2ESRA

Conserved hypothetical protein- streptococcus pyogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
b'VRGAIFNMIGPYFNGGRVLDLFAGSGGLAIEAVSRGMSAAVLVEKNRKAQAIIQDNIIMTKAENRFTLLKMEAERAIDCLTGRFDLVFLDPPYAKETIVATIEALAAKNLLSEQVMVVCETDKTVLLPKEIATLGIWKEKIYGISKVTVYVNEGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
publication title Crystal Structure of hypothetical protein of Streptococcus Pygenes
rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2esrA00
2AZTA 2IDKA 2ZIFA 3MHTA 3AY0A 2UYHA 3M4XA 3EVEA 4YMHA 1VP3A 2DPMA 3IEIA 1FBNA 3M6XA 5CCXA 2QM3A 2NNWB 1P39A 5HEKA 3UJBA 3SSNA 1JQEA 3SXJA 3KQMA 4X41A 1TPYA 4Z2YA 4DZRA 2P41A 3BT7A 1D2GA 1VPTA 2WA2A 3DP7A 2BR4A 2YTZA 2UZ4A 3AJDA 3DXZA 3I9FA 3FYDA 2ZULA 3P9IA 4P7FA 4IWNA 3GJYA 3VC1A 2B2CA 2N47A 2DULA 3FZGA 3E7PA 1IXKA 3GWZA 3KHKA 3KKZA 3OU2A 3QOWA 4G56A 1YF3A 4PYOA 2BM9A 1UFKA 2NYUA 3IYLW 1JQDA 2BM8A 3FRHA 3GGDA 4PYLA 4O29A 4RTJA 1XVAA 3RODA 4X61A 4RTOA 1F3LA 4AZTA 3LCUA 1UWVA 2Y1XA 5E1MA 3FPEA 3FUXA 3RW9A 4GUAA 1FP2A 2IDJA 2WK1A 5FCDA 1NE2A 4RTNA 2BH2A 4FSDA 2HMYB 3IHTA 5K0LA 4UOEA 4PYNA 2FPOA 4X63A 4C07A 3ORHA 3R0QA 8MHTA 2ONYA 4HH4A 3LBYA 4YV0A 5K0CA 4CKEA 1KPGA 5BW4A 2PXCA 3DMHA 5P8WA 3T7RA 1Z3CA 3G2MA 1JG1A 3BGDA 3GRUA 4FT2A 2YQZA 3EGVA 3I58A 4OX9Y 4F84A 5DXJA 3VSEA 4C08A 1G8SA 2B25A 3KPYA 4GOOD 10MHA 3HVKA 3ELUA 5HIMA 3REOA 4F85A 3SR4A 3A27A 2BR5A 2Z6AA 4MHTA 3G88A 1XCLA 4DCGA 4ER5A 1F38A 3KQYA 1O9GA 5CUQA 2UYCA 3R3HA 1KHHA 4FP9A 4KW7A 4B17A 5ICEA 1XCJA 1NW5A 1X1AA 3I53A 4PNEA 3UJAA 1RJFA 1SVUA 3CCFA 5K0BA 3BKWA 2ORED 4E33A 3FYCA 3TQSA 5CCBA 3GNLA 4RTRA 3MCZA 2OXTA 2ERCA 3EVZA 3OE4A 5DRYA 5E9QA 3RIEA 4M38A 3BKXA 4MQ4A 3UZUA 1ORHA 3OZTA 2AR0A 3U81A 4IV0A 4POOA 2ESRA 4YV1A 2ZBQA 1NW6A 2IH2A 5CVJA 2ZIEA 4P58A 5E2BA 2CKDA 2NXJA 3C6MA 4PIPA 3GO4A 5E1BA 3MAGA 5LQJA 1FP1D 2QRVA 3MERA 2B3TA 3SSOA 2P35A 3I64A 4ER6A 3E05A 3FUVA 3UJ9A 3ER8A 5EHIA 4RVFA 2PX4A 2JH9A 3ID6C 3PX2A 4EQZA 5DM2A 3MTIA 2AOUB 1NBIA 4F86A 4BP3A 4QPPA 2AOXA 3DLCA 3VC2A 3P9CA 5D1HA 1XTPA 5EIWA 5DPMA 3PT9A 2E5WA 2IP2A 4M36A 1RJEA 3B3FA 5DX8A 3HCAA 3B89A 3G5TA 5DM1A 4U7PB 3B3GA 2VDWA 3G89A 4E30A 2PWPA 3EVCA 3FPGA 2B78A 3HNRA 3KQSA 3LHDA 5LR6A 3R9XB 3TMAA 4EK9A 5E8JA 1HNNA 3SVZA 2I7CA 5EOVA 1SUIA 5LQNA 3LPMA 5DX1A 4RTKA 3E8SA 4QDKA 4XUCA 5LQUA 1V39A 3PFHA 4V0RA 3HP7A 4XCXA 4YUZA 3EEYA 1ZKDA 4HRAA 1B42A 1M6EX 3HCCA 3LDGA 5HIKA 1P1CA 3SMQA 1JTFA 2PKWA 3M70A 3AWIA 4R8SA 2A14A 3EMBA 4HGYA 3HTXA 3KU1A 1VP9A 4DA4A 4LWOA 2AOUA 2ZIGA 1JR4A 2JHCA 4V0QA 4P7GA 3BWMA 5DSTA 4PYKA 5CVUA 3EMDA 3G2PA 1XDZA 2G8NA 4GOMD 5ICGA 2AVNA 3KQPA 3MB5A 5K05A 4RTSA 3HM2A 4HSGA 1VE3A 1G6Q1 3UJDA 3NDJA 2C7RA 1R74A 2ZWAA 3AXSA 2I6GA 2R6ZA 4YUYA 3HCBA 4C03A 5LQAA 1BC5A 5DTRA 3CBGA 2H11A 5DT2A 5B1SA 2O07A 1KPHA 4PGHA 2HNKA 2PGXA 1JQ3A 5FADA 2LD4A 2PWYA 3JWGA 3LKDA 1G38A 3B7PA 1R18A 4AZSA 3BZBA 2NP7A 5LQCA 2CMHA 2PXXA 3HVJA 5CVEA 3KPJA 3EEOA 2PJDA 3EVGA 5ICFA 2EX4A 1BKYA 4HTFA 1ZGJA 3CGGA 4PCAA 5K0NA 3NTVA 4PGGA 2Q41A 5D1NA 4Y2HA 1NT2A 3OE5A 5EGSA 1ZQ9A 5HIIA 1EQAA 1RJDA 3KR0A 1MJFA 4FZVA 5T64A 1NW8A 1HMYA 1EJ0A 5FWAA 3ELDA 4P7KA 5LSAA 3NWEA 1QAMA 1H1DA 4PYIA 4U7TB 5GINE 1EIZA 3A4TA 2G71A 3NVMB 2YXDA 3P2IA 1T43A 5T6BA 1JSZA 3D2LA 3V8VA 5C1IA 3UFBA 4GEKA 4M7RA 3HA5A 5EIFA 5EVJA 1KR5A 3O4FA 2FHPA 1XDSA 2C7PA 5K0EA 1FJXA 3G2OA 3P71T 3CC8A 2ZCJA 3TKYA 4EKIA 3P9NA 1KPIA 4E32A 1G60A 3OPNA 3OZSA 4KIFA 4QTTB 2NXEA 3KQVA 2XVAA 3OZRA 5K8VA 3R24A 2VS1A 5GP1A 2IIPA 3O7WA 3H2BA 3EVAA 4OBWA 4DKJA 3FTFA 5FWDA 2P3QA 5GM2A 3THRA 3UJ8A 3THSA 3L8DA 5EHGA 5GOZA 5E9JA 2P7HA 2VZ9A 4EVIA 1NV8A 1KYZA 2OB2A 2P1DA 4CTJA 5DWQA 1YFLA 3IV6A 2FRXA 1JG2A 2ZZKA 5FULA 3UBTA 5ICCA 2C7QA 2GS9A 2HTEA 3FUTA 4RWZA 4FSXA 7MHTA 5M5BA 2PT9A 3NWBA 1KYWA 3P97A 2I9KA 2NXCA 1YZHA 3DULA 5DTQA 4EMSA 3T7SA 4E2YA 2QE6A 4GOLD 1JG4A 4AUKA 5KVAA 4FT4A 3MTEA 1MHTA 3FPJA 2VDVE 3DR5A 5CVVA 1X1DA 2V7EA 3DTNA 1NW7A 2PY6A 4NECA 4OQDA 1IM8A 3HCEA 3OU7A 4GOND 4RYLA 4DM3A 2ZZMA 3NW9A 3HA3A 1L3IA 3EVFA 3BWCA 3NMUF 2PLWA 1Q0SA 4IV8A 4MWZA 4R6WA 3QOXA 3CKKA 1AQJA 2UYQA 1VBFA 2ZTHA 5FHRA 3LECA 3ME5A 2IH4A 3FTCA 1G8AA 5EKXA 3G7UA 1R8YA 4GF5A 4R8RA 4DMGA 1I1NA 5JR3A 1SG9A 1VQ1A 4MIKA 3PX3A 2AVDA 1QYRA 2AOTB 3HVHA 4PYMA 5DXAA 5EEHA 2AOVA 1RI5A 3PS9A 1VLMA 3SM3A 2XBMA 2PT6A 5KYGA 4QVKA 4YUVA 1EG2A 5CVDA 4E2ZA 3SX0A 1FPQA 2OKCA 2P7IA 3TFWA 4PCLA 1WY7A 2BR3A 2AN5A 3JWIA 3LCCA 5LQRA 3GDHA 3O31A 2Y1WA 3B5IA 3OFJA 4Y30A 1QZZA 3TM5A 2ZVJA 2GAFA 2XYRA 3MQ2A 1R00A 2PXAA 4JXJA 3UJ6A 1SQGA 1QANA 4GC5A 5EMJA 3PTAA 3ER9A 5E9WA 5KQRA 4K6MA 4M37A 5EPEA 1TW3A 5EQJB 5GWXA 3EVBA 1M0EA 1QAOA 4RX1A 2C7OA 1R6AA 1RI2A 2IFTA 3KR1A 1AQIA 3TLJA 3TM4A 3P9KA 5EMLA 5EC8A 2PX2A 1AF7A 5K0FA 3S68A 4KRGA 4RV9A 1AV6A 5EKUA 1U2ZA 2QY6A 3FTDA 2HV9A 5DM0A 1P91A 4ISCA 5F2KA 2WA1A 5DLYA 4XUDA 5IH3A 4OA5A 1SKMA 1ZHFA 5MHTA 1N2XA 5GIOE 2PVCA 2AN4A 4A6EA 5GM1A 4C4AA 2P3OA 4CKBA 4RTQA 1KIAA 3M6VA 3KQOA 1Q0TA 1TW2A 3HCDA 5U4XA 3BWYA 1BHJA 2EFJA 1ZG3A 1ZGAA 4X60A 1X1BA 5CD1A 2IH5A 2NXNA 2AS0A 3BUSA 3SGLA 3EVDA 3VYWA 3GRRA 2CL5A 1ORIA 5DX0A 3DH0A 3JWHA 2ZSUA 4A6DA 4AZVA 5JUWA 5EZQA 2HWKA 1O9HA 1VL5A 1SUSA 5FUBA 5F2OA 1L1EA 2O06A 2H1RA 5CM2Z 3DLIA 4ZTBA 5G02A 5EEGA 2I62A 3LBFA 4RVDA 4DCMA 2OPBA 1RJGA 3M6UA 5EG5A 4YV2A 1BOOA 2P3LA 2CWWA 3CJRA 5FHQA 3WSTA 4GC9A 1EAMA 3B3JA 1JG3A 2ZBPA 2G72A 2QYOA 3OU6A 3Q7EA 3KPVA 3LDFA 3HEMA 1I9GA 3P8ZA 5EMKA 2B9EA 5K03A 2OB1A 4X1OA 4RTPA 4YUXA 2IGTA 4C06A 2ZZNA 1NBHA 5FQOA 5HOQA 3EGIA 3TOSA 3KPWA 2EJTA 3C3PA 2OBFA 2YVLA 4KIGA 4LWPA 2IBTA 5FA5A 2ADMA 2F8LA 2XVMA 3FPFA 3DXYA 3KQTA 4QDJA 2GA9A 4CXMA 2XYVA 4ATNA 1KP9A 5LQKA 4LECA 2AN3A 3KR9A 4PYQA 4LG1A 4XUEA 4BLWA 3CVOA 5GIPE 4E2XA 2ONZA 1X19A 2ZBRA 1YZ3A 3GCZA 5E8RA 2O0LA 1RI4A 2GB4A 2VDUE 4OQEA 1PJZA 2H00A 3A7EA 4OBXA 4CTKA 4DF3A 3QV2A 2Z6UA 1DUSA 4BY9E 1WZNA 3TRKA 1XDUA 5KS2A 3FPHA 3M6WA 5IKMA 1X1CA 4R05A 1WG8A 2JJQA 3GU3A 4QTUB 3UJ7A 1RI1A 5HIJA 2G1PA 4RTLA 3JWJA 5FQNA 3LL7A 2EJUA 3ELWA 3V97A 1O54A 3DMGA 2HR1A 3GIWA 2Z6QA 5HFJA 4HGZA 2YXEA 3LX6A 3UA4A 2QRVB 3A7DA 3KPUA 4H0NA 4RTMA 3BGVA 3LDUA 2R3SA 1YB2A 3A26A 3K0BA 1WXXA 3NJRA 5K09A 2PV0A 2O57A 4QQNA 3BWBA 5E2AA 4BLUA 4ER0A 1NV9A 5BXYA 3AXTA 3R6TA 4P7JA 3TKAA 2FK7A 5DRTA 2EG5A 3SSMA 3M33A 3G5LA 2FCAA 3KQQA 2ZLBA 4GQBA 3GRZA 1KXZA 3UWPA 3C0KA 4OA8A 2NP6A 5C0OE 2UYOA 4QQKA 1DL5A 3BXOA 3I5UA 3GXOA 5EMMA 3P2EA 5HZMA 3MCTA 1PRYA 2BZGA 2K4MA 3A25A 3MGGA 5K0JA 4KWCA 4E70A 1WXWA 4KDCA 3GRVA 4C04A 2JG3A 4R6XA 2GH1A 3G8BA 3OFKA 5FTWA 5C9ZA 1JSXA 4MTLA 1G55A 3HVIA 4AX8A 2IBSA 3TR6A 3LSTA 3T0IA 1UIRA 1SQFA 3LCVB 3C6KA 4KVZA 4RVGA 1IY9A 5FA8A 4L7VA 3BGIA 4CWAA 2ZWVA 3KR2A 2JH8A 4PYJA 1YFJA 3G2QA 4QVGA 4ER3A 5K0GA 2VP3A 3LGAA 1L3CA 2AOWA 2P8JA 3DMFA 3E23A 3UA3A 3FTEA 4DQ0A 2YX1A 3DXXA 3X0DA 3PLAE 5ERGB 1INLA 1P1BA 1NKVA 5T67A 3UJCA 1N7IA 1NW3A 4WXHA 5E1DA 9MHTA 4EKGA 3K6RA 2ZW9A 4AZWA 5F2NA 3EGEA 4HC4A 1D2CA 1M6YA 4QPNA 3KQWA 3FRIA 2OZVA 3GRYA 3P2KA 3HA7A 5HILA 3FUWA 4PONA 4C05A 3ERCA 3C3YA 5CIYA 1N7JA 1YUBA 2CMGA 2OYRA 2OY0A 3HCFA 3NVKI 4PIMA 1DCTA 3F4KA 3FUUA 3CJTA 4FGZA 1WS6A 1VIDA 1R8XA 4BP1A 4E31A 4YUWA 3NDIA 1XXLA 1L3BA 5E1OA 3OCJA 4E2WA 4YMGA 2IPXA 2YXLA 3PB3A 5BW5A 5H02A 1OR8A 4WVLA 5DTMA 2G70A 2GLUA 3DOUA 2PBFA 4HG2A 2GPYA 2V74B 3Q87B 1L9KA 4BLVA 4PWYA 3CJQA 2AOTA 3DUWA 3PFGA 2KW5A 4KDRA 4RVHA 3PVCA 5DM4A 1XJ5A 2XYQA 3LKZA 1EJ6A 2FYTA 2P40A 4GBED 2YR0A 4CKCA 5KQSA 1JTEA 3G8AA 4PINA 2JHAA 1I4WA 2PSSA 4HTFB 4RSRA 1D2HA 5EZSA 1QAQA 2O05A 2ZFUA 4FR0A 2JHPA 5BP7A 4IKPA 4FS8A 5DSXA 4ER7A 3T7TA 3TPZA 3ELYA 2PX5A 2OO3A 3EPPA 1Y8CA 2YUIA 2PX8A 1RI3A 5K01A 3ANXA 2FK8A
chains in the Genus database with same CATH superfamily
1WPXA 1LNQA 1HE3A 4FFMA 4MW1A 4RKEA 1YE8A 1YUNA 2J32A 3WL4A 1FTGA 1XD2A 1FJHA 5HR5A 1QHHA 4URUR 3GP3A 4I50A 4RDCA 1RYBA 6NULA 3N0WA 2KMLA 4N0QA 4B76A 1GXSA 4RIHA 1D2GA 4NY1A 5J4HA 4QC2A 5IK2A 2BR4A 4E1BA 1IRIA 2O5EA 1EVLA 3WTBA 4HN4B 5JDCA 1I01A 1ZJZA 3ABZA 3TGWA 1CZKA 4BVFA 3TQCA 4Z3DA 1BU8A 1P9OA 4EHNA 1CG6A 4Q4LA 2IY7A 4HQOA 5CAEB 3ZJTA 1WB9A 3NVAA 1DBVO 3SS8A 5EWLA 4DPMA 1YF3A 4P5PA 3H7AA 2FMIA 2AG5A 1TTQB 1LJLA 3W6PA 4DNOA 4EW6A 4O29A 3SYRA 3UGQA 2C42A 5FOVA 1EBUA 4EHAA 3C45A 2OO5C 4AZTA 1YRQA 4M0MA 3EG9A 3JZFA 5F1KA 1VCNA 1U6JA 3RW9A 1FC0A 1X86B 2C57A 3BMCB 2OWDA 1QB7A 1P4GA 1GQSA 4Q05A 5ICSA 3GLIB 2CZQA 2O52A 2ZTSA 3ORHA 1N1MA 1DQRA 5CLLA 1YMUA 4CLXA 3VBCA 4J0HA 1Z3CA 2BFEB 4AIRA 1HLPA 4Q1CA 4OHRA 4UD2A 3PXGA 4BVLA 1Z82A 1CQJA 7ABPA 5LMUB 2RGGA 8ABPA 2NVUA 5DXJA 3I45A 1P61B 3VSEA 4BIMA 1K88A 5CIQA 2G5PA 3LXMA 2E5FA 2IEZA 3GBVA 4YMUA 4C0AC 1YE3A 3ZWAA 1G8JA 1L1FA 2BTOA 2WF6A 3NFRA 4MHTA 3WRWA 3NU1A 4H18A 3ZHXA 2BGRA 2JBAB 4I0WB 4BQSA 2H6EA 3G13A 3R3HA 1DEKA 3AJ8A 4RHYA 2VDQB 4QM6A 1ZNXA 2RBEA 1QIEA 1C50A 1SUCA 2TMDA 2VPQA 1G3UA 1VJ1A 1X1QA 1Y1LA 2A57A 2ORED 3G0GA 3Q3IA 3FYCA 4H1HA 1DXYA 4L9WA 3SC3A 2WUVA 1TKRA 4XEHA 2EBFX 4PX2A 1GARA 1HE5A 1Z0UA 2XXJA 4O8CA 4V0LA 5TEVA 4NV0A 4YS6A 3X43A 3D81A 4Z0HO 3W7VA 4Z4QA 3VDXA 1G21A 3OEHA 3DEKA 3I28A 5E2BA 1H65A 2OD7A 1R9GA 3MT0A 2PH3A 5U9CA 3RJTA 2VHYA 3EEFA 5LP6C 1X7ZA 5M29A 3QYPA 3C7CB 3LOQA 1DUVG 2QRVA 2FTKE 3MERA 3SC2B 5JS6A 1I3NA 2C83A 3I64A 4PAMA 4Q3BA 3UJ9A 3KETA 2QLBA 4GXRA 5LWQA 3ORFA 3SKYA 3M2TA 1ISSA 2XUGA 5LOVB 1NXXA 1UKAA 1ZN2A 2CXTA 2FDXA 3KOMA 4Y2RA 4PWZA 3ZWVA 1GAJA 1K1EA 2CC2A 2FWBA 2JATA 2R44A 3EDOA 3TIFA 1BWSA 1SUPA 3EPRA 1XTPA 3PUYA 4RGYA 5D1HA 5TRTA 1LNSA 1T6BY 1AKRA 2HAEA 1RJEA 5EE1A 4KPYA 4O4JF 4RIIA 3UK1A 3B6KA 1WB5A 3HXTA 2Y1CA 3S1AA 2FAXA 1KK3A 4PQRA 4JL6A 4TVBA 3OQHA 2GM5A 2ATCA 2CCJA 2I2AA 3V4FA 2IVZA 4AF8A 1A9TA 2PD3A 4IV5A 2REQB 3HB4X 2QD5A 4DWWA 4G23A 3SVZA 2G4LA 4AC9A 1SVSA 3DFIA 2G9RA 1TMGE 3DZFA 2OQRA 4B3SB 4DB2A 1PF7E 4D9BA 4FFPA 4IIHA 1J8DA 1JG6A 3DA8A 4KMSA 5ECYA 1NP7A 1XUOA 1J2RA 1F6BA 1KTVA 3AR8A 4J0IA 2NUBA 1DEAA 1QWSA 1XZDA 4D9CA 4HLQB 2F1OA 4PHTA 3F2VA 4DWOA 1T2VA 3ICOA 4K26A 3WDSA 1TRKA 3ISVA 3LDGA 1LK5A 4TKLA 1OD6A 4REQA 2FUCA 3R3SA 2CVHA 4A4DA 5KWIA 2WUWE 3IHWA 4N49A 4M8NE 2A0WA 1GZ7A 1SUAA 3VPGA 1YNSA 3U37A 4R01A 4TSRA 1KP2A 1SVWA 2ECOA 3LI2A 3OIVA 3FKSA 1ENPA 4TUYA 1V3QE 5LYJA 1BWQA 3NP9A 1GPNA 1ZIPA 3LH5A 4JQYA 1YFKA 2GARA 4RA6A 2G6TA 4N0EA 4LNHA 2GZSA 1EUDA 2J7PA 1WQ1R 1LPMA 3VH2A 1EWKA 2X5JO 4UW9A 1E18A 1G6Q1 1JJAA 3ER6A 1WUIS 2VAMA 4ZYZA 1SUBA 4M8LA 1V16B 4KFCA 1E5VA 3AVYA 1NVWQ 3ZX5A 2OGSA 3V2UA 2GCOA 1CP3A 4RZ2A 1CJKC 4LJ5A 2GDJA 3GUZA 2OO5A 1NT4A 4QKQA 3DDSA 3OBIA 1C3OB 3IEVA 5IBQA 1QCZA 3QOFA 1RWMA 3RLFA 4BNNA 1EFCA 5BMVA 4IIGA 4HHEA 4BE4A 3H7IA 3F3SA 2ZETA 2OFFA 2NG1A 2Z1MA 1OOEA 2NX2A 1OKKD 4PCAA 4JKOA 1JKFA 3CQ9A 3OZWA 1RWPA 5H80A 4Y2HA 3OE5A 4KRXA 2LW7A 4AI6A 2YOFA 5HIIA 3A2LA 3KR0A 4JBWA 3W5SA 2QMZA 2XNKA 4UQPA 5EWJB 5KYWB 2BGLA 5EXTA 2R5NA 4G5GA 4F06A 1WUYA 3GEBA 2QTVA 2PL9A 3L6UA 2P2DA 5C4IA 2CDRA 2G80A 3ENZA 3GLHB 4U7TB 2HN9A 5FOQA 2I4IA 3HV0A 1SB8A 2YXDA 3HVUA 3P2IA 2DXIA 1C4XA 2BMWA 2XUQA 5ALGA 3RTDA 4M0KA 4LWZA 1QZXA 4FR5A 2J6CA 1VHDA 5ALLA 2HXSA 4CEJA 3WI7A 1XWWA 2KB0A 5IDYA 2RKBA 5LA6F 3CC8A 2GEVA 5CFOA 1WOMA 4R2WA 1VSUA 3PNOA 5EPUA 1CNMA 3B52X 2ZBFA 4QTTB 4CT0A 1G21E 1T5LA 3CSUA 4LV5B 4DKJA 1OASA 3V4RA 1EE1A 2XZTA 5C8VA 2JGJA 2N0SA 5GOZA 3VPXA 5MGBA 3I5MA 3IX7A 2AXPA 2FN4A 3KV1A 1A2BA 3GBSA 5FYQA 1VL8A 3EQ7A 5LP6A 1KVRA 1F48A 1RCTE 2XQFA 1UDWA 1ZH0A 3SQMA 2Y4OA 4HX9A 3VR5A 3WNBA 1ACLA 4B7ZA 7REQB 1ZUD1 4D0RA 4A8TA 2X40A 4BO5A 3ETLA 1M2GA 2X8WA 3WNDA 2A9RA 3BIOA 3FBTA 3NGMA 4TYWA 5JIBA 4Y0NA 1JZTA 2ZUEA 3P2MA 2ZIVB 1NSTA 3IOEA 2VLIA 4BJ5A 4HF7A 5B1YA 4GYYA 2BPOA 1IEWA 3LVBA 2NGRA 3DLTA 3PQEA 3FJOA 4R6WA 2Q4BA 4HQKA 2IX9A 5AKXA 3OLQA 1D4AA 5JZ9A 4G65A 1I4OA 1A27A 3C8UA 1II8B 3STHA 3I76A 3TVYA 1PGNA 1G7SA 2FKAA 3RAPR 4ZI3A 2J6HA 1MB9A 4X95A 2YYSA 4FFBB 1K7XB 2HT6A 2W70A 3WAKA 2D0IA 3FGNA 3JYNA 1YJBA 1GL7A 3DZHA 3FR8A 2D5LA 1GZUA 3FTNA 4Y8VA 3LUHA 2QRUA 1RP7A 2HPHA 3O2NA 1LLQA 2G17A 2Q46A 4UBMA 4X1YA 2XD9A 4MWSA 2IODA 1SEVA 4F5DA 1E58A 1WUJS 1TZCA 4PSDA 3TM5A 1OYWA 1U5CA 3BC1A 2PXAA 4ZAYA 1L7RA 4JI6B 4NOJA 5KYKA 1G42A 3EXAA 1A7KA 1H2WA 5EQJB 1E3IA 3HP4A 1QIMA 1ZPDA 1QAOA 2W6OA 3LQ4A 4MINA 1GRCA 4G1VA 5L4LA 4W5NA 1LBQA 1NIJA 1PQYA 1DTSA 1HRKA 5HCNA 2ZB4A 1LBIA 4RV9A 1O97D 3EFHA 1I2BA 1SOVA 2X15A 4LVNA 1GAXA 2N42A 4EQ6B 4HATA 5F2KA 2BMJA 1TKBA 2NSLA 4PC2A 3ZWKA 4EO4A 4HDMB 3B20A 5GIOE 3QKUA 4R2KA 4PC1A 5A04A 4B2LA 5GM1A 2GYWA 2E4XA 3N5CA 3VXKA 1H94A 2ZAGA 3AHCA 4Y2UA 1KIAA 3OO1A 4LF7B 1RJ9A 4KEAA 3QXSA 3ZW7A 1ZM7A 3I52A 2SNIE 3LMKA 4KC0A 1BHJA 3VQTA 1TO6A 3QFRA 3MWGA 4EMBA 3W0LB 2VF5X 3P9XA 4X60A 2H7CA 5JSFA 3BUSA 3LP6A 5FI0B 4K0RA 4CGZA 4CKZA 1VMIA 5JUWA 3MZ0A 1J5PA 1JFVA 3GLVA 4I36A 1O9HA 2Q2WA 2JDID 1SUSA 2VTVA 2WM8A 4ZEVA 2HEIA 5I5EA 4NH4A 4XSVA 3DYIA 3HS3A 3N7UA 3C97A 4ZU3A 2JIQA 3KSRA 3Q1LA 2WFLA 3AVOA 3QX8A 1CVRA 4YRLA 4GHWA 4D5EA 1RCFA 4HPWA 4ETWA 4DCMA 3GFQA 5AM4A 2AC4A 4HJRA 1Z6PA 4E21A 3HYLA 2Q6LA 4KYUA 5T4FA 1JG3A 3F3YA 4I1OA 1MFPA 4UTXA 3OU6A 3LY5A 3WZLA 4BMPB 3FMVA 1IAVA 1Z68A 2JLCA 4BB0A 3H8WA 3IP1A 4Z4CA 4OD0A 2P62A 2ZJ5A 1ZD2P 2VI5A 3GMIA 2WF9A 4CCYB 3BEDA 1WD5A 1EDOA 1BA3A 3EY9A 1LU9A 4JJ8A 4K40A 1JKXA 3D6MA 4LDAA 5AI5A 4DJFC 3VYTB 1CZLA 1C4OA 1T2NA 5KX5B 5IM4F 1GKIA 2AW5A 1E1DA 2M6RA 2FZEA 4XDZA 2XNSA 3KQTA 3EF3A 4V0KA 2R47A 3DXYA 4CXMA 3PTLA 1O6GA 1PLLA 2QRGA 2ZTMA 3U3RA 2IU3A 3U6KA 2LR0A 4G24A 2BFPA 1KP9A 1T4CB 2PVPA 3C87A 3IUYA 4MWEA 4LG1A 5CK4A 3HXOA 1KKUA 1JB9A 2BFNA 4ID3A 3LG2A 3R76A 2ZBRA 1ES9A 2OHJA 2RHOA 2AHRA 4JLSA 4P8RA 4KBGA 4ZCRA 1Y9JA 4LC9A 2BP7A 4MEBA 4OQEA 4PNPA 1NXOA 1T5TA 3N2GB 4DLSA 4ML3A 1NN5A 4KNYA 2B61A 2CXXA 2XUIA 3DC2A 1PNOA 2QN3A 3KB1A 4BO1A 1QH8A 3BXZA 2YRFA 3LV8A 4FKMA 1WWKA 2QHXA 1EX9A 3ELWA 4U00A 3OFSA 5F21A 3EMKA 1FUEA 4JYBA 3IUEA 1NU8A 1K68A 4YFYA 3WGMA 3TQIA 3VU8A 3LDUA 1T4BA 1KKMA 3QGMA 4BMXA 5CA0F 3OESA 1RXUA 4IOLA 5DMXA 1F2TA 1S8OA 3NT4A 4I5DA 1SOAA 1XN1A 2O57A 3WLEA 1E79D 2HRRA 3BK7A 5E7IA 1VI6A 4INJA 1I3KA 4KQEA 4P7JA 4EG0A 2R8OA 5THQA 1LK7A 5ITWA 2G5GX 2LDXA 4NPCA 3ZJ5A 3AF4A 9ABPA 1IY2A 1N6OA 2J5XA 3W04A 4FUQA 1OH8A 2UXDB 2XT0A 1J1IA 4U7JA 1XZMA 1SR8A 3D6HA 5BPHA 1CEEA 3C6ZA 1U7XA 2K4MA 1XCOA 2OBBA 3A25A 3G5AA 3S7TA 3WKAA 1DC8A 1XF1A 1YQWA 4MR7A 3QMVA 3G8BA 4BNWA 4D42A 4DDVA 2QPOA 3FAKA 1FRFS 5TV2A 1H8HD 4YRKA 3W2IA 4LYHA 4DJ5X 3EZ6A 1NYQA 2QMOA 3SJCA 4TV8F 2IYYA 1TDJA 3DNFA 4IZ6A 3RS2A 4FCVA 5T7BA 3AHDA 1MXHA 2OM2A 5K0GA 1ZK1A 2D7DA 1E7QA 3LGAA 2DUWA 3JTEA 1TNDA 2PT5A 4A2CA 2ZQZA 4CIXA 5B4TA 4M0CA 2GVZC 3PLAE 2OVFA 2G9QA 2A5DA 5ELXA 4UAGA 3B53X 3R6LA 4URYR 2AGVA 2DBQA 2G9NA 2E21A 4C0JA 1YR7A 4NU0A 5AW6A 1WMDA 4O5OA 1WOYA 4H4DA 1THTA 3RUEA 4RDHA 2H1FA 2HUPA 4EH1A 3DD1A 4QOHA 4WT7A 3L0CA 1SCNE 2BMVA 4ZCLA 1QFJA 2CMKA 2WP0A 4L78A 4BOYA 1PGQA 3H11B 3GHYA 4ALMA 1FFYA 2P4EA 4YP9A 1H6DA 1H4VB 1RFLA 1JPUA 2CNWA 3A4IA 1D04A 1U0LA 3BRSA 5HQ3B 4MIEA 3ZDEA 1ICEA 1VIDA 4DCSA 1EGMB 3DKVA 2Q1XA 2OILA 1T6XA 5G0TA 2XNDA 3RYHB 3GFSA 3PB3A 3QYAA 4LUCA 2WWIA 2FEPA 4J7CA 1OYVA 4KQ2A 2CKMA 4HG2A 3B1ZA 1MENA 1C1DB 2V74B 2QZJA 1L9KA 1PK8A 5K45A 4I66A 3SQLA 4MV0A 4I9GA 1RHUA 2XQVA 3EWAA 4LGMA 3PVCA 1BCSA 3DEAA 2IF2A 1EQUA 3DDOA 3L6BA 3L0YA 4G2TA 4IZOA 3T1NA 2J33A 1Y82A 1QZUA 3ZGOA 2JHAA 2J9RA 3OZEA 4DCNA 1GAQA 2OD2A 4JYMA 1GGJA 4RZUA 1B2RA 1Z0AA 1SMKA 1KSGA 4Y6QA 5KSPA 2PO7A 1GQYA 3ZHRA 4JVNA 2CLMB 2GBLA 2GO7A 3GT7A 2J4DA 1JQLB 3LIIA 4RAOA 4TN5A 4E4YA 5KTKA 2P4SA 4RLHA 1I2DA 1EPUA 2IDKA 2WOJA 2FMTA 2YHSA 2DFTA 2WP8J 4HDNB 4MQ6A 1WXGA 4OFZA 4V2UA 1X80B 3C2QA 3FPBA 5AW3A 4P3KA 1J8VA 2PGNA 3BT7A 2I67A 5CT5A 2ZB2A 3VKUA 5I47A 1VE1A 2ZRJA 2XOEA 2XTZA 3UFXA 1F5NA 1K7FB 4PC7A 2EJVA 2GJSA 2XDQA 1HG0A 1ZGGA 2P6PA 5B3KA 4YT2A 2NO9A 1BROA 4MUYA 5I9SA 2CNDA 1UPFA 2P9BA 4PLCA 4F46A 4GRIA 1SVKA 1FYEA 3JARA 4PAWA 5FV7A 3WHPA 3PQDA 4G56A 1MLDA 1RHMA 5DV9A 1MH1A 3X1WA 4B6RA 4F7WA 4JSRA 4J43A 3G0OA 4LJYA 4PYLA 1RRPA 3AVVA 3ZZ1A 5AW7A 1TU0A 1NMZA 3QI7A 1XAGA 5K3AA 1PWHA 5KJ6A 4OJTA 1SVLA 4MWCA 2Q3HA 3AZOA 3FPEA 1ATZA 4LC1A 2XVYA 1RQ2A 4M9SA 4ZYYA 5LJIA 2FP3A 1LF0A 1GN8A 1N6NA 1Y7PA 2HMYB 2ZXEA 3I8SA 3LK7A 5K0LA 4B47A 3KS9A 4BPRA 5BR8B 2QZ4A 3OIGA 4HLDA 4BIIA 5C2JB 2W2VA 8MHTA 2ZTLA 2ALJA 3B9PA 3TJRA 1GZ5A 4WIAA 4PW0A 4E5SA 5P8WA 1ZK2A 1VIVA 4FLFA 4XWKA 1RT9A 3I58A 1SFRA 1RPZA 1VLQA 4LRYA 5ADUS 5HX7A 1ZIYA 1G8SA 2VO1A 2RJNA 4H1UA 3W9BA 3PQ3A 1NG1A 2EBUA 3FVQA 1LVGA 4MYTA 5EHNA 4K28A 4MEAA 3VPHA 3QPVA 4HAYA 4LHSA 4B1FA 3ABRB 4B73A 1YWGO 2Q6TA 2AZ4A 3CNLA 3EXG2 3G88A 2E48A 3OO0A 4HS4A 5AHKA 4Z9AA 1T6YA 1QH1B 3BB4A 2QZPA 5K3BA 3WGIA 4L8VA 1BH6A 1YC2A 1AK9A 3CWQA 4RADA 3ZDDA 2A1UA 3HB7A 4PS1A 4BNLA 3CLRC 2BEVB 5JADA 3GJSA 3IBSA 1GSAA 1ZNQO 4QNRA 2IHKA 2BE9A 2VQFB 1CYEA 3F46A 2ZWIA 4GU5A 1NRIA 5AKGA 5EFOA 5L3QB 1ITZA 1JAZA 2ERCA 1IATA 1ISFA 1U7ZA 3OE4A 4P82A 4D4KA 3VBEA 2E4WA 5MFPA 1ZD5A 5I7UA 1AK1A 3FDIA 4URXR 2Z56A 4RL6A 2YWEA 2C4MA 3UQZA 4EPVA 4YMTA 3WIUA 2I3AA 4AWXA 2OAP1 4BMNA 1SKQA 2GA8A 5HDBB 3ZD8A 3EZLA 5J58A 2H54A 2GR9A 2WIJA 5G0UA 5HJEA 4WOPA 3WGLA 4A73A 4QT0A 1E2UA 4ZCSA 3GPLA 3E3OA 4N6OA 2YMLA 1JDUA 1US8B 4PVCA 1ZNZA 2PN1A 1QONA 5DNDA 3G02A 3TIVA 1EIWA 4HMQA 4OBEA 3PKZA 3WADA 3MTIA 1Z88A 3ZWYA 5DLPA 4D96A 1JZSA 1HBJA 1UXGA 3B70A 3UIEA 4QZVA 1NY5A 1Z25A 1AMUA 3ZCXA 3HMQA 2J9ZB 3HCAA 1MD9A 4IBOA 2FEOA 2VDWA 3G89A 4XD7A 1ZMXA 3O73A 3IALA 4BEBA 2F3QA 3L8MA 1G3MA 4G8BA 2QTAA 2VA8A 4FI3C 4IH9A 2XRMA 4JT8A 3TEJA 4CV0A 1NLYA 4GOXA 3SOZA 1CK4A 1WCV1 3EXEA 3GFFA 3C5WP 2ZYIA 4GPAA 3UMGA 3K70B 2CGEA 3TJMA 1UEIA 3F1LA 3QTTA 2FLKA 3SXUA 3ZK7A 8AT1A 3HR8A 1XCGB 3DLBA 5DN6D 3S5UA 4B4OA 5IVKA 4KO2S 2NUPA 2W2LA 3E9EA 3EF1A 5IXJA 4NYJR 1VXRA 2WV9A 3C7DB 3USES 4P4GA 2X1MA 1LSSA 3QM1A 4FYVA 4B9AA 2F64A 1N5RA 3AP1A 3V4VB 1TZMA 1YB4A 3Q0EA 3FYHA 1DOAA 1BRMA 3AG6A 4RVUA 2EVWX 3GARA 5AH0A 1VFNA 1BE8A 4Z51A 1I5OA 2XE7A 3R0JA 2LRHA 1X6VA 2QRKA 4GZ3A 1K0FA 1UBSB 3S70A 1I32A 1E3WA 1TOAA 2CHFA 4M1QA 3HKCA 1SIBE 3G6KA 1YQ9A 3NBYC 3AFOA 2IHNA 3AX6A 4ZYWA 3PEVA 1UK9A 3RU3A 3K5WA 4QUIA 3U40A 2AE1A 3UMBA 1YMQA 3AUTA 3ZKWB 5C52B 3EMDA 3H2KA 3SP1A 3TTTA 1OWNA 3RKSA 3CCBA 1CJBA 4U2FA 1RTKA 3E53A 3Q3JB 3IQXA 3NT5A 3O8CA 3AJRA 2VJDA 2WHYA 3KNZA 1JB1A 3S0JA 2CDBA 2H5IA 1F0YA 3QU4A 4QREA 5KTTA 4QGFA 4BX3A 2R6ZA 1HYBA 4HAVA 1QMPA 1KFBB 3ORRA 2H11A 5DT2A 4GI5A 3VR1A 5I4IA 2IU4A 4FIDA 3OJEA 3M49A 2O2EA 4JYZA 3GJ4A 4NHEA 1G38A 4YDRA 3BXXA 4A0QA 5CYPA 1OGIA 1GZSA 2XMBA 4EEZA 2QZSA 5HZHA 1R8SA 1AH2A 4PRLA 3EX7C 4Y6RA 3QPCA 3TE6A 4G0YA 5D87A 3TAUA 4FX5A 3A1WA 1HEUA 3WJ7A 1NT2A 3PWKA 4KXLA 2F43A 5TMDA 2H8GA 4FZVA 2L19A 1BQ4A 1EJ0A 3O2SB 4UPDA 5KYNA 2HDHA 2O2HA 1TVEA 2Y8EA 3LUPA 4EB0A 4NU8X 4ZU6X 1JL3A 4EA7A 1PEDA 3IS3A 1PU2A 2NQ8A 1E9DA 4KJZA 3D6VA 4MKRA 3TK1A 5KVSA 4GPTA 4JLBA 5C3MA 1YIDA 4JN6B 5FTNA 3ROEA 3T3DA 3U62A 4GKVA 3VHRA 1VRWA 2QPTA 2AE2A 3H5IA 2TYSB 3D7MA 3CNHA 4HD8A 3T1QA 5K8JB 3SDBA 4KQHA 1G2QA 2CLOB 4IJKA 2X8JA 1K92A 2IW3A 2QD3A 1W9HA 3DLAA 4XSHA 5A62A 5K6TA 5L40A 2BGMA 2C7VA 1S2LA 5EIBD 1ULTA 1WX1A 4YRSA 5KCMA 2R84A 3WK7A 2NADA 2VS1A 5JATA 2YWGA 4IZIA 2HQRA 2B1JA 4KPUA 1EESA 4MQEB 1P74A 1N3YA 2YWHA 3LUBA 3BHNA 5BVGA 2P7HA 1NV8A 2XMPA 2B5OA 3PFBA 2J0VA 1F14A 2IIVA 4UUOA 4QNNA 1CUGA 4RS4A 3ZWNA 1R64A 2GEBA 1OAKA 5I7SA 2CXSA 1RU3A 3NHFA 3PJFA 3DZBA 2HTEA 1VOTA 4RWZA 4BTEA 3W5HA 1CWUA 1SO8A 2Q3DA 4E2FA 2EHJA 4GICA 5CW2A 4AN4A 1P6UA 4O4JA 4ZANA 1HOXA 3BD9A 3L0SA 2QD4A 1SUEA 3PQ2A 3WLKX 5E3HA 3DZIA 1O77A 3GX1A 1XAJA 2ZE7A 2XIQA 1F8GA 4GO1A 3HA3A 1L3IA 4JASB 4TWJA 4DXHA 2DH6A 1JR3A 3NPMA 3ACCA 4CI0B 1Y3IA 3JPWA 4F1KA 4CU2A 1PJ8A 1H0RA 1RTTA 5AKJA 2RB4A 2GN0A 1IY8A 4D9MA 1X9IA 2R60A 2WW8A 3H2JA 2YOHA 3C6YA 3KVYA 3L0BA 4V3CA 3WQBA 4C76A 4K5QA 1EP3B 4BXOB 1S8NA 1SXGA 2NZYA 1QK5A 4R2JA 1B1CA 3T4EA 2AVDA 1WB4A 2R86A 4QOGA 4V1CI 2GM4A 3PS9A 3NIFB 3SBXA 3DDCA 3CHYA 1PHPA 2JARA 2XIJA 3OPQA 5K5EA 2R68A 1H69A 3BGOS 1GUZA 3GAZA 4S35A 2OKCA 4BDSA 4YRIA 3PC6A 4TXNA 5IWCA 2QV7A 2DETA 2CCGA 3QJYA 4XVQA 3GOQA 5FLYA 4M1EA 2L0XA 3CSDA 4NQZA 2MYPA 1A9YA 3GJ3A 5FR1A 1VCIA 2Z5LA 4F3KA 2GKSA 4P53A 4Q9HA 2PX0A 3UJ6A 2PUCA 4YJHA 4F6CA 2QM0A 2BIFA 2PAAA 1FX1A 1TU3A 2BI8A 4XVRA 3I12A 2QVBA 2A5LA 2YJTD 2YN2A 4J0EA 3SK0A 2YZMA 3UHAA 2QL7A 3UY4A 3EW7A 3VHXA 4DCCA 3BSWA 1W44A 1UL1X 1WRBA 4JAVC 2WQZA 1Q83A 1M9NA 3NKVA 3LY8A 1OH7A 3RSLA 3P27A 1IN6A 1HXHA 3FNEA 4B83A 3U16A 5DHPA 1P2BA 1KZ7B 3DZ8A 5HTOA 1UXHA 3VR4H 2DVMA 4RETA 1N3LA 3DTVD 3ZGXA 2PQ2A 1U8XX 4QXPA 3O84A 5AVKA 4UUMA 1JAXA 2GBIA 2I5PO 1XVTA 4C4AA 1HNWB 3ZZMA 1OLUB 3I92A 2YW2A 5LD2C 3NVDA 5K0NA 1A8PA 5CNKA 3H1BA 2WVHA 3MINB 3ABOB 3BWYA 2F9FA 2PX6A 3BSFA 4D8XA 3A31A 1X8KA 1ZGAA 3SY8A 5CTJA 5DGTA 5GZ6A 1G3IA 3SGLA 4IH1A 5I8PA 2QLTA 1NA5A 4X84A 4A8HA 3RUCA 3GJRA 1HK7A 2ZG6A 5FUBA 4JY7A 3SQNA 1KWGA 3FNRA 4YH1A 1T9GS 4MMYB 1JEQB 3LT0A 4ZTBA 5THXA 4B71A 4RPJA 4MWBA 4K7JA 1YA4A 5BQXA 3ZY5A 1A77A 1RZRA 1KRHA 3M6UA 2C2OA 5A9TA 1SA0B 2HCBA 5CEJA 3AKEA 1Z2DA 4ZD6A 1X1RA 2QP4A 4ALIA 1XVUA 3EAFA 1NSFA 1SQ6A 4YRCA 4FYWA 5LZ7A 3IVCA 3UAYA 3DHYA 1X0VA 1E98A 1Q1ZA 3FAZA 3HEMA 5LA6A 5DDIP 3WHIA 2C96A 2PSFA 3WICA 3HCOA 2CBZA 4RTPA 1O94D 4QRDA 4HTAA 1MBZA 1GNRA 3HB0A 5B3LA 1T5OA 1ZX1A 2PSHA 1XTIA 1ZAYA 3W5IA 4ILKA 2FN7A 2RGXA 1YQEA 3ICCA 1L8OA 3IB6A 4ZVSA 1OGJA 1L4FA 1P9LA 1SZPA 3GGJA 4Q00A 4RPKA 1G64A 5JVDF 2ZJ7A 3H2SA 3IXLA 1QB8A 3TWOA 1HA3A 4RHCA 4BLOA 2AN3A 2WUDA 4KSCA 4BX9A 2HJHA 3CVOA 3IKMB 3V46A 1C3XA 4AKGA 1N2OA 1YZ3A 2V7QD 3GCZA 1QGDA 3WNZA 2QBYA 1Q92A 4G09A 1O57A 1G5RA 5AWFC 4BLTA 3QV2A 4EHIA 1RPNA 4B81A 3DV0B 5AI4A 2C58A 1IZ7A 3NDPA 4MPJA 4TRRA 1RAHA 1U4OA 4JXXA 3E9QA 4F8JA 2NM0A 2V6IA 4QPJC 2EJUA 4D3FA 2I22A 4OM8A 4ZT7A 2HGZA 1XNJA 1JSLA 4EG4A 2GZ3A 2VHVA 1MG0A 2GK4A 1PAUA 4X6YA 1F0PA 1L8XA 1U3FA 4AVYA 3RGWS 2V54A 4WK2B 1ULHA 1U80A 3NNSA 1VM6A 5A4IS 4LJ4A 4AS2A 1AE1A 5E2AA 2GNAA 1NV9A 4UC0A 2XB6A 1AHPA 1XJ0A 2G07A 1NZDA 2B1QA 3AGPA 4I1IA 1QIGA 2GZDA 4XPZA 3SHWA 4IIDA 3WBFA 1QG0A 5LLSA 3VR4A 3T5AA 2NTYC 2PBRA 1FF9A 3Q9SA 4Q3AA 4WJZA 2QQGA 4IM7A 1I30A 3KUXA 2PWBA 4N3AA 1E20A 3KOUA 3BDAA 3KWMA 4TT3D 1Y3FE 3C16C 3PD1A 3W5VA 1O97C 2FUNB 3K8OE 1UEXC 3TQFA 4BN5A 1BH2A 3PNPA 2Q45A 4QYIB 4RVGA 4B6QA 2VP9A 1S3FA 1IY9A 4H6VA 4L7VA 3KWLA 1CXZA 3BOSA 4FEEA 4DVJA 5HOEA 1F5SA 4FDAA 2DMRA 3WX0A 1Y6ZA 3G0DA 3K3PA 4EYEA 1PT5A 1XZFA 4UNSA 3T5BA 3THYB 1JBKA 4AUNA 3IUJA 3LX4A 4NDZA 3M6LA 1TLLA 2IYAA 3PC8C 5ED0A 2D2IA 1WHSB 4OUDB 4X93A 1GGEA 4B3HA 2ZXUA 1VMDA 2C3MA 4BMYA 2GVDC 5F2NA 1LK0A 3LLSA 4M99A 1KRWA 3ILHA 4QPNA 4EO7A 1RMYA 4A8PA 3B51X 5HILA 2XGMA 2I2XB 4FDTA 4AZ3B 2R87A 4C05A 3O3OB 1OKKA 4KR0A 3CBQA 3UHFA 1R16A 2GN4A 4NRDA 1K3FA 4TVOA 4DCUA 3IEMA 2IHUA 5LXTF 1PKXA 4DKXA 2OK7A 3NOVA 4ZZIA 4DV0B 3HE3A 3FMFA 3DKPA 4JFRA 1K3TA 4DQKA 4OHWA 1PV2A 3R1IA 1DC4A 4DMFA 5J9FA 1N2GA 2HHJA 3BQNB 4FGUA 3EDYA 2IPAB 2HBZA 3FFXA 4BQIA 3VJKA 2G70A 2JIPA 2CYAA 2ILTA 1NHWA 2YJ6A 3ZS8A 1FNCA 1XELA 4S12A 4HB4A 5D5HA 1N1DA 5UKDA 3R7SA 4GBJA 3WFIA 3ASVA 1DPGA 4JB0A 4J1SA 4CKCA 3N39C 4DLPA 2D8MA 1WMSA 2PR7A 2IZ7A 3HJBA 2C4HA 3TCNA 2GFHA 2Q3MA 2WJYA 4GGPA 4KK3A 2F6RA 1XZKA 4EHLA 1NX9A 4E5UA 1KFKB 5JRDS 2YUIA 5DXAA 3UPUA 2XZPA 5DHTA 4MS4A 1DARA 2R2AA 1Y6JA 4XW2A 4HGRA 4I4CA 4NYJQ 4WAUA 3T35A 1F7UA 4YQFA 1AVTA 2FPGA 1CQJB 3ESDA 4JOBA 4LWQA 1JLHA 4MUNA 2NVUB 1MKYA 4C7OA 3KUKA 4FEGA 2LTAA 3TDKA 3CRQA 4LVOA 3ZGNA 4YRZA 2VPZA 3VR6H 5KPJA 3K9LA 2ORYA 4B7AA 5M34A 1D6MA 1TCAA 4ZAXA 1DRVA 4C6RA 3GJYA 3P9ZA 2OL4A 2X8BA 4W9NC 3FZGA 2RG1A 3PHLA 4S04A 2NU8A 1NWCA 1H6CA 5CA0A 3DDWA 5HFNA 3GT0A 4PAQA 4ZGBA 2YZ7A 4D56A 5CYOA 2P5UA 5HZGA 4X61A 2B7CA 2LZ0A 1JAYA 3CSSA 2JIDA 3DBOB 1UWVA 3LCUA 3QPDA 4ZWNA 1RYHA 1XXHA 3T7DA 1X8JA 5BMOA 1KFEB 2JFGA 3H9BA 2XCIA 1NUTA 2JJ1A 3WS7A 3ZLBA 4B79A 5JRZA 5KTOA 3C5CA 2YVQA 1G21B 4IDPA 3PFFA 2GN1A 4B45A 4LMRA 1FJGB 5TXGA 3RYCA 4IVRA 5AUOB 4BNVA 5LU8A 5MFZA 1EJBA 2ISSD 4OEHA 2I1QA 3L41A 1X7ZB 2ANCA 2QNRA 2W2KA 3GRUA 4KACA 4M87A 6LDHA 2I80A 4NMWA 5EI5A 2IHBA 1DADA 1T9AA 4UM8B 1RIIA 2Y0DA 2QN2A 2PLNA 1UBFA 2WJAA 3CZ4A 4M49A 3ELUA 4ND6A 4YJ3F 4CW7A 3LWDA 4DJAA 1MR3F 3VYVA 1M5RA 3N6RA 1UDBA 4NIMA 4LNAA 4TXLA 5ALQA 4GM1A 1GQRA 1FUIA 4ROSA 4U7WA 1QFYA 3S1AB 4KLAA 1SOMA 2QIPA 1L4BA 3UJAA 1PDWA 2C3YA 4IGKA 2F3TA 1FB5A 4PHHA 1T1GA 3L46A 4D9NA 2FSVC 3KBBA 1HZJA 4XB6B 5E9QA 4E0BA 1Z6YA 2WWRA 4MUHA 4I1YA 4RW0A 1MCZA 1PX2A 1MMFB 3PC8A 1RWWA 4O1HA 2APJA 2QRPA 3K0CC 4BP8A 3JPYA 2CBGA 3U3OA 3MWEB 3COJA 4LXIA 4F1WA 3FVVA 4TYPA 4COOA 5DW3A 1KY3A 3JRXA 5HMMA 3KSAC 2A9VA 4LFCB 3ENNA 1OWMA 3D8TA 3PGA1 4FU0A 5JY1A 1Z18A 3CF0A 2ZIXA 3D4LA 3R9KA 1RLJA 2JKVA 2OV2A 4ZCMA 1MJ5A 5JCJA 2AG8A 4RV4A 2EU8A 1FU4A 4MJ3A 1FDUA 4WDQA 1FXSA 4V0ME 5HCIA 3IDFA 5EXSA 2E7ZA 2KX7A 4HGNA 2R96A 3LNCA 4KV7A 3WGJA 1NBIA 1Z4KA 4BTVA 2B7LA 2VK1A 3FZNA 4TUYB 5JBNA 5LYJB 1CY2A 1U98A 3L7BA 2HB6A 4RA6B 1CY8A 3PT9A 5D86A 1LDEA 1A5AB 1EUDB 5EIWA 3ZJYA 2H1OA 1JT9A 3R5KA 2M6LA 4MP3A 5L4NA 3V7FA 3H1EA 4K2HA 5ALRA 3VR6A 4AJNA 2J0SA 5CLJA 3KZMA 4K9DA 4CCWA 1MP0A 4ZQIA 3OKCA 2GCOB 1U2QA 2ATXA 4N4AA 3V55A 2OUIA 2VR1A 3L1UA 3IAM1 4JEUA 1QGYA 3QFSA 5CD9A 4JI4B 2PH7A 3RBZA 1TX4B 4QHSA 5CR9A 1UWLA 5CT8A 4RCYA 3ECCA 3RYIA 1ZH6A 4YAOA 4Z0NA 4E08A 5BMVB 1U1GA 2X6QA 2JI6A 3BWXA 1GCOA 5LFAA 5IEBA 3K0SA 2DTEA 1R3UA 2D5CA 3E9NA 4G8DA 1XQ6A 3UXYA 2NVOA 1T9KA 4FGKA 1PIWA 4UUPA 4V2IA 4R8SA 3W3AD 1OWOA 1WHTA 4KYVA 3W5JA 3ZCUA 5JROA 3HTXA 1TUEA 5FBZA 3QVMA 2O8CA 5AVQA 3HYTA 2WIKA 1Z6QA 2Z2JA 4JROA 4DS3A 3W79A 1X77A 2BRUA 3KLNA 2AUNA 5AW2A 4F6RB 2ZIGA 2H8KA 3FOAA 3KUCA 5AHXA 2QTVB 2O2SA 5DLEA 3MTAA 5DU2A 5DSTA 1MC8A 2HBQA 4PYKA 2O0MA 4KMOA 5CVUA 4PR3A 5AM5A 3ZXUB 1NJFA 4E15A 3QMMA 3QXHA 5K05A 1AG9A 2FDCA 4W9NA 4J0KA 4P2BA 2H1LA 2YY7A 2ZUDA 4CEJB 1MABA 3K0EA 4BKMA 8OHMA 1ABBA 5M04A 3QX7A 4HFRA 3L40A 1IM5A 2VUIB 4G26A 2DHRA 1YB1A 2O8FA 1OMOA 4CCAA 3E0QA 1SHZA 4RL4A 2Q27A 1P9RA 1A9OA 2Q21A 1GYPA 6YASA 2BI4A 4YDQA 1QP8A 3LKDA 1OAAA 4HNAB 3SZLA 3ZJUA 4MI3A 1HO3A 4LF9B 1C9JA 3O1HB 2WI8A 4JBLA 1O8BA 3LD9A 3PHIA 1Q1BA 4B0OA 4G8CA 2H9IA 5KC8A 3ZXIA 3EEOA 3VI3B 3IODA 1U3GA 3C1OA 2BHRA 1KO8A 3MW8A 1H8HA 5JWRA 4QXRA 4DBVO 4RZIA 3V8RA 4PQGA 1NURA 2QVXX 4CUZA 2BISA 4DREA 5JDIC 3ZDFA 2PTHA 1U2SA 2XRFA 1EDZA 3IAS1 1MIHA 3W5AA 1N4DA 3R5XA 3SICE 5CXSA 2AK2A 3N6XA 4NTZA 5DK4A 3H3JA 1HE1C 4M9UA 4F4FA 1BAPA 3HJFA 2NO7A 4HMOA 5THKA 4B46A 4EYKA 1T43A 2FEXA 3H2GA 2OP1A 3W8RA 1THMA 2D06A 2W8BB 4EG6A 1UC4B 3O2QB 4QUDA 1DZ3A 4ZEMA 1ECCA 3B1VA 1JEAA 3U7RA 4EVSA 2H7XA 9LDTA 1FJXA 2X7XA 3G2OA 4K9KA 4ZOQI 2XZLA 1PS8A 4P5DA 4HNGA 1KY4A 5KYTA 1J21A 2P6UA 3TOZA 4E32A 3OTOB 1NQOA 4JLUA 2C07A 4I9FA 1VJRA 1VA4A 5KJEA 1JVSA 1QGUA 2VAWA 1M7GA 3AERA 3OOYA 3ROKA 2EP7A 1KJWA 4OQNA 2NZWA 2B94A 4BJ6A 4KR2A 3H3XA 2HWYA 4H6XA 2IBMA 5EJFA 3THRA 1ULAA 2A94A 3GRFA 2G3YA 3L8DA 3K0CA 4LRTB 5EZYF 3UW3A 4X1YB 1G18A 3WLAA 1P80A 621PA 3S28A 4XOIA 2DCMA 4KFTA 3JYPA 2YWDA 3A1FA 2GI4A 4FYKA 3DZJA 1YCGA 2NU6A 1GNLA 1TK2A 2X0JA 3FOCA 5IJWA 3R0VA 3HJNA 4FSXA 4ABYA 3A05A 3MJ4A 3JAWB 1WDMA 5H4GA 3R3YA 3ZV5A 2EC5A 2X13A 1GRNA 1BDHA 2G63A 4GOLD 4JR1A 2XJ9A 4R7ZA 2NOAA 3MJFA 4OQDA 4RYLA 2PY6A 1M7BA 3RVKA 3CVUA 1VKHA 4LEIA 1Z62A 5CYGA 3ESCA 3T3OA 1HDEA 1AB6A 2JAXA 1JP7A 2OKGA 1LVUA 1GFSA 5FHRA 2OBMA 3HBLA 2B35A 1JJFA 2C3UA 3FTCA 3NR2A 4OXIA 4IIFA 5H83A 4ESOA 4J3NA 3UUWA 1V96A 2BFAA 3LS2A 1A1SA 4GZLA 1I0LA 1RJ9B 1VQ1A 2F3PA 4OOFA 5EUQB 1WCYA 5CB4A 5JCOC 4PYMA 1CRZA 3FYTA 3GCXA 1ZEJA 3LLUA 3FVWA 4WY5A 2ZSHA 3HFRA 3SQOA 5A7FA 5C32A 4XKJA 5KTRA 3FI0A 4PQYA 3E9RA 1B0AA 1CQWA 5JI2E 1NLMA 1RW4A 4F11A 3O4HA 3X44A 4C4SA 4QM7A 1OLSA 4Z3KA 1SXJD 1D4ZA 1DDOA 1WY7A 5H8WA 1GZ4A 1XU7A 2ZRBA 5JQGB 1D7AA 3BF8A 3GA5A 1AUQA 3GDHA 3SBOA 3F7NA 1II0A 2MYTA 2PEYA 1UF9A 3B5IA 2MSKA 3PLRA 2WFLB 4LISA 3QJGA 4KLZA 2EGUA 3QVKA 2EG9A 4RD0A 4WSOA 3K2QA 3UEOA 3ER9A 4FGWA 3OQJA 5EPEA 2FWMX 4D8YA 5I7FA 2D1TA 3RJ5A 2DGDA 4PO1A 2J3HA 1ML4A 2HHCA 2OCGA 1NXTA 2G7MC 4M22A 4HLNA 4R98A 1AF7A 2IC5A 5AK4A 1I4TD 5EKUA 2AR7A 1CVLA 4NOLA 4EITA 1FTNA 5DLYA 2A5YB 1EZ4A 1L5WA 4HH3C 5EUBA 4BV3A 5I9NA 1TVKA 1WMFA 2QUAA 3F2IA 2ZBVA 3NWJA 1U28C 2DQSA 2HX1A 5EQTA 4ND8A 5FJIA 3LM8A 1QYIA 1KO5A 3GW8A 4KVFA 2P6OA 1NBOA 5FNZA 1P44A 2NV2B 1U3WA 4QL3A 2EFJA 2XUPA 1SUFA 2NZVG 1Y5MA 1SNYA 2QD2A 2WZDA 1C0EA 1VLZA 4RO0A 1T26A 5DX0A 3VH1A 1JR2A 2BP7B 5IJ9A 4N01A 1P1JA 3UCEA 1YR1A 2QGNA 2Q3EA 1Z5OA 5G02A 3UKOA 4DIDA 1RJWA 1QH8B 1YR3A 2X4GA 1DTEA 4EIWA 1H5UA 2E6KA 1TTTA 2OG2A 5JDIA 2OAGA 3OT1B 4EW3A 4Q3CA 4D8UA 4EF4A 2C7QA 2LVBA 4UZSA 4GC9A 2PU5A 5EIBC 4TMWA 2VH2A 3PUXA 2MR6A 1GQFA 1Q84A 1R5OA 3QHQA 3BREA 4MS1A 3F3MA 1QRTA 2MSLA 3GEDA 5BNWA 2C84A 1F2TB 5EMKA 1JXOA 2QN1A 3TCXB 3GLTA 3MJCA 5D3ZA 2AIRA 1T8RA 2WHPA 3I9V6 4CM8B 1JILA 3P9RA 4LN1A 3ND7A 1X39A 4YIKA 4YR9A 1CF2O 1F20A 2IBTA 4CDMA 1TMYA 4FD2A 4K9RA 1JHDA 1RHRA 5BN4B 3TOVA 1V3TA 3H75A 2H7YA 2P0EA 3MYYA 4QTZA 3WGNA 3FSGA 5FBHA 1NPDA 1GGNA 3LL4A 4A10A 2P77A 2NIPA 4IOMA 3W5UA 2OOSA 2Z08A 5FI3A 3MSXA 3NH6A 1RI4A 4MR7B 4F2WA 2VKTA 4KGZA 4RXUA 5K3FA 4IDQA 3CXRA 4FMBB 2EFYA 5C4GB 2HT1A 1WZNA 4L76A 1UFRA 2P9FA 4PRYA 4HI0E 4DDUA 2P5SA 1QOZA 4TLMB 2PEZA 1O3YA 4MLZA 1AY0A 4BZPA 2J9YB 1NLZA 3PDJA 2KLBA 2ID8A 1CE8A 2VNJA 3SBDA 3VVBA 2JFQA 5ALYA 2HR1A 1Y3HA 5HRUA 2GJAA 2PHZA 2EZ4A 1D07A 3BGVA 3P19A 5DN6A 1UFOA 2H2IA 2XUFA 2EKPA 2Q62A 3D8RA 3P4UA 5G4LA 4AJLA 3NS7A 4CN8A 1QF6A 2GSDA 1HE2A 2X3UA 3W2TA 5IJAA 2WJ4A 3X2EA 3Q2OA 1Z5WA 4EATA 4ZYLA 4KN5A 2ODPA 2DG2A 3MJVA 1P8AA 1UK7A 3K6KA 3QKRA 1H2EA 1UAYA 1WF3A 4WRRA 2XYGA 3R6DA 1XZHA 4Q12A 5EWMA 2P9YA 3STUA 1G5FA 3HXMA 3WXMA 2IZ0A 1KXZA 2NO1A 4KODA 4DCJA 2YJ3A 4RKQA 2P75A 3IAUA 5C0OE 5A3JA 5BWMA 3CUWA 2AB0A 3I30X 5JCOA 5HZMA 1U0TA 1QQAA 5CDUA 4UU8A 4U7GA 4C5AA 1J2TA 4MKXA 2J9GA 3LC2O 2QTNA 1KTIA 3AW8A 2JG3A 4ARZA 1L7EA 1WXFA 4AZ0B 2G1KA 1KL7A 3K70D 4PQEA 3K1YA 3CO5A 2W42A 3CKLA 4MGHA 4WKOA 3UG6A 2WNSA 3DD5A 4QAQA 5HM8A 1JG7A 1AOXA 3MBKA 3VJRA 3IQEA 4CQJA 2J87A 1LI7A 2ZJFA 5IT9A 4QGBA 1BCSB 4FW8A 4KB5A 1ZM4A 2IYPA 1ODIA 2P9JA 3HRHA 1SPXA 4QRIA 2W7TA 4LXTA 4V1CB 1S2NA 4IQ8A 4WUTA 1TD9A 2H3HA 2ODBA 3FTPA 2KSQA 4R5HA 2CNKA 2R5WA 3A36A 3WB1A 3WFJA 3P9SA 1P7CA 1N7IA 2WPDD 3MA0A 4M7PA 5AXBA 2IPOA 5EIEA 4KOEC 4BS9A 3B2NA 5HBGA 3S2IA 3AKDA 1YS9A 3ZXSA 4B85A 3QBJA 1MC4A 4UFPA 1IH8A 4LZAA 3H8VA 2ZCVA 1AS2A 1FTSA 1T2UA 3ZYCA 4R2XA 5BWCA 1GRVA 4N0MA 4F2HA 1U28A 4GSLA 4MHSA 1ZD8A 3X1DA 2GAOA 1V2HE 1XP5A 2VUTA 3D3KA 4MWGA 3UG7A 4INAA 3UFXB 3VO9A 5LZ4A 5C8XA 2W8ZA 2XDQB 4N5DA 1XA3A 2MMGA 2JIMA 1LPOA 4FFWA 4X8OA 4F93B 2OGTA 3QLJA 1Y8ZA 1Z6TA 4OUKX 2ORIA 1T13A 3A8TA 1GU0A 4WVLA 2BHSA 3JARB 3K0FA 5JNTA 1FRZA 1O94C 1PFQA 3OOWA 3Q87B 5SYNA 2QN8A 3UJ3X 4CYMA 1LRJA 4DDMA 4EFMA 5HJ7A 1QHEA 4HN2A 1IU9A 1UBNA 3ITNA 4KDRA 3K0KA 3G1WA 4OKNA 4W99A 4MK4A 1WB6A 4WBNF 4EW2A 2OC9A 4IQGA 2FPXA 4NJMA 4ZO8A 1I4WA 2WY2D 4DJTA 1MRNA 1NDUA 5ESWA 3OQMA 1D2HA 2J5RA 3DOCA 2VTBB 2BTQA 1QFZA 2RGBA 4RABA 2GNOA 4E13A 4YJ2B 5IVPA 4BQPA 5ALIA 3BJIC 3ZS9A 1M8PA 3LBHA 4MGEA 3K1AB 2CVPA 1J42A 3H0CA 3JR3A 4MAMA 3U7JA 1QGAA 2NAPA 1LX7A 4JLVA 2R8XA 3FGZA 5KMGB 5JHHB 3EUEA 3I2KA 1WV0A 2GRJA 2PGAA 5HHTA 1C7RA 4II2A 4QBKA 5FRDA 2UZ4A 1Q2XA 4D6XA 3FB1A 3C5EA 3NORA 3BL8A 5EQFA 4NNOA 3TLAA 3DKKA 1H2BA 5FJJA 3UMRA 4UHHA 1W4CA 5FF9A 3AR2A 1YIAA 4P4TA 2G25A 1YK1A 2VWGA 2WU4A 1EMDA 5IMSA 2EJWA 2ZM6B 4OKSA 2XGSA 3NBKA 4LOLA 4WE3A 5H0IA 2F59A 1X7YA 4OHVA 1FUUA 2ZUVA 4YRBA 2ACKA 5C5CA 4C7VA 1NF8A 3CINA 2PM8A 2HLHA 2X86A 1KQNA 1YVDA 4RQUA 1OI3A 5JWHA 4BX2A 1KYYA 2C8KA 1FJ2A 4C4TA 4E6EA 2WWGA 2BM1A 3FPLA 1K8RA 3EQ2A 2Q6IA 4RZQA 2VQ3A 5FNVF 3BD8A 5FUMA 2JI9A 1Z2CA 1DX4A 5JZOA 2IUEA 3MT8A 2E18A 3G2MA 4BB6A 1Q7CA 3QBDA 5COAA 4BV8A 3BJZA 3L8ZA 4FT2A 4DC9A 1QHYA 1H2XA 1DVRA 1Q7GA 3QW4B 5JE8A 4EYQA 5MN5A 3KCQA 3V6MA 3GMSA 1YA6A 3IKTA 5EMNA 1W5BA 3EGCA 3EDQA 4JNCA 1A98A 1TUBA 4GOOD 1H22A 1YBHA 4IDNA 4TXHA 3RVMA 1DO0A 4YXFA 3N8NA 1ETHA 3G1UA 1ARZA 2WFZA 3B1XA 1ODSA 2QLLA 2Q07A 3MTBA 4RE5A 4E5YA 2PUVA 4PR0A 1X70A 2F3UA 3NQ41 4ON9A 3KQYA 1T2FA 1AHNA 3BA1A 1KHHA 4F2DA 1EH5A 1U04A 2VDWB 4HEA6 4JV5B 2CFTA 4PNEA 1K98A 2OHFA 3DTVA 1AUVA 2BGKA 1XLVA 3EXEB 5I4BA 2WTEA 1LLUA 2FX5A 4S2EA 3VNQA 3ZBQA 3RIEA 3AR6A 1N0UA 2C2GA 4UNIA 1R88A 1ND5A 4ZPXA 5KOHA 4ZQEA 1BU5A 3WJ1A 4WFIA 4US1R 3U81A 1JDVA 3KLPX 4DDHA 2CFCA 4POOA 4X3CA 1L7PA 1P33A 1QE0A 2ZIEA 4JCCA 5LXTA 3CT6A 2R8YA 5B1IA 1XOIA 3TRKA 2V9ZA 2ZB3A 4G5SA 5DGCA 4D80A 2W6MA 3TKLA 1C1HA 4L8WB 2CNBA 1XRJA 4NFHA 4F21A 5DTJA 3JQAD 5J4YA 5KTYA 2DWQA 4LOJA 5LNK6 4ZN6A 1OLXA 1P81A 3M4YA 5JH7B 4OHXA 4EPWA 1QG6A 3JATB 1E3WB 1GTG1 5HMLA 1TM4E 5EHIA 3RT7A 2PX4A 3C43A 3CPHA 2W98A 3HKCB 3PNMA 4FGSA 4JLKA 4ND3A 2R48A 5L3ZA 3UB4A 4X65B 3K1ZA 1VZ2A 2ZM5A 1FDRA 4BP3A 1E2MA 1SKUA 3VC2A 3H05A 4Q1FA 1W36C 3AV3A 2O8BA 2NPOA 1H1TA 2B8WA 3E3NA 3M6MD 4M36A 5JEDA 5A5VA 1ZVKA 2EL9A 2QYHA 3PNYA 5IYZF 4E30A 7YASA 4TVSA 4F6LA 1D0SA 4C22A 1M2JA 3HKEA 2PS3A 3HSYA 3DB1A 5K3SA 2H2GA 4FR2A 1HNNA 4LJLA 5ENVA 2XNHA 3HKDA 1XFAA 1QORA 3I2IA 5DX1A 4EKNB 5LQNA 2PRJA 3B9QA 2BYTA 3L7CA 4RJIA 4BQQA 1DAOA 4HRVA 2CXUA 2QKYA 1AIPA 1V39A 3FRJA 5FB3A 3ZDQA 3NHAA 3L18A 3CO0S 4JZYA 1SUDA 2OMEA 4UNRA 4TMKA 2I7VA 5ALUA 3AYZB 1OI2A 1F1BA 2TSYB 3DLPX 1S0UA 2W6ZA 3DOOA 1VCOA 5CNJA 1O5OA 4ACAA 1PE0A 1FYVA 5J1SB 4ZICA 5SY4A 3DJYA 2B82A 2F43B 3CLHA 4Z8YA 1R1DA 3H8SA 3PNBA 3AEUA 3IT0A 3L8HA 1U7TA 2FFAA 5B2EA 2PZMA 1ZNWA 4ZQGA 3MN1A 5DGDA 3F5SA 1SELA 2J4FA 2X0IA 2GKOA 2AHOA 3BILA 3HKBA 1CNFA 1U8TA 1YSCA 2NO6A 3MB5A 4Q0MA 2FSIA 3RVQA 1TM3E 4CVNA 4EJSB 1PJAA 4B8YA 3NLLA 2HBRA 3QNUA 4M8SA 1F8UA 1QQ6A 5E4FA 5F4BA 3RJ9A 3DTYA 1R74A 4YN3A 5G0WA 3NZEA 1N9ZA 2ZBEA 4PICA 2HSJA 4U9UA 4XIFA 3RIMA 1U8ZA 2RSLA 3OKAA 4Z4IA 1UK8A 1NF9A 3JWPA 4FBLA 3KAQA 2PKCA 3TPCA 3OA2A 1JQ3A 2PMEA 1PSWA 1RIFA 2D7CA 4XWTA 2WWWA 8ADHA 5U1PA 3UICA 1VSQA 3LU1A 1M3SA 4EUFA 5BVGB 4YJ3A 3EVGA 2CLIB 1M10A 2CLEB 2Q3FA 3DE6X 3L7IA 2FQWA 3LGSA 5KSOA 4TRMA 1TA0A 1Z6XA 3I1IA 4ETIA 3THXA 3JZIA 1ZQ9A 4XDHA 3ZU3A 4XGNA 5JY6A 4O4JB 4KREA 1VJDA 2FZCA 3FETA 4DHWA 1DIBA 4DLKA 4EA6A 2WEKA 1TT5A 4NATA 5FWAA 5GV8A 3MTGA 4EJFA 1KZ4A 2HV8A 1E1NA 2B4KA 4QEKA 2J3EA 3W7BA 1J06A 4HV4A 3LHIA 4BWGA 4L3VA 1JKMA 4W1PA 4D5GA 1PR9A 3K09C 3WIOA 2Z8YA 3AKYA 3GBPA 1M6VA 1XDSA 1I13A 2FFRA 4ZOBA 1IHPA 1L2TA 3FCUB 5HE9A 2ZCJA 1QG4A 4UTPA 3BE5A 4D9IA 1T5SA 4MA4A 4QQFA 5IWAB 3D6AA 5FWYB 1U0NA 3TQTA 3Q0IA 2ZB7A 4XWWA 3CTPA 3H1FA 1CVIA 4RPHA 5C5IA 2C7BA 1RYNA 2HWWA 5K0ZA 1EWQA 3PJEA 3EVNA 4IVNA 1KE1A 3IV6A 1SBYA 3F4BA 2QJTA 1GNPA 3UGKA 2REBA 1ZAKA 1ZRSA 7MHTA 5FBWB 3OQVA 1YZHA 4DAOA 4UFNA 4EMSA 4EG7A 4I55A 2NTVA 5AI0A 3BFPA 4CMGA 1Y80A 2C2MA 2PQMA 1HDIA 4AUKA 1IN4A 4IX1A 5CB0A 5E2IA 5HXAA 3WLQA 1B2LA 2OZKA 2HADA 1P0IA 2HDNB 3DTNA 3EULA 3F5MA 4R54A 4UM5A 1TM5E 4TTVA 5DH9A 1ZJJA 2WF8A 1UP6A 4JI1B 4TTAA 2Q2NA 4BO8A 4BNUA 1Q0SA 4D4HA 2MINA 3CKKA 2GBGA 1AQJA 4KR7A 2RGAA 3B2QA 2QUHA 2ZDQA 4Q9IA 1U65A 2E4ZA 2WILA 2LE0A 1R8YA 1IL0A 1I7NA 4LI0A 2Z9BA 4KHPB 2ZRCA 3PX3A 4RKYA 2AOVA 4L02A 4DLWA 3V2IA 2DECA 4GI7A 3C7KA 3D7LA 3P4YA 2CE2X 1LDNA 2AQIA 3D6FA 3ZHQA 3ZY3A 4O08A 1WKCA 2A4KA 2IZZA 2ZXFA 2SHKA 2FMHA 1XQXA 3RVSA 3Q0TA 4JL8A 1DMRA 3LVFO 5BT8A 3OQ6A 3AEKB 3QVXA 3MD9A 2ZVJA 2QTMA 4HAOA 4MYSA 4RSHA 5E3IA 3HR4A 1GZ3A 1QHFA 2WMYA 4HQLA 4EHKA 4M37A 5KQRA 4ALKA 1ZONA 3DKIA 3RFVA 3TLBA 3KAJA 3ZDZB 3BDVA 3WNVA 4AM8A 4R1QA 1E69A 2IFTA 2O1SA 5E6RA 3BERA 2PUAA 1D5WA 4LK2A 2GILA 2C5SA 3YASA 4L8YA 1KIFA 3GHHA 3MMZA 1LBSA 5LA6B 3BL6A 1Q7EA 2ZYGA 1VHJA 3D5QA 1AV6A 1C30A 3SC4A 4DIKA 1I80A 3HPRA 5B5SA 4BRUA 1COZA 4XUDA 4KXQA 3I9JA 5ILOA 1Q6YA 2PLRA 3A3KA 1WBJB 3COYA 3EZGA 2ZUCA 1GIAA 3HBMA 3GA0A 5DW0A 3RSZA 4EY4A 1RE1A 2ZIUB 2ZRDA 3WWEA 3I04M 4OMDA 1QKJA 3C5VA 1HNZB 2XYPA 1JWLA 1JH8A 3IO5A 3TGLA 3VNUA 3OM0A 3H9GA 3WNQA 4BUZA 2HSZA 2IH5A 3I3SR 3M9WA 2Y3IA 1GU7A 3WKEA 5A2QA 4MVXA 1SOUA 3JWHA 1DZIA 2PSDA 2QBYB 4PAGA 2PGIA 3LPAA 1JJIA 1L1EA 5L6MB 2H1RA 4R31A 3RADC 3C7TA 1U7DA 2C9BA 5AK5A 4B5LA 1MEOA 2QP3A 3GWGA 3SIRA 2WAXA 5CX1A 3E35A 1ZYUA 1UZMA 3FZEA 2QB5A 5IP5A 2C61A 4UFOA 3ADBA 1Z7EA 2V45A 3S6JA 3T3PB 1KDPA 2QG4A 3GLFA 3AJ9A 1DIGA 1ONSA 1PJRA 2UVDA 4J75A 3WWYA 1N2JA 1WUKS 4QQ8A 5CITA 4BGDA 2C5GA 3ED1A 3P8ZA 2JLQA 4B8WA 1EA7A 3H18A 2FPPB 2XMZA 1TB4A 2OB1A 3K0HA 4GX1A 4OHBA 4YQYA 3WA6A 1K7EB 4L27A 4EYGA 4BN4A 5B7NA 1DGQA 1XALA 1GPH1 2WABA 1CY1A 2PL5A 2DUJA 3K09A 4NCIA 3HB1A 3JTMA 3VC7A 3UF0A 4LHYA 1XFDA 5EZYA 3SDZA 4KAAA 4FHZA 5DGHA 3A14A 2XCSB 2B4QA 3ZCPA 2R4QA 3LWBA 4JKYA 3H9UA 5DCUA 1E2QA 2H5EA 2HK7A 3KR9A 4NCBA 1NBMD 5LPNA 3CX7A 3ZNPA 1KEWA 2V1XA 1OU4A 1DFIA 1Q0QA 3VTZA 2AR9A 4R1PA 1IYZA 1WU7A 4ERNA 4DLRA 5JC8A 3RUHA 1ZM2A 2PZ8A 5IT5A 5FUQA 5HK8A 1KNQA 5KS2A 3FPHA 5JQWA 1WG8A 4EPRA 5HCUA 2XB9A 1QNFA 1SBTA 2FZKA 5SY6A 3M34A 2Z6QA 4LE0A 4DHEA 2HYDA 2W90A 3A6HA 2DKFA 2ETVA 2YIJA 2YMPA 3IKVA 4RHEA 1XTVA 1EDBA 5FOTA 1O89A 1DWQA 5B3AA 3RVLA 1GOTA 4FHFA 4DIOA 3E9YA 2O20A 3EJWA 3NJRA 3ETDA 4JI2B 5EL0A 5IDWA 1PG0A 1SXJC 3PDWA 1H4TA 4XYBA 5E4JA 5TGDA 1YJXA 4OREX 1KORA 2O2YA 1T0PA 1W2WB 3N2IA 1LPNA 2ON6A 4IIXA 4JB2A 3L6EA 3UMSA 1L7OA 1Z26A 4AJPA 2VFAA 4JLWA 5IZ4A 2W71A 4B43A 1NBAA 2BBTA 3PVSA 1ZHHA 5LJLA 1CUWA 3AOEC 4M4SA 3HUEA 3B5EA 1DC3A 3ONWA 1K06A 3CX4A 4GKAA 4LMAA 4R8LA 1RC0A 4MKZA 4TM7A 4E70A 2X6RA 4FXPA 2Q5IA 3MMSA 3CKYA 4YK7A 4DBLC 821PA 4MTLA 2P8SA 2ZANA 3IL2A 1RQRA 4J03A 1ML3A 1JW9B 1XRRA 1J8FA 1LQTA 2YCLA 5BO5A 3JQGA 3ZY4A 4CDRA 1FX0A 1MO4A 2IPNA 4P34A 4CKCB 2ZRGA 3GYGA 4AS3A 1LX6A 4YEDA 4PC3A 2ZJ1A 3MWDA 3UA3A 4B35A 1N25A 4X8HA 3D9QX 1ZD3A 3AR7A 3KB2A 4L74A 3X0DA 1BS1A 3OUUA 3LXXA 4U02A 1KJQA 4IQ0A 4UAJA 5ERGB 1BIFA 4Z4GA 3ZUGA 3ISTA 3F47A 3JZMA 1GCIA 1R6BX 2G0TA 3AUJB 1W2GA 3L7YA 3OHPA 3F5FA 4L8FA 2I3BA 4XIGS 3V34A 3VZDA 4RGVA 4MS4B 1TMKA 3FRIA 4Y1FA 1T1EA 1VKNA 1XMPA 3A70A 2CJYA 5FD8A 3W9UA 3HWWA 1VSBA 2YQ5A 2F8MA 2FPGB 5DM70 1XWFA 2EX1A 1ECPA 4YP6A 1AKEA 4MAFA 1VHLA 1PJLA 2V7UA 1AT1A 1XTRA 3MIIA 4GWGA 4C7OB 3FUUA 5ETJA 2HMVA 1S1MA 1QH9A 1TMOA 2Y2UA 3WK8A 4E12A 4AO8A 5AQ1A 3BXHA 4BDTA 3NDIA 4FDMA 1Z07A 3A6FA 4CLHA 3SDSA 3ZDAA 5BURA 1U8FO 1NHGA 2CUKA 2NZXA 2P91A 2QUZA 3L6RA 3UT0A 2VOEA 1TEHA 3A06A 4FSHA 4F91B 4BLVA 2X9VA 1G63A 1KQPA 1D4FA 2UKDA 4QBHA 2NU8B 2OTCA 3EODA 5CA0B 2QMEA 2XDYA 4RD3A 3C98A 4FZJA 2QTWB 4BASA 3LIPA 4U2BA 3GLFE 2Y99A 3GH3A 1Z6AA 4HQNA 1XXHB 2CK3A 4NBWA 1U2DC 1IQ0A 1Z22A 3CB4A 3JYHA 1Z6GA 3WO1A 3AJAA 1H3FA 1QFXA 1GGKA 4RMIA 4X92A 1XU4A 1ANKA 1BVYF 3UWOA 5A3VA 2OO3A 2ZRKA 3WQSB 4F4HA 4S1NA 1N33B 3SMVA 2HMTA 3HZOA 4IDFA 2QYTA 1P3JA 1TT7A 1BMFD 1EX7A 4Q3OA 5K01A 1FOEB 4WKBA 5AJXA 5F7OA 5AVUA 1B23P 4QJ4A 3B5JA 1KDYA 4AAYA 3KVOA 1EAYA 2W2KB 1EZZA 2VWQA 2B7BA 3DF9A 4HLCA 1KBQA 3FHJA 1Z8NA 2NNWB 1X14A 4FFNA 4QDZA 2NU9B 3VPCA 5JISA 1V48A 2P5YA 3Q8LA 3OE7D 3STVA 2RGRA 1SULA 3W2EA 1O2DA 2EGGA 3TUJC 2XY4A 1VE9A 2GJKA 2Z5VA 3FGPA 3I8OA 1FLNA 5ESRA 4V24A 5IASA 1B6RA 1YCHA 1KH1A 4EJ0A 3RNOA 2NLOA 3U6BA 1SIUA 1Q0ZA 4LK3A 3IFSA 3AEQA 1KEZA 3M6IA 5I48A 1IBRA 1KQOA 4FHCA 4GUDA 1VBMA 4QQRA 3JSAA 4F3YA 2I6TA 1FFGA 1KKLA 3RRZA 4RTJA 1GQ2A 5HDQA 3RODA 1CUSA 3K96A 4RTOA 1RYEA 5JLJA 1LJUA 2XQIA 4YRJA 5FCDA 3QPUA 3NC0C 2PKEA 4UASA 3PE3A 4UCWA 4UOEA 2BH2A 4C21A 2P2CA 4DZZA 1P9WA 2PUWA 4X63A 3R0QA 2I3ZA 4IO1A 4UVHA 3K70C 1G4HA 2MYUA 4KBYA 1SXJA 1WCXA 4I46A 3HEBA 3PEYA 2X14A 4WJKB 1JG1A 1A2KC 5ECDA 3CNEA 1GPUA 1U94A 1B3BA 1QNLA 2O1XA 4JSYA 2QTRA 3QV1A 4OX9Y 4IVQA 3IUBA 5HUJA 1PFWA 5KYXA 1E2DA 4H1TA 1NF2A 4B3DA 2O3QA 2PU7A 4YMIA 4WY8A 2B2XA 2LWIA 2IV2X 3AOEA 5HIMA 4S3MA 4UXJA 3REOA 1PUJA 4MPRA 3GDWA 4AQDA 4IO0A 1YQGA 1A9XA 1YBFA 3NUZA 3OY2A 1L5MA 1N2HA 1XCLA 3GFGA 3HXKA 4A0GA 4J4TA 3W4IA 4MWDA 1GT91 4H2DA 2PRSA 1E7SA 3A3YA 2NXWA 1FEZA 1T4MA 3IAFA 4ZARA 4TLLB 1UOOA 1DRWA 2GHTA 1BS2A 3KSUA 1E9AA 3KFVA 2KI5A 3TQSA 1A88A 2AYYA 4FYIA 3TDNA 3TINA 5KINB 2COEA 2Q3JA 3BKXA 1FRNA 4WCFB 1DINA 4HBGA 1E4OA 3I05A 4MLCA 4UULA 3UBMA 2VWHA 4REOA 2ESRA 3HWX1 4KGXA 4AKTA 1H5QA 3LWZA 4C2BA 4R3UC 4S1WA 3U5TA 4KIUA 1IXRC 1XEWY 2Q99A 3VUFA 2B2NA 2NXJA 4KG7A 4ENQA 1LPPA 2IF0A 1P4RA 2FRVA 1JQAA 1EVKA 3GRCA 4PIPA 2VF8A 2PUDA 3GO4A 4XQGA 2VHUA 3L1KA 5TSDA 3SSOA 2ANBA 3GZ4A 2O8CB 2WM3A 4XB1A 2ZYUX 4J90A 2FE1A 5BQPA 3WG9A 1O96B 1USGA 3VO8A 4B3GA 3T54A 4C3ZA 4AY5A 3F73A 5JXIA 3C24A 3DP9A 3ZEIA 2Y05A 4F86A 2O8NA 3K2BA 2PLFA 4WUVA 1ISPA 2A86A 1RWXA 4LYJA 1PDVA 4PIVA 3V1NA 4E3WA 3ZKAA 3O26A 4JIGA 2W4IA 2PTGA 3BEOA 1P5FA 5AW9A 4DIEA 3CE6A 5DM1A 2PK3A 1XMSA 6GPBA 3FPGA 1MABB 2X5KO 2WD9A 1OCEA 3EW9A 4WPGA 1FS6A 3NM5A 4X7MA 4WN3A 3ADDA 2O8FB 1TF5A 3FOWA 3JQCA 3DEZA 1KOLA 1VPDA 1Q6ZA 5BSKA 1L4MA 5LB2A 1U2DA 3DQZA 1R6VA 1WW8A 2YV1A 3CF6R 3AIIA 4JA2A 1NX6A 2W6QA 5B6IA 5CXUA 4RF5A 3UUFA 3VAAA 1A7JA 2Z2IA 1FFBA 4TKZA 2ZATA 2F67A 2AYZA 2FR0A 1XZLA 5G3ZA 3WMRA 5HIKA 2IOHA 2QQFA 1A9QA 4MR9B 5JNUA 3O8LA 4YX9A 3N86A 1VMKA 1PJTA 4FPXA 1GL9B 2ZR0A 2QF7A 1L7MA 2UZ1A 4ACBA 2ZDHA 1GPKA 2Q2OA 4LWOA 4HDKB 1NKTA 1WDKA 1E6EA 3K9BA 3PKIA 4R5MA 4ZVLA 4UHEA 3NHBA 3VMFA 1FY2A 1XMOB 3KE9A 5COBA 1G9SA 3JAKA 3AETA 4E94A 3EZFA 3RTCA 2QT0A