M6WA 3L4SO 1MFZA 1R0KA 4WLFA 4WPGA 1TA4A 4PLTA 3KYBA 3GLQA 1SNYA 1VPDA 3D3EA 4H15A 3PWSA 4LCEA 5BSHA 3RFXA 4Q3BA 1ZO8A 3V1UA 4LW8A 4IDGA 1U3TA 1YQXA 1MG0A 1VRWA 1FDSA 4MKXA 1EBUA 3O8QA 3VPHA 1IB6A 2ZB7A 4E12A 1GEGA 1ISIA 3PHLA 4NJOA 4Q3AA 5COQA 3K2BA 2OFPA 3ZWCA 4BO4A 2NTVA 3NYWA 3ROQA 1NPDA 2HAEA 3JQAB 2I66A 4CM8B 2ZQZA 1CQJA 2DUUA 2WYWA 1KIFA 4GI2A 3DMTA 3VDQA 3DHYA 1J6UA 4CR8A 4BKPA 4IQ0A 3RC7A 5B4TA 3K8ZA 4HADA 2W2LD 1ZKMA 3ANNA 5TGDA 3GVIA 2DTXA 1GZ6A 2D5CA 4YT2A 4J1TA 4R1UA 3S1LA 1P77A 5CEEA 3DONA 3A14A 1A7KA 4BNHA 3D3WB 2B4RO 4ONEA 4YTEA 4AJ4A 3CKYA 4F46A 2P5UA 2A92A 4BO9A 4BV9A 5EIOA 2YFHA 3C1OA 2CF5A 3ONFA 2G17A 1VL0A 2IRWA 4JBHA 5L4NA 4R4JA 1NAHA 1E3WB 1N5DA 5H83A 5CG2A 5IDQA 5CDUA 3MOIA 4NHEA 1Y6JA 2QQ5A 4YJGB 2O4CA 3FBTA 1D1TA 1SAYA 2Q4BA 3NJ8A 1W6UA 3JQFA 3W4JA 4J0EA 2X7HA 1KOLA 1LRLA 4M1QA 4YDRA 3N74A 2P5YA 4OQYA 2O3JA 5THKA 3VH4A 2AE1A 1YVEI 1C1DB 4CM9D 1B14A 2I76A 4LVUA 3HN2A 3ZWVA 4H7PA 3ZNOA 3I9OA 4D45A 3OIGA 2J8ZA 4C4OA 3CH6A 5KJ6A 1S7CA 3TL3A 1A5ZA 4PRLA 1HEUA 1EK5A 3UGKA 1I33A 3E5RA 5DULA 5T5QA 2YV1A 3OEYA 4YPOA 2G5CA 3G49A 1M6HA 1QR6A 1H0KA 4A5OA 3T4EA 2PY6A 3WMWA 1UXGA 4N54A 3WQQA 2IZ1A 5JE8A 3N58A 4KTVE 2FOIA 3ITKA 3VPGA 3AJRA 2CY0A 2JD2A 1PX0A 3FCOA 2WJPA 3WNVA 4DRYA 2YYYA 1JDJA 2IE0A 4FD3A 4UAGA 1NFRA 1NVGA 4W7IA 3H9JA 2J5KA 3MTGA 4D0SA 3KYDB 4XEHA 5TJ9A 1KEUA 1GZ3A 3PJGA 4X54A 1O95A 1G6KA 2X1HA 5KWEA 1Z73A 1B26A 4KMSA 1ARZA 1TI7A 3DBHB 3TQHA 3JQ7A 1A27A 4J16A 3BA1A 2W90A 2O7QA 5LC1A 4XZ3A 3O26A 2YW9A 1C3VA 1LUAA 4CLEA 3RJ9A 4TKLA 4ALKA 5CDYA 4FQ8A 2OO5A 2JAHA 2GSDA 3MJVA 1G0NA 4YVFA 1C0KA 1YOVB 3OH8A 3F46A 3TDKA 5JY6A 1E7RA 3U4HA 3AI2A 4K28A 4E30A 3W6ZA 1E1KA 1O5IA 1V6AA 3GZNB 3LC1O 2C59A 3OSUA 4N5NA 4YBZA 5L4SA 1DOHA 3ZH2A 4B8ZA 2YUTA 1LDNA 2GGSA 3HQ4O 1EZ4A 1DO8A 1FF9A 3CZRA 4UEOA 3JQFC 4LRTB 4NBWA 2Q1TA 3DZHA 3WDSA 1PQUA 4DTIA 1M76A 2X86A 5H81A 1IPEA 3JTMA 1X7HA 1OBFO 4MO2A 1ZNQO 3V2UA 1MLDA 2GN8A 3V1YA 1I8TA 1YWGO 4F6CA 3JQCA 4TVOA 2ZTUA 5B4VA 3I9JA 1H94A 4PCVA 1LLDA 5JXWA 3D7LA 4DYDA 3PYXA 3D0OA 2G1UA 2XF8A 1GD1O 3C24A 3WQRA 4DVJA 4M54A 1B3BA 3F1KA 3HDYA 4WK6A 2C7VA 5I7EA 3AI1A 1KVUA 3VPXA 5KVVA 1D8AA 4FC7A 1BRMA 4CQLB 1YJQA 1PQPA 4DMMA 2RHRA 4O5OA 1PJTA 4OXYA 4B4VA 2GRAA 4NFYA 1HYHA 1Y8RB 3Q3CA 3MJTA 5T8KA 4J4HA 1DC4A 1X0XA 5TT1A 4DBVO 2J3JA 4XD2A 3WIDA 4A10A 1JW9B 1CQIA 4NK5A 2Q4EA 4XYLA 1MFPA 2YY7A 1U2GA 4WOKA 4D46A 1ZXLA 3DBRB 4QX6A 1Y9EA 5JMWA 3FHLA 3DOCA 2OGUA 4E5NA 1J5PA 3MJSA 3HDHA 1DIBA 4IDBA 1PJ4A 1AE1A 3OJLA 2GASA 4YQZA 2YV2A 4YJDA 5JYEA 1DIGA 3WNQA 4O0LA 4IZHA 1R16A 4Q3DA 3IKVA 1LSOA 2IXAA 1GQYA 3NT4A 1R4NA 2WYUA 3QVOA 4BS9A
chains in the Genus database with same CATH superfamily
1JA1A 1M2KA 1V8DA 3QMVA 4GGMX 5AVRA 3OCYA 5HZMA 4G0UA 3WJAA 1XZNA 3OCJA 1SG0A 2QZSA 2AJDA 2D3WA 1KSHA 3DHWC 5HJEA 2CC2A 4WN9A 3KNZA 5FQOA 2EFCB 2CVOA 3WGYA 3J7TA 4QICA 2JIQA 5KQLA 4KOAA 3I4LA 2P2ZA 3I01M 2QTNA 2OXRA 3BMCA 4ZCQA 3R8CA 1BS9A 1LGYA 5J2TB 3FKSD 1D7OA 3CEMA 3LFUA 4B1FA 3A04A 2XB6A 2DBYA 1ZQ1A 2B98A 1P3DA 2WDPA 4L8GA 1HYEA 5IC4A 3H6HA 2PMBA 3OT4A 2JGMA 2PQ2A 5E8JA 5IASA 2JCYA 4N4AA 5K0GA 4ARCA 2G1PA 3UOWA 2O59A 2IELA 1FXWA 2FZEA 2DVMA 2FH5B 5K01A 2PX5A 4JKIA 4HKTA 4NH0A 3G2HA 4ADSG 3ESAA 2GYUA 1L7MA 3CH5A 3EUWA 1LBEA 2JATA 3PPIA 2W70A 4G0VA 4J3JA 2F9MA 3Q8KA 4BO1A 1UMDA 1J0DA 3AUXA 5B1SA 3GK3A 2JFYA 1X19A 3GZTB 3NWOA 3NXKA 1RC8A 1BVUA 1ZOLA 4GL2A 2GTPA 1JG3A 2H17A 1RBYA 2Q6KA 3NEJA 3ZIDA 2N1BA 2R4TA 3AF1A 4N8EA 4NS1A 3L1HA 2ZSJA 1PQWA 3DAHA 2WSSD 3ZHBA 2QTHA 2X58A 4J7AA 4B4DA 1FNSA 2CL7X 1JYSA 2NN3C 5BR4A 1HMYA 2Z4TA 5CDTA 3QX8A 1ZC3A 4HLUA 4B8YA 5LLTA 3D64A 1KAQA 1MD9A 2WTNA 1BA2A 4JK3A 5LFAA 2Z43A 4AKEA 2IHJA 3O83A 4K8RB 1H1LA 2W43A 3V5NA 2R1TA 5AXAA 2XE4A 2YYZA 4F71A 3L7OA 2IZ5A 3UF0A 2GTIA 4EF4A 2H1HA 5AI8A 1OXMA 4ZYYA 4ZVVA 3NI2A 1Y8AA 4H7HA 4QE3A 1UT5A 3KYDA 1FVXA 3J81k 1W4LA 1Z4NA 3GLFA 3V33A 1K2VN 1IYZA 1L7DA 1KU0A 5ECYA 1H2XA 2RHHA 2WD8A 2EP7A 3P0FA 4IX9A 4OGGA 5BO5A 1ZZEA 3W9UA 2GN6A 2X40A 1F4VA 1NPYA 16PKA 2QTVB 1JHMA 1LJLA 3HUFA 1IWOA 2Y92A 4NU6A 4ER0A 2HSDA 3P9SA 1C0IA 3OU7A 2ZYHA 5BNWA 4YCBA 5GOTA 3EVZA 1DZIA 5JADA 2ZT5A 5AW2A 1HOTA 1ABBA 4IGEA 1IPHA 2P9GA 2Q2QA 4JIMA 3CEHA 3S2GA 1ZVJA 3VYWA 1EWRA 3FLAA 1F48A 4V0LA 3U7GA 1YCGA 2OHFA 4Q02A 2BJHA 3E70C 2E21A 1O03A 3GLIA 1W73A 2KMLA 5E4FA 2IV2X 3K1AB 4F9GA 2ENUA 3U61B 2GNOA 1DRUA 2NZ2A 2OV1A 3U6BA 3W5SA 3X3HA 1GHTA 5GY7A 4YLYA 1RYZA 4QO8A 4J2OA 4HQRA 3EWSA 1V9SA 1G3RA 4LMPA 1CNEA 3SFTA 4B3SB 3DL4A 5KS2A 3L8MA 4PZ9A 4NCHA 1Z2CA 2NNLD 3EZXA 3MJ4A 3ZYCA 4POOA 5AUNB 1EVIA 4WZBE 2QUBA 4F1JA 4H6PA 2C4MA 1SKUA 3VAAA 3VKVA 4RPHA 3WISA 1RAGA 2GK6A 4MWEA 3S4YA 3BVPA 2BCJQ 4DHWA 3UQYS 2PH1A 5BY2A 2CMHA 3T3MB 3RVOA 5LN1A 2HO5A 5CLJA 1DCTA 3NOXA 1E4EB 2VCEA 2ZTHA 2G70A 5HF9A 3ZY3A 2BGWA 3E9CA 4MUFA 3TSWA 4P2BA 3BWBA 3NBMA 5FADA 3GZNA 4PYOA 2WAMA 3HZZA 4MVJH 1JQ3A 1YRAA 4M8IA 1XK7A 5I4KA 1R2QA 1U2SA 3WMFA 4JU9A 3REOA 3KQHA 4EJ0A 2ZYGA 2AF3C 4MR8B 4BVGA 2R11A 3EF3A 3PUXA 3X2FA 3K0AA 1P39A 5LCXA 1JHVA 3BFJA 4I55B 2FWJA 3FI9A 1E3EA 1U5CA 1IBSA 1BMQA 1PNTA 1V1RB 1NNSA 1W47A 1TUBB 3OM0A 2GA9A 4CKEA 5I7SA 1F6DA 1UPTA 2H9AA 1XVIA 4V3BA 1RBMA 4CMHA 1ZCAA 5AM4A 3DMYA 1B16A 3T12A 4GBJA 1N7IA 5DTMA 3T95A 3P2MA 3ENZA 4N18A 3SHWA 3SXUA 2A59A 4EBFA 2ABWA 3WG9A 5JFGA 2OP1A 3JZIA 1TQDA 4R9UC 2GM4A 1UPXA 4BCDA 1G3MA 1O8BA 2PSDA 5HKKA 1QHIA 2OQRA 1JHRA 5I9SA 1SUIA 3AU9A 3NHFA 4IKEA 4E5MA 2JFHA 1U8EA 4LS3A 4ZVNA 2P7HA 3RRJA 1OI2A 3PDUA 5DHAA 1F4PA 3H84A 2PQ0A 3HY3A 3TL2A 4AQ7A 2L82A 4CLRB 4UNRA 1NPTO 2AB0A 1RPTA 2PQMA 2VAPA 1J8VA 1WXQA 2E4XA 4HOYA 4LSWA 4Q16A 1FMJA 4JJIA 1IDOA 4YB8A 2AOXA 3OG9A 1G5FA 3FUTA 2H18A 3H16A 1N0IA 2XT6A 3WLSA 2X6RA 4DA6A 3W8NA 2ROQA 1GTZA 1LK7A 2YDYA 4JB3A 5ICMA 2PH3A 1FX0B 3TEMA 3ZTYA 4BZQA 4L5JA 4W8GA 1I1OA 3C3XA 4NPHA 3WHLA 4BCCA 3VH2A 3WGVA 4TS3A 1ESEA 3S2FA 4ZO9A 4Y2RA 4ID3A 1IN5A 1XVTA 1K3FA 5HZHA 1YRBA 2AG6A 2RB4A 4HGYA 5M2QA 3PZRA 1Z5VA 2F43A 3KQLA 1SVUA 3GJ0A 6REQA 5A7GA 4UZFA 2HV8A 4Q34A 2XDYA 1Q0PA 4MJXA 1O3YA 3FCXA 4LOIA 4OATA 2WE8A 5CT8A 1KI6B 1OXSC 2OVFA 5FF9A 3TRKA 5CDGA 1K88A 3O4HA 4BGUA 3O38A 2X3YA 2ZRGA 4RHEA 4AJNA 2Q4DA 3F2VA 3U48A 3UWOA 3P2EA 4G1EB 1I6WA 4WXRA 4URXR 6NULA 1J49A 1QO0A 2VDRB 1UKZA 4PF1A 3I09A 3S55A 1KH3A 1WDWB 3EXFA 3RF7A 2QD5A 4ZOAA 4MKFA 1IY0A 1DE0A 1PK7A 3LCUA 3RFVA 1CIPA 3ANLA 3W77A 3KJGA 2AN3A 2OCLA 1PRYA 1CULC 4LVNA 5TQ0A 4V3CA 4YCSA 1A77A 1S8NA 1E62A 3P0HA 4PYMA 4R7GA 4F0JA 3SM9A 2ZAMA 2C1ZA 4KREA 1B8VA 2Q45A 1Z56C 2EWWA 3DAFA 3RUHA 4JHLA 4Y9RA 1E9CA 4INAA 1SU4A 5JALA 2DUJA 1W4CA 1O4WA 2QX9A 2VZEA 1NP6A 1UWKA 4RPKA 5GAJA 4NEQA 4C9BA 3O8NA 1Y8ZA 1W29A 2BBTA 3HU2A 1R6XA 2OFFA 5C8ZA 1QCYA 3L8GA 1RKBA 1LNQA 2JHAA 2I9PA 3EH1A 3MCTA 4NPAA 4B45A 4Z7JA 3IEMA 1E2IA 1I24A 1LW6E 3IPLA 4UVIA 5DIZA 2IWHA 1TM7E 4BLSA 4Y6OA 3CIOA 1ZN9A 4D80A 1LLQA 1GN8A 3WLLA 1BMFD 5KYWB 4ZGBA 1TPYA 4ZJUA 1NYLA 1VIYA 2J7PA 2QRNA 2C2XA 1PK9A 3E8XA 3I92A 4Y7CA 1P33A 1PJSA 3U56A 5I8ZA 4IFIA 3Q9NA 5FLKA 3UANA 2YC2C 1Z6ZA 2B3TA 3HB5X 3GH1A 4EENA 4M76B 2JAUA 3RF6A 3CXUA 3QFCA 3GBPA 4GP9A 2PEZA 2VDQB 1BH6A 4HC4A 4F97A 1OXTA 3A4NA 1Q14A 5IK2A 1R00A 1MGPA 4OAPA 3T7JA 4JLPA 5C3MA 4WQMA 4AO7A 3X44A 4TTSA 1WVIA 1G1AA 3HWX1 3ILXA 1QFSA 2GRJA 2PMDA 4O8CA 4DLLA 4YJFB 3PNPA 3VSCA 2OGWA 1IJEA 2COUA 1THMA 1W7AA 2YYAA 1Y5IA 2YRWA 2J7PD 2GLXA 1YUBA 5IAOA 1HE8B 3RSGA 4FM9A 1Q7CA 1XFDA 3IGFA 3GLHA 3ND5A 2ERXA 4HEHA 1QP4A 1GQOA 2CNLA 3BTVA 3WKCA 4RNCA 2IBTA 3KT8A 3GVCA 4Y1RB 3DAYA 2VXBA 5KTRA 4OI1A 4LKOA 3T5PA 1BGWA 4DCVA 3OIVA 3R5XA 4WOBA 5BNIA 1OVGA 1XJ5A 2SBTA 1IUPA 4FKZA 1Z06A 5BOSB 4YRNA 1UM9A 2SNIE 1VG0B 1YVRA 1GDDA 5M04A 1TQHA 1ZD4A 4LI3X 4D0GA 7ADHA 2MYPA 4Q9DA 2R6FA 4FFOA 3OAAD 4KYTA 4D74A 3PA8A 2F2TA 3NM5A 5AVQA 2P3OA 3C5EA 1OWNA 5AVZA 3KVOA 4AQDA 4LJ4A 3BF8A 1NRIA 4BP8A 1EXNA 3N3BC 5AM5A 4MULA 4ZK2A 1L5RA 3LYAA 2JKZA 4WLEA 5L53A 3EGOA 3IERA 5HP4A 1YJXA 3KDAA 3BWXA 4JODA 3BHMA 4AZVA 2NU8A 4C78A 2P90A 2JGKA 3C8ZA 5H80A 3HWRA 4FFMA 3STTA 4UUNA 3SFVA 1A5SB 3NVMB 4QYIA 2JLSA 2YY5A 4AJPA 3DDWA 4I4LA 5JVDB 4WZBA 4C22A 1HO3A 3SP1A 4ER7A 4DR2B 4KR6A 1TT5A 4JIGA 1TEXA 1UOPA 1EQAA 3I28A 3K0AB 2X13A 4GMKA 1Y7IA 3SYRA 4IICA 1ZVMA 1HQCA 1KZ1A 2J3IA 4O4LB 1NI5A 4XQEA 3TTTA 4E5KA 4OIFA 4Q21A 3HKBB 3G8CA 3KKOA 1Q7BA 3JQPA 3GBVA 2OHHA 3OJOA 3PGVA 3NIWA 2F62A 2GHIA 3OWXA 3Q8MA 2FR0A 5I4CA 2ADOA 3OPQA 3R3UA 3FVTA 2VPQA 1XOIA 2F1RA 1V39A 3RSOA 2Q2OA 3HVJA 4HQKA 5MN4A 1J4AA 4CMGA 2VATA 1DBPA 2WJIA 3HACA 1P2TA 3U4IA 3TRDA 3JQ6A 3QE3A 1FSPA 2H1LA 4BDSA 1D4AA 4RL6A 4CMEA 1HL7A 2J9ZB 3BWDD 3KKPA 1N5OX 3SVTA 3O9MA 3WDMA 1AVTA 2JGFA 3K9HA 5AM3A 3KAJA 2ZJ3A 4TQGA 1ZGHA 1F0PA 2NVWA 3S29A 2K2QB 3UUFA 3VR4D 4MRMA 5BXYA 1M54A 2XRFA 2XCTB 1VJRA 2OAEA 2SCUB 1HY3A 1K7EB 2OP0A 1JJIA 4L27A 4D3YA 4Y6PA 3A36A 2PJZA 3DZDA 4R2JA 4FYVA 3GI1A 4RV5A 5I6DA 1WJGA 2Y8EA 4QNNA 2ODWA 4FCWA 3ETJA 5LYJB 1DC5A 1AK2A 3SVLA 2GNAA 3UT5A 1KAHA 3ZGLA 1N9ZA 4I8XA 2ZSAA 4UE2A 4Y98A 5E6UA 1KMHB 1OLXA 2W6ZA 4P58A 2BFOA 4NE9A 3RRNA 5MFZA 1LH0A 3LZCA 1Q0TA 3T06B 4BMZA 1VDMA 4XGRA 3H2HA 2BM9A 4H60A 3ZNNA 4EY5A 4IJUA 5IJAA 3SM3A 4B4OA 3WK4A 2H57A 3QHQA 4A2PA 2D13A 4AMVA 3MBIA 4HD8A 4DJFC 5JSHA 1HLPA 2PRIA 5LZ4A 3NDPA 3V1LA 4J03A 1FDTA 1K9SA 3A1DA 3TIIA 4WY2A 4QJ4A 4P53A 1FNNA 5FUYA 5TF4A 4ALMA 1TAQA 1N5JA 3JATB 1NMQA 1A9QA 4B3MB 1SC4A 2JS7A 4YAJA 2NV0A 2W2LA 3Q1KA 1ISHA 2ZJOA 1IIRA 5DGDA 3S7TA 3X2EA 4AN0A 4D79A 4F2GA 3H3XA 1CDOA 1ZITA 1KY5A 1GZHB 2IEGA 3DLAA 4C3ZA 1QK5A 1RKQA 5J2TA 2JFNA 4H7DA 4OXXA 4A7PA 2E4UA 1X2BA 2G6TA 2V5AA 2XADA 3DNMA 1SB8A 4N7JA 3IA2A 4L8FA 4RKRA 2Y4OA 1ST2A 4CGZA 3EMDA 2QVLA 4TTJA 3SXPA 4WKPA 1TEVA 5B7GA 1FFHA 1NUTA 3BHJA 1H2RS 3IXLA 2Y0BA 1TRHA 4RYDA 1RYBA 5P21A 5HUQA 1WPXA 4V0QA 1QYVA 2II6A 2ZROA 1JHZA 1W0JD 3I23A 3S0JA 3C3MA 3NPAA 4TWAA 2FI1A 4PZDA 1C30B 1T3LA 1K3UB 4HS4A 4V0ME 1AB6A 1F9AA 3VR5H 4MI3A 1N6OA 3AF5A 5EJ4A 4U4AA 3BDVA 2YBEA 3IT2A 4DA8A 2H1WA 3K05A 1SBCA 4HGNA 4M86A 3H7IA 4P8RA 1GFSA 3F4LA 5A71A 3UW3A 4EI2A 4KXQA 4NYMQ 4QG3A 1I4EB 4MPRA 1WCV1 2BT4A 3OT1A 3OY7A 3KB6A 4B17A 3VX3A 3QK7A 4KFRA 2ARKA 5ALJA 2UAGA 3AW8A 1E20A 3HDQA 2HWKA 4K05A 1MEJA 3F5MA 4FE3A 4GNKA 4M22A 1DKLA 3O4RA 4EPWA 5CA0F 3CQ9A 3PFKA 4O2AA 4PBSA 3A1UA 3D2AA 4RLSA 2PL9A 4FP9A 1QIEA 3HMKA 4BNIA 1J9GA 3JQRA 3N2KA 3F5SA 3GOQA 5H59A 2VOEA 4XSGA 4BMXA 1O95D 4QNMA 1PT5A 4YCMA 3ZDYB 2OTCA 1NX6A 4BBJA 1ZYUA 4EMBA 4JD5A 2CUKA 2XOXA 2G77B 4D6PA 3WQHA 2RC6A 4DMLA 2PT5A 4ZDKA 4JSRA 2EBUA 2V03A 1HDEA 4GECA 3UJ8A 2CJPA 1C9MA 1ZOIA 2HA5A 1OLSA 1BJRE 3LLVA 3ND8A 2G08A 1LXCA 4L9AA 1E89A 5KDLA 2RIPA 2IDMA 3TBFA 2P3SA 4HYTA 1Z4QA 2YS7A 3HO8A 4V03A 1SU7A 5CYGA 4WZ6A 4RMNA 1RAIA 4EPXA 2C07A 1SG9A 3ML1A 2WJYA 1UM9B 1OZGA 2JZOA 4L2IA 2NVUB 1QIKA 1P9OA 3UPDA 4D98A 4HTFB 2O8CB 3PNQA 1C0EA 4HX9A 1EVJA 2HF9A 2J67A 3NH6A 1QGDA 2P6UA 5F35A 2H2IA 3EXHB 3FKJA 5JS8A 1LSJA 2DBZA 4H9GA 4B6PA 3QFSA 5AVKA 2A14A 3GLFE 3B5EA 1XU4A 3NKLA 4YAIA 1AQ6A 4F4JA 2X1LA 1NQOA 2QD4A 3KUXA 4GKAA 2GCPA 3FYUA 2J09A 1SIBE 2X22A 3LDFA 4OJTA 1ZUHA 3IMCA 1U6IA 4PAOA 1PQ4A 3MEQA 5TQ2B 1KYQA 2FSVA 1XXHB 5H16A 5JEDA 2JAQA 3OO0A 5LXTB 5CG1A 3MJEA 4EKYA 1LF0A 1UJ2A 2G4LA 1VL8A 1LDMA 1XYYA 2PS3A 4P4UA 3L2OB 1Z36A 4HDKA 3ROZA 4B7ZA 3CVYA 4C05A 1WP9A 4LGCA 3U1TA 5EINA 2NP7A 2CLKB 3RS4A 3GGSA 3TZ6A 3F49S 1MO3A 2RAVA 2ZIXB 3PXEA 4MS3B 4K87A 2EZTA 1W2WB 1LU9A 3LV8A 3O1HB 3EZLA 2EVWX 4JROA 3S2IA 4AZ3A 5HUHA 4ITUA 3SEFA 3C87A 1M7GA 3C97A 2EKBA 3OZCA 1E4VA 3EB9A 3NHBA 4HAOA 4UBKA 1YT5A 2FFBA 2OBFA 2WSSA 3P5BA 3X1YA 5DV9A 1YZQA 2CF6A 5FNVB 3BTOA 3LLSA 4BRSA 2GR9A 3L4JA 1J5XA 2F3RA 5DFAA 2XHEA 1ZCBA 2FQ1A 1WB9A 4XD7D 1MB3A 1R0ZA 3AUTA 1CEQA 1RR6A 3LBAA 3N0WA 2NNWB 3FHOA 5G0VA 4DSNA 3C41J 4S1WA 1BCSB 1ONPA 2YL2A 5LQJA 3ET4A 1JAXA 2GAAA 4MCJA 4W5QA 5E4JA 4BO2A 1KI9A 4ZT7A 4UM9D 4LE2A 1GZDA 2QY6A 4PTYA 3UK7A 1U94A 3QEMB 8OHMA 2O2ZA 1KJ9A 5CB0A 2Z9DA 1I14A 4WESA 5IJ9B 1Y6GA 3KETA 3M4XA 1J0XO 3IIMA 1JQEA 5DLQC 3CEPB 5JRZA 2CDCA 5I7WA 1D2NA 1PHPA 4F5WA 2DEUA 5GJCA 3KDPA 1PWHA 5AKXA 1XMJA 3A05A 1EJ6A 1DTEA 5LA6F 4DQDA 1XL1A 3QVXA 4AY4A 1EB9A 4UFNA 1C80A 2SKDA 4TOIA 4YJHB 1SN7A 3N2IA 2BRUC 4AJOA 4C2AA 1QF7A 5AVJA 1DFGA 1ODFA 1KVSA 4GX5A 2BMDA 4E07A 2GX6A 4GW3A 4II2A 4B35A 4AC9A 4PG8A 1OREA 1IPFA 4FGZA 4EGFA 2L2QA 3CF2A 2GN0A 2OUKA 2JJ2D 4C3OB 2AIRA 4TSFD 4YUYA 4XGIA 3GLVA 3I01A 4KPYA 3S8EA 1H8ED 3OKCA 1XD2B 1XTPA 2OZLB 4EZIA 1GT6A 2NUBA 4JA0A 1G7CA 4QHYA 3IV7A 3NM4A 1L3IA 2RBKA 1QF6A 3FTNA 2Z57A 5H9VA 4RANA 3A6GA 4UM9B 5HM8A 1Z39A 3GWZA 1GUZA 4LMBA 4FXPA 4OL0A 4G8JA 1PFWA 3TWOA 2PLAA 2O23A 3EEQA 3LD9A 4WOPA 3QEOA 2BLLA 1QAOA 1UXOA 1Y7TA 3N5CA 3PFCA 4HUQA 4MS1A 4UMEA 4Z0HO 5FDFA 3W5VA 3K70C 1KEPA 1P7CA 2YZNA 3R3JA 3UK0A 3OA2A 4AU1A 3AVTA 1E3DA 3FCYA 5I51A 3R4CA 2B1GA 3TLAA 3AVXA 1L7AA 1PWXA 1OU4A 3V4VB 4JZYA 2JHCA 4ZQIA 3C0KA 3H11B 2F4NA 4Q05A 1ZEMA 1PX2A 4B46A 4Q9HA 3R3SA 4BNGA 1P17A 3WL6A 5HGJA 4PG6A 3ROXA 3GDFA 1NHWA 3GFGA 2EFYA 1P91A 4X3PA 3USES 3IE1A 1IN6A 3CUVA 3TJMA 2R1VA 5D3QA 5L95A 2FXVA 2VNKA 3GFFA 1QYDA 2GBLC 3I1JA 1A5BB 3OE5A 1I3OA 2FWPA 2GWRA 3SJZA 4BV8A 1V8FA 4EHDA 1KA9H 1G5PA 3DEAA 5KKCA 3IUMA 4GZ5A 4Z53A 1ILWA 1DAPA 2X9GA 1V41E 2RG7A 3KFLA 2KYRA 5LB4A 1R10A 4PAQA 4ENSA 2W2OA 2X8BA 4XX0B 5LVAA 3HL4A 1CCWA 2W6MA 3UJHA 3O8DA 4FYJA 1EJ2A 1RQGA 3KG2A 2Y0CA 1E2MA 1T8UA 3T94A 3PLRA 1ZGAA 3ZCRA 5U4XA 1Z6YA 2YOHA 1U8ZA 5JCOA 3RJZA 3MTEA 2GBGA 3MT7A 1NBIA 3LX6A 5F5XA 1QPBA 2R1UA 3ZY6A 4ZYXA 1QDEA 3TFOA 4MXDA 3P45A 3GGGA 4JHXA 3NV7A 1ZH6A 4C0QC 2IOYA 2GJSA 4HLQB 1UUFA 3TQIA 5KOJA 1U9ZA 3VOSA 4PO8A 3WX0A 1WSWA 4DCMA 2QA5A 1C9YA 3BMQB 4LRSB 4WVFA 521PA 1C8BA 4FE7A 2A84A 5L3RA 3ROGA 3QE2A 3LCVB 4NZZA 3X43A 4Z3DA 2WSIA 4EDHA 3B5JA 3AB8A 4YRMA 1YK1A 2F90A 2JEZA 2JIBA 4GM0A 4M1WA 4YAEA 3V2GA 2KBEA 3A28A 4JXXA 2ZYTX 1MRZA 3HB7A 3LQ4A 4ZVLA 3RTDA 1VKHA 4Q9KA 3O4JA 1QNFA 1QVRA 4DSTA 4HVCA 4MVJP 1RXWA 2Y66A 4XB1A 1U99A 4ITVA 1PL0A 4BAUA 3BORA 4ETIA 4KYVA 3FR8A 5DNEA 3KB8A 2G88A 2V8OA 1LV7A 1ORDA 3EGEA 2ES4A 2I2WA 4MDHA 3DZ8A 1LLCA 4TTTS 4DLXA 5EQDA 3T7DA 4U00A 2WHPB 4KQJA 1OC4A 3RU2A 3K9BA 4MI1A 4J90A 4QTZA 1Z6AA 3W9BA 1E58A 2OCIA 3SI7A 5A62A 4C4AA 4D42A 1NW9B 1V9CA 1B0PA 3L4EA 3GCWA 3LOPA 2FCAA 3MMXA 4UUPA 4DXDA 2MSDB 1CV2A 3KBOA 4KE8A 3ZU6A 4E2WA 2EZ8A 2RH4A 4PSAA 2OK8A 4HX2A 2G7MC 1A4UA 1GTG1 4N5LA 3SYMA 4YQYA 4ZICA 2UXBB 3Q6IA 3TSYA 2CXSA 4QLAA 2JLWA 1SCUA 4PZPA 1G21A 2V6GA 1JH8A 1LPMA 1OWLA 1M5TA 2VA8A 3PD0A 1RLOA 1UKCA 4IOLA 4G9GA 1M6VB 4XJSA 3H42B 3ZDRA 4AFNA 4BMPB 1GTVA 3A06A 3KKQA 3HGQA 2CN1A 3P2KA 4ZAVA 2PTGA 3OIWA 2BEJA 3FPCA 2KW5A 5BYJA 4RDXA 4J0KA 1FUIA 2QU8A 3H0CA 3HKCA 5K6AA 1H1DA 5EP1A 3OIFA 1O77A 3D3JA 2Q28A 3IE0A 3ZN2A 3KV1A 4Y7DA 1FW8A 1UP7A 2GETA 3F98A 4X0EA 1N2BA 4DMRA 5JRJA 4F93B 4ZQBA 1WPQA 1KR2A 1NXPA 1W35A 2QUIA 1U7ZA 4MIYA 4XYMA 3NGLA 3CF6R 1N1EA 1JTFA 4H4CA 2C5EA 2GPBA 2WFMA 3I5YA 1OZHA 3T61A 4R3NA 3RC3A 4N7RA 3WIEA 1I7DA 1DJNA 3HB4X 2MYUA 1PV2A 2VFAA 1JFFA 2ZRMA 4WVLA 3SHOA 1T9CA 1QRDA 2G5PA 1X8JA 1G8HA 2C04A 3Q0IA 4AICA 1Z0JA 1V3TA 4N9QA 3RU7A 4IINA 2JFOA 3ZGVA 1WSDA 2P0EA 1AA6A 3KC2A 4ZOLF 1KU6A 5KOHA 3N53A 3WHPA 4G4JA 4DCOA 3LGXA 2YQ5A 4FHDA 3G2NA 4R0MA 5DNUA 1SD1A 4MW2A 3V7WA 3ZE8A 3DE4X 4IUBS 4EHHA 1TO2E 3C4QA 3FE2A 1A71A 3PA6A 4COOA 1H4QA 2ECKA 2FOLA 4GC5A 2IYUA 1KXZA 2JJYA 2ODPA 2Z2ZA 1KO7A 3NDIA 5LOVB 3EFBA 1HPLA 3AHJA 3UJDA 3VPCA 1Y4AE 3GXBA 4NIMA 2R751 2FSVC 3QTLA 1XU7A 1D0VA 4PFJA 4UDNA 5CGQB 3UH1A 1DKUA 1AX9A 1YB2A 5HF6A 1YHZA 3ITEA 5BV0A 3AFNA 2BRUA 1QLHA 3R3VA 4B80A 2PMWB 3EIXA 4RA9A 1SCQA 2ZS7A 4KZKA 2IXFA 3ZLUA 4AS1A 3GA0A 3ECCA 2WIDA 5HK8A 2H2GA 3QBDA 3BGOS 3GD5A 4H6VA 4D3FA 1LJUA 2QN6A 3EGIA 3TK1A 1YR3A 3DVAA 2HF7A 4AN4A 3DZFA 2JDIA 2PL1A 2D2FA 3CPEA 4HRYA 4N5IX 3TAUA 3AK4A 4D9KA 1WXDA 5M34A 4K2AA 3GW8A 4X66B 1CIJA 3GJ3A 5B64A 5F12A 3SLKA 2GVZC 1CZOA 2XYQA 4MQMA 1CFJA 3IODA 1GL7A 4TVBA 4X7MA 5IJ0B 5D3MB 1NVVQ 1QOPB 2XB4A 4FSHA 3T3IA 3J81A 3F74A 2YZKA 4BUJA 2VF2A 1G5RA 1LA2A 1WQ1R 3D3NA 3JD2A 5TRTA 2NUTA 3D8TA 2FFHA 4IZ6A 4J6FA 3CLHA 3U3DA 4CIYA 4MCHA 3CNBA 1KAOA 2CMDA 4QYSA 4J7UA 3COJA 4G5QA 4I19A 3N05A 2J1LA 2V59A 4PPNA 5IF3A 2YFQA 2ZCUA 3H5AA 3QYPA 4JP1A 2P4EA 4BGVA 4KXMA 4CUZA 3K6SA 1JZTA 2BI8A 2XODA 1CUEA 4E15A 2G9ZA 2OD7A 3QI2A 2FP3A 2GF2A 3PRJA 2OM6A 2HQ1A 1NVDA 1WXHA 2QK4A 1UDBA 1Q20A 3K8OE 1OFHA 3M6WA 1LTKA 2PKQO 2JLBA 1OH7A 3DXZA 4UREA 5TVGA 4YCLA 3LVBA 5KQGA 4QELA 2D1YA 5J4YA 1EWQA 3WNBA 3UUEA 4BTVA 2VCHA 2AR0A 3SIWA 2QTGA 4BVEA 4EW3A 1C4KA 2PVPA 1ECGA 1S4MA 1Q84A 4MUEA 5LJLA 3CMCO 2W4MA 1FFDA 1EVZA 2X76A 3VNBA 1XVLA 5ES4B 1PS0A 2ZR0A 2QGFA 5EYPB 4HGZA 5BSVA 2Q3LA 1L4LA 5I5EA 3Q15C 4AUNA 3SD7A 1PFUA 2R96A 4WK4B 1RRVA 2DCUA 5EFOA 4HWTA 1MOSA 1VLHA 5KYYA 1L5YA 2W6IA 4L8LA 1M83A 2H65A 1GV0A 3G5MA 2DKOA 3E2MA 3IAAA 3KYJB 3N5KA 2A5YB 4EI8A 4F8YA 2VK8A 4QPZA 3TLCA 3AESA 1RXVA 3NT2A 5EESA 5K5EA 1BH2A 3ND9A 2XYGA 3E9YA 3IVCA 1YR9A 2W11A 1EVLA 1I1HA 3LY5A 4PU0A 3ZNPA 4AMYA 3PXUA 1OHHD 2QLJA 4MYRA 4AP6A 2FRDC 1U63A 1ZIXA 4IZOA 3G9XA 2ZI4A 3FBWA 2BFFA 4FHCA 5AD1A 3ZQJA 1N6IA 2ZWIA 1N0WA 2YWHA 4FWIB 3I64A 3PC6A 1T0BA 4MUMA 4RK6A 1U02A 2RGUA 1MB4A 3I53A 2Z3VA 3C45A 3JALA 5JNVA 1CLEA 4K8OA 3ONVA 3I6MA 2OXEA 4AQYB 2CV2A 1SRRA 2A4MA 3QBEA 3WGLA 3GRRA 2HMVA 2IY7A 3L0SA 2VH2A 3L7BA 2FLWA 4FCVA 1U11A 1NOJA 1SELA 1MTZA 1NVUQ 2ONYA 2GD1O 5TSDA 1UC4B 4X8LA 4KQHA 1BMFA 2GBCA 1NUPA 5T4EA 3W05A 3BIXA 3ESZA 1C9EA 4B2PA 4RWZA 2J0VA 4BLTA 1M74A 3IL2A 1BGVA 3GNLA 3IOYA 2QYHA 3S1AA 4RDHA 4CRWB 1QK3A 5LSAA 3I9V1 1JMKC 1YA8A 3MWYW 2EGUA 4F91B 4DLBA 1G8FA 2J4DA 4YLGA 1CPYA 4EUNA 3IEPA 1Y33E 3KUDA 1N7GA 4M9RA 4HV4A 1F5SA 2JVJA 3I9NA 4QUBA 5AW8A 3AV0B 2Q8PA 4TT3D 5AJWA 5KNLA 3GX1A 2WW8A 3FOZA 1QQ5A 1HF3A 3VR4H 4CKBA 2HNAA 3VDNB 4HNUA 1UK9A 1DC6A 1II8B 1ZRSA 2DRIA 2QTBA 4G86A 4YIKA 1WB5A 5JBNA 5BN4A 1Z4JA 2HJRA 3IP8A 3L1VA 1EAYA 3E3OA 5EZ5A 3DF9A 5KHAA 5CD9A 2X2PA 4UEKA 2UZ3A 3K9WA 4P3XA 1X8LA 2MINA 3DFIA 1OIXA 2C82A 2GN1A 4NU5A 4OG2A 5FPQA 4DCPA 4O4LF 4HB4A 3E6AA 4INOA 2H51A 2ZPTX 2AYXA 3MWDA 3OAAA 3E0XA 5FBZA 1JSRA 4XYGA 2V7QA 4ZDIA 4TYYA 3BXGA 2FGKA 4L57A 4WV3A 1T4DA 3OEED 4O4JA 1G9SA 4O1HA 3LTEA 4M7RA 4BMOB 5JT1A 2XWJI 4QUKA 4EW2A 3RSSA 5JYDA 1EI9A 2WYVA 4L3VA 3RWOA 5TIIA 4LDAA 1G6Q1 2GFQA 3PPWA 1FNMA 1OX4A 2QL9A 1CJCA 3I3SR 3N7TA 4BQSA 1PGOA 1U8YA 4WCFA 1MXFA 2TMGA 5F2NA 3OQNA 3JVDA 4KWEA 2X8AA 2DPMA 2OORC 1GPYA 2H2FA 3RFCA 3HFRA 4BKUA 2JFPA 5ALVA 2HLNA 1M2OB 2AEEA 1NJ6A 3V00A 5IDWA 4B85A 1AY0A 4RPLA 4NFSA 1ZGGA 4G1UC 2BJWA 3DFFA 3WGMA 3KX2A 2XITA 2NXNA 2VAVA 3IBSA 4BE4A 4BQQA 1LPSA 1LVGA 2HWXA 2VUHB 3TZKA 4M7WA 3GP8A 1GPMA 2X9QA 4GEGA 1H0HA 3PGA1 1EUQA 1E4EA 1UINA 2QVZX 1UEJA 2P1ZA 4JBXA 2R00A 1F0YA 1OXUA 1IBRA 2VSQA 4PX3A 3WOHA 3ZTWA 5KNDD 5L40A 1ONNA 5L51A 2QEQA 1Z62A 3NDJA 3MPOA 4PNEA 3WLPA 3HBNA 2F59A 3PGJA 1O97D 3L77A 1RCTE 4R05A 3IESA 4MA5A 3VR5D 1FTYA 4B6EA 1DKMA 5ITZB 3ADKA 3PL5A 1GTL1 4DLAA 2JJ2A 1PV1A 3IAS1 3A1WA 4J8PA 4HZGA 2R3SA 5AFSA 4IIVA 2GEUA 1JR3D 1G7SA 2C54A 2IP2A 1Z37A 5CM2Z 5AW4A 5I8PA 5JATA 3Q4GA 4F5YA 5DCLA 1TF5A 3PR1A 4JJ6A 4EYEA 1RD4A 1RSZA 5ES3A 5IJ0A 4ZHSA 2RAFA 4U7JA 4HTFA 2FG5A 4BFYA 4GI3A 4KV7A 4BQFA 1TD1A 1QVZA 2VVTA 3Q7PA 2GESA 2PJDA 3ESDA 3RV4A 3KJXA 3Q3GE 1FU4A 3ME5A 1JGTA 1WW8A 3ILHA 4IKPA 5G53C 3OCZA 4ESHA 2DPGA 3LG2A 4DJTA 4Z99A 1O0CA 1FFEA 1LFDB 3LNTA 4BB9A 2IA5A 3TI9A 2REXB 5CRIA 3R6DA 1ORWA 1PGJA 4UUMA 1D0SA 4QRHA 4KWCA 3OQJA 1TZBA 1B6RA 2LRHA 1U65A 3A1SA 1NBEA 1W9HA 3F8WA 4OBWA 5EHXA 5GONA 4DF3A 4JA2A 1JLMA 1EEHA 1JQLB 2VWPA 1SXHA 3KPWA 1RE1A 4JJFA 4E88A 1E7SA 1JHUA 4RUKA 1JUDA 3ZBTA 4I0WB 5UKDA 3JZDA 1M7BA 5E3IA 4F60A 1YGYA 2O0MA 1Z8DA 4IXTA 3BJEA 4WD3A 1OLSB 2YNMC 4G0PA 4KO2S 4OQMA 5CNKA 4ZDWA 2ODQA 4CL8A 2WJ6A 4NCJA 4JS0A 2BGKA 1HWYA 2RC5A 1JZSA 1FVHA 4NCKA 4EFMA 1S0UA 3KSDO 4DQUA 1CVIA 3CYFA 3VKUA 1T4GA 2JFFA 2JLZA 3VSEA 4LJ5A 1SPBS 4K3VA 4UCWA 4I4TA 1PKEA 4IDPA 1Z25A 1UODA 3KJFA 3ZXXA 4YJ2B 4YHHB 3REQA 3UHOA 3T54A 3FAZA 3SR0A 1CYEA 3CR3C 1M2WA 1OTXA 3ABQB 2WNHA 3I4CA 1D4ZA 1BEUB 1A5AB 4D4JA 4YJ2F 3MTIA 4XDZA 1PNVA 1P19A 2DWCA 1NJ1A 3LLUA 1KFJB 1NTOA 2I4LA 1FMTA 2O2SA 4OP3A 2GYWA 5F1KA 2ZXUA 2UU9B 2V0GA 3E5MA 4ZI7B 2OQVA 1EZZA 1FY2A 2UUBB 1LVUA 1YR8A 1XCLA 1NFFA 1JVNA 2JBWA 2P78A 2C2GA 3B7PA 3MZ0A 3OX2A 3PJEA 2C58A 1BOOA 3ER6A 2HR1A 2FMFA 1DFHA 1DRWA 3ITNA 4XIJA 4FHGA 1S9DA 1ZJ6A 2XNJA 4GOJA 4WLNA 1EGHA 3O6VA 2Z6AA 2YXPX 1TTQB 1Y9ZA 3OPYA 4Z6KA 3MWJA 4PQGA 4O4JF 3AO0B 4HB3A 4R2MA 3EQZA 4IS3A 5CLHA 3SC2B 3UXHA 4BEVA 2OENG 3A9VA 5FEMA 1SBNE 1F6WA 4GP6A 1W0JA 2VBFA 1EUZA 3WRYA 3GNSA 4EJ6A 4HWGA 1SXPA 2AUMA 2XLBA 1P5ZB 1ISMA 2GD2A 2R79A 2HJSA 3EFEA 1WXIA 4H3SA 3N75A 3GLTA 2DQ4A 4Y6QA 2Y1LA 2PU7A 2VF4X 3L0DA 1Y63A 4R51A 5CFNA 5ICSA 2ZE5A 1II0A 3GFOA 1TFRA 3VDMA 1RWKA 2GPNA 4CEJA 3CNLA 1CTQA 3ZHXA 1IN8A 4I1OA 3SF8B 4N3GA 1WMEA 4HDOB 1CF2O 1A7JA 1YR6A 3RVBA 1R3UA 3LYUA 3NWBA 3MQ4A 3W8RA 4D4IA 5JAHA 4GYWA 1GGMA 4I8IA 5EPUA 1Z7WA 3G7UA 5J3JA 1WCIB 3N59A 4LJYA 2MCFA 1WCWA 2OBNA 3ETNA 3OCVA 4PWZA 2O7NA 1VE6A 2ECFA 1GWNA 1PEDA 4EO9A 1DWOA 1KC1A 1XYVA 3I83A 4DNPA 1CJVC 1GFIA 1NQTA 3OESA 1IHOA 1JG2A 1VB3A 2AFVA 7REQB 4MWZA 4RCVA 1I5EA 4DR3B 3EGWA 3QEAZ 2IOFA 4IJQA 3DJYA 2GAOA 4E2ZA 3MMNA 1W5FA 1QMGA 1XLTC 5EMNA 1AOXA 1CY7A 5ECWA 4YV0A 2DB3A 4HWOA 1JMYA 3PCXA 2R7AA 3IO3A 2DH6A 2VNSA 3TM5A 1EXMA 4JP8A 1Z2DA 4I81A 3C8DA 3NAQA 4U3JA 5I7VA 5CW1A 1FX0A 2WR8A 1CQXA 1HL3A 4HRVA 4W8HA 4BVHA 2EQ5A 2HMTA 1GVNB 5KYTA 4L85A 2GKOA 2H1OA 1MNAA 1ZIDA 4HFNA 4C20A 4EA8A 4C03A 3GR6A 7MHTA 4FNOA 1U2ZA 1ICEA 1KJIA 4LHXA 4GLLA 1LNSA 1YASA 3FR7A 1THTA 3GAZA 3RYTC 3VJLA 5JSKA 5L7TA 1RDFA 1QKIA 1SULA 3BD6A 1USIA 1V1JA 3FCEA 4IDNA 1Q7GA 3WB1A 2I54A 1CUXA 4RGQA 1OJ7A 1TCCA 2BFAA 4DQKA 4DV6B 2W8ZA 2KX7A 3LUDA 1LFAA 2XDWA 4MQFA 3KSUA 3NORA 5EC8A 1OAOC 2WUFA 3A7EA 5IMBA 1Y1LA 2A3RA 4ML3A 1JHPA 5IUJC 1YZYA 4G81A 4KUEA 4OMCA 1RWOA 1M8GA 4UTOA 3L0YA 2P2DA 4UAUA 5DBEX 4BB6A 4NK4A 2CHGA 5A4JA 4M0UA 2HDOA 5I7AA 2O8FB 4DA9A 4QGSA 1RCFA 1ZM2A 1LLFA 4AG5A 3H5LA 2G82A 4BNDB 3OX1A 3K71B 3AFGA