2FW1A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium acetobacter aceti, at ph 8.5
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
molecule tags Lyase
source organism Acetobacter aceti
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw1A00
4JA0A 2YWXA 4B4KA 2FW8A 3LP6A 3KUUA 5BORA 3RG8A 5CTJA 1D7AA 2FW7A 4YCDA 2NSHA 1XMPA 2FWIA 5BOSB 4ZMBA 5C5DA 3OPQA 5CLGA 4ZK2A 1U11A 4YCJA 5CLFA 5CVTA 2FW1A 2FWAA 3TRHA 2FW6A 2FW9A 2NSLA 3ORSA 4ZJYA 3OOWA 1O4VA 5CLHA 2FWPA 2FWJA 5CLJA 4YCBA 4ZC8A 4GRDA 4YCCA 2H31A 4Z7JA 1QCZA 5CLIA 2ATEA 5BOSA 4AY3A 3RGGA 2FWBA 4AY4A 2NSJA
chains in the Genus database with same CATH superfamily
1QHGA 4JBGA 1C7JA 1M34A 3BGOS 3L7IA 1FFEA 2BM1A 4OK5A 4PO8A 5G1OA 5AHRA 3MCTA 3V97A 3TQCA 3QWFA 1OKKD 4EYOA 3FKQA 1NAIA 2D3TA 4ETMA 3DBHA 3H4IA 1QKJA 3KWJA 2RSLA 5HDBB 1QTQA 1MKYA 3DL4A 1NVTA 4A36A 1JDJA 1KZ4A 4BXOA 1JA9A 1B42A 2HHJA 3UMMA 2ONYA 3DF9A 2A7QA 1C7QA 4YRQA 2QGZA 5EZQA 3CV3A 3LQ4A 2P30A 2ZI6A 1AK1A 1DBSA 1UMCB 2RCNA 1J06A 5KSZA 3C0KA 1JQ5A 1MEEA 1T1SA 2G17A 4UM9B 1I2CA 1MOQA 2C95A 5FLYA 3GAAA 1CPYA 2OQ2A 5LDGA 3VHXA 3ZHSA 4A8JB 3M1IA 4Y9DA 1NQ5A 3QVGA 2OR3A 4IAOA 2AYYA 3HKDB 4NEHB 1SH7A 4OJNA 1ZHHA 3UJ8A 4NECA 2IEGA 5TT1A 4M7WA 5H5JA 1GSIA 3Q12A 4B84A 1TEVA 4BLPA 1XJ0A 4FFBA 3A6PC 1BWQA 1Z6GA 1KWKA 3OC6A 3HWSA 1V71A 2DY0A 2Z1DA 1FX0B 1Q7CA 1KOFA 2H07A 4NYJQ 1BDJA 2PMWB 1CZUA 1RS0A 3GMIA 4JI3B 4PC7A 4U2CA 1RWQA 2HF2A 1W30A 3I6BA 5JCOC 4FPXA 1SWVA 4QYIB 4IIVA 3E2IA 5A02A 2R6JA 4I1OA 3WWOA 1W8DA 4RYLA 3FGOA 3F5MA 3FHLA 1F0PA 2EP7A 3AGPA 3U16A 3ROPA 3NC0C 2X1LA 2PRYA 5FH9A 3DO8A 2YN2A 3ZHQA 3MG9A 4EGFA 1RQRA 1MW8X 1KOLA 1U0GA 4QUIA 1L5FA 4WEOA 4M87A 1RQ7A 2JB9A 2WHRA 4RJ2A 1ZW1A 2WFAA 4PWZA 2YIMA 4RH3A 3E0XA 1R12A 1CVIA 1QE5A 4FIZA 1GGEA 1DRUA 2Q46A 5DP2A 2YTZA 3UGKA 3V1TC 4RVGA 2K7FA 3M83A 4HO1X 4JCCA 5DHAA 3WLHA 2AMYA 4IS3A 1Y3HA 2YMLA 5AM5A 1M0TA 1JWLA 1A9QA 4ZOQI 1I0IA 4XYMA 4NATA 4X9XA 2GAAA 2W2PA 4RABA 4YJ3B 4GZ3A 2QNRA 5LP6F 2R86A 2R2AA 1ZZEA 2IPNA 3GEIA 3E5RA 1JG3A 1N7IA 3FRIA 1F3LA 4DLNA 3AUJB 4L72A 4I4TA 5KNCA 3KSUA 3I4CA 3ZYZA 2ZQYA 3EUWA 3OBBA 3OIVA 4YQYA 3EZ9A 3NXSA 1T29A 3GCZA 2OFPA 4LX0A 2A4KA 3LQ2A 5F3DA 3DE7X 4CT0A 2BJVA 1GCGA 4UXHA 4CQNA 4KO4S 4I55F 5REQB 2JGEA 4KXUA 5ETJA 1KI1A 1S3IA 5TQJA 3NUZA 1DAFA 2A8YA 5IU6A 5F1KA 3FPJA 4BJHB 4KIWA 2BDEA 1QPBA 1TVCA 3GF4A 3M6AA 5KNBH 3HN7A 2L82A 3BMNB 4F5WA 5G40A 1KEEB 2QRHA 3IDFA 1OPRA 4MR7B 1NJGA 4S1OA 3I61A 3JQGB 1QG0A 5CDFA 5ITWA 5DGTA 4F9GA 1PJCA 2HMSA 3KELA 3L8FA 2PL3A 1JG7A 4DL9A 2XT6A 1ODJA 3ENNA 4ZU1X 4POOA 2VOEA 2IZ5A 5HJ2A 3UTCA 5D86A 5KDOA 3PXAA 4KMOA 3PNYA 1JU4A 2NG1A 1IRXA 3LVRE 2CFOA 4FX2A 1GSHA 3OAAA 4HG2A 2W2MA 5H81A 2GHQA 1Q0TA 4RV9A 1FLAA 4PLVA 1AGPA 2NAPA 5FB3A 3X2EA 3QHAA 1KDZA 4ZGGA 1C1XB 5F76A 3QPDA 2QUIA 2QN6A 2D1QA 1C3OA 3L04A 3L7CA 3QNUA 1RHMA 4MW9A 4ZHQA 1I7SB 1JGTA 1FX1A 3BQMB 1IJBA 2IEAA 4ARBA 3LAWA 3DCIA 3INYA 5LQKA 3KKKA 4NCHA 1II0A 1HE3A 1X3LA 2SNIE 4QFBA 1HI9A 1KNXA 1VI2A 3VR4A 4ALLA 2QN1A 1X8LA 2C4UA 4HYTA 1P6QA 4MVJH 5JZSA 1TIPA 3TIGA 4KQKA 3GA5A 5JASA 1U99A 3EAGA 4D44A 1M9NA 4MPDA 5LA6F 3BZUA 3DEAA 4ZZ0A 5I4KA 1IBKB 4PGGA 5FNZA 3B6IA 1F0NA 1NBOA 1DCFA 1NYTA 1TFUA 3OHSX 5D5QA 4M86A 1BCRB 3DEFA 3NYQA 4WRRA 5AHOA 5B7QA 1GILA 1WHSB 5KINB 1E0KA 2J3EA 3OEED 1E3WA 1NUQA 3PF9A 4Y98A 1KMIY 3RRFA 2D0IA 2I4LA 3T7RA 3W2TA 1RXVA 3FTCA 2BYTA 3MLBA 1K2WA 4CQMA 4MV4A 2JFNA 2BOVA 1KP2A 2EW8A 2I78A 3WQRA 4NDZA 1W0JA 4JI7B 3OI7A 4EJSC 4AD8A 3FWHA 5KTPA 4DKJA 2I65A 3PHHA 4YO7A 4B3SB 3R9WA 3DL0A 5EIOA 1WDTA 2ZQ5A 5CW1A 4QUHA 1A96A 4RPKA 3U7QA 3LWNA 1RQPA 1FMCA 2WKQA 3P20A 4PZLA 2J0VA 3F6SA 5L3RA 1CVLA 4J03A 2WIBA 3HXLA 4RVUA 1IN8A 4Y2YA 3B7GA 3F1KA 3GLUA 3ZE1B 4AP9A 2ZTSA 4DC1A 4X85A 4E6EA 3AFNA 2PD4A 1T4DA 3MYRA 3WNVA 5ALZA 3WFZA 1M2GA 2O8EB 2Q5FA 1PSDA 1NR5A 4A2QA 2FAXA 1UMCA 2REOA 3KSMA 4FE3A 2QU8A 1UBKS 4INOA 1G8PA 3TQRA 5ARBA 2JIQA 3AFHA 3VDXA 4TYYA 5EWLA 1NQXA 1OZGA 3BRWD 4BYMA 3FBGA 2V7QA 4RK1A 1X7XA 4LJSA 1GGMA 2XUGA 2CLDX 4R51A 4M6WA 4D4JA 1MVNA 3BL8A 4QHSA 1F0YA 1KFKB 4CHGA 2B9EA 4QKQA 1U0OC 4ZA2A 1YRAA 2V65A 1AK2A 1GRVA 3H0EA 5CB4F 2F8SA 3HCPA 3A04A 5EE0A 5IAGA 1GZ6A 3DFIA 4TVOA 3WHLA 1CG6A 5B7PA 2VTBA 1XDUA 2GBGA 2ZK7A 4BRSA 2HSZA 3IPLA 2H1HA 2R4UA 3BGWA 1V6CA 3TLAA 2EATA 1K6MA 4RNCA 1XT6A 3ROTA 4YDSA 1KY4A 1Z28A 4JP1A 1ZRSA 4MQFB 1H2XA 5BSEA 5FI3A 1SKYB 3VX3A 4Z51A 5I9IA 2ZCUA 4U0KA 2QTVB 3L8GA 2NU8A 2NUBA 4JU8A 4RADA 4O63O 4C4SA 4HWGA 4E4YA 1RYZA 4FXPA 4YQFA 5C5DA 2B34A 1IM8A 1PJAA 3C6XA 4LJ7A 1TK3A 4GXRA 3MPOA 4F8YA 3OU7A 3DBOB 2O2IA 1Z13A 5E0KB 3VTZA 1HORA 4HEQA 3MTAA 3VMFA 5C5EA 4YV1A 2GERA 3KXPA 5JHHB 4LF4B 3DEYX 3S5UA 3HVJA 4BX3A 3CO5A 1L5VA 4WCFC 4XRGA 1PFQA 4PC2A 2K4MA 1C1HA 1VI6A 1UAYA 3BF7A 2Q8QA 4BLQA 4CTOA 1PZHA 5AUOB 1JVSA 4DCSA 3NTOA 3VA7A 1NDQA 3EMDA 1Z5OA 3FLMA 4RVNA 5CT4A 5IAAA 3PCTA 5J63A 3RROA 3UT6A 1PT5A 1H23A 2FLKA 4U9UA 3UMBA 3CKLA 1PLJA 1E89A 1E9FA 2OBXA 2I33A 3D64A 5CT8A 4BGEA 1MMFB 3QENA 3ZI0A 4L07A 4NCJA 4K9OA 4UFNA 1TLTA 1JKMA 3CNQS 2DQKA 1T36B 2HN9A 5J58A 3FYUB 5JNUA 2ROQA 5KS2A 4FZVA 4H6PA 4NRDA 5HMMA 1W1UA 1ISHA 3ZE7A 4I6GA 4WVFA 2AMLA 4I1SA 2VEOA 4EJ0A 1DIGA 2OG1A 3SJCA 2N46A 5C2JB 2NU9A 2QSUA 2HQOA 1RI5A 4M8LA 1NVEA 3WLSA 2DR0A 2Y71A 3DVSX 5JBIA 5TNXA 3KOWA 4TS3A 4AJOA 2YR0A 4ZT5A 3VNVA 4QM6A 3VC3A 3FA2A 3AY3A 3TW8B 1QH9A 2O8BB 1XCBA 3JV7A 4TQ9A 2NUPA 3I09A 2GK6A 3OHPA 1P5ZB 1QXSA 1LNQA 1VLVA 1QONA 1YA4A 1IPEA 2C8JA 3P2MA 5K3FB 5AJHA 5BOSB 1TF7A 4MGIR 4BDSA 1UDBA 4DUGD 5JDIC 3RAEC 1SG9A 1EQUA 5AHKA 4NXMB 3M4XA 2A86A 5FBKA 4BX2A 3CF4G 2D5IA 5JQGB 3OTWA 4G1BA 1NV9A 2A3RA 3W5JA 2B69A 4ID3A 4HR7A 3FHTA 1W5FA 3DE5X 3G8CA 1R64A 4K1LA 2INGX 3T3MB 3N7UA 2YBEA 3RYHA 2HSEA 3A4NA 1HFWA 4B6SA 4QUBA 1AH2A 2QTRA 4Q03A 3K5HA 2RH4A 4M2LA 5TF0A 1G7RA 1LWOA 2VT6A 2R1TB 2XE7A 2GD2A 2HK7A 2WR8A 3GFBA 4G0ZA 3EG5A 6LDHA 3MWEA 3PX2A 2ZIXA 1ECJA 1HGXA 2YFYA 4MSUA 4TTJA 1RAAA 1DXYA 3ULKA 2Q7XA 2Z4SA 5CX1B 3DEIA 1JHVA 3E15A 5LR6A 1NBHA 4ZAFA 5FBZA 1M8GA 5TY0A 4JLVA 4FFRA 3AVVA 4M1WA 4MW1A 3LI2A 4HFJA 3OEHD 3QMWA 4XKJA 3ZI4A 4JODA 1T9ZA 4B3MB 1PUJA 1RRFA 3QMVA 5FHQA 3TOXA 3R7SA 4MHTA 4L9SA 2GVNA 2RARA 4YR7A 5FV7A 1V9SA 2V6GA 1QQBA 1GTSA 1XVLA 4D0LB 1TE2A 1T4CB 3KPVA 1YL5A 1OLUB 2Q2NA 1C9MA 3IJRA 4IG4A 4LYDA 4KXXA 4E5MA 3LRPA 3JRNA 2QPAA 1YKGA 5BRJA 2RDMA 1IEQA 4M1YA 1J00A 2FZ5A 3Q1LA 4IKPA 2VP5A 3I0MA 4K9KA 4PO1A 5EKDA 5LPNA 1ESCA 3WYCA 1XI2A 5IABA 5L8VA 5M2QA 4AS1A 1WJGA 2NOAA 3RK1A 2QE7A 4H31A 2IT1A 3AVQA 4A92A 4YRIA 1G9XA 2VHZA 2ID4A 1Y1TA 1EDZA 1T1RA 2XD9A 3GL9A 3V4RA 4TMKA 1IQ0A 1P1HA 2A5DA 4UMVA 1NVVR 2ZTVA 3VOSA 2YHUA 4PRZA 3IP9A 2WD7B 4ZWNA 2WTAA 4B33A 3GZTB 1Q0PA 1KR2A 2WIFA 4E32A 2VK2A 3L8EA 3T5TA 5AW2A 2HD4A 2EL7A 3A27A 3LXXA 2J6BA 4HZIA 3A6LA 3ZW7A 5KJCA 1ILWA 3DXXA 5C46F 2FOIA 4I1UA 5ENZA 1KJIA 1DCKA 4WA8A 4IR7A 4L22A 4NEQA 4B46A 2W0SA 3PXBA 2GPWA 4DXDA 2XZDA 1P2VA 2G04A 4KKVA 2HJRA 3HBLA 3HE3A 4U4AA 5DTEA 3CPHA 4CN9A 1IMOA 5KTNA 3L6RA 2YVLA 1E6WA 3CNEA 5DKFA 1TO2E 5KVAA 3VAZA 5LWQA 2BEKA 3IFSA 3KTFA 4ZV9A 3UC5A 1YU9A 4Y1FA 4GZ5A 1N0IA 2ODQA 2VA9A 1PNQA 2C9BA 5AXDA 4J91A 2R5NA 4ZV4A 2M1XA 5L6MB 3WGQA 4K9SA 3DV0A 3STTA 3L1UA 1EJ6A 3FMPB 3FZYA 3GT3A 3IYLW 5JMPA 5IDXA 1EK2A 3QVLA 4G9EA 2IXEA 4K9RA 2FFRA 4US1R 1T5DX 2N1BA 3QU2A 1SXJE 2ZWIA 4BBJA 3LVBA 1JEYA 4UM9D 4DMKA 2P5TB 3WV5A 1VKZA 4FYJA 1JA0A 4JS0A 2GVZC 1PQUA 3QY9A 1GQ2A 3Q15C 3QLVC 2HZ7A 4WBNA 4Z4CA 4XJXA 2VHJA 1HE5A 1JU9A 2VK4A 1X38A 4Q3LA 1GKIA 5FLEX 3FFBA 3EXHB 2DFLA 1TI7A 3O92A 1Z8DA 1T25A 2HQ1A 1DU4A 3LT5A 1U5CA 1UXGA 4LJ4A 5EA2A 4DNPA 5BSFA 2VPQA 3E3OA 4EUSA 1EHIA 1TEHA 2ZBRA 2OO5C 1Z0DA 1OHHA 2AC4A 3F71A 4BVLA 3CVYA 3BWYA 5KCZA 2DX7A 1GU0A 1ADFA 5DGIA 3LM8A 2QD2A 2GB4A 3GH3A 2LKDA 2V6JA 1RJGA 5K51A 2MINA 2FUKA 1JG2A 1XNHA 5JECA 3NEAA 2WSYB 3OLCX 1F6WA 2E9SA 1ZY2A 4HLCA 2ANBA 4PZDA 1QX4A 2PUFA 4CMCA 2NZWA 4R8RA 4EB6A 2HF8A 1MHPA 3K0CA 4EHJA 1IONA 2D2VA 2AOTB 3TGPA 2I4TA 1NBEA 2NNLD 4HLNA 4IIGA 4EFDA 4R0NA 4ZYZA 2XEDA 3CE9A 2EC5A 3F8WA 4KYVA 1UZLA 1JG1A 1Y7TA 3HEBA 5AM1A 3HWRA 3GVHA 3QVKA 4WESB 1DWOA 3G5TA 4KSYA 3LKVA 4IBOA 4MV1A 1NLUA 4YJ3F 4Y6PA 1TQ8A 2Q2WA 5I7RA 1M2VA 5E8JA 5KYTA 1HYBA 3H1TA 3LGSA 3U1BA 4ZQIA 1B73A 4P2BA 3VPCA 4U02A 1F2TB 2ZRHA 2UYCA 1WIWA 2V97A 4M1MA 3OO1A 4DYVA 1N3IA 2HYIC 2CJXA 2BFBA 2ZKIA 3BTUA 4N5DA 5C8VA 1B23P 4R2IA 4EO9A 3QTLA 5T8KA 4CM9D 4YCMA 2OD7A 4G0MA 2BP7A 2YBDA 3TKAA 1O57A 5LA6B 1QIIA 3C3CA 3BDAA 5NULA 3ZQUA 1CY2A 3WLQA 1O96B 4CG3A 1YBFA 3A6FA 5AQ1A 3VJLA 1SCUB 4XJVA 4RAOA 5CG2A 4WLUA 4B6EA 1NXOA 2OORA 3MTJA 4RTOA 2CMDA 5ITVA 4GMHA 4GZMA 4RJTA 1B74A 5TJHA 4Y6GB 3BIOA 1E5TA 1J0BA 1POWA 3HP7A 4P3XA 4J0EA 3T34A 4A6XA 4F7WA 3PGJA 4GBJA 2JEZA 4YCDA 3G1TA 3H1PA 3K3PA 2UZIR 1G8HA 3BK2A 4Q4LA 3S3TA 1CEXA 3VYSB 3VO8A 1XLVA 3CKMA 1AQIA 1XZIA 4XWTA 4RENA 4U2FA 4RV5A 1FTYA 2JGMA 2TECE 5CNKA 1ILEA 1SCKA 3GLFE 3LP8A 4WXEA 4OLBA 1ZXBA 3EW7A 2IEBA 3QVUA 3DD5A 4C5CA 2VAVA 3NGMA 4AMBA 4F85A 2QN3A 3MT7A 2NTNA 2EL9A 2WU8A 4O4IF 4AJJA 3KPWA 1DOAA 2BGJA 1RLMA 2DVMA 2EBHX 1B3BA 1FVHA 1I2ZA 2G82A 3Q4GA 4ML3A 4TL9A 2YL2A 2AFIB 3TE6A 4N18A 2JH9A 4P08A 4UMEA 3FNBA 1FPQA 4LS3A 1K4MA 4LPSA 4YUZA 5HKBA 4QBHA 2QIPA 3KEFA 4K5QA 1TMOA 4JLMA 3RM3A 2P4QA 1Z5WA 1QR6A 5G0WA 4WOCA 3UAOA 2ACWA 4AKGA 3HXTA 4ID9A 2KWIA 4NU5A 3IURA 1MBZA 1NJSA 1CDOA 1JQEA 3FCCA 2A4MA 1XZCA 2VJCA 1BQ4A 1Z56C 3MBKA 4KQJA 5THKA 4BNYA 4BUZA 4JB8A 1G8SA 3BXGA 3VDNB 3CX4A 5DW3A 1WHTB 1FW6A 1EP2B 1TW2A 5HBGA 4Q6WA 4LDRA 3B6EA 3TLJA 5IJZA 1ZIOA 4HMPA 1R6XA 2D74A 4X24A 2C3MA 1L4KA 4Q3KA 3C7KA 3QW2A 3IELA 2A0FA 1N1EA 1RI1A 5BNFA 4AM8A 1YHYA 3ENZA 3BMQB 4UNSA 4BVFA 5I01A 2H3EA 3S8EA 1OH7A 4UNQA 3G7NA 1GQQA 2H4JA 4JCOA 3UCFA 3R75A 2DJ5A 2PTHA 3T3GA 1WMFA 1U7XA 1R6DA 2C3UA 4RY2A 3C41J 2WD7A 3F67A 4YR9A 3VU8A 4LVCA 3CNHA 3VR1A 3FLEA 3ZE9A 3K71B 1X87A 4YUAA 3CGGA 1C3LA 2FEKA 4L15A 2Q3LA 1LBHA 1YWGO 2XCUA 4J07A 1XELA 2C5BA 1AV7A 1E3LA 1Y8CA 1QHYA 3FDJA 4HVAA 4JHXA 4RX1A 1OBCA 1CEYA 5IVDA 2XTAA 2OV2A 2Q7OE 1W48A 2JANA 1OWMA 3IQDB 1ODCA 3RK4A 4BNDB 3DR3A 1A7UA 1GPLA 1FTWA 1V39A 4WK6A 2PX3A 3MQ4A 3O8OB 2AG5A 2QTBA 3SLKA 1NVDA 5EFZA 5E6UA 1GGFA 2ZI9A 2FN4A 3M1AA 3SYMA 4EF4A 3T95A 4EHKA 1KYVA 2HIHA 1E92A 4G23A 5HE9A 7AT1A 2JLYA 1E2EA 5EWJA 2EF0A 2OPBA 3GRCA 3HB4X 3WJ7A 4KR7A 3HYSA 3HVHA 1D1TA 1ZP6A 1L4LA 2AW5A 4IJUA 4O29A 2SCUB 3B3QA 4HGRA 3NR2A 2C84A 3CLKA 3I6IA 3SZGA 3EEQA 4DR5B 1M3SA 3DZGA 3B6ZA 1FFXA 1ZGZA 1ECGA 4IWYA 5FBHA 1AMOA 3OE5A 4KHZA 1Q1ZA 4P2GA 4ALKA 3C1TA 4L4RA 3RF6A 2W90A 3PX3A 1O95A 3LNCA 4PG6A 4PSUA 2XAAA 3WHPA 5K6RA 4IF6A 1ZS9A 4O0MA 5JFGA 4RCZA 1AN9A 2DECA 2RI6A 4Q21A 2RIPA 1JHRA 5HVNA 2LZ0A 5LIRA 2E85A 2LCIA 2P6RA 4CUKA 1P4GA 3RK0A 2QAGC 4KNWA 4QNRA 4BP9A 1H2WA 2Q3BA 3CW8X 3JSAA 4E5SA 4FB4A 2RG1A 4G0PA 2JJYA 4IJ5A 1B0AA 1KU0A 3WYDA 3IJ5A 1PIWA 4PFJA 3OZGA 2Y0DA 4IJVA 5I9LA 2FPMA 1GZ4A 3P19A 1XZLA 1KKLA 3PKJA 4WCFA 1KMHA 1TNDA 3OE7A 3GGJA 4PRYA 5IYZA 1M83A 1S2NA 2NUPB 4GRAA 3RKRA 3OZUA 4I5IA 1Y3IA 3AW9A 3CH4B 4OKIA 2NO6A 1I33A 1ZD9A 2FFQA 2JZOA 2KM1A 3DE0X 3W5AA 4ZZ3A 2XB6A 4HGNA 5EWMA 4CW7A 2BONA 4BVKA 3FDZA 1H1LA 4L50A 1Z0IA 1Y1RA 5ALPA 3EDQA 4DLBA 1VA4A 5EIEA 3Q0IA 3CZMA 1KSGA 4P3PA 2Y8EA 1E4VA 3PQDA 2C5EA 3WP0A 1STOA 4QT0A 4D8UA 1QDUA 1SKYE 1EUZA 5HF9A 1J42A 1DAPA 4K81B 4JJFA 2RGGA 3SR4A 5KCMA 4LRYA 1CFZA 4ZVTA 5CM8B 2XMPA 4QRIA 4YEDA 3RYFB 1XHEA 1V5EA 1WEHA 3BF8A 4GX1A 3GUCA 1J39A 4XQ0A 3GG9A 5C4MA 1LTKA 5KQGA 2GPSA 2JAXA 2XGSA 5CEEA 1KMCA 1NBIA 1QAOA 3BAZA 1DELA 1U3FA 4U5XA 4URXR 2JFOA 2VQSA 2ZRQA 4L6IA 1N8TA 3MGGA 5HHTA 5K2OA 4QBFA 4RMHA 3ZJVA 1H2BA 1JMKC 1EP1B 1C0EA 2Z2IA 5B57C 4NG5A 2QTVA 1EFHA 5BN3B 3THWB 2CLSA 1IHPA 3KJQA 3BJZA 3PEEA 4RQTA 1A9ZA 3JALA 4CUJA 2XEXA 2BY4A 4JH0A 4L8GA 3RUPA 2PKQO 4CKYA 2QBYB 5DBHX 3OJ0A 3ZGZA 1XD8A 2EFEB 1I6WA 3MTIA 3D4IA 1YMUA 2QW1A 4I9FA 1W581 1PDOA 3GJQA 5KWVA 3DHNA 3NOXA 2Z6QA 2ZZKA 5D5PA 4TLDA 3TXAA 2QDXA 4W9NC 1E7QA 1RMQA 4GOLD 1E6LA 4M9QA 4PVCA 1U80A 3RSHA 4ZZIA 4F71A 1O5IA 2IZ1A 4MGEA 2ZJ8A 2HA7A 2ZRPA 4I66A 3PIIA 1NXPA 2BVNA 1ZH2A 3R3JA 1FYWA 2DPGA 3FOAA 3KLPX 4EQZA 3VPSA 3KOUA 5A5GA 3LLCA 3T0FA 3QU9A 1Y5MA 4NVRA 1CB0A 3KRTA 1MC5A 4A27A 4CIVA 3SEFA 3FOEC 4G26A 2UZ4A 4ZT6A 1YR7A 1RRMA 3OOWA 4KI0A 2RMKA 5CDGA 4G1EB 3TIFA 1KHHA 1U9JA 3MMPA 4P4UA 1PYGA 5SY4A 2I54A 1ZJ4A 1CTQA 3MFQA 2F90A 2FY8A 1KO4A 2GBPA 1XL0A 4OVKA 3VR5D 5I7EA 2AJTA 4C9BA 3T9EA 1KI3A 5FL3A 1OLSA 5G02A 2HH9A 4ZCQA 1OZHA 1H8ED 1W4ZA 1Z5UA 2AG8A 4JKOA 4R0VA 1ADGA 1SUBA 3L3BA 1HOTA 3QKSB 3L4SO 1YK0A 1YI1A 4AJNA 3SZUA 5DPMA 2OV8A 3AR6A 4MRAA 1JFRA 2WWTA 3L9WA 5ECDA 1M0SA 3RRJA 3WE7A 2REBA 4GPBA 1WCIA 1RXCA 4B82A 4RBNA 2UZ3A 2MMCA 4CMEC 3R1IA 5CB0A 5JQWA 1CJCA 4B6QA 1N7JA 2YX1A 3CWQA 1LD3A 4O4JA 5EXDA 3WSTA 5LB4A 1KP3A 1GRNA 5I9TA 2HWYA 2IXGA 4XUEA 5IH7A 1I94B 5K20A 2WSBA 1NUSA 4MQ5A 1ODTC 4R83A 1PNTA 4EAAA 1P5HA 3VI4B 1Q50A 1MG5A 1W94A 1ZOSA 1PVDA 3OESA 1XZJA 3FWPA 3EHDA 4TXHA 2BBOA 3LBNA 4LHZA 2DQSA 4K9QA 2R97A 4BNMA 1QKIA 1ZBDA 4D96A 3FDZB 3D7KA 1G5PA 4TT3D 1IJKA 3T5AA 4Q3CA 1SCJA 2SKEA 3DYBA 1B0UA 3EVCA 3MWEB 4FINA 3ZQ4A 5ITSA 1E1QD 4ND8A 2R6R1 2AGVA 3F6CA 2OZVA 3ZJ5A 3AL0C 1Z74A 4ZAYA 3ONNA 2FMXA 2GT1A 2PXCA 3WYBA 1SXPA 2VK1A 3CH6A 3O84A 2O14A 1DV2A 2FR8A 2VNKA 3DJFA 3PHIA 5IANA 1WO8A 2K5UA 2O1XA 2IRWA 3CPSA 2V1UA 2HA2A 5AW7A 1J99A 2XDQA 5ALWA 5COAA 3HLTA 3RT1A 3UH1A 2R48A 3JXEA 3WMEA 1JKJA 2EJUA 3ACBA 3BB3A 5EMNA 5AVKA 1BD4A 1HDGO 2FXVA 4J1QA 4BMNA 5KYNA 2NMVA 1TUBB 9ATCA 5DT9A 2JK1A 2QUKA 1ZWKA 4F45A 5KKNB 1NU6A 1O5TA 1UJCA 3JYOA 3W4IA 2WMDA 3B8HA 5H1YA 3DTNA 1RPJA 4ARIA 1PJTA 3RVRA 4AK9A 1Y37A 3IB3A 3E8XA 4GF5A 2V54A 4J0FA 1FFXB 4MWOA 2EZ9A 2PM8A 4YCLA 4C89A 4KE9A 2GLXA 2B78A 2PR7A 3G0DA 1RBQA 1XV5A 2AOUA 3NDRA 5AOCA 3ZGVA 1M2WA 2QUJA 3TDNA 5JWOA 3VSDA 1F6BA 4H18A 4EITA 1H0HA 5KVQA 1P60A 3E7FA 3MC1A 5EYPA 3JQ8A 5IVHA 2RAVA 4ZI7F 4FZRA 4PFSA 4H3SA 4YUWA 5I51A 4Q02A 2FZGA 5ESRA 1PQ4A 2H08A 1R8SA 2BSAA 3M4YA 3N86A 1XQWA 3RRMA 3WISA 3QKTA 4RD2A 4GOOD 1A7JA 1AIPA 5HQ3A 4CJXA 2OHIA 4ZRNA 4FZJA 3ZOKA 2V9PA 2PT5A 3C7DB 1K6IA 4MAFA 4N3GA 4ROTA 1M2OA 4S1PA 4LX8A 5LC1A 3FETA 3H9JA 3HFSA 1T0PA 4JJZA 3UAXA 4PQFA 3ZWCA 4M0CA 3SF8A 4DXHA 3CLSD 1FP4A 1BDHA 3TEMA 4XQGA 2ABWA 5TJ9A 2OC9A 3V2UA 4HGZA 5JCOA 3R5TA 1NE7A 3MXOA 4YPFA 1PZXA 3TH5A 3WJAA 4ZGWA 2J1LA 1IOVA 2JHAA 4IVRA 4L4UA 2OFXA 4I2VA 1T3TA 4IOLA 2R2GA 1YU6A 2P5SA 3OY2A 3L0BA 4J9VA 2C1EA 3DOFA 4ZI3A 3DF7A 4WZBA 1QG6A 5K8JB 3LPNA 2IELA 3C70A 3OY7A 1DWPA 2V8OA 3H65A 5JAPA 2HY7A 2ZTHA 4HNGA 3IBGA 4KE7A 4ER0A 3HVRA 1WZUA 3LCUA 4B4UA 5FWAA 1ZIXA 4I36A 2Q7DA 1JMVA 2I1LA 3HCNA 1M6NA 3N8DA 4FT4A 4HYQA 3C4JA 4ZVUA 3WTCA 3BE5A 4N9WA 4MWSA 5G1NA 2HJ9A 4ZMRA 1FB5A 4K46A 4FMCB 4D4LA 4ZIRB 3CVUA 5BSTA 3ASZA 4GUDA 4JUIA 1YVEI 2GA8A 2AF3C 4REOA 4ZVQA 3VDRA 3WMRA 1SHUX 4CWAA 1WUKS 2BZ1A 4QPPA 2F1HA 1DRKA 1Y89A 2EOAA 4LE2A 4IKOA 1S8NA 2NU7B 4UDYX 3UM9A 4BUJA 3IBTA 3IULA 4YRZA 2M6RA 4W7SA 4JBIA 1GPDG 3EGCA 1DDGA 3HUFA 4G0YA 4JJEA 1L7PA 4C88A 4C7XA 4IIBA 2JLAA 1GP2A 3E18A 4QATA 2NXWA 2HNAA 2Y05A 1J70A 2OCIA 1SQ6A 4MYSA 4XQCA 4DMUB 4DZTA 1GFSA 1UAAA 1F2DA 3DZHA 3DDNA 3O4RA 3NANA 5A5FA 5L4LA 2Z08A 3PGXA 5CB4A 3LVFO 1T26A 4B32A 4B7AA 2AXEA 1XZEA 2OC4A 3LCJA 1G20A 3NGLA 2JD0A 3UHJA 4IZ6A 2QQ0A 1U8TA 2VSNA 1Z3IX 3ZY5A 4CPDA 4JUFA 2XRMA 3C4VA 4D3SA 1AZWA 1V0JA 1B0ZA 1RU3A 1Z7GA 4JA2A 1DKNA 1OD6A 4K9LA 4OUDB 3T5GA 3VR5A 3W7VA 2BUBA 2BFPA 2QYTA 5EKTA 1BJTA 1W44A 1IN5A 2X8AA 3CZ9A 4NHEA 5BV1A 2YICA 1PJQA 2C7BA 4MKZA 5CDUA 5CVVA 5FD8A 1I32A 1U28C 1XAIA 3IS3A 4YMTA 3PSAA 1EVZA 4RTLA 2NVOA 3AR9A 2WNIA 3HABA 3TQSA 3WIBA 4CQMD 2QVGA 1M66A 3QBDA 4FR2A 4KVGA 4C0AC 4B43A 4L76A 1MOZA 2J3KA 3SDBA 2Y1DA 1GCIA 1K4KA 5JOQA 1E9BA 3LDUA 4HH0A 4PO9A 5FEUA 4TWBA 1NOIA 3K6SB 1F9AA 2BGIA 1SD2A 3I01M 4AJLA 2J46A 2HHCA 1T1JA 1QZXA 1QU3A 4KR2A 3PXUA 1CUHA 5BP7A 1GPWB 2IY7A 5CB8A 5GM2A 5GONF 2VUIB 1IBCA 1ORHA 3VH3A 9MHTA 4KLZA 4TUYA 3ZW9A 4OP2A 1E32A 1AD2A 1YR8A 2BRUA 2IHVA 1LX6A 2OE2A 3H87A 1L6RA 1N6NA 1WCWA 3O90A 1RACA 2BHTA 2VRCA 3HKCB 4PAQA 2ZYHA 4B75A 1QO9A 5IBPA 2FRDA 2CK3A 4GPTA 4HNAB 5EKXA 3H16A 5HWSA 4OA8A 5B1HA 4EPVA 1FUEA 4CG2A 3H9BA 3VYTB 2HTFA 3NVMB 3P52A 3E1SA 1PWYE 1GA6A 2XNSA 3RODA 2HT1A 1A0OA 4FIDA 1UOQA 4NQRA 3WWCA 1YBVA 3MJFA 3IESA 4ZDKA 1XTUA 4ESVA 1AUVA 2Q3CA 1M73E 2W8ZA 2CCGA 3HDQA 3RIGA 1E2FA 4G8BA 5A5VA 3C8DA 3IHLA 4CMAA 2ZSFA 2CHQA 1VG8A 3AIOA 4TV8A 3M33A 4JEMA 2G9ZA 2I7VA 3K0CC 4IGFA 1K6EA 2DHDA 4KQEA 1Q7RA 4ZPJA 1YNSA 1N8SA 4ENVA 1BVHA 1A2QA 2DSNA 1WR8A 1MNQA 1I6MA 3F7OA 4ZRMA 2RB5A 3GMDA 1GA4A 3OM1A 1MO2A 1BKDR 3H3FA 2X0RA 2PA0A 3EOZA 4MVJP 1N2CA 1GARA 1SHZA 1HFKA 1TD9A 1JDZA 5TB5A 1NW5A 2AN1A 3PVSA 4NHOA 3ITEA 4CN8A 2FUG6 4UNPA 5B36A 2DHCA 4RO0A 1GTL1 3QU7A 5PNTA 3U49A 3B5EA 4YMWA 2PMEA 4NJMA 3HU2A 1NGSA 5D3MA 3CT4A 3JU3A 4FNOA 4M0PA 4QYSA 1WUHS 4XPIA 4PPYA 3WSWA 1HG1A 2JFQA 4L0DA 3CNOA 3IUQA 5F3RA 4N41A 1DAEA 4KRYA 2QHXA 5CA0B 2FGKA 4B7UA 2WMYA 3KSAC 4HX5A 2X77A 4MV3A 3ABSB 3I04M 3RVOA 3ADBA 2XKJE 1BE6A 3DMGA 1RCTE 2AS0A 1MB2A 4OHKA 5BQXA 1MJHA 2HI0A 3ND6A 3U5ZB 2WRZA 5E7JA 1X92A 2WWXA 5A1JA 1X7DA 1K3UB 1O4WA 1U1CA 2PK3A 4Y2SA 1S0UA 3K53A 5T8KC 2C54A 1RJFA 2IPLA 1WSWA 1ACMA 3OE4A 4TWAA 3EDRA 4X3OA 3I8XA 3DFZA 2AIRA 3OO0A 5D2CA 3URKA 1ZVMA 4DLLA 2VQFB 3ZGLA 2BIFA 4HGQA 3L4JA 2C1ZA 4JZYA 4OLHA 3TVYA 1JAXA 4FW9A 3FI0A 2B4KA 3RFUA 2OOKA 4JXKA 4EG4A 2UU9B 4HDOB 3OJWA 4MI9A 5HF6A 2Z5GA 1IC6A 4TT8A 2ZB4A 4CFYA 2ID8A 2I7DA 3DC7A 4YRFA 5AI0A 1Z4JA 4EPTA 4ITVA 1XCOA 3QQ5A 2L19A 3EC2A 1YDMA 2DLCX 4LSWA 2OO7A 4M0LA 4P4LA 4EPXA 1AV6A 1N77A 3FTDA 3AV3A 3HYTA 3L7YA 2QX4A 3K8OE 4JB0A 2WUFA 1UEJA 5E2BA 1D9ZA 1NNSA 1OTXA 2KPOA 1QIHA 4PZ0A 3UGQA 1MO4A 3KPJA 5A4IS 4ZCRA 4ZANA 1B6SA 4YH1A 3UBMA 3K15A 4RIGA 1R8JA 3LUDA 3DM9B 1M54A 1QVZA 2AMFA 4G4GA 1V9LA 2P8JA 3IUMA 5I8WA 5JVDA 1IWOA 1SPBS 1SXHA 2OHVA 1C9EA 3CCFA 5CR9A 3GP3A 3RYCB 4WL0A 5D8DA 1QFMA 3WFJA 2O5CA 2OG2A 1EFKA 1VE9A 4B4DA 1SXGA 1U2SA 1RKXA 4XOUA 1IZ7A 2PH3A 3L07A 1M2NA 3EFOA 3MAJA 3NWJA 4KKXB 1UZAA 3JZFA 1T9AA 3QUAA 1L5KA 3CW9A 5AVXA 2RGEA 3CS3A 1S8OA 2RGUA 3HN6A 5E7MA 3HI6A 1BWRA 4P0TA 5IH3A 2RH5A 3GEDA 4CM5A 5LU9A 1YQXA 4YDRA 4HAUA 1BKYA 1DIOB 4PYRA 1XDZA 3AEQA 3NBMA 3GRUA 3B36A 2XJ4A 3AK4A 2NZJA 4KTTE 2XGJA 2A57A 3P2KA 1X9HA 2XQJA 4XFKA 4C0BA 2P11A 1IM5A 1M34B 1XZDA 2GEVA 1Y3DE 2QNBA 3IOCA 1I30A 3ODPA 4QRHA 2XCRB 2O3SA 4G89A 4A0FA 2GZAA 2VDMB 2ODAA 2WJHA 3A2NA 3HADA 3QKUA 4LRSB 4H1HA 4E3ZA 5JTTA 3H05A 2PV7A 2ZRBA 1T8PA 4L8LA 1N5RA 1Z2NX 4PGMA 4CT5A 1TRHA 3AHIA 1JIIA 4IUYA 4F38A 1U7DA 1PN3A 4JMLA 1NW7A 3CO0S 1RYMA 3UMFA 1FU4A 3ICQB 5KQSA 2DSTA 2TRSB 1G1MA 4ASUD 2ODNA 3VJRA 4XVUA 3QK7A 4E5UA 3C87A 3ZU6A 1DKPA 3OZBA 3GFSA 1YDWA 4ZVSA 3M89A 4K3VA 3U1TA 3X1KA 3ZY2A 3BIFA 5DK6A 5BXYA 2FMTA 3LC1O 1M7BA 5DYTA 2GN9A 4YDHB 3W90A 1G4HA 4S1TA 2GTPA 3BH0A 3TJMA 3T12A 9ABPA 1EPUA 4M1QA 1ZN8A 4OJTA 5JYEA 2EZ8A 2XUKA 2CLEB 3A6ZA 5DZSA 4CBVA 2G83A 5BUCA 1T4BA 2ZB8A 4RQBA 3U3ZA 4KQ9A 1IHXA 3TVTA 1XZAA 2JIZA 3WGGA 4RLFA 4UUQA 1KO8A 3ZXYA 3RDPA 1E2LA 1XWWA 2FJ0A 3OJCA 4KNVA 1RZRD 1Y8RB 4BY9E 2F62A 1V11A 1LI7A 1B0PA 1WUYA 2QN7A 4V24A 1OV6A 3H2KA 5ALLA 1N75A 3V2IA 3WBJA 2A5JA 3ZIUA 1U3TA 4AJ2A 1PWHA 2EHJA 5KC9A 2YV3A 4I99A 4DWOA 1QV9A 2PFGA 3NW9A 2EF1A 4YMSA 1S2IA 1S4QA 3VGPA 1XSEA 1MFZA 3M1YA 2H1IA 1QP0A 3SJZA 4UCFA 1B2RA 4PYJA 1GPBA 1QX3A 3JVDA 1EX6A 4XEUA 4PZYA 1GSAA 1ENZA 6NULA 3AB7A 3AM3A 2IHJA 4LVOA 1XNGA 3OF3A 4Q15A 3RWBA 5JRJA 2OZEA 3E9YA 3N2IA 4JX8A 4LJAA 4WCFB 2I3ZA 5E9WA 4E4RA 1A5ZA 4B6FA 3SQDA 3GEBA 3MRXA 2PGJA 2C2BA 3C6YA 3LP6A 4IXNA 5DHRA 3K0FA 3T9DA 4YV2A 3A1DA 1XRRA 2AXNA 2A59A 2XDQB 3BAFA 3O94A 1YACA 1V26A 3LCRA 2C07A 4EA9A 5EPUA 5ICEA 1L3BA 1W1WA 4WXYB 5ICGA 4HUJA 3DQQA 4B80A 1CV2A 1E69A 4FLMA 4PO3X 4KK4A 4I1YA 1J56A 1XIVA 5EMHA 3QFCA 1Z6ZA 4NBUA 1TTTA 2RH9B 2XIQA 1FFAA 1RWKA 2VXYA 3QG1A 4HFNA 3D6JA 1ADCA 2IQIA 4JGBA 1L1FA 4EJ6A 4ZJZA 1J20A 1QHSA 3INNA 1JWAB 1TM2A 2YASA 4R9SA 3WO1A 2DZDA 4EUEA 1KQNA 3RJMA 3QEJA 2PMCA 2LCFA 2ENUA 3FNGA 5F5LA 4BQOA 4FHZA 4GE3A 1S7GA 3OA2A 1O9BA 4B7CA 4C0KA 3SS9X 3GRVA 1N2EA 2HFJA 3OQIA 1O6BA 5KNDA 1OYYA 1ADJA 1IZ0A 1PV1A 1TVEA 3LCVB 4QUEA 2ZSEA 4X64B 2GPBA 4DM4A 3I5UA 1MAHA 1COZA 1K68A 1WD5A 3P0RA 3HR7A 1L7NA 1VL2A 5E9JA 1AKQA 3M7IA 1UC4B 1TX4B 3QIVA 4JJKA 2ADFA 2Q5CA 2F48A 2PDAA 3CKYA 2BDTA 3EF3A 4JB2A 2RH8A 4TXJA 3ED1A 4IQ8A 1I7NA 5BURA 3D6MA 3NBAA 4KH0A 2FX2A 3RW9A 4A5OA 1NG9A 2CMGA 2YY7A 3EGIA 2Y9PB 4MLPA 1UCFA 1GAXA 1NTRA 1FBNA 1IDN1 1XCMA 2Q21A 2JJ2A 4ZEVA 1WD7A 2HK6A 2JD2A 2QW0X 3ZHVA 3TXXA 3PGA1 2XH8A 2FUNB 3QOFA 4JVNA 3A58B 2ZR8A 2E4AA 1NF3A 2I62A 3KE8A 1AS3A 4M36A 4P38A 4TMTA 1B1CA 1E77A 4EW2A 1EUQA 1SJ9A 1B6RA 3TR5A 5JDCA 3H2YA 1ECPA 2GEFA 2EEZA 2WWGA 4A8JA 3C5HA 4EHDA 2GX6A 3VYWA 1OTYA 3ZHTA 1V96A 4Q66C 2O8BA 2NP6A 4BGIA 3GB9A 2X5XA 4O4HA 3TUJC 2XNCA 1GL9B 3LY7A 3R7FA 2HU2A 3ABOB 5FYQA 4FHEA 1XDSA 1XHFA 4X1YA 2G36A 2AEJA 1S2LA 3CCBA 3S68A 1ZM7A 4XR4A 4RD1A 4I2NA 3INGA 3DW3X 1R5OA 3ND9A 3W8EA 1TVMA 1E2JA 3IAFA 5IP5A 5LNK6 2PKCA 1KR5A 3ORHA 3OZWA 1PGPA 3D4BA 1HYHA 3D8BA 3F2IA 5JSKA 1DIHA 4LHVA 3NQ41 2I8CA 2VHVA 1SELA 2BELA 3HBNA 3JQ7A 4KQGA 4RA9A 2ZSAA 1D07A 4K6GA 4UU0A 4N3NA 3IPXA 1MO3A 4NFHA 1T1EA 1Z4MA 3IMEA 5DXJA 4ZEMA 5CFOA 1PBTA 3U0BA 4O1IA 1K75A 2Y4OA 5CLHA 1JJFA 1KXZA 4MJ7A 1HSOA 1OMOA 3VU1A 3A28A 3ACDA 2OVFA 1EE9A 1ULHA 1DL5A 1R0SA 1XA4A 1YV9A 1DV1A 1HT2E 1YZNA 3V7UA 1QDLB 3SJUA 4BV3A 1PUIA 5J2TA 1Z35A 2G63A 4JC0A 4NI5A 4PXYA 1A9SA 1G8KA 2ZJ6A 1M75A 4WADA 4KWTA 4EB3A 4MVJI 1L9KA 2CKMA 2YXDA 4YAWA 5FADA 3PWKA 1BGWA 4R1LA 4M9ZA 1U7TA 2ZSIA 4HDSA 4Y0NA 4ZARA 1MF7A 4HDCA 2PSSA 4RSRA 4ALJA 5CVTA 2QI9C 3LO5A 5BNWA 4AJIA 4BFTA 5JPIA 2V1XA 5FOVA 1DO8A 5KTSA 4DPMA 1T43A 4LBZA 3I30X 4R1MA 1C2YA 1QHNA 3KVYA 4FMDF 2R6ZA 4HKTA 4QVKA 4X54A 4DOMA 2RGRA 2JCSA 4FGLA 3TUIC 1MX3A 1KYTA 3N7AA 3COZA 2RAPA 5D5HA 3RSGA 1D1PA 3ILYA 4RFSB 2NVUB 1TC2A 4IMJB 2Q1UA 1NN0A 1X9GA 3EFOB 3VYVA 4H7JA 2C5HA 3L1VA 1YT5A 2QTTA 3BXXA 5DEOA 1N4AA 4NJEB 1PFVA 3VSEA 3KUCA 2WHQA 2IU3A 3B1FA 2QJRA 3H04A 4O4LF 1MHTA 4O4IA 1CW2B 4CV0A 3FUCA 1GEGA 2B6HA 4XD2A 2EYQA 1OPXA 3OVMA 3EB9A 1ISMA 4XXHA 4ARSA 1VCIA 3N53A 4LHSA 1I7DA 1ZW6A 2Q6VA 4HDQB 2UUCB 4NJMB 2VUSA 4G8JA 1B8PA 4H7HA 4HUTA 3O38A 3W78A 2IP2A 2XITA 3NDBB 5ECWA 3F8TA 4QM7A 2OL4A 1E2BA 2YW9A 1W85A 3NDJA 4UASA 3L6BA 3PNPA 1APBA 4KQIA 1HMYA 2XNHA 1TADA 5EY5B 1RKVA 1F3OA 2CDAA 3BSSA 3KAJA 3ZTYA 2Q4OA 2WUEA 1Z26A 1JDNA 1DFGA 2RONA 1FPMA 3OF5A 2D0PB 3DD1A 2J30A 1SCAA 2VHCA 3FMFA 2P1DA 3Q5GA 2OHJA 1HTTA 3PPVA 4G01B 1W8IA 2QL9A 3OPYA 4PLFA 5IM5A 4EB6B 5BO5A 4REMA 3ROEA 2J9YB 1DBPA 4F4JA 5FPKA 3ZOZA 3ZVLA 1IQUA 1IUKA 2KSQA 3CLTC 3KZMA 4YCBA 3GT0A 2Y68A 4DEVA 4Z7JA 1N3BA 1U8XX 1M6VA 1XVAA 2IYPA 2WYHA 1S89A 3SC6A 5LZ9A 3PDWA 2ZUUA 4O4JF 3F5FA 4XGRA 3WA6A 4E7OA 5B3LA 3RCBA 1A7KA 2QAJA 3KYCB 4QXPA 3FCSB 4EY8A 1SM4A 1IRIA 2FEXA 2P35A 1WBBA 4M21A 1MTOA 2XT9A 1KGSA 3H1EA 4M38A 4YO8A 3FGZA 4LXTA 1EUDA 3G49A 1G9SA 1PZEA 2JCXA 3G0BA 4M3NA 3W5BA 4DCPA 4WFIA 2KE5A 1Z2OX 1ZK3A 4H17A 4M37A 2WT9A 4D4MA 2X3FA 3CPEA 4B79A 5L3QB 3UB2A 2I7TA 4WK0B 4FFNA 2YW2A 5E3HA 4TXLA 4AS3A 4M1ZA 5FOWA 1CJKC 2C3PA 3FSRA 5CCXA 1JEOA 4AKTA 1A5SB 2PKYX 1ECFA 2FA9A 1SA0A 2OBBA 3K0KA 1JJ7A 4LF7B 2EG9A 3B3FA 3S2GA 4Q3DA 5JANA 3BRQA 3STHA 1B2LA 1QVVA 1SUAA 1XDWA 2IEZA 4GL4A 2ZUEA 3TTXA 2IHTA 5HX7A 4HK4A 4B3TB 2CMKA 3LUFA 4G0VA 2H63A 3E61A 1E2HA 5BVGA 2OD2A 4N1AA 4OK3A 2GCGA 1XJWA 4L5BA 2NU8B 2X1VA 4KACA 3UWSA 1J0CA 3HR4A 5DHUA 3I5AA 4DJTA 1TZCA 1ZA1A 2WIJA 1V1MA 2VHEA 3JQAD 3WGTA 4AG3A 3O4IA 4UTNA 4BQSA 1OYVA 4FYXA 4PC3A 1I4WA 1P39A 2JGAA 1IXRC 1JWBB 2OORC 5CXQA 2Z56A 3TRHA 4MEAA 4L3VA 4LRQA 2VXCA 3FUTA 1Q12A 3PRJA 3ETLA 2L18A 1EXVA 1Y9JA 2HCFA 4MJ3A 4HN2A 1QH1A 4BFCA 1CRLA 1UXJA 2J07A 4UFOA 3ZLJA 2GK3A 3OTHA 1I6KA 4NCIA 2ZE8A 4KX5A 2YDXA 4NU8X 3KPUA 2XF8A 4ERXA 1BOFA 1UJBA 1BXGB 3WGVA 4M53A 1TF5A 1VKRA 4GI1A 5C8YF 1OWPA 2H7XA 2P2DA 4OMDA 5AVJA 5SZHB 5FOQA 4NE2A 3M5CA 3AVTA 4P4TA 1E0AA 3F5QA 1P7YA 3IAXA 3W3ZB 5IT5A 4Y2TA 5M29A 4C2TA 1UFKA 3K8QA 4N54A 1AKTA 2AZTA 1DAHA 3EWIA 4IG9A 3SP1A 1RPTA 3WYGA 1LJLA 4FFMA 4TUYB 2FPUA 3VZSA 5A7FA 1XCPA 4I7EA 1UMDA 1VG0B 3V8PA 4BASA 1AHPA 1M2JA 2XCIA 4B0OA 4P0QB 1JZTA 2Z8YM 4JQOA 4WBXC 5CJJA 2PG3A 3NAZA 4ER6A 1MNAA 1UP7A 2I4MA 4EZIA 5I5EA 5D00A 3RNLA 2YUIA 2FSPA 5HRCA 2HXSA 5LMUB 4HDMA 3U3KA 1A1VA 1N0HA 4QFMA 4REQB 1JR2A 3EPPA 4LZJA 3RHFA 3VOBA 3P0EA 3S2FA 5LXTF 2CC2A 2QAIA 3IV7A 4MWTA 4KN5A 1NATA 3IRUA 4KQXA 4BO2A 3KV1A 4YJ2A 5HJEA 1W0JD 2Q4BA 4PBTA 3W3AD 4B2YA 3MCZA 3WMFA 4BTVA 1K97A 3UB4A 1R5JA 5K4GA 3ONWA 4W5OA 1GG9A 3TR0A 4AP5A 3RHSA 3N2LA 2WJJA 3E53A 4FYMA 3D1VA 4AROA 4IXTA 5AJXA 3RRYA 3W6PA 2O52A 2FDRA 1R3DA 1M74A 5K05A 2PMKA 2HWWA 2H1OA 4R81A 1PI3A 5ISMA 4R1TA 1I14A 1FJ2A 1OX6A 2PPLA 3ILXA 3LGXA 4PYQA 1C1DB 3AJ8A 3PUXA 4RXMA 3AF6A 4XX0A 1C81A 2IE0A 3CSSA 3PP8A 2XDWA 3SFZA 3G7UA 4BCCA 1ZA2A 1KZ9A 2G4CA 1OLXB 3QFTA 1TOAA 2WABA 3EVEA 3F47A 1ZRHA 3G8DA 3IPAA 5ELLA 3VI3B 1TK9A 4R3WA 3QKSA 4QRDA 3GW8A 5K09A 3N07A 1JB9A 5KNLA 2WF9A 1SOMA 3C8MA 1P7ZA 3LVQE 1VJ1A 1CUGA 4MXDA 4BX9A 1NW4A 2CW5A 1VPWA 1CQPA 2GF2A 2RGYA 3TZQA 1ECBA 2C20A 2OILA 2C78A 2NU7A 3UAGA 1U28A 3MOSA 2KW5A 2JI9A 2E4WA 2Y66A 2ZIGA 4MMXB 2D0DA 1MOPA 5DVZA 2VC2B 4RIHA 2F43B 4L3OA 4D98A 1JHPA 2FSVC 3G5UA 4QC2A 1GL6A 4QTTB 5HCIA 2B1JA 1YE8A 2C2XA 3A6EA 5F3WB 4EJFA 1E5LA 4NU6A 4INZA 1SOUA 1X7GA 2Y92A 2JCBA 2CYCA 2ZLBA 5CB4B 1P2UA 3G2MA 4NIMA 1SCBA 5I7AA 1JTFA 5F35A 1VHQA 3I53A 4CIWA 1QRSA 2FEPA 2QVBA 2I7XA 2WJ6A 2V6MA 1RQGA 3FVRA 1CE8B 2UV8A 1H42A 1L8AA 3BXZA 3FMIA 4IZOA 4CG1A 5ICMA 4PSDA 5K8UA 4BV2A 4I3HA 4NBNA 3NC1C 3VU9A 4QBIA 5ED0A 4FNGA 3BXHA 3KT6A 1TGVA 1RABA 4W82A 5KX5A 2CK3D 3DMTA 3GNLA 3G79A 1EJ2A 2WJ3A 1NVVQ 4KXVA 1PG0A 3K5IA 4D5EA 5GONA 3TJZA 5A4JA 4EVIA 4EKNB 1GAJA 2DAPA 1VPEA 2HW8A 1JALA 3AH8A 1NY5A 3ZLTA 3FB1A 3NH6A 4BRWA 3GPLA 2PNJA 2GN1A 3NHSA 3OCXA 3U13A 4DILA 4MUGA 4OHPA 3VKUA 1T9BA 3D7MA 3ROKA 3NASA 2RB4A 3U37A 1SBIA 3IIEA 3IQWA 1QCCA 1NX6A 2V7QD 5B6IA 2QX8A 5COBA 3FR8A 4BO0A 5LDHA 4FEGA 3ESRA 1OSNA 4F04A 3GLFA 1HNNA 4JIGA 3B1XA 3ITKA 4LIPD 4TX1A 3V7NA 2OZLB 2NXJA 3Q6IA 1EDEA 2X2PA 2E87A 3TXYA 3GI1A 4V38A 2AKEA 2H92A 4PLWA 2C97A 2NYAA 5FPHA 3PEYA 3D43A 3HH8A 1Q6YA 4IFBA 3QV2A 4Q4CA 1GTVA 2EYUA 3S27A 1DDOA 3WQHA 4J43A 3RT7A 4B85A 1CETA 3LS2A 2WLSA 4O4LA 5GZ6A 1DBIA 4FILA 4D25A 3OT5A 3FMVA 2XQVA 4EYSA 4O2LA 3MAAC 4F97A 4RDIA 2IHUA 1M8JA 4DIOA 1W34A 5DU2A 2YYYA 2GN8A 3KKEA 3LQFA 5CLIA 1P2SA 1OVMA 5JEEA 2FG7C 4EM6A 3DDOA 4M1TA 4DGSA 1VLZA 3RGWS 2HU5A 3T1NA 1W5TA 1XEWX 1QCDA 2UUAB 1R7RA 1M1ZA 1DCMA 3QOXA 2WF7A 4E6PA 3ICEA 1BRTA 3FZQA 1CUZA 2DFDA 3JZDA 3Q85A 4RF4A 4TQAA 4V39A 4ISBA 1ZMRA 1A5BB 2I6XA 3KOMA 1H5UA 1MQAA 3LWBA 3PNBA 3EZ7A 3QW4B 4OQPA 3JQ9C 4Q7JB 5JSFA 3EXIA 4B7XA 4IIXA 3ENWA 3S6JA 3ZV3A 3SDSA 3WLKX 3K0HA 3JZIA 3TAUA 1ZM9A 1TYCA 3HSYA 1XKLA 4N82A 2FMIA 2PKXA 3MQFA 4W63A 4EVQA 1C50A 4G1FA 2W42A 5KYGA 1P9OA 3R7LA 2PX0A 3KQOA 5GV7A 3BH6A 5IDQA 1TIKA 2IOYA 3ONDA 3F46A 1SC1A 3HQ4O 4KWHA 1WUJS 3T7SA 4EMTA 1E3EA 1RCUA 2NT3A 2QEQA 1UBEA 3EBPA 5BVHA 1ISIA 1YB1A 4I14A 5DRYA 1MQSA 5G4LA 1FNCA 2VH5R 3EOBI 3EXHC 4GLFA 3ZYCA 2VNSA 3E22B 1XEAA 5AKHA 4JBXA 3FBWA 2Q4TA 1CF9A 3AUSA 3VM6A 1AQUA 2GKSA 2B30A 5JAMA 1YZHA 1TPZA 3CE6A 4MVJM 3G0OA 2R84A 3OT1B 1SQSA 3SQLA 1NOKA 1ZVQA 4YNBA 2PSDA 2W70A 3JALB 3BRSA 4BJ6A 4OQZA 1GIAA 1T9HA 1W96A 1D2AA 3PXDA 1RI4A 5JQGA 2X7JA 1FL9A 1NBAA 1V5IA 1RD4A 3FNHA 4G4SO 3RNOA 4KE6A 1RPAA 2VT3A 1JX6A 3K09C 4GWKA 3MM4A 1VIVA 1UH5A 1Z06A 1WW8A 1YR9A 4GXQA 1BMQA 1YE5A 4DA0A 4HVTA 1VL5A 3PZBA 1Q1NA 1D7AA 1PR1A 4LSZA 2I0FA 3KQUA 1FDSA 1O6ZA 1WPRA 2LR0A 3AF0A 1WZNA 4ZVNA 4D3YA 4D8YA 3TD6A 1MB0A 4KIGA 4P31A 4S0ZA 4MRNA 4BAGA 4GYKA 3W8NA 1R4NB 2IDMA 2ZJZA 1Q17A 1TAHA 3E82A 3QMPA 3C3KA 2GFHA 4FCTA 3ZWYA 4F8JA 1SQGA 5MFPA 1TKCA 1TYEB 3ZW8A 1E0JA 4ON9A 2I2DA 3EIOA 1XKQA 2TMKA 4JEIA 4W1PA 4GPAA 3WLAA 5EJ9A 3PUHA 3OU2A 3NIBA 2PSJA 2KB0A 2CXXA 3MERA 4JI1B 1QMPA 2JHFA 4EBFA 3ECSA 1NSFA 5BSUA 3STVA 3BBPA 3FLBA 4BJ5A 1Y6JA 1YRHA 2PT6A 1AHHA 5DB4A 5KJFA 2N0SA 2FPLA 3QITA 3U48A 2O19A 2NUTB 4UJ5A 4Z99A 5EN4A 4FC7A 2J7PD 2BFMA 2JFUA 2IOQA 2XWBF 1LVGA 2W2XA 5KSPA 1T5TA 4PZEA 3NEJA 2JCVA 4IIUA 2GI4A 4AMVA 4O4LB 4E08A 1DG9A 2PQ2A 3FE2A 1ELOA 2I2BA 2XGMA 2ZPUA 1SVOA 2GLTA 3B6KA 4LI3X 4PEVA 2P2CA 2YRFA 1F51E 4BGVA 4ZMSA 5LZ2A 3AJ9A 4G5SA 4NZ9A 3OTOB 1OIXA 5AXAA 3DJYA 1HKHA 3MGAA 5KAMA 1L4BA 3DE1X 5ILGA 1A97A 6ADHA 1UPBA 4RTJA 2VJBA 5EZ6B 2X2OA 2QOEA 1VSQA 5CX4A 4BBAA 4D74A 2W6JD 5E2IA 3K73O 1N6IA 2W4QA 3UC9A 3TTVA 5ADVA 1NG1A 4JDUA 4FBMA 2GCNA 1LLQA 5DCWA 1T0UA 3ETNA 3IKJA 3JS5A 3OZDA 3H1BA 4QGAA 1I01A 4PZAA 5ALRA 3SHTA 4C5AA 4D80A 1KZ6A 4J94A 3H7IA 5EOVA 3UMVA 4RU1A 1EI9A 3BHNA 1NWCA 3V7YA 4IY1A 4A0QA 1KJ8A 1C30A 2GDZA 3PK0A 2QM8A 4DSAA 1LBIA 4E94A 3ZD9A 2QIOA 4H3VA 2J5RA 3W06A 3RU2A 2JJ2D 3KYDA 1OXSC 4ODIA 4Z1OA 1Q83A 3ZCTA 2LRHA 4R8KA 2FFJA 2UZ1B 2SECE 1XXHE 1UWCA 3WRXA 4E13A 1Q7EA 1MEOA 5HZHA 2XT0A 1ATZA 1D0IA 1H3FA 1NF2A 2X15A 2D3WA 3CM0A 4JJGA 4PX2A 2H4ZA 2Y93A 3DMYA 4RK4A 4TV9A 5DP1A 1IVYA 2ERXA 3UYKA 1FDWA 4HWPA 4O2AF 3TZHA 4IP0A 1R5BA 2ODPA 4N03A 3RVNA 3EEOA 3D3JA 2RK4A 4Y2UA 4NAUA 1KJZA 1ZAKA 3TCNA 1NJ1A 2G4VA 2Q8PA 1U6JA 1UMBB 3L46A 1MDBA 3NWEA 1A82A 4P7FA 1HF3A 2YV5A 4QTZA 4O4HF 3DONA 4DQKA 5AK6A 4X6LA 5EIBD 4YT8A 2JJQA 3R3WA 2YJ6A 4V1CI 1FQOA 1J97A 5JFOA 5JNWA 1UJ5A 2UYOA 4DB4A 4YP5A 1QFJA 5K0JA 3WG9A 2Y1KA 4BFLA 1KZGB 3IDAA 1GUZA 1UXIA 2X0FA 1SVMA 3KSRA 1S3SA 1WE2A 5J4VA 4FHFA 1SU7A 2JFBA 1QK5A 2NP7A 8AT1A 2CXQA 1F2VA 1RE1A 1J22A 3HRKA 3OKCA 4UU1A 4D4GA 4XX1A 2Q2VA 3NONA 3R20A 5J2UB 2V7TA 3F6EX 1EWYA 3KE9A 4P84A 1VG1A 2GO7A 3SAJA 3BTSA 3ZCUA 1H2ZA 5FPPA 4KI7A 5JCJD 5HZMA 4TTTS 4DEYA 3WB1A 3D6TB 3OIUA 4R4JA 4C7KA 4YRKA 1BE0A 4HS9A 4ZIRA 4OL0A 4G0UA 1EE2A 3D5QA 5DGXA 3HSKA 1JEDA 1Y6QA 4MIYA 3HM2A 3LUCA 4QJIA 1SCNE 1XD9A 2ZPAA 3NAGA 5HS6A 4JROA 1LI5A 4Q9KA 3OF2A 3VX4A 2ONZA 3DGEC 1GPKA 3E7WA 3U6KA 3G2PA 5CJPA 1Q15A 4UTXA 4LJ8A 4C3UA 4OXRA 3G8AA 4V0MA 5E6UB 4CQLB 3OQMA 2PVSA 3T54A 2AD1A 3PT5A 4QUKA 2BZGA 3GQVA 3KYJB 1JJBA 3SJAA 4HQOA 1YUBA 1FUYB 4KMMA 1TT5A 3A14A 2VHYA 4HZUA 1QQ5A 4O1MA 3P5BA 2JHCA 3GVIA 2ZVJA 5AVSA 1YUNA 2FMUA 1D1QA 1VLMA 2AYXA 3HJGA 4AP6A 3A6HA 1DQSA 3LC2O 4OHXA 1PR2A 5DX0A 3FNEA 3JD3A 5JDCC 5L7YA 2GM5A 2HM7A 3X1WA 3JASA 3DBRB 3M4ZA 3P1JA 3WB2A 1MXFA 2AN5A 4KC0A 5E6RA 1EA5A 2QLJA 2PZAA 4LYJA 5AW4A 4Q4JB 4OX9B 4FKBA 4OJMX 4XDGA 4P5EA 5EJ4A 4KQ1A 4NNPA 2X14A 4EGQA 2IA5A 5JLJA 1A9XB 3PQ6A 3UJ6A 1JEYB 4XDHA 3MUEA 1IULA 3T7KA 3WK4A 1K63A 3M6XA 2IYWA 4GMGA 1I80A 4MB6A 4MZDA 3JPYA 4YRLA 4Y3UA 5TRTA 1EZ4A 2CFCA 4J4TA 1DC7A 5TQ2A 1OI7A 1WLYA 1WX1A 1YJBA 3HJCA 4X92A 2ZAYA 1BX0A 1Q77A 2G72A 2WILA 1NW6A 3R8XA 1GUYA 3U7GA 4OKSA 4YWHA 2P91A 3P9KA 3TBHA 2W58A 4ER3A 2XZOA 5BNTA 4LEIA 2F7SA 3D6NB 2X1MA 5JSQA 4YJDA 2Z4TA 2ZE5A 5HKKA 4KDRA 5KSYA 2W2OA 3G9XA 1JAYA 2X13A 2V7WA 4QGGA 2H7CA 3F97A 2GARA 2LBPA 3EWSA 3OOSA 4Q7MB 3SN6A 3VSBA 4WD3A 5JC1A 2E18A 1LJ8A 1JFTA 1R0RE 1F12A 3LNTA 2OK8A 2CEKA 1VKOA 1X80B 1ZSVA 1C4KA 3PJEA 2A0KA 4NULA 4C08A 5HRAA 1M1YE 2Q6LA 3FW1A 3PUZA 4H3KB 4TTRA 4B74A 3EZNA 3L0YA 2D7CA 4LXHA 3T5DA 4AWAA 4GP7A 3R7NA 1IBSA 4W5HA 4EENA 3UOAB 1WVMA 4AUMA 1K08A 1U3DA 3I2YX 3NEPX 5M3BA 3DZKA 1NM5A 2NUAB 2WF8A 4ZQEA 1BKSB 2CVZA 3SZLA 3UMGA 3ZDFA 5GAJA 1YCDA 4GICA 1VB3A 2FQXA 3SC4A 3TM5A 3H83A 3LBFA 2O5EA 1AK9A 2EGUA 1AQ6A 2YFQA 3Q9SA 2CE7A 3FUUA 5AT1A 4KH1A 4E3WA 4URWR 1PR4A 3MT0A 3PI7A 3H1FA 3TPCA 3AFIA 1UIMA 1GKLA 1SZCA 4OFBA 2ZPTX 3ISJA 1CP2A 2OLJA 1EFRA 3HR8A 1JFSA 5H82A 2G80A 4OYRA 4DV3B 2G0AA 4DCOA 4ENRA 1JHXA 1NRWA 1K86A 1PTKA 1THMA 2I8LA 3EQ8A 3QF4A 3DV9A 1LCIA 4XD7A 1R37A 2P0YA 2PCLA 4IDBA 4MV8A 4X44A 2JLXA 4HQ6A 3C3DA 2RGDA 1MN6A 3DVAB 1MRZA 3H8WA 3JAKB 3M4NA 2CVFA 4FONA 1DVRA 4H08A 4LGVA 1KHTA 5BPFA 4TSFA 4BO8A 2BEVA 1Y34E 2F9LA 3ECCA 1XEXB 1YH3A 3B5JA 4OLJA 1NXTA 4YRTA 2GDJA 1XMXA 2QMZA 1ES9A 2DH5A 2K2QB 4C6TB 2X8WA 4NYIQ 4EYGA 3A1SA 3BWVA 2P6PA 1CY1A 5A3SA 2ZZMA 2PHZA 1JQBA 3CN7A 3GEMA 4YGXB 4JLWA 4Q48A 3TBKA 4ECAA 4DKXA 4P53A 1JVBA 3S7ZA 2KBEA 3OSZA 1Z4PX 5G3ZA 4ACAA 3ER9A 1N25A 3OBIA 3A1VA 3HVIA 1FTSA 3FYHA 3K09A 4PG8A 3P9IA 4EABA 4DADA 4ECEA 4R7ZA 3PX7A 3LF1A 4PY2A 5HOQA 2GHTA 1QBGA 3F4LA 3G2OA 3PVCA 5B58C 2XTZA 5HJ7A 3E27A 1I10A 1XCJA 3UPUA 4RTSA 1K06A 2HLDA 3OMWA 2EW2A 2H9AA 4BFYA 1NHGA 1SVIA 3V8RA 2XMGA 2BZSA 3B2NA 3FD8A 1PX2A 1YRBA 2QRMA 3NCTA 5GVSA 1E6MA 1VFPA 1PRYA 4OH1A 1CUDA 2UYQA 1CNFA 4UAVA 4N76A 4ARAA 3GRFA 4HB2A 1W29A 3N6XA 1NI4A 1JE0A 2CLFB 3KJHA 2ZSKA 1KK1A 4D1YA 5G2OA 4TVSA 5JI3E 2H2GA 4G56A 4MRRA 1U2GC 2AN9A 1V7PC 1OREA 5J4HA 3OPMA 5CD9A 1GZHB 4M0UA 4DDHA 3SVZA 4HSGA 4GPIB 4BUCA 5AVRA 3BICA 3N9IA 1SOWA 3INTA 1X2BA 5DNUA 4QOIA 5BWLA 2JA2A 1TIBA 1U3UA 4F5ZA 5K7SA 1YMVA 3I83A 1S8FA 3CEJA 2D4HA 3GZ4A 2O8FA 2ZBEA 1T5HX 3OEHA 4GQIA 2O8CB 2DUUA 2IUFA 2G1JA 3N75A 1FP4B 1KAMA 4LYGA 5BQOA 3ZS8A 5L3QA 1SXJC 1RCFA 1BX3A 4DW8A 3PE3A 2JH8A 3PEUA 4WACA 1U5AA 3NIDB 3FZGA 3T5CA 1U3GA 2JIRA 1GUBA 1GGKA 1QB8A 1IHYA 1SUSA 3EASA 2DWUA 3PC6A 3UF0A 1HT1E 3NP7A 5KOJA 4Q7LA 3K0EA 1M8KA 2P9YA 2VWGA 3MMNA 1S2OA 2IHYA 2JFWA 3DGFC 3G5AA 1LC0A 4JC5A 1F8XA 5D85A 4DE5A 1SY7A 1XQXA 4IKEA 5LMZA 5KNBD 3EA0A 1V48A 4WCVA 2JLRA 5T67A 3B3AA 2ZYGA 5LKRA 1W1IA 1YE3A 2F64A 3WP1B 4L6CA 1A3CA 5E0OA 2BL4A 4IIJF 3PJFA 3K9QO 2QSYA 1ID1A 1MJNA 4ZO9A 4BLSA 1NF9A 1RXEA 1GGHA 1N8KA 3CW2A 3RGGA 3RG2A 1TCCA 3AETA 2OOSA 3DKIA 3LMKA 1XNJA 4WNAB 3UVEA 3TG2A 2R751 3ETHA 2UXCB 1H9BA 3IUYA 1DTWB 4HDNA 3NBFA 5IYZB 2PUGA 4LZZA 1QH8A 2GAOA 4MRMA 2O5RA 1GG5A 2G28A 2P6NA 3D8HA 2QSJA 2EEPA 3O0DA 4J0JA 4NCNA 3VSCA 1U11A 1N36B 2MU1A 1YB5A 1RIFA 4DWVA 5FBVB 1QG2A 4U00A 2QQGA 4UTOA 2VDNB 2WV9A 3JQAB 5FUWA 1Y1LA 3WTBA 4EKIA 1XZHA 5CH3A 2J0QA 2PRSA 4UHFA 3HCOA 1K8XB 2IJGX 2CFRA 4IQ0A 4X6YA 4X41A 4EHHA 2JKVA 2Q6TA 5C1BA 1RRCA 3A3KA 1MCZA 4X62B 2M6LA 1KBOA 4MV9A 3RJTA 4LRUA 4DARA 3WHIA 1RJEA 3U4HA 3KWMA 4ALIA 4FB5A 5C7IO 4EF6A 2J09A 1GDHA 2NWQA 3UJHA 2B7CA 5L4SA 1R18A 1OLUA 4JJ7A 2YZ7A 5ERYA 2D13A 2DKFA 3ETEA 3RSLA 3TCKA 4LOLA 3L92A 2HCJB 3GPIA 5C8DA 1Z4LA 3TUZC 2R3SA 2W6QA 5CVJA 5H4HA 2H2DA 2YN0A 3DO5A 4C4PA 5CA1B 2GKOA 4MYHA 2VT7A 3AF2A 4JI6B 4CCYA 5KYXB 2A9OA 1G6KA 3KKNA 3OPYI 4Q6BA 3ZZNA 3ONFA 1AMNA 3F4KA 5HDQA 2AZMA 1LS6A 2DUNA 2EFGA 4PYIA 2WAMA 2FZ4A 3HDJA 3PGVA 5D7BA 4NBVA 1KA9H 3S2SA 1B8UA 4W8GA 5EIAA 3T4UA 4QODA 2JI4A 4JDPA 3RVSA 3IOBA 4FCWA 2RGCA 2XODA 3NYRA 2RHMA 1W2GA 1DMRA 1QQ6A 2YNMD 3HGMA 3TGWA 3C1AA 4FZ5A 4NK5A 3ZZTA 3SYLA 3HA3A 5FT9A 5DT2A 4BMCA 2AWNA 2YVQA 4EYKA 4DBLE 4EFKA 5LXTA 3H42B 4DCCA 2BLNA 3M6WA 3T9BA 5LYYA 5FPYA 4ZN6A 1A4RA 4IDEA 4NARA 3G9ZA 3PCRB 2FWNA 3B13B 3P2EA 3MOGA 1RHRA 2W6JA 4GX0A 3EPJA 3WNCA 2HLHA 1SUWA 4C7OB 1E3MA 1IOWA 2AEFA 3ZBTA 1YC2A 4HX2A 4I4NA 4EG6A 1B76A 1N9GA 2DLDA 3PR2B 4MQ4A 4MPJA 4K0KB 3KJFA 3RVMA 3WOVA 4UXJA 4BGDA 1JLHA 1IH8A 1N0UA 4AZVA 4P7JA 3V4VB 1BROA 1ETUA 4GI2A 2C7RA 2RHRA 4L57A 5GGXA 5JBNA 1PEDA 3V42A 5GTDA 1K5HA 2J5KA 2NV0A 4BLTA 3LFTA 3LOPA 1WB5A 4LZOA 4FS8A 5DNVA 2OENG 4AKEA 3V2GA 4B73A 1SXJD 4FYIA 2V7GA 4PN7A 5J2UA 2PL1A 4GR5A 1UKVY 2VDPB 1HQKA 1IJFA 4JIMA 1BNCA 4QECA 3BMXA 1U8CB 1M6YA 1KYWA 1RW4A 2Y6UA 4MUXA 1ONPA 5CNIA 4A0RA 1BMFD 1XAGA 1C7RA 1A2OA 2CE2X 3CLSC 3EGOA 3AW8A 5A03A 2GESA 2ZM5A 4R3NA 2Y9MB 1QO0D 3O1HB 2CCJA 3R7BA 3IPRA 2Z8XA 4MUIA 3N2GA 4NBSA 2JBAA 3B9PA 5EC8A 4Z7NB 4UM7A 3EYAA 5TMDA 3X1XA 1XZQA 3CX6A 3C43A 1ZBQA 3BHMA 3FPLA 4E5VA 1JLMA 1G6Q1 1MT3A 1FS6A 4GYYA 3UG6A 1VMDA 4CL3A 2XPCA 4FGUA 4JN6B 3CTPA 2GKGA 2NV2B 4CM3A 5IF9A 5IWCA 2YQZA 2A9PA 2WWVD 4GOJA 2E5LB 1NQTA 3EZYA 3IALA 2CJYA 3WKAA 5T4FA 2Y1CA 1JKJB 2OCXA 2EZTA 3EY4A 3MCVA 4HTFA 2VRNA 2IPXA 2WM8A 3IEUA 3LOUA 1KF0A 4G41A 4CCWA 3CEPB 3W9SA 3LUHA 4JAVC 1J25A 2O2ZA 1T6XA 5A6SB 1ZQ1A 1I2MA 3VUFA 2IODA 2FHPA 1EBUA 3ZLBA 3CN9A 4AY2A 2MINB 3P9PA 1F5SA 2JFFA 1OT5A 4JI2B 3LRTA 3PBKA 1F9EA 5E4FA 1UOPA 5JTUA 5DNYB 3H2HA 5I7OA 4ISCA 1QANA 4QPNA 4HAXA 1I4TD 4LV5B 4XSGA 1YO6A 1GTZA 2VOJA 3VR4D 1IYZA 3RKUA 5A4KA 2WTNA 1GT91 4NDNE 3EY9A 5AHWA 5C4IA 4EQ6B 1XQ1A 5ALFA 2Q3EA 1CZNA 1T0HB 2H4YA 10MHA 5HXAA 4OQQA 2O7QA 3AHCA 3V4OA 3VR4H 2WM3A 2B5OA 4ZT2A 1HT0A 3QYAA 2BUAA 4DPKA 4R69A 2FE1A 2F8LA 1EP3B 3C1OA 4UREA 3MOIA 3SZRA 4ITRC 1ZR4A 2BEWA 4HMOA 4CF5A 2QJFA 4JYAB 4Y6SA 5A3QA 1A8IA 3GJRA 1LVHA 2PKEA 3A1WA 1YJCA 2H2WA 3FPFA 4FKMA 4G9GA 3T1VA 1CF4A 1D9XA 5KJ6A 1S1MA 1H3NA 2HF7A 1S96A 3TZCA 3U17A 4LQDA 3VAAA 1E9VA 4GYJA 1KETA 4GI3A 1KDRA 4F4HA 4DLVA 3AGQA 4LE1A 1L5NA 3RVKA 3Q8MA 1H2FA 2IVZA 3SYKA 5HIAA 1MU0A 4Y0VA 5K0BA 1E99A 5EP2A 3R8CA 4IL5A 3JD4A 3P4UA 3DG9A 2X6TA 4PWYA 4QIHA 5KYKA 2JK0A 1LNZA 2HZBA 3VNQA 4K6HA 3IAS6 4L0MA 4Z9FA 4TOIA 2VSQA 1F5NA 2EKPA 2C2OA 2J08A 3AY7A 4DUGA 4CIYA 3FTEA 2ZJOA 1E1CB 4OQDA 5E3IA 2PLNA 1YIDA 5EWMB 1HFJA 3M70A 4LHWA 3TDKA 1SUPA 1Q5PA 3RUIA 2GNOA 3IVAA 4OSEA 16PKA 4Y67A 3W8DA 2JIMA 5DBEX 2VYNA 2WMNB 1KBQA 2QL5A 2Q29A 2X0NA 4CEIA 1VIYA 4X1KB 1XF1A 3GEEA 3JQGA 2QROA 4KW7A 3EARA 3DZFA 3ORQA 5IAKA 3IAM6 4KFTA 1NFQA 3WMXA 1V1MB 1G98A 1LK0A 3X1MA 1O9HA 4TUYF 2P69A 4URHA 3AIKA 3PZRA 4RHXA 3O8NA 3GGGA 1EWTA 1D2RA 2EJVA 1B93A 3A3OA 5P8WA 1UPXA 3VFDA 3NHAA 3FWKA 4JYMA 1U8ZA 5K0NA 1S9HA 3B12A 3L49A 4Z1MA 2JHGA 1V5GA 2OQIA 3OZ7A 4YV7A 1IBLB 1NN3A 2W6ZA 4UXIA 2J59A 3SSAA 1P2GA 3K1TA 2JI6A 4OY3A 3IIIA 3A1TA 3PKZA 1XNRB 3ZWMA 2G5PA 5HQTA 3AB3A 5I47A 1O2DA 5DLEA 3THWA 4ZAWA 1SUFA 4JMPA 4CKXA 4ZYVA 1X7YA 3IH5A 3OEEA 4DV1B 3GJTA 2HK9A 2FUEA 3LV8A 2O0HA 4ZYXA 1II9A 2FF7A 5B3JA 1HKUA 2EW1A 4YMIA 5CA1F 2ZQZA 1C30B 3OOJA 5KOYA 3DSRA 2VYFA 5DLDA 1LDNA 1KARA 1A9TA 2ZJYA 1P5FA 4UD2A 1WXEA 4C0JA 3PD7A 2GXAA 4IPTA 4TYPA 4DT1A 3B1ZA 2FWPA 1E9CA 1Z5VA 5DXFA 1L1RA 4GRDA 1G63A 3EEYA 2BF7A 3EIXA 4TLEA 5BW5A 4Q82A 3ESXA 3DVRX 5DFAA 5F2KA 4PGAA 3BMOB 4XYBA 4NMHA 3LQQA 4TT3A 3UN1A 1YHZA 1AZSC 4OLFA 5SY9A 5KWIA 4D8TA 1DADA 1QZTA 3ZN2A 3GFQA 1LDBA 4R1PA 3KKLA 5KTOA 2C0PA 4OHYA 3K5PA 5AXCA 5JS7A 1U0RA 1HDXA 2HLNA 2OHFA 1W5EA 2ZRFA 2H59A 3KQSA 1D5WA 2Z2YA 2B94A 1QFZA 3KZVA 5JYBA 2QGFA 2O8CA 4ZCMA 2WWYA 1R0KA 2ZAGA 2W93A 4HZUB 3PUYA 3GJXC 5EE3A 2CF6A 4GT1A 1ANKA 2CLLB 3ST7A 1H2YA 1V2GA 4EAQA 4IMPA 4AFNA 2WK1A 2J45A 5E9AA 3F8SA 1XRQA 4Z0NA 1Z75A 1TKAA 4MJXA 4RIIA 4EJMA 2YS7A 3HUEA 2BEUB 1EZ1A 1QF7A 2YXNA 1MRSA 1ZGCA 4NBWA 4RPHA 4G5HA 4P80A 5EEHA 5H4GA 1FJXA 2EJTA 2EAUA 1GFZA 4BO7A 1OY1A 1QNLA 1J2UA 2H00A 2HLPA 1CJBA 2RE8A 1KDPA 1PL7A 4EPWA 4KZPA 2VATA 4TSRA 3KZ1E 3OWHA 1SUEA 3DUWA 5AKEA 3AKEA 2HDWA 5CAEA 5JPDA 4UATA 5ALGA 1L6IA 1NASA 2I2AA 2QB5A 1F2UB 3EJ6A 2Z2ZA 2RHLA 3OE7D 1K9SA 2CJPA 4JVSB 3U6BA 4KR3A 3EJWA 5EZYF 2VJMB 3D2AA 5J5CA 4CUZA 3CF2A 1TUBA 4XQ9A 1QR2A 2BJHA 1DPFA 3VNSA 5IM4F 4EY4A 5ALDA 3RADC 2YWJA 3RB8A 2PGIA 2Z95A 2FJPA 2AYZA 4MS3B 1CRZA 9LDTA 3ZJYA 5JDIA 2DRIA 1VM6A 4JB3A 2ZJFA 1YUMA 2ZBFA 4W1RA 4JWKA 2Z98A 1V8PA 2WAYA 3IVRA 4M9CA 4YBRA 1MZPA 2IEYA 2JJ1D 4F4CA 1EWVA 1R0CA 3PUKA 2HOQA 4NYIR 3JY6A 4W1QA 1JTVA 1Z68A 2Q9BA 1HY3A 1ZL0A 4BVGA 4M22A 4Y1RB 2BGWA 2D62A 3ZWNA 5HIIA 4DJ5X 4BO4A 3IT3A 2WU3A 5DCYA 2ISQA 4JBLA 3KLOA 3QX9A 3SKYA 4DR1B 4FR0A 3T5MA 2H29A 2VYND 1LRLA 3U40A 3WNBA 2HCBA 2XYVA 3I28A 4DV4B 2B7BA 2ZUVA 2ZYWX 4B3FX 1OFTA 1D1SA 4A0SA 2HRRA 3N8NA 3LCCA 2OFWA 4UZEA 1HC7A 3WNZA 1P1JA 3L84A 5DX8A 1E1NA 1WF3A 1UUFA 1QWSA 2BZ0A 4KFUA 1IDOA 5FTLA 4JVOA 4YX9A 1Y5RA 1YJ8A 1OBVA 2C2MA 2X5JO 3PDJA 5G4KA 5T4BA 3LIPA 3T3HA 2R8RA 4ZZ2A 3O21A 4DANA 2NM0A 4AJEA 1XTQA 1R0LA 1SCQA 1U9CA 1SBQA 2AOTA 2FZKA 3UICA 2XCLA 2XVAA 4U2DA 2Q07A 3DAGA 3UHOA 3RANA 1Q3TA 2NPFA 1GPYA 4U1RA 2IS1A 4FVTA 4BCDA 3D2BA 3LXMA 1UDRA 4H0NA 1HLPA 3UJDA 5F98A 1UBTS 3OCUA 4EY7A 1W88A 4OU5A 1DC8A 2WVHA 1YRQA 3Q3EA 2G8NA 3RRXA 2PU5A 3SJBA 4ZKEA 4LJ5A 2JGKA 3O95A 4BO3A 3L8ZA 4DHEA 4UM5A 4Y1GA 1EESA 1Y4ZA 4ND4A 1U3CA 5LYJA 4DGQA 1VTKA 1IY1A 3WZLA 1L4NA 1IWPB 1HDYA 2H4HA 2IOFK 2A9KA 4JBHA 4CU2A 4I08A 1OXVA 3N2GB 1QORA 3NCHA 5LZ5A 3WB9A 1US8A 1OU0A 4KYTA 4OI4A 4GX5A 4QO8A 1QF9A 5G53C 1RAFA 4YUXA 1N5JA 3ILHA 1NC3A 4UVEA 3IT1A 5SYAA 3SM9A 2OV1A 4E2YA 4CMKA 4OOFA 2ZI4A 2Z9DA 5DIZA 1U5BB 4WT7A 2R1VB 5IEJA 4Y2VA 1JEJA 1EXNA 3OJFA 5FEMA 3RIXA 3U3DA 4WLVA 5AOAA 2QAGA 4KMSA 1KMMA 4IX1A 3HB7A 3NNNA 4TYQA 2WHPB 2B37A 5DYGA 4RVDA 4I5GA 1ODKA 2AQKA 4CTJA 4V3CA 2KMLA 4EI9A 3QHPA 4FJ2A 4WW0A 4BQFA 1DKQA 3NPMA 3A4LA 3OPVA 3Q7PA 3W3AH 4EK9A 2XUOA 2YCBA 1NPTO 2FPRA 4Q3BA 1ZN9A 1XZMA 2QG6A 1BD3A 1CD5A 1XA3A 2FWJA 3O3OB 3OM0A 4I9UA 5EJFA 5GONB 3ZVRA 4EMUA 4YAGA 5AK3A 2H2AA 3JASB 3SWWA 4TSKA 4TTSA 4XASA 4ZP1A 2IV7A 3W79A 4LPKA 2CBZA 1C80A 4B83A 4WPGA 4E09A 4Y2XA 2P9BA 2XUZA 2P68A 1G6HA 3GV0A 4FFVA 4Y7CA 1WU7A 3OLXA