2ESRA

Conserved hypothetical protein- streptococcus pyogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
VRGAIFNMIGPYFNGGRVLDLFAGSGGLAIEAVSRGMSAAVLVEKNRKAQAIIQDNIIMTKAENRFTLLKMEAERAIDCLTGRFDLVFLDPPYAKETIVATIEALAAKNLLSEQVMVVCETDKTVLLPKEIATLGIWKEKIYGISKVTVYVNEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of hypothetical protein of Streptococcus Pygenes
rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
molecule keywords Methyltransferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2esrA00
1SQFA 3OZRA 3EVZA 2Q41A 1G8AA 2NXCA 2VDVE 3DP7A 3OU7A 2I7CA 2OY0A 4PGHA 5K0BA 3G5LA 5E2BA 4RTRA 1TW3A 5F2KA 3EVGA 4RWZA 4EMSA 4YUYA 1VL5A 3SSNA 5JR3A 3CJRA 4CKBA 3TFWA 2PXCA 4POOA 2JG3A 3OCJA 3F4KA 5E9QA 1ORIA 3OU6A 4P7GA 4CKEA 1UFKA 4YV0A 2WA2A 1WG8A 4RVFA 4MWZA 3TR6A 3CKKA 3I58A 1ZGJA 3FZGA 5GM2A 5K0CA 2AN4A 1EAMA 4YV1A 3TKYA 4RTMA 4E32A 4C4AA 3GCZA 4C05A 4KRGA 2CL5A 5B1SA 1VPTA 1RJFA 3KPYA 2Y1XA 4AZWA 1R00A 4GEKA 2ESRA 3FRIA 2AOWA 5DM2A 4XUEA 2XBMA 3BUSA 1YF3A 5DM0A 3EVFA 4DA4A 1VP3A 2IP2A 1SUSA 3SSOA 3NWBA 4M38A 4DMGA 2DULA 3P2IA 2AOTB 4XCXA 4U7TB 2PGXA 4KDRA 2PKWA 3BWYA 4GOOD 3G2QA 1Q0SA 3ELUA 3LGAA 4HG2A 3V97A 2YUIA 5K0FA 2F8LA 3LDFA 5HZMA 1DUSA 4CXMA 5CD1A 2HMYB 4OX9Y 4RV9A 3BXOA 3KQVA 5CCXA 3G8BA 1NKVA 3ME5A 3KQMA 3T7TA 2UZ4A 2ADMA 3M33A 1KPIA 4M37A 5CVDA 2IH4A 2EX4A 1IM8A 3A4TA 3GRRA 3KQPA 3SMQA 4V0RA 1INLA 5K03A 2PX8A 3PT9A 3UJ6A 3A26A 4RVDA 3GIWA 3ORHA 3JWIA 3DMFA 1EG2A 3PX3A 1T43A 4MQ4A 4R8RA 4F85A 3A7EA 2PT6A 3IV6A 5U4XA 2P7HA 2EG5A 2O0LA 3M6XA 5EMJA 5T64A 4KVZA 3TM5A 4AX8A 1X1AA 4RTSA 2HNKA 1EJ6A 5EQJB 2C7QA 5GOZA 3DLCA 4KIGA 5DPMA 3KQOA 3ELWA 3EVAA 3K6RA 3HCCA 3P2EA 1ZHFA 4Y30A 5EHGA 3MCTA 2JH8A 5C0OE 3RIEA 5LQAA 3HP7A 3EVBA 4E33A 1VLMA 1KP9A 1NV8A 5CM2Z 5FWAA 5HIKA 1X1BA 3I53A 3HVJA 3JWGA 2AOUB 5EEHA 1NV9A 5ICEA 2FCAA 3LX6A 3GRZA 2GA9A 2A14A 4QTUB 3HNRA 4R05A 3M4XA 3MTIA 1SVUA 2PWYA 3R24A 4OQDA 5DT2A 2CKDA 2ZSUA 1YFJA 5ICFA 3MTEA 1JTEA 1PRYA 3FYCA 3ID6C 4PIPA 5EIWA 2ONZA 3AXTA 1KHHA 3C3YA 4WVLA 1R8XA 2XVMA 1N7JA 4RX1A 5F2NA 2IH2A 3KPUA 3OFKA 3P9CA 3HVHA 3UWPA 2AVDA 1BC5A 4DF3A 2OB2A 3SXJA 3LKDA 2CWWA 3HCEA 2BZGA 2P3OA 3TQSA 2FYTA 3E23A 5E1OA 4DCMA 5FA5A 3PLAE 5KYGA 5JUWA 3UFBA 3GGDA 1ORHA 3CBGA 3SVZA 1QYRA 5LQRA 3GRYA 2IDJA 1AV6A 3UJCA 4GQBA 5GIPE 1Y8CA 5FADA 5T6BA 3UA3A 4RVHA 1KPGA 3M6UA 1KXZA 2QRVB 3RODA 4CKCA 3QOWA 1BKYA 4FP9A 10MHA 1R8YA 1JG3A 2ZIEA 2PJDA 4V0QA 1QAMA 4RTOA 2AN5A 4ER0A 7MHTA 2NXEA 5HEKA 3G2PA 3R3HA 5IH3A 3FRHA 4PONA 2NNWB 1RI2A 1D2CA 2JHCA 4A6EA 2B78A 2O06A 3M6VA 3MCZA 1BOOA 4LWPA 5T67A 4HGZA 1D2HA 2B9EA 4DM3A 3HM2A 1RJDA 3BWCA 3O4FA 4FGZA 5EMKA 2QYOA 1VQ1A 4R8SA 5BW4A 4R6XA 2UYOA 2FK8A 4P7JA 5K0EA 3H2BA 5CVUA 5DWQA 5EOVA 2NP7A 2JHAA 3KQWA 4Z2YA 3HVIA 3FUUA 2GLUA 4B17A 1XXLA 4P7FA 1KIAA 2YVLA 3FUVA 4FSDA 4QQKA 5H02A 3AWIA 5F2OA 2OZVA 3HA7A 4G56A 3HA5A 1KYWA 1AQJA 3FUWA 2YXDA 4RSRA 4ZTBA 4DZRA 2BM9A 3FTFA 2FRXA 3OZTA 3LBFA 2PY6A 2CMGA 3ER8A 1G6Q1 1HNNA 2NP6A 4EK9A 2P3LA 1XCLA 3KR9A 5EG5A 1KPHA 1NBHA 3SM3A 3S68A 4PCLA 3PFHA 1X1CA 3DTNA 1JQEA 5FULA 3U81A 5HILA 2WK1A 4F84A 3TLJA 3NWEA 2Z6QA 2UYCA 3C0KA 1IXKA 3CJQA 2IFTA 5BW5A 3P9IA 3O31A 5LQKA 4QVKA 5EHIA 3G7UA 5EMLA 2P8JA 2P35A 1JQDA 5FHQA 4AZTA 5KS2A 3FPHA 3KPVA 4YMHA 4EVIA 3DH0A 2ZZMA 4RTQA 2GB4A 4OQEA 4GC5A 2G72A 1JG4A 3CJTA 5IKMA 2ZVJA 3KQSA 5LQCA 5K0JA 3THRA 1X19A 1ZQ9A 3RW9A 3TM4A 1RI1A 1XTPA 2OKCA 5K09A 2HV9A 1UWVA 3NDJA 1VIDA 4IV8A 3EVDA 3FPFA 3HCDA 3MGGA 5ERGB 5GWXA 4PYIA 2ZULA 4HTFB 5ICGA 4YMGA 1QAQA 3P9NA 2QY6A 1SG9A 2ZIGA 4M7RA 4IV0A 3FPEA 5HIMA 3KR1A 4FT2A 5E8JA 2EJUA 2VS1A 3JWJA 3UJ7A 1QZZA 4QTTB 2BM8A 3P9KA 4LG1A 3T7RA 2IBSA 3HTXA 1M6EX 3I64A 4K6MA 4PYNA 4XUDA 3C6MA 3C6KA 2O07A 4PWYA 3BKWA 4FZVA 1UIRA 3V8VA 1X1DA 3M70A 2ZWAA 3OPNA 3BZBA 4EKIA 3BGIA 1EQAA 3E05A 2ZW9A 5EEGA 3P2KA 2QRVA 2OB1A 2AS0A 5GINE 2KW5A 3KQTA 3UJDA 5K01A 3MHTA 1P39A 4OBXA 2AOTA 3KPWA 3QOXA 5DTMA 8MHTA 5EKXA 3P97A 2OPBA 2BH2A 4PNEA 1NW8A 1L3CA 2JJQA 5HIIA 2ZZKA 2VZ9A 2GS9A 5HOQA 5EGSA 2BR4A 2G71A 5DRTA 5DSXA 4DKJA 2C7RA 2NXNA 1AQIA 1SKMA 2ERCA 4CTJA 1TW2A 4PCAA 2EFJA 4RTLA 5CIYA 1M6YA 3KR0A 5C9ZA 3SR4A 2H1RA 4PYKA 1JTFA 1N2XA 2K4MA 3UJ9A 2ZIFA 2VP3A 4RVGA 4AZVA 4DCGA 3G2OA 5D1NA 3OU2A 1PJZA 2ORED 2R3SA 1Z3CA 1O9GA 2AVNA 3IHTA 3FTDA 2B25A 3MERA 1NBIA 3UZUA 2G1PA 3EVEA 1I9GA 3K0BA 3DR5A 2OO3A 2V74B 4FR0A 1JSZA 2ZBQA 5EZQA 1ZKDA 3G89A 3BGDA 4P58A 4QDJA 3DXYA 2GPYA 5FHRA 2ZCJA 1D2GA 5LQUA 2R6ZA 5LQJA 4O29A 1AF7A 2P40A 1FP2A 4GF5A 3G2MA 5EIFA 2IPXA 2ZTHA 1NW3A 1XDUA 3C3PA 3KHKA 2YX1A 3LL7A 4LWOA 2ZZNA 1FBNA 4BP1A 3QV2A 4MTLA 4QPNA 5HIJA 2I62A 2AOXA 3B3FA 4M36A 5DX8A 3HCFA 2HR1A 4Y2HA 2VDWA 3MAGA 1BHJA 2IH5A 4GBED 4GOLD 1R18A 3EMDA 3GDHA 4RTJA 3LECA 3EMBA 1SQGA 4KIFA 2IIPA 2G8NA 4GC9A 1EJ0A 3GWZA 5DX1A 1NW7A 2I6GA 5EVJA 1WS6A 2OBFA 2C7OA 4U7PB 3EEYA 3UBTA 1M0EA 1FPQA 4C08A 5FUBA 4C04A 5GIOE 3NDIA 5DM1A 2P3QA 1DL5A 3B89A 3T0IA 3NVKI 1KYZA 3GRUA 5FQNA 1DCTA 1FP1D 3IYLW 3B7PA 1IY9A 5GM1A 1G38A 2ONYA 1H1DA 2PXAA 5DX0A 3GRVA 2IBTA 3DMHA 3GJYA 3R0QA 1I4WA 3ELDA 4PYOA 3HCBA 1WXWA 2PLWA 3TMAA 4C07A 5BXYA 3HCAA 5EPEA 3MQ2A 1P91A 3OZSA 3EVCA 2AOVA 2QM3A 3ANXA 4E2ZA 3BKXA 1RI4A 2NXJA 4GOND 2V7EA 3LKZA 4JXJA 4UOEA 3BWMA 3ER9A 1G60A 3EGEA 3AXSA 3FPGA 2C7PA 1KR5A 2FHPA 3CGGA 1B42A 4MIKA 5DTQA 2YXLA 3E8SA 3PFGA 4YUXA 2ZFUA 4X41A 2XVAA 1SUIA 3LPMA 4BLVA 3M6WA 3AY0A 3VYWA 4ER6A 5MHTA 1F38A 3AJDA 3FUXA 5LSAA 3BGVA 2XYVA 3TPZA 3DOUA 4OBWA 3TOSA 3NJRA 4BP3A 2AZTA 4IWNA 3FUTA 4OA8A 1R6AA 4L7VA 4KDCA 3P71T 1HMYA 4IKPA 4X61A 2PXXA 1F3LA 3LBYA 4E70A 2ZLBA 4PYMA 4E2YA 4HSGA 4RTKA 3VC1A 1RI5A 2AN3A 5LR6A 1TPYA 3PVCA 1JG2A 5DM4A 3BT7A 1L9KA 4FSXA 1V39A 5FCDA 1L1EA 5HFJA 2NYUA 2P41A 3EPPA 4HH4A 1G55A 2YQZA 3NW9A 3NMUF 5DXJA 3UJ8A 4ISCA 5DXAA 4DQ0A 1VE3A 5G02A 4A6DA 5P8WA 3R9XB 1XDZA 2E5WA 2LD4A 2EJTA 3B3JA 3EGVA 2Z6UA 2IDKA 2I9KA 3KQYA 3CVOA 4KWCA 2UYQA 5KQSA 3G88A 4E2XA 2P7IA 2PSSA 5D1HA 1ZGAA 3PB3A 3HVKA 3CC8A 4QVGA 4E2WA 5KVAA 5EMMA 1XCJA 4WXHA 1JQ3A 2PBFA 2PT9A 2BR3A 3A27A 4P7KA 4BLWA 3ERCA 2YTZA 2AOUA 3LCUA 3B5IA 5CVJA 4X63A 4ER5A 2PX4A 1ZG3A 3D2LA 3EEOA 4XUCA 1QAOA 3TRKA 3UJAA 3OE5A 1L3IA 1N7IA 3MB5A 3DLIA 2O57A 4KW7A 5C1IA 4E31A 4CTKA 4YUWA 4R6WA 4X1OA 5FQOA 4YUZA 1VP9A 2YXEA 5K05A 3ELYA 3VSEA 1WY7A 2XYQA 3NVMB 3PTAA 4HGYA 3G8AA 3A25A 5K0LA 1OR8A 2WA1A 3I5UA 1YB2A 2H00A 1NT2A 3A7DA 3KPJA 5DLYA 5EKUA 3THSA 3X0DA 1YZ3A 2XYRA 2IGTA 4HTFA 5E9WA 4F86A 5CCBA 3DXXA 2ZWVA 4QPPA 2PVCA 2PV0A 1WXXA 2G70A 4ATNA 4C06A 1NW6A 4PINA 5LQNA 5K8VA 3Q87B 2B3TA 4HRAA 1MJFA 4YUVA 3UJBA 3TKAA 1O9HA 2GAFA 3GNLA 2JHPA 5EZSA 3R6TA 3DUWA 5FTWA 4EQZA 3REOA 1WZNA 2JH9A 2HTEA 3FPJA 2ZBPA 3IEIA 3DXZA 5K0NA 3I9FA 4AUKA 3GO4A 3LCVB 4AZSA 2YR0A 4PYLA 4RTPA 3PS9A 4PYQA 5DRYA 5E8RA 1P1CA 3PX2A 5ICCA 1U2ZA 5E1BA 2OYRA 1QANA 1P1BA 4RYLA 1NW5A 1NE2A 1VBFA 3SSMA 1JSXA 2ZBRA 3E7PA 1RJEA 2QE6A 2BR5A 2P1DA 2VDUE 3FYDA 3G5TA 5FA8A 4LECA 3HEMA 3JWHA 1R74A 1I1NA 5DTRA 3KU1A 5FWDA 3DULA 2N47A 5K0GA 3CCFA 4HC4A 1JR4A 5M5BA 1RJGA 1XVAA 3GXOA 3SX0A 3EGIA 4PIMA 1MHTA 5BP7A 1JG1A 3GU3A 3LCCA 3OE4A 2OXTA 3FTEA 3LSTA 4OA5A 1G8SA 4PGGA 4GUAA 3LDUA 4CWAA 5GP1A 3Q7EA 2H11A 2UYHA 1XDSA 4GOMD 1YZHA 4PYJA 1EIZA 3WSTA 4QDKA 3BWBA 3UA4A 4QQNA 4ER3A 2PX5A 3KQQA 3L8DA 4X60A 3HA3A 4E30A 3KR2A 4BY9E 4FT4A 1YUBA 3LDGA 3LHDA 1YFLA 4EKGA 4ER7A 5EC8A 3O7WA 3FTCA 2HWKA 3DMGA 1L3BA 2Z6AA 9MHTA 4NECA 4C03A 2B2CA 2GH1A 5E1MA 2DPMA 5E2AA 1Q0TA 2PX2A 5CVEA 3T7SA 4H0NA 5DSTA 3P8ZA 2Y1WA 3KKZA 3B3GA 3SGLA 1FJXA 1RI3A 4FS8A 4RTNA 4MHTA 2CMHA 4BLUA 2FK7A 5CVVA 5E1DA 4YV2A 2O05A 2PWPA 5KQRA 3NTVA 5CUQA 1O54A 5E9JA 2AR0A 2FPOA 3VC2A 1XJ5A 3OFJA
chains in the Genus database with same CATH superfamily
3WWYA 2QBYB 2W0SA 5AK0A 1I01A 4BXOA 4ZOLF 2NT4A 2O59A 4UM5A 1RXEA 1TK9A 2BTQB 4MDEA 1NZDA 4QU8A 5FUMA 4JI4B 3A58B 4KXWA 4LJYA 4RHFA 4WNCA 4YJHA 3O1JC 1W0JA 4XEUA 3ZY2A 4YUYA 1XELA 2IF2A 3W2TA 1MZPA 4G36A 1PS9A 2XTNA 3T3MB 4AJ9A 3QRWA 1R4ZA 4Z1OA 1XNQB 2HA2A 1ZOPA 2R25B 1JN0A 3U4DA 4LYDA 3R9IA 3C39A 4RMJA 5FPPA 4Q4HA 2FMKA 3HU1A 2QN8A 3W1WA 1KVRA 2AN4A 3MOGA 4JA0A 4RK4A 1ECGA 1IBMB 1UFQA 3VAZA 3H8VA 4JXKA 4C05A 2R6HA 1HURA 3HYRA 4CIDA 2Q4EA 1BROA 3CLHA 1RJFA 3E3OA 3KPYA 5K45A 1OFUA 3D3JA 3JZMA 5LB2A 1A27A 4FOLA 4BV2A 2VJAA 1R8JA 3EG9B 3HN2A 2C4UA 5TNXA 4DW8A 1T9GS 2YMMA 5IARA 4PX5A 3THXB 3SJZA 4PZAA 1CNMA 3OTHA 3SSOA 2AWNA 5JALA 1E8NA 1TMYA 4CW7A 2X0RA 4EHDA 2FV8A 1PR1A 1Z83A 4JBGA 4RAQA 4U2CA 5TARA 3P52A 3EX7C 1QHFA 3PJRA 4P4LA 2C5BA 4AWAA 1SA0A 5CXXA 3LDFA 3A37A 4PV7A 2RDMA 4H7FA 1OLSB 2B4TO 2BVNA 3HE3A 1YRQA 1ZLXA 3H6GA 4KYUA 1F06A 3S1SA 2G77B 2GCNA 3BXOA 4FQ8A 4JIGA 1NKVA 2XY4A 1OHHD 3L8CA 4PPNA 1WUYA 3T7TA 5JYDA 3I6YA 2IPNA 5CVDA 5DHRA 2UZ4A 2G67A 1CE8B 1U8CB 2VHWA 5KCMA 3MMNA 1MDBA 5J4VA 1HPLA 3HHEA 4YRQA 4KRXA 2J3EA 1M5TA 1SHJA 3IV6A 5DHAA 3Q5DA 2RBEA 3LLUA 4AX8A 1X1AA 3TZEA 2AFVA 2ZE6A 1R12A 3EMVA 2GVNA 1UJ6A 5I7AA 4JLWA 1CY0A 3FCAA 4HDOB 1SU4A 4REQA 4ARZA 4DWVA 4GUDA 1KF0A 4A91A 4H4EA 5JMTA 2FH5B 4ZI5A 2C78A 4ZCMA 1OIWA 2VYVD 2DHRA 1O95D 3ADKA 2VTKA 3KFVA 4KYTA 2BJWA 3DBHB 5CM2Z 2EJCA 1S0UA 1KFEB 1OKKD 1UAYA 2RHOA 3B9PA 2IU0A 3TB6A 4G3XA 3WZ2A 4GM0A 2IXTA 1MC1A 4IZ6A 2PYIA 4ZAYA 5B2ZA 1JT9A 3AUAA 1YB4A 2F1RA 1MVLA 1AQNA 2LW7A 2OEPA 3PWZA 4BO8A 2YYSA 4GYWA 4UUQA 1U7TA 1WJGA 1XFAA 1XTIA 2GM9A 1BQ4A 2ZITA 4D4LA 3MTEA 3HPQA 2E9SA 1PRYA 2HT6A 4ZO8A 1SQSA 2ZJ2A 1MENA 3LYLA 4WVLA 2P79A 2V6FA 1QMPA 1U5CA 3CINA 3HSKA 5B1YA 4FLFA 3GV0A 4M8SA 4GMFA 3SDBA 3T5TA 5F7XA 4IAOA 4P5DA 5TMPA 2D8MA 1YNSA 2BZGA 3AKYA 4YMLA 5KU1A 2IP1A 3TQSA 4IJVA 1HLPA 1VBNA 1M2FA 4GOXA 1AGPA 4I9UA 1V16A 3G59A 1V6SA 3NIDB 3GLTA 1JXOA 3MA0A 4QTXA 4ESOA 2A4MA 2FSUA 2VHTA 4RJKA 1AHPA 1QYRA 4LHWA 1Y9JA 1QHHB 3UA3A 3SVTA 1S89A 1HFJA 4BNWA 3P9QA 3ONWA 3F9CA 4BASA 4G5RA 3WAKA 4HXYA 3PEVA 3RUIA 4V0QA 4QGBA 4Z9FA 2Z98A 4YJ2A 3ZVLA 3T5GA 4MKIA 2FEAA 5AJVB 5IH3A 1MHTA 2MSWA 3BZUA 1ILWA 2I7TA 3DMPA 1GYQA 2ZJ0A 3M6VA 3FF1A 4IVPA 3QBJA 4LJ7A 2B9EA 1E61A 1JEJA 3QE0A 1JXMA 3O4FA 5CYOA 1JHUA 4C6RA 3QVMA 3K09C 5IT4A 4XSGA 1CR4A 2GBIA 4EJSC 1QFSA 3FAZA 4Z7QB 1I1QB 4NPAA 4P7JA 1L7MA 2KYRA 3UUEA 3V8PA 3OT1A 4UW9A 5H4GA 1IBKB 3KL2A 3WMFA 2RAUA 3GBSA 3EA5A 3TI7A 4A0SA 2EFDB 3P0IA 1JWAB 3VR4H 4B87A 2OV1A 2KE5A 1P17A 3AWIA 5FR1A 1ZJ4A 1KTIA 4O0LA 1YE8A 4GICA 2VIIA 3BE8A 4I4TF 1MNQA 3RH0A 2P77A 2D4AA 1A5TA 1JV2B 4I3HA 2ZQ5A 3A1WA 1OYOA 1TT5B 2Q5JA 2QMUA 3DTYA 2CMGA 2I2WA 2K5UA 4N1AA 2NSJA 4FYWA 3IUMA 1P77A 2XTJA 1GUZA 2VDJA 2VXBA 3GJ7A 4HXGA 4JC0A 3ETLA 3S68A 3UWOA 3H9BA 5AVKA 3WLOA 4DIKA 3A2KA 2JLWA 3PL1A 3OM0A 4WBSA 2J4FA 2FA9A 4G25A 1OPRA 1R9JA 1YB5A 3I2HA 4JJKA 4PBSA 1XJQA 5CLJA 2OHVA 2QTMA 2HSJA 4FNMA 1NXQA 1XKLA 2GT1A 2YY5A 3OPQA 3RTBA 1PUXA 5EHIA 5C5EA 1QLWA 3N59A 5FPKA 4N76A 4Q05A 1EDOA 1KU6A 1JR3E 2ZE7A 1CCWA 2W90A 1A88A 1SCKA 1VPEA 4BCBA 3NEYA 2BGTA 3K1TA 1XZEA 2V55B 5CDUA 3DEZA 4DBZA 4IDDA 4E12A 4PM4A 4A27A 5KX5B 5HS6A 3WJ7A 5AUNB 1D9ZA 1VIDA 2X14A 2QF7A 3MRVA 4UXIA 2HWWA 5ERGB 4B3GA 2RHTA 2A0KA 4M1ZA 3X3HA 4BLTA 1XR3A 2O3QA 3REQB 2DJ5A 3VZCA 1D1QA 2Q3LA 2RHDA 4II3A 4RD3A 3MBIA 3ENVA 3L18A 4LBZA 2IXDA 3KAQA 1F7UA 1P18A 3FPEA 4IH1A 2WWHA 1BW9B 3MS2A 3UJ7A 2RAVA 4BNYA 2HQSA 3HTXA 4HNAA 4TTSA 2I33A 4KAJA 4MCAA 2WQ7A 1Q0ZA 3C6MA 1EFHA 1ETHA 2RC5A 3IMKA 3HKEA 4M83A 1OKKA 2C7BA 3OJOA 3BXZA 2LVBA 1DQZA 2P62A 2BDUA 1X1DA 4GL4A 5HUHA 2ZT7A 1F2TB 4UUBA 4BB6A 2X4DA 3KYIB 3ZD6A 3GP8A 4YCLA 2ZR0A 1C1YA 3MINB 4L8FA 4DWWA 4BMXA 3IAS6 5CR9A 1CD5A 3R5JA 5J5VA 3SJBA 1PQYA 5HFAA 1UQTA 3O74A 2G7MC 4J43A 2PZMA 3JRXA 2C31A 1MRNA 5B3JC 2RI0A 1K88A 2BR4A 2COEA 4DKJA 2CDRA 1EWYA 4GWKA 1V4BA 1T4CA 3FDZA 4ZANA 2REBA 3GJ6A 3L7DA 1J33A 4AVYA 2GBLC 5DI9A 1KNXA 1O8CA 4KVFA 1N2CB 4JT4A 2JCYA 3NNSA 1YZUA 1C29B 1CE8A 2XYHA 3K53A 4O4JA 4TLEA 4NYMQ 3TIVA 2IS6A 1LPBB 1XRJA 4GI1A 4RVGA 1PKXA 3GD5A 4KB5A 2W6JD 1ZUHA 4A8PA 1XAGA 5DYTA 4B71A 1T8UA 4Q1FA 4DOMA 3GNTA 1RNLA 2G1JA 3I9OA 4ZV9A 2W6MA 2HNBA 4L0QA 1K4KA 2C4WA 1QYXA 2BFWA 3WNBA 5A2GA 2CNKA 3OQMA 3INNA 4KUHA 2VSOA 1NUPA 4OV6B 3VZPA 2UXDB 1NTRA 3I5YA 1W5SA 4BMPB 4FMCF 4MKHA 1Z2CA 1QIIA 1LBSA 3EPRA 1XV5A 4UMVA 3BQMB 3QV2A 4KR7A 1FB5A 2V45A 5LP6F 2ZUFA 3QKRB 2C4TA 1K98A 4NBSA 1YJXA 2XI4A 1D6JA 1PKEA 1UXKA 1HQCA 2JAHA 1JEOA 2NO6A 3Q3VA 4MGEA 4R8LA 5G3ZA 5TV2A 4RPLA 5K6AA 3AVUA 3ZZMA 2O5EA 2BFOA 3NBQA 1E2JA 2OFPA 1ONSA 1NDQA 5EVJA 3DDNA 4M46A 5D3KA 3TAXA 4RORA 1QF6A 2XX3A 3S29A 3VH4A 3ED5A 3KT8A 4NENA 3INYA 1T3ZA 1GT6A 1JEDA 3H8JA 2H4WA 2DR2A 2JLXA 2ZJAA 2IXAA 3WGLA 1FQWA 5EE1A 4MVJF 4N0MA 1H1LB 4LE2A 2DY1A 1FP1D 3DZDA 1FMTA 1MVOA 3QVTA 1A77A 2HUNA 3FTQA 3WBBA 4ZAFA 1G38A 3DL7A 3B6ZA 3GRVA 2VAWA 4JCOA 1A9XA 1DZIA 4DLUA 1CUGA 1VI5A 4J90A 1GKKA 2C9OA 4TLDA 5FIUA 3CNOA 1TVCA 4PZ0A 1JDSA 3REGA 3UC5A 4E2ZA 2VLIA 4F04A 5BUCA 4LOLA 2BMVA 4JXJA 1UCFA 3KZ1E 3MXOA 4WKBA 1T9AA 1CUCA 4XVRA 3FPGA 2A9KA 2H4YA 1YOVA 2DTXA 5ELMA 2GBCA 1QJCA 2NVUB 3E8SA 5ULLA 2FWNA 2XGSA 5HQTA 4E14A 4B6JA 1JDVA 3HP4A 3ORSA 3VYWA 4V0LA 2FU5C 3F7NA 1NATA 1U94A 1RR6A 2FQWA 2RAPA 4PFSA 2C0PA 5ETJA 3UFXB 1RYMA 1HE3A 5L4SA 1QTNA 5B7QA 3JQFA 4NG5A 3DPSA 1Z35A 5KWIA 2XIJA 1FVXA 2NPIA 4JDUA 3KOYA 4QIHA 1QVRA 5D7NA 4PGMA 2IE0A 3FY4A 2XMCA 2COKA 5C3MA 4MPTA 5D86A 2XOXA 1XX6A 1M9NA 2CK3D 3V32A 1T34A 2H5EA 1M67A 1R5JA 4K6KA 1A4RA 2NYUA 3ES9A 5ES4B 4YYZA 3WBKA 2OC9A 3D5QA 4U39A 1RAFA 9LDBA 5CTAA 3CNLA 4RD4A 5DBEX 2Z9DA 3PWTA 1SOAA 3DOFA 4DARA 2VJLA 4KLNA 5CBPB 5J4YA 3HJUA 1NJ5A 3WGKA 4AF6A 3VR5A 4BAUA 5LQSA 1ELOA 1M2GA 1VE5A 1CFJA 1SKYB 3WKCA 3ZLJA 3UAVA 2TECE 3CC8A 3OO1A 4I9NA 2HO5A 4GW3A 4NQZA 4KC0A 4XARA 3RYCB 1Z75A 1WEHA 2BR3A 2EP7A 4YNBA 4EUKA 3ERCA 1H93A 5C3UA 3L07A 4PAQA 3SS9X 4N5MA 1NQXA 3S81A 3UMMA 5FTLA 3RSQA 4NG4A 3GAFA 4JQZA 3PZBA 1GGKA 1L3IA 3QY0A 2GJKA 3PTZA 1QFZA 4BN0A 3HABA 2XD9A 1CUAA 3AHCA 3ELYA 1GQYA 3VSEA 3QWHA 3PGA1 5CU7A 3JWEA 3DL0A 1OR8A 5JQGA 5KBYA 1NT2A 1T8YA 3OURA 4FINA 4MPPA 2A9OA 3THSA 1HGXA 2GZ2A 5K99A 3I04M 4ND1A 1VL0A 2IGTA 2CVQA 1GUYA 2I54A 1JEEA 1QO7A 4TWZA 3G9UA 4G2NA 5AK5A 1EWVA 1YBMA 4U0JA 3GDWA 4A23A 3ASZA 4QA9A 5JMWA 2GAFA 4MJ7A 3FSRA 3B5JA 5ALGA 3F49S 3V3KA 2H5LA 3GEBA 3FFAA 4K81B 4M21A 3ZKWB 5AVSA 3SFTA 3MGCA 1SBNE 3H6HA 1V3TA 2VJPA 1VMKA 2Y4NA 3I39X 2VPZA 3DXZA 4FOOA 4O0MA 3LCVB 1JBQA 1U63A 4HSEA 4P82A 4X84A 1FRVA 3KEGA 2PO7A 3KCQA 2FWAA 2HL6A 3MINA 2EVWX 3UB2A 2GCOA 1Q50A 4TRJA 2IUFA 4UE2A 2W58A 3H0CA 1GCIA 1K0FA 4Q9JA 2GD1O 4EHIA 3EEBA 3QOFA 4J3NA 4DR7B 4OFXA 1DAGA 3TS1A 1NLYA 3DULA 2ACKA 1ZAYA 1BSVA 2J5XA 2OXTA 1BHSA 3LHFA 4H77A 3ETGA 1XU7A 3L8ZA 1HYQA 1XEWY 3NKVA 4KMRA 2BJVA 3RGWS 1YZHA 3L8HA 2CLDX 1S4MA 5EXDA 2UVDA 3RKUA 4DABA 1YJBA 4G4GA 4NOMA 5LP6C 3WNQA 4WIAA 4Q9KA 5A06A 1I24A 5ARCA 2VUSA 2Z5FA 4KR3A 1VA5A 3MGAA 2X5OA 3H1GA 1SVNA 1UDRA 1AGYA 1YI1A 3QHAA 5ERYA 4FT4A 4E30A 5C7YA 2CF6A 1YFLA 2EGUA 4H08A 1Z36A 1VJ5A 1X77A 2W5UA 1J06A 4ZVNA 3SE0A 3ISVA 3QNUA 2J3IA 4UQPA 1ZUD1 2F9MA 2ZYIA 2FPLA 1E8DA 1NWHA 4BNZA 3ITEA 5DDIP 3TZQA 3EWSA 3HK2A 4N5NA 1HTBA 2C42A 5SYMA 3VR0A 5BOVA 5KTRA 4RZQA 4CHTA 1SUWA 3P8ZA 4INPA 1TKBA 2R7AA 3LKBA 4W6QA 1FJXA 1PGJA 5JJLA 1EX1A 1HKUA 4QGHA 1C1DB 1S7GA 1TEZA 1F4PA 5KC9A 1NLZA 2R2GA 1LRLA 1ZN7A 2OORA 2GXSA 1SCQA 1OUMA 2D0PB 2OBBA 3P0JA 1X80B 3R2JA 3WLNA 5C8YB 3EVZA 1NSFA 2IQIA 4LCBA 3RRBA 1Z5NA 1E6KA 2GDJA 3O92A 3RNOA 4W1SA 4A8HA 2KM1A 3FFWA 1YDGA 3G5LA 5CAEB 3K8QA 4EW6A 5IPFA 4QYXA 1K4MA 3LA6A 5CM8B 3H7IA 5CNKA 2FZWA 3CJRA 2DKOA 4POOA 1VMDA 2BBSA 2BUCA 3IUEA 1C9DB 4P7GA 1Z38A 2CEAA 3BWEA 3KQLA 2QOEA 2DT5A 1S1MA 3QEBZ 3IALA 2VHUA 3WIDA 3EAFA 5BMVF 3L46A 2Z43A 3D59A 1T2FA 2IYZA 3OPYB 5K0CA 3X1YA 2ZUEA 1ZVVA 4E32A 2I4IA 2OYCA 4C4AA 3TO5A 4CQNA 1NBOA 3TQIA 3RLFA 3DMTA 3H2ZA 2C1EA 2XE8A 1CQWA 4KIJA 1VB5A 2DR3A 2D5LA 3B82A 4CU5A 5DM2A 4YLYA 3CURA 4RVCA 4GG1A 2G08A 1CQIB 2NVUA 4N7BA 3FNFA 4RF2A 4EHFA 4O4HB 3W34A 1T4MA 1KA9H 4JYPA 5J63A 3QHPA 4AJOA 5MF6A 3C97A 2PAFA 3HYSA 3S28A 1SIBE 4UEJA 1SPBS 3L04A 4WINA 2QZJA 2CLCX 3IX7A 3A11A 3EQZA 1XQVA 1O95C 2UAGA 3KUXA 2QN6A 1QGAA 2VHJA 5D7BA 4PU0A 4M1YA 3PC2A 4H60A 5CPBA 4XWYA 3WNZA 3TZKA 2EX4A 1JHQA 3F2VA 1MRZA 2WU3A 1JIKA 4V0RA 1E6MA 1YS1X 1OTYA 3NO4A 1P0FA 1GNVA 4L8GA 4DDVA 2WVJA 3A3YA 1LSJA 3FPAA 3Q7RA 3ZV6A 5HWSA 4Y3UA 5IJ9A 4MK4A 4QUGA 4YRLA 3OQBA 1AXRA 4J0CA 4Y9SA 1DBQA 4HNUA 1LLCA 2GN6A 1VSQA 1ISRA 1W44A 2YJ5A 5I51A 1QP8A 3BPSA 4XIGS 4LJ6A 2JJ2D 2O2EA 1NONA 1W29A 4PSUA 3ZY4A 4OP2A 4DWJA 1JIQA 2W4IA 3C3BA 4RLFA 3G0DA 5I5GA 3A6KA 1PQPA 2C3PA 1QLHA 2HPZA 2BZ0A 1EFLA 2NUAB 5KYXA 1WOMA 3JWGA 1NMZA 3K6KA 2FCAA 2QAJA 3I2IA 4RGBA 3V2GA 5AKIA 3B2QA 2DM6A 3SX4A 1NVVQ 1SIUA 3M4XA 3R3YA 5HKKD 5AO9A 2WFZA 3RPEA 3U7JA 3WWOA 4Y6RA 5F73A 5BQPA 1PNTA 4MVCA 2ZAIA 1AZLA 3PUWA 3HUDA 5JZMA 2C04A 1H4QA 1QG6A 3L1HA 2JLVA 4ED9A 1GTRA 1E2PA 4CF6A 3OFKA 3QUBA 3ONNA 5CVCA 1QQAA 3OA0A 4AJHA 4BEWA 1RPNA 2PA3A 3KXLA 2NO0A 4UFOA 4P1ZA 4MVJE 3EZGA 1DAEA 3HL4A 4RVSA 1QK4A 3K94A 2CE7A 5EHZA 4HO1X 3ZHYA 1G2IA 3UHPA 2HIAA 5TMDA 4O2AF 4QXMA 1WZIA 1H2XA 1L5SA 1ORHA 1U2PA 4IHJA 4NH4A 1AKYA 1V3QE 2C9YA 2C3OA 2RI6A 2X9LA 3ZKWA 4DQVA 1NVBA 3NHAA 2FQXA 3ZCRA 4RABA 3BMNB 1EE9A 1TD1A 1ZH6A 4IGAA 4JI5B 1KPGA 2F64A 4XQ0A 1J0EA 1DWPA 3UGJA 4DJAA 3GGPA 4L0DA 1NMEA 4MV5A 4CQMB 2G28A 4NU8X 10MHA 2X7HA 1LWOA 3VSCA 1IZZA 1QAMA 1RM5A 1W2HA 2REQA 2GCOB 4LDQA 3VKVA 4CT5A 1ZONA 3R3HA 2P6RA 2Y9MB 4ND7A 4ADSG 1TC2A 3K8ZA 3QVUA 4KQXA 2QR5A 4C29A 4TUYF 4RK7A 2FEPA 2DZDA 1G20B 1SXJD 1BMQA 1D2NA 1TQDA 1W46A 2WJ6A 3H3XA 3HNOA 3PGXA 4ZKEA 3RGGA 3ZCVA 4UBNA 1IK6A 1QYVA 4FGZA 5KNCD 1ZH2A 1X0XA 4NPHA 4XGRA 2UVQA 2ISSD 1DPGA 1LVUA 5WRFA 2ZSKA 2GLUA 3JVVA 3DZIA 4M55A 4Z5XA 1ZUIA 4FE7A 3O91A 4ZQFA 5H02A 3ZI7A 4G56A 1FW8A 4ZRDA 5IYZA 3A6PC 4EELA 2OFFA 3SFZA 2BM9A 3PQEA 2BFEB 2WTNA 3TVYA 1BJTA 1VIVA 1G6Q1 3WRXA 821PA 3TSWA 4MCJA 4R83A 1GT91 1C3JA 1BYUA 2PV7A 3CG4A 3F6CA 2IWHA 3TKLA 1SB9A 4D3ZA 3FHJA 1XTTA 1YQGA 1E6EA 3U81A 3ZW7A 2A9RA 4CTNA 3HEBA 3VR6H 4RDIA 5EESA 4TTJA 4GPZA 2QW1A 4FFSA 2ACWA 2JD2A 4MAMA 2IFTA 2X0FA 1O0CA 3EZ2A 4G1EB 1J6UA 3P9YA 3WK8A 2IJGX 4G97A 2PUBA 1VXRA 1JQDA 4C4SA 1YHZA 4E5NA 4O59O 2HU7A 5AFSA 2EW1A 2IPOA 3PFFA 4M9XA 4KAFA 5KCZA 1VLZA 2EARA 1YB6A 3OKCA 3VPXA 3X1DA 1KK1A 4I4TB 4QD3A 3RUCA 5C8YA 4EGCB 4HVLA 4P53A 3QBTA 5G40A 6PFKA 1ZQ9A 2C5FA 1X1RA 5IZ4A 1Q17A 2Z2ZA 2WKSA 1JMYA 3EVDA 3VAYA 3ADOA 2GQ0A 1L5NA 4PZ9A 4TLLB 1TQ6A 3ZWVA 3CB2A 4MYRA 2X8WA 1FX1A 3S55A 4FYIA 3ZHQA 1E9BA 3BSSA 3RYIA 3LT4A 3O8RA 1X9GA 4OXNA 2QY6A 5JCJA 3QEMA 1GZSA 1D4ZA 1ODSA 4UMEA 4YAGA 4G23A 3FIUA 5IZCA 1U3GA 1HZZA 1PEKE 4PZPA 4Y9DA 5AKZA 3U1VA 3NHLA 1SD1A 3DV2A 3P9KA 4NXNB 3A9WA 4G24A 1G5HA 4LMBA 1C0KA 3Q2OA 1VMAA 5F64A 4D74A 1HTWA 1U7HA 5A4IS 3OOSA 2FOXA 3BKWA 5JIBA 4N12A 2EKPA 3BAFA 1Y80A 2AFRA 2R6DA 3AONB 5FUYA 3UHOA 4BLQA 3O26A 3PICA 3BZBA 1N9ZA 1GU7A 5HVNA 5BYAA 3UOWA 2IOHA 1KS2A 2ZW9A 1XEAA 3JQBC 3QWAA 4QC2A 5JVDB 5AW9A 1PN3A 3AETB 4MI6A 1ZOOA 1SCUA 1IZ9A 5JZSA 1KSFX 1LBTA 1SG0A 3VR5H 1E62A 1K1EA 4B3IA 3RJTA 3V4RA 4BUCA 1C9MA 3TOXA 2XODA 1C4WA 3F47A 3L6EA 3L7BA 4R1MA 2Y05A 3U7GA 1QGUA 4OUKX 5A0TA 4J7AA 5JD6A 1IHOA 3OF5A 1IRIA 1D2MA 1JYFA 7AT1A 3FOCA 4S2EA 1N2JA 2N0SA 4ARIA 1BDJA 1E5DA 5CDGA 2QTNA 1H0SA 2I6FA 5BSKA 7YASA 2IOQA 3L84A 1WKVA 2H7YA 2Q4TA 4JSRA 1KU0A 3NX4A 1PJ3A 1W36C 2A0UA 4G0OA 5BWLA 1VOTA 5C5IA 2YZKA 3FMGA 1N2XA 1T10A 3SF8A 1O08A 1GPWB 2VP3A 4R9VA 4RF3A 1R1DA 3AEUB 5FPTA 2O2SA 3IA7A 3EUEA 1QIMA 4G8DA 4ZGWA 2RGBA 4MVJH 3GRCA 2X2PA 3G89A 3NNDA 1JMKC 2GK4A 2B83A 1PZMA 3QU5A 1D2GA 2CVFA 1NVTA 2R6ZA 1CJSA 1YR6A 1ORRA 3KZOA 1RZRA 3VPCA 4C2UA 2I1VB 5KYXB 4C7MA 3I8XA 2C9CA 1GRVA 2ZTHA 1Z08A 3QMVA 1JL3A 2FW1A 2VTEA 4LDPA 3JAWA 4FGSA 5JCOA 4B3XA 1MB9A 2I62A 3SXPA 1Z37A 2A30A 1TK2A 2O1SA 4FFMA 4OH7A 1L5RA 1B7GO 3RAJA 3JQQA 5BYKA 5L3SA 2RJNA 3KOXA 1TYZA 4ZGGA 2C2WA 2UZIR 3FGNA 4KQKA 4Y2RA 2OV6A 4NBWA 2IS4A 5F9HA 1QC5B 2XBUA 5ER6A 4GC9A 1T5DX 5TT1A 4I0WB 5B2EA 3W5SA 4L5IA 1OZ0A 1DMSA 4MQFB 3LUBA 1JEAA 4L5CA 1NZJA 1FFGA 1FPQA 4GR5A 4N8DA 2GYUA 3AESA 3AI2A 4TTRA 5JSHA 2ZYAA 1W52X 1ZSYA 2FRDA 2AG1A 4JLOA 4OHWA 5D6OA 5E0OA 3EF3A 1DJOA 5MGBA 3SXUB 2ZTUA 1W5TA 1J90A 3TJMA 5BSEA 4I1PA 1UWKA 2AV6A 3ADCA 3B7PA 4B75A 3R44A 1N9GA 1VPLA 4DRYA 1KWKA 1SXJA 4GSYA 4DE5A 1JIXA 2QVLA 2ST1A 1TFUA 4HXEB 5HG0A 3F1LA 3BMNA 4D25A 5FL7A 3NBFA 1Y34E 4A0RA 3OZSA 3ANXA 2WD7B 1RHJA 4DNQA 4D8XA 5FTKA 3GZJA 1E7MA 3G7SA 4UBJA 4Y9RA 2A57A 2QX8A 2GGSA 3NATA 3TB4A 1EUDB 3N6VA 4NEQA 4UCWA 3K20A 3ABSB 5ALYA 4C4RA 1J99A 2XVAA 4TLMB 1MMFB 3AG5A 2IEZA 4RNDB 2VQ6A 1HZZC 2P2NA 1G20A 2G9UA 1ZYUA 2YS7A 1P7YA 3PYMA 4H1HA 4NFYA 2NG1A 5MHTA 3UT6A 2V3WA 2ZVQX 4F1WA 2ZRKA 3NJRA 4JIMA 3ZDYB 3IVRA 2R6CA 3GJQA 4BQEA 2TMDA 4EFMA 1TNDA 3GUCA 4N9WA 3H3FA 1TVMA 2BGMA 2PXXA 1W4RA 1ZIOA 1Z6ZA 4H0CA 3D54D 2G0NA 4IKPA 4E70A 2OAEA 1KHTA 4QREA 4BC1A 2B9VA 1PL6A 4BO5A 1XROA 4ZI2A 2XKKA 1Q7EA 5JYEA 3WADA 4HLQB 3GLUA 1MQ9A 1YRYE 5B36A 1KFCB 1M1YE 2XT9A 2XWSA 3AEKB 2OSVA 4HH4A 4M49A 4TLAA 3LVFO 5DXJA 2SECE 3WC4A 3IE1A 5EJ2A 1QRDA 2E5WA 2IYQA 2V58A 3A4MA 2Y9PB 2HJVA 2NO5A 3EGVA 3HBLA 4Y2JA 5F77A 3UK7A 1YR8A 2IIVA 3GLIA 1JG7A 4ZTUB 3UB3A 3VGJA 4PBRA 4ENQA 1C2YA 4WBNA 2NVOA 4QBKA 4XWOA 2Y0PA 4X5OA 3N8DA 3L4SO 4LIPD 1DCFA 3Q3IA 1WPRA 4X91A 3LCUA 4QLBA 1XTKA 3AYXB 4JT8A 1GQ2A 2HF7A 3EGXA 4C0AC 4QECA 4MUAA 1R9GA 3L0OA 4ZI7B 3FCSB 1B43A 3VPHA 1RT9A 4RC9A 2D1QA 4A5OA 1CV2A 1DC3A 1N5JA 2YXEA 2ZK7A 2F8SA 1WUHS 5IEBA 3SVLA 2I3AA 3EEFA 1NR1A 1S02A 1DEOA 1OAOA 1JF8A 3RU7A 3G8AA 1NWCA 5TF0A 2ZAMA 1ONPA 1N25A 3TNLA 4ZAWA 3EXEB 2FMIA 3IAAA 3IQGX 4OQXA 3JVIA 3N5CA 4Y2GA 5DSZA 2XYRA 1VJGA 3OWXA 2FPKA 2HBQA 4DLYA 3SLRA 3DFIA 1MAWA 3JQRA 4UVIA 2EAUA 4F6RA 5BR1A 2QTZA 4IXMA 5A9TA 5C51B 4U8GA 3KSDO 1KO4A 2IYAA 4B31A 4YRGA 2PNFA 3N9IA 2UYYA 3DBIA 3DUWA 3PXAA 5AXCA 3IHKA 1I1HA 4INJA 4NPCA 1G6KA 2EW8A 1C0IA 2ZBPA 1OAKA 2PUVA 1GPLA 4FHEA 4MOWA 1YE3A 4QBFA 1YZKA 4DR5B 5E8RA 3AILA 3VHXB 4K9MA 1OXMA 1ZGBA 2FVYA 3AFGA 4RYLA 1IEQA 4JDPA 4B7AA 3EMKA 4OXQA 4DL9A 3L1KA 3FYDA 2VBGA 4G4SO 3DGEC 3QF7A 2YV2A 8ABPA 2C4HA 1WCIB 2UVPA 3BVPA 3WB2A 5FWDA 3KKLA 1I5RA 5A4JA 1X8XA 3RHZA 4QG7A 1EE1A 1XVAA 3GXOA 3EA0A 3SBXA 1JG1A 3LTEA 4UUOA 3NPAA 4L95C 4AXBA 4GX2A 1FDRA 4OGFA 1UKZA 3D6JA 4DA7A 1TIPA 1ADJA 2CXNA 1MO5A 2FQYA 1DTEA 3B1KA 4RACA 1P1JA 3ECCA 3JX9A 4CWAA 5CITA 1OLUA 3EFHA 3JZIA 5JS8A 1EJ2A 2MIIA 2QLJA 3OX2A 3FCOA 1L7OA 4M0CA 2G9VA 4QNMA 4ZN6A 3GLKA 4YDQA 3KCNA 2NUTB 2J7PA 2BMFA 4HDKA 5FBQB 4ZRNA 3ZGYA 2VSQA 1JT2A 4G1UC 1QPBA 1SWVA 3PF9A 3Q5EA 1AE1A 1V8DA 4D6XA 1L4MA 2RB4A 3JQ9C 2QNBA 3LC7O 2ZYRA 2VDOB 3QVGB 1A2OA 4XPZA 1J2TA 5JECA 2IZZA 3QBVA 1GPNA 2OFOA 3PJDA 1Y6JA 3NM6B 4IUBS 3T9DA 5FEUA 3FB4A 1I3KA 2B35A 2DLNA 3Q4GA 2PSJA 1YAHA 1XIVA 3JQPA 4P36A 3H1FA 4ZOQI 5IWAB 1O3YA 4KR2A 1MA0A 2JAPA 2AX3A 2F1KA 2D4HA 2R85A 4EFDA 5IDWA 1FVFA 3EGCA 4YV2A 3R76A 2G4VA 2NACA 2VJOA 3P4XA 1SKQA 2P27A 3NTVA 4JN6B 1V5WA 3WV5A 3OOYA 2C83A 1EG7A 2XUGA 1ZCAA 1BXKA 3T4PA 4CDMA 1QTRA 3NH9A 4P92A 4CJXA 3OCZA 3TFOA 2BGWA 3X44A 4B40A 2X3YA 1R27A 3WAGA 1QU3A 3WX0A 5KOHB 5JAPA 5FPQA 1I94B 2PJZA 2F7SA 1Y6GA 4HYEA 1UBCA 2WFLB 3CCCA 2XW6A 2ZSHA 4FONA 3VKUA 4YHHB 1FFXA 3V4SA 2HJHA 4LXGA 1GY8A 3BA1A 3JQAB 3T5PA 4RKWA 3D8HA 3S99A 3SXUA 4BLSA 3E82A 4FUQA 2LTAA 2ZIWB 2BE9A 1HOXA 3AHJA 1QO9A 2J0UA 1DAHA 1HLDA 3O9VA 2DFDA 4LYGA 4RIFA 5JCZA 1H8EA 1RBQA 1SCBA 2QG9A 1B6TA 2DHEA 5DHFA 5AKJA 4W5HA 2CL5A 1E9SA 1KI3A 4IDOA 5G3YA 5HF5A 1UZNA 2CVOA 1J7JA 1EGAA 5C7IO 3DMTC 4XA8A 3BRSA 3WXMA 2GF0A 1YO6A 3IEUA 4FEAA 1RAAA 4YRKA 2BJHA 3SHFA 2H6EA 3DWFA 1EUDA 2OO5C 4EFLA 3LH5A 2HIHA 1YC2A 5LFAA 2O3SA 2YC2C 1HT3A 4WK2B 3SOPA 3WWEA 2YL2A 3E8XA 4CMCA 3QE9Y 4NJMB 4FQ5A 3O2QB 3AF5A 1J5XA 1E5QA 1E2NA 1Y3AA 4GOOD 1UT8A 2H2AA 2XA1A 4DGSA 3RVLA 3G23A 5CT9A 1YASA 4WOJA 2WY2D 2WF5A 5IW8A 2EBHX 2MSCB 2ZKLA 4F2HA 1GPBA 4I9HA 3KT3A 1CJVC 4G65A 1XVTA 4KPUA 4XM0A 1H2WA 3SZUA 2ZXUA 1N2ZA 2PX8A 3UJ6A 2ZQZA 4I81A 3PUKA 4RVDA 4R8RA 2Q6LA 1N5KA 4GWGA 1J00A 2DUWA 5FOWA 4L4YA 5I7EA 5A02A 4RTSA 2OM6A 2VHEA 1DELA 3AEKA 3OO0A 4PFQA 4MHOA 4XX0B 5IJXA 3WRWA 5HTOA 3PZRA 2C7QA 1X7ZA 5DBOA 4ZPJA 1CDZA 2D1TA 2ZCVA 2ZUWA 4ZO4A 5EHGA 3KT6A 4F6CA 1IY8A 2JH8A 1JQBA 1E20A 1PW5A 4WN3A 2Y66A 3QYPA 1XTVA 1EB8A 2JGAA 4H7PA 3SNHA 1JJVA 2IDZA 1JU4A 3FI9A 3OZ7A 3ST7A 4HGPA 3V7WA 4KV9A 5L9AA 3VXKA 2X76A 3FZQA 4DCUA 1ADFA 2XWQA 5E6UB 3W6NA 2R6AA 3WWDA 3TR5A 3WWZA 2BEJA 2A14A 1JJFA 1DC6A 4ZI7A 3HGQA 2XMPA 2C88A 2NN3C 2H1WA 3QXJA 4C6HA 3VSBA 4DB2A 3JD2A 2WJVA 5KTPA 3K2QA 1MAUA 1DV1A 1QYDA 5G41A 1HSOA 4JJAA 3MFQA 4BV9A 1L5FA 5F1YA 1YHNA 2B1RA 3O8LA 3W5DA 1UBHS 2ZBGA 4FJ1A 3T9EA 1BC5A 2QYSA 5KDLA 4F5WA 1SEPA 1JDPA 3E5NA 4ON9A 1PDWA 3AF1A 3K96A 4QFBA 2BUBA 4R2XA 4RLHA 7REQB 2P5UA 1XP8A 2YW9A 3PUZA 4A03A 3ICWA 3N74A 4FGJA 4CKEB 1V95A 3IH5A 4GLJA 2B3DA 1RFLA 2H52A 2A5YB 2XKJE 2YWFA 1E79A 4FU0A 5LXTB 4PC6A 2D1FA 2OG1A 3CNQS 3U9TA 3I4FA 2IWRA 3SDZA 3UV6A 3AKCA 3WMXA 2AMYA 5B58T 2ERXA 3M6UA 4FHZA 1ZMBA 3KAPA 3L05A 2MT9A 4JLAA 5ADWA 5AKHA 1OTHA 1TEHA 1WMAA 4IMIB 4C3ZA 1R7RA 3LUFA 2HLPA 4MR8A 4Z7NB 4TVOA 2ID4A 1C2TA 3Q0EA 1NY5A 2PD6A 2HBYA 2HF9A 3UAGA 1H4VB 1LX7A 1ST2A 2O06A 4BVGA 1V37A 3N0TA 2CDNA 2I67A 4DM3A 1MKYA 3EEIA 2FHSA 3P96A 2IKQA 2JBAA 4HMQA 1NRXA 3K0FA 2E4XA 3OBIA 4OHMA 3UXHA 1T36B 4L3WA 4AXXA 4UUPA 4L3VA 2PMBA 1REQA 4PW0A 1OLOA 4LJ5A 4RY0A 2VF7A 4H7DA 4F97A 5E3JA 4Z2YA 1SXHA 3BILA 2E6KA 1NOKA 2ZXFA 4B7ZA 3QW2A 4ILEA 5KYWB 5JNLA 2OKGA 1ZD8A 3P45A 2R5NA 4BO0A 4NCHA 1TIBA 3MS4A 1PR0A 1V1RB 2Z09A 3K1AB 1AQJA 3WGTA 5JU6A 2EL7A 1UBUS 2JF0A 3IIMA 3ILVA 4HYTA 4RH1A 3V1TC 2VUHB 1P5RA 2P3LA 5I6DA 2GKSA 3CLVA 4WV3A 3F6BX 4J94A 1TJ3A 2NV6A 2JHFA 3U4CA 2F8TA 3ZDZB 1FDSA 1HKHA 5ERXA 4IIXA 5E4TA 3GRFA 1H2BA 2PN1A 4M6WA 1I7NA 2QJRA 5C81A 2EF1A 2YZMA 1JKXA 5AHWA 2GZMA 3M0EA 4YCDA 3SK0A 3RS3A 3TLCA 2RGRA 2LV8A 2BH9A 3H5VA 4AMUA 3FJ1A 4M60A 5FV7A 4PLVA 3SICE 5IU6A 4OYRA 3O38A 1OSNA 4BV8A 3T7EA 1HI9A 2ZVJA 3BMXA 1IMOA 2NLOA 3HVUA 3SZLA 4MB6A 5AK4A 4YP6A 3OUZA 2DUMA 2R1ZA 4JOSA 4G0QA 4KZPA 5F5XA 4BB9A 3LWBA 5FL3A 4P35A 3K8YA 1C41A 5BSUA 4BOYA 3KEQA 5BT9A 3LUCA 1JHRA 1Z0ZA 5DLPA 1DBPA 1VHJA 3JQFC 5ICGA 2WFLA 3MHPA 3P9NA 2BEKA 1R10A 1SG9A 2P30A 3B3QA 4LRQA 4BNTA 4C87A 4FM9A 3U3ZA 3HQ4O 3VPBA 4CIYA 1XEFA 3VUEA 3VC7A 4IXNA 1EGQA 1HQDA 3I64A 4B83A 5IASA 3G82C 3FFBA 5BWNA 2LWIA 2WIKA 2ZRNA 1GU1A 1E9EA 1LSOA 1O94C 4XUDA 5FNZA 5TXGA 4HGOA 4EATA 2GN8A 6AT1A 1NJ1A 1UIRA 3OZBA 1A04A 5EWJA 4ZQCB 3DFFA 3EASA 1AD2A 4UVGA 5I4IA 5J47A 3ORRA 2H9YA 3DLBA 4DS3A 3DOJA 2QRVA 3L8GA 3R6DA 1OXXK 2E1RA 3C7CB 3EDCA 5EE0A 3PIRA 1AUQA 3QP9A 1G3IA 5L7WA 2IW1A 2JFOA 2VRWA 2DHDA 1ND6A 3C4QA 3DEFA 3FSEA 3NTUA 2YUTA 4JWTA 4M76B 3SEFA 5HIIA 4XLLA 1RAIA 5JC1A 2FPGB 1A7KA 4UBIA 3RVKA 3VHQA 2G71A 3AR4A 3HXKA 3MYYA 3H4TA 3VR6D 3FWKA 1X9HA 5L3QB 1NHGA 1RRKA 4QUDA 4DIFA 5FB3A 1T6XA 1P74A 5JAQA 2ZUTA 4CE6A 5LP1A 4CLDA 5EJ8A 2B2NA 3LF2A 4JYZA 4QXOA 4MV6A 3DMRA 1Z2OX 3ANLA 1M6YA 2H7XA 4J2TA 5A5DA 5K6AC 1U1CA 5AW0A 2WF8A 1CUXA 4H3SA 3UJ9A 2PT7A 1Y82A 3CX7A 1Z0DA 1TEVA 1P4SA 1ZM9A 5KVQA 7ABPA 3UV3A 1ESNA 2VPIA 2YHUA 2D5CA 4OQFA 3OFSA 1N6HA 2XOEA 2JJ1D 4RNCA 3I09A 2CXHA 2X6QA 2AQHA 4KU4A 4K26A 1F0NA 1QV7A 1QWOA 2RBKA 4FMDF 4A16A 5JFGA 4TS9A 4NKRA 4IWYA 2OXEA 1SVMA 3UH0A 4D0SA 1Q0RA 1PNRA 2XXAB 1XZMA 3KHKA 4IO1A 3LL7A 2H54A 2SKDA 4BP1A 4YS6A 1UFOA 1L7VC 1YZNA 5ALWA 1V8OA 4LNUA 1IM2A 1GTL1 1KMIY 1M83A 2WZCA 3JYPA 3PFKA 4URWR 3VJLA 5JISA 3TJRA 5CT5A 3AEXA 3M9WA 1WB4A 3HFJA 4CEIA 4FCWA 1OX4A 4GBED 121PA 4KIFA 5CH3A 5K3OA 2E5LB 4DILA 1LRKA 1RCFA 3KQUA 2PK3A 1HL7A 1NW7A 2H4FA 3TW4A 3LPDA 3T3DA 2B2XA 4OQYA 3NBKA 1KARA 2GHTA 4ZDIA 3BFJA 13PKA 1L7AA 5CHEA 2Y6VA 3GLGB 2QX6A 1GSHA 1M0TA 3T7KA 1TF5A 4IRXA 2J9XB 4LDAA 4QDXA 3AFNA 4HJRA 4RELA 1GN8A 2VDLB 2QUHA 2VJDA 1RYBA 1FFCA 1K8ZB 3T41A 2QQFA 4FCVA 3T5BA 3TLMA 3BIXA 5C2JB 3FE2A 1YGPA 3K0SA 4A6PA 3EXFA 1T6BY 4Q6BA 2I99A 1AZSC 3CEJA 4MJLA 4E5DA 1UOOA 4UJ5A 3JR3A 1F4LA 1A9TA 2ZU0C 4Q16A 4XI9A 4CG1A 3ZWYA 2HMUA 3W8DA 1QE3A 1T9DA 1UK7A 4MW6A 4GQIA 4EUHA 3L7LA 4W8OA 2C7PA 4UUNA 4RZ3A 1XL1A 2GCPA 3RUHA 2ZR8A 3BN3A 1YZYA 4B81A 3LWNA 4Q3AA 5K8LA 5B37A 1IONA 1JZTA 1DO0A 1XZKA 4TWRA 1QVAA 4ROTA 3S5JA 2QMEA 3E58A 2HXYA 1M1NB 1DKMA 3JZDA 2QT9A 2OGUA 3WK7A 2R66A 3JASA 4I3GA 2ATCA 3WDLA 3I5XA 4DFDA 3C3JA 2Z8XA 4RTKA 3TTWA 1RI5A 4UMFA 2IKSA 3O8BA 5EJ5A 3QG1A 2C92A 4KXNA 4XWWA 2A3NA 1JG2A 3C5WP 3NC1C 5FUWA 4AURA 1L4LA 3L40A 3SPXA 4O2BF 1PI3A 5LPNA 4C5BA 1YSCA 1CTQA 3C4VA 4OAOA 2OUKA 4R1PA 3JRNA 2J41A 4DAEA 4EYGA 5HJ2A 5FX2A 2DUNA 2ICAA 2ISCA 1AJEA 3UJ8A 5PGMA 2FEKA 4ISCA 4BQSA 2VRCD 1FYXA 5ILGA 2EL9A 3L82B 3V4LA 4FFDA 4C7JA 4LYFA 1OBFO 3EODA 1JLMA 2O50A 4Y98A 2J5QA 4DIOA 2IDKA 3DM9B 2EG9A 1IIBA 1C4XA 1XEXB 5ALOA 4EQ6B 3COJA 5GONF 3MT8A 2PSSA 1Z7YA 3TXXA 2DECA 3MWGA 5HKAA 5HZHA 4QXPA 5KVAA 2CSXA 1E1QD 1E4YA 4PSVA 3VVBA 2AUNA 5HK9A 2PT9A 3PI7A 4U02A 3R5FA 5ALNA 3U40A 2PX4A 2VVTA 4ER5A 3HUFA 3ZU2A 3DJFA 3PQDA 3FNIA 3H5OA 4MUIA 3H05A 1GAWA 3OE5A 2WHPB 1SIOA 1IJBA 2JK0A 4GMXA 4LJ4A 4RD1A 1BA3A 4P80A 3D8NA 5EWMB 1YRHA 1LFAA 1VIAA 4TWIA 4BN5A 4KSBA 2XYQA 1W94A 1FP6A 2G40A 3LT1A 4WKNA 4TYWA 3NJ8A 1ORVA 1YB2A 4R9RA 2B4KA 3HYLA 1FSGA 3C16C 3NBAA 3STTA 3KT0A 3WLMA 1QDEA 4U1RA 2CMFA 1R6UA 1IHXA 4UBLA 1ID8A 1Q16A 1QMGA 5KX5F 4MB0A 3K0KA 5JHGB 2YOGA 3HI4A 4Z3DA 4ZYVA 1UBMS 3D6VA 3CLKA 3G9ZA 1H5QA 3QY9A 3TZ6A 3U80A 3TKAA 3GNLA 2ON6A 2D7CA 4WZBA 2FGJA 2WT8A 4Y2PA 4D9JA 5JZBA 5LYJB 1KDZA 2FDXA 4J75A 2HTEA 2R6FA 1QK5A 1EZ1A 1U9YA 1UC5B 1JPNA 2GF9A 2RH4A 4J2HA 4LDNA 4HDRB 4AUKA 4RTPA 1W36D 1OBCA 3OKFA 4PVDA 3W06A 1Z25A 4PN7A 1TUEA 2O0MA 1JHDA 1T29A 5K3SA 1T8SA 3VR3A 5TRTA 3GVIA 3ZWCA 1C3EA 2BWJA 1LBQA 3PQCA 4JP3A 2GNOA 2ECKA 3D2CA 3C8ZA 1I4TD 2VBFA 3S8MA 3WMEA 4KPEC 1T2CA 5A6SA 2IZ0A 3IKTA 3K7EA 2V0CA 3T9FA 3CUWA 4OQQA 5KKCA 3HJHA 3K32A 1F3OA 2VZLA 1UFRA 3MOIA 4IIYA 5M5BA 1GRCA 3IJPA 2A8YA 1UM8A 2I1LA 1Y63A 1DEKA 1RWOA 4OH1A 3EOZA 4WH0A 5KPDA 1LJUA 3NHBA 3K1YA 1ZO8A 3GQVA 1LW7A 1Z18A 5AJWA 1RM3A 3CBQA 3VJRA 4WFJA 2QPAA 5D5QA 3FOZA 1K89A 1O95A 1SVIA 2JCSA 2WAXA 3LZDA 3PITA 4G37A 4MV7A 3ZE2B 3ZV4A 1ZMOA 4FE3A 1I6WA 1KBZA 3A1FA 4XIFA 4YRIA 1YJ5A 1U3FA 4ZQHA 3DE2X 4QUEA 4ZT5A 1Q0UA 3BMQA 1ZD2P 1ZSNA 3Q9NA 4RHCA 2HSEA 2XQFA 1KVQA 3LDGA 4JMLA 2OYSA 2QD1A 3T12A 4PLGA 3ZS9A 4AFNA 3NIFB 2IGBA 4C2BA 1FYFA 1V5IA 3V4ZA 2DERA 3AF3A 5FXMA 1DX9A 4C03A 5I7VA 1D2RA 1E9AA 3VH2A 4OAQA 4RXMA 2AEMA 5F23A 3L7IA 3LHKA 4QGGA 5DSTA 3W1EA 1US8A 1BWPA 4HTAA 3NLLA 1XK6A 1LTHR 2XOKD 3B3GA 1UKYA 3NYRA 4D42A 4FS8A 2WQ6A 1N1DA 4JJ6A 2VH1A 4L2IA 3W8NA 2JW5A 3WIOA 3LUAA 1Q20A 4YAJA 2R00A 1OX4B 3FHLA 3OZRA 2E85A 1AQYA 1MJGM 3NHMA 3G2LA 3E2PA 3D8SA 2BTOA 3AVWA 4II2A 2WJ3A 5K0BA 2O2HA 5EXXA 3T7IA 5A1JA 1H2EA 2Z83A 3GROA 1N6IA 2B7CA 2UDPA 4PGAA 5JHHB 3THYB 2ZRDA 1RYYA 3CT4A 1XYYA 4CKBA 2YNMD 3WJAA 5JR3A 2JG3A 1WVMA 1ORIA 4YX9A 1TCCA 4UQLA 1WQ1R 4NAVA 3EB9A 3FOBA 2JIQA 3D5EA 3TR6A 5CH5A 5GM2A 1R0KA 3A2LA 2DRIA 4JUIA 4NEHB 4HNSA 4YK7A 5DCYA 3TKYA 3MBOA 3WQBA 3TQOA 4PZCA 2DCUA 2GBGA 3FYSA 5EXTA 3TLYA 4B3FX 4CZ2A 2Q5CA 4Q3EA 3C5HA 2D62A 3T38A 3K70D 3IIKA 3TK1A 1N32B 4OJKA 2FF5A 1EUCA 1AN9A 3JRWA 1D8TA 4KR0A 5DLQC 5HK8A 4BE7B 5I7HA 1DFIA 3NHJA 1OI4A 3DGFC 5TMEA 2CHFA 4FYMA 4QJIA 4WA8A 3RSHA 1UMDA 4JJEA 1GPKA 1RRMA 3AU9A 1OOEA 5CXSA 1E3LA 5ALZA 1HX7A 1Q1EA 2PQ0A 3DKPA 1L4YA 3KZCA 4YO8A 3CM0A 4AW9A 4BGEA 1U5BB 3OVMA 4ODIA 3H2IA 2VPYA 3RREA 3KG2A 4QOHA 5CFPA 1Z6YA 2J9YB 1CIPA 1DQPA 2ZSJA 2GZHA 1HOTA 3DBRB 1M1NA 2F8LA 2ORIA 3DDOA 1N0UA 3F5SA 3Q3CA 1BS9A 2HMYB 3Q8WA 5BQ5A 3E53A 5LP6A 4KRFA 4OUDB 1IJFA 3V8MA 3DS8A 4LV6A 4RANA 4Z49A 2ODEA 5GZ3A 3MWEB 4KVAA 1ZNZA 3LQKA 4FFBA 4KQMA 3UMYA 1CHNA 4Y2TA 2QG6A 3TOZA 3PXDA 2IPAB 4W8HA 3DW1X 5L6LB 2X9QA 3PT9A 5JDIC 3GGGA 2MCFA 4BX3A 1AB5A 3C98A 3A7EA 4L16A 3IUSA 5CT8A 2O0LA 3TM5A 4XM2A 2UUOA 4OL9A 2VF4X 2HNKA 2AFIB 2O1XA 1XJCA 2ZYHA 4QXRA 5IAEA 2N1BA 3EXHC 3OOJA 3TLXA 4YRJA 3OJFA 2IRWA 2PBRA 5JT1A 4R68A 4YIHA 2Q45A 3PXBA 2Z58A 4QBHA 4E5PA 1BAPA 1SC6A 2KX7A 2PL3A 1LCIA 4O5AA 2PGNA 1JEYB 1XZCA 4EABA 2QVGA 3RB8A 5HR5A 2E3JA 4QNNA 1XZ8A 2FUNB 4RHEA 2R97A 3I53A 3WHLA 1G9SA 4GXQA 4IXTA 2VH2A 3CZQA 3V1NA 3VX3A 4YR7A 4XWGA 2GA9A 4ZJYA 4A26A 1MO4A 2XEDA 2BE7A 1GGHA 2VPXA 3N0XA 1PV1A 1YR2A 3CT6A 3G6WA 2CLOB 1KERA 1Z6GA 3N3BC 3ENQA 3RBAA 1GAXA 4CDNA 4FW8A 2DQYA 1AK2A 1J20A 3I6QA 1A2BA 3DT6A 3S2EA 5EHXA 1YOBA 3IP6A 3QKSB 4DB4A 5CG2A 2BM1A 2ONKA 2QL7A 2D1YA 4NTZA 3B8EA 2GASA 4EW1A 1JSRA 2CWWA 4KXLA 2OHJA 1M8GA 2OHXA 3JS5A 3ZZNA 1R0XA 3T3HA 2GJSA 2FYTA 3FGPA 3FVWA 1N5DA 2VCEA 3VYVA 4CM5A 3I42A 1RLTA 3Q7SA 3GGDA 5J5AA 3CS3A 3ZIUA 4B85A 2G5PA 3CBGA 1TVKA 5G53C 2P0YA 2C4VA 2PZJA 4ZDWA 2J9FB 2ZU6A 1JU9A 4IJQA 4PAWA 1E0JA 2DE0X 1MOPA 2DBYA 4L9AA 5T6BA 3HM9A 3BX1A 3C6ZA 4OBEA 4L85A 4C3OB 3HLTA 1I7QB 3VX4A 5B4VA 1N2OA 3RWBA 4WY5A 1D0VA 2CV0A 1ORTA 3QJGA 3PK0A 3U4QA 2YMLA 4D4JA 3PU6A 1XZJA 4Q4CA 2B5OA 4KIWA 2AN5A 1QCZA 4IP0A 1K3TA 4AKGA 5DT9A 2VPQA 5AI8A 1JLLB 1VHWA 3EXG1 3MCZA 4H9GA 4LYYA 4LWPA 4PLZA 3DKIA 3UT5B 4BWVA 1UAGA 1TECE 3C3DA 4YQZA 2CNWA 1PT6A 3PFBA 4FXOA 1FUKA 4I1RA 5ECWA 3SIRA 4C5AA 2O8FA 2RGWA 1LC0A 5DU2A 4RE5A 3F5DA 5LIPA 4AP9A 4OKIA 5NLLA 3C8UA 1TJYA 5JADA 4EHKA 5FF9A 1EFVA 5EAIA 3FUUA 4HAVA 2WJJA 1U9CA 2XWBF 1YL7A 1F5SA 2OZVA 1SH7A 3E2IA 1UBKS 4IR7A 3TW6A 3HCNA 5DK6A 3RFCA 1JHMA 2VCHA 2QSZA 2R1VB 1D3AA 5IVPA 2QGFA 1EM6A 2FG7C 5CLGA 2QD2A 3TX6A 3W3AD 4OD0A 2CKMA 1EFPA 1GQRA 1ULUA 4XIJA 3A6DA 2W6PA 1CQZA 5BVGA 5AKYA 4CG3A 4J9UE 2VK8A 3B1ZA 2NUBA 4GD3Q 1CS0B 1A7JA 5SZJA 3TLJA 2ZS8A 1TTHA 3NR2A 4O08A 1MU0A 2ZR7A 2JCXA 2LKCA 2VXYA 3NYWA 3IKJA 3P0RA 4G5GA 4INOA 5BSRA 5BW5A 1UADA 1UBLS 2AC2A 3HV2A 5JDCC 1T13A 3UV7A 1K97A 1VZ2A 4IINA 4QVKA 4TT8A 5TQ2B 3RG8A 3VTKA 4XVUA 3IRVA 3LC1O 2VZ0A 3V1KA 1J8VA 1XCMA 2FFBA 3BQNB 3DH0A 1T8RA 2ADOA 3FA2A 3UM9A 1CQJB 1R3UA 1Y4AE 4L2IB 4RJLA 2DC1A 4GC5A 5SY4A 3RK0A 1CZLA 1QGYA 3EAQA 5F5LA 3QPAA 4YP7A 3U7QB 4E03A 5JZ9A 5KIAA 5HFNA 1XZIA 1B00A 2IUTA 1X19A 2W93A 2B1JA 2C5LA 1NBWB 1X86B 3NDJA 4IV8A 4JNKA 4V1CI 2PDAA 2NSYA 1NSTA 3QLJA 5EJFA 1JPJA 1PDVA 4PSKA 4PYIA 3DE4X 2P2GA 1E3WA 3EF1A 2HFJA 1V1MA 2C4NA 4MCIA 4MQEB 4WEQA 1G291 3INTA 5DJ5A 4IV0A 1DRWA 4JC4A 3RC3A 1PT5A 5THQA 2WYUA 4J8PA 2B61A 2F9FA 5GPBA 2JEYA 4D8WA 2IYWA 1R50A 2Z0MA 1UBRS 3G1UA 3PJGA 4TYQA 3MYRA 1JBKA 3PRHA 4TWBA 1K7XB 3FOAA 4PWYA 4B3BA 4FZVA 1I3NA 2F17A 1XE3A 3V8VA 4B4OA 3G2JA 1P6UA 2DQZA 1YZFA 3NP7A 2IYPA 1ZISA 2WKWA 1MIOA 4FOTA 4H1VA 3U44A 2PR2A 2VHQA 2JFNA 4YJFB 5FFFA 1MUUA 1Q7RA 2JFQA 4KGDA 3KYCA 3FAKA 5EKXA 3P97A 3URKA 3JQAD 1C5KA 1XLVA 2RHHA 4Q37A 4QT0A 5AW3A 3KETA 3VR5D 1V5FA 2ZZKA 1DAOA 1QBKC 2ZI4A 1AKUA 1K6XA 2A5JA 5DSXA 1NASA 5BOSA 2O4CA 4GGPA 4EB3A 4YRDA 4DUPA 2FSIA 3EH2A 4JD5A 3PNMA 4TS1A 1YD7A 4Y6PA 2F6RA 2OQIA 4LY9A 3UG6A 2IV3A 5CD9A 4V3CA 521PA 3KQNA 4D41A 5KTTA 1CRZA 1DBRA 2XUKA 1WBBA 2C03A 4UTVA 2NZXA 2HJSA 4IOMA 4ZI3A 1DKPA 2JI9A 3I5AA 4IH9A 2ORED 4E4RA 3QF4A 1XSEA 2HRDA 1LBIA 2HREA 3CZPA 4LA4A 4AYWA 2V74B 3LXXA 1JSZA 3ZJ4A 5KYTA 2VWGA 1GL7A 4U9HS 2Y2VA 1ZKDA 2JDID 1U3UA 1T1GA 2NT3A 1M2WA 2PWBA 1M6HA 4MAAA 5CW1A 5HKLA 2QDKA 1U2DC 3L9WA 4PHTA 4GPAA 4KZKA 1N2GA 5IUNC 2PUEA 2O19A 3HJRA 4L3OA 1MJGA 1FP4B 2OQ2A 1MHPA 1YKSA 1FBNA 1XF1A 1JHXA 2WIDA 1GNPA 2OD7A 1QZUA 4KG7A 2P9JA 4YBZA 1Y7HA 1MV8A 1LK7A 5KI6A 1KBOA 4HH0A 3EBOA 3QJ5A 1E2EA 2PZBA 2ZUSA 3PQ8A 4XDHA 2O1WA 1V8FA 1M8KA 1NW4A 2ZQYA 5GGYA 1OASA 3T1OA 1JFFB 3UNXA 1XMPA 4CL8A 4DIUA 2QMOA 5IAOA 2OBFA 5JS2A 3GA7A 5TB5A 1TTQB 4BGUA 1F2UB 2GN1A 2ZWOA 4A2PA 4JV5B 1DXQA 4ZREA 3FSGA 2E5FA 5LMZA 3CA8A 1Z13A 1DL5A 3U9LA 4G5FA 4RS3A 2C82A 1YZTA 1L7RA 3DOHA 4BO1A 1TO1E 5ITSA 1IQ0A 2XB8A 1TVKB 2FFQA 1G2OA 1QKJA 1W2WB 2WNIA 2NQ8A 2XGGA 4J0JA 2F43A 2PZAA 4WLFA 3GZ4A 2B6HA 1L5WA 1SK8A 3B5EA 2BI7A 3BSFA 2XWJI 4I8XA 1UANA 2R68A 1G60A 5JEEA 2HRZA 1Z47A 3CGGA 1B42A 4NATA 3WMRA 1XHEA 3KEMA 1EFTA 4DBLC 2GZSA 2PSFA 1DOHA 3LPMA 4L02A 1H3FA 3UMJA 5AUPB 4IS2A 4LXHA 4X3CA 4AO7A 2OV4A 3LM8A 1EUZA 3AF4A 1CUHA 5C8XA 4XGIA 2W2TA 4IWNA 4QUAA 1QPZA 4V0NA 4BX0A 1XMXA 3P27A 1GOTA 1PJRA 1ZNXA 2BFPA 3KYBA 5CRIA 1P1IA 3TAUA 1MEEA 4LRXA 1BEZA 4CV1A 4R2HA 4OMDA 4MR9A 1ZD5A 3LYAA 1FP7A 4JL8A 3HSYA 1NX9A 2IY9A 4HCJA 4LRWA 4KVGA 3WYDA 3A9RA 5EFZA 5K3DA 2DH6A 3EISA 3LYHA 4FYXA 1QVZA 4TMTA 2YQZA 3VH1A 5FWXB 4ML3A 3NTQA 1IU9A 1GKYA 3A6ZA 3D3WB 4R4JA 2CFRA 1WAMA 2Y3IA 4HLNA 5DHSA 2Y2UA 2IX3A 5ALJA 1P4HA 2WAAA 4HAIA 2VP0A 4QASA 2WWXA 3AVXA 3ONFA 3NKFA 2ZZMA 2P7IA 4Z86A 3ZDQA 1GUDA 3NBYC 4OXIA 1T5HX 2JIBA 4MPDA 1VCNA 3C1AA 1CU1A 4Z6KA 2R96A 4CF4A 2HMSA 2HFKA 4XUCA 1JFRA 1YA8A 4B3TB 3GUYA 3HJTA 5AM5A 4UDXX 5FP0A 3OF2A 1KJNA 3B9QA 1W4CA 4WFIA 1KS9A 4C4ZA 4E31A 1TA9A 4P9NA 5HXAA 4D81A 2EEZA 1GG2A 1WX1A 4JYMA 4BC0A 4NBUA 3WLHA 1A8PA 4DXHA 4D8YA 2VDWB 2N42A 3D81A 4KAAA 3ZWDA 2G5CA 5KNLA 4IIGA 4EW3A 1P9RA 3A1SA 3A9UA 3QELB 3GRAA 4D3XA 2BL4A 1T2EA 4M89A 4GE3A 3WB1A 2OZKA 4Q01A 2WB2A 2FEMA 2Q3CA 5KTOA 4C6TB 3DL4A 4O4LF 5K8VA 3L93A 3JQBA 1DTSA 2B8JA 4HRAA 1OFUX 4EZBA 1IEXA 1DIRA 3DLPX 4C22A 1JKJB 3E0XA 1SC3A 2QLLA 4M99A 1YVPA 3R6TA 4EQZA 2M6SA 1KZ6A 2IHVA 2O0KA 4L57A 5E6RA 1H94A 1TPZA 4PO1A 4X8LA 5AI4A 4L5YA 3I9FA 3LK6A 3RABA 1G5IA 1OWOA 4PYLA 4ZJUA 2H31A 1RQNA 3L8FA 4PYQA 1NNEA 2I2FA 3T99A 3ZPXA 4I1OA 2P8SA 4WE3A 3QWBA 3VU0A 4DT1A 4K7JA 1NE2A 4CF3A 4JUDX 3A2NA 1LPNA 3E3NA 2D5AA 5M34A 3ECSA 4D02A 1VB3A 1JR2A 3PPXA 2QTVA 5ABPA 1E5TA 1ULAA 2JI4A 2XOKA 3ZZ0A 2AI3A 3AJEA 4N3GA 1M5UA 4CKWB 4DV6B 1KMNA 5ALHA 4N3AA 1YV9A 1C3LA 3PDHA 5FI5A 4LXYA 5DI3A 2DAPA 2H11A 2EKDA 2YIDA 3ISJA 4P8RA 4ZHSA 2UUPA 5HQ3B 1PVVA 1FA9A 3RAEC 3L8DA 5H3HA 2NZ8A 2OESA 3EIEA 2FI1A 3FNRA 3HA3A 3U26A 2FWJA 2XB4A 4KDFA 4Q19A 2FSHA 1UOEA 3JARA 3QF4B 5TGZA 1EFCA 4J0HA 1TQ8A 2E0IA 4KLZA 4IIHA 4UNQA 1P45A 2Z04A 3BFVA 3DDUA 2CBGA 4NBKA 3EWAA 3E4DA 2GJ8A 4UCXA 1RYEA 5JV5A 5EKSA 5AM4A 4Z2AA 1ZMTA 1CWUA 1T1RA 4W82A 5F98A 2NU7A 4QARA 3L0ZA 1KOGA 1RHKA 4DM7A 2JVJA 2QUBA 2R1UA 3C7DB 2MJLA 2YBDA 1RI3A 3ICPA 3IIIA 1GG8A 4GEGA 2YIMA 3ZQ4A 2QNIA 4K9PA 5A0FA 1XU9A 4H3HB 3QI2A 4D5EA 1J4AA 1N7HA 1KEEB 2AEEA 2PRIA 3B9BA 3H9UA 1O54A 1VKNA 1Y33E 3GPIA 4JZKA 5CUQA 5DNDA 4RMNA 5DYYA 3FN4A 2WWVD 3S7ZA 2JATA 4MEJA 4EPYA 1P6QA 3IV7A 2WW8A 5HCIA 4ZYYA 4HQLA 1PP4A 1EGVB 5TQJA 3G2HA 1Z4NA 5A7HA 1OYVA 1U0GA 5ALEA 4NE7A 4FMBB 2Q7OE 3P32A 4DQKA 4G8JA 4JXXA 1XXHB 4EMSA 3E5RA 1XP5A 2R8XA 3E1SA 3GMDA 2FW9A 2XV1A 2I1WA 3W7VA 1BJRE 2DLDA 3OCJA 1Y6QA 4Q24A 4DY4A 3IOCA 4EY3A 5AMXA 4MUBA 3G0CA 2HCFA 2BT4A 2HZBA 3MQFA 3B1FA 1TJPB 1U0NA 4RVFA 2NMVA 1YVDA 4LBYA 4C0WA 2J09A 1NC3A 1BVUA 1Y1RA 4CODB 4F46A 4Y18A 1O94D 4ZOCA 1CKEA 3IAM6 2W6QA 2WB4A 3VJMA 4BLPA 4BAGA 4IGEA 1YCFA 2GBPA 3IESA 3PNSA 5B57C 3GFQA 1BMTA 5KOJA 3B60A 4WCFC 2VQSA 2G17A 4DDTA 2ARKA 3BUSA 4FVTA 2GDZA 3ZG6A 4BECA 4LN1A 1I13A 1BX0A 2JLQA 3A1UA 3QQ5A 2IP2A 2WYHA 4AMBA 3OM9A 5BWBA 3U7FB 5FUQA 1OXBB 2H59A 1Y4SA 4U7TB 4EMUA 1XWIA 3W4JA 2YZ7A 4J2OA 5BUSA 1X8KA 2F90A 3WDKA 1J1IA 1TCUA 1WW2A 4G5XA 1A3CA 1E99A 1G1MA 2IU6A 2OD9A 4GMDA 4GLLA 4Y6LA 5B30A 3TL2A 3K4QA 4N9QA 3WLRA 4EL0A 3KE9A 2SNIE 2WWGA 4R1LA 3DUFB 3WSWA 2H4JA 5DBFA 2C2ZA 1PNVA 3O8QB 4XGQA 1V11B 3ZK8A 2UZ0A 3KKMA 4RDCA 2PIDA 1WZUA 3E15A 3B2NA 3W5AA 3TCNA 2C0CA 1XMOB 3FTPA 5EUMA 4OREX 1W35A 2HLDA 4YPFA 3TD6A 5FFMA 1P5HA 5IRCD 1B8VA 1G8KA 1ENPA 4HEQA 4O4IF 1KJYA 3GVXA 4YXFA 2PUDA 4KOAA 1BN7A 1CJBA 4YRCA 3ROZA 2IS2A 1NV8A 5F1PA 1IB0A 3AY6A 5H68A 1ECCA 2ZJ4A 4WN9B 1Y7IA 2XR1A 2YY6A 1NV9A 3DKKA 4F92B 1WCYA 3M2TA 4MPJA 1V25A 3MJVA 1DBVO 4RFVA 3RHFA 1G17A 3PJFA 1R0WA 4AZ3B 2O6HA 2WUDA 1D7AA 1JDBB 2Q4BA 3WLFA 5L3RA 3I9JA 2HB6A 4QYWA 3B85A 4MW5A 1NMQA 1NVEA 2BEUB 4JHLA 5ALLA 5C18A 3H19A 1K5HA 1M1YB 2BRUC 3U3OA 4AMYA 4U7WA 1W6RA 3ED1A 3WA6A 3FYCA 3I30X 3AB3A 1ZJZA 3IHWA 2J0VA 1UFVA 4BXOB 3NFRA 4M86A 4Q47A 5KYUB 5ALUA 1E2GA 1F8GA 3CN9A 4JMPA 5IDXA 4NMXB 2PWAA 5TLSA 3TAHA 2EHJA 3E23A 3IERA 4C6TA 1J8MF 4Y7CA 1IHUA 5B1HA 1JPVA 2Q21A 3U61B 3AUFA 4QX6A 1HRDA 3DT8A 1L9XA 1N5OX 1SVLA 5BN4B 1OX6A 1PT9A 4ZU6X 3PC8A 1DBWA 4GQBA 5GIPE 2X8LA 1Y8CA 5T3YA 3NB0A 5MGNA 1AMUA 5DGDA 3OCYA 2C54A 4DJEC 1C4KA 1LA2A 3NVAA 4XQ9A 3HDJA 4UOZA 5IM4F 3GVCA 4TQ9A 1MXHA 2VPTA 1C80A 2B7BA 1DCMA 3BERA 1ADYA 5FWNA 4M8KA 4F4UA 5SY6A 3DM5A 2QU7A 1MRSA 3KIPA 1A4UA 3AK4A 4N7MA 4F5DA 2E37A 1C50A 3HM2A 5ILOA 4LFBB 4MLZA 2VK4A 4HR7A 2GERA 3DDCA 4JITA 5F7ZA 4R8SA 4TTQA 3UXMA 5KREA 1KH1A 3KKKA 5J9FA 5D3ZA 2ZB2A 3ANMA 3IOMA 3R77A 5CFLA 1L4HA 5K3BA 4CKYA 3FYUC 3IT2A 4EI2A 4KR6A 1LI4A 1Z17A 5JFTA 3QITA 2B4QA 4GX0A 4LS3A 4LHEA 4N6OA 4ZOEA 1CY1A 1YJAA 2BAGA 1E1NA 2CBZA 2ID9A 1GADO 2IT1A 4MGYR 4UVDA 4BO7A 2XUAA 1E9RA 3KTAB 5I7UA 2PD3A 4ZZ1A 3FTFA 2KWIA 4IDAA 3D7NA 3ZH9B 4BMOB 4WL0A 1BFUA 3EYWA 3JTMA 1OB2A 2NP6A 3DLTA 3DA8A 1ZCBA 2VLBA 3I2GA 1OFTA 4L6IA 4RCVA 1T0BA 4J0EA 3HI6A 1C9YA 3ZWXA 5DGIA 5GVRA 2ODWA 1EVJA 4REQB 3S70A 4ARZB 1NN5A 5AVVA 2BF7A 3WGIA 1SHZA 5KQLA 2JD0A 3CJQA 5SYAA 1ZGGA 3O31A 1W4LA 2PLNA 2QLTA 4TQAA 5L7TA 1QO0D 4L5BA 4MPRA 5BPFA 3VR3D 5KJFA 2JLYA