2ESRA

Conserved hypothetical protein- streptococcus pyogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
VRGAIFNMIGPYFNGGRVLDLFAGSGGLAIEAVSRGMSAAVLVEKNRKAQAIIQDNIIMTKAENRFTLLKMEAERAIDCLTGRFDLVFLDPPYAKETIVATIEALAAKNLLSEQVMVVCETDKTVLLPKEIATLGIWKEKIYGISKVTVYVNEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase
publication title Crystal Structure of hypothetical protein of Streptococcus Pygenes
rcsb
source organism Streptococcus pyogenes
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2esrA00
3AY0A 2HTEA 2PY6A 3KQPA 4F86A 4PIPA 2OZVA 1R00A 2NP6A 4CTKA 4E2XA 2GH1A 3VC2A 3B7PA 4RVHA 2Y1WA 2QRVB 2ZBRA 4PYQA 5D1HA 3A7EA 3DXZA 3SVZA 4YUVA 1PRYA 1WS6A 4POOA 2P3LA 1QANA 1SVUA 2ZVJA 1P91A 1NW6A 3HEMA 2YUIA 2FK7A 3I5UA 2FPOA 1UIRA 1G60A 3GO4A 5E9QA 3G7UA 3IV6A 4GOOD 5T67A 4E33A 2AOUB 3TM5A 2QE6A 5K0EA 3FPFA 4QPNA 1EIZA 3HCAA 2HV9A 4E2ZA 1XCJA 1FPQA 3ME5A 1M6EX 4KIGA 5LQRA 1VQ1A 1VLMA 1D2CA 3OZRA 2IBSA 5E9JA 3PFGA 4AZWA 2ZZMA 7MHTA 4GC9A 5K0NA 3D2LA 2AN3A 3EGVA 2JH8A 2HR1A 3ER8A 2AN5A 1XXLA 3WSTA 3CJRA 3FPJA 4YV2A 1ZKDA 4YV0A 4FGZA 5EIFA 5LQNA 1FJXA 3FZGA 4PYLA 4A6EA 1ZGJA 3AJDA 1YZ3A 3C3YA 4M38A 4RV9A 5E8JA 1P39A 2IH4A 3E7PA 3BKWA 5H02A 3ER9A 1JTFA 2OB2A 3EVZA 3UJ8A 5EOVA 3CJQA 5CUQA 2PWYA 1YZHA 2VDVE 1O9HA 5DSTA 4CKBA 2P3OA 2C7PA 3CC8A 1MJFA 3O31A 3PX2A 3OFJA 1KP9A 2P41A 4PYKA 3P9NA 4E32A 2ADMA 3EPPA 2G1PA 4CKEA 2BR4A 3GGDA 4X63A 3P71T 3CCFA 2V74B 2XVAA 4DQ0A 4IV0A 4E31A 1JG3A 2OYRA 2ZWVA 4PCAA 1H1DA 3HCFA 4H0NA 4PINA 4BY9E 3KR0A 3LBFA 4X60A 1JQDA 2GB4A 5EC8A 5GIPE 2G8NA 3IEIA 2IH2A 3MERA 3SX0A 5FA8A 3ERCA 1V39A 3KHKA 3DR5A 2O05A 3EMDA 3E8SA 1DL5A 3DOUA 2GA9A 3FYDA 3ID6C 4GC5A 4RTPA 4GF5A 4ER6A 2B2CA 2IPXA 3MAGA 5HIIA 5K0FA 3R24A 3BWMA 1KIAA 3C6KA 3EEYA 4HH4A 4YUXA 1U2ZA 1I4WA 1O54A 3LECA 3DH0A 3G2QA 1WZNA 4LECA 1KHHA 1TW2A 3GRRA 3RIEA 5LSAA 4KDCA 5F2NA 4OBWA 3G8BA 4LWOA 1YUBA 4EKGA 1KPHA 3KQOA 8MHTA 2OO3A 2BR3A 2UZ4A 2GAFA 1HMYA 4OQEA 5KQSA 2OB1A 4GOMD 1XDZA 4DCMA 5CD1A 2GS9A 2IIPA 3B3JA 1TW3A 3EVDA 5DX1A 5FHRA 4R8RA 5EGSA 4QDKA 1ZG3A 4PYMA 5FTWA 2G72A 1VBFA 3MGGA 5D1NA 3ELDA 3OE4A 4L7VA 3AXSA 3HTXA 4QQKA 4P58A 1NW7A 1ZHFA 2PLWA 2G70A 2H00A 2PWPA 3HCEA 4C08A 3KQVA 2IH5A 4V0RA 3OCJA 3F4KA 1AQIA 1X1AA 4C04A 4BLVA 4YUWA 2PX5A 5P8WA 2R3SA 4ER0A 2PGXA 2PXAA 2EG5A 2IDKA 4YV1A 1NKVA 3P97A 2FYTA 5DWQA 1EG2A 2P7IA 3EVFA 3FYCA 4OQDA 2P40A 4X61A 3BXOA 3G88A 1R6AA 3ELYA 5E2BA 5GOZA 5HZMA 3BKXA 1RJGA 2G71A 1G8SA 2ZIFA 3EMBA 3VSEA 5LQCA 4GUAA 4FP9A 5EQJB 2YX1A 4RYLA 4DF3A 3ELWA 3E05A 5LQUA 3CBGA 3BGIA 1JG1A 1INLA 2O57A 5DTMA 4RTQA 5EIWA 3UWPA 3JWGA 1XDUA 2Y1XA 4M36A 5FULA 2IBTA 2BM8A 3DTNA 1XTPA 2I62A 5E1BA 5EEHA 4B17A 4C03A 5B1SA 5G02A 4DZRA 1KR5A 4KWCA 2ZLBA 4DCGA 1FBNA 1UWVA 4RVGA 3DLCA 4BLWA 4P7KA 1L9KA 3MTEA 5GINE 4MQ4A 1NE2A 2ERCA 2LD4A 2B78A 1I1NA 4P7GA 3NJRA 5EEGA 2HWKA 3GNLA 3B89A 5FQOA 4YUYA 4UOEA 1VL5A 5M5BA 1R18A 3S68A 3UFBA 1PJZA 2AOTB 4PYJA 3HCDA 5KS2A 4MWZA 2CMGA 3BGVA 4QQNA 1UFKA 3NW9A 1JQEA 1WXWA 1RJDA 3M6WA 2F8LA 5CCXA 4OX9Y 4PWYA 5E1MA 3OU6A 3V97A 3C6MA 2NXEA 3HVJA 2ZWAA 1P1BA 5EMKA 1NBIA 1VE3A 1VP3A 3GRZA 2UYQA 5DRYA 4MIKA 5DTRA 2OBFA 3G5TA 4DMGA 1P1CA 1XCLA 5ERGB 2QYOA 3KQYA 5K0CA 3AWIA 2AR0A 3C3PA 2PX2A 2ZIGA 3FUXA 5E9WA 4HTFA 4CXMA 2JG3A 3MHTA 2WA1A 3PS9A 4Y2HA 3NVKI 5CIYA 1N7JA 3HVHA 4KIFA 5DTQA 1R8XA 2PXXA 3R9XB 1XJ5A 2PX8A 1JSZA 5EMLA 5HIJA 5BXYA 1AF7A 1G38A 4DKJA 4FSXA 3MB5A 5E1DA 1D2HA 1I9GA 1N7IA 3HVIA 3NDIA 5KVAA 1KYWA 3HM2A 3PLAE 4K6MA 3FPEA 2O0LA 3OE5A 4HGZA 2ZBPA 3KQTA 4R8SA 3TR6A 5JUWA 3DMGA 5GM1A 2EJUA 2PV0A 5JR3A 2ZIEA 1FP1D 3P9KA 5GIOE 1JSXA 1XDSA 5CCBA 2Z6QA 3A7DA 1IXKA 3UBTA 3LPMA 3SXJA 2P7HA 3UA4A 2IGTA 5EMMA 1R74A 1ORHA 1NV9A 1QAOA 3NTVA 3HCBA 2H11A 2AS0A 5K0JA 1G8AA 3LDGA 3DLIA 2YXDA 3LSTA 3FTCA 2ZCJA 5EG5A 1BKYA 3B3GA 3TMAA 1KXZA 2P35A 2P8JA 4RTSA 3K0BA 3BT7A 4ISCA 5DLYA 3M33A 4KDRA 3TKAA 4NECA 5HIMA 5ICCA 5GM2A 3T0IA 4CTJA 2C7RA 3PB3A 5E2AA 3M6UA 4OA5A 2DPMA 5LQAA 3GCZA 2P3QA 4P7JA 4ZTBA 3RODA 1JQ3A 1SUIA 3FRHA 3NWEA 5DX0A 3GDHA 3THSA 3E23A 5FA5A 3DUWA 3VYWA 5EZSA 4U7PB 1FP2A 2AZTA 4RTJA 2XYQA 5ICGA 2BM9A 3BUSA 4HSGA 4M7RA 3Q87B 4PYIA 3KQQA 4FS8A 3TRKA 5KQRA 5KYGA 3DULA 2ZULA 3PVCA 3LKDA 3SMQA 3EGIA 3I53A 3SSNA 3GIWA 4X1OA 3QOWA 3DMHA 3EGEA 4E2YA 10MHA 1YB2A 3NDJA 1F3LA 5HILA 1G6Q1 2BZGA 4GEKA 3FUWA 5DSXA 2K4MA 5ICEA 1L3CA 3I58A 2OY0A 3KQWA 4KW7A 2UYHA 3G8AA 3M6VA 4P7FA 1T43A 2NYUA 2OPBA 3I9FA 5DM2A 5HEKA 4O29A 4RTNA 1AQJA 3O4FA 4F84A 1X1CA 4PNEA 2JHAA 3OU7A 5HOQA 3FTEA 3ANXA 3R0QA 4ER5A 3DMFA 4GQBA 1ORIA 4M37A 2E5WA 2I7CA 4QDJA 3G5LA 5K03A 2C7QA 3KR9A 3G2PA 4QTUB 3KPVA 1NV8A 4XUDA 3GU3A 3LDFA 4IWNA 2YQZA 5DX8A 3UZUA 5MHTA 1KPGA 1RJFA 5C0OE 3GRVA 1Q0TA 5T6BA 3CVOA 3G2MA 3KPJA 3P2KA 4YMGA 2QRVA 2XBMA 2VDWA 9MHTA 2PKWA 3EVGA 3FPHA 3NMUF 1QAQA 4F85A 3FPGA 4GBED 5FHQA 3L8DA 3UJ6A 3BWCA 1WY7A 3UA3A 3TM4A 1BHJA 2CWWA 2YXLA 4ER3A 5FADA 3P9IA 5FCDA 3HNRA 1RI1A 2AOXA 2XYVA 4AUKA 5C1IA 1KYZA 3LCUA 2AOUA 4EQZA 1AV6A 3HCCA 2OXTA 3K6RA 3T7TA 4RTRA 3JWHA 4PCLA 3I64A 3P9CA 1SUSA 4MHTA 2ZTHA 3REOA 2EX4A 4XUCA 3FUUA 1X1BA 1IY9A 1NW3A 1RI2A 5FWAA 3HA7A 4AX8A 1BC5A 1L1EA 3P2IA 3MTIA 1SG9A 3A25A 3G89A 3KPWA 4GOLD 4RVDA 2ESRA 1HNNA 4EK9A 3PFHA 4PYOA 3TQSA 3HP7A 3PX3A 1ZQ9A 3LCCA 2AVDA 2HMYB 2ZBQA 3FRIA 3FTDA 4RSRA 3A4TA 5EHIA 1RI4A 3LKZA 3TOSA 4V0QA 2ONYA 2CMHA 3G2OA 4LWPA 4QPPA 5E1OA 1YFJA 3TPZA 4KRGA 2AN4A 1NT2A 4C4AA 3B5IA 4YUZA 5C9ZA 1JR4A 4OBXA 5E8RA 1KPIA 4BP1A 2GPYA 3A26A 1Y8CA 4FSDA 2BH2A 3OZTA 2HNKA 4FT2A 2B9EA 2ZFUA 5GWXA 5CVUA 2PJDA 1NBHA 3M70A 5IH3A 3DP7A 4Z2YA 1X19A 1RI5A 3PTAA 2Z6AA 3LHDA 2A14A 4IV8A 3R3HA 5BP7A 3HVKA 3ORHA 5DRTA 4CKCA 3DXXA 1EAMA 1QZZA 3H2BA 3TKYA 1SQFA 2GLUA 3R6TA 2Z6UA 2FK8A 3JWJA 4E2WA 1L3BA 3LDUA 1OR8A 4Y30A 5EPEA 2YVLA 2PT9A 3FUTA 4BLUA 3HA5A 4OA8A 2AVNA 1VIDA 5K01A 4FR0A 5GP1A 2YXEA 3UJBA 3LL7A 5DM1A 4WXHA 4PONA 2N47A 3SSOA 2OKCA 5CM2Z 2EJTA 3B3FA 4PGGA 3UJAA 4DM3A 5IKMA 3EVAA 4PGHA 4QVGA 5EKUA 5U4XA 1SQGA 2JH9A 4A6DA 5BW4A 2PVCA 2IFTA 2PXCA 4QTTB 3CJTA 4HRAA 3KR1A 4E30A 5HFJA 1M6YA 1WXXA 3EVEA 3KPUA 4E70A 5K0BA 1SKMA 5DM4A 2ORED 2C7OA 5BW5A 1VP9A 2CKDA 5EKXA 4EKIA 2B3TA 1XVAA 3CKKA 3GRUA 3O7WA 3BZBA 1JTEA 3OPNA 1Q0SA 3P8ZA 4GOND 3KU1A 2JJQA 4HC4A 2VDUE 4IKPA 5EVJA 2VS1A 5DXJA 3RW9A 3TLJA 4HTFB 3AXTA 1QAMA 5CVVA 4R6WA 3DXYA 2BR5A 3TFWA 1VPTA 2PT6A 3SR4A 2ZSUA 4EVIA 5LQJA 4RTKA 5F2OA 1YFLA 3FUVA 4C06A 3IYLW 2EFJA 1EJ0A 2NNWB 5FUBA 4YMHA 1MHTA 2VP3A 4KVZA 3BWBA 5DPMA 5ICFA 2QM3A 2QY6A 1B42A 5F2KA 3NVMB 2O07A 4RVFA 2P1DA 3QV2A 5K8VA 2ZZNA 3KPYA 2I6GA 3QOXA 2O06A 4EMSA 3M6XA 5K09A 1NW5A 2WA2A 2YTZA 5DXAA 5EZQA 3LX6A 2PSSA 4LG1A 1RI3A 1Z3CA 3UJ9A 1N2XA 5K05A 3IHTA 3EVCA 4FT4A 2FCAA 2ZZKA 4HGYA 4PIMA 2NXJA 5K0LA 4ATNA 2FRXA 4C07A 5LR6A 1L3IA 3GJYA 4HG2A 4RWZA 3X0DA 4AZTA 4AZSA 1IM8A 3P2EA 3T7SA 1O9GA 3THRA 4G56A 3GWZA 4MTLA 5CVEA 2DULA 1WG8A 3KR2A 3NWBA 1BOOA 1NW8A 2ONZA 2Q41A 1G55A 1QYRA 2AOWA 2IP2A 2ZW9A 3CGGA 2YR0A 3M4XA 2AOTA 2CL5A 4R05A 3MCTA 3GRYA 3UJDA 5LQKA 1DUSA 1EJ6A 3JWIA 3LBYA 4PYNA 4RTMA 5CVJA 1RJEA 4DA4A 5EMJA 1M0EA 3SM3A 4RTLA 3A27A 3BGDA 2I9KA 4JXJA 3OFKA 3VC1A 2UYCA 1F38A 4R6XA 2B25A 5CVDA 2UYOA 5EHGA 3ELUA 4U7TB 3Q7EA 2NXNA 3BWYA 1TPYA 4RTOA 5DM0A 1ZGAA 4C05A 3KKZA 4X41A 3LCVB 3FTFA 2VZ9A 1D2GA 2R6ZA 1JG2A 1YF3A 4RX1A 5DT2A 5HIKA 3KQSA 1DCTA 3GXOA 2JHPA 2H1RA 3OZSA 2WK1A 2KW5A 5FQNA 2IDJA 4XUEA 4CWAA 3EVBA 2V7EA 3SGLA 4BP3A 4FZVA 1EQAA 2XVMA 3C0KA 4QVKA 4AZVA 1JG4A 2PBFA 3T7RA 3U81A 5T64A 2XYRA 3MQ2A 4WVLA 3PT9A 3UJ7A 5K0GA 3LGAA 2FHPA 2NXCA 2JHCA 2AOVA 3HA3A 2NP7A 3KQMA 5FWDA 3V8VA 3SSMA 3MCZA 3OU2A 3UJCA 4ER7A 3EEOA 1X1DA 2PX4A 1R8YA 4XCXA
chains in the Genus database with same CATH superfamily
2JIOA 3D7KA 4CMBA 2PMWB 2J32A 1T34A 1BMFA 2OCLA 1R4NA 3DDNA 2ZRHA 2RB4A 3EJ6A 4D82A 4L50A 4ZXPA 4LDRA 2VCEA 1NXSA 1X2BA 3T94A 2MTBA 2J9FA 1IONA 2JVJA 2MSNA 3LY7A 4IPTA 4RS4A 2IK8A 1DARA 2P3LA 2G7ZA 3ZCPA 1RXSA 5KNLA 4AVYA 3I5UA 3VZRA 1EP1B 4IHAA 1HI9A 2FUG6 2HRRA 4D96A 1HDYA 3AETA 2NSDA 4O4HA 4OYLA 3TM5A 1J9GA 2AG8A 2C3YA 5ESXA 3AESA 3MWGA 1XCJA 3IKVA 4KI7A 2LW7A 3V55A 1FMTA 2GZ2A 5IYZA 3INGA 1Y8RA 4CLDA 1ZDMA 4RKYA 5IEBA 1IJBA 1E89A 1NYRA 3W1WA 4B81A 2X4GA 2JFUA 3AY7A 4ENPA 2PGAA 4HEQA 5FAKA 3GP3A 3OVMA 3WLAA 3WSTA 3DT6A 3FPJA 1C0LA 2OFFA 5AK4A 3SN6A 2O8CA 5TVGA 4HD8A 4TTPA 6REQA 4W9NC 3MJHA 3A70A 1WMFA 4IJKA 4OXKA 1GGNA 2D54A 4QC2A 4NU0A 1ZN2A 4M9RA 2ZM5A 3RWMB 4MV7A 1E6MA 1UPUA 1CIVA 1ZAKA 2XB2A 3U1VA 2GD0A 1AE1A 2I3AA 4OEHA 2AJLI 1C5KA 4AZ0B 4ED9A 3ONDA 3PXBA 2GHQA 1MTZA 3DEAA 3QYAA 1BXKA 3H05A 3TXAA 1JG3A 1HTBA 3LC7O 3H7AA 4PINA 3PNLA 5FIUA 4PRKA 3UMRA 5G3ZA 4X60A 5FRDA 5MDHA 3RPEA 2AC4A 3HRIA 3KHUA 1HA3A 1T26A 2VNKA 4FBGA 3R0ZA 4PICA 1XXHB 3RQIA 1WNTA 2C7BA 4N49A 5AOAA 4RIIA 2IGBA 3R3SA 3UXEA 3WV4A 3GUYA 3X1XA 3C3AA 1B16A 2GVZC 3GWGA 3CWCA 4OIFA 4WE3A 2R00A 3EK2A 3ROKA 3K35A 2JK1A 1LLCA 5K51A 1XI2A 1O54A 4LOJA 5AVZA 5JPCA 2OESA 1FFSA 1LRKA 4QAJA 2P65A 3DBHA 3GRRA 3CWQA 3QI7A 3GGSA 4PANA 3R5XA 2V45A 3QY9A 1HBJA 3FIJA 4UMVA 3LUHA 1TAGA 3O95A 2PVPA 3GNQA 3PWSA 4PX9A 1N0UA 3N2GB 1PR0A 4TTQA 4U7GA 5FNVF 5KQSA 1XDZA 2X8LA 2QX8A 2YHUA 4WXMA 2C77A 4P8RA 2G9UA 1VBFA 2CJPA 4TTAA 4JLUA 1NZDA 3KSUA 2OQVA 2G63A 1LLFA 4HFMA 5IF3A 5JD4A 4L7VA 3GFFA 4MVYA 5H59A 5AH0A 4FW8A 5A5VA 2PH1A 3JQ8A 1L4YA 5EJAA 2FMXA 3VPCA 1TLLA 4UD6A 4OHZA 2V4UA 3BEDA 4C08A 2GSDA 4MROA 1UQRA 1WQ1R 4RVSA 4KBGA 1Q17A 3HDVA 3N6XA 3NIDB 4WLOA 1EP3B 1U3GA 5DBFA 2JLUA 4RKFA 2IDKA 3K0AB 1G20A 3PHHA 4YJ2F 3PC7A 4UXIA 3ZJTA 3L0OA 4YJ3B 1D1PA 4ZMRA 4PFJA 3MS7A 1IZ0A 4ODIA 1NVTA 4YECA 1G8FA 3WLSA 5K8LA 4OFBA 1LJLA 3GG9A 4D4HA 4TMZA 3MPOA 5DTMA 2CNWD 2O57A 2C03A 3ICPA 3HE3A 4GMXA 4L5JA 4IFEA 2VT2A 2H6EA 3BQNB 3GEMA 3IAS1 1JDUA 3JQ7B 4D41A 2WWRA 4LCEA 2XZDA 4RY0A 2HGSA 4NF2A 1WD7A 2DWUA 4JNKA 4A6XA 1Y3IA 1JDSA 2R60A 4MP8A 4X6YA 5FA6A 3JVIA 1TJPB 2W8BA 3I6ZA 3NTRA 3VJMA 5LOVF 4FLEA 5FBZA 4YACA 1JQAA 1UR5A 4ZAZA 2H2FA 4G5RA 5ITVA 1ZD5A 2XQIA 2JI9A 3BEOA 2J9YB 5AOVA 1WZCA 3KSDO 1L8QA 1UWLA 1E1KA 2JNWA 4I4IA 2RGNC 4BFWA 2XNJA 4FGSA 5FJIA 1JWAB 5B7NA 1EWRA 3JD2A 1ODSA 2QN6A 5JMTA 1KARA 3ZWKA 3BMOA 4OX9Y 4JBLA 1FUYB 4AKTA 4YCLA 4BNFA 1KGSA 3HVJA 3TQRA 2VT6A 2JI4A 2ZWAA 3U9SA 3L7IA 2WHYA 4YUWA 3QF7A 5D7NA 3VJKA 4K9LA 1IWBB 3FKSA 1V7PC 3G5TA 3D8SA 3MSXA 3KJHA 5FO1A 2NQ8A 3GH1A 4MVJM 3TJMA 1RVV1 3WA7A 5I7AA 1N78A 4FDLA 1RM4A 2D2IA 2H0AA 2PX2A 4N9WA 2IF0A 1GM5A 2VK8A 3D4IA 3ORQA 2CBZA 5HJ5A 1HR0B 4TV9B 2V7XA 2V6FA 3W4JA 3EBOA 1AO0A 1JEEA 3SZMA 1CYEA 3TOXA 2WI8A 2ZSIA 4J90A 3N59A 3VVBA 1RYDA 4WWHA 3FJOA 5K2MA 4BBAA 3SHFA 5FOQA 1R4AA 1D2HA 3ZGOA 3WJ7A 1WXFA 1Q95A 3WWPA 2FE1A 2IW3A 3QSGA 1CK4A 4Q47A 2IU6A 3C7CB 3GLVA 1Z0UA 1M6HA 2ZBPA 1HFJA 3SDZA 3TR6A 3VHLB 1SCUB 2ECQA 3WYGA 1GGJA 2PV0A 4N0QA 3EE6A 1ISPA 2ZIEA 3HZZA 5I4IA 5GIOE 1XDSA 3PC3A 4G5YA 1U04A 1LA2A 3A7DA 3P27A 3SXPA 3GP8A 4B43A 2IY9A 4LY3A 2F43B 2OHVA 5UKDA 4QOHA 2GZDA 4L2IB 3IPLA 1OYWA 4BVBA 3GT3A 1A77A 4FSHA 4NJEA 1Z0SA 5DP1A 4EVQA 2HB6A 1DGQA 3VKFA 1V4VA 3OG9A 1PNVA 5LXTF 3OHMA 3RROA 1FTWA 3JWPA 1D5WA 3D4PA 1YZLA 2FZEA 3EY9A 5CA1B 1KY2A 1RXYA 3ZDQA 1UC5B 5HUQA 4P3XA 4F4IA 1H2BA 2IHKA 4OI2A 4WFKA 5JWHA 1YDWA 4D0GA 1LNSA 1E9SA 3RAEC 4R2XA 2CD7A 4X97A 2AMJA 2KSQA 5KYWB 5EZ6B 1E9BA 2YY7A 2J0EA 1ITZA 2Q8QA 2EP5A 3DGFC 2V0CA 4HQRA 2GZ1A 1OGIA 2E49A 2G25A 4IUYA 4DJEC 5IKXA 3QP9A 2GNOA 4H1TA 2QN3A 1NBWB 1FP2A 1D2MA 2FMIA 4X1YA 3V4PB 5KU7A 2Q2WA 4KXFB 3THYA 2F8TA 2BM9A 2GLXA 5ERXA 4GR5A 3KQQA 4YAGA 1ML3A 1Z2CA 2POCA 3HK2A 1KA9H 1UEXC 2CLMB 2IBMA 2E4AA 4X9XA 1DPGA 3JQRA 3RTGA 3THXB 1LBSA 5JQGB 1YRAA 1MG5A 2X8WA 3ZIAA 4BN4A 2P79A 3FDXA 5HILA 5K4AA 2K4MA 1VL0A 1MAHA 2LUOA 4P3NA 4R68A 3MMXA 2Q7DA 4BQIA 4DQVA 4ZYWA 2YDXA 2QN1A 1A9TA 1VE5A 2CXNA 1W76A 5DM2A 5JSZB 4P5EA 4JUFA 3AK4A 3H2SA 4KSBA 4B4OA 4CLEA 1FDSA 3UFXA 2JHAA 3L9XA 4ER5A 2RGWA 3C3MA 2ZBVA 2Q3EA 4DDVA 1O3YA 5FOTA 1HSOA 2C8VA 1U6JA 4MQFA 3AVXA 2ZSEA 1C7FA 1Z7BA 1ULSA 4M9UA 2P69A 2ZWMA 3C2QA 3HR7A 4MRMA 3W8NA 3ETCA 4FDMA 1CERA 4FYXA 1CUWA 4I55F 4LWQA 2D4HA 5BN4A 4DR5B 1V45E 4I4LA 3NMUF 3EAFA 1FDOA 3G49A 3PC6A 2Z2XA 4GSLA 4DDWA 2HU8A 3AL0C 4UAJA 5FHQA 5I4BA 4JJAA 1A7JA 3L6UA 6NULA 2XGOA 3LJKA 5U4QA 3WNVA 1KERA 5CMLA 1KZ1A 1AVTA 1JI0A 1JHRA 4QNRA 5CM8B 4EUEA 5CLFA 2QRKA 4NG4A 2OECA 4QFDA 1NJ6A 3RSCA 3WIUA 3WQSB 1UXHA 3WK8A 2IS2A 2UZ1B 1ZESA 4XW2A 4RVCA 4ZAVA 2C2KA 4MI9A 2GAIA 3KB8A 4C9BA 5CB0A 1U9YA 4PR3A 2H2IA 3CH7A 5LP6C 3WMRA 1FDVA 1XWIA 2FFAA 4UBMA 4HX2A 3O3CA 5T4HA 3WK4A 5L4SA 1ZRNA 4HS9A 4WN9A 5K1ZA 3FTNA 5IVHA 4M1ZA 3PR2B 3CW2A 4CLXA 1Q92A 2BKUA 1I1QB 1SRRA 2WC1A 1O0SA 2J9GA 2O2SA 3G2OA 1M0SA 4FGLA 1VIVA 2WILA 3DFUA 2WWWA 5HKAA 1G98A 9LDBA 1G19A 1BQEA 1S3FA 1ZK0A 1SXJD 3KUDA 4R2IA 4ZQEA 4URYR 3DV9A 4U3JA 5FI5A 5TXGA 1ZN8A 4DTIA 1DIHA 1M6VB 1SVNA 2IODA 2BUCA 4G4SP 2QPTA 3FIUA 2VT7A 3QA9A 4GPAA 4IQFA 3NC0C 4C0BA 1EKXA 4ARBA 3PTAA 1FMFA 3C1UA 3IMCA 5DRTA 1DX4A 2YOFA 5H83A 5E7MA 1CY0A 1PFGA 3K30A 3CVWA 4K87A 3SEFA 2R0QC 5BSUA 1KJ8A 4K6GA 1QRAA 1TM4E 2JDID 3WO1A 4NG5A 2P5SA 3AR4A 3GA7A 2XKKA 4F7WA 5CK4A 3JQAA 3QE9Y 1E1MA 1U6KA 2VZ8A 1KBOA 4P3PA 2RE8A 2XT0A 3AKEA 2HK7A 1UBCA 3ET4A 1EYZA 1CR0A 2WMDA 2C2MA 3O21A 3VTFA 3EVAA 2W6NA 4QVGA 4OXIA 1L5HA 4EHKA 4F2DA 1QQBA 3NHBA 1W5FA 4G9EA 5HJ7A 4QRDA 3R9IA 3SZ3A 1NQXA 3I9LA 1XTIA 3RT7A 3QX8A 3SQDA 3VUEA 1NGSA 1IN6A 1YHZA 3LXRA 3WIVA 4H4CA 5BO5A 1WXXA 2H1OA 1ZAYA 1X8JA 5KKNB 5E6RA 3VH3A 2CKDA 5JVDA 4OYRA 2QU7A 4J2HA 3DLAA 5H1YA 3C3BA 1IMOA 3R4CA 5CD9A 1W0JA 1H6BA 1KY3A 3RVDA 4DXAA 2JFFA 2VEDA 5HHTA 3SF8B 1E2MA 3OX4A 2HF7A 3RW9A 3TLJA 1W0CA 4KR9A 4HTFB 3TLGA 1F5NA 2OBBA 1OOEA 3A4LA 3IE2A 1QV6A 4JBGA 3RJTA 1F7VA 3F5MA 4YN3A 3ZD9A 1YUNA 4MV3A 4EQ6B 1OYYA 3O3MB 1E8DA 5F2OA 4DNXA 1PJTA 3FUVA 5ALMA 1APBA 3GLGE 4QM6A 1L7XA 1RE1A 3NYRA 4LBZA 2DHRA 3AJAA 1K7EB 1GQYA 5HS6A 3X2SA 4AG6A 2QM3A 1P4HA 2Z2ZA 3RNLA 5DOZA 1U5BA 1DBRA 4Q7MB 2ORIA 4Y18A 3SJZA 2GJAA 4B3RB 2SICE 2A0UA 4QYTA 2WTEA 1FFGA 2GQ0A 3AP2A 3OM0A 3ROZA 2K7ZA 1Y34E 2HK8A 4YRCA 2XUGA 1F06A 4H6VA 1PS8A 3CVUA 1CD5A 1L7QA 3EPLA 5GZ3A 1I10A 1OD6A 1ZMXA 2RHHA 3U4MA 1ML4A 3CNOA 3V6LA 5KO2A 4TWBA 2QTVA 4ATNA 3MJRA 5L3SB 3Q4GA 3K71B 2BFMA 4JLSA 4K8RB 1KQPA 3P2EA 3T7SA 1G8GA 1RFGE 3AEQB 4H17A 1Y4SA 1AH2A 2WINI 4B71A 1NJSA 3ILHA 5E9AA 4HAXA 1BW9A 2ONZA 1CRQA 3L6OO 2AOWA 2IP2A 4F9TA 1P2BA 1TM1E 3R6GA 4Y6LA 2C1EA 1FIUA 2ZJ7A 3WRWA 1PAUA 1EJ6A 1XR3A 1IE3A 2B94A 2WT8A 3BX1A 4L08A 4B46A 5BSFA 4ZDIA 5T7BA 1QG0A 1ACMA 1NVEA 3BGDA 5TEWA 4LI3X 1G20E 1Y1KE 2RAFA 3ELUA 4NPAA 2WAAA 4ZK6A 3H1PA 1LPPA 2PMKA 4WCFA 3TF5A 3GJRA 2CJXA 3UUGA 3WLRA 4Z0HO 3HUTA 4MGHA 1JG2A 3JQQA 4UMDA 2VRCD 5E3IA 3IAM6 4ZVOA 3DAOA 1LBTA 4HDKA 4URVR 4EB0A 3NM5A 3ACDA 4HVLA 1ISFA 1I32A 3OE7A 5BPHA 1QRTA 3W6NA 3OLYA 4EJ0A 2RH8A 4NDZA 3R7SA 3DMNA 2O2JA 3EPKA 3HV0A 5FNVB 1FU7A 1SUAA 2XVMA 1YQGA 4LJKA 1MD9A 5CA0F 2FX5A 1E3QA 2NO0A 3ZG6A 5T4EA 3STWA 5K0GA 1V1RB 2XYRA 4POAA 4UATA 3DZDA 1IWPB 1FFHA 1VBMA 1ZVQA 5DK6A 2ZUTA 1R6BX 4CTMA 5IHPA 2JAQA 5J23A 4B33A 1QFMA 1OLOA 1P1IA 2IYSA 4DLSA 3AWDA 3I9NA 1TA4A 2H2DA 2NACA 2OCAA 5GTDA 2VF4X 3T1TA 1YKGA 3HXMA 1M1YA 4BEJA 5EIHA 2VK4A 1ZBDA 1TDJA 4TYQA 3AF2A 5THQA 3ICOA 4H3KB 1QIIA 4NCBA 3BTUA 1WO8A 2O3UA 1C3OB 1Q2XA 5C52B 4ZICA 3ROTA 1ES9A 4RVHA 2Y1WA 4CM6A 1QGYA 1UC8A 1W5AA 2EC5A 2P30A 1EIWA 4E5VA 1QJCA 3DXZA 1NBAA 3BFPA 4IFBA 4LRYA 4BIIA 2ZRIA 4UHEA 4R7TA 4AL4A 5D7BA 5E9QA 5A3SA 5IJ0B 3QU9A 2YV1A 3I8SA 3IALA 2EYUA 4O3MA 3P7MA 2XCIA 4NAVA 4PHHA 5HRUA 2IBSA 1QOPB 2B35A 3LX4A 2F3UA 5ALNA 2NT4A 4RH3A 1TF2A 2FPPA 4LSZA 2JH8A 3SQNA 3L7OA 6CHYA 3L7AA 3R7BA 4AJPA 4YV0A 5EI5A 4BUJA 3G5UA 5L7WA 5LOVB 2A1UB 2P75A 4UVEA 3MPUA 1WMBA 2ZBGA 1GGEA 3D8UA 4DIMA 4EABA 2CVOA 1P7WA 5AW5A 4F96A 3WICA 2OB2A 3IB6A 4MI1A 2HSDA 2ZGVA 2GFIA 4U7HA 2PWYA 1YZHA 2M6RA 2WICA 2F3SA 3OOSA 5LMNB 3DQZA 4F4FA 5HF8A 4H16A 3ETJA 4DLPA 2ADMA 3OESA 4LV5B 5DIZA 3ZDDA 3FHTA 2QUAA 1FQKA 3IA7A 3DAHA 1ZC3A 3F46A 4XFDA 2FZKA 4H0NA 4NU5A 3TSAA 4EWLA 5DFAA 1L5OA 3DZFA 1X14A 2FE4A 2QM0A 2RGXA 4OP3A 4BLPA 1GPAA 2J5RA 3U7FB 4PFQA 3D2AA 4F1KA 1KOGA 1J56A 1LSUA 2NZ2A 2YHAA 3DO6A 3ZWBA 3ZQ6A 1U8UA 1JP7A 4TT3D 2IHNA 2GJ9A 3EMDA 1IY1A 2P91A 2JB9A 3FYDA 2FJPA 1UPTA 3ILXA 4JP2A 1QE5A 1DEHA 4LDZA 4FWTA 4KRFA 4OHOA 3CRZA 3H7IA 3MAGA 3BWMA 1T35A 4R8VA 3A4YA 3V4OA 1G6HA 1T4CA 1TJ5A 2XUQA 3NDRA 1CUCA 3FOAA 3G9UA 2OGSA 1HEIA 2VYCA 2C4HA 2OMKA 1QVWA 3IRUA 3T3IA 1YQUA 4ZREA 5A71A 3RVLA 4BO8A 4H7FA 1VLLA 4OI4A 3UT6A 5G2OA 4BVHA 4EFLA 5H4HA 4ARSA 1YUBA 2X2EA 5KKAA 4C0SA 5IZCC 5FYQA 2GAFA 4OQLA 2JZOA 2OMEA 2EAUA 1XU7A 3OCVA 5JS1A 3GZNA 2FZWA 4PG4A 5C1BA 1E1QD 1CUAA 3ZCQA 2JFHA 1A2QA 1X7XA 2WB4A 2C98A 3L6CA 4IUDS 3K2EA 4URUR 4UTPA 1A2BA 4QECA 1Q1BA 1CVIA 5K3AA 4GLFA 1U4OA 4RPJA 2H4HA 1II8B 3UQYS 3WLKX 5IC4A 5JS6A 2BV3A 1T0JB 2HW8A 1BD4A 2IE0A 4FYPA 2NLOA 3M0EA 3D6MA 5CT9A 3UIEA 3CA8A 5KREA 4NS1A 4X7MA 4LJ5A 5E4TA 2B99A 1PL8A 1GNVA 2JCXA 3A6GA 3H6HA 4L9AA 3VKUA 3EVTA 1NKVA 3L04A 5T41A 1VCIA 4ZEOA 2RHRA 1DKQA 2FW9A 1DKRA 1OILA 4KDFA 1QBGA 4E11A 2F8MA 1W88B 1AS0A 5EZ5A 5EESA 1E4VA 4Q9KA 1GAEO 3GK3A 1W44A 1NHGA 2OZLA 2LPMA 2J3DA 3AUTA 4C5CA 3O8OA 1XDUA 2P0AA 1RYNA 3A05A 1IZ7A 4Q93A 2XGGA 3ETEA 3PDWA 4KE9A 4GYYA 1TVMA 16PKA 5JWRA 3R4VA 2FPLA 3DDSA 1Y9AA 4CRWB 4EY7A 1BRMA 3HDGA 3S55A 3GLIB 4INJA 3AM1A 5TPZD 2C5EA 4HWTA 4MQ4A 4RD4A 1W48A 4L4SA 2Q6TA 4W1PA 4BNKA 1ZK3A 4M0LA 4BBJA 4X6XA 3C7DB 1O8BA 1YS6A 3GFGA 1V37A 2EGUA 5AI6A 3RF7A 3E5MA 4KWEA 4I19A 2HX1A 1I8TA 4H27A 4RJJA 5C53B 3IKMB 3QFRA 3M4ZA 3JYPA 4AB1A 3TAXA 1XNRB 3Q5DA 2EKPA 4AFNA 1MDFA 2IEYA 5JCJA 1Q0LA 1JR2A 3AFIA 3PUIA 4ZDJA 1LWOA 1XKLA 3UOWA 4RESA 1U0BB 2QX6A 1E7SA 1TXGA 4M76B 2XE4A 5I9MA 3U37A 5IK2D 2O1WA 1NJ1A 4R0VA 1NLFA 2JGEA 4LMRA 4Q02A 3HEBA 1MXFA 3RS0A 3N2YA 3V97A 1P1BA 2ODTX 1MGOA 2O3JA 3IX7A 1IAQA 2HXSA 1DNPA 3O47A 2BFNA 2ZRJA 1FY2A 5D5HA 4DMGA 3IOBA 5FPSA 3ZZMA 2WJHA 3QVWA 2AJ8A 5ITSA 4PIVA 1VDMA 1C0EA 1U3CA 1VFPA 1B2LA 2ZATA 1MUUA 2IXFA 3LWDA 1SGWA 4PW0A 2YWGA 5HDBB 3TG2A 4XZ3A 1UQTA 2WA1A 4LDJA 5ESDA 1GPYA 1YTLA 2HBZA 3H2IA 3RVPA 4RXMA 4XQ9A 2AEEA 4N39A 5EYPA 5BXYA 1M9NA 1BMQA 2HLHA 2YJ3A 3KDPA 4QXOA 3MFYA 1A8IA 4C6SA 1Q0ZA 4DKJA 1CQIB 3VHRA 3C5EA 3MB5A 3C5HA 1ACJA 3MM4A 4OVKA 3H3XA 3HM2A 2HU7A 5DB4A 1CEYA 5A4FS 4RA6B 5LFAA 3PXDA 1J2TA 2QVXX 4QG3A 2R4QA 3FNFA 5TARA 5HTOA 5HZKA 1J0AA 2P4SA 3N5CA 3DE6X 4R9VA 2H18A 2HHCA 2ATEA 4L4YA 4AIRA 1FP1D 5L3QB 1TQ8A 1CY6A 3GJ0A 1RRPA 3L7LA 2G1UA 4NHOA 2DT8A 2FWBA 4YT5A 3T9CA 3T95A 3L01A 5EMMA 1IZYA 3ZD8A 1R74A 4N0EA 3R7FA 4KP7A 1X77A 3VKVA 1GSAA 5C81A 4YHHB 1GVNB 3OTOB 1I2AA 4RADA 4N7JA 4NE9A 3T7IA 1N0HA 2Q5IA 2SCUA 3LSTA 3TE6A 3K8YA 3GEDA 4U0JA 1ZS9A 3M5CA 4Y6PA 1TADA 3DHYA 1YB1A 2OBYA 5DVZA 5JI2E 1YFZA 2XB4A 3IIEA 2GEJA 3L4BC 1MRNA 1FUKA 1YE3A 2XD9A 1PVDA 3BF7A 3AFOA 2NZ8A 3E7FA 1CRLA 4RCVA 2CK3A 3E3NA 3GLRA 5F2EA 4B44A 1SKQA 5K2OA 2ORVA 1J1ZA 2OGZA 5AWFC 1DQRA 3NUQA 4Y98A 1ULZA 2YWCA 3E3AA 3NEAA 5LQAA 5I4CA 3HLKA 2JBAB 1G2IA 2OORA 2YJ6A 2J3KA 4J0FA 2GO1A 4UAVA 1CB7A 1S8NA 2NZWA 1I2ZA 1E79A 2Q5OA 1V41E 4S1TA 5K3FA 2FTKE 4QG7A 3FD8A 3AL2A 2BHRA 3G9QA 1T9ZA 1PZXA 2WHRA 2W71A 5BSWA 1MZPA 2WEKA 5KNBH 4IXWA 2JJ1D 1GZ6A 2CCGA 3SNHA 4QJ4A 3UWOA 5IKPA 5K7SA 3KALA 1I4OA 1Z07A 1PFQA 2VHJA 3GLHA 3UH1A 5DXFA 5AW2A 4X20A 1CFZA 2GBFA 1JXQA 1ZJ5A 3CINA 3KVNA 3ND7A 3OJOA 3QPBA 3V9AA 5ADUS 3K0CC 2OORC 1GQRA 1DXQA 1FLDA 2FEWB 3DMRA 4GVLA 4HGOA 4LN1A 4WEOA 1JPNA 2QTZA 3ZU3A 2P2SA 2OPBA 4BFXA 2AIRA 1DAHA 1R4ZA 1N6RA 1ZIXA 1PL0A 3C5CA 3C4VA 3OTHA 4HEA1 3CRQA 1NE7A 1WF6A 2JLAA 3KOOA 1ENYA 4PLPA 5HE8A 2VCYA 4DLLA 3GZJA 3RC9A 3ENWA 4QQFA 1R0KA 2I7CA 2ZVQX 3FZEA 2DP4E 1IHPA 5L7TA 4P0QB 4MUBA 4ZVMA 3PSAA 1E3WA 1RJFA 4PZ0A 4GWGA 4F6LA 1QK4A 3Q8KA 3NG1A 2D7DA 1NXOA 3SQOA 4EJSB 5L4NA 2PKWA 2VTBA 1FQJA 4F3KA 3DDWA 4AP6A 5LNK1 1SCKA 1ZH8A 3CSUA 3S99A 1GLVA 4I99A 4MS1A 1ADYA 1C2YA 1BHJA 4ROTA 1F8XA 5JADA 4ER3A 4YQYA 1TI7A 2VWGA 2OUKA 1ZU4A 5JCOC 1SXPA 2C2GA 3WGUA 1E2QA 3HCCA 4L0CA 4YRRA 5BV2P 4B5LA 1TPZA 4OKNA 3RC8A 1KXJA 4PCLA 1H85A 4OQ4A 1QF7A 2VOEA 3KBOA 4MV4A 2GNPA 3RVQA 1KOFA 1GYRA 1V16B 3A0UA 3NONA 2Q2OA 3PWKA 4NTZA 3IXMA 4LHSA 4W82A 2Z04A 3PEUA 4CQLB 1JDZA 5KTKA 4XRGA 3QEAZ 4H18A 2V7QD 5TF0A 4YRMA 3EFOA 2IL1A 1YS9A 2OBLA 2REOA 1FZQA 2VN8A 2BFPA 3AV0B 3PQ4A 2HYIC 1D0SA 4QYSA 4FZ3A 1FE8A 3DCYA 3LCCA 1JU3A 3W2IA 2ZBQA 1BE6A 1JEOA 2HMYB 3AERA 1ZH6A 4MARA 4NU8X 2RHLA 2IUSA 3C24A 4QSMA 4R2KA 4YREA 3GCGA 3TOSA 2ONYA 1M1YE 2OO5A 4RF2A 1CJVC 4G5FA 5ADHA 4ZMBA 4F7DA 4G1UC 4UBKA 4QOJA 1NT4A 2QB5A 2HCRA 2IQ5A 1NU8A 2FGJA 1XVLA 2GAAA 1JJ7A 3H9JA 4ON9A 1ZONA 2WUEA 3LVBA 3ZI0A 4WY5A 4M98A 5EJ7A 3WK7A 1OX6A 2A58A 1QIJA 3UV6A 1X8LA 1ODKA 3EHDA 3LOPA 2QUHA 2X42A 5FPPA 1WKCA 2CXTA 2PUGA 3IE1A 2AK2A 3SBOA 1PE0A 2ZJOA 1TJ4A 3BG5A 4L5CA 1QZXA 3ZN2A 1QVAA 4DRXB 4BNWA 4HMOA 3FUTA 2FP3A 2AVNA 4Y6GB 1JHAA 3PEFA 3F1KA 1H9CA 5CA0B 4N8EA 3OT5A 1G5RA 4B87A 2HSEA 4C3UA 3CW8X 3L6DA 4ZOBA 1XEWX 1KE1A 1PGQA 4QL3A 4ZEMA 5BV1A 2EF1A 3ZQ4A 4DADA 4AMUA 4P84A 1SHZA 3JZAA 3PUZA 5GONF 1HKUA 4ZCRA 1ONSA 1GDHA 2B82A 2BTOA 5MGBA 4P86A 5K0BA 4EBBA 5F51A 5GJCA 4C88A 4HWPA 5BW5A 4D3DA 2C7OA 3VMMA 1CJSA 5C34B 1Q0RA 1RWMA 2CLKB 4KPUA 1JH8A 2IDZA 5J58A 2RAUA 3O7WA 3SP1A 4OHYA 4BP9A 1C3EA 3GRFA 3OPNA 4RK1A 3QOYA 1K8RA 3K15A 2VDUE 1M73E 4RK0A 1T9HA 3AU9A 5LDDC 1P31A 2KPOA 4LXUA 1N9KA 3NNSA 3W7BA 3VVMA 1Y8AA 3E4CA 3WLQA 4BATA 3H11A 3O8CA 5EUBA 3ZE2B 1A9YA 2ACEA 4DMUB 5LQJA 4HCJA 4KIUA 2NNWB 1FNSA 5CFMA 2N9UA 5U9CA 4XSGA 1S3GA 1RAHA 3DDCA 1XLTC 2WYUA 1UK9A 3N0RA 3NVMB 1XRSB 4JJEA 4YT2A 1LLDA 3MIIA 4D0RA 1NQ5A 3EDOA 5CCDA 4E6EA 3KE9A 1M2EA 1QUFA 1RLTA 1KL7A 2ZTMA 4KPYA 1P2SA 2Q9AA 3RAGA 3MJSA 5LD2B 2HNAA 4RA9B 2W42A 4PO1A 1JHQA 1VCNA 3ITNA 1O4WA 1GAXA 5LA6B 4WZBA 1X0VA 2QN7A 3UVEA 3C8DA 2Q1UA 4IRXA 3SYLA 4RLHA 1E58A 2FRXA 3HB0A 2V8OA 3S7TA 3AOEA 5I7HA 3PC8C 5DM60 4LKRA 4GHWA 1KFBB 4GLBA 3P9YA 1FSPA 3V1MA 1X80A 4HDQB 1WG8A 4YYEA 1P3DA 1MBZA 2DR0A 2WU8A 3D3WB 4P4SA 4G26A 1B0PA 2AZDA 1E1YA 3RB8A 4N6NA 2UXBB 4JD5A 1L4EA 3ELBA 3CRW1 3GXBA 4DLUA 4PWZA 3P1JA 1T9GR 5EIEA 3DL0A 3NV9A 3UEOA 3DBOB 4CHGA 2H9AA 4CEIA 4Z4QA 3SHOA 1QR2A 3HHPA 3G6WA 3G2KA 2UYOA 1A9QA 2X9GA 3H4IA 4FLMA 3VR2D 1SURA 5AK3A 3Q7EA 5JD3A 2NXNA 2E21A 4JLWA 3STVA 1BCRA 2R84A 3LCVB 4FYIA 3IT2A 3KEQA 1XDGA 5ILGA 1G3QA 1U7ZA 3TNLA 1QVVA 5AKHA 5HKKA 1LC0A 3ND8A 3OQJA 3WHPA 3ZTYA 5B7PA 2KW5A 3OM9A 2JCYA 5I5GA 2X6QA 1JRLA 1GRCA 5G4KB 4YP7A 3ZZNA 1EXDA 1QV9A 2YXBA 3EXHB 1KETA 3MD0A 3MUNA 2CZCA 3C7TA 3I2GA 4IEFB 3VSCA 2SBTA 2HRCA 4PAWA 1W5EA 2EX1A 2Q1WA 1AXRA 2O2CA 3D8NA 3E22A 4P35A 4CLRB 3F8SA 5JTUA 5IBQA 2JA2A 2QRQA 4D99A 4R01A 2EZUA 4LOLA 2MWMA 2PCJA 4KV7A 4DV5B 2XLBA 4PSCA 1RWOA 3OU2A 5K99A 2NYVA 2Q9CA 2WHPA 1BXRB 1JIIA 1KBQA 2Q3BA 4QKQA 3WGIA 3AILA 2PQMA 2VC2B 2FRDA 2JCVA 4TXNA 4ZHQF 2HO5A 2VDPB 3LOUA 1VRCA 1R00A 2QP3A 3HA2A 5DHPA 4CI0B 1X7HA 1ZICA 4CTKA 5IANA 1JB9A 3AG6A 1NNEA 3B7PA 4AKSA 4PZAA 4JBXA 4RPLA 5EE3A 1Z5VA 3L1UA 3SVZA 2QMOA 2CWDA 3B9BA 1YA8A 2Q4RA 2YY6A 3ED5A 1BS1A 1OXTA 4UHFA 2FPGA 1FSSA 3KZOA 2P9ZA 1G60A 3Q1LA 1ILWA 2TMKA 5K0EA 1E96A 2N75A 2OXRA 3WGJA 4QLBA 5JXWA 5B1EA 1NZJA 2X5XA 2EFEB 5DULA 5LQRA 5K3SA 3A10A 1BFKA 1KQFA 1CR2A 3UICA 2V7GA 1CUUA 2Z58A 4M99A 3ZCVA 4GW3A 3B13B 3KSBC 2QG6A 4X0EA 1MLDA 2YZ7A 4W6ZA 3OCZA 4XIYA 1AZLA 1BN7A 1DPFA 1YQXA 2HLDD 2ZEJA 3N6VA 4MWEA 4TXMA 3AJDA 1G8HA 4J6EA 5C4MA 2C2WA 5ENZA 1CP3A 1QKKA 3BKWA 3NHUA 5EWLB 2D0IA 4IWYA 1GVHA 1NUHA 2FPXA 3CR8A 3HLTA 4Z9FA 3MB8A 3IUPA 4IDEA 5KKCA 1E0SA 3DEHA 1FOEB 5E6SB 5G1OA 1MJFA 4COKA 3CB2A 4E5MA 2JIRA 4DNFA 1Z2NX 2LCFA 2VJMA 4OV6B 1RWVA 2QLBA 4FIDA 2GCOA 2FSGA 2BMEA 4TMWA 4AJ4A 3NLLA 1YWGO 4GWKA 2C99A 3DL7A 1BFDA 1MEEA 3A1EA 1SVOA 1POXA 3KX2A 4HAUA 4CKCB 4IIFA 4OMUA 5DTJA 2OD9A 3MERA 3MS4A 1ETUA 1GR1A 2FPSA 1SVSA 5GY7A 4MIYA 3SF0A 1XZQA 2DVMA 5KIAA 1UBGA 1GG2A 1NC1A 3L4SO 4UUNA 3RV4A 2EFYA 4JHXA 4PX5A 3LWZA 3R24A 3M89A 3FF1A 3AM3A 4HH4A 2V0GA 4F97A 1KQNA 1I4WA 3SXUB 4CMIB 4MQBA 4KH0A 1IHYA 3PHLA 4M0EA 1UMCB 4V2IA 3ZU5A 1HWYA 1BHQ1 3M4NA 2JK0A 5DYIA 5ESRA 4EFNA 4C30A 2QW0X 3QLVA 5CTAA 4CM4B 3WKCA 4GL4A 1QP0A 2JL1A 2CFCA 4GOXA 1T15A 2BGTA 2LIVA 1SPBS 2NTYC 2P9EA 2XRMA 4FNAA 4DCMA 1NQAO 1TQDA 4X3CA 3WTCA 1KRXA 1KVSA 2RBGA 5I7SA 3WRYC 2FH5B 2HHJA 5EWJA 3DE5X 1XRRA 4FJ0A 4HZUB 4DV3B 1IVNA 1E2FA 1ZD4A 4OHMA 1T4DA 1DT3A 3WFJA 1LNZA 2ZJBA 3DAPA 2DHQA 4ENQA 3FKSD 2GF2A 3CF2A 4ZD6A 1SXGA 2BJVA 3F4KA 4P6VF 4YONB 3WJAA 3ZHVA 2DTDA 3HACA 4RPIA 1B14A 3O94A 4JBNA 4TQGA 5TDHA 1N4DA 2G06A 2P7IA 4DVGA 3GL9A 4KXNA 4HUTA 1WAMA 1NVVQ 1QFSA 4O0LA 3T3DA 1R6AA 4DBVO 4CEJA 2XR1A 4IIGA 5BPFA 1W25A 1U31A 4GUAA 1WTCA 1HSZA 2YX1A 2ONJA 1DWPA 2EGHA 4I8IA 1STOA 5EJGA 5KOJA 4FMCB 3ZWNA 1TF7A 5L9AA 5CHYA 1NWCA 5FULA 3BXPA 4R8LA 1U8YA 2X2OA 4P2BA 4AS1A 2GBCA 2UZIR 5CEJA 1KR5A 1J4AA 2G08A 1XZIA 2QENA 4I1RA 4DOMA 5EKDA 3ES9A 3AINA 1O94C 1HQCA 3QXXA 3H2GA 2X0EA 3R74A 3R9XA 3BGWA 1I30A 3MNFA 4PSUA 4URZR 1FL9A 1CEQA 4WY2A 4A6EA 2DJ5A 4LMPA 3NJRA 3J81A 3ZVKA 5FQOA 4QBFA 1H8HA 1R12A 1ISHA 1ZGZA 4IOKA 3BRQA 4ZARA 5LCXA 5TQ0B 1D2AA 2IXDA 2Q6OA 1RWWA 4H7JA 2BT4A 3BGVA 5DBOA 4ZC8A 1A9RA 4DIKA 3SK0A 2XCLA 3RTBA 1ZM2A 2YICA 4LJ9A 5SY9A 4WBNF 1YDGA 1ZRSA 1YH3A 2NNLD 3QVJA 4KQIA 3S2GA 3DDOA 5CNIA 3C6MA 1MPXA 4G1EB 4Z9XA 2WZBA 5KVQA 4WK6A 5F73A 1PDVA 1VMDA 4EX6A 1K0UA 3QELB 3O1HB 3CE6A 2I76A 3HN7A 1T6BY 1XPJA 1Y7HA 3COPA 1E6CA 3OA2A 5BR1A 1E4EB 1Y0BA 2QYOA 3ETGA 3K32A 4OM7A 3KJNA 3AVQA 3CYFA 3SC4A 2R4UA 2J31A 2QPLA 4GZ3A 4JROA 4TLMB 1QCZA 1X74A 3SNKA 2AT1A 1UC4B 1K9VF 3K4HA 3OCYA 5BSTA 3WGQA 4C14A 1K5DA 2OZEA 2IEIA 1OYOA 5CDUA 1YOBA 5EQFA 2AA3A 1TMYA 1UXGA 3QW2A 4ZQHA 3ZVRA 5IDWA 2WQ7A 4FSXA 1SVIA 4FYJA 2ZYGA 2W8ZA 3HCRA 4UFNA 2G9RA 3EGDB 1OC2A 3CEJA 1MT3A 1O8CA 2DLCX 1QH9A 1A8QA 3ACCA 4D79A 1R0YA 4MS4A 5GJWC 1N0VC 1DDIA 2KE5A 2RHBA 3DMGA 2PNJA 2YFKA 1JI3A 4G2NA 5GM1A 4HEJA 4ACBA 4TVBA 4AWBA 1PF7E 3G23A 3P9KA 1JDTA 1SUDA 1NVAA 2FSFA 2GNAA 1H8ED 1VHWA 1GZVA 2ETXA 2X6RA 3Q7TA 4JI7B 3DKIA 5CX1A 4X94A 4U6SA 3ZGXA 5IUKC 1O97C 5EE9A 2PH3A 1QSGA 3UMYA 2VDMB 3PUWA 3QPAA 1KI1A 1JKIA 1WTAA 3MLEA 3OQHA 3DNPA 3V8EA 4P4TA 1RD4A 1MJGM 1KXZA 2BGMA 2MSDB 1H4TA 4LS3A 5TJHA 4AJKA 3EEBA 4PQFA 3NTOA 3M33A 2JANA 3W5UA 3DONA 4N6GA 1GRVA 1JLMA 1OFVA 1TTQB 4JFAA 4ZZ3A 5IMBA 4C7OB 3JQEA 1FZTA 4XM2A 1Y6GA 1EBFA 5CURA 2ZPTX 3EXG1 1N6LA 4BQNA 1UBUS 4GPTA 5KTMA 5HCUA 3UMGA 1R5NA 1YB5A 2FAXA 4EYSA 4EECA 5I3CA 4DMLA 5FA5A 4D4KA 2Q7OE 2ZQYA 2JLWA 1P44A 2QMEA 4L8VA 3ESRA 4NL4H 3HR8A 2EZ4A 2FDRA 3EZ9A 3OY7A 3ESDA 3H5TA 2HQOA 3FVVA 4IHQA 2JKVA 2QUJA 4B1FA 1QCDA 1VXOA 1PD0A 3ZH2A 3RFVA 3I0NA 10MHA 4FMBB 3B2NA 5E7IA 1LX6A 4WZBE 1HDZA 5EKSA 4AMZA 4URXR 3Q15C 5BSRA 3I58A 3V4SA 1P62B 1WXQA 3QLEA 5BY2A 2CNLA 1IOWA 3GCWA 1TCCA 2VYFA 3KWJA 1AG9A 1F8YA 2QVZX 2VTDA 3GRKA 3QF4A 2FQQA 1O03A 1KJJA 2PNFA 2PMFA 1M54A 3HABA 5HCNA 1F0YA 3EGXA 3LC0A 1LI4A 3BOSA 4UXHA 4XPIA 4CV2A 3N87A 3ZHOA 1VSQA 2E5WA 1JZTA 1BE0A 5TR9A 4EB6B 3L0BA 1RM3A 2ZCVA 3E9ZA 1BEEA 3N8IA 3X2FA 1XQ9A 2AQHA 4CN8A 4AYTA 4L76A 5IFKA 1G41A 2O3TA 3HB1A 4O4IF 4YXFA 2CJFA 3H1FA 5C8YA 4FHEA 4BAZA 5BVGA 3JQAD 1J0XO 1Y8QB 4PNHA 5DHSA 3FPGA 5AI5A 2YXPX 3PD1A 3STYA 2GYUA 1XL0A 3FWPA 4UARA 5THKA 3TTVA 5JO0A 3ZW8A 1SCNE 4JUIA 1WUJS 1KZHA 3V9PA 1MW8X 1O77A 4ZYLA 3P9IA 1AMUA 1V35A 1RI1A 2XYVA 4MTCA 2DH5A 5C1IA 5DLQC 1GPNA 1KYZA 5B7GA 4ETWA 4JI1B 2XSZA 5LMZA 3ZKWA 3C1AA 3DTYA 1TM2A 1UBJS 3AVPA 1W85A 3RYCB 4YJDA 4QATA 1UT8A 4XB2A 1RYZA 1Z73A 2DU8A 2ZQ5A 4JLBA 5TX7A 4PG6A 1W0JD 3EMKA 5F9HA 1KWKA 2VJKA 5FORA 5FX2A 3T52A 1RCTE 1O95A 3EA5A 3G68A 2AVDA 3E3LA 3GLUA 5D85A 1UZLA 2WJAA 3NBQA 1XROA 2HDHA 4YMIA 4J0EA 3Q3GE 2INGX 5MN6A 4IHKA 3OZDA 1QMGA 2IUYA 3LT4A 4DCPA 4US0R 3WBKA 3C4QA 1XD9A 3OEEA 4RZQA 1ETHA 5DNEA 2ID4A 5AVQA 4UHCA 4REOA 3B5IA 3ZY5A 3I1JA 1G8YA 1JR4A 3DBRB 4ZQFA 5JT1A 1LPNA 1TM3E 2JGJA 2Z98A 1Y8CA 3I61A 3OIYA 2EU8A 1C4KA 2ZFUA 2PFSA 1DC4A 3CCBA 3VV3A 3W05A 1N3IA 2OCGA 3FGOA 4IV8A 4BIMA 3GGGA 3R3VA 2RG1A 3OLZA 4NABA 4I66A 2X8BA 3R6TA 2Z6UA 3ASUA 2X0DA 2WNHA 4A8JC 5EXPA 1MQ8B 2FP4A 3BB1A 2PWZA 3GGOA 4RGVA 4XWYA 1A8HA 3RFUA 1QH8A 1AF4A 2DH6A 2VQSA 3ECCA 3GMSA 3NETA 4FW9A 3WKEA 5DK4A 2JAUA 4GX1A 1CQWA 5F3WB 1FS5A 4TSKA 4Q1FA 2PQ0A 3IDOA 4O0MA 4FD3A 5GP1A 3V8PA 1Z16A 3PQEA 3PFIA 2WTUA 2GZAA 4BMSA 2UUCB 4CGYA 5TPWA 1XZCA 3KG2A 2ZT7A 1QHGA 3M2TA 3PQ2A 5IBRA 3RVNA 2NO6A 4K05A 4F8JA 4LHEA 5TC4A 3R3UA 1E59A 1MO3A 1PK7A 1QO9A 1M8JA 2PS0A 1NR5A 1CUBA 1D9ZA 2R66A 3KR1A 3QU5A 1PGOA 4UCFA 5D86A 1SG6A 3EVEA 4V1CB 2HAEA 1Z6QA 1UAYA 2EIHA 1UXJA 5TIIA 3RCBA 3RYFA 1XZHA 2ZYRA 2NPOA 1BSVA 2ZR7A 1DLJA 3FYUB 4GOJA 1KBZA 3CKKA 3IEKA 3L82B 4TMKA 5JH7B 3HGQA 1CF2O 1Q74A 1V7ZA 1ENOA 4D3YA 3UMMA 1SULA 2YJ4A 4GECA 1YMQA 1NOJA 2EARA 2OUIA 3AUSA 3EDCA 2QLFA 3DVQX 1GPUA 2J5XA 4NHEA 4RJKA 5CVVA 4CF3A 2VG8A 4DYHA 3TRIA 4BMXA 1P19A 3JV7A 4LYJA 3LCJA 1EWYA 4U7JA 5L40A 3ST7A 4QGBA 4B3JA 3QYPA 4NZ9A 1R5BA 4BGDA 1YFLA 1HORA 1XMJA 1DJMA 4IDDA 4LCJA 3ZJ5A 1CQJB 3E58A 2VP3A 4ZMSA 2YRXA 1S8OA 2DBZA 2WP0A 1J8MF 2NUPA 3DF7A 3O74A 2VHXA 1QYVA 3AQ4A 4II7A 4NLLA 5MFPA 4OFXA 1RAAA 2CHUA 1V9LA 3BXHA 3CT4A 2QLTA 3ODPA 1BVYF 3LPLA 2O06A 4F3NA 4UTNA 2Q2QA 3DM5A 5D3ZA 2A9VA 2B6NA 1B8OA 2XADA 4RY8A 2YUTA 4MVJH 2XDWA 3NS7A 2YBEA 1A7KA 1JPUA 1N2BA 4JJ7A 3F6RA 4BE4A 3LY9A 5CYFA 4QHYA 1WPQA 4O1MA 2W6OA 2OG1A 1PR2A 2ZKIA 3A3KA 3H0EA 2PL5A 3H5OA 2QV7A 3D8RA 3PJDA 3R3ZA 3ZDEA 1Y5LA 5LR6A 3UJPA 3X0DA 3EF3A 4UVGA 1XZGA 4ZZ2A 3K6JA 3RRMA 3F0TA 4LXIA 2Z2IA 4G4IA 4KYIB 1V11B 1N4AA 5BNTA 2UAGA 5HS4A 4QM7A 1EWTA 2Y76A 2Y92A 4HLUC 2ISQA 4O2BA 5JIBA 1GZSA 1DFGA 1CPYA 1OI4A 5J9FA 1V7CA 5PGMA 1HO3A 3T5GA 1X38A 1P8AA 3QIAA 5BOVA 1FJHA 3ZQKA 1G9SA 1LF5A 4H0FA 1JX6A 5CXUA 1H6DA 2QTFA 3IR6A 3VBEA 1Q7RA 3PPIA 5LDGA 4PE5B 4IHJA 3A27A 1ESNA 1WQ4A 3MYRA 2Y2UA 1F38A 3B6IA 2ZJYA 4LDNA 4S05A 3GY0A 3HJNA 3OPYI 3MJCA 5CEEA 4GNKA 2PZBA 4NE7A 3E35A 2H1LA 4JEUA 2XF2A 5EJ2A 2K2WA 3FRJA 3EXIA 3FKJA 4Q4JA 1JKJB 4X8HA 2ZJ3A 2R6ZA 5CAEB 4BKOA 2AZ4A 4OXRA 1DKMA 1K4YA 2H0RA 3P0FA 4B83A 5HP4A 1T2NA 4L8FA 1MOSA 5JD5A 2BEVA 2V54A 1SUWA 2ZBFA 3F97A 3OEYA 1II0A 2FHSA 3K9BA 3QWIA 1HLGA 4KSYA 2ID9A 5CW2A 3NUGA 4MUGA 6ADHA 5LYJF 3KWFA 4RD6A 2I9PA 4RQUA 1H2RS 5KDLA 3PT9A 1TVCA 2H48A 2AQIA 3ZLTA 4KN6A 2JGNA 2JHCA 4TMYA 4Y0AA 1ZCJA 3HKEA 2CEAA 4X1KB 2KBEA 3RIHA 4FDVA 3OZWA 2QZJA 5FTKA 3I23A 4RZSA 3SJ7A 1R6TA 5T4BA 2QNRA 3GJ5A 3DNFA 3OJXA 5AJHA 2Q3JA 2NSHA 2C7GA 3DFZA 1KZ9A 4PIPA 4AZ3A 5KAMA 1S9DA 3ML1A 3T3PB 1UDAA 3C3CA 3B12A 4F2PA 5FBHA 5FF9A 5L3VA 1M2OB 4PLYA 1E8MA 4AJLA 3Q8MA 4Y6QA 5KNCH 3HZHA 3QYJA 1SVUA 4KWHA 4NFSA 3SC3A 4N5LA 4Y2VA 4WASA 3KXLA 2XEXA 3GJTA 1G4HA 4DLZA 2I3GA 3I62A 2NO1A 3EISA 4YLEA 3RIXA 4I6GA 4RSGA 4WOPA 2XRYA 2HT6A 4TTIA 4KIGA 2R6R1 2HFJA 4RDXA 5KWEA 4Z2AA 1C3XA 5FI0B 3TIFA 2H59A 4QLOA 3FX2A 5H3HA 4DM7A 3H4MA 1FX1A 1TUBA 3MT7A 3OPQA 5EY5B 5A0TA 1I7PA 1WB5A 1Q22A 2QWXA 3TNFA 1JDJA 3QSYA 1EZZA 3JD3A 4BZXA 1W6RA 2LTAA 4YDHB 1THZA 1UPCA 4IO0A 1ZQ1A 3DEYX 4Q4DA 1GDTA 4H08A 1M0WA 1TKCA 5FTJA 3KCQA 1ECGA 1IEQA 1NPYA 1WKVA 4LNUA 3DMTA 1Z6TA 5A9RA 1QV7A 5CH8A 1VHJA 5B53A 1VGQA 2ZM6B 1X92A 2VBCA 4HVAA 4Z4FA 3AB7A 3OC6A 4WBNB 2BMVA 2ZWVA 2CC2A 2XA1A 1W0KA 3HCFA 4OH7A 2HJRA 1EA5A 2Z4RA 4FXPA 4I3FA 1SUPA 3WGZA 4ZVLA 2VBIA 1XKQA 2C2ZA 4B3CA 4Y9RA 3IE0A 3RJMA 3KHKA 3QBTA 9ABPA 2A30A 2DERA 3B6MA 4L3WA 5JATA 5AK6A 1PSWA 4FC6A 5JAIA 1A8UA 1KEWA 3PGA1 3L1IA 1YB4A 2IYXA 4LGMA 2DCMA 2C88A 1ZOOA 1GZHB 3SJBA 4MVXA 3UUWA 4A2CA 3OEWA 1A96A 3ZDXB 4G0QA 2VYVA 2XOEA 4D02A 4RHXA 2GVNA 1LNQA 5H5JA 4HNAA 1D0IA 1II9A 1DKLA 4BFZA 4H1WA 3LHKA 1TFUA 5MN4A 4IOLA 1X3LA 3UW1A 5F2NA 4B7XA 4OI0A 1Y1QA 1Y4AE 2CMDA 4BQFA 5JCJD 4PX2A 3N8NA 2BZSA 3PPWA 4GD3Q 3DYBA 4OQEA 6REQB 1CJUC 1J9EA 1F8FA 2YZGA 2BFOA 3EGCA 3LD9A 4GOMD 4JDPA 2DQSA 2FW6A 4NBSA 4YAFA 4BMPB 1P1KA 1XU9A 2VHWA 4WSOA 6PFKA 1TCBA 2XXJA 3SVLA 4KPEC 2AI3A 3NAZA 4KLAA 2I87A 4LRTB 2IYNA 7YASA 1A8PA 5CNJA 4PAOA 3PWZA 2HZBA 1F5SA 2ZJ1A 1DCFA 1EI9A 4ZU3A 2B5OA 3E5RA 4E5DA 4PRZA 4EKNB 1WKBA 1TE2A 3AVYA 2AZMA 2FSVC 2YWJA 4AKHA 1X1AA 3HKBA 4G0MA 2QMQA 3N2IA 3ROMA 3WV5A 3ZLUA 5BSVA 4IDFA 5HUHA 2BDEA 3KD2A 5HR5A 1U0NA 1P3JA 5K8JB 4CZ2A 5DWQA 2P62A 3N7UA 1QIHA 1EAYA 3K70B 4HAIA 4XOUA 1V2HE 4F2HA 5JXGA 1PL6A 2PYIA 1VBNA 1VCOA 1CQPA 1AKNA 2E2WA 2DUMA 5CLLA 2DFVA 4CQMD 3OMWA 2GK3A 2OV4A 2GILA 2SECE 5EWMA 1CDZA 4LDQA 1QCYA 1YJCA 2ZT5A 3JAKA 3S2UA 3JAWA 4A0GA 4EGCB 4M36A 4G5QA 3BXXA 2H1VA 3BFXA 1ZKMA 2Y27A 1PYDA 3DBHB 4J94A 2PGJA 4A92A 2ILVA 3Q1KA 4Z7JA 2JAHA 3NHSA 5K3OA 1K6JA 4RVGA 4JSYA 4H7EA 4JOSA 4LZJA 3V1NA 2NZXA 2Q6IA 3MTEA 4U7DA 5IJWA 4JT8A 1EP9A 2R25B 3KXDA 5KOHB 2X3YA 5DE3A 1BDMA 1WU8A 3AHHA 4A7PA 3FPKA 5F23A 1DX6A 3VNQA 4TYWA 3I52A 3PRKE 4GX2A 3V34A 3AUKA 5BT9A 4PYJA 4JYAB 3RV3A 4EZEA 2O8EA 4CF4A 1KDOA 1OXUA 1ST3A 5G4LA 4JLOA 2CK3D 4JI2B 4V39A 2AI1A 1FPMA 1U0HC 4Z54A 2R6CA 4YALA 2F8LA 3UC5A 2KHZA 3WMWA 1P18A 2F90A 3E9MA 4QOGA 1EA7A 3REQB 1MO2A 1UFVA 4PG7A 5JQWA 2GCGA 2EKDA 2O7SA 4MWSA 4R2LA 5DRYA 3F9IA 1Z08A 4MIKA 3QXCA 1VIYA 1E79D 1XCLA 2C2YA 1DRVA 3B1JA 4R31A 5JHHB 5JBIA 3NWOA 2AR0A 4W9RA 4FPXA 3WBJA 2XNDA 3FUXA 1L5ZA 4IDBA 1ADFA 3FLAA 1SEPA 2WQZA 2XYPA 4HEHA 4IGFA 3A1SA 1E2NA 2OAEA 3R7WA 2FQYA 5GADl 5HIJA 2GYWA 2UKDA 1JEQA 5FI3A 2IELA 1LPMA 2NOAA 3ZE6A 1ZSVA 2ZSDA 4LVNA 4OYYA 4E09A 3F7MA 1Z17A 5AI0A 2B21A 5D3KA 5ARDA 4D0SA 3QX7A 1KYWA 5FLXA 4EPWA 4CIAA 2O0LA 1QVRA 3SKXA 4HJRA 2XB6A 3FWZA 1MOPA 4HGZA 2A94A 5J2TA 1C14A 5G0WA 3GYBA 4N76A 3GBVA 1UMDA 1O4VA 2I99A 2JFGA 1LXCA 3W79A 4HQFA 4Q3BA 5MFZA 1OXKB 1E1CA 2W43A 1PNTA 4KO4S 4OFWA 5BWBA 5JY6A 2IGTA 2B4TO 3TL6A 1OX4A 2B34A 2VZ0A 3SJCA 3W7VA 1G8AA 1RAFA 2LE0A 2QSUA 3HYTA 3R8CA 3SIRA 3ZE1B 4KAXA 3CZMA 1YOVB 5BQFA 2Q4DA 1OFUA 1MO4A 4CBVA 2VDKB 4DMKA 2VJNA 1T5OA 3X1MA 2WJ3A 3OCCA 5DSZA 3NIGB 3MT0A 2PR2A 4BVEA 2I67A 2ZRBA 3I73A 3B1XA 3OKFA 3FKQA 3OT4A 4ZC1A 4YCDA 4E21A 3T0IA 3DEKA 3OJWA 1I2DA 3DCNA 3GPDG 1IATA 3VNRA 4B6RA 3H9QA 5E2AA 2GN6A 1UDWA 1DRJA 1FRVA 1W7AA 4J1SA 3TFOA 1Y7LA 4TL7A 5A7HA 3E2MA 4ZTBA 4TOIA 3EXAA 1NJ5A 2JJ8A 1W30A 4RJTA 3DHWC 3DQPA 3FSGA 1T6ZA 5DX0A 1EGVB 2IEAA 3LFUA 4BC1A 4MWDA 1Z7EA 4Y2TA 4BLRA 5KYNA 2G3YA 4UEOA 2C84A 4EEKA 1E1LA 3FHJA 4UE3S 2XYQA 4YRLA 4X64B 4DTCA 1SOWA 1R37A 5J4YA 5CTJA 5LZ7A 5JI3E 3TECE 1N34B 5KQRA 2BHNA 3BSYA 4M88A 5A6SB 4KL8S 2X0IA 3BWXA 1E7YA 2ZYAA 3O3OB 3EGIA 3I53A 2RGRA 2V7BA 2P9GA 3QMMA 1HLPA 3ITKA 3ONWA 4WLFA 4X1OA 3I83A 3QEKA 2C1ZA 1QMPA 1F3LA 1NVMB 2RC5A 3Q7RA 5TGZA 3FUWA 5BV7A 3B5EA 3CIFA 3J7AC 3D6UA 1PO7A 4WOJA 1VLVA 4GKBA 4DYVA 1AUQA 1BVUA 3FZQA 2WJJA 1AKVA 4XI9A 3L84A 3OC0A 4M37A 1E7QA 4NJEB 4YROA 2A86A 3G5LA 4MVJE 3SYTA 3KR9A 1EUYA 5I4KA 1XN1A 1NQOA 4GRAA 4J3NA 5HQ3A 1T0UA 2Q99A 2Y6VA 1PT8A 1H66A 1F1BA 2I1LA 2OBMA 3UHFA 1WB9A 3HR4A 1XOIA 3NFYA 3CVOA 4WHMA 4MRSA 4DB2A 3ASZA 3G82C 3AI7A 3W4IA 2X3UA 5F12A 4WA8A 2WZQA 1UWCA 2XTNA 1FRNA 4JQSA 4KRYA 4WNAB 5ER9A 4BNMA 2H92A 1KHTA 1C4WA 2VHYA 3PLNA 4Z7QB 3ABIA 4XYEA 3THYB 2OLJA 2NVWA 4JP5A 5COBA 3I09A 4ZU1X 4ZKEA 3H2YA 1S4MA 2Q45A 3K6RA 4L85A 4GZMA 4WBXC 1FQOA 4R1SA 3H99A 4R1TA 2DPYA 1PUIA 3P9CA 4PNPA 2X77A 3JYQA 3OCXA 4BECA 4RKWA 1CZRA 4OLAA 4J1TC 3A3NA 1A5TA 1PGPA 1DINA 2E7ZA 2W6JA 3ILSA 3PSHA 4QUEA 3OLQA 3ZWQA 2BONA 3P2IA 3G89A 1QK3A 2P4HX 5H16A 4A0RA 4EELA 4BMZA 1GO2A 5EIAA 5HNKA 3F71A 1W52X 4CMAA 3MRXA 5FO0A 3KQNA 1US8B 2F6RA 5AJWA 4LWPA 4X7PA 1EM8B 4ECEA 4LVCA 1IEVA 3QVTA 2RC6A 1L5YA 2WNIA 2R47A 4C4AA 5C9ZA 1OI2A 2VTKA 1P73A 3D0OA 2DFKB 4DC0A 4AZ0A 4N5HX 4FT2A 5JS2A 4XKJA 4DLRA 2XZOA 5CVUA 1EE9A 2PJDA 4KQ1A 1NN3A 1C9KA 1EVZA 4QOFA 2CXOA 3IBSA 4P81A 1X19A 1I7QB 1IN8A 1ISMA 1O9BA 3SWWA 3T99A 4XXHA 1XXHA 2CFSA 1J2EA 3A6JA 3IBTA 4ZIRB 1EK0A 1I4EB 1QQ6A 4Y30A 2KM1A 2BMAA 3GUHA 2HNBA 4GIBA 5KVCA 1RKBA 4HFJA 5K01A 1FBTA 1KSHA 4B3FX 3LP5A 1IDN1 2FVXA 4X71A 3RTDA 2A9JA 3LL7A 2F7SA 4M0FA 4NJMB 3IP9A 5LYJB 5B3JA 8GPBA 1X87A 1ZBQA 2BM0A 1K7YA 4CMEA 1ESZA 1BGVA 2A59A 3ABSB 4BUCA 4PZYA 4RV4A 4UPEA 1R15A 3IPAA 4OXYA 3Q9SA 4UUPA 3K4PA 2QTAA 4M8IA 1UQUA 4V24A 3K31A 3LDHA 3IXLA 2VSOA 3N2GA 4I1VA 1YHNA 3T6KA 3ZH9B 4Z51A 4ZYVA 1M6YA 1KJYA 2G5TA 2P4QA 4B4UA 4FZRA 3OPXA 2OC9A 4OXXA 4DLYA 4URWR 5ELXA 2O54A 2IPOA 1YD7A 2QW1A 2WAYA 2XH8A 3D5QA 3DPIA 4KK4A 4BB0A 4P80A 2HO4A 1SHLA 1ZITA 4P54A 5L8VA 1YVEI 1YRYE 1HC7A 2EVWX 3VSDA 1TMGE 4EUFA 3CX8A 2RGBA 2W4QA 5HGJA 4LDAA 4KFSA 2H57A 3PA8A 4ZVVA 1RZRA 2QV0A 3DW3X 4YXWA 1CEEA 4XD7A 3H97A 2R48A 2PA0A 2Q0HA 1EEXB 3L92A 1Z6GA 3MZ0A 4M8NE 3AU8A 4DLVA 2ZYIA 3CVJA 3OTWA 4C06A 2XQGA 2Z08A 3E61A 5KYYB 2XY4A 4EUHA 3DPSA 4YJ3A 2QTWB 3K94A 5LWHA 3RG8A 1ZHHA 2IY7A 5TQ2B 2YYSA 2P1DA 1GPLA 4LXTA 5CK5A 3ZXXA 4YMWA 1V7QA 1YBVA 5IAAA 4GYWA 3LT0A 5DYYA 5EN4A 1LK0A 1V8ZA 5IVPA 4IINA 1QTIA 2C94A 5EJ6A 1VG8A 3JQ7A 2NTEA 4FDUA 5KYVA 1IEXA 2WSSA 3IHTA 3O75A 4YRNA 1W581 1DLIA 3O4RA 3RC3A 3V42A 2WB2A 2OAQ1 1BE8A 4LPKA 2H7CA 2FV8A 3FNBA 3EDYA 1N1GA 5KWIA 1SBHA 3E81A 4IIDA 1ECLA 4N3GA 3MWEB 5I9IA 4Z9AA 2MSKA 1KEEA 3Q8LA 3THRA 5KTYA 4OKSA 3DDHA 3E9EA 3EQ2A 2HCFA 2PO7A 4IVPA 4E7PA 2QAGA 3KVVA 3SU8A 3V4RA 1LRJA 2OT3B 3DD5A 1YZTA 2CNNA 2E89A 3CGGA 3EF0A 3K16A 1JJAA 4ZFNA 1DX9A 1ZI9A 2VHVA 3OKCA 1YQWA 1J1IA 1J99A 4C2AA 4ZI5A 5EMJA 3H1AA 4M0UA 2RHDA 5D51S 4X66B 3KT3A 3LYAA 1D6SA 1Z83A 2AG6A 1PT6A 2JIZA 4CE6A 4B3TB 3G6KA 5A4KA 4BGUA 5K0TA 4AQ7A 1AM4D 3VYUB 1GR0A 5HOEA 5EPUA 2GCPA 1F2DA 2DPXA 4AMBA 4C3OB 1TEHA 4D9FA 1L7RA 1WVGA 2GF9A 2WJZB 2XDQB 3BXFA 2J3MA 1R10A 4V0SA 4Z3OA 3P9XA 1IXSB 1P5JA 4M8LA 1ZCBA 1JVSA 3FXAA 5FWYB 3UNXA 4CFZA 5BYAA 1AOXA 2NV2B 1PJCA 2V7EA 4IOMA 4TV9A 2Y1EA 5DI3B 1SOVA 1YZUA 2JFBA 2PT7A 4OJMX 3RBAA 3UAYA 3O1JC 3DBLB 1PR4A 2PBFA 1CR6A 4BZPA 4NPCA 3I9MA 1YBFA 4ND5A 4DQKA 3EXFB 1LI7A 2AFHB 3N76A 3RRNA 4M87A 2X4DA 2YRFA 3QVLA 2EKLA 2XUKA 4R83A 1KO5A 5FPHA 3FNIA 1V71A 1VE1A 1WCWA 5IAEA 3VTZA 4J9VA 1BW9B 2NVBA 4D9GA 1AXEA 1PN3A 1V5FA 1SCUA 1ZCZA 3BTVA 3AY0A 2E1PA 4Q48A 5LBTA 4BX9A 1DAOA 4D9HA 1ZXBA 2GYYA 2OZVA 4Y8VA 5KX5B 2V3VA 1SC1A 4FDAA 4HWKA 5SICE 1DIAA 5DN6A 3ESXA 2QT0A 4D3SA 5KINB 5LP1A 2LP4Y 1FMJA 3K3PA 2ZBRA 4ETMA 2MMCA 4BVAA 2F43A 2FWAA 3A7EA 4DR7B 3QVKA 5LQDA 2IHUA 1GWNA 1U3VA 1CIJA 3H9BA 5K8TA 4OF4A 2XE8A 3HEMA 4ZT7A 1KYTA 2WUGA 3NCHA 1USIA 1GSIA 1V3VA 2AOUB 2J59A 2V4MA 4LXYA 1IBCA 4AKGA 4HDKB 3N0TA 5DYWA 3RSQA 2HIAA 2QOEA 3HUUA 2AHRA 2DOKA 5CA1A 5JBNA 3HO8A 3PFGA 2QGNA 2PL9A 1BGWA 5K0NA 3ZDRA 1EDBA 4QU0A 4JEMA 2ODWA 4OY3A 4XX1A 2HR1A 5AI4A 4EO9A 4PR0A 5DBHX 1GU7A 1ZM3A 3SE0A 4DSTA 4CT5A 2PIAA 1TCAA 3BCSA 4IIBA 5C1PA 3BXZA 2HJ9A 3NXKA 5FNZA 3RUEA 2XTMA 1VMAA 4JLPA 5IM4A 1HETA 2XE6A 2YWFA 5E7JA 4GDMA 5EOVA 1XFDA 1WQ3A 3BZWA 3UHJA 1QQAA 1GOTA 1QQ5A 1I5EA 2X14A 4B82A 1M1YB 3THXA 1O94D 4S2UA 3FHCB 5JQGA 2NSYA 1N25A 1WUHS 4ILKA 1GNQA 3SQXA 4D5EA 5CDFE 2GOYA 2OYRA 2A5FA 3GGCA 4R1QA 5HGXA 3BULA 1LFAA 3M3DA 8OHMA 4DT1B 1R9GA 2CL0X 5JSZA 2IS6A 1P4GA 2GB4A 2G8NA 4JLAA 1WABA 1ABEA 1V39A 4NAUA 4AXXA 2ZE7A 2HD4A 1CXZA 3O38A 4LHWA 4A2PA 1BCSB 4Z4EA 4B45A 3AFMA 5DCUA 2JEZA 2EKBA 1R5JA 2XIQA 3BCRA 3EQ9A 1RYBA 3ID6C 3OECA 3OLWA 3STUA 3GJ8A 4BWFB 1SA0B 1VE6A 1U2GC 621PA 3AF6A 1IJEA 4HATA 1Z0AA 1ZO8A 4ICIA 4U2GA 3QTLA 4BE7B 2PKCA 3IMEA 1KHHA 1H8HD 2ZJ6A 3V6MA 3OQBA 2AEJA 4KC0A 3KHTA 3QUAA 4Q15A 4D9MA 2F2TA 1XRMA 1J8VA 4S3MA 3VO9A 4BMOB 3A6DA 4LWOA 1UBHS 4BJ3A 4WKBA 1EB8A 3GQBB 3MAAC 4MQEB 4DJTA 1JSLA 2W83A 1C50A 4HBZA 2WWYA 3K05A 3TRDA 4IW3B 2HJGA 1OGYA 3E6AA 1YO6A 2BOVA 2L0XA 4IQ8A 4WT7A 521PA 1NF2A 1LX7A 1RKUA 2C5LA 3IB3A 3TBHA 1IZ9A 3U9TA 5KSOA 1XE3A 1SQSA 3JZIA 2UZ1A 1C1YA 1QHXA 3F73A 2O4CA 4CKYA 4F4HA 3DGEC 4D25A 3U3XA 2EW1A 1BYIA 2R7AA 2OV8A 3QVUA 1AKEA 4P58A 3NPMA 4RQBA 4FFPA 3DOJA 2G70A 4RZ3A 3ZY2A 5JOQA 3AUUA 3ISJA 1RYEA 4MR9B 4KGZA 4E07A 4G41A 1FDUA 3ENVA 4JITA 5AT1A 4B4DA 3ZQJA 1YC2A 4FFRA 4ZQBA 4D8TA 1PNOA 2MYPA 2X9LA 4FHFA 1U1GA 1WW3A 2O19A 1X0XA 5EJFA 3BHJA 3ELYA 1I3MA 4ZA2A 1R6DA 5GOZA 3TOCA 3B53X 1F9AA 1O97D 1G8SA 2ZROA 2J45A 1DP4A 3H4TA 3RS9A 3I04A 3QNWA 3NBUA 2PSJA 3VBCA 1GCAA 3RVBA 3A2NA 5JEEA 1G8JA 4P22A 4K5QA 3GDOA 2W6ID 2UVDA 4KVGA 1UXOA 1JEYB 4MUFA 5TE9A 4CQJA 4G89A 1UK7A 1KVUA 1S2NA 3DVAB 2FEOA 1AZTA 2IF2A 2ZLBA 4RFSB 5G02A 4DLTA 1FBNA 3MELA 1UWVA 3CT6A 3FBWA 1Y9EA 3T0FA 1V4NA 3WXBA 2ERCA 3HP4A 3O2NA 1FLVA 1Z4IA 3ASVA 1PFVA 5E3JA 4YPVA 2BJWA 1QHSA 1OSNA 4JT2A 1G8MA 2H5JA 1CZKA 2QE7D 1Y3DE 4JR1A 4L3OA 5M7EA 1TYAE 2ZAIA 3IQZA 3MMSA 3NI2A 1N57A 3T35A 3UWMA 3FR7A 1L0BA 5F9FA 2COKA 4TRNA 5ALPA 5JMWA 5DW3A 3L8YA 1VYHA 2EJCA 4ZCMA 1WXDA 3TOZA 1L6RA 4IJQA 2FA9A 3C6ZA 1Y81A 2K7FA 1UADA 1WE2A 1EGHA 3M6WA 2CHVA 4R7GA 2QTNA 3PFBA 4FKMA 3BTSA 4WUTA 4MK4A 3TQCA 4LC1A 4IUCS 1D5CA 3NQ41 3WRXA 4FNOA 1Z6YA 4BLOA 4TZ0A 3MMNA 1ZM7A 1R9NA 1P1JA 4CIBA 4RK6A 1CX9B 5BQXA 5KU1A 1YASA 3I0MA 5J5VA 2WF9A 3KCNA 3O5AA 3G1WA 5I9BA 3SF8A 2QP9X 3U40A 1CJMA 2FUEA 5IN4A 4HTFA 4RGBA 4XLZA 4OYHA 2JJ2D 1EP2B 3RNOA 5DTQA 3KQHA 4Q16A 4HDRB 4XUGB 5AKLA 4EQ6A 1CJBA 1VIAA 5DHUA 1XXHE 4WDRA 4MUIA 5GOTA <