4AJPA

Human ldha in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol- 6yl)amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
329
Chain Sequence
ATLKDQLIYNLLKQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 329
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajpA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajpA02
8LDHA 4B3HA 4OQZA 2O3TA 5ADHA 4FPXA 4XGIA 3HG7A 2AA3A 3BYZA 5I9NA 3JQBC 4R3WA 4BO2A 4CJXA 1PR3A 4BO4A 1LC0A 4GWGA 4BKQA 4CL8A 2X5KO 1C14A 1DC4A 2G0TA 1NHWA 2O3UA 1FDVA 1CQIA 1WDLA 2P9CA 1LSUA 3AM5A 5DOZA 5CPBA 5EIOA 3D4OA 3FR8A 1ZJYA 5EERA 3D3WB 2DT5A 1BMDA 4CMGA 4DQVA 5CG1A 1BW9A 3GRKA 4XJTA 3RD5A 1NFQA 1AE1A 3DZIA 3VZSA 5GMOA 3GHYA 4ZQGA 1RKXA 4IM7A 3ZN2A 1T2EA 2VOJA 3IC5A 3TOXA 3TZHA 3V1TC 3ANNA 4BNJA 4MO2A 2W98A 1PL6A 5ENVA 4DMMA 2Y99A 2EW8A 4GAEA 1EFLA 3RBZA 3D0OA 3JYLA 3T7CA 4DUPA 3QWAA 4RDIA 2X0IA 3GNSA 4CM4A 4LISA 5C5IA 3C24A 1O94A 1HYGA 2FPGA 1SOWA 3QV1A 5JY1A 3PYXA 4J0FA 3C1OA 3L6DA 1LSJA 2WM3A 4FC6A 1HSOA 3RFTA 2V65A 1JKFA 2LDXA 4RVHA 1QP8A 4EBFA 4HV4A 2C82A 2P91A 4D46A 2Y67A 4OQYA 1BRMA 4HWKA 2DBZA 1CQJA 1BVRA 2YFHA 1PL7A 3UICA 1YOVB 4GWKA 2F00A 1U5CA 3ENNA 1DRUA 4U5QA 1V3UA 4OSPA 3MJEA 3PJFA 4XDZA 4R5HA 1FDTA 4E6PA 4B7CA 1MA0A 3GA0A 4A10A 2J5KA 3RAJA 3A1NA 3QP9A 3WBFA 1K6XA 2QW8A 3E9NA 3NT5A 2PY6A 2NU9A 1ZK2A 3LT4A 4WOKA 1ISIA 3U4DA 3GVXA 1E0DA 3ZNQA 5L9AA 4K9DA 3GLQA 4R1NA 1SZJG 5TS3A 1PZHA 3GRPA 4Z6KA 2O7QA 1R4MA 1E5QA 1DDOA 1ID1A 2XPCA 3R3SA 4YJHB 2GUGA 1F06A 2GPTA 4CM6A 2FOIA 4EEZA 4WNCA 1PGOA 3LK7A 2A35A 1KYQA 3LC7O 4BNFA 5KVCA 3S2GA 2DPGA 1A9YA 3EUWA 4TSKA 3ZWBA 1N5DA 1LTHR 2GN6A 5TNXA 1I2CA 4AJJA 3K8ZA 5DCWA 2X7HA 2GSDA 4RVDA 2BH9A 2VZ9A 2VUSA 4Q3NA 6ADHA 1M76A 3CH6A 3GQVA 1SO8A 3ZH2A 3ASVA 1KEUA 3UAGA 4CM3A 3R1IA 3F3SA 4KTTE 5COQA 1DB3A 4Z9XA 3ETEA 4HFRA 4WLOA 3BTVA 3RC2A 3W8FA 4QTZA 1O8CA 3ST7A 1LC3A 3IJRA 4Y6RA 1N1GA 3KYDA 4JIGA 3Q6IA 1HSZA 2VQ3A 1E77A 1QYWA 4XEHA 4RO0A 3AY6A 3BA1A 4LSWA 4O6VA 1JWBB 2Z95A 3MJ4A 3QWIA 1Q0HA 3H65A 1KEWA 1P0FA 3BMQA 3DWFA 1GQQA 3KB6A 4FOOA 2IXBA 2CZCA 3UGKA 2VNSA 3GN2A 4W9NA 4TKMA 1PEDA 1O0SA 3HDYA 3GVIA 5L45A 3DZJA 5F5LA 3OA0A 1GZ3A 3GG9A 1OI7A 4NMHA 4OGWA 3WGIA 1D1TA 1SCUA 4N7RA 5JXWA 4ONEA 3DR3A 1UP7A 4RCVA 4AJNA 1YL5A 4CR6A 4XR9A 3P5SA 1DIRA 1P1IA 4RZHA 2V6MA 3RSHA 1T4DA 3UOGA 5T8KA 1WPQA 5BQFA 1DPGA 4KQXA 5KJ6A 1A7KA 1SEVA 2IRWA 4KMSA 2HSDA 4IGEA 1DIBA 4P8RA 3PTZA 3DBVO 2Q3EA 3LLSA 4YT4A 3GPDG 4Y98A 3KYBA 4ILKA 1LDMA 4JROA 2Q2VA 1GYRA 2C07A 5FF9A 5JAIA 1XU9A 4LN1A 3CSDA 3D7LA 1PJLA 1YQGA 2OUIA 4OMUA 2Q99A 3DL2A 5T6BA 2NQTA 4NPCA 3QVWA 1H6AA 2I76A 3I9KA 2RCYA 4D44A 4WLNA 1N92A 4XWYA 2CVOA 1IUKA 3QA9A 3JYQA 4GL4A 1D3AA 4GMFA 3MOIA 1K0UA 3AJRA 4B4OA 2BELA 3GEGA 4RPJA 4Z9YA 2AXQA 3I5MA 4JXKA 2IZ1A 4RPLA 1K3TA 1T2DA 1TT5B 1R16A 4PZEA 3S55A 1UUFA 3I23A 4FIZA 1ZNQO 4J90A 3WYCA 2Y68A 4NNJA 2NLOA 4JP2A 3GAFA 3HN2A 5FWNA 3VOSA 4YAEA 1XA0A 1QG6A 3I1JA 1I3MA 2CNBA 3RROA 2ZIZA 2Y93A 5KJ1A 4IDFA 4WPGA 3S2FA 3UVEA 1T2CA 3FNGA 1UXIA 4FR5A 3HE3A 3E5MA 4RDHA 4WGGA 2AEFA 3N58A 3WWYA 1R15A 1F8FA 4YXFA 1V0JA 1QR6A 1HYEA 2D5AA 3O26A 3RUDA 5F21A 4TWRA 2X6TA 4CMIB 4BO3A 2OXIA 1PSDA 1FDWA 3ZCXA 2PA3A 3FBTA 4IZHA 3AK4A 5EQDA 2WYUA 3GF4A 1ISMA 1KC3A 5IAAA 1ZFNA 4DC0A 4YJGA 2VOEA 4AJOA 2AE1A 1I2BA 4CMHA 3IDSA 4EUEA 4KUEA 4NI5A 4MP6A 4F46A 4PLPA 4J2OA 3R0IA 1E1MA 5MGBA 3WX0A 1B3RA 2B5WA 3MOGA 2UUPA 3QVXA 4GGPA 3WICA 4CM8A 2WEKA 2HJRA 3FPLA 2ET6A 3I9JA 3FWZA 1J5PA 3AUAA 3IIEA 2HKIA 4YT2A 1Z73A 1TLTA 1LDBA 3JD2A 3PVZA 4BMVA 5F3RA 3ZWOA 4EGFA 1WAMA 1WW8A 1Y8RA 4I8XA 3SX2A 4GH5A 3DZHA 3KOUA 3VAZA 2FN7A 4RVSA 3GAZA 3KZVA 1PWZA 1WDMA 4TRJA 4FB5A 3QIVA 3SC4A 1VSVA 1E3IA 4FN4A 3KYCB 1TT7A 2P9EA 4U7WA 1J49A 4XRGA 2PKQO 1K6JA 3DOCA 1YL6A 3RUFA 3E18A 4YYZA 4LMPA 1U7HA 1NWCA 3D5QA 3JQ7A 5I7SA 2JCVA 1JA9A 5TX7A 4WCFA 2AHRA 3UW3A 1GZ6A 3H2SA 2JAHA 3DHYA 3K31A 1A9ZA 3ZHZA 1QYVA 3IP3A 2VRBA 3OA2A 1B8PA 1X1TA 1MX3A 5HBRA 1HWYA 2H1SA 3GZNA 3OJFA 3P2OA 2Q1SA 3WGOA 4J2HA 3IP1A 4XGKA 3WS7A 4JJIA 3HHPA 4CQLA 5IN4A 1LLCA 2DFDA 3FSRA 1NR1A 3IJPA 1GY8A 3WJ7A 4B8ZA 1GUZA 2VZ0A 3CMCO 5ENDA 1I3LA 2ZB3A 2X9VA 2ZKLA 3FN4A 2BFMA 5L4SA 3GMDA 3UCEA 3HJAA 2W2KA 1UXGA 4IS2A 3GNQA 3DC2A 4J0EA 1R12A 1JAYA 3OQBA 3UCXA 1Q7BA 3PHLA 1OZAA 3C7DB 1UDBA 4KWIA 4H16A 3PYLA 1KVTA 4YRAA 1B15A 2FP4A 3JQFC 3O4RA 1N2SA 1W0CA 1IZ9A 2A94A 1LBEA 4HNGA 3WYBA 1YQDA 1X0XA 3FHLA 5DT9A 2WDZA 2FRDA 3RU9A 1QXSA 2O3QA 1Z75A 4OXKA 2Y05A 5BT9A 3MTJA 3H3JA 2P2SA 4CV1A 4RF5A 1MB4A 2BKAA 2EKLA 2FR8A 1PU2A 3DHNA 3X2EA 3ZWAA 4S3MA 4CLDA 1KY4A 2QG4A 4J9VA 5TSDA 2GN4A 2P4QA 4IUYA 3K9QO 2D59A 3JQFA 1LDYA 3P19A 3ZU4A 2BMAA 3BHJA 3WFIA 1IE3A 3O8QA 3QLJA 4WK6A 4BO1A 4FFOA 1LQTA 2UV8A 2HQ1A 4NHEA 1VL6A 5DCYA 5EMHA 4Q3CA 4I9NA 1BVUA 2O3RA 2PV7A 3RC9A 3OJOA 1VE9A 5C37A 3MEQA 1BGVA 2FZEA 1JQBA 1PIWA 2PZMA 2ZB4A 4JQCA 1XQ6A 4ID9A 4YQZA 1O5IA 2DFVA 2HJSA 2I3GA 1Q7GA 3T4XA 2NU7A 2UVDA 3ZWMA 4K1LA 3SXPA 4Y6PA 1EVYA 1W4ZA 2EHDA 2GD1O 3DZFA 2Y1OA 3PQFA 3KLMX 4PG4A 2BI8A 3LT0A 5DDIP 3Q3CA 4M1QA 3AUTA 1UZMA 1H6DA 1OOEA 3A4VA 5JC1A 5BR7A 4BO8A 2J3IA 3RUAA 2DU8A 3INGA 3P7MA 3RASA 5CDUA 4IJUA 5HS4A 4OJNA 1UP6A 2GDZA 4WUVA 2W8ZA 4H15A 3OIDA 1LDNA 3JYPA 4I5FA 4BKPA 4IXTA 1F0YA 1MFZA 3JCZA 4YCAA 3OIGA 3U62A 1F14A 5KJCA 4QFDA 3PK0A 5GY7A 3UFXA 2AQIA 1EVIA 1QV6A 2I6TA 4H7PA 3WMXA 4ZQHA 2A92A 4WOJA 5CPFA 4U6SA 5IJZA 3H6KA 1PJCA 2JHFA 2FY8A 1CEQA 1WXDA 4RQUA 1LLQA 2Y0CA 2PZKA 2JFGA 4XYMA 3O8QB 3UHAA 5DP2A 2X9NA 3L4BA 4E32A 4JJFA 1XIVA 1RYDA 3E9MA 4EYEA 3V8BA 4E5YA 3U09A 5JCXA 1V6AA 4R51A 1DHRA 3GMSA 2GASA 5JDIC 4MIEA 1A27A 4FJ0A 3AUSA 1S6YA 4O63O 3ZW9A 3BMNB 4JGBA 1HYHA 5I7VA 1Y5MA 2I99A 3I9LA 1YB4A 4RQTA 1NR7A 5ITWA 1XQ1A 4XKJA 5I8WA 4XYEA 4Y67A 4MIYA 2JHGA 3WOHA 5G0UA 4BNWA 2C20A 3WGGA 3V2UA 3CMMA 1YS4A 3O03A 1VJ0A 2YW9A 3OP4A 4MJLA 3QJ5A 4U0KA 2B36A 4TQGA 3VTFA 4D7AA 5KJFA 2HMVA 4FC7A 3GGPA 4WASA 3AI3A 2X5JO 5BNTA 4KWHA 1EE2A 5JBIA 5JDIA 4CM9D 1NX6A 3WNQA 1U2GA 2XF8A 4BUCA 3LT2A 1E3WA 4EW6A 2JCYA 1ARZA 3B1JA 1XDWA 3E82A 2E4AA 3BMOA 3VZRA 3MCVA 4TRNA 4ZICA 1E6UA 3KLPX 1U9JA 2YHIB 1NAIA 1EBFA 2R6JA 1P31A 2IXAA 3ZV3A 4ZHSA 1T1RA 2FZWA 4ZQFA 3TZQA 3VHRA 4L74A 1PJ2A 4JN6B 2JJYA 4XQCA 3UUWA 4E5PA 2P9GA 2PLAA 5L3ZA 4YJFA 1Y9EA 4UUPA 3PZRA 3SLKA 2X1HA 2GN9A 2Z1MA 4WLFA 3I3OA 3ZWVA 2R00A 3FD8A 4IIVA 5A03A 4OOEA 3UCFA 1H9BA 3G79A 3N7UA 5C7LO 4ND2A 4DYVA 3VVBA 4LSMA 1YJQA 1LDGA 1QYCA 4P38A 1GDHA 2X0JA 3WSWA 1E5LA 1HZJA 2BGMA 1MLDA 4CMEA 5JO0A 4GSLA 1FDUA 4BNZA 1NBOA 1ONNA 3K96A 3OQ6A 3RJ9A 3RJ5A 1T24A 3HFSA 3DBHA 3GT0A 5ITVA 2CD9A 2XXJA 1VM6A 3NJ4A 2TMGA 1A4UA 1KBZA 2UYYA 3K5PA 2W2LD 2I66A 3IS3A 4HX5A 4BNLA 1I30A 4IZIA 3K2BA 4D43A 1NVMB 3PI7A 4NG5A 4HFMA 5G4KA 3OECA 1KC1A 2WYVA 3BHIA 4BQRA 1ISFA 3ASUA 5L51A 1HDYA 1JWAB 3CINA 1YE3A 5FYDA 3WGQA 2HLPA 3OEWA 4A2CA 1N1EA 3JYOA 3PPIA 1C0KA 1EE9A 4M89A 2HO5A 4P4LA 4TVOA 5DBIA 4M86A 1GD1O 1VPDA 2QQ5A 4D0RA 3KXDA 1LA2A 4R9SA 4E2WA 1Y1PA 3GEMA 2VWHA 4M55A 1HDOA 2D4AA 1NAHA 1E6EA 1UH5A 1DC6A 3NDJA 2YHUA 3BMOB 1ZMTA 3UN1A 1E7WA 5AXAA 1JKJA 2VYND 3DBLB 4OXNA 4PLHA 3VVCA 4O0LA 4YWJA 4I1IA 3DAPA 1EUDA 4Z9FA 1MFPA 1V3TA 3JQ6A 2HK7A 1XYGA 5LDGA 1V8BA 2ZB8A 1GYPA 3U3XA 3K30A 2J8ZA 3HDQA 3TF5A 1C0LA 1ZO8A 4OKIA 1GEEA 3FTPA 5GZ6A 2AE2A 5C7OO 1ZXLA 3CIFA 2XOXA 5I7FA 4MDHA 1V3VA 2NTJA 1QMGA 4RPGA 3I4FA 1PJTA 4D41A 1YH3A 2PH3A 4FOSA 2HRBA 9LDTA 1VKNA 4R9RA 4L4RA 4XB2A 1Z6ZA 3EY4A 3RC7A 7MDHA 3TN7A 1M6HA 4QUKA 2VWGA 3WIEA 2PZLA 6LDHA 3WR5A 4BNXA 4QFCA 5IXYA 3C1TA 4W99A 4NBVA 1Q0QA 3PIDA 2GN8A 3F46A 3L6EA 1BWSA 3K6JA 4FJ2A 4Z3KA 4ND1A 3EDMA 1AHIA 2B4RO 4CM9A 2Q1TA 4PLCA 5TF4A 2YZ7A 2ZJ0A 1IL0A 4IDAA 1Y8QB 4R41A 4D79A 1ZSNA 1I24A 2DKNA 3JQAB 4PVDA 1PS8A 3PZBA 3CUKA 1NYTA 1ZUD1 3JQBA 3ROKA 1B3BA 2IYOA 3RI3A 3ETDA 4DLLA 2XXBA 3EW7A 3GH3A 4YAKA 2B83A 2X0NA 5BSHA 1R0SA 1SEPA 2O7SA 2GLXA 4NFSA 2AQ8A 3V2HA 3KSZO 4PFJA 5G0SA 2BRUA 3DMTC 3PGJA 3X2FA 2E49A 1PQWA 1G6KA 3IAHA 3G17A 1NFFA 1D7OA 4FW8A 1VKOA 4Z0PA 4IQ0A 5JDCC 3GVHA 4GPD1 5G2OA 3FNFA 4Z0TA 1BTOA 3I9MA 1T1SA 4J16A 3NGLA 3E48A 3WB9A 5A06A 1H94A 3D3EA 2OO5A 2C2YA 2VWPA 4L76A 2H9IA 4BO9A 4D45A 3RUEA 5HWSA 5JSFA 1DIGA 4TKLA 1A5ZA 2W2LA 4WECA 3LYLA 1U2DA 1K5HA 3FF4A 4J49A 2CSUA 1DBVO 3PHIA 1W8DA 5KKAA 2O48X 1YJ8A 3F1LA 4X54A 3DMTA 1VSUA 2YUTA 1E7RA 5BNIA 1CETA 2BFPA 1VJTA 5JDCA 3ZWNA 3TSCA 4H3VA 4WCDA 3W4JA 4LMRA 4CUJA 1U3TA 1MXHA 4CQMD 4BHTA 1HEUA 4CLHA 3PDUA 4BNVA 3PQDA 4OH1A 1BW9B 4OOFA 3PJEA 4XX0A 1H2BA 2DQ4A 3NDIA 3QVTA 5JAZA 1EQUA 2AEMA 4NFYA 3DFZA 3ENKA 5KTKA 2G76A 2OGUA 2VYNA 5F5NA 3VPFA 4EDFA 1QRRA 4XGNA 3W8DA 4HFNA 3GR6A 1GL3A 3TL2A 3ANLA 3AI2A 1G1AA 4CM4B 3C85A 1ADBA 4J6FA 4RF3A 4UVDA 4QX6A 3ULKA 3IKTA 4E5KA 1R4NA 5C7IO 4CL3A 1Q7CA 2OZPA 4DRYA 3B1FA 1BXKA 4Q39A 5DBGA 1JLLA 3WNVA 3C7CB 3VKVA 4ALKA 3KTDA 1OFGA 3HZZA 3MWEB 3R3JA 5KJEA 3VTZA 4LRSB 1NWHA 4ROSA 2V6GA 2X4GA 3B70A 4BNTA 2G82A 1LI4A 4TRMA 4CMCA 4B8WA 2BFOA 4YVFA 3PFFA 1NTOA 2YV3A 4JLWA 4DBVO 4CR7A 5L4NA 5TC4A 4WNIA 4CMJA 2HMWA 4AJ2A 3JQ8A 5EPOA 1JVBA 4HKTA 4GSKA 4FDAA 1H6BA 1XCBA 1IB6A 4Q3DA 4II2A 3I83A 1ADCA 1XEAA 1BDMA 1DJQA 1PGNA 4AJ4A 1PJ4A 5K0ZA 1ZXBA 4C7KA 1YGYA 4E31A 3QWFA 3IUSA 3O38A 1TI7A 4J1NA 4YDRA 1F12A 1R4MB 1LNQA 2VZ8A 4MPDA 4RL6A 2CMDA 4BNGA 3WQSB 4ND3A 4GI2A 5AXDA 5BSFA 1GFSA 1SB9A 2E6UX 2H63A 3H5NA 4HP8A 2B69A 3LZ6A 3V1YA 1I2ZA 1TVEA 4IJWA 3RVDA 3I6IA 3ONEA 4P4NA 3JD1A 4CLRA 5HM8A 4UULA 5TJ9A 1W73A 2VT2A 1VC2A 1M2WA 5JS6A 4IMRA 3C3XA 5IG2A 4R3NA 4G65A 4MP3A 4BIIA 1RM4A 2V7PA 2GZ3A 2BGLA 5A5EA 4M87A 3GZ4A 3WJAA 4A73A 1DO8A 5CEJA 4J9UE 1HTBA 4BNHA 3DTTA 3PJDA 4AJIA 4UUNA 3RFXA 1G0OA 2GNAA 2O3SA 4R16A 1KETA 3IKVA 3KYDB 3ZDFA 3IOYA 3OF2A 3ONFA 1E1KA 3D4NA 2NU8A 4NZ9A 2PFGA 5EN4A 1ZJZA 3KO8A 1DFIA 3FRJA 4JX8A 3BMQB 4DPMA 2D3TA 3NV9A 3LF1A 5I8ZA 3EVTA 1BXZA 1YB5A 1T4BA 2YFQA 4E33A 3HADA 2CFCA 2ZYAA 1U7TA 2GF2A 1U8XX 4N54A 1P1RA 4E3ZA 2WD7A 2WD8A 4FSHA 4YAIA 1Y6JA 3WGZA 1EVZA 5H82A 2HMTA 4CQMA 3AOGA 4KTVE 1IZ0A 3ZGYA 2Q2WA 4BL5A 1LSSA 3H9EO 1FJHA 4BOYA 4IJVA 3TPCA 1R66A 1QKIA 1EVJA 1E3SA 1CIVA 1Q0LA 3BAZA 3DBRA 1M75A 4UAGA 1DAOA 3HUDA 4HFJA 1AGNA 1WZIA 3IUPA 4PLTA 1E7MA 5EINA 1Q2XA 1MG5A 4NH4A 5A1TA 3AY3A 3I9OA 2QHXA 1OBFO 4CLOA 4EUHA 4RV9A 1Z7BA 4XCVA 2OORA 2AG5A 3H5AA 4RORA 3WGYA 1BHSA 2PD3A 2EGHA 3Q11A 4XZ3A 4MVJH 1B0AA 3AFNA 4XIYA 2PZJA 4XDYA 4HBGA 2WE7A 4RVGA 5AXBA 1OC4A 3JQ9C 4ESOA 3F1KA 4Y6SA 3VH2A 3OJ0A 3ROPA 2XAAA 3PRJA 2HUNA 5JMWA 2EG9A 1C1XA 4FFMA 4TROA 3RQSA 2J5QA 4UEKA 4IDDA 2NVWA 2BD0A 4MIOA 1A72A 2Y0DA 3LDHA 4A27A 1ULSA 3VDRA 3EC7A 3RCBA 2AW5A 1YRLA 4MVJM 3AWDA 4RLHA 4UVEA 1TA4A 1UR5A 1X0VA 3FTNA 2IE0A 4QT0A 4PLFA 1ZSYA 3GUYA 3L9WA 5KNLA 1PTJA 1GV1A 1UZLA 1X7DA 3ZHYA 4EEXA 5IFLA 2PGJA 2GZ1A 3D64A 4ALNA 4JBHA 3F9IA 4K26A 4MVJI 3SJUA 1D1SA 2YDXA 3S2EA 1IOLA 2VHWA 3DZKA 3HSKA 1Y81A 1I5RA 2QZZA 2VRCD 5AXCA 1TEHA 3SEFA 4YJGB 4WEOA 4FFLA 4JK3A 5A9TA 1FF9A 2DBVO 1GUFA 2EJWA 1LRKA 1RYEA 1C3VA 3I6QA 3ABIA 5LDHA 3F5SA 1Z7EA 1K89A 5JE8A 1B26A 2RH4A 1L1FA 3ZHXA 3TL3A 4CM8B 2QYSA 3PHGA 5IDQA 4NR0A 1I36A 4MVJP 5KVVA 4LK3A 2JFFA 5AOVA 3AM3A 3ZWWA 1NXQA 1O95A 2J3KA 3PLNA 4D42A 1ONPA 1MGOA 3EZLA 5COBA 2RBEA 3L07A 1B7GO 3W6ZA 1MC4A 3V5NA 1N8KA 3ICCA 3IL2A 4XR4A 4MKXA 1Y8RB 1DEHA 3KSDO 2QYTA 4GVLA 1NHGA 1EEHA 4MVJD 5F1OA 1P0CA 3ITDA 5K9ZA 1NQ5A 1WWKA 1EK5A 1E7YA 4LVUA 1KVRA 1LEHA 1XWFA 1IYZA 1EUCA 2P5UA 3E5RA 3VZPA 2JKVA 2E37A 1XU7A 2EERA 3ETGA 5KIAA 2WMDA 1U4OA 3DAGA 4TZTA 3EHEA 5I9LA 1JN0A 3JQ7B 3OH8A 1JDJA 4WCFB 3U4CA 1SBYA 1X15A 3PWKA 3H5RA 2GYYA 2PKQP 1XELA 4GVXA 2LDBA 4J7CA 4BNNA 5TGDA 4RLSA 4M8SA 5TJHA 1ZCJA 1VRWA 2NTVA 3GZNB 2C7VA 2D1YA 1WNTA 4HNHA 1B2LA 1R0LA 5I7EA 5K6AC 1YKFA 3CXRA 4CQLB 1CWUA 1FDSA 4PZDA 3GFBA 4G81A 3TDKA 1ADGA 2WYWA 4O5OA 2FPPA 3RFVA 4PG6A 4XQEA 1HRDA 4DL9A 4PLYA 5B12A 5AQ1A 2FR1A 2W2KB 4WLUA 4URFA 4IDEA 3H9UA 2NQ8A 5ICSA 4BNYA 3Q9NA 3EMKA 3JD0A 4UVHA 4YQYA 1AHHA 2B4TO 2G5CA 2GERA 4BO5A 2P4HX 4BKRA 2UDPA 5U1PA 4IDBA 5K6AA 3W1VA 3WGHA 1U1IA 3TOZA 1VL8A 2ZQZA 5JW6A 5TT0A 4AICA 5IDYA 4QXMA 1LLUA 3JYNA 4WLVA 4B79A 4XYLA 2YDYA 3BXXA 1PJQA 2DTDA 2HMSA 1PR9A 1N7HA 5HA5A 1P1FA 1LLDA 3NDRA 1BDBA 4AG3A 2Q1UA 3U5TA 1WDKA 4UEOA 3GNTA 3P2YA 4DREA 2FMUA 1MXFA 1T2AA 1M67A 2OBNA 1SMKA 3SC6A 4YA6A 1KY5A 4JNKA 1NNUA 2HRZA 3V2GA 3DMYA 4PLGA 5JCJD 4RJTA 2VRCA 5KWEA 1KERA 1ZK1A 1YXMA 3ADOA 3C7AA 5IF3A 3HB4X 2F1KA 3MJSA 1Y5RA 4NFHA 3DFUA 4L0QA 2GRAA 5A3JA 3OBBA 2O4CA 2O3JA 3GHHA 5L7YA 1C1DA 3HDJA 5DCUA 5DNAA 4Q3BA 1ORRA 3L6OO 1OC2A 2WTBA 2B5VA 1I0ZA 1LJ8A 3F5QA 1P1KA 5LC1A 3OMLA 4W82A 3JSAA 4LCEA 3T7EA 3EK2A 3FPCA 4PCVA 1HE5A 3VPSA 1I8TA 2QRKA 4IPTA 1ZKMA 5THKA 4ZJUA 4I08A 5GZ1A 3CZRA 5CDYA 4FS3A 3RWBA 5GZ3A 1HETA 1Z74A 5B4TA 2SCUA 4RZIA 4B3JA 3MZ0A 2HCTA 2CDBA 2GCGA 2OP1A 1QV7A 4IMPA 4MVJA 3TZKA 4ALMA 1H5QA 1O9BA 4J4TA 5B4VA 5F1PA 4FFPA 1DIAA 1VI2A 3HFGA 3Q1LA 2YV1A 5U9CA 5H81A 1YO6A 5JPIA 3ZU5A 3W4KA 4BNMA 4CUZA 3GEDA 3PP8A 2C29D 3KBOA 3R6DA 1HZZA 4QO8A 4CMKA 2BHLA 2B35A 2H6EA 2J3HA 1YDEA 2DVMA 3AUUA 3KETA 3FWNA 1SB8A 1HLPA 1ISJA 3U4HA 4DLAA 2VHVA 1QLHA 4DVJA 4BGUA 3IMFA 4CV2A 3H9QA 2V6FA 3VPHA 1U3UA 1QORA 3AOEC 1ENZA 1MV8A 4UREA 4CODB 5JAQA 2I3AA 3DOJA 3OEYA 5CHEA 4A0SA 1T2FA 3OICA 2EIHA 1ZIDA 4Y8VA 4ZVVA 2ZCVA 2Q2QA 2CVZA 5COAA 1H93A 9LDBA 4BMSA 4U8GA 2Y1EA 5DN9A 4GX0A 3WBBA 1ZVMA 4YAGA 3EAGA 2JFHA 1N9GA 4QECA 3COSA 3QRWA 1C1DB 4ZN6A 1IPFA 1UZNA 2ZB7A 1OAAA 1GZ4A 3NEPX 5IDWA 1OMOA 1PJ3A 1HT0A 4KDEA 2ILTA 1AXGA 1KIFA 3PDJA 1UP4A 4FJ1A 3AOEA 3F4BA 4AJLA 1GADO 1ENYA 3JQDA 1VJ1A 2G17A 3FI9A 5KVQA 3MJVA 4O1MA 1RPNA 4MP8A 3VKUA 3G0OA 4GGOA 4S1VA 1DHTA 4UUOA 4BV8A 2AMFA 2NU6A 1QYDA 4E21A 4YRDA 4UVGA 3WG9A 1GTMA 4E13A 1GQYA 1K6IA 2BFAA 2CDAA 1N7GA 2C5AA 5B37A 2VHXA 4EJ0A 3GY0A 3L0DA 3PFWO 3INRA 3RUHA 5C3MA 1KS9A 2CF5A 1XLTA 1PS9A 2EKPA 3NAQA 1B14A 2FSVA 3D3WA 8ADHA 4XA8A 1FXSA 4XQGA 1GUYA 2P5YA 3BZUA 3STHA 1E3WB 1KVUA 4BQPA 2NADA 5EJ2A 1M6WA 3N74A 4IBOA 3MTGA 3OIFA 4NU6A 3PGXA 5JCJA 4CM7A 4L4XA 4OSOA 1X7HA 4OIMA 3SBOA 2AG8A 1EZ4A 2VHZA 4PG7A 4F6LA 1HXHA 5A9SA 3FCOA 3QSGA 3LT1A 4ZGWA 4BO7A 4YJFB 2C54A 4B3IA 1EMDA 3NX4A 3U49A 2B4QA 3AFMA 2DM6A 4BO6A 1JKIA 3G49A 5MDHA 1XKQA 2HK8A 4CR8A 2IDZA 4DQUA 5CDGA 3HN7A 4MOWA 1KOLA 4LRTB 4BNKA 1IPEA 4BVAA 1H9AA 1N9GB 4A03A 4BNUA 2VT3A 2VUUA 3GG2A 2PNFA 4YAJA 2ZATA 1B8UA 1NASA 2A9FA 2FR0A 3BIOA 5TIIA 3CE6A 3DBHB 3GOHA 3T4EA 1YOVA 4CMBA 2VNAA 1WLYA 2RIRA 2YY7A 2NUAA 5KCZA 2Q1WA 4KUGA 3PEFA 1UDCA 5TLSA 3E03A 5KVSA 4K6CA 3QVSA 3U4IA 1HDRA 4OO3A 4C4OA 4BGEA 4ZQBA 5G4KB 2RHRA 3KUXA 4RPHA 5DOVA 1LDEA 1YWGO 5EESA 3NT4A 4ZD6A 2X5OA 3QY9A 4EUFA 3H8VA 2GO1A 4WKGA 3GC6A 4GKVA 4CUKA 4ND5A 4UUMA 5FEUA 3LF2A 4CMAA 3TWOA 4BO0A 3M1AA 4GLLA 4U0JA 4J1TA 3PWZA 4JCOA 3GGOA 3JQCA 3Q9UA 3KVOA 1H2HA 4YJHA 3ZZNA 3ZW8A 1HE2A 1LUAA 4MKZA 5JLAA 1ADFA 2JD2A 1YVEI 1HF3A 1T26A 4W7HA 4BMNA 3A9WA 1NQOA 1P45A 3BTSA 2DTXA 3OJLA 3QWHA 4PG5A 4P4GA 4AJ1A 4I9UA 4PN3A 2DBRA 4R1UA 1R6DA 2Q46A 2DUUA 2NTNA 3TJRA 3W6UA 4EITA 1PZFA 5A02A 5A9SB 2Y1CA 4E0BA 4BNIA 1P33A 3VC7A 1X13A 3TQHA 2TMDA 4XB1A 3VPGA 3D1LA 3CTMA 1DC3A 1DOHA 1U4SA 4PRKA 5BNFA 5IXSA 1SAYA 1NVTA 4Q3EA 3HWRA 3GVPA 4D3FA 2IYPA 2OOSA 2W90A 2PK3A 3WLEA 2I5PO 1ENPA 1YBAA 4KUHA 4F6CA 1ZK0A 2EF1A 5HS6A 3WYEA 5JFOA 3K2EA 3HNPA 5ER9A 1ISHA 3JD4A 1KEPA 3DDNA 4RF4A 1YB1A 1BXGA 2Y1GA 1J6UA 1EK6A 1PZEA 3QHAA 2QRJA 4M49A 3U0BA 2JD1A 2O2SA 1EDZA 1EFKA 1Y7TA 4XRRA 1MC5A 4DGSA 3RUCA 4HXYA 5CEEA 4TVBA 4E5NA 5JAMA 2D0IA 3DONA 4W4TA 3AW9A 3OSUA 3UKOA 3KEQA 5T67A 4PLVA 4BGVA 2HDHA 4NBRA 3VH3A 4G2NA 1WVGA 4P22A 3TZCA 1NPDA 4ND4A 4TRRA 4ALJA 3CZMA 4NBUA 3WIDA 3VH4A 4E2XA 3ZV6A 2VCYA 5JMPA 3WWZA 4EZBA 3AM4A 2ZQYA 4J91A 1O6ZA 3LC2O 5AYVA 1DFHA 1XG5A 2POQX 3ZI0A 4GQAA 5B1YA 3E1KA 3DZGA 5U4QA 4YB8A 1I10A 3RIHA 4W9NC 3JQGA 3VDQA 2IZZA 3HQ4O 4J7UA 4QQRA 1DIHA 1GV0A 3QW2A 1R37A 1NPYA 3ON5A 4NDNE 3ZWYA 1GCOA 2B0JA 4DWVA 2Z1NA 3OFSA 1WZEA 4BKOA 1A71A 4JJGA 4N5MA 1UXJA 1E1NA 1B8VA 1TT5A 1GAEO 4L4SA 3NRCA 2NVUA 4OM8A 5IZ4A 4RVUA 3SVTA 3BTUA 1RM5A 3B20A 5T8KC 4TMFA 3WXBA 4GKBA 5JY6A 1J0XO 1HKUA 3DXFA 3TNLA 1E92A 2Y1FA 4E2YA 5KKCA 4YPOA 2C5EA 2VHYA 1BXGB 2D2IA 5J23A 2A4KA 5TRTA 2H5LA 1LX6A 2FPIA 3ZNPA 2I65A 4EJ6A 1HDXA 1I3NA 5L4LA 3WGTA 4ZU3A 5G0TA 3H7AA 1R0KA 5AVOA 3W4IA 4PLZA 3RU7A 3PXXA 2FHSA 2OP0A 3GFGA 2CUKA 4CMIA 2ZTMA 4KZPA 1DFGA 4Z3DA 1S7CA 2NM0A 1XHLA 2PH5A 3INTA 5DP1A 4II3A 2ZTVA 4WEQA 2DC1A 1B16A 1E3LA 3C1AA 3NUGA 1T25A 2J3JA 2C7GA 2C2XA 1PX0A 1R4NB 2YJZA 1PJBA 5JO9A 1XGKA 2GGSA 2ZTUA 4CM5A 4EI2A 3F6YA 2EP7A 3FR7A 3ZNOA 4CV3A 1ML3A 4I5EA 5ILGA 4A7PA 4FFRA 4XIJA 4PRLA 3WLFA 3U9LA 2WE8A 3JQGB 4FCCA 1RWBA 5L95A 3ZWPA 2VYVD 4O59O 4OHUA 4DC1A 1AN9A 4I9HA 1NFRA 4B4WA 4HADA 3Q0EA 3JQ8B 4J4HA 3H2ZA 4PIVA 3DAFA 3DTYA 1UJMA 4DLBA 5FI3A 3L77A 4RF2A 1ZZEA 3NJ8A 5JYDA 1ZEMA 2QIOA 2NVUB 1ISGA 1U28A 1HDCA 2PTGA 3Q2KA 3SJ7A 3KSUA 2BI7A 4NBWA 4IINA 2DLDA 4YT8A 2CF6A 2G1UA 2QRLA 4MVJF 1LSOA 3TFQA 3KYCA 2QZ9A 4KDFA 1IY8A 3CPSA 4E30A 4PZCA 1FMCA 2RHCA 4IS3A 3KRTA 4RGBA 3WMWA 4PG8A 3FBGA 3G1UA 4OYRA 5DF1A 2PWZA 4E4YA 4BB5A 1W6UA 1JU9A 2EV9A 4DXHA 3GN1A 4DPKA 5EL0A 1L7DA 1A4IA 4E12A 4CLRB 2Y0EA 1KVSA 5TQVA 3UF0A 4RVFA 1YQXA 2GR9A 3DZBA 1DXYA 1D4FA 2D5CA 5CEFA 2VWQA 2X9GA 5G0WA 3SLGA 4NIMA 1XSEA 1YBVA 4AL4A 3ROQA 3RBXA 4IIUA 4E2ZA 5CDSA 1ZH8A 1CDOA 2JCXA 3QQPA 3NTRA 1LU9A 1DC5A 1RM0A 2IODA 4GBJA 3DOOA 4DYDA 2NWQA 5T57A 4A26A 1JW9B 3BTOA 3MWDB 3VH1A 3D4PA 3I9NA 2NSDA 3M1LA 2X58A 4XYBA 3PIIA 1IULA 1YONA 3EVNA 1HL3A 4NJOA 4NJMA 3TRIA 3OQ1A 1VLLA 2RAFA 4G5HA 3NKLA 1JTVA 1PQUA 3AI1A 3BHMA 3EZYA 2PD6A 1UXHA 3JQ9A 3GGGA 3G1TA 1L7EA 3GPIA 1AXEA 1LRLA 1F17A 1IHYA 1IHXA 3H9GA 2DBQA 4WCFC 3FNHA 4NU5A 3E9QA 4YEDA 3OHSX 1A7AA 2BLLA 3F47A 4HY3A 2WD7B 4QO7A 1CERA 3PJGA 4LGVA 4CQMB 4MKRA 3ANMA 3AY7A 2UAGA 1P44A 1Y9AA 3WQQA 3ZWXA 3I4CA 2BF7A 2PGDA 3DBRB 4N5NA 1P1HA 2P68A 1HDZA 4L8VA 5CAEA 3ORFA 5CG2A 3TFOA 1KVQA 1E1LA 2VUTA 3JV7A 4YACA 4DIOA 3LU1A 3AU8A 1EQ2A 2YV2A 3UH1A 4CLOB 3VZQA 5H83A 1ZK3A 5I9MA 2C0CA 3E6AA 1GPJA 5T5QA 5ES3A 4PGFA 2CDCA 2OHXA 4W7IA 2I67A 4IQGA 3ZHBA 3G3EA 1V9LA 1G0NA 1PGQA 5F1KA 1GR0A 3L4SO 4XD2A 2AEJA 3DHEA 3OM9A 4RPKA 1RJWA 3CEAA 3OJEA 2ZYDA 1GQ2A 2EKQA 3PHJA 4NK4A 2EP5A 2X23A 1CJCA 4BS9A 5L7TA 4ALIA 1UAGA 3ZV5A 5KOIA 3K92A 3GDGA 1C1XB 2VYVA 3WQRA 2YQ4A 2OBYA 3LVFO 5DULA 1MUUA 4OL9A 2ZTLA 3C8MA 4NJMB 5CP8A 2EGGA 2JL1A 4FQ8A 1P9LA 2ZCUA 4B4UA 1J4AA 4IJKA 3KHUA 4R54A 3GDOA 5LCXA 3NYWA 3PWSA 5A5FA 5HRUA 2X8LA 1KEVA 1PGPA 2X86A 3QVOA 1QYXA 3PQEA 1HE4A 2HAEA 4AJKA 3S1LA 1JVSA 2R2GA 1ZEJA 3NT2A 4NQZA 3NTOA 5DBFA 3RUIA 4B7UA 1YDWA 3AU9A 4LVCA 1YL7A 5THQA 1SNYA 1D8AA 4FFNA 1U8FO 3V1UA 4E5MA 4KQWA 1UAYA 4MVJE 2Q4EA 2Q4BA 3D5TA 4GX5A 1EBUA 3LC1O 4J3FA 5JNLA 3GVCA 1Z82A 3RKRA 2HK9A 4NBTA 2Y66A 4MVJG 4AJPA 2WSBA 1E7SA 5JC8A 2PR2A 4J1QA 1P3DA 3CKYA 4ZRMA 4TZKA 3A28A 5G0VA 4CV0A 1PQPA 2X22A 1LRJA 1ZMOA 1LQUA 5BSGA 5ICMA 4YBZA 2GZ2A 3DQPA 1DJNA 4GMGA 3KM0A 5CDTA 1X1EA 3VPXA 4GLOA 2ZYGA 1LXCA 1NVGA 2DPHA 3Q2IA 4JBIA 2O4UX 2JD0A 1DLIA 4J43A 1PZGA 1ZW1A 5L53A 1ZSVA 1M66A 5IZCC 3H3FA 4YR9A 2I9PA 4YJDA 5ILOA 3B6ZA 3PHHA 3QWBA 3PLRA 3W8EA 4ALLA 5B4UA 3QE3A 1SPXA 1P1JA 4MINA 1PL8A 4WJZA 3GUCA 3RBVA 4B7XA 2ZK7A 4ITUA 5FFFA 3B1KA 4CLEA 1E3JA 3H4VA 4N5LA 4NK5A 3BMNA 2Y1DA 4OAQA 3OETA 4L9RA 2QX7A 1PGJA 1ONOA 4IDGA 4IDCA 5G4LA 4LCJA 4M54A 3WDSA 1GEGA 1QLJA 2Z5LA 2VN8A 4AJHA 4KOAA 4R1SA 4K28A 3H9JA 1WP4A 4OKNA 2IEBA 4PVCA 5IZCA 4GX2A 4L75A 5IN5A 3ZNNA 5A05A 4DTIA 3RC1A 3LSYA 1SC6A 1ZK4A 4J7XA 1MP0A 2AQKA 4XQ9A 4XJSA 4BB6A 1H0KA 3HDHA 3ITKA 4YRBA 1P77A 3GDFA 2FSSA 3JQAD 3L4BC 2FWMX 5T64A 4UEJA 5EQFA 4IQ8A 2NVBA 1U5AA 4IXWA 2YHIA 1DLJA 4ZQEA 2PD4A 3NGXA 4R5MA 2W4QA 5A9RA 3I52A 4BGIA 1DRWA 3A06A 4WLEA 4JBGA 4W6ZA 3BMCA 3K73O 3MJTA 3JTMA 2O50A 2V6BA 3WSVA 2VTEA 4ZA2A 1QSGA 4YT5A 7ADHA 2CY0A 5FI5A 1C0IA 1GCUA 3M6IA 2JAPA 2PGLA 4FBGA 4Q9NA 4EJMA 3EGOA 3M2PA 3E8XA 4DIFA 1I33A 2Q45A 4YTEA 5CFZA 2WJPA 3JQEA 3FNEA 2O23A 3DB2A 4DMLA 2HMUA 2EWMA 3IQDB 4HUJA 5ER6A 3WTCA 4A5OA 2OL4A 1ZBQA 1F8GA 2AQHA 2IZ0A 3O9ZA 4GX1A 4N18A 4AVYA 4C7JA 3ICPA 5JYEA 1MG0A 1UDAA 3LQFA 1YBMA 2J5RA 1GYQA 1ENOA 1PS0A 1BG6A 4CM1A 3WTBA 4DBZA 4IY1A 1H6CA 2DUWA 2ZJ1A 2B37A 3KEOA 4FGWA 3ZV4A 4R69A 1WMBA 3L9XA 5BSEA 3KV3O 1XR3A 2OMEA 1CYDA 4DQXA 1TB4A 2R00C 2Q50A 2X0RA 4Z0HO 4DPLA 3ADPA 2DAPA 3A14A 2BGKA 4IGFA 1SOVA 3PYMA 3UXYA 4I5GA 1PWXA 1X7GA 2YQ5A 1RM3A 4BKUA 4CPDA 4CMEC 3DBLA 4K6FA 1O89A 4AJEA 1V35A 1DSSG 2EJVA 1EDOA 4LW8A 1EUZA 2O2YA 3F4LA 3BMCB 2E82A 2UUOA 4QEDA 3WFJA 5A3VA 5A04A 5HTOA 3MJCA 2NACA 3DO5A 2OFPA 2YYYA 4FD3A 3S2IA 1NP3A 1GU7A 2HU2A 3DEYX 2DTEA 2D8AA 3GK3A 3EYWA 1NQTA 1UXKA 2Q49A 1Z45A 5TT1A 4R1TA 1WMAA 1GPDG 1Q1NA 4BV9A 4R68A 3RKUA 4FGSA 4F45A 1NQAO 1CRWG 1I32A 2PKRA 4UVIA 2VTDA 2J6IA 1ULUA 1I01A 1JAXA 1HE3A 3ONDA 4R4JA 4ZRNA 1K2WA 4PLWA 1P74A 4Q3AA 4OXYA 3S8MA 1HLDA 5L7WA 3TZ6A 1DRVA 1PJSA 4J1SA 3ZWCA 4D0SA 1HDGO 4Y9DA 1Y8QA 1E3EA 1U3VA 3JQAA 4B4VA 3ROMA 1TXGA 4R01A 1VL0A 4XYGA 5IDXA 2WWRA 1NPTO 4CLXA 4AFNA 3JD3A 4D3DA 1E7QA 4DIBA 1CF2O 2C59A 4J4BA 1NM5A 2CVQA 2NNLD 5A4DA 5L40A 4I5DA 3ZU2A 2IEDA 1X14A 3LLVA 4L73A 1U3WA 2NV6A 1FK8A 1AUPA 5DZSA 4U6QA 1C0PA 3HB5X 4WE3A 4QSMA 3M2TA 4KP7A 4D3SA 2E48A 4INAA 1BSVA 1DAPA 4JP3A 2EW2A 1E6WA 2EEZA 1I3KA 2EXXA 4F3YA 3ZU3A 3NTQA 2RH8A 4DA9A
chains in the Genus database with same CATH superfamily
3QFTA 5BW6B 8LDHA 1IN5A 3K0KA 2O3TA 4IWYA 3HVJA 5ADHA 2BUBA 5F7OA 3E61A 4FPXA 3KD2A 4W1PA 1KPHA 5B53A 2P41A 3BQ9A 2P8JA 3O6VA 5I9NA 3PDHA 4CJXA 1Y5NA 2CNLA 3T99A 1PNRA 1SD1A 3JAWB 2X5KO 4BEBA 3T7SA 1NHWA 3QHPA 3HRKA 2RBKA 2P9CA 4YUYA 4ZK6A 3SICE 2DHDA 3K0FA 2QM7A 3M4ZA 4ETWA 5HVNA 5EERA 3SR0A 3D3WB 4U7PB 1UPTA 1WS6A 5FCDA 4A15A 1BMDA 1JJFA 4JBWA 4CMGA 4EGAA 5B7NA 5IABA 2JGIA 2REOA 4DTCA 1FEZA 2ZW9A 4MGEA 3DZIA 2RHJA 5CDFE 4R7TA 3T5PA 4IM7A 1II9A 3UW1A 1PI3A 4HQNA 2OO7A 3H11A 3HCEA 3W2EA 1E2MA 3CXUA 4WKOA 4C5BA 1U1CA 2V03A 5REQB 4B74A 2C31A 3S44A 2CLFB 2VH5R 2GXSA 3FPEA 3D0OA 3JYLA 2QR5A 3QWAA 1MO3A 2GZSA 4RMJA 3GNSA 3CEHA 1KO4A 4X7BA 2LD4A 4OQPA 2ZT8A 3GRUA 3RSFA 3UK7A 5ADUS 1DMRA 3TVTA 2R6FA 3BJIC 2FPGA 3IAAA 1JEJA 5JY1A 1W5EA 4J0FA 4P3XA 3AXSA 3R8XA 2C2KA 1RPAA 5JWRA 3RFTA 2V65A 2ZIFA 3OMWA 1NZJA 4RVHA 3V4FA 4UM9B 4D46A 2AF3C 2Y67A 4OQYA 1T8SA 3TW0A 1UAAA 4LOJA 1S1MA 1E0SA 4H2DA 4HWKA 2YOHA 1CQJA 2NO5A 3CRMA 3UICA 4UBKA 3ENNA 1WHTB 3K32A 3KXKA 1DRUA 1N34B 1UEIA 1C9DB 4U5QA 3WHIA 3ZLBA 1R8JA 1SCDA 4N7JA 1H69A 2NUAB 1YNOA 4E6PA 5AW7A 1C7EA 1YDFA 1MA0A 1E79D 2XYRA 3EGDA 1VHWA 1J0BA 3SHQA 3PGVA 4A10A 3AF3A 3RAJA 2BP7B 3H2IA 1VCNA 3A1NA 1ZOOA 4XD7A 1L5KA 5B7QA 3WJ1A 3HS3A 1GPBA 2FW9A 1CQWA 1YCDA 4L1KA 3VR6D 3NT5A 1I2MA 1XNGA 2NU9A 3SFZA 5CFLA 1CF9A 1ISIA 2VDNB 5FOVA 4EHAA 1ZXXA 1P1BA 2CJFA 3ZNQA 1ICIA 3D2BA 1BMTA 5L9AA 1Z3CA 3VUEA 1MKYA 3AIKA 4P5PA 5EMKA 3BKWA 4OIFA 1SZJG 4BX3A 4BJ5A 3Q3VA 2D1SA 1PZHA 4J7AA 5KTYA 4P86A 4QYIB 1IVSA 3EFEA 4WK2B 5AKGA 2OHHA 1KMNA 1R4MA 2O7QA 4Z6KA 1E5QA 4ZV4A 4ZYXA 3HVKA 1NVVR 4BXOB 1NVBA 2N1BA 1F06A 2FAXA 2GPTA 4I2NA 2FOIA 3RWMB 1BD4A 4FNAA 4CM6A 1XTZA 2A35A 1NURA 4OQNA 4BFCA 1KJNA 2XMRA 3S2GA 1YRYE 4U7HA 3EJ6A 4LF4B 4BRUA 1NVAA 1B6RA 4DR4B 3I4LA 4OFXA 4M8IA 2WF9A 2FOLA 4B2YA 1I2CA 3K5IA 1DIOB 3PBKA 3BBPA 4WRRA 4KREA 4RVDA 5IJ9B 3FLAA 3OTIA 4KQFA 3IELA 3NBXX 4HDKB 1TM1E 3LAWA 5LJIA 4I55B 4LC0A 3CH6A 4KPUB 1SO8A 2AFRA 2ZRBA 3NG1A 4MUEA 3UAGA 1T9BA 5DX0A 4D92A 5CFRA 4EJ2A 3R1IA 5E3HA 3F3SA 4KTTE 1MJGM 1RJ9B 1WPRA 2FTKE 3ETEA 1OZFA 2J3QA 3MM4A 3KQQA 3Q7SA 4C7OB 2C96A 3BTVA 4AN4A 1J7KA 2AI3A 3V6MA 2ZE8A 4O8ZA 1LC3A 2C04A 2O57A 3E27A 2PBLA 3KYDA 2HQSA 3Q6IA 3HXTA 1HSZA 4HH3C 2PMFA 4BE9A 4XEHA 4RO0A 3JATB 2AI2A 3BA1A 4G26A 3SQLA 1NJ1A 1UIMA 4LXHA 4COOA 2QJTA 1UBKS 3QQ5A 3H65A 4FOOA 2LE0A 2VTBA 4RD6A 3VKWA 2FN8A 4EB6B 1YSCA 1SG0A 2RHHA 3RS2A 4FK8A 5DGXA 1WF3A 5L45A 4DDMA 4B5LA 1CJVC 2ANBA 5C53B 4DV2B 2ZSKA 3DNFA 5FPQA 4OGWA 5EXSA 1RXUA 1J2RA 3NHAA 2ZE6A 4N7RA 1X77A 2RGUA 1FBNA 3VR1A 3UG6A 2JHAA 3IOBA 4RCVA 1LV8A 1UP7A 1YUNA 1HT1E 3A2MA 3PQ6A 4MUMA 2JIZD 1R6BX 3P5SA 3FYCA 4RZHA 4TT8A 4UBLA 5PGMA 4BB0A 2WWTA 1T4DA 3C3YA 3LKVA 3FLBA 4MEAA 3UOGA 4Z7JA 1LVUA 2OMKA 1ONBA 4M1ZA 3AGPA 4RU1A 1SD2A 1MVNA 1SEVA 2H4HA 2IRWA 4DKJA 4OLAA 3TQRA 1D0IA 2C4VA 4P8RA 3O1IC 3DBVO 3LLSA 4PXSA 4ESHA 1FJXA 1J90A 4F84A 2Q2VA 3AFOA 2R1UA 4CEIA 2ZVDA 1NW6A 1J2EA 4R8KA 2SBTA 2QD3A 2UUAB 3PC2A 3PVSA 1XA4A 5KDLA 4CRWB 2Q9AA 2XLCA 2G7ZA 4RXUA 5EMNA 2NQTA 3UAZA 1J70A 4NPCA 1KGSA 2J9YB 3O0TA 3WQBA 4HDRA 1Q1AA 1N92A 3HKDB 3Q7TA 4G9GA 1Z4IA 4UZFA 4YP7A 3T3IA 3QX3A 1ULBA 2CVOA 3QA9A 4KE9A 4GL4A 2EEPA 2EFEB 4GMFA 3MOIA 3VR4D 1K0UA 2AMYA 3KT8A 3RS4A 4C5AA 1BKSB 5BURA 1D6MA 1KEZA 2BGUA 3F5MA 3G02A 1E5XA 1ONSA 1YJCA 3VJRA 3BK7A 4RPJA 3IRVA 4C88A 3A3YA 2D6FA 3FSGA 4JLNA 4P2BA 1T2DA 1FYEA 4PYIA 4II7A 3AL0C 3R7BA 1FTSA 5KPDA 3HYLA 2AFIA 3X44A 3P2MA 1BA3A 3FVWA 5DM70 4NNJA 2QUKA 5GOZA 3SSMA 3UMJA 2NYVA 3HYRA 3D2AA 2VKQA 1Q7RA 3HN2A 4YI5A 3SDSA 4JI4B 3I1JA 1P2BA 1NW9B 4S1WA 1RE0A 2Y93A 1NN1A 5KJ1A 1VE1A 4JEMA 3HU2A 1TFUA 3ZDRA 2XKBA 3FNGA 2IOFK 4C6SA 2EFGA 3E5MA 4FTWA 1Q0PA 3H6GA 1DMSA 1KYVA 1UBOS 1UWKA 3L46A 3V7WA 4YXFA 1V0JA 1GGMA 1HYEA 2ZJ8A 3N6VA 4GNKA 4I46A 5SYAA 3ZBPA 8MHTA 2QVZX 4BLTA 1TD1A 1CUHA 4IICA 2W8BB 3AUYA 2X6TA 1ZA1A 4TWRA 2ZJFA 3X1XA 2OXIA 5AW0A 5DX1A 3C6XA 2PA3A 2X7XA 3AK4A 4ENSA 3NOXA 5EQDA 2A1TR 1XQYA 4J3JA 1KC3A 1G9XA 4CFZA 5T3YA 1P7YA 5CCBA 3JR3A 3NVMB 2AE1A 4PNPA 5GONF 3MLAA 3IDSA 4WBSA 4TS4A 3GCXA 3ESXA 1LJLA 4DMGA 1CC1S 2BM1A 2Z9DA 1ZGHA 1ZMBA 1EAYA 3B3QA 3FFAA 4M98A 5EHNA 2OQIA 3TLMA 3VM6A 3WX0A 2GFIA 1GDTA 2BFDA 2C9BA 2B5WA 4TV9F 3MOGA 3QVXA 3FM9A 5DH9A 5F9MA 5F2KA 2WWWA 5M7EA 4DV7B 3I9JA 1J5PA 4RSMA 1QH9A 2IYXA 1Z73A 1X80B 4TXJA 3JD2A 3ECSA 1XI2A 4BMVA 1M8PA 4LNHA 1IY9A 2ID7A 1YE8A 3CZCA 3ZWOA 1YR7A 4DNFA 4WIAA 1XPRA 2FK7A 2HU8A 2GKOA 5ALNA 1YMQA 1WW8A 1ZQ1A 3DZHA 3NNNA 3QG5A 3CZPA 3FTEA 4PSVA 1KDYA 3ZYZA 4Y2GA 1RWXA 4IHKA 1C3OB 2FN7A 3EZNA 5JXGA 3B8HA 1PWZA 3BA6A 3LCCA 4F11A 4TRJA 5LZ5A 1ORWA 1CSEE 1UEXC 5H59A 2WJHA 3V8QA 4U7FA 1W5SA 2ZRLA 4QU5A 1S01A 2FSIA 2PEZA 3KYCB 1NX9A 4Q16A 1EVEA 3CVXA 2X9QA 4F8YA 3HA3A 3FH0A 1QG4A 3TD9A 5IXJA 5FOWA 2Y71A 3HYTA 3LKDA 1YL6A 3HBAA 3E18A 3U13A 5IK2D 4QG7A 2EIXA 3D5QA 1DXQA 2NUPB 1UQRA 1INLA 1GILA 2IYYA 1GZ6A 3ZDYB 3H2SA 1GCAA 1LQ2A 2BFEB 2QB5A 3ZHZA 2AZXA 1VJDA 2BSAA 1AUVA 5ESWA 1RSZA 2VRBA 1Y89A 1B8PA 2I4LA 3ZCTA 4YRLA 2Q1SA 1XN1A 3GJ4A 4J2HA 2OCLA 4KXXA 2IZ6A 3IP1A 4IP0A 3RVRA 3LOQA 3QVKA 4EB0A 2ZI5A 4PYJA 3CT4A 3HVIA 3RYCA 2HCFA 3JAKA 1ZC3A 1LLCA 1SK8A 3D8BA 1NR1A 1NJ6A 3IJPA 1GY8A 4K8RB 1W35A 4YRTA 3WJ7A 3VVLA 3MAGA 2VZ0A 2J9FB 1RLIA 5ENDA 3C3EA 2NNWB 2P9JA 2CCKA 3H2JA 1XA3A 2F67A 3MOSA 1MA3A 4YRMA 3WIOA 4XE5A 4C0LA 3GMDA 1VIDA 3HJAA 3UCEA 1M2OB 3J81A 4E51A 1UXGA 3VPAA 2I6FA 2QN9A 3GNQA 5K8TA 3IHTA 3JQPA 4J0EA 4HSEA 4LWPA 2DT8A 3E22A 4NDAA 3QKWA 4QTUB 4CQNA 3HDTA 1T3TA 3PHLA 3PUJA 3PVCA 4Z4IA 5AM0A 3W7BA 3MWFA 3D59A 4KWIA 4D9HA 3AF4A 4EG8A 4YRAA 1WB4A 4KXYA 4H27A 5AMXA 4JBLA 4KPYA 1ETUA 3L8EA 2K4MA 2GAOA 3O4RA 1SK9A 3SQWA 3QU7A 4JT4A 3UAYA 1NNLA 3WYBA 1NW7A 2WJVA 4XDGA 1J06A 1H2XA 2WBLC 3NKFA 2WDZA 3RREA 2RGWA 3IIKA 2O3QA 2Q9BA 4OXKA 5AKEA 4AWBA 2P2SA 2AC4A 2V5AA 2ZBEA 3KTOA 4FUTA 4O4IF 1XROA 1R6TA 4OA5A 3C87A 4RF5A 1VPTA 1USVA 2LTAA 2V8BA 1Q0SA 3R3UA 1NU8A 2FR8A 1L8OA 2P4UA 1L4EA 1PU2A 4IX1A 4IIDA 1JH8A 3DMGA 3M4JA 4S3MA 3ZWAA 1SHLA 2I33A 2QG4A 1CHDA 2P4QA 3IAFA 3LXMA 1JIVA 3K9QO 5IT9A 3G9ZA 3JQFA 4MWSA 4ZZ2A 1Z7YA 3AHDA 1V1JA 2QN7A 3DE3X 6PFKA 3O8QA 4ZVMA 3E9ZA 1COZA 2VT7A 1LQTA 1M0SA 3A3PA 4NHEA 1GKKA 3L8YA 1QF7A 5LP6A 4DSAA 3OO0A 3QTBA 4HF7A 4LOKA 4LWZA 4NG4A 5FWYA 4RCYA 2I1QA 3CT6A 5E3IA 3BRWD 1ISRA 3OJOA 1VE9A 4TLCA 3TQFA 4CKYA 5C37A 3AEKA 1PIWA 4JQCA 2PZMA 2JIDA 2RH5A 3GP8A 1E6CA 3PFHA 1A8SA 3ZUPA 3VA7A 2R68A 2JH3A 4EHKA 2YHBA 3BXEA 1A98A 2UVDA 3LM8A 2J0QA 4K1LA 1P5ZB 3U31A 4DLTA 1YR3A 1EIWA 3T9AA 3OPYB 2G9RA 1U8ZA 3DZFA 1JQKA 3MT0A 2DHRA 3UB4A 3W05A 3RK4A 2AC2A 3SQNA 1JG7A 3WV4A 4U00A 5DDIP 5C4IA 3EA4A 2D7DA 1AQLA 2PH7A 1UZMA 1H6DA 3ANXA 3CNBA 4A0RA 2KPOA 2WMNB 4R9VA 5A7GA 5JC1A 3TD2A 3UGQA 3PEVA 2OVFA 3RHTA 5BR7A 2AVDA 1EX6A 3Q5DA 4X94A 3ZR4B 4HNUA 3H5IA 2I2AA 2ZR8A 2FP4B 1C80A 1QH1B 4S2UA 2UXBB 1WSDA 2GDZA 3A05A 4WUVA 3IALA 4IFTA 1LDNA 1QVWA 2FOXA 4CG2A 4AP5A 3RSSA 3LQRA 3X43A 4C01A 5JNRA 4YAFA 4EFDA 3PC8C 2O7NA 2AXPA 2ZJOA 1MFZA 2AVNA 1G3UA 4B3XA 4FGKA 2J67A 1CZKA 1FXUA 1MAUA 2OKCA 3WWEA 3ICQB 4RULA 3CW8X 1YA8A 2B30A 5GY7A 3UFXA 4F1KA 4JC8A 2AQIA 1I6LA 4LY6A 1QV6A 1ZWLA 2I4MA 5HOQA 3HB9A 4IIJB 2A92A 1FNMA 1G6HA 4HDSA 3A3KA 3HCPA 4DANA 2QW1A 3B8EA 1CEQA 4WWHA 5KNBD 4B3MB 3BK1A 1S8NA 2A5YB 4EYSA 3CLHA 4IH9A 1JNYA 5DP2A 5M3BA 10MHA 2ONJA 1JTEA 4FLEA 4Q9LA 3UYKA 3L6BA 5KYXA 3H8WA 5CIQA 2IWHA 5C1DA 4FYYA 4GMXA 3HJTA 1N3LA 4OLJA 1Y3FE 3TX6A 2D2EA 3E9MA 3KL2A 4PW0A 4E5YA 1AKYA 1SM4A 2A0UA 5HJ2A 4I4NA 2QRGA 1ZY2A 2ZWIA 2C2GA 3GMSA 2BBWA 5SYNA 5A0TA 3U37A 3WWCA 2WVGA 3PGLA 4LIPD 3EMBA 4PTLA 1U2GC 2H59A 3AUSA 4GR5A 2FPOA 4WH0A 4O63O 3ZW9A 1ZUIA 1N36B 1M54A 2I99A 2GVZC 2QTWB 3QXXA 4RQTA 4CDNA 2D3WA 3HWWA 4RENA 3A3OA 2DF8A 5H5JA 3VKFA 1XQ1A 4XYEA 3FFTA 3K9LA 4LJ9A 2JHGA 4RD1A 4BNWA 2POCA 1DKLA 4BFWA 1ZL2A 3CMMA 3QBDA 4KGXA 3GO4A 4AUKA 1VXRA 3O03A 1VJ0A 3W77A 4JL5A 1XP8A 3FZGA 3G13A 4MJLA 4PFSA 5F2EA 5LBIA 1OA1A 4Y7DA 3EZFA 3TE7A 2WFAA 2XHEA 2IHKA 3GGPA 1T9GR 2GPJA 1KF0A 2R62A 1VGQA 2X5JO 2XYGA 3P4XA 4YECA 1JR3E 2AZMA 2B1JA 2ZSJA 4KWHA 5BNTA 4JLVA 2ZDQA 1D5WA 4F72A 4ENUA 3AIOA 1US8B 1BOOA 1NN3A 1UDRA 4ZO7A 4CM9D 4HAWA 5IAEA 2XF8A 4BUCA 1RR6A 3D8HA 1PQ4A 3Q8XB 5BOVA 1DAEA 3IPLA 2ECKA 1U2SA 1E3WA 2QMHA 3B1JA 4Q4JB 4U2CA 1KQOA 1FFCA 4B80A 4DMKA 3E82A 5I9IA 2E4AA 3VZRA 3MCVA 4QOFA 4HR7A 3WLAA 1BO6A 2IA5A 2AWNA 1EBFA 1JV2B 3NIDB 4LTMA 4LBWA 5ISMA 3AW8A 3F67A 4V3CA 3RIYA 5C7YA 2ECOA 3ZV3A 5IYZB 1P0MA 4DA7A 4CTJA 3VMFA 1GAWA 3O2NA 4XQCA 2JJYA 1IEVA 2IKQA 2V7BA 3COVA 4P0TA 2H1WA 4JI0B 4D56A 2R66A 3IKMB 5TE9A 1SHZA 4ZQIA 5EVJA 3SLKA 1VE7A 3C2QA 4FWIB 2YWFA 4NU8X 2Q5FA 4TN5A 1JG4A 1TU0A 2XUJA 2X1MA 3F49S 3G0BA 4N65A 4OOEA 1XD2A 5A03A 2J07A 4C6HA 4HQRA 5BW8A 4JLAA 1EYZA 1QYCA 2Q5CA 1GDHA 3DFMA 3ETNA 3NCTA 4GR4A 1HZJA 4GHWA 1KL7A 5EIFA 2AH5A 1KA9H 2W6JA 4GSLA 3NANA 3V1MA 1K8QA 3WNDA 1TZKA 1G41A 2W2VA 1AUOA 3A1DA 1AGXA 3RJ9A 3RJ5A 3HFSA 1QVRA 2GT1A 3HGTA 3NHKA 3P0HA 5J2UB 3TJZA 5FIUA 3NJ4A 2EATA 3D3JA 1W2HA 1A4UA 3KL4A 2W2LD 3SNKA 4HX5A 3KUUA 1C8KA 4DRZA 1I30A 3ZBUA 3GX1A 1X7YA 4KI7A 2A57A 3RFUA 3K2BA 3DKVA 4D43A 1E1QD 2VDRB 4B3BA 3PI7A 1WW2A 1BJRE 3Q40A 5K0NA 1LI5A 3BHIA 1ISFA 3CO0S 3KB2A 5LWHA 3VI3B 2CFTA 4V0KA 4EG6A 3P0IA 2VDWB 2YJGA 1BWRA 5FYDA 3WGQA 4AMVA 1P2SA 4MLPA 3OEWA 4IQ4A 5EP4A 1N1EA 3LQ1A 4ZI5A 1C0KA 4HV4A 4P4LA 4TVOA 4LF9B 1FJGB 1NI4A 3I39X 1NKVA 2XIQA 3EXIB 3EBOA 3DO6A 4RK1A 1I1HA 2PCJA 2RC5A 5FOUA 5FUXA 1AHPA 2XLBA 4GMHA 1Y1PA 4G2TA 1QS0A 4R9SA 4LBVA 1SXPA 2VWHA 3PEUA 5KSOA 3GYGA 1HDOA 5TMDA 5MN5A 5LMCA 1E6EA 2N0SA 1NT4A 2Y1LA 1A9PA 1NUTA 1P60A 3NDJA 2YHUA 1QQTA 3BMOB 3TOVA 4Q19A 1SPBS 3QTLA 4Q1DA 5JPCA 1K97A 1WXFA 3DBLB 3OD5A 1OHHA 2PSEA 4UM7A 3SZUA 5IKEA 2JF0A 1S4MA 3WLNA 3CLUD 3RAEC 4I1IA 5SZKB 1WP9A 1PFKA 5BXQC 2DY0A 4F8JA 1XYGA 3ASZA 4BATA 5KQSA 1N2BA 1ESZA 2V0CA 5EKTA 2ZB8A 1P2UA 2P0EA 2FN9A 1C0LA 1ZO8A 4DQ0A 3ZK7A 1GEEA 2RK4A 3JVUA 2CWDA 1NVDA 4WXRA 1T1JA 4A3SA 4KR7A 2W5UA 3QX8A 2OFFA 1UM8A 3PS9A 4MDHA 4MKGA 4D41A 3JARA 1YH3A 4CCSA 2HRBA 4X1IB 4GKAA 2WIFA 4F93B 2QPOA 3IQGX 2ERXA 3K09A 3MLBA 1Z6ZA 3PPXA 5KJFA 4YP6A 3ZZMA 3SDZA 4QUKA 2ZT5A 3C3WA 2I6QA 1USKA 1TF7A 2QJRA 3BH7A 2ZE5A 4PZLA 2FPRA 4G07A 2QM8A 3ZIAA 1Q0QA 2X8JB 1BWSA 1K9SA 4WL0A 4ZVNA 1XFDA 4CCYA 2H57A 1LF5A 2Q1TA 3H75A 2YZ7A 5CVCA 3FY4A 2ZYIA 1IL0A 1ZN8A 1KH2A 5IT5A 4R41A 2DKNA 1I24A 3EA5A 2LCIA 1FY2A 3ZE2B 1PS8A 4HCJA 4MULA 5T4EA 2QN1A 3ROKA 4DUZB 4V1CB 4J16C 1ECCA 2OZKA 3F98A 4U2EA 1UWVA 2BEVA 5DHPA 2B8EA 1KJJA 4JYCA 3GH3A 4RXMA 3ZCUA 3AP1A 5KU1A 1FFWA 1W581 3HACA 4YAKA 3A9CA 4P0PB 1R0SA 4FN5A 3UY4A 9MHTA 4YAOA 3W9UA 3ZVLA 1ULHA 1FP6A 4UXHA 3TZLA 1MJ5A 1SVSA 3MSCA 3VSDA 3V2HA 3KSZO 2PJZA 1CUCA 1Y5LA 3DMTC 3WYNA 5E1DA 2HRCA 3H4TA 4URHA 5LM3A 4H3KB 3MBOA 1IB0A 4FW8A 4BEVA 4PR3A 5C5DA 1JFSA 1ABEA 4DE5A 5JDCC 4AZ0B 3BXPA 3P32A 1T4GA 4QOSA 5ALVA 5JZ9A 3HEAA 3HXLA 2GPWA 2ATEA 3FNFA 1G5PA 4O02B 2Q4RA 4Z0TA 5K2OA 2OGTA 1PFVA 2HO4A 1ZUNA 1WCWA 1ZBDA 3LH5A 3DMPA 3N3AC 4W5HA 5DYGA 1H94A 2VPQA 4MRNA 2F17A 4FI3F 3IAM6 2VBIA 2B0CA 1RZUA 2RGBA 3KHTA 1N6IA 1QH0A 2H9IA 3NTVA 1IG3A 3OQPA 5JANA 3ZOZA 2WSMA 4I1VA 5HSGA 3LYLA 1IM5A 4JGGA 4RD2A 4QKQA 3FF4A 3RB8A 1SXJC 4ZJYA 4FT2A 4YV7A 4HNTA 3ABRB 1WVMA 5KKAA 3IB3A 4MHSA 1QE3A 3FYSA 3CISA 1VSUA 4JUCA 4C4XA 2QN3A 5BOSA 5KTMA 2FFHA 4RTRA 2Q21A 4YIHA 5JBNA 1CETA 2JVJA 3PL5A 4LZAA 4NECA 3ZCQA 2F4VB 3AG5A 1ZI8A 3TSCA 3FKSD 2I54A 4H3VA 4WCDA 2YN0A 3VNBA 3K0FB 1LPSA 3W4JA 4CQMD 3BL8A 4LXYA 4CLHA 1Y5IA 3IMKA 3PDUA 4BNVA 3PQDA 4OH1A 4H1VA 1N2CA 1WHSA 1ZM9A 2WW8A 3DBOB 3ZIDA 4V02A 4K9QA 2DQ4A 1H0HA 2UXCB 3ED5A 1MVOA 2R4TA 3D8SA 1YB6A 3H11B 4XDHA 1YAHA 4DCPA 4XVCA 5BUSA 2AEMA 3DCYA 1U11A 4NFYA 2JGMA 3HVHA 3ENKA 2VYNA 4ND7A 3VPFA 2PS3A 2AXEA 5IEJA 4OV6B 1M8JA 5EPEA 2Q9CA 5DIZA 2XYVA 1ZGJA 3LPMA 4X85A 1FYWA 1OYWA 2C5SA 5ALQA 4I4LA 1R0BA 5HF9A 4B48A 5C32A 5LR6A 2LP4Y 1XEXA 2GN0A 2J9GA 3I37X 4G3XA 5BV7A 5JCZA 1P73A 3FWHA 1IXYA 4QX6A 3X1JA 4E5DA 4BQIA 2WSIA 5A3SA 4CL3A 3HL0A 4RZQA 4DRYA 5DBGA 1Y1SA 2WI8A 1IQ0A 4ETNA 2KS6A 2NTEA 3C7CB 1DQSA 1X7ZA 3D4IA 4ZT3A 2ZIAA 3MWEB 3ELDA 2K5UA 4TLAA 2C2MA 5EI5A 5KJEA 2C7RA 2IHNA 1WXWA 1D03A 3A6ZA 4LRSB 3NB0A 3RSZA 4EARA 2O8CA 1Q14A 4K8OA 4LI0A 3B70A 3I28A 1LI4A 4TRMA 1F3OA 4B8WA 3TLYA 3PFFA 1L5HA 2C1ZA 3QKRA 1QKJA 1WA5A 1YMUA 4GLBA 4CR7A 4OYYA 5L4NA 3EGDB 4AY6A 2HMWA 2WHRA 3O8NA 4O2BA 2HZBA 4UMDA 1JVBA 1QG0A 4UTNA 4RTNA 3KQUA 1EWQA 2BM9A 4O8CA 3S1AB 4QDUA 4II2A 2ZXUA 4DABA 1K68A 3V48A 1OF1A 3EFOB 5E7JA 3BREA 4TL9A 1PGNA 1Q5PA 1V16A 2NU9B 4AJ4A 3UBMA 2RJ3A 1C5KA 3VSCA 1K1EA 4ZRDA 1UJ6A 3RJTA 2VAMA 1POWA 3CWZA 3G1WA 3VV3A 4C7KA 4ZGBA 5ITZB 1Z5NA 4E31A 5LYJA 3RAPR 1QGOA 3TAXA 1KDTA 2Y1WA 1F12A 3HI6A 3ZXUB 1URPA 1R4MB 1LNQA 2G3YA 3ND7A 3R3HA 2VZ8A 2DZDA 1B41A 4YPFA 4FHCA 4BNGA 4TXMA 1HNXB 3GT7A 3EZ6A 3IVRA 2E6UX 3ESZA 3H5NA 4UFNA 3VRHA 3TOCA 2A1UA 4EMBA 2B69A 3L7LA 4MQFA 3UMSA 3A26A 4IJWA 2DR2A 4AYXA 5AVQA 3LA6A 4RQBA 3DW1X 3JD1A 4GDMA 5TJ9A 1W73A 2VT2A 4C0KA 2F1RA 1SQ5A 2F1OA 3PXAA 5AT1A 1M2WA 1JHDA 4G67A 2R97A 1SKYE 4EO7A 3A6HA 4WKPA 3M6AA 3I01M 3LOPA 5EHIA 2EX1A 4DBLE 3V4SA 2V7PA 2BGLA 3HCWA 3IJ5A 4ZI7F 1PN3A 3WJAA 1DO8A 2FSPA 4F12A 3FYUB 5AHOA 1FLAA 1TQHA 1HTBA 2EFJA 4N8SA 3DTTA 3PJDA 4UJ5A 3S5JA 3P4YA 4AKEA 2GNAA 1IBRA 1U28C 1AK2A 5HX7A 1O95D 4ICIA 2JLYA 2R6R1 3KYDB 2RH9B 5ERXA 3SHVA 1P72A 3OF2A 2NU8A 2FFRA 2RCNA 4P9NA 2VPZA 3MBKA 1VSTA 2P62A 4EVIA 1ZJZA 3KO8A 2X9LA 2BONA 2J0SA 1IJFA 1IZZA 1E2QA 2VTBB 3MCTA 2D3TA 3C3JA 3FX2A 4A0QA 5LQJA 5I8ZA 2AKAB 1SKAA 2H16A 1BXZA 2MDTA 4UW9A 7AT1A 1DCFA 2YFQA 4HYQA 3DMNA 1WCXA 5HW0A 1H2AS 2CNDA 2ZYAA 2JFQA 2PIDA 1DOAA 3LG2A 4BZQA 1RYMA 2YIMA 3FDXA 4FEGA 1W6RA 2NUBA 5ESRA 1U81A 1Q57A 2XWQA 3TLAA 1WLSA 4F4IA 1K98A 1KQ3A 1TZBA 2QRVA 1QOPB 5B1DA 3THOA 3WA6A 1JPNA 1IZ0A 3DFKA 4EIWA 3BCSA 5F7XA 5KREA 1EX1A 3QYFA 4IJVA 2WLTA 4H7DA 3TPCA 1EVJA 1JAIA 1Q0LA 4B2LA 2YBEA 4N6NA 3HUDA 2PRZA 4Y1GA 5EWMA 4YFVA 3CF6R 4X62B 4G5OA 1Q1EA 1NQXA 3P9PA 4LJKA 3DR5A 3LNTA 4CLOA 2B25A 3PRHA 4KMMA 3TQCA 3ZZTA 2BMEA 4LPKA 4EUHA 4CEIB 1VIYA 2OORA 3H5AA 3WGYA 4C4PA 4LJ4A 3HTXA 2PD3A 3Q11A 4XZ3A 1WXQA 4ES6A 2ZRDA 3CR3C 5K99A 3A1EA 3THWA 1QJCA 1X1DA 2BWJA 3USCS 2EHJA 5EFZA 1G9SA 2C99A 1EQAA 1NBAA 1PP4A 4YONB 3ICVA 3QK7A 4HAXA 4NYIR 4RH3A 1H8ED 5BWMA 3ZDCA 4MJ7A 3GLGB 1CJMA 3OJ0A 3OZVA 3ROPA 1DOZA 1EDEA 1LB1B 1FLVA 3U4QA 3ABOB 3WC4A 2QEQA 1AC5A 3K70B 2J5QA 4NCKA 4IDDA 1SA0A 2NVWA 3W6PA 1CNFA 5DNCA 1O6FA 1T3ZA 2FWNA 2O6HA 3E0QA 3OIUA 4M1YA 1XVTA 2JJ1A 5SICE 3ZK9A 4A27A 2B92A 3VDRA 2D0DA 3EC7A 3RCBA 2CYBA 5CK4A 4CN9A 3FZNA 2Q7XA 2AFIB 3MTEA 4TVKA 3SJBA 5DM4A 4MUFA 4UJ3A 1MJFA 4J0DA 2E0IA 3ZTYA 5B2EA 2W7TA 3THXA 3IV7A 5HF8A 5BN3A 5DXAA 1O4WA 3TRKA 4PLFA 3TR0A 1Z4PX 3GUYA 3L9WA 2I3ZA 1CS0A 5KNLA 1I4OA 1PTJA 3LVBA 1SU7A 2CV2A 1UZLA 1X7DA 4RETA 5DTJA 1RT9A 1XOIA 5IFLA 1JA0A 4FUQA 3LKZA 3BORA 4AT1A 2PGJA 1N2XA 1L5LA 1KP9A 3EQZA 4HDNB 1AMOA 1QP0A 4L7QA 3OCUA 1T0HB 3BDAA 4G84A 1E0JA 3M6XA 1DWPA 5E1BA 1QQAA 1D1SA 1JIUA 2C78A 4G0WA 3BD9A 4DG5A 4WX2B 1BH6A 1E2EA 2QAJA 2VHWA 1K6EA 3DZKA 4BFSA 1KZ9A 4K1XA 3ZDZB 3I3SR 2V4MA 2V7TA 3FCEA 3F8SA 3SNHA 5HKKA 3D2CA 1KP3A 5HKBA 1WUKS 2W6IA 1T6BY 4HYEA 1G42A 3K20A 1L8LA 1TEHA 1W5FA 1SWWA 1TUEA 4P7BA 5TQ0A 2OGSA 2R6CA 2P9HA 3EXEA 5AJUA 1KFCB 2FG7C 4EPTA 3F3KA 2JGLA 5IAGA 3ABSB 1MB9A 5CJJA 4YJ2F 3P9NA 4RHEA 5CJ2A 3I6QA 3ABIA 4CG0A 3NHUA 4OJQA 4JLJA 4FGUA 1ESNA 1B26A 3ZHXA 4COKA 1GTRA 3T1QA 4C2TA 5IDQA 3L8FA 4IL5A 5KVVA 1PT7A 1Z5VA 3NVAA 4FNGA 4QBGB 3DVSX 2W37A 3RUPA 4ZVUA 3PLNA 1UKBA 3NNDA 1MGOA 5FAXA 5HDBB 5COBA 2GK7A 4LJ5A 1GTG1 5FLXA 1OT5A 4MV5A 4I9FA 4CL0A 5DV9A 4JMLA 4S1NA 2R86A 2XNJA 3E2PA 5AI9A 2OCAA 2EFCB 3KSDO 5FL7A 4X97A 5JSZA 1JNXX 3EH2A 4QXQA 1XMSA 2CXOA 4RANA 5BYBA 1DZIA 1UFQA 5B3JC 4MVJD 1GA1A 4N82A 2N75A 5EJFA 3Q88A 5GPBA 3VC2A 2JLWA 1B8NA 3RVLA 3TCXB 1L7BA 5JALA 3UPUA 1E7YA 3TB6A 3EQ7A 4Q24A 1XWFA 4PZUA 4Z4GA 2MSCB 3EC1A 4QJBA 4S1OA 3U4AA 4B6RA 1XU7A 2EERA 2J4CA 4TYYA 2W83A 1MAWA 4GEKA 3RV4A 1WV1A 1SY7A 2WMDA 2NZVG 2FPWA 4TZTA 2L0XA 2VYCA 4MJ3A 3D6HA 1GKIA 3OH8A 2VXBA 5G1NA 4Z7OB 4QDTA 1JDJA 2FWJA 4X9XA 3TNDA 4EAAA 16PKA 1SBYA 3II6X 4I6GA 4KMOA 1M7HA 1V7QA 2IYZA 5AKJA 2ZYTX 1TE2A 2GYYA 4Q01A 1LPAB 2LDBA 3TX2A 3CNEA 3HEBA 4DV3B 1M6VA 2V0NA 3R0ZA 5DBEX 1FX0A 3GARA 1RPTA 2DPLA 1R0LA 4Z7QB 5I7EA 1XLUA 4RHTA 3SBDA 4L4UA 3TLBA 1FDSA 1MU0A 2ZANA 3JAKB 3RRNA 1K7XB 4NAVA 4C5CA 2CFOA 4DYHA 4KN6A 3L04A 4UQOA 4DWJA 1IAQA 2FPPA 3O8DA 3RFVA 1B93A 4B35A 4XQEA 3OE7D 5CLFA 4PLYA 4GP6A 1L4BA 1PNQA 3DMHA 2CLCX 2FR1A 3SYTA 4OH7A 4YI3A 4L16A 2OK7A 2GLTA 4FGJA 2NQ8A 3RVNA 5ICSA 1JIKA 1N7JA 3E22B 3EMKA 1JWLA 3JD0A 3K0AA 2H9YA 4UVHA 1IIBA 3AUJB 3E3LA 1RYZA 2MIIA 2C2ZA 2JCBA 2X5NA 2ZRIA 2HHCA 4LSGA 4IDBA 2NV2B 3N39C 1T5TA 4TTPA 4TTQA 5CNIA 2VJQA 2AR7A 3VJMA 1H8HA 1AA6A 4KK3A 3TRJA 2E5LB 2HYDA 2GYVA 1DINA 1NF2A 4AICA 3HN6A 4X1KA 1BN6A 1VMAA 2NZ8A 4QXMA 4MCAA 3NHFA 4KWCA 4JB2A 1E9BA 4R71A 2GZRA 3K1TA 2YDYA 3BXXA 2J9XB 3SDBA 1YC2A 3GU3A 4UE2A 2DTDA 2XY4A 5D3ZA 3CF4G 3N76A 2I34A 1N7HA 4PHGA 5HA5A 3ZHSA 4D9IA 5A7FA 3SVZA 5FTNA 3NDRA 3AMVA 3QW4B 1EZ1A 1KORA 2Q1UA 3BVPA 4X8MA 2WYHA 3KZMA 4M7PA 2YNMC 1AH2A 2I2XB 3C14C 2RDMA 3P2YA 4DREA 2GJ4A 4MR9A 4JGIA 1W47A 2FMUA 1II8B 1MXFA 4NBNA 4ACAA 4JR2A 2XVMA 1SMKA 3LX5A 4QGSA 4LDQA 4NKRA 1KY5A 3ZDQA 3CG4A 4JNKA 2HRZA 2XTZA 2N42A 4OTZA 4CTMA 5JCJD 1T8TA 2IS2A 5FBLB 5C51B 1YXMA 3C7AA 2UYCA 1U02A 2GRJA 3AR9A 1FQOA 5J40A 2C8KA 1FRNA 5LP6B 3PEYA 1O5TA 4L0QA 5A3JA 1A77A 3PD0A 4KLAA 2O4CA 4W63A 2OXFA 3FDJA 4R1OA 1XJCA 2F55A 1AZSC 3GHHA 3NWPA 3EIOA 1W1WA 5FWYB 5BQ3A 5DNAA 4LJLA 4HZUA 1HO3A 4RIGA 4BNDA 1Y3IA 1IY2A 2UZ3A 3QHQA 2WF8A 2WTBA 3AEKB 3KR0A 5H3CA 4EYKA 1P39A 1OWPA 1I0ZA 1QFZA 3SKVA 1DTEA 1CLUA 1P1KA 1YUMA 2JFOA 4IG4A 3S70A 1FTWA 2LNDA 3FETA 2E4ZA 3A9TA 3EODA 4NEHB 4LCEA 3U7QA 2IBMA 2I6UA 4NBKA 2O2GA 1Z88A 3EK2A 1ZX1A 4GRAA 1EFUA 1DI0A 1L7OA 1OBOA 1R0WA 1Y98A 2QRKA 1QZUA 4LV8B 1ZKMA 2XODA 4KQ2A 4FB4A 3T06B 3MGGA 3HB0A 5JQGF 3FHOA 5GZ3A 4WN3A 5KQMA 2A0FA 5DI3A 4YX9A 4EA7A 2SCUA 2ASEA 3OPXA 1E18A 4B3JA 3M6MD 1FNCA 4I36A 4IEEA 1JEDA 2GCGA 1LWNA 3WYGA 4EJSC 3T3NA 1ECPA 5B4VA 5K4HA 2CSXA 3EGXA 5F1PA 5F2OA 1XZBA 1GNVA 3HFGA 3Q1LA 4JXJA 2YV1A 4KMRA 2PJDA 4XIIA 4TZ0A 2Z6VA 1TMOA 3ZVNA 5JPIA 3ZU5A 2ZGVA 4BNMA 1CUYA 4LZWA 3CEPB 3NHLA 2C29D 3LS2A 3R6DA 1HZZA 4Q37A 1E2DA 1Z2PX 3B3JA 4LGYA 2P6PA 1ZRMA 3IEPA 2H6EA 2J3HA 5CBKA 2CMHA 1YDEA 3DEKA 3OIWA 4G0ZA 1HE8B 3AUUA 3FWNA 1RXVA 3EAQA 2PGAA 3IAEA 3U4HA 2FEAA 4Q9IA 3TB4A 1BHJA 3UFXB 2VHVA 4R2WA 1QLHA 4U2GA 1FYFA 4N3NA 1ESEA 3D3KA 5FOTA 4D6PA 5LMUB 4NULA 4EKGA 2R25B 3PI6A 5KYYA 1QUFA 2J0UA 3QZUA 4HDSB 1ENZA 1IC6A 2SECE 3CHYA 2W42A 2VP5A 4UREA 4CODB 4NEQA 3VJLA 5EIEA 4P33A 2YASA 3RS7A 5SZHB 4A0SA 5AFSA 3ORYA 1QH8B 4KKXB 1G98A 1GGFA 1R9NA 2XUKA 2AL7A 3OICA 3HXOA 3STVA 1ORIA 2EZUA 1T0UA 2R84A 3GLSA 3UUFA 5K8UA 2F8TA 2HB6A 5EJAA 4TV9A 2Q2QA 2CVZA 9LDBA 5IASA 3FOZA 4BMSA 2JAOA 2P6MA 2QTTA 2YXBA 4BASA 1BNCA 1LNSA 3WHLA 5IAKA 3GJSA 3U3JA 1BFDA 3ANYB 4ZN6A 1TVCA 1IPFA 1UZNA 3ZC3A 1GZ4A 1XTPA 3LX6A 5BQOA 3EVCA 4IEFB 1PJ3A 3PLAE 3QPBA 4RD0A 5IAJA 2PKCA 3LWNA 4EUKA 1SGWA 2JKYA 2ODEA 1KIFA 1UP4A 3MMNA 3AOEA 4MK4A 1PF7E 3UV3A 4NNOA 1GADO 1Z06A 2G17A 5TY0A 5BNWA 3MJVA 4ZOCA 4EGJA 2WJJA