2FW1A

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium acetobacter aceti, at ph 8.5
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Biochemical and Structural Studies of N(5)-Carboxyaminoimidazole Ribonucleotide Mutase from the Acidophilic Bacterium Acetobacter aceti.
pubmed doi rcsb
source organism Acetobacter aceti
total genus 51
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2fw1A00
4YCCA 1D7AA 2H31A 2FW9A 1XMPA 5CVTA 2FWAA 4YCBA 1O4VA 2NSJA 4AY4A 3LP6A 2NSHA 3KUUA 2FWJA 4ZC8A 4JA0A 5CLFA 4Z7JA 3TRHA 3ORSA 4ZK2A 2FW7A 4B4KA 5CLHA 3RG8A 2FW1A 2FWBA 5C5DA 2FWIA 2NSLA 2FW6A 4ZMBA 5BOSB 4YCJA 3RGGA 4YCDA 5BORA 5CLJA 5CTJA 5CLGA 2YWXA 3OPQA 5BOSA 3OOWA 4ZJYA 1QCZA 2FW8A 2ATEA 4AY3A 4GRDA 1U11A 5CLIA 2FWPA
chains in the Genus database with same CATH superfamily
2EP8A 3AQIA 3DQQA 3HFRA 3JVVA 4N7RA 3ZCXA 1QOZA 3NDJA 4HO1X 4N8SA 4S1OA 4A8JA 1NHWA 2BONA 2GH1A 3I39X 5JUWA 4F3TA 2DTDA 2QTRA 3TI9A 2R7AA 1R3UA 4BVEA 4LFAB 1TECE 4INJA 1G8HA 3RGWS 1R00A 3TRKA 1U5BA 1N5LA 4NZOA 4BP9A 1B41A 1T26A 1JLMA 1Y98A 4DCCA 4AZ3B 2YNMA 2CXNA 5G4KA 4DIMA 1O0SA 4I6GA 4QYTA 3W2IA 5DN6D 4YUVA 2FPGB 1XMVA 4D0LB 2BTQB 4J9VA 1S89A 3BJIC 1NMQA 1L2TA 2HWYA 3L04A 2H7CA 2EFYA 5IARA 2YWFA 3RS2A 1Y9EA 1KDOA 1ZBQA 2RIPA 4WE3A 1C2YA 2J59A 4AXXA 2CYAA 3UHAA 4B3SB 2ADOA 1FXWA 5D8DA 2HJVA 5KNDD 1U9CA 3F49S 2HNKA 1NUSA 2W11A 3BWMA 2OK8A 2QL7A 1M8GA 3RQSA 3OHMA 4FEAA 3MS4A 1KVTA 2PSHA 4DLYA 4CQNA 5HFNA 4LWPA 1CY2A 3O9ZA 3D3EA 1TDJA 1CF2O 1PU2A 2QD1A 2LCFA 3LT2A 3N59A 3QF4A 4PHGA 1Q20A 1LPSA 2RB5A 8ABPA 4COKA 4F3RA 1WUJS 3LPDA 1Z3CA 4TSFD 1Y5LA 2I5PO 2J6BA 1VIVA 1XZQA 4Q15A 3ZDFA 3WAGA 3AY0A 1BVUA 1JFLA 2C7QA 3OBBA 3PUHA 1TLTA 2OG2A 4JBYA 1IG3A 3KKMA 5BN5B 4BUJA 1EXNA 1XU4A 3FPLA 3HNPA 2OLKA 4M7WA 1KQGA 5ALLA 4RMJA 1RYZA 4MVCA 3BIWA 4NG4A 3ZIAA 1JBEA 3ER6A 3K6KA 4IXNA 3RVNA 2G9ZA 5A7HA 1XJCA 3V8BA 1DAHA 3AJAA 3E9QA 4FFLA 3KYIB 4LNAA 2ZETA 3OMWA 4X85A 5EIBC 3UAOA 1VPTA 1AT1A 2O8FB 4YRJA 2ZSAA 5H5JA 5EIFA 2XXBA 3DFMA 2JLQA 5JAMA 2YHIB 3C6YA 4GG1A 4UPVA 3A3YA 4LE0A 3CT6A 4L9AA 4EW3A 2HQBA 3UJDA 1A5AB 3ABRB 1F7UA 1U1DA 3KKQA 4RWEA 2ZU6A 2V7BA 3FB1A 5M04A 2ASVA 2XUAA 3AVUA 4TQUS 3NYRA 3EYWA 4A5OA 1YF3A 4KO4S 1ZK4A 5T4HA 2QD5A 3NYIA 3ND6A 3TZKA 3AHEA 5FPPA 3WNQA 4BMZA 1THMA 4F5YA 1CNFA 3WV5A 2DQYA 1UBOS 1GFZA 1XDZA 1U8FO 3ZVRA 3PFNA 5GOTA 2ZJZA 1TJ3A 3CNBA 3SU8A 3NHZA 4DQDA 4HXYA 2BLLA 4Y8VA 1SBCA 1TVEA 3VPSA 4B7AA 3V7YA 5CVDA 1U6IA 1XQWA 2FW7A 4Q48A 4GNKA 5EHNA 1Q44A 4EL5A 3S2YA 2Q5OA 2VQDA 5IF3A 5FORA 2XRFA 2A4MA 1IN5A 3A4TA 4X8MA 3OU6A 4QG7A 2VYVA 5LNK1 3JAWA 2HM7A 4J8PA 1Y8AA 2H4FA 4UAGA 4JYAB 3ZDQA 1CV2A 1X0VA 2ONCA 4F5WA 2YOHA 1JQBA 3UWMA 3BT7A 3UHOA 1QHEA 5JHGB 1K0UA 1N2EA 2FEMA 2GZ2A 2W2LA 5DIZA 3EDOA 4JODA 2BZSA 2I7XA 4AQDA 4JBNA 3CJTA 5LL6P 1Y1RA 1JAHA 5J5VA 1KYTA 2H31A 3FWHA 3JRWA 2W00A 4ALMA 3KUKA 3TM4A 3T9EA 1T15A 4NY1A 2Y1LA 1JE1A 1PP4A 3OPYI 3GNQA 3P45A 3D6TB 4OQ4A 1U6JA 4PAWA 1MENA 4FDUA 5FXMA 1AMNA 3VKWA 1LI7A 1OZFA 2VRWA 3GDGA 4DUYB 4UDNA 3UUGA 3II6X 3MD9A 3C3PA 4YROA 2DH6A 2GD6A 2OAGA 4FCCA 3U4DA 1JYFA 3BS4A 3ZV3A 4ER6A 1EUDB 1GTJ1 4DR1B 1JG4A 1VECA 3RVQA 3R2JA 1OH5A 2D5LA 4HN2A 4BQEA 3MUNA 1UMKA 3V48A 4EGJA 1WBBA 4I8XA 5MGBA 4DZZA 2NUAA 5ICEA 3EA4A 3ZZ1A 4EMBA 1XAHA 3ZTTA 2HLPA 1JQEA 1YJ5A 4I14A 4GM0A 4ZAWA 3KKEA 1XNGA 2JFNA 4Q1DA 3SEAA 2DR0A 1TU0A 2IOFK 3G2PA 1TGVA 3JQEA 1JG3A 2ZVPX 1QMGA 2J0VA 3GCZA 1M5UA 3KZCA 3PE3A 4TMZA 4BFWA 5BRJA 1CRPA 1ZUIA 1ZIPA 1U80A 2I3BA 1MV8A 3GV0A 3THSA 4HGPA 4O5AA 3MS7A 3B6ZA 5REQB 3FOAA 2E0IA 4M53A 5AIAA 1N6OA 1S2GA 2UYHA 2X22A 5DSXA 1BQ3A 1WDMA 1V5IA 3GAMA 5C51B 3I6QA 4FLMA 4M8NE 3T5CA 5K3DA 1R0ZA 3MCTA 4QOSA 1E0JA 1B73A 1JIKA 4PFQA 1NVDA 3F8SA 4ZRDA 5C8XA 1BDMA 4HNUA 4A8JB 1C2TA 1SKYB 3DZBA 4WCDA 3D6AA 3HFSA 3URKA 2QENA 1E7SA 1EGQA 1RXEA 3BEDA 4PLVA 1X7DA 4ENSA 2KQUA 4E08A 4CTNA 1K75A 1GZ3A 1VC2A 1YS6A 4DS3A 5COBA 2X0FA 1O7JA 2MSCB 2O7VA 3H5IA 3TJZA 4BNWA 3U5ZB 4MUJA 3N8HA 4S1TA 3ZW8A 4X7MA 2XV1A 1AUOA 2ZB7A 2G72A 3N76A 4GI2A 1EFVA 4LRTB 1NFQA 3RIXA 4GZ3A 5K8TA 2WZDA 4Q66C 1FLVA 5JLAA 2Q4TA 2QJTA 3IA7A 4RZSA 1QIIA 3DBRA 1PIWA 3OZWA 4I1YA 5EOVA 4BC0A 4Z4IA 3K2QA 1EHCA 1WMFA 3BMNB 4RF2A 1O97D 4BX8A 2B2NA 5K8IA 4JHLA 1JIXA 1JS1X 3S81A 5E7IA 1UMDA 1EK6A 2AI3A 3PC6A 3EXHA 2GCNA 2HO5A 1UBEA 1YU6A 3FGOA 1AKMA 1Z73A 2BBWA 4W5TA 1CJVC 2BGNA 5IUKC 3DHWC 2JA1A 3R23A 3D5TA 3TBKA 2QS9A 3QF4B 3CIOA 3CZQA 2VJPA 3L40A 3M5DA 3L01A 2GN1A 1KA9H 2HLHA 4L57A 4YCMA 3C85A 3RUCA 3N58A 4J4BA 5FA6A 4YRPA 1JKXA 4CTOA 2B99A 5LQUA 1KWKA 2ZCVA 1B42A 3LF1A 4HUQA 3TXAA 1O54A 3QP9A 4K03A 2Q4EA 4NV1A 1A5ZA 4YAFA 3U1BA 4MKGA 2HF7A 5DRYA 3QA9A 5BQPA 1E2IA 1AKYA 2WPNA 1CJTC 2WTEA 4ZI7F 2H4ZA 1EP2B 1WZNA 3WFZA 1MGPA 2X9LA 4URWR 1SU7A 2Y92A 2VUSA 3QMWA 5F3WB 4POOA 2MU1A 2GAAA 5HW0A 2I4IA 2O0KA 4Q7KA 4KP7A 5C1IA 4IQFA 1UT5A 1UBMS 3LQQA 1N5JA 3VAZA 1YB2A 3AY6A 4AZ0A 1ZXBA 2XLCA 3TL3A 3AESB 4QDUA 2V97A 5HZKA 3QBDA 1X3SA 2CVPA 2Q4DA 1IBKB 2JAQA 3B85A 3C1UA 3VV3A 1G8JA 4TV8F 1DAOA 4MLDA 5HWSA 4HZUA 4MTCA 2H1SA 1XX6A 4XRRA 3JQ9C 4M1YA 4HNAA 5ISMA 1GKIA 3E3NA 4WTOA 3UCXA 4B4WA 1TVKB 1NUQA 1BOOA 1ZGHA 3GXOA 4HQFA 5ALTA 3ZXUB 4E3ZA 5I48A 1P5JA 2Y1FA 1FVXA 1E79A 5E4YA 3MMSA 4DEVA 4PYJA 3AP1A 1JQJC 4BLTA 2B69A 2QRVA 4QXOA 4YJFA 3ACBA 4LY0A 2EL9A 1C1XB 4CIYA 3OZDA 4C30A 5BNTA 4H18A 4UOEA 5CIWA 3O8LA 4B09A 5U9CA 2H3HA 4P7JA 4TS1A 3IELA 2YDYA 3MRVA 3O3OB 5CU7A 3RBAA 4UQLA 3ZCPA 3G7SA 4HH0A 3BB4A 2IUEA 3DZFA 4DQVA 4FEYA 1DOAA 4JFAA 2VWHA 1GNQA 5ITVA 4YN3A 3HGQA 2FVXA 4HAYA 2ODPA 3DDNA 1ODCA 3A1SA 4MKFA 1JB9A 4JBHA 5HS6A 4DJEC 5DIFA 3K1ZA 2IEZA 3PLRA 2PFKA 3HXMA 3AETA 3GLHA 1Y5RA 1OJ7A 2TSYB 4QLBA 3KDAA 2CMKA 1QR2A 1WMAA 2RKBA 1DEAA 4MCHA 1OFVA 3K2EA 2C5HA 4QBGB 4B4OA 2PKQP 1IVNA 2CEKA 4ZKDA 1XLTC 3L8CA 1U3CA 1DC8A 2N0SA 4JJKA 4Q4AA 2WJWA 2B1JA 3LW8A 2QX7A 3R09A 5DI3A 1FFHA 2PGAA 1P2VA 2XNCA 5E1BA 5EMMA 2IV7A 2JCGA 4DLUA 3GRKA 5CFPA 3ZHXA 5LFAA 2PX0A 2OAQ1 4CCYA 1MRZA 4OEHA 5KKNB 1MXHA 2A94A 1J2JA 2I3AA 4DTCA 1PZMA 3EODA 4AJ9A 3JWGA 5EG5A 3LYAA 4N0PA 4FNOA 4WKPA 2PQ0A 3TLZA 1ZNZA 4UAJA 3AI3A 4IKOA 5HQ3A 2F1JA 1UK8A 3R74A 1CU1A 1N2JA 2HT1A 1YU9A 1XBTA 3IKJA 4ETMA 4H7HA 1RSZA 1NW9B 1T91A 4BVFA 3NBZC 1V37A 2WF6A 4KBGA 1ZLXA 1G2IA 1R88A 1JX6A 2BPOA 3A6HA 4S3MA 3RIEA 1T5DX 3V8RA 3OE5A 2O54A 2PNFA 1UBTS 3B3GA 2VIIA 3D7NA 3H5OA 4XIFA 1GDDA 5CNKA 3X0DA 2CJFA 4MICA 5CRIA 3DYIA 5TF4A 1JTVA 3DEJA 2VHEA 1YJXA 5DNEA 3WBBA 4M1WA 1GKKA 3JWJA 5EE5B 1WX1A 3NOVA 3WFIA 4PZLA 3EOAI 4EKDA 1JHDA 1Z83A 2CN1A 3V8VA 2BFPA 3TGWA 1T1GA 4AECA 2F1IA 2QR3A 2XEDA 4YRNA 2NP7A 1OUMA 4Y2SA 4JD5A 1Y81A 4BO9A 2BGUA 3K1AA 4FSHA 1WDTA 3JRNA 5ULLA 1P5ZB 1NHGA 3NWJA 2Q6OA 3PV0A 3TXXA 1WF6A 2XTAA 3UMFA 4BCDA 3A4IA 4CF6A 4MRSA 4BN0A 3ANLA 3EEIA 4FSXA 4CNBA 1I3KA 1VDMA 3IO5A 5FT9A 2C84A 4TXJA 1SMKA 3ETJA 2O1SA 4R69A 4YRMA 1MD9A 4PZCA 3I0MA 2XVZA 4L50A 1HLPA 1EFVB 2G76A 2IW3A 2WYUA 2FV8A 2GCOB 1T2NA 2Y8EA 3WHLA 4OCZA 1ISHA 1Z0AA 5HF6A 1ACLA 1YSCA 3FFAA 3HCPA 4J6EA 3TLAA 3F5FA 3W5HA 4M22A 1QH9A 1PSZA 2B3DA 3BB1A 2WM3A 3EXHB 1LNZA 1Y42X 1N6HA 2TYSB 4M8SA 4A91A 5K3OA 2C5BA 1SJ9A 3NBKA 2RC6A 3ZHZA 1NOKA 4DUPA 3RNLA 4F97A 5E4TA 3HB1A 1KYXA 1MOZA 3A3OA 3WG9A 1PG0A 1FP4A 2ZBDA 1K7CA 4MDHA 2J3DA 1Z15A 4KSCA 5GM2A 1VE6A 4TMFA 1RI1A 1YCGA 4B40A 4MVJG 3CEMA 1EX1A 5EE1A 2FN9A 4LOJA 1N2HA 4HUQB 5KYVA 3BWVA 1M2VB 3I32A 4EJ0A 2YC4C 4UM9B 4FZVA 5KPDA 5BN4B 3AL0C 5LLSA 1F0PA 3AR5A 3CE6A 4MW6A 5HGJA 3SSNA 3U49A 5KOYA 5G0UA 1Z06A 3A27A 4G56A 3OBIA 4OX9B 6PFKA 4H1VA 3F73A 4RHUA 2OO7A 3O8NA 4PX9A 2OSBA 4ARZB 1B0PA 3R6LA 2RGXA 3NIDB 4UVDA 1E7MA 2AOUB 4WCFC 5IPFA 3AFIA 2YC2C 2ZI4A 3PLNA 2C8KA 2ZSIA 3I92A 3FGNA 3DE3X 5EJ7A 5F7XA 4Q9DA 3NKLA 2B35A 4DLTA 1K3TA 1Z6YA 2DJIA 3KEGA 2C9YA 3V6MA 3AR2A 2A33A 2ZIZA 4L6IA 1HX7A 5A3VA 3I23A 4AP6A 3OQIA 2ATVA 4IZ6A 4BPRA 1MDBA 2DT8A 4ZOAA 3HB5X 1DAIA 4RPJA 5EZYF 3WLOA 1R16A 4C01A 4HZUB 4LY9A 2R6DA 1ZN7A 2Y27A 5A62A 3RC3A 3WLSA 5KU7A 5ALRA 721PA 2O3QA 3EGXA 1UJMA 3BXPA 3K15A 4FILA 4M0LA 2XDWA 3NOQA 4MMXB 4ENUA 4BX3A 3DXFA 4W82A 4BNGA 3L46A 2GTHA 2OLJA 4D5EA 4LNHA 4X3PA 3ZXSA 3RRMA 1Z2OX 3DTNA 3OKCA 3NKVA 2I7VA 2P68A 5FOSA 4KRYA 4N0QA 2FWJA 3P0HA 4XWGA 4DA7A 1FDVA 1E64A 3IEXA 3WYBA 3OM8A 3X43A 4FYMA 5M5BA 2C0QA 3SHQA 2EW1A 3EUEA 3A1NA 3LX8A 4I3FA 3ITEA 1DB3A 2JLBA 2GCIA 2EQBA 4NXMB 1ICEA 3L8ZA 1RWBA 1V1RB 5IXSA 4DM4A 4YVFA 3PC3A 3H3FA 3Q9SA 3H7IA 3TQCA 3TEFA 2V7VA 4F4HA 4FSDA 3DQPA 4V3CA 3SHWA 5B5SA 5JNVA 4BE7B 2FWNA 4QWWA 2NTJA 1JHRA 4NESA 1J56A 5CM9C 4B2PA 5CCEA 2PZEA 3OPVA 1J06A 5HMMA 2FF5A 4AJ4A 2Z2ZA 2FWPA 2WHXA 3E3AA 3C3KA 5KYTA 3I58A 4AJ2A 2GCPA 3CKKA 3DT6A 1Q0RA 3A58B 2JBAA 1TW3A 2X58A 4OL0A 5F4BA 3AETB 4G8CA 4NULA 3BIJA 4MW0A 2WUEA 3C3AA 3AWDA 4DA8A 1U0JA 3WMRA 1RWWA 2PBRA 2YV5A 4JLKA 4YDRA 2ENWA 5BW6B 3K70C 2VBIA 3B3JA 1UFKA 3PHJA 2OA0A 2ZW9A 3RS9A 1V71A 4DR6B 1NLUA 4U2KA 1WO8A 1KOLA 1JEQA 3WGHA 1BKSB 1GNTA 1TK9A 1UBNA 3K31A 4YCAA 4J4TA 3RGGA 4JLOA 4CCYB 5ERGB 4F4JA 3F46A 2XBLA 4M9XA 3U3JA 2YZ2A 4BB9A 3EISA 4IPTA 1SIUA 5DM60 1Z63A 4DCSA 2PS3A 2WIAA 4TTIA 5JNLA 2E1RA 5HQ3B 4ZAVA 3Q6NA 5A3QA 1D7AA 3GFPA 3FWYA 3HA7A 1N4AA 2ZR8A 3RR2A 2FN3A 2ZRFA 3K30A 1R10A 3LW7A 3OM0A 5AHRA 5DNDA 4E5SA 1GSOA 3QEAZ 3VH4A 3P96A 4CMKA 2C03A 3A3KA 1GN9A 2I2BA 3RU9A 1F7VA 3LG2A 2ZPTX 2J33A 1RTKA 4B81A 4JDUA 4ZA2A 2A1IA 2V7UA 4O29A 3H8WA 1K7EB 1DO2A 3IEUA 4IIJB 1FMTA 1KEUA 2D4AA 3I6ZA 1IBCA 4D0NA 5AKKA 1H1LB 3QOWA 1L7NA 3C24A 4DC0A 1OVGA 5GP1A 2ZT8A 2WU1A 5IBRA 3QEBZ 3K20A 3TLBA 3Q7SA 1M1NB 5J58A 1K5HA 3VU3A 4LX0A 3DKIA 1GCAA 3IE2A 2EYQA 2UZ0A 1ONBA 3BTSA 1BFUA 3LDFA 2HYDA 3N2YA 1U2GA 4M6WA 4MIOA 5FPTA 1CTQA 1L7QA 2EEPA 4MMYB 5G4LA 1SQ6A 2PR2A 2JRLA 3V7NA 1V39A 1UJBA 4OKIA 2PX5A 5DOVA 2FR0A 4IFTA 4ZT3A 3V42A 3G2QA 1OWLA 1X80A 3B8HA 1QG6A 3RG8A 3EARA 3VOTA 2FWBA 3KVNA 2BCJQ 1B14A 2C4KA 4GC9A 2YWDA 1O96A 3BXXA 3HJTA 4QX6A 5ICCA 4WESB 1K66A 2R7NA 1R5JA 3IKLA 1D2GA 1ZHHA 5DTQA 1HA3A 1RPJA 4G84A 4ODIA 3ZDXB 1DJLA 2EJWA 3SBOA 2ICAA 1GTSA 4MROA 2ZZMA 4U2DA 1F2TA 1ZMXA 4D0RA 3IS3A 4ZQCB 1F2DA 1XCBA 3A3NA 4I66A 1E6UA 5EESA 2Q7DA 4P34A 3SYMA 4J1QA 3P2JA 2H0AA 3KC2A 3ELUA 1QJCA 4IDDA 3QBVA 2HXGA 4E1BA 4R41A 2GHQA 1YB7A 3HB4X 4UMDA 2ANBA 3IAXA 3WGMA 1E3TA 2WR8A 4V24A 4KN5A 2EHDA 2GO7A 4RNCA 1O95C 2VRCD 4WZAA 5JR3A 1D6NA 3AFNA 1PJQA 2BFBA 3Q7RA 4FN5A 2B1QA 3FMPB 2ANCA 4OSEA 4YECA 3STHA 4MS3A 1YGPA 1NAIA 3ZGNA 1ZAYA 1MN6A 1Z2CA 3DLIA 4DA4A 1DS6A 1SEVA 3LT0A 5C7IO 4O4LA 1GUYA 4F04A 2VP6A 3QVJA 4MH0R 4YRSA 1UPUA 1WLYA 3GLGB 1AKVA 1T5SA 3IXMA 4H0FA 5HCIA 2QUJA 2ZJ0A 2RB4A 1FW8A 3E05A 2XXJA 1P19A 5DGHA 2RONA 4W6QA 3GVPA 4P3KA 2PL1A 4LYGA 4JEHA 1WUHS 2WABA 5C3MA 5FUMA 1AHPA 4BV8A 2OHXA 4XWTA 2RHGB 4GL2A 1EWKA 1N2CE 1XVVA 1Y48E 2R62A 1ZONA 1T3GA 3DAOA 2UXDB 6NULA 1NBIA 4EA6A 4DKJA 1ISRA 1D4AA 3EGXB 1CRLA 4D9JA 2P35A 2BE9A 5JXHA 1UEXC 4QPNA 1B8VA 1S1MA 2EJUA 3VO9A 4DCNA 3M4XA 1C81A 1NXVA 2B5VA 2IZ1A 3IUNA 2YUIA 3LIPA 4GKAA 5B6IA 3Q7QA 1PTJA 2E9SA 3FM9A 4CM6A 4ARAA 2XJ9A 4OH7A 2I1WA 2V7GA 1KMHA 1JR3A 3AVPA 3ROGA 3VYWA 3QQ5A 3I1JA 3PJEA 2WMDA 4DBLC 3GELA 2PS1A 3ASVA 1ZU4A 3DLTA 4QEDA 5B1DA 4A0HA 3IEVA 1P4HA 3PHLA 2WIJA 5C8DA 3U56A 3P9XA 1PN3A 2QJRA 2X7JA 3TMAA 2N9UA 3ZZ0A 3OWOA 2A7XA 3L7DA 2EU8A 3QU7A 5I7UA 2KPOA 3M8KA 5IM4A 3DULA 1LZLA 1K5DA 3ZJ4A 3V8NA 3HXTA 4RD6A 2BJHA 3IYLW 1X1QA 4INOA 1XZJA 2BFOA 2DUJA 3PQ4A 2C8VA 2IS1A 1FYEA 4LQDA 3MIZA 1LQ2A 1UKZA 2QRPA 3PFBA 2XZPA 3H4MA 4B7ZA 2SNIE 4ZJZA 5BT8A 4CXMA 1WS6A 1CUFA 1QH0A 5JJCA 4D9BA 3M2TA 4HDOB 1EK2A 3CX6A 1XEWY 5E8RA 4IEFB 1A2QA 1Y4UA 1UAYA 2O2YA 1ZXLA 4V2IA 3LY8A 4R3UC 2HW8A 4D0GA 5KNCH 1CFJA 3QFCA 3SHFA 5SY6A 1VHDA 3DP9A 4LRQA 2Q3FA 2ZS7A 3QVXA 4N6GA 5MFZA 4BASA 1DQPA 4NHEA 2GHIA 1R9MA 2C42A 3KXDA 3PENA 3PXDA 2BOVA 1FFEA 2A1UA 4W7IA 5CFQA 1YS1X 3BWXA 1KYZA 1PNQA 5CDTA 3ZD7A 2GBGA 1NP3A 1Q7TA 2V5VA 3T7DA 4FT4A 3ONEA 1BS2A 1ZSVA 5DXJA 3WA7A 2GBPA 4G5XA 4IIYA 4F9EA 2I76A 1BDBA 1NVBA 2X2PA 4WCFB 4M0EA 3TSZA 5MN6A 5GY7A 1THZA 1NVWQ 5BMOA 1ZR2A 1YE8A 3J7AC 1TYAE 2F1RA 1BWSA 1Q3TA 2JLXA 1T4CB 1M6YA 3I8SA 3B1KA 4XYBA 2CLSA 5K0CA 4A26A 3ZVKA 3ZJUA 1FX0A 1HG1A 1UDCA 4LMAA 2PMEA 3M4YA 3CVOA 1ZD5A 3AB7A 3MK31 4NEHB 4PLWA 3E2PA 4NE7A 3PA8A 1DWUA 2PD4A 5FULA 4GP9A 3ORRA 3HVJA 1A7KA 2UYOA 5ALOA 2ODQA 3KKKA 4BO3A 4BLWA 1CEEA 1E99A 2OV8A 1U94A 3EGEA 4WKCA 3EIUA 1LVGA 1TQDA 3G82C 5HF5A 4ZI7B 1YKFA 1NOJA 1ZD9A 2GD1O 4GRAA 4K6GA 2VTEA 3HB7A 5GZ3A 2HSZA 4U9HS 2NTYC 1JJBA 3FOFC 1P45A 4MJ3A 4KYUA 2DBRA 1TT7A 3TG2A 1ZOPA 4RY9A 1XP8A 3B53X 5EKDA 3BORA 3RIMA 4YRCA 1OREA 4MR8A 4Q1FA 1KSGA 1X80B 3OQVA 4P7GA 5KWVA 4MPJA 1C7FA 2ZI7A 4PONA 3VR6A 4RTKA 3PRYA 3G8YA 2Z5FA 2D5IA 1O96B 4ME6A 4NICA 2ISCA 1K9VF 3O4IA 3TLYA 3ZC3A 5AVUA 5L51A 4S1WA 2HSEA 5F9FA 3Q0IA 2CE7A 4KYTA 1XRNA 4PWZA 2WKSA 2HF8A 5JC1A 4EO9A 1E6EA 2RHHA 3PR3A 4ZREA 5AKYA 4DEYA 3CZ9A 3JTMA 4KW7A 3M3DA 4YJHA 4TLCA 4RCZA 4A8PA 3T4EA 4KWIA 2O1EA 1H2RS 3ESQA 4ND6A 1HLFA 1T5TA 4UHKA 4DLPA 3AF1A 4BCBA 3LYHA 3HG7A 1NLFA 2V7WA 4HNSA 4QGBA 4B3DA 2WPDA 2C4NA 1L4LA 1OASA 4JBIA 1ZUD1 4QUAA 5EJMA 3PHIA 3TQFA 4WZAB 5FL3A 4AROA 3K70B 2XQVA 4QIHA 4CETA 4WKNA 2FE4A 1Z38A 3FNHA 4HZGA 1FU4A 4MS3B 4RGYA 1BXGA 3ZIAD 2DTEA 4FBLA 5HBRA 5BXQC 1JAZA 1VJDA 1U90A 3EXAA 4MUYA 1CVIA 1LX6A 4O4LB 3A6DA 4NKRA 4ENQA 2FW8A 4CFYA 4TT3D 3NTLA 1BOFA 3QHAA 1PLLA 2QRZA 4J1TC 3TSWA 1J9GA 1KOFA 2BP7A 3QFRA 3ZWVA 4CI0B 4MWCA 2J6HA 3S70A 5HZHA 3F5DA 2JLYA 4OI2A 1OFIA 2A9FA 3RDPA 3IDFA 5FWXA 4GBED 1EG7A 3A3PA 1I2CA 2D3TA 1KEPA 3GH3A 5B30A 1G66A 1ANKA 3WGVA 1JEEA 3DL7A 4YRZA 3USZA 1AK9A 1MMFB 1A8SA 1TZMA 2EFDB 1H5UA 3FNFA 3H7AA 4JT4A 1FE8A 2GN0A 3HUDA 4TKUB 3F7TA 4MYHA 4DLNA 2PTHA 3P2IA 3Q85A 3TIXB 3GRPA 4AMUA 5LOVB 2XD4A 1YB6A 3KXIA 3NORA 4M46A 3R75A 3WXBA 1SCUA 3KQVA 5G2OA 3L0SA 1IJEA 5EY5B 2G71A 2YTZA 1RMQA 2HDOA 3D4BA 3Q3HA 4JL5A 1OYYA 2YH2A 4YMLA 1E0SA 2HMYB 4W7SA 2I22A 3IB3A 3MWJA 4IH1A 5ALIA 4BB6A 2VYVD 1KMHB 1NXTA 4QULA 5I01A 5EJAA 4HGYA 2ZJ3A 1XRRA 1WSWA 2IPXA 2NOAA 1RAAA 4NABA 4CKYA 3WXMA 3PEFA 4ZPXA 4C0LA 2CV2A 1N2BA 4HDRA 1XYYA 3V6LA 1PEYA 2XVMA 5ILQA 4S1VA 1E1RA 4G67A 4QGSA 5IAOA 4OP1A 1X42A 1SOWA 3DVQX 2XT9A 2P91A 4R05A 1T6BY 1MH1A 4KITB 1GCIA 3JQCA 2J5KA 3R3JA 4NYJQ 1V2HE 1JUDA 4YUXA 4AX8A 5JQGA 3QEJA 2ZTLA 2H3EA 3D0KA 4DIEA 1RYFA 4WVFA 3W3AH 4DNFA 2J5BA 4PSAA 1GQFA 2JLSA 2GBLC 2WICA 4XIIA 2X2EA 5DHFA 1J0CA 1FS6A 1I0LA 3KSDO 4JROA 2BBSA 5B36A 1N2SA 1LLDA 2JIOA 3CNEA 2XTZA 5EE9A 1OZ0A 4K9DA 1TD9A 3P2OA 4N82A 5EXSA 5GVRA 4UC0A 2H2HA 4PSVA 4ALLA 1T4DA 4ASUD 2BHSA 4PZDA 1QHHA 1O2DA 3Q1LA 5DCWA 3RSOA 3P9SA 3Q3JB 3CVXA 4DDWA 1IQUA 3S2IA 3B5JA 4Q01A 4XPZA 3AF5A 4WW0A 4EFNA 1WETA 1PDWA 2AE2A 3LQFA 4O2RA 2RJOA 2QRLA 3TAUA 1RYBA 1NBOA 3CUVA 3GRYA 2VSQA 3FJOA 1MABB 1HKUA 4G0NA 4KQCA 2EW8A 4N54A 3IP1A 3U4QB 4D3DA 2H1HA 5F2EA 3ZWYA 3IKTA 2W6JA 1FP2A 2C20A 1PFUA 2HMSA 2Q3LA 2H2FA 1NF9A 3KTFA 1CQJB 2Q7XA 4L9WA 3ZLBA 4KZPA 4LJ9A 4L2IB 3ACCA 5HHTA 2WA1A 2OILA 5D00A 1EBFA 1L6IA 1HOXA 1OXMA 2XUZA 4YO8A 4D79A 5CLFA 1WEKA 4HRYA 2VBGA 4EY8A 3GGOA 3GCDA 2JGKA 3SJZA 5JMPA 2C8LA 4EI7A 1TAGA 5AT1A 2YMPA 5DMXA 5G0VA 4BBJA 2WE7A 1FQWA 1JEJA 1PW5A 4I1UA 3QIVA 3C15C 2XKJE 4D4MA 1G17A 5DOZA 3OETA 3VNQA 2P41A 1WB5A 1NN0A 3IMFA 3KZOA 3ILYA 5LDGA 4BV2A 4YXWD 2WWYA 3PJRA 5LQSA 3SM3A 3ZJVA 5LD2C 3WJAA 4KO1S 3NWOA 4GOXA 4CT0A 5KINB 5DBEX 1OU4A 5E0KB 1E1QA 1TI7A 1RWXA 2C9MA 4D92A 2PUFA 2VT2A 3CNNA 2YJ6A 2FMTA 3B38A 4BECA 1HYEA 3DLPX 3D4PA 4X95A 3DCIA 5MDHA 3OD5A 3NHLA 5D3KA 1TVMA 1KR5A 3VVBA 4ENPA 1S2IA 5BUSA 1NF2A 1OT5A 2IUTA 3D64A 1KETA 1VL8A 1FRQA 4ZVQA 5DTJA 5KVCA 2AVNA 2OKGA 2Y1GA 2FEWB 1JVBA 1ZCJA 1E1CB 1GUZA 2JANA 1XKXA 3H8SA 3LQ4A 1T0BA 4ZZ0A 5KX5F 3K0SA 4PQRA 2KBFA 3LOUA 1GNVA 2CB9A 5ALGA 3QE9Y 2ZBUA 4D9GA 2NPOA 3UTCA 3U4IA 5EZYB 1LPNA 4EVIA 2GZ3A 5D1HA 1PX2A 3WIOA 1ADGA 1STOA 4TXHA 3WWEA 2R8XA 4D56A 1PYGA 1ZIOA 2FMIA 1U2PA 4QARA 3W6UA 5UKDA 1DLJA 1TMKA 2QJFA 1YRYE 2GVZC 3OZBA 2ZYAA 1ZR4A 4RF4A 3I4FA 4E5MA 4Y2UA 5LP6A 2HJWA 4DLLA 2K6GA 3HPQA 4X8HA 3ENVA 1ZGGA 3KAPA 2W0MA 3LHSA 4FJ1A 4MP3A 4DCUA 4B3HA 5EJ5A 3FX2A 4GXQA 3OTIA 3HABA 3MTDA 4R7TA 1GG9A 3B3AA 3KKOA 3KL4A 3M3HA 3VHQA 2ZUDA 3F90A 4YQEA 4H27A 1JQKA 2D8MA 2FN7A 2ZRBA 5BT9A 1DSSG 3JZFA 3OJ0A 2IDKA 4X20A 1TL7C 1SOVA 2BI8A 2CLFB 2YR0A 5J3JA 2WKPA 1JFSA 2E5LB 4DRYA 5AKHA 4YAWA 2GN9A 1I01A 3ZK7A 3ZHVA 1C3EA 2O4CA 1GADO 4G5OA 2BP7B 3KXPA 3M4ZA 1GU7A 1H22A 1W29A 4PAMA 3WQQA 2NGRA 4NEQA 2Q3JA 5GMOA 3AVYA 2D62A 1TGYA 2GMWA 2GA9A 3NBMA 4ZO6A 4YPFA 5AVVA 3C43A 4UCQA 1MC4A 3NU1A 3P4XA 4TL8A 2YWRA 3UB4A 4DY6A 4YLGA 1HE3A 3U0BA 5E7QA 5F73A 1N3IA 1DU4A 4Y18A 5CXXA 2Z9DA 1V45E 1OTYA 2JK1A 2WW8A 4J3FA 3EDQA 1GPAA 1BEZA 4D80A 4IIUA 3R9WA 2IS4A 3GBSA 2YN2A 3PIIA 3FUXA 3ZX5A 4EKEA 2PGJA 2ZDQA 2XE8A 3ZK8A 3DAHA 4PQEA 1E3WA 1GRQA 1GQSA 2CNOA 2R5NA 3AR7A 4YK7A 3GC6A 1O03A 4LYAA 4G36A 2QQFA 1C5KA 1KQPA 4BGVA 4CF5A 7ADHA 1E61A 2AZ4A 3AEYA 3TX2A 4M89A 4CWAA 1W36C 2WSLA 3GUHA 3S1AB 2ROQA 2IPMA 1AKQA 3DMHA 1OI3A 3RFVA 3HWX1 3TECE 2YVKA 2IW1A 2FP3A 1A98A 2ZT7A 5FH9A 2ETVA 3HO6A 2RGYA 1I7SB 2VZEA 2JGFA 2X4GA 1ZHFA 1JIQA 2JFQA 1MO5A 2Q8QA 3JXEA 4RY0A 5IBCA 5AM1A 2YWGA 4HDRB 5CJ2A 3FKSD 1VJTA 3FVTA 3H84A 4M0KA 1W581 4OUDA 4QQFA 3K4HA 3EGCA 3SFZA 3V1LA 4FYXA 4O63O 1N0WA 3ZE8A 3PWKA 1R7RA 4PC2A 1Z0DA 2QF7A 1PG5A 3Q11A 5TMEA 3LVBA 3ZHQA 5LYJA 4CIWA 3FIUA 5JQGB 2E5WA 2P3SA 4PFJA 3M7IA 5JNWA 3HUTA 3KOOA 4RNDB 1DUVG 4TWRA 3EG5A 4RL4A 1OZGA 4DMHA 1MAHA 4HDMA 2HCRA 4IFIA 4RLFA 4J43A 1RZRA 1DADA 2GPWA 4OREX 3C3DA 1QC5B 1ISGA 6YASA 2HNBA 1JJIA 1NRJB 3TVTA 4HSGA 3MW8A 3DW3X 2I71A 1KMMA 1U7TA 3RWMB 3IOMA 2WB4A 3TOCA 1RD4A 4C0XA 4CMGA 2P4HX 2RGNA 2Z8YM 3JQAD 1NDQA 1EFRD 1W88B 3PD0A 1I3OA 2RG1A 2XQGA 2ZBGA 5K3SA 1NM5A 1ZGBA 3HR8A 4K5QA 3EH2A 3MC1A 3MM4A 1GHTA 1L7OA 2V7QA 2DYKA 4NX2A 4EKYA 5LBUA 1PEDA 3KSZO 2ZEJA 5JS8A 3KKZA 4MHSA 1H3NA 1O9GA 3BUSA 4HN4B 4AMYA 1H2HA 3QE3A 4FDTA 5FNVF 3ZCTA 1NP6A 4PXAA 3TZCA 2DR2A 2JFXA 3RWOA 1Q92A 5IG2A 3R7AA 4L7QA 2KYRA 2QYHA 3ZJ5A 2ZVJA 5KTYA 2QI9F 4CPDA 3QWIA 4D97A 1T5BA 1WJGA 3I5UA 4OBEA 3TVYA 4D8UA 2JGRA 3EQ2A 4C06A 2I1VB 4NNOA 4X1KB 5E3JA 1W49A 4AS1A 2XOEA 1AKUA 4G23A 3LA8A 3M83A 4FCVA 5TSDA 1E6WA 3SZUA 3UWSA 1Q1ZA 4RA9A 2W6NA 1RQPA 1CXZA 5A5DA 4CEJB 1MO3A 2BHTA 3C6BA 4KLCA 4UM5A 4Y3UA 4N41A 1QGDA 2FRDC 1UF9A 4Q21A 3TW8B 1GGEA 3GH1A 2AFVA 1NG1A 1UWCA 1I1QB 3P71T 4BEWA 4ESOA 2OENG 1PFVA 2P3LA 4WXRA 3WL5A 4H0NA 4C3VA 1S8FA 2QM7A 1DBWA 1P2TA 1KBQA 2GFHA 3IPAA 5EZQA 3ROMA 4YV2A 4PPYA 4PG4A 3ZKWB 3DL4A 1Z0ZA 2IUUA 3M2PA 1V16A 3PPIA 4HGRA 4OJYA 2EARA 4X1IB 5EEGA 3VH3A 2Y1KA 4EG4A 4TRJA 2WHRA 1N6LA 1NJ1A 1A5TA 3N86A 5JPDA 2O20A 3ZG6A 2FR8C 3RSZA 4WPGA 3DMRA 2OHIA 2X2OA 1KQ3A 1ULSA 4FZJA 3TQRA 5I7VA 2BUAA 4L02A 4XJVA 1QP0A 2WSYB 4LQ4A 4TYWA 2J3QA 3Q88A 3ZZNA 1CULC 4NQRA 1ZRSA 4RS3A 1PBNA 4BO4A 5LQMA 1S7CA 1Y7PA 4LPKA 5LP6B 5D3MA 1ZVJA 3FOCA 1HWYA 3RREA 3EBLA 4K9SA 5K6AC 4W1QA 4I08A 4YBZA 3J7TA 4XYGA 5JSHA 5CH5A 1E3EA 4W1RA 4GEGA 1JTFA 2IEIA 4L8FA 1YNOA 7MDHA 3SY8A 3K2IA 1T9GS 3WSTA 1HSZA 2C77A 5LVAA 1T13A 2R25B 4IIBA 3EVTA 1EESA 1DHRA 5C5DA 3C3BA 4X20B 1E2PA 2AN3A 4JVNA 1SVWA 3SC2A 1CRWG 1ORTA 4PO3X 5KCZA 5IT5A 4ZO7A 4IQ8A 2X8JA 4G9GA 4DLWA 5H8WA 3TE7A 3T1HB 3QLUC 2GARA 2WZBA 4MA0A 3E9NA 3NIFB 4I5DA 4RHEA 2IEBA 1EZ1A 5JH7F 1JAIA 3DO6A 1L1RA 2JZCA 2DWCA 1WUKS 1MOQA 2ZQZA 1DJPA 2UAGA 2W83A 7ABPA 1Y6GA 2PJZA 4YI3A 3DBVO 1XK6A 4ZVSA 5IM5A 5LJIA 3IEMA 3D3QA 3TW0A 5AYVA 4D8WA 3FXAA 3K9FC 4M4SA 4LC9A 1U1FA 3U3MA 3JQ8A 1U31A 1JIUA 3R7BA 1E3WB 3J81k 1VFNA 4L8YA 3W6OA 2DUWA 1W85B 3DR5A 3RRXA 4N03A 1YVRA 1ORHA 2DY0A 5KSYA 1EUQA 1M7HA 4RKEA 4E33A 1NQUA 2CHFA 5B12A 2YRXA 2JLCA 1UK7A 3GEDA 1VCMA 1YE3A 3BFPA 1K9SA 3A6KA 2WWVD 4EF4A 5LQAA 3ICEA 5HFAA 1GZUA 3DUFB 5AVKA 1A8PA 2PFSA 1D7OA 4UFPA 1NQVA 2A2ZA 1A4XA 2XVYA 3AW8A 3GJ4A 2H07A 5C5IA 1IU9A 1V6CA 1KVRA 5ESRA 1CZLA 2YHUA 1L7AA 3DMFA 3Q0TA 3NV7A 5B1EA 4F91B 1M6HA 4R8RA 2WYWA 1GYRA 2FDRA 1ZH4A 2EZUA 1QHNA 2Y68A 1NKTA 1XUOA 4GOLD 4F3KA 3FTEA 4F46A 3H3JA 3NTVA 1WV1A 3LV8A 2VNHA 3P9ZA 4RH0A 5LYYA 2CHGA 1A82A 1A77A 4CL0A 1AO0A 2L82A 2CUNA 1C80A 3GUCA 4A0RA 3LT1A 1NI3A 4M0FA 3ZU3A 2Q8NA 5B57C 1CDZA 3GFOA 4M1SA 5C35A 1PLKA 2WFMA 4CEHB 3BDIA 4N7BA 3RYIA 2Q3CA 3EEYA 3BTOA 2ZRLA 3CM0A 3PFIA 5F4ZA 2IXEA 3QU9A 1G42A 1HZJA 4CLDA 3E53A 4ETIA 1DG9A 3ZY3A 3L7AA 4Q5IA 4KEAA 4JNKA 4DB2A 2CUKA 1YZUA 2B4AA 2CGEA 2AEFA 2AYZA 3H1FA 2VCHA 1TM7E 3UB2A 4Q9JA 2D7DA 4UTXA 1V8DA 4MR9B 1WCXA 1W0JD 2JJ1A 3VR3D 4HLDA 4IDFA 4KE9A 5JNUA 4UNSA 2X3YA 3T7KA 1WU7A 4YCJA 4BX2A 1XTKA 2RI1A 1QXSA 2AFIA 3DGEC 3G0BA 1CUZA 4DXAA 3KJEA 4LZPA 4QEZA 1SC4A 3ZCSA 2IZ7A 3UT0A 3PQ8A 2RBEA 1WSBA 2CXQA 1W2WB 4EDHA 4BB5A 3WMXA 2GF9A 4UTVA 2P4QA 1VP9A 3N53A 4HJRA 3IR7A 4RW0A 3P0IA 2F3TA 5HUHA 4EVSA 2ZRDA 2CCKA 2ECFA 3GEGA 4GOJA 5IXYA 3DLCA 3AP2A 5EQJB 1AS3A 2YYZA 3RVMA 1DGQA 2DH5A 2COEA 1YZ3A 3WGKA 1OW3B 2IGTA 5IH7A 1I4OA 4E03A 1UWKA 3ML1A 5DMHA 1U5CA 3OX1A 4OJQA 5LXTB 2JGJA 2XW6A 1QPGA 1XEXA 1BQEA 1YBFA 4IHJA 4C1NA 1NC3A 4EH1A 3FPHA 3B9PA 3T7EA 1YS4A 4BU1A 4Y67A 1AHNA 4MI9A 1EE9A 1J2YA 2YMQA 2A9QA 4AF6A 4OP2A 4PAQA 5HM8A 3IODA 4RS4A 4EJFA 1KBZA 1UPTA 2QBYA 4HY3A 1GA1A 1X1BA 3ORFA 5CVEA 4BGUA 4YMIA 2AG5A 3OE7D 4GQAA 5MHTA 1P0PA 2XSZA 3H18A 2R8PA 9MHTA 4HLUA 3L4BA 2LVBA 4KPGA 3IMGA 4TUYB 2NO9A 3N1UA 3P8ZA 2CWWA 1RVDA 4G5HA 2XA2A 5ER6A 4EO4A 4TM8A 1QGYA 3GJ6A 1E2DA 3FKQA 4CKCB 3AEZA 3IBFA 4WCVA 5SICE 1NTRA 2HCBA 3I4CA 2WJGA 4KQGA 1ZH2A 2BDUA 5TPWB 2WJ3A 3IIKA 3CX4A 2JIZD 1SKYE 4DWWA 5J4HA 3KSMA 1PSWA 4IDEA 4IIXA 3A4LA 2PL9A 3HSKA 4YYEA 4Y1RB 1X19A 1XQ1A 2PMKA 2GPTA 3CNQS 5EEHA 1QGAA 3F6RA 4I50B 1UJ2A 2O07A 1IN8A 2M6RA 2ZYGA 4NZPA 5K9ZA 3ZVNA 5C1DA 2WF8A 3I8OA 3M6MD 2P67A 3E9DA 3VMMA 5A4DA 2EJTA 4JVLA 3QX7A 1UFVA 2OBNA 4JVOA 3ISVA 2BEWA 1CEQA 4INPA 5ALFA 3SC2B 4UPEA 3TEJA 5F7ZA 1JI0A 3GLIA 3PVZA 3E58A 1JJ7A 2VZ0A 2B8NA 3N7AA 3ONFA 4OAOA 4W5HA 5F5LA 1E69A 2HWUA 4OI1A 2QTNA 3EQ9A 3IOYA 4EO7A 3OTQA 1ZA1A 2PV0A 3WK8A 2UUCB 4QQRA 2AW5A 1E5TA 5I7FA 1LGYA 1AKRA 3L84A 1D2RA 1Z13A 2VNJA 4PLYA 4YRIA 4F9FA 5HZGA 5JFOA 3MT8A 1XXHA 3OOSA 1RAEA 1ZZEA 2UUAB 4V02A 2NZJA 2NWQA 3B1YA 4R2HA 1SZCA 4M99A 1BH2A 4UHBA 3GPLA 2A0XA 2WLTA 4S2EA 1T1SA 1HOTA 3WP0A 1E18A 1Q1NA 4Q1CA 4JQOA 3CUEF 1G59A 3UMBA 1KAGA 1K3FA 3WO1A 1DBIA 1H94A 1RVV1 1P7PA 3FR7A 5BSHA 3PI6A 2HSDA 2IZ5A 1J09A 3H9GA 4OBWA 3K0HA 3MAGA 3BXZA 3N0TA 4P80A 1EK1A 4EHHA 5HQTA 4BLOA 3KOYA 4KACA 2MMCA 3HDJA 3VPHA 4EA8A 1Z16A 3IJ5A 4PAGA 2W93A 3THRA 1H0HA 5B7NA 1K8XB 3IVMA 1XDBA 2AXNA 2O5EA 4JA0A 1XHEA 2B4KA 5HE9A 1TJ4A 1Z7WA 2W6PA 3PI7A 3D0QA 4MAMA 1NN5A 2EGGA 2ZIGA 3DMTC 1QU3A 3CLRD 2FU5C 4JEIA 4YCSA 3ZU6A 1VGRA 4BXOA 4IWYA 7MHTA 3OOEA 3AEUA 2F2TA 1ZM9A 4CKZA 1SA0A 2ATXA 2FY8A 1AJEA 5GGXA 1EFPA 2WNIA 4YV0A 4J3NA 1IB6A 3N2LA 3WJ7A 1PQUA 5IC5A 1XOIA 3TXYA 4EHNA 2REQB 1V26A 2HPHA 2F6RA 4P2BA 3UJAA 2J30A 4OLAA 1W4BA 1Z5NA 3I3SR 1FTGA 4OAQA 4BBPA 4MPTA 3RYIB 3WDKA 2GNPA 4B0OA 4KAXA 3MUEA 4V3BA 2R6CA 1OLUA 2WIGA 2IHZA 2IITA 2QVLA 4WY5A 2H16A 2ZBVA 2BTOA 1UDRA 4HFMA 3D0OA 5JANA 4U7WA 4W9NC 4Q3BA 5AVYA 3NX4A 4EFMA 3WYAA 1QKJA 1GPLA 4YCBA 2CBZA 2DPLA 5JC8A 1WCIA 5IVPA 5KQPA 1NPYA 4N76A 4XQEA 3V4OA 2ZJYA 2W2MA 3KX2A 2AD1A 4O8CA 4TZ0A 4BN5A 4F1WA 2A0UA 4QPJC 1SHUX 1RTTA 3GX1A 4NNJA 4D43A 2JC3A 2BL4A 2QZZA 2V6GA 2XGOA 4Q3LA 3AQ4A 1SXQA 1QCDA 1W4CA 2D7CA 2OXEA 3D8NA 3F1LA 1CC1S 1F8UA 4WK4B 5G1PA 1YV9A 1U2EA 2AFIB 1OWOA 3ROTA 4B6FA 4GAEA 5FLKA 5CB4B 4EPRA 1YJQA 2E6UX 1L1FA 1E9EA 1Z0SA 2XB4A 1IAVA 1JIVA 2QVYX 1ORRA 2NM0A 1U2SA 1G5PA 1T34A 1BDHA 2VDKB 1B43A 2WSIA 2BM9A 2YXDA 3HCFA 4JL8A 3TD2A 3TW6A 1RCFA 2MINB 5I7HA 4Q3EA 1J33A 2UYCA 2XWSA 2ZYRA 5AKIA 5IJ9A 2NSJA 4MX8A 4DIOA 1CZOA 4NMHA 2HA7A 3GMDA 4WHMA 2VTVA 3V33A 3FBWA 3EG9B 3OF2A 4BU0A 1C1DA 2WJ4A 4C4YA 1WULS 2IXBA 2V9PA 1GTMA 1J8VA 1G5HA 1VA5A 3O8BA 2BE7A 3LX5A 2Y1CA 4J0GA 4PIVA 1Z0UA 3UC9A 5I3ZA 3L7JA 4LSZA 4NTZA 2A57A 4RGQA 4HDKA 3A1VA 2C7OA 1UODA 3WGTA 4GPD1 1ZH0A 4IRMA 1PT8A 2GQ0A 1BRTA 2ZQ5A 2QBYB 4RQTA 5IZCA 3W2EA 1ODIA 2YHSA 1CERA 2FPMA 3GWGA 1CY8A 1V4BA 3OTGA 4P7FA 5IK2D 3LO8A 3SAJA 2P1RA 2WT4A 3KWMA 2F67A 3WGGA 3FKJA 3T3GA 3ETEA 1E4EB 3IAAA 3S40A 2Z2JA 3KPUA 3PT9A 3U4MA 4JU8A 4IWXA 4QUIA 4JZKA 4CF7A 4ABYA 2FXIA 4QRHA 4YX9A 1B7GO 1NF3A 3HXQA 3EVZA 1QK4A 2OXTA 1MIOA 4P7BA 4AICA 1DRKA 2A6PA 3OZEA 3SVTA 5FPKA 1DPFA 2O0LA 4EP1A 4C4OA 1JDSA 1DG3A 1U7WA 4FLEA 4ROTA 1A04A 2FX3A 2I6UA 2NNLD 2PZKA 4DNPA 1H3FA 4KXMA 4R2LA 2FQYA 3IHTA 1BA3A 1E4YA 1TQHA 2F9LA 1I7PA 4LTMA 5ADWA 1TJPB 3DVAA 2IOYA 3FLBA 4DLVA 4WZBB 1KH1A 3LVFO 3ID6C 1DX4A 2M2IA 2YOGA 3L8MA 5J1TB 3HFJA 5BR4A 2Y2UA 3HVKA 2AUNA 1FUKA 4NCJA 4MWZA 3L9XA 5I4KA 2C4MA 3DKRA 4JI3B 1VE1A 3U3OA 3I04A 3R1IA 2GZHA 1LPPA 1I4WA 2XMCA 1ZJWA 2BFFA 3GLIB 4EJMA 1CQZA 3IULA 5HG0A 4EARA 1UQUA 1Y1KE 5ESDA 4CEIA 4BFZA 1NASA 1JRLA 5I8ZA 1P6QA 2QVZX 5JROA 2HLNA 4X24A 4U6QA 3VOSA 1GV0A 1NMXA 4FS3A 4MQBA 3S2ZA 3TS1A 1IN4A 2EZ8A 2X9NA 4J1NA 4J7XA 5T64A 2E4ZA 3MGAA 4CLOA 1RW4A 1W35A 1XFDA 2ZI9A 4HRXA 4UHDA 4DIFA 4I6EA 3TZBA 2J4DA 5IBQA 2IZ6A 4HRVA 4WXHA 5K6TA 1F1BA 3I8XA 4L3WA 2J3HA 4JKOA 4C4SA 1VMEA 4PICA 4B4KA 3GLFB 4B87A 4KIJA 5JJLA 1L5RA 3UV7A 4HNQA 5KO2A 3W4IA 4OQXA 2UDPA 2IYSA 5C3UA 4C9BA 4ED9A 4GPEA 1Z7EA 2C3PA 2ZUUA 4IJQA 2FN8A 1QFMA 1P74A 3SQXA 2X9QA 3DOHA 3FOWA 4XW2A 4NH4A 3VZPA 5HPYB 2QLMA 1G7SA 3PEWA 5CXQA 3VO1A 1SQ5A 4L74A 3P9YA 3R20A 4BLQA 1UXOA 1PK9A 3WC4A 2W90A 1USVA 4BJ5A 5A5VA 4C0HA 1UL1X 3PYXA 3LX6A 1JVSA 1EFPB 5JO0A 5KQMA 1ENZA 2QR2A 4L27A 4Y9UA 2H29A 1FFBA 2GF2A 1HNXB 4DAOA 2QD3A 1YA8A 1VLVA 2GXUA 2Q41A 5SYMA 2XHZA 3T41A 5HK9A 3HJBA 3R3HA 1NE7A 1SRRA 3AKYA 3TQIA 3L8DA 2H48A 1UC4B 1R0XA 2G67A 5H82A 1NONA 5ALZA 4AT1A 3FYDA 4HX2A 1M1ZA 4IDHA 5B3JC 3DTVA 1ZO8A 5FLXA 3ECSA 1OLUB 2J9GA 2ZQYA 3LUKA 2Z6AA 4K6CA 3O1IC 3IJRA 4G1MB 3JATB 3AUJB 1V35A 4IH9A 4RHFA 3K92A 3F6CA 1HH4A 1QOPB 3H5AA 4MUBA 3F9CA 2EP7A 4MEBA 4BGDA 4UXJA 4NYIQ 1RXIA 3EDYA 1WCIB 1UH5A 5TARA 4AIIA 2CXUA 3LXRA 5KQGA 1T3SA 2VATA 4KBYA 4FP9A 2IP2A 1QFYA 1QIFA 1SC9A 2DKFA 4Q1BA 3WMEA 1J00A 4CTKA 4LF7B 3MLEA 1VRVA 3P19A 4EITA 1CX9B 4FOPA 4NENB 5SZHB 2QG4A 5BV1A 5F2KA 3E18A 4WD3A 2K2WA 5IJ0B 2PZLA 1OSNA 3DV0A 3ZZTA 4ERNA 1N5OX 1W30A 1DO8A 1W0KD 4DJDC 4MVJF 4UJ3A 4UNRA 3S6JA 3DCJA 4A82A 2JAWA 1FTQA 2NV2B 3UQZA 3N0XA 2OVBA 2SBTA 4BNHA 2C07A 1EJ0A 2ZBQA 4PSDA 3VHRA 1M6VA 4KVZA 4M0DA 2JLVA 4ZAYA 3X3HA 3ZHSA 2X7HA 4EJSC 3EAFA 3FHOA 2P11A 1VMIA 2NXEA 3MRTA 1KMNA 5BWOA 1RKBA 3TI7A 3Q5DA 1NXXA 3F78A 3HGMA 3QBTA 2H7VA 16PKA 2P90A 1YA4A 3DHEA 2PU7A 4G0OA 4OK3A 3PNSA 4QUEA 4WFKA 3QBJA 2R85A 4WLNA 4EG6A 1BMFA 1UBJS 4DABA 1DIAA 2LP4Y 1P9OA 1X39A 3PUZA 1MOPA 3QM1A 2X0EA 4J29A 4HDKB 3ERCA 1NGSA 4RFLA 5CCDA 2VP3A 3E1SA 1SUFA 4BTVA 4CM9A 1KSJA 2JFWA 5H0IA 2VHTA 4JR0A 4NONA 4Y0VA 4XWAA 1Z4IA 2YYSA 5AM0A 4FGLA 3BH7A 3PF9A 5C1BA 1XAJA 2AOTA 4ZIRA 2GYWA 3PHBE 3V1YA 2QP3A 5WRFA 3MLBA 3JQQA 5H3CA 5JH7B 3LZ6A 3LY7A 1E32A 3H4IA 3FAKA 4ZD6A 3R6WA 1G3QA 1Y7TA 3A9SA 3WMGA 3FZYA 3ZH9B 3AHCA 3L1IA 2VHZA 2Z8XA 3OICA 1ESMA 1NI5A 1TW2A 1O9HA 1VHJA 3OT1A 1L5YA 1JWLA 4KXYA 1KQFA 1JJVA 2WV7A 3OD1A 3B70A 5TLSA 2WHYA 3DONA 1AMOA 1SC3A 1Z7BA 2HRDA 4DG8A 5AW3A 4IJVA 3E84A 3L7BA 4GKBA 3TIGA 1L3BA 3E7WA 2ZR7A 1FFYA 4JR1A 1AOXA 4W8HA 4Y2YA 4ETNA 3A7DA 2EKZA 4KE6A 5KDLA 2O8EA 2XE7A 2QIPA 1ODSA 1KK1A 3TCKA 3B9RA 4QUGA 5BUCA 1U6KA 2HTEA 2VDOB 5ERXA 1GQYA 1ZRHA 3VZQA 4BQFA 3EZ7A 2SECE 3E22A 5AKEA 4CUJA 3F3MA 1CZKA 1XD2B 1WLSA 3DH0A 4DZRA 2O8BB 4E94A 4DM7A 4QU9A 4TV9B 1NVEA 2QXTA 3QHQA 3ZHBA 3I6IA 4GI3A 1TAQA 3NUZA 1LCIA 4JBWA 5E95A 3UBMA 4RGVA 2OLEA 1BW9B 4GXNA 1UOQA 2PXXA 2OZPA 2BFFB 2R6HA 3LUBA 4CL8A 4UAUA 1WZ2A 5CGZA 2QXYA 1CY0A 3F74A 3RUHA 4Z3KA 2BM1A 1FNNA 4RVUA 4L8GA 4JAVC 1W73A 3Q6IA 5PGMA 1UK6A 2J45A 1NYLA 2W70A 3SHTA 4C6TA 5CFOA 5EWJB 1D04A 4ZZ3A 5KOJA 2QW1A 4PO8A 1GL9B 3CJQA 3MT7A 1GUAA 5FWDA 5DSTA 3W8DA 5D84A 4TYMA 4CLOB 2JBHA 4B6RA 1ZU5A 3W8FA 3AHJA 3CIFA 3CRZA 1BKDR 4FX2A 4NU5A 3JARA 4WN9A 4MPRA 4BVGA 2R6AA 1UT6A 2EKBA 1A3CA 4KVAA 3BJRA 2NO5A 2Q21A 4Q37A 1E66A 1MFZA 1Q7CA 3H2SA 3O7MA 3AJRA 4OXRA 1NYQA 4LZOA 2YL2A 2GD2A 4L4RA 5HUJA 4L8LA 3KQTA 4WJZA 3GLGE 4AZTA 2N1BA 4LHEA 2PM8A 3N0VA 4LISA 2HT6A 5KYGA 5BQ3A 3LD9A 4ZN6A 3SX4A 5K2OA 3LWDA 3PPVA 3C7KA 2FMXA 1MTOA 1VZ3A 1Z08A 2D0OB 2D2VA 4TLAA 2R47A 5AMXA 1SG9A 3QVUA 2CL7X 3PT5A 4LKOA 5FBLB 4Y6PA 1QP8A 2OYCA 3RYFA 2V0NA 1LDBA 3H1PA 1IK4A 5F52A 2QD2A 5DHAA 4LZAA 1SCNE 1L5OA 3MWYW 4GKKB 5EMLA 3R44A 5D87A 3UCFA 3ZWQA 1CUYA 1FQJA 1QV9A 2NZWA 4ICIA 2H9AA 4PE5B 4TWBA 5CEFA 5KDDA 1Z22A 4F4DA 2O8CA 4RSRA 2PQ6A 2PAAA 1D2MA 1KAQA 3DTVB 2I4LA 1MQ8B 3M6UA 4LNUB 3E70C 4X64B 1NVUQ 3RABA 2JAXA 3OKAA 1X8LA 4LCBA 4PLCA 4Q9AA 3E2IA 5JZBA 3VDXA 4ZCPA 4QJ3A 1EP1B 5ILGA 2E7ZA 1EX7A 3VHLB 1R6VA 3TUJC 3K9CA 4LBZA 1D2AA 2QTBA 3VR5H 3M3PA 2F3QA 4D3FA 4HK4A 5ALMA 4ACAA 1MBZA 2EBUA 1IEVA 3CEAA 3OM9A 2V7QD 3B3FA 3Q9NA 5SY4A 3EULA 4NAHA 2PZMA 1UKVY 1XWWA 4ZT4A 3LAWA 3DS8A 2V9CA 5EIWA 3DV0B 4UNNA 2ONJA 4OQYA 2PSFA 2QA5A 4FONA 3RVBA 4LHYA 5JWRA 2ATIA 2PVSA 1ZEJA 3ETDA 5HJ5A 3SFTA 3MCUA 4S05A 4YAIA 5F78A 4ZOLF 2C82A 1ID8A 1O94D 1Y6RA 1ZM4A 1FZTA 3ANYB 4GP6A 2J9ZB 1KOGA 1JG6A 2XUDA 2JDIA 4Y2XA 3BGVA 1BJKA 2CLHB 1XZLA 2NO6A 3RKUA 3KYDB 3UOAB 4DV7B 3QEOA 4AY4A 2I3ZA 4NOKA 3PC8C 3IDSA 1G20A 1AXRA 4QLOA 4TGLA 4YJ2B 5EVCA 5F5XA 3V46A 4JR2A 5LB4A 1N8SA 2GDJA 4FWIB 5JRZA 3TLEA 1RRCA 1ZK2A 4ZQBA 1P1IA 2WQZA 3T7AA 3BRCA 1M72A 3C3EA 4E11A 2VDWB 2QDKA 2WG1A 3FF4A 4RV5A 1QHGA 4HB2A 1DAGA 1D8AA 4MB2A 4AUKA 4I4TB 1WL8A 3BRWD 1XO1A 1Z4QA 1VKRA 2C5GA 2R1TA 3R0QA 1MHTA 3KJZA 4PHCA 1VL6A 1GUDA 4YBRA 5H9VA 4JELA 2AOTB 4M0PA 5C8YA 4YRRA 1FTWA 1EA5A 1M2GA 1U0HC 2B1IA 3D5EA 4QYWA 2XTNA 4UPDA 3B6EA 3HV0A 5A1JA 1J0DA 4DHWA 3HPRA 4PNZA 1BA2A 1GU0A 3WTCA 3EXFB 2B1GA 4IQGA 4HWKA 3OEEA 1DXYA 3QPCA 1X13A 1G5RA 2HRCA 4KSYA 1NP7A 1UFRA 2AB0A 4QYXA 1V5EA 4MWGA 4FVTA 3QU5A 1M66A 3GGCA 3LFTA 1HT0A 4R7ZA 4S0ZA 5EMJA 1UPCA 1L1QA 1HT2E 3CG0A 1BHO1 1NYTA 2PUWA 4KV9A 3NHFA 4EF6A 1SUWA 5HA5A 3GDFA 1DFGA 2IXDA 4G0PA 3K9HA 3C0KA 1VJ1A 3HBMA 2W8BA 1Y6QA 3HU1A 3DMPA 4J7AA 4BUZA 2ZM6B 2O8EB 2AN4A 1D2CA 1MW9X 2RMKA 3D6UA 2C7PA 2VJYA 5G53C 3VPXA 1SURA 3UWPA 4P4SA 1I7DA 1E2JA 2EFEB 4TV8A 1URPA 1ESNA 4E4TA 1UBFA 3T7IA 1GL3A 2MYPA 3I01M 2XCTB 1S3SA 4BNLA 1LLFA 3C8HA 3CRRA 4NAUA 3WLRA 2B3TA 1N5IA 1IM8A 5BSVA 4FJ2A 1ODJA 3EVCA 1G64A 2DQSA 1WW2A 2P8JA 3PDIA 4JP3A 1BE8A 2Q0HA 3PEVA 2VPQA 2IDZA 4RBNA 1KBOA 3PQ2A 1QH8A 3GT3A 1VYTA 3B48A 2OBFA 3OAAA 3LLVA 5BOSB 4Q4HA 4EG3A 1L4FA 1SHZA 2I6SA 3CLUC 1B15A 4DT1B 4Y9SA 5KOJB 3TGPA 3ZV7A 1XQXA 1Z2EA 3PFWO 4GYJA 4RF5A 1MJNA 1N3LA 1Y3FE 3K71B 1X6VA 1GAQA 2Z1MA 2IIBA 2JK0A 2JJ2D 3CV3A 2V96A 4NYJR 4FD2A 3NEPX 3ZEAA 4PLZA 1HORA 2QRQA 3U7QA 3MERA 5AOBA 3VYSB 2WDPA 2I54A 2FH5B 5IZ4A 3O38A 5ALUA 4WN9B 3C7DB 3LI2A 4KH0A 3L1VA 4O1IA 4WZAE 3U9SA 4EJSB 1QOQB 1DIRA 5DASA 1ZC4A 2EFJA 1SN7A 1AKNA 1YR6A 3C3WA 4L15A 1FTSA 4F92B 1OTHA 4XCQA 2IZ0A 2NV6A 4AF8A 5CVVA 4Q7JB 4RYDA 4RVOA 4BP8A 1AMUA 4ENWA 3QVOA 4BJHB 1NXQA 1ZJZA 2PT6A 3ENNA 4UCXA 4ZYTA 3F7NA 4NMXB 1EVLA 4BNZA 1MJFA 3BH0A 3SYRA 1PUXA 1EJ2A 1S5PA 2PUHA 3KXLA 4NECA 4V0MA 1P61B 2VUTA 5CW1A 4MYSA 5JSQA 1OOEA 4DMFA 4IGAA 3VFDA 1C3OA 4RSMA 5E6RA 4KIGA 1XWFA 4OXXA 2ZYDA 5CYFA 2VRNA 3T1VA 1BDJA 1WR8A 3M6AA 2IC5A 5FQNA 2AZMA 5K3FA 5HMLA 4PY2A 1XD9A 3R8CA 3RYFB 1Z7YA 4GMGA 1VL2A 3RV3A 3GHHA 4B1FA 3MVEA 3DE7X 1CQIA 2J5RA 4P3NA 2JHPA 4X8OA 1CZUA 2H4JA 2W6QA 4HXEB 5FO1A 4CCSA 4EHBA 5AVZA 5TJHA 2FI1A 3PIDA 1E98A 4J0HA 4LF9B 3OP4A 3O83A 4MVJH 4N39A 5CD9A 3JR7A 3T5MA 3V3KA 4WSOA 3F5MA 2GO1A 3BFVA 3PGKA 3Q7EA 5HXAA 4B6EA 1K4MA 3F8TA 4D3SA 1DJMA 3RTCA 3R3YA 3MQ2A 3R9KA 2YN4A 2DM6A 3AT1A 3H9JA 4M9UA 4C1BA 3C1TA 1G9SA 5LMNB 1FUYB 4WNAB 3JS5A 1L5ZA 4EAAA 1GLVA 5GV8A 5KNCA 4R6WA 3CVJA 3THXA 2O2DA 2JJ1D 2Q5JA 2WUDA 4FHZA 4R4JA 4TVSA 4BVLA 2FWAA 3G2MA 4MMZB 4PLHA 5G40A 3HRKA 3K4PA 2QKYA 1JDPA 3KYBA 4JXKA 3GP8A 2FQQA 1QIDA 3UO8B 5A4KA 2HIGA 5LMUB 1KP9A 2CLCX 3HYRA 5JNSA 4OP3A 1KS2A 1KDTA 3OZTA 4X84A 1NVGA 4Q82A 3A05A 1I6KA 3EBOA 3I45A 3JYLA 3JWIA 5DE3A 1JI3A 1XTTA 2VWQA 3IOBA 4MGEA 4N7MA 3SE0A 4DA0A 5I9IA 5CR9A 1UMBB 1RI5A 2NPIA 4LHZA 4B73A 1A9QA 5KNBA 3KIPA 1W5EA 2WJYA 1IRIA 3SKXA 2Q1XA 2RGAA 3E3LA 2J3MA 4KAFA 1TYCA 4X90A 1TYEB 1FXSA 4ZQFA 5DM1A 5B58T 1X7ZB 4NPCA 3TKYA 1HR0B 1LF5A 3K9GA 1OX4A 3H1BA 1OBOA 4ITUA 4MUAA 4C03A 2NVOA 4O2AB 4UNPA 3UB3A 1FNDA 1DXOA 1JTEA 4JOSA 2HRQA 4D82A 1XZ8A 4WGGA 2C4HA 1A9RA 5A5GA 2JGIA 2W4MA 2YHAA 4RLQA 3KR2A 2HU8A 3KD2A 4FS8A 5IWCA 2B4YA 3CEPB 2HI0A 1W6UA 1G6KA 2J3KA 3COVA 4O4HF 4H7PA 1SHJA 3BD7A 1PZXA 3QG1A 3UHFA 4AO7A 1AQ6A 1D6SA 4QO8A 1EDDA 3P94A 3O8DA 3LLCA 3P7MA 2YVQA 4XLZA 1SIOA 4RPKA 1RACA 1UT8A 4TOIA 2G4LA 5JD6A 2V59A 2A5JA 1TRHA 2O50A 1T3HA 3FPBA 3OCJA 1FLNA 2OT3B 1GUFA 3R41A 4M0MA 4DPLA 5C7YA 2YCLA 3OU7A 4KFUA 3W5JA 2JZNA 4JENA 3ZNNA 3SHOA 2PTGA 4OFZA 4JB2A 4AD8A 2I2FA 2XA1A 5JV5A 1DJOA 2XNJA 2JRCA 5BWBA 1FXUA 2J9XB 3T1TA 1Y7LA 4UUPA 2W8BB 1QH1A 3E9YA 2BI7A 2DULA 2IYEA 3M6FA 1Q7RA 3MMXA 4HWSA 2QAGC 4NBRA 3I4LA 3HDGA 1XN1A 4P4SB 2VCYA 4LJ8A 1VFPA 2ZIVB 5FQOA 2DMRA 1XRPA 1FFGA 2X0DA 2F3UA 3PDCA 3VU9B 4C6HA 3AFHA 5LBIA 4Z4FA 2VTBB 2H4WA 2XOXA 3AJ9A 3DW1X 1KYQA 1B00A 1Y4DE 2GZAA 2NADA 3EMKA 3UK6A 4DBLE 2X0IA 1I4TD 3MGGA 2OCKA 4BL5A 4BRZA 2FZGA 4MQFB 3KJNA 2B8WA 5DX1A 4FDLA 3W7VA 4EYKA 4TZTA 1SBZA 5C32A 4U7JA 3RLFA 3QELB 3R77A 2HMTA 1BXRA 1CHNA 1U02A 2ESRA 3KOWA 4XGKA 4KPUB 1P4SA 1CS4C 2J9FB 3NYQA 2O2ZA 3DBHB 2ZI5A 3JD3A 4WN3A 5AXAA 1FW6A 3A9UA 2E49A 2VHWA 2FW6A 2XNHA 5CW2A 5DP1A 2HRBA 4Q4HB 1FYVA 1TKBA 4FYKA 4ARSA 7REQA 5JSZB 1NIJA 1WIWA 4JMLA 2F8SA 4DLKA 5AHOA 2JARA 1KI9A 2CFOA 3F4KA 5HR5A 4TN5A 4ZMSA 1TNDA 2OM2A 1VKOA 4H17A 5IMSA 1RQLA 5DW0A 1H93A 2GZ1A 3F4LA 4IXTA 4LHSA 3GFBA 4KJZA 3A6GA 1RQNA 3P26A 4W1PA 3RUPA 3C14C 3HNOA 2J08A 3CRMA 3G3EA 1G7RA 1D5CA 3O82A 2K87A 1S7GA 1UJ5A 4KLAA 4OK5A 3JAMA 1SVLA 4KGVA 3BM5A 3WS7A 1U7PA 1WZCA 2YMMA 3B6MA 5AVJA 4TKVA 3OE4A 1SO8A 3P0FA 4MI1A 3MPUA 4QECA 4BY9E 1UQTA 1YQXA 5DDIP 1PJRA 3GP5A 3TSYA 5L4LA 5BW4A 3ZWCA 3FROA 1IN7A 1WUTA 1M8PA 1TMYA 2FSHA 2R44A 3ZX4A 2H5EA 4U7HA 3W4KA 1A8IA 1ORIA 4RXTA 3ROEA 1A1VA 4CTMA 4IF4A 5TY0A 2WF9A 3D6JA 1FFAA 2JG3A 2R87A 1L4HA 3AUFA 3Q9UA 2OSVA 1PQ4A 1U4NA 5P8WA 2C2ZA 5LLTA 2WSMA 2B7CA 2SICE 4ER7A 3O4RA 4Q1EA 2P9FA 3TDKA 3C70A 1J8MF 1KI2A 2XDQB 3G2KA 4D57A 1KTVA 5K51A 1W8IA 5KMGB 1P1RA 5CA0F 4G1FA 4Z49A 2HHJA 1SU8A 2C98A 5J2TF 4G63A 2VF5X 2OD7A 4CFSA 1G3UA 2YWXA 3UT5A 3UYKA 3H13A 3CH6A 3ZDBA 3THXB 1FU7A 1TZBA 1KMCA 1YDHA 4RKWA 5FADA 1R5NA 1KDPA 3ZGXA 1J0EA 5K0NA 1NOIA 2QZJA 1ZL2A 2EIXA 2PX4A 3DT8A 4W5OA 2P0EA 1E2LA 4GO1A 5K3BA 1VLHA 1LK0A 4PNHA 5IULC 1H8ED 2CSUA 2DBQA 2CF5A 2DZDA 3DG9A 1XQYA 1HEYA 2VCEA 2I7CA 1FMCA 1BD4A 2ZYSA 5T67A 4CDMA 5ICGA 1Q1EA 3C16C 5JTTA 3R7WA 3ND8A 5L3SA 4LJLA 1EG2A 1EZ4A 1ZK1A 1KKMA 2V3WA 1MVLA 3A10A 3GN1A 3AZQA 1G5QA 2XYHA 4KQXA 3SG0A 1XTZA 4EENA 2C3YA 3U0VA 1MDFA 2NU7A 3CZPA 3L8GA 4DQLA 2WEKA 3CZRA 3NBFA 1PZEA 3R5SA 3I64A 1OX4B 2D0DA 4JX9A 5SYAA 1XLVA 4IGKA 1CZRA 4RV9A 1E2HA 3IQDB 2ECQA 4TMKA 5DLEA 5H70A 5LCXA 2BLNA 3K7EA 1Y33E 3QNWA 3Q41A 4AYTA 3QVLA 3DL2A 2BJWA 2ZRGA 4AL4A 4F11A 4R68A 1WZIA 4D4JA 4EYSA 5HF8A 2HUNA 2QUBA 2JVJA 2XADA 4Y2PA 3M6XA 4A0SA 3I37X 4NWIA 3VAAA 4BMSA 1IQRA 3EXIB 2B0CA 1EIWA 3PYLA 2UZ3A 3KZ1E 4V1CB 4QWMA 4QYIA 5KC9A 1GA4A 1UBKS 4XIJA 3D1VA 3OX4A 3WKDA 4CV2A 3NTQA 3SMQA 1CK4A 1KZ1A 1TFUA 1DC7A 3VSEA 1GTRA 3PNVA 1MJHA 4N5IX 4HWGA 1V9LA 1YRQA 2OK7A 4FIZA 1IJBA 3VKFA 1S2NA 3TNFA 5T3UA 2A9VA 2J7PA 2LD4A 3CW2A 3BCUA 4ZCQA 2NAFA 2ZE6A 4LFCB 4L5IA 4D6XA 2CL6X 4KQKA 1EX6A 1HFWA 2WVHA 4X62B 4Q4LA 1KJNA 2OO5A 3Q6MA 2P40A 2ZSUA 1GILA 2UUBB 2OC4A 1QH1B 3STWA 1PAUA 3ND7A 4U8HA 5F12A 4NEGA 1BWQA 3N28A 3PCRB 4YFYA 2GUGA 4MVJI 2OPBA 3IBCA 4R2MA 4JUCA 5JCOC 3ZXYA 4C29A 4EYQA 3KETA 2WIFA 1U3VA 1ZD1A 1JQLB 2VP4A 4I1PA 3KSUA 1OF1A 1VRWA 2P0YA 4JLSA 3B13B 1IIRA 3U26A 3R3WA 2GZSA 1E6KA 5LDHA 5LR6A 2J1LA 4PHHA 4YQZA 2ECOA 2H1IA 3UANA 3I42A 4JJEA 1R8QA 2XBUA 1ZMRA 4AJEA 1HQYE 4HH4A 1K8YB 5E1MA 3BGDA 1BXRB 1V8PA 2FSPA 4PCUA 1YQQA 5CYPA 3AI2A 5KTNA 3WYCA 2PA0A 3GVHA 1XYGA 2PU5A 4JKYA 4UM9D 3WADA 4N4AA 3AVWA 1PJSA 3AUKA 1Z2DA 3WGIA 4KDEA 1R1DA 4OB6A 2ZWPA 1HK7A 1LNSA 3QMMA 4M9CA 5IH3A 2EZ4A 3ASUA 1GN8A 3LP8A 3PHHA 4U3JB 5CJPA 1E8DA 3VH1A 1TYDE 4K6OA 1QVWA 3DXYA 1ECCA 3CHYA 3ZS9A 2ZTSA 3EWIA 4D5GA 3HU2A 2FPIB 3SNHA 5CH3A 3DSRA 4BLSA 2FSSA 5IKXA 2GK6A 3IVRA 3LBAA 4G5YA 1I1HA 1SXJC 2H1VA 2G63A 3CBGA 3GG9A 2WZQA 4PGAA 1JFFA 1T8YA 3FH0A 4KH1A 1ZVQA 1Y3HA 1Q6YA 1JQDA 1Q1GA 1TO6A 2IRWA 1II8A 4R81A 3WZ2A 3ZV5A 3D2AA 3M4NA 3SQNA 3U19A 2D1RA 3IUJA 1J2RA 2ZAGA 3WBFA 3VTKA 3PWTA 5TQ0A 3RC8A 4GW3A 5ADVA 1ST3A 4TKVB 1PQPA 1PWEA 1QFJA 4TTQA 3O7WA 1GDTA 1LS6A 2P1ZA 5DI9A 3CO0S 4YDQA 1Y80A 1N7IA 2PE5A 1DMSA 1G3MA 4QFDA 3OESA 2M6SA 4FKZA 4LXGA 1OLXA 3AM1A 2BGWA 1M9NA 2MYUA 3AIMA 2G07A 3AGQA 4C07A 2P9TA 3U16A 5KJ1A 1KVSA 4OO3A 4CM8A 1X9IA 3HUEA 1UKEA 4EY6A 4ZOLB 4XR4A 1JDJA 3AI1A 2V6JA 4EI8A 5IJXA 3UFXB 2I66A 1O5TA 9LDTA 1HI9A 1YJCA 1RI3A 4D9HA 3VKHA 1EP9A 2CDAA 1ENPA 1IPEA 1SG6A 3RRZA 5EWMA 1ITZA 1KC1A 4E5VA 2Z1NA 3DFUA 3M5WA 3K5WA 3T15A 3SXUA 4MK4A 3FPCA 4O4IB 1PCXA 4RIIA 4Z2AA 4IEEA 1VDZA 1Z6ZA 2P8SA 3F5SA 2P5TB 5FPSA 3KT0A 1Z0FA 2PN1A 5F7OA 3M49A 1U81A 2Q6TA 2R6GA 4WFIA 3UT5B 2QD4A 4V1CI 3OZFA 5C4IA 1RYEA 2VAWA 3KQWA 1E2GA 1JH8A 2A1TR 2NN3C 1L7PA 3GROA 4FZRA 4P5DA 2OOSA 1HDXA 1U4SA 2R8YA 1EQUA 1YTLA 2G9QA 2IPNA 4LE2A 4NBTA 4BQNA 1A96A 1TZJA 4JVMA 1FUIA 4CKXA 2LUOA 1J5PA 3COPA 3NEAA 4EHFA 3CCCA 4N5DA 4FR2A 2FJUA 3RSHA 3B1WA 3K9QO 4KSBA 5KC8A 3DPSA 3VHXB 2ZRPA 1SCBA 2Q07A 2WYVA 4Z7JA 3FPEA 5F35A 2C57A 3RM3A 1Z6XA 5JO9A 1G8SA 4F6RB 5LQJA 2QLFA 5E1DA 1J1UA 3LNTA 3R7WB 1K8ZB 1SQFA 3PHGA 4KGXA 3UGKA 3WGZA 1KJYA 4OG2A 2YJ5A 5L3SB 2JH3A 2AG0A 2PCLA 4H31A 4KR0A 5CBPB 2W98A 1KI1A 2Z4RA 1HTWA 4LE1A 3W7AA 4P4LA 2Z56A 2FZ4A 5BYKA 1ARZA 1NXWA 3NBYC 4TM7A 4B2IA 1VBKA 4H77A 4PG7A 4X5OA 4R0VA 5TQ2A 1PT6A 4D7AA 3E4CA 4OJKA 1BMFD 2EG9A 2PGDA 4IFEA 2FZCA 1ECJA 2AL7A 2XYVA 3HCEA 2OCAA 2H2DA 4PN3A 1J7JA 4BFLA 4BNJA 5K3CA 3AILA 1Q16A 1JILA 2DE0X 2ZGVA 4D02A 3BYZA 2P2LA 5H83A 3TRHA 3MUOA 1KK0A 2I7TA 5DT9A 3PEYA 4Q0MA 1I4DD 2GAIA 5TEWA 5B2FA 3G2HA 2XVXA 5AHKA 3LHDA 4KQMA 1QP4A 4WFQA 2AUTA 1ZAKA 2XDYA 4PBSA 4L0MA 4F9GA 2V4UA 4QYIB 1JT9A 5FYDA 4KZKA 1XZFA 2ZWMA 1ONNA 4I55F 4OSPA 4EY7A 4FGJA 3CW8X 4WOCA 4EY3A 3D3WB 2OV6A 1V1MA 1KEKA 2VWGA 2JF0A 3DEYX 3L6BA 5FPHA 2NT3A 3NBQA 4V2UA 4BWVA 2WHQA 3AR8A 4P38A 2VQSA 3KLBA 4C2BA 3KV1A 4DWVA 2VAMA 4GX0A 1LLCA 1ZLYA 2W4QA 4H3KB 3UJNA 2CFCA 1XT6A 4OLHA 1VLQA 3KP1A 3CS3A 3ITDA 3LSYA 3D3KA 4GLOA 2MDTA 5GJVC 2NAPA 1DINA 1FFXB 2PH5A 3DDWA 4I7EA 2I03A 3RS0A 4KR3A 3B60A 4EGCB 3HJRA 3WRXA 5HSGA 2QTVB 4LQLA 1QIHA 2VXOA 2OCBA 4LPSA 4RHYA 1BYUA 3RW9A 5D3ZA 3SS8A 4DQKA 1OA1A 1YFZA 2VF8A 1BU8A 1R0CA 2YYAA 3BL5A 2Q6IA 1G4AE 1NMSA 3H4VA 4G8JA 3A2MA 3L5OA 5BMVB 3BWDD 4TLMB 4JI2B 2Q3MA 2Q0SA 1J90A 1OVMA 1VKNA 2B5WA 4DUGD 3ISTA 1HE5A 2AR7A 5DBOA 1YK1A 1RYHA 3PZBA 2JJQA 4AO8A 5F64A 5BURA 2QYOA 4WA8A 3NHBA 5LA6B 2WQ7A 4IL5A 3T3EA 2Y67A 4J75A 4ALNA 4EHJA 1SHTX 1RLUA 3SF0A 2VT3A 4C5CA 1SVSA 3OFSA 3ZJTA 4K28A 1Q57A 3NANA 4RZQA 1NF8A 1VYUA 2HMUA 3UOGA 3V4SA 2CJPA 4FB4A 5JCPA 1LSSA 2LZ0A 4KLZA 3SX0A 5IKPA 1JFFB 2YZGA 3UPDA 4ABTA 2AZDA 1ESEA 2OZVA 1II8B 2XQKA 1ZOLA 4FBGA 3H11B 1H2EA 3GF4A 1LUAA 3RJZA 1IOZA 1QQBA 2P6UA 5K20A 2RK3A 1ABEA 5TQ0B 3KHUA 5FWYB 2IDMA 3AO0B 3NUQA 1XP5A 2I34A 1GGMA 1WKVA 1FTYA 3TVDA 2FOXA 4JLWA 8LDHA 2IIPA 3IDAA 4BKQA 2ETXA 4PQGA 1SXPA 3KAQA 3KJXA 1K0FA 4KKXB 4NS4A 4DPKA 1Q22A 4DXDA 2Q5FA 3RAEC 1E3LA 1B0AA 1OLXB 3HCBA 4PZYA 2WA2A 3HP4A 5CDSA 2JFOA 2YWCA 4CM8B 2VXYA 2PANA 3WZMA 4LXHA 1WXIA 1KP2A 3SOPA 3RYCA 1XPJA 2C3OA 3B1VA 1VB5A 5KVAA 1MZVA 1N1MA 1TUBA 1Y3BE 2X6RA 4PV7A 5LZ7A 5EC8A 3SR4A 4KRXA 3FDZA 2ZIAA 2EX4A 3SJAA 4NV3A 1J99A 1GPYA 3AOEC 4AX4A 1ECPA 1U28C 5EWMB 5JPIA 5JXIA 3CX3A 1JDNA 3M1IA 3VTAA 4MKHA 2AZTA 3H2GA 1GGHA 4W4TA 3LCMA 1DKLA 1QVAA 1TEXA 1Z4LA 2EJCA 4XAQA 5J63A 3SXUB 4C7VA 2XZOA 1GO2A 4Z0TA 4WBNB 3FCEA 5BNIA 4B3RB 4QAQA 3RRJA 5GIPE 1T0UA 3E7DA 1SWWA 3BZWA 2OMKA 3D7LA 5K3AA 4FJ0A 3MHTA 4G0UA 1WKCA 2XYGA 2OWDA 2P0AA 3DC2A 4LW8A 3IKVA 1S4MA 1V9CA 1ULUA 2RHTA 1UDBA 3P2YA 3QGMA 2V58A 4IVRA 8OHMA 1KU6A 4KO3S 1A7AA 3G23A 3Q3GE 2XBMA 4G8BA 3R3VA 3BRQA 3KVRA 1D6JA 1PGNA 4MPDA 3KDPA 3BL8A 3MINA 3BHNA 2N47A 2WJVA 3T9AA 4MWSA 4W1SA 4CVNA 1KYYA 4KQIA 4W8OA 2BFDA 3SVZA 1CLEA 1FP6A 3CLSD 3TYXA 3G9UA 3QKIA 3OEWA 3AVOA 2GEUA 1E3DA 4I1RA 1H8HD 4AYWA 4LV8B 1OXBB 4YMTA 2V03A 5KX5A 2RAVA 4KK3A 1C8KA 2L42A 3GN2A 4X8LA 1QNFA 2AKYA 2WJHA 3FI9A 3D54D 2XNDA 4A2PA 1NR7A 3FPKA 1PR4A 1IRXA 2C61A 2HZBA 4JSYA 3GEPA 3H6KA 4L07A 3TEMA 2I4RA 2BGMA 2WQ6A 1GG8A 1FC0A 4D6YA 4O2BB 1SXJB 4TSKA 5EL0A 5KQLA 2AWNA 1HQKA 1Y0BA 4QBKA 2N75A