2ESRA

Conserved hypothetical protein- streptococcus pyogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
160
structure length
160
Chain Sequence
VRGAIFNMIGPYFNGGRVLDLFAGSGGLAIEAVSRGMSAAVLVEKNRKAQAIIQDNIIMTKAENRFTLLKMEAERAIDCLTGRFDLVFLDPPYAKETIVATIEALAAKNLLSEQVMVVCETDKTVLLPKEIATLGIWKEKIYGISKVTVYVNEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase
publication title Crystal Structure of hypothetical protein of Streptococcus Pygenes
rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
total genus 47
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2005-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2esrA00
3L8DA 1SKMA 2ZIFA 2B2CA 2HR1A 1VP3A 3BZBA 4BLWA 4FZVA 4E2XA 5F2OA 4RYLA 3DMHA 4Y30A 5EGSA 3MERA 3NDJA 3TFWA 3KR1A 5K0JA 3VSEA 1AV6A 3SSMA 2OBFA 4HSGA 3ELWA 3NWBA 3R0QA 5E8JA 5E8RA 4CKBA 2I9KA 4P7JA 5KVAA 3EVFA 4YMGA 4PYQA 5EKXA 2PLWA 4FSXA 3EMBA 2PV0A 5E9QA 1G55A 3OZTA 3HVIA 5EIWA 2WA1A 3CGGA 4XCXA 1L3BA 3PS9A 3NDIA 3OE4A 1XCLA 2AOXA 1O9HA 3I58A 4GQBA 3FUUA 5CD1A 1NW3A 2V74B 4CTKA 1NE2A 3DLIA 4RTKA 2IGTA 4R8SA 2UZ4A 5DM2A 3UJ8A 1XDUA 3PLAE 5BW4A 3JWIA 4X60A 1X19A 3KKZA 5DTMA 2EG5A 4E31A 4RTJA 1NV8A 2AOUB 4BP1A 2P7HA 2UYHA 3LX6A 1MJFA 4ER5A 3KQSA 3PVCA 4HRAA 2PT9A 4V0RA 5EEHA 4HG2A 2GS9A 3HCAA 2G71A 5K0LA 5FQNA 5T67A 3MTIA 5EEGA 4E30A 4RTOA 3R9XB 4EK9A 3ANXA 2FK7A 8MHTA 5FHRA 3D2LA 5K03A 4RTPA 3KQVA 3IEIA 1R74A 3E05A 4QDKA 1ZQ9A 3BGVA 3NJRA 5LQKA 1AQJA 3LKZA 1N7IA 3NVMB 3QOXA 4OA8A 4P7GA 4Z2YA 1VPTA 1NKVA 2FHPA 2PY6A 3G2OA 4MQ4A 3U81A 4A6EA 3ORHA 3ELYA 2G8NA 3OPNA 1T43A 3B3FA 3GO4A 3O4FA 2PSSA 5DXJA 5ERGB 2O57A 2XBMA 1JQEA 2EJUA 2G72A 3DH0A 2ZULA 1XDZA 1ORHA 3R6TA 1SUIA 2PX5A 1JTFA 5EIFA 3T7TA 4KWCA 2P35A 2YXEA 3B5IA 3CCFA 3P2IA 4PCAA 5DXAA 5EPEA 2ZW9A 3OZRA 5T64A 5K8VA 5GIOE 3KQOA 1JG2A 1PJZA 1X1DA 5DSTA 4M37A 3IHTA 3QOWA 4QDJA 1ZGJA 4DM3A 3LDFA 4HH4A 5C1IA 5GIPE 1WXWA 1IY9A 4L7VA 3GCZA 5BP7A 3FUWA 5LQNA 5DM0A 4WXHA 5CVVA 3ME5A 1Y8CA 1L3CA 3GRUA 5GM1A 2QM3A 4MHTA 4HTFB 4QVKA 2OXTA 4RTSA 3ER9A 2CMGA 5E1MA 5E9JA 4X61A 4GOND 2YX1A 3LSTA 4GOOD 2ZBPA 3FRIA 1OR8A 3SSOA 4CXMA 1X1AA 5DTRA 3I9FA 3AJDA 1X1CA 2R6ZA 1EAMA 4OQDA 3HVHA 4KDRA 2NXCA 2AOUA 1B42A 3KU1A 3MCTA 4X41A 3B89A 3BGDA 4PYMA 2BR3A 3FTDA 5C0OE 2BR4A 4X63A 3HCEA 4NECA 2JG3A 5EMMA 2EJTA 3ID6C 4RTQA 1D2CA 4PONA 1R8YA 2AS0A 3EMDA 4QPNA 4C08A 3EVBA 2VDVE 2IH4A 4PNEA 3HVJA 4C06A 3BKWA 1QZZA 1YUBA 5FUBA 2FRXA 3A7DA 3P9NA 3DTNA 4BLVA 2NP6A 5B1SA 5GM2A 2ZVJA 1RJEA 5EVJA 4C07A 3A7EA 3CBGA 2PJDA 4GOMD 2HWKA 1N2XA 1XXLA 1RI3A 3G8BA 3M6UA 2PWPA 2VZ9A 4ATNA 1WG8A 3GXOA 2OB1A 2IPXA 1Q0TA 1VLMA 4V0QA 3CVOA 3FPGA 4JXJA 4R05A 3G5LA 5FULA 4KIFA 2P41A 4ER3A 5EQJB 2B78A 1WS6A 4C03A 1JQ3A 4E33A 1YZHA 4BY9E 5DLYA 2AOTB 4QQNA 2QY6A 3BKXA 3X0DA 1YFJA 3UBTA 2ERCA 2IFTA 5E2AA 2ZFUA 4YUZA 1D2GA 2BH2A 5JR3A 5EMJA 5M5BA 3JWJA 2ZIEA 1SQGA 5G02A 4U7TB 5EKUA 1NW7A 4YUWA 3K0BA 3M6XA 3LBFA 3TPZA 1JG4A 4X1OA 3UJDA 4PINA 2QRVB 2FPOA 2PXXA 2YUIA 3TMAA 4C4AA 4XUCA 4POOA 3KQMA 1NBIA 3SVZA 2AR0A 2NXJA 5K0EA 2VS1A 3DMFA 1FJXA 3LL7A 1I1NA 3KPUA 4GC5A 4HC4A 2OB2A 3HA5A 5ICEA 1P1CA 3UJ9A 4LWOA 5DX0A 3EEOA 4P7FA 1L1EA 1KPGA 3AXTA 3UA3A 1R6AA 1YFLA 3I64A 10MHA 1VL5A 1ZGAA 3C0KA 2P3OA 3C3PA 1KPIA 4ZTBA 1F38A 1WZNA 2I6GA 3AWIA 3FTFA 3CJTA 5F2NA 4AZTA 1I9GA 5LQCA 3C3YA 2Y1WA 1RI4A 4GOLD 2BM8A 4M36A 5DSXA 3DP7A 2FK8A 3O31A 1EJ0A 3A26A 2C7QA 3FYDA 4R6WA 4ISCA 3B3GA 1RI1A 3SX0A 2GA9A 3SSNA 3MTEA 3AXSA 4C05A 3RODA 1O9GA 1ZG3A 1JSXA 4OBWA 3KQWA 2WA2A 3BWYA 4GUAA 4CKCA 3BGIA 3HM2A 5DM1A 3G5TA 1EIZA 3SGLA 5EC8A 5CM2Z 5FHQA 5IKMA 3THRA 4DMGA 3ER8A 3G2MA 4FT2A 1KIAA 1R00A 5CVDA 1ORIA 1QAQA 4FR0A 5BXYA 3P8ZA 2GLUA 2AOTA 1EQAA 2O06A 2PX4A 3EVCA 4KW7A 4C04A 4E2ZA 5LQAA 3G88A 3HP7A 2NXNA 3IYLW 1X1BA 1D2HA 3UZUA 5CCXA 1WY7A 2B3TA 2YXDA 5DX8A 3MHTA 4RTRA 4YMHA 4YUYA 4BP3A 3G2QA 2IIPA 3BWBA 3DR5A 1HNNA 4PYIA 5ICGA 1NW6A 2P1DA 2ZZKA 4PYKA 2PX2A 4R6XA 4QTTB 5EMKA 4DCMA 1EG2A 4OBXA 3B7PA 3LCUA 3FUXA 1Q0SA 3S68A 3REOA 3P9IA 3G7UA 2QRVA 3JWHA 1AF7A 1SVUA 2UYQA 4IV0A 3UWPA 4AZWA 3T7SA 3UA4A 2JH9A 2VP3A 4Y2HA 1XJ5A 5FQOA 5HIJA 3EPPA 2AN4A 2XVAA 1IXKA 4PWYA 3PX3A 1Z3CA 4PGGA 3TR6A 2CMHA 1H1DA 3H2BA 3R24A 1MHTA 4BLUA 2GH1A 4PYJA 1QYRA 2O05A 2ONYA 4LECA 2QYOA 1L3IA 2XYRA 3E7PA 3V97A 1YB2A 4MIKA 5HZMA 2A14A 1AQIA 3DMGA 3KHKA 5CUQA 1XTPA 5KQSA 1DUSA 2R3SA 1FP1D 1JG1A 1N7JA 1XDSA 2ZLBA 4RWZA 3TOSA 4UOEA 3FPJA 1QAOA 5H02A 5GINE 2B9EA 2ZZNA 3HCDA 4F84A 2Y1XA 2AVDA 5K0FA 2XYQA 4OX9Y 3VYWA 5D1HA 1SQFA 2BZGA 3A4TA 1BHJA 3LBYA 1M0EA 3M4XA 2OO3A 5E1BA 5GP1A 5HIMA 2JJQA 4EQZA 5GWXA 4CTJA 3GDHA 2BR5A 5HIKA 1KYZA 3UJ6A 3GRYA 5KQRA 2P7IA 3MB5A 4M38A 5CIYA 1G38A 1DCTA 3RIEA 3WSTA 2O07A 4DQ0A 3LCVB 4MWZA 4DA4A 1KPHA 1YZ3A 1YF3A 3NMUF 2H00A 3TQSA 4OQEA 1KP9A 1XVAA 3RW9A 4FP9A 5DRYA 4IKPA 3PFGA 5HFJA 5T6BA 4LWPA 3FPFA 5FA5A 1BKYA 3LGAA 4E32A 5K0BA 5JUWA 3EVEA 2FYTA 4F85A 5KYGA 2C7PA 2B25A 5CVUA 3TM5A 1NV9A 2ESRA 2PXAA 3FPEA 5LSAA 3EVDA 4PIPA 3KPVA 3PT9A 4H0NA 2DULA 3DLCA 4K6MA 4G56A 1VP9A 2JH8A 4P7KA 3FPHA 4RVGA 1INLA 2AN5A 2IBSA 3QV2A 2GPYA 1NW5A 3KQPA 2G1PA 2H1RA 4CKEA 2YQZA 2ADMA 3ELDA 1V39A 2NYUA 3GRZA 4HGYA 1DL5A 2IBTA 3G89A 5EMLA 4R8RA 2IH5A 2BM9A 1QANA 1VE3A 3OE5A 5C9ZA 1JG3A 3JWGA 2EFJA 1R8XA 4YUVA 3BXOA 3KQQA 2AN3A 4HTFA 1UFKA 2AOVA 3LPMA 3SXJA 3FZGA 3BWMA 3T0IA 3LHDA 4GF5A 5MHTA 2OY0A 3LDUA 3K6RA 3HTXA 5P8WA 5EG5A 3M6VA 4KDCA 1F3LA 2LD4A 2P40A 3ELUA 5ICCA 3HA3A 3KR0A 1TW3A 3P9CA 2HMYB 2YXLA 3SR4A 5HEKA 4GEKA 2DPMA 1NW8A 3TM4A 3EEYA 1L9KA 2PKWA 3NTVA 1M6YA 5K0CA 5F2KA 1RI5A 1O54A 4DKJA 3SMQA 2I62A 3BWCA 4GBED 3B3JA 4RTLA 5CVJA 3HNRA 2YTZA 3ERCA 3P2KA 3UJCA 3HA7A 4YUXA 4FS8A 2P3QA 3P71T 2O0LA 1R18A 1RJFA 2OYRA 2CL5A 5E9WA 2PWYA 1XCJA 2Z6AA 3GU3A 2PXCA 2AVNA 3EGVA 3GGDA 4RV9A 4EKIA 4F86A 2FCAA 2WK1A 1VBFA 5LQUA 2PX8A 4AZVA 5DX1A 3EGIA 3DXYA 2F8LA 5DWQA 5E2BA 5FCDA 3FUVA 3Q7EA 2ONZA 3HEMA 1G60A 4AZSA 3A27A 2JHPA 3MGGA 4KVZA 2I7CA 2H11A 1VQ1A 1G6Q1 4RVHA 5DT2A 3EVAA 1QAMA 2GB4A 2VDUE 4U7PB 1RI2A 3NVKI 3UFBA 4AX8A 3GWZA 3OCJA 1RJGA 1FBNA 1FPQA 1KYWA 1NT2A 2ZIGA 3DOUA 2ORED 1G8AA 2Q41A 2KW5A 5FA8A 5IH3A 4PYNA 1SUSA 2Z6UA 3OU7A 4YV1A 1PRYA 3OFKA 2P3LA 3FRHA 5EZQA 4FGZA 5DTQA 1P91A 2E5WA 3G8AA 3IV6A 4P58A 4B17A 2CWWA 5EZSA 4XUEA 4QPPA 2IDKA 2V7EA 2ZCJA 3KPJA 2PVCA 5FWDA 5E1OA 2YR0A 5K09A 2IH2A 2ZBRA 4FSDA 2ZZMA 2XYVA 1JSZA 3FTEA 5EHIA 3I5UA 2AOWA 1JR4A 2VDWA 3GNLA 3SM3A 5LQRA 3GRRA 3HCCA 3E8SA 5U4XA 5LR6A 4WVLA 4OA5A 4O29A 3EVGA 4RVFA 4KRGA 5HILA 3R3HA 3Q87B 1I4WA 3TKAA 3OU2A 3PFHA 4GC9A 2UYOA 5DM4A 4CWAA 3MAGA 1BC5A 2K4MA 4DZRA 3FUTA 2JHAA 3FTCA 3C6KA 3TRKA 2OPBA 3NWEA 5E1DA 1JQDA 3HCFA 3AY0A 4QTUB 4A6DA 5ICFA 3HCBA 2ZBQA 1SG9A 2G70A 2PBFA 4E2YA 3DXZA 5BW5A 5FTWA 3T7RA 3PB3A 3THSA 4DCGA 2ZTHA 1RJDA 3KR2A 4DF3A 4XUDA 4IWNA 4RSRA 1FP2A 4KIGA 4QVGA 2XVMA 5K0NA 4EKGA 4EMSA 2NNWB 3CKKA 3TLJA 5LQJA 2OZVA 1IM8A 2NXEA 3BT7A 3LDGA 4M7RA 5CVEA 1WXXA 2IP2A 1EJ6A 1VIDA 4IV8A 3O7WA 2EX4A 1BOOA 3GIWA 4ER6A 2ZSUA 2N47A 3KPYA 1KXZA 3OZSA 4FT4A 4YV0A 4RTNA 3OU6A 2QE6A 4RVDA 4QQKA 3FYCA 1KR5A 4ER0A 2HNKA 5CCBA 3P97A 5EHGA 4PGHA 1G8SA 1UWVA 5HOQA 5K0GA 3TKYA 3UJAA 2P8JA 5FADA 3F4KA 2JHCA 5EOVA 3HVKA 1JTEA 3GRVA 4LG1A 4PYLA 4E2WA 4E70A 4PCLA 2HTEA 3EVZA 3MCZA 1KHHA 3BUSA 1TW2A 3GJYA 3M6WA 5GOZA 3PX2A 3LCCA 3E23A 9MHTA 2NP7A 2IDJA 3PTAA 2PGXA 1TPYA 2UYCA 1NBHA 1U2ZA 2GAFA 3MQ2A 3NW9A 3DULA 3CJQA 4RX1A 5KS2A 2CKDA 4YV2A 3VC1A 2AZTA 2PT6A 3CJRA 5DRTA 1M6EX 3DXXA 5D1NA 3G2PA 3M33A 4MTLA 5DPMA 5K05A 2C7RA 4AUKA 3DUWA 3OFJA 4HGZA 4PYOA 5FWAA 3UJBA 2ZWAA 3KQTA 4RTMA 3KQYA 1ZKDA 3I53A 2C7OA 2ZWVA 3VC2A 3CC8A 1ZHFA 3LKDA 2YVLA 3KPWA 7MHTA 3P2EA 5K01A 3V8VA 4PIMA 3LECA 3EGEA 1UIRA 1P39A 3KR9A 2HV9A 1P1BA 1HMYA 2OKCA 3A25A 3M70A 3P9KA 3UJ7A 2Z6QA 5HIIA 3C6MA 4ER7A 4EVIA
chains in the Genus database with same CATH superfamily
3B12A 1VMKA 1ZN2A 1EFRA 4L51A 5AOVA 1E6CA 1QVVA 1DAMA 3LWDA 4QDZA 3KJEA 2VF7A 3IXMA 3KK0A 1U9ZA 2YFQA 4KGXA 3T7DA 3VMFA 4QU0A 1JQJC 2IV7A 4YV7A 4L16A 5BV7A 3ELWA 5E8JA 2B35A 3CR7A 1TRHA 1O0SA 4P7JA 4H7PA 4POAA 2JCXA 4EKNB 5CDTA 3WYBA 5L4NA 5LP6A 4MR8B 2QMYA 3HCWA 3OQPA 1TLTA 1K6XA 4TSFD 1V3UA 2LRHA 2P67A 2W8BB 5A4KA 2MU1A 1R8QA 1LV8A 1U80A 1VYTA 3DCJA 3T4UA 2H1HA 3P27A 1L3BA 1VPEA 4N54A 4KRFA 1XCLA 1DX4A 1CBUA 4WZZA 4BJ1A 4J3JA 5CD1A 3TMKA 2QTVB 1NE2A 3EDCA 1VPWA 3IMCA 3UMBA 4CF4A 3DYIA 3AVWA 2WVJA 4OXIA 4FFMA 4PFKA 1RS0A 3K05A 5DLDA 3V2HA 4QTXA 1Y6RA 2Z4TA 3FKSD 3K2EA 3L6RA 4BP1A 4RTJA 4U8GA 2HMUA 1FNBA 1AH2A 4A2QA 1IU9A 3NH9A 1GD1O 4OHVA 3GEBA 3RAPR 3HCAA 3SJ7A 4DGQA 4YRNA 5J43A 2HSWA 1XMIA 4BX9A 5T67A 5LIPA 4L5JA 3ANXA 2EQ5A 1FW6A 5IU6A 4TVKA 4CV3A 1AGXA 3K9HA 4LHSA 4JNCA 3QUTA 3U39A 5ES3A 3E05A 3I34X 2AK2A 1HDOA 2VBGA 2HTFA 1E2LA 2PLNA 3F7TA 4Y1EA 3GBSA 5FXMA 3L04A 3QBJA 1U3TA 2JFYA 4UBNA 1RJ9B 3D3KA 2ZKIA 3ZDBA 4RZSA 5KHLB 4OHCA 3E48A 5A4AA 1KO5A 1HL3A 4X3PA 3VM6A 4BFWA 3ZCPA 4EEKA 3A4IA 3EFOB 2E55A 3OCWA 4J0IA 4KV9A 3TW8B 3W3ZB 4J7UA 2FAXA 2PX5A 3RUCA 2JFWA 2XIJA 4MRVA 3W5HA 4PCAA 1Q1ZA 2I67A 2O7QA 1K63A 4XARA 1L8AA 3OQNA 5K8VA 1B00A 2YQ5A 3CPEA 4W4TA 2EF0A 1M83A 4B7UA 1TNDA 5BWOA 3RYCB 3AHIA 1SVOA 4EQ6A 3ECCA 4LBWA 1QFSA 5C1IA 4NFYA 4HVLA 4MKFA 3U4DA 4DG5A 3WNZA 4WXHA 2V59A 1IHYA 4HJXA 4OH7A 2JLWA 1NVWQ 4KXQA 4LOAA 4TS9A 3QX3A 1SVIA 1JECA 2JIBA 3KZOA 4JA0A 2OXTA 2XMSA 4I2VA 3RYFA 2WAMA 1IDOA 1V45E 3W5BA 2HHHB 1DI0A 3RHSA 3IVAA 1JHPA 3SSOA 4D3ZA 2JA2A 3ASVA 3OC0A 1SZCA 5DGDA 1XNGA 1ZXLA 4TSFA 3WGIA 3L6DA 2R6ZA 3BTUA 5ALNA 5NULA 4G5YA 1TDJA 4RJLA 1QH1B 4RQTA 4S2UA 3C3DA 4XGNA 1IVSA 1VIMA 1EVKA 3B89A 5KPDA 3T1TA 3LQFA 2R6FA 3OKFA 4MUIA 5IAEA 2SKCA 5KVQA 3S55A 1A1VA 4KGDA 5DHSA 1JN0A 1G16A 2BR3A 2Z9BA 3EQ7A 2OUIA 3QKSA 4Q4JB 3DFIA 4X63A 5FYQA 2IIQA 4NECA 1E2QA 3TOXA 5AJXA 1GCGA 5HPYB 1EK2A 1THGA 3URKA 4FK8A 1FNDA 2X0FA 1FFCA 3FKSA 1PG2A 3DC7A 1YVRA 1Z26A 1SAYA 2ECKA 2BE9A 2PGDA 2ZE7A 4LS3A 2QD3A 2BKVA 4RS4A 4R3NA 1ZGHA 1DV2A 5DYYA 3DFFA 2IXGA 5FP0A 3E2MA 1XP8A 3KNZA 1SGWA 4G1CA 4MLPA 5BSRA 2VJCA 4MMXB 2ZVJA 4DRYA 1ITZA 5L6MB 3ENKA 2PJDA 5L4LA 2CYBA 4OJMX 4CLRA 2DUMA 4KTVE 5B4TA 1T5LA 4CMAA 5ECGC 4MJXA 1NF3A 1WU7A 4UEJA 3G9UA 3UK6A 2XE7A 1ORWA 3ESAA 1ODIA 4DLRA 2J67A 2WD9A 4W5WA 3C8UA 3HRHA 4TRNA 4EVSA 5B2FA 4WNAB 2FE4A 2FW0A 1CZRA 3VFDA 2CMDA 4WY5A 2ZB8A 1NATA 4YUZA 2AJLI 1A8HA 4K9MA 5EMJA 4P0TA 5G02A 2CDRA 3IJRA 4L76A 1A9TA 5EWMA 3EGWA 2WIDA 2A7QA 1QU2A 1JNXX 2Z0MA 1ENOA 3M5PA 4OKNA 5LIRA 1RYYA 3WDKA 1DG3A 4ZZIA 2FPOA 2PXXA 2ZSFA 4GRDA 4YT5A 4MDFA 1R6XA 2WICA 1G7RA 4B74A 3EIWA 2IS2A 4RWEA 4UJ5A 1PO7A 2CJWB 4RVSA 2ZYAA 1Q21A 2ZP1A 1CR0A 4FZJA 4QATA 3TSAA 1F8FA 3TECE 2O2JA 5E2IA 3VHQA 2ON6A 3EZGA 3KC2A 1A5AB 1VL5A 2MSEB 1BMQA 4KLNA 5J40A 1HG1A 3LBHA 4ZTBA 1IG0A 1ZUNB 3BICA 3EXHC 2MWMA 3OIYA 3PRKE 1OXTA 1C9KA 4OLBA 3IOEA 3LX5A 4DBLE 1D03A 3G85A 4IFTA 4C7MA 3BRQA 2Q3BA 4WLEA 5LUAA 3LM8A 2CVOA 3WWPA 5I4KA 1DG9A 3D81A 3ZGZA 2FK8A 2N3ZA 3A26A 4JN6B 1RFLA 2QRPA 3B1ZA 3BC1A 3G0BA 5AKHA 3I76A 1NMXA 2CBZA 2DJ5A 4ZVNA 4ARZB 2CLEB 3SSNA 4BV8A 1NPTO 1K98A 3O8OB 4C6TB 4Y6PA 1H2ZA 1W8DA 4HI0E 1TEVA 4OHUA 4QU8A 3HB4X 3NBUA 3UICA 2HU5A 4QZVA 4Q9AA 1IONA 2OHVA 5J4VA 2FEOA 5LPNA 1K6JA 3WWDA 4DWWA 2W6MA 4IQ8A 3GPBA 4PX9A 1ECCA 1NA5A 4G0NA 3U7QA 3H2SA 4CM7A 2HU7A 2XRMA 1N33B 1B8OA 1OIWA 1YCGA 4OQPA 2G1JA 2X40A 3D7KA 3EQ8A 4NENA 5KU7A 3H3JA 4C04A 4XM1A 1ZA1A 1IN1A 5TT1A 4OI4A 4IGKA 4YLEA 2X77A 5CT9A 1OB5A 3BWBA 5EMKA 2DY1A 3DDNA 2ODEA 3N6VA 4DCMA 4I5FA 1OWLA 2G9QA 1TVEA 1N7HA 1T8YA 1CUSA 3B7PA 3AR6A 3COWA 2VTVA 3DF7A 4ZT6A 4ZWNA 5CB4A 3DONA 1AB6A 3BN3A 2I55A 3A11A 3ZC3A 4LF9B 3EA0A 4TQ9A 1J4AA 1Q77A 3DCIA 2OP0A 3NKVA 1VL8A 3Q7PA 5C5EA 3A6PC 3V4ZA 1ZLYA 2B9VA 1J7JA 2FZ5A 5FA6A 3UHAA 1USWA 2B2XA 2IPNA 2JD2A 1E1NA 3HKEB 4W5TA 3PD7A 4QJ4A 2KHZA 3DFZA 3HCNA 2KS6A 1XLTA 4Q37A 3SVLA 4U63A 4FWBA 3ZY2A 13PKA 2RGYA 1QG2A 4LJ7A 3VJKA 4YX9A 5CX1B 4ALJA 3KD2A 1MG5A 1XDSA 1MLDA 4WI1A 2WYIA 3TOSA 2WSBA 3EFBA 1E59A 3E3LA 1DZ3A 4KB5A 1QPBA 4Z49A 4KN5A 4J29A 3RARA 1OI3A 4GKJB 1YB7A 2AVDA 3Q6NA 1Y5IA 1WOMA 4E4TA 3EIXA 1CRPA 1RRVA 3JQCA 2XCIA 4OSOA 3KSBC 1KJQA 2BZGA 4XYEA 4E5NA 1FUEA 3I2HA 5D3QA 2XUHA 1WSWA 2RGXA 5C53B 4AKEA 4EQZA 1W88B 2PQMA 3T15A 1ZMTA 4M0MA 3I42A 3WP0A 1LNQA 2GWRA 4BFYA 2Q5JA 3L07A 1KQFA 2B94A 4CR8A 4BMVA 1PK7A 4QQFA 1J5PA 4FNGA 4CMIA 2F3RA 2WLTA 4HUQB 3EPLA 4HFRA 1UKAA 4DABA 3IB3A 4OQEA 1KP9A 1EDZA 1REQB 4X1IA 5IUKC 5LCXA 4DHWA 3L2OB 1IUKA 1RYEA 1SURA 1T10A 2HMAA 2N42A 2WJJA 4GX5A 4LYJA 4OTZA 1DBQA 4HP8A 4B83A 2OILA 2P4UA 1G5IA 2DYKA 3QP9A 1XAHA 4PBRA 3OJFA 1G1MA 4MV6A 1YRLA 2MMCA 2Q27A 5LSAA 3K0CC 4N0MA 2NV2B 2CLSA 3DLCA 4R8VA 4ARSA 2NVUA 1J56A 4N48A 4EOGA 3NHZA 2P4QA 2QG6A 1Q14A 2QD4A 1TM4E 2I1WA 2IBSA 4BIMA 2DWOA 4OP2A 1J09A 4M9RA 3ZE6A 4DJTA 1X7YA 4YO8A 4F97A 3P9RA 2C03A 1Y9EA 2UYCA 1DQNA 1UINA 2PZBA 3AF5A 1KI6B 3TOCA 3NIFB 3ADCA 3CE6A 3MQFA 3STTA 4HTFA 4KAJA 2ZRHA 2WM9B 1EXNA 4PBSA 3UUGA 2OY0A 4H4DA 2ROQA 5ENZA 4M1EA 1EMDA 4NX2A 2GRJA 4DJJA 5I4IA 4DDVA 3PHJA 1JG6A 5C32A 3UOGA 3A1TA 2HJ9A 1C9EA 1G17A 1LH0A 3Q12A 5CNIA 5F9MA 2R65A 2A3RA 5LXTF 1NR1A 3AHJA 4D79A 4PZEA 1HYHA 4URHA 3WISA 1SK8A 1Y4AE 3R23A 3H0KA 5I9NA 1VKHA 3DMPA 4JFRA 4JL5A 4Q9DA 3L8MA 4CEHA 1IFXA 1QQAA 3PGXA 5IKEA 4GBED 5A4FS 4NBLA 1GITA 4CQJA 4BNMA 4E3ZA 1PEKE 3QTTA 5AVQA 5JCJD 1U2SA 1W30A 2ZIWB 4NPHA 2Z6AA 5JS1A 2GVDC 3IAS1 3S2UA 2HLNA 1Z3IX 3P9XA 2UZ0A 3RF6A 1IWOA 1XAJA 2GNOA 1DPFA 5DNAA 5DYTA 4HAXA 5CA1A 1JAXA 4QT4A 1DKMA 1M1NA 4AZSA 2I7CA 2IYNA 2DMRA 4S1VA 2Y99A 2RH8A 4G01B 2IU3A 4CIXA 5FPQA 5IC6A 2ZM6B 3R0IA 3FPAA 3OCJA 5A4DA 1SB9A 2VF4X 4YQEA 5JBIA 2FFHA 3B6JA 4ZQCB 4PPFA 3VJRA 2QT9A 1KJJA 3P9YA 5IH3A 1G63A 4RZQA 3LPLA 3LUKA 2PSDA 4FYHA 3GLUA 3KB1A 2HDWA 1AXRA 3I28A 4IH9A 3C3CA 2WIFA 1P91A 3VHXA 2V97A 4UC0A 3HADA 1BMDA 2EW1A 3M4NA 1N9ZA 4DRXB 3R3JA 1MJGA 2ZIAA 5HMLA 5K20A 1E1KA 4MLCA 2XB9A 4D3DA 1KSFX 1NU6A 4HUTA 2FWAA 4JOQA 4E51A 2IOHA 2ZBRA 1XD2B 4D5GA 5KNDD 4Z7OB 1W5SA 2AOWA 2AA3A 4JR0A 3ZE1B 3GP8A 1L7VC 2FTKE 4DFDA 3FDIA 5HQJA 1KO4A 1VFNA 1VYHA 3HUUA 3T1OA 2ZE8A 3CUVA 4WVLA 3DDWA 4MQ5A 4HGQA 1FRQA 1ICIA 4KSCA 1AHNA 1VIYA 2IE0A 2IZZA 1KKMA 5DBHX 3UC9A 4F3TA 1WZCA 3ORSA 1EHCA 2UVQA 4GC9A 4N4AA 3DB1A 4UBMA 2A30A 1X7XB 2AQIA 2BT4A 1J42A 3V7YA 1KMMA 4HQ0A 1JPNA 3NU1A 1QYDA 4UHBA 2AEMA 1XU4A 2XYGA 5BR4A 1SN7A 5HP4A 1T3LA 4RM2A 2V5AA 4E1BA 4D97A 4RTNA 4GPEA 5DP1A 3WLAA 4RK7A 3GX1A 2BMEA 5B7QA 1LJLA 1H05A 1QB7A 3LHKA 4IWNA 1D07A 4M8SA 2BI8A 4O2RA 2I4TA 3RIGA 3UAGA 3JQFA 5HCUA 2OZVA 1QS0B 3AEYA 4BVGA 2ZRFA 5LJIA 2DUWA 1AK9A 1R64A 1NVDA 2FEWB 1QQTA 1YA8A 3K94A 4I9FA 1Q74A 4KUEA 4LDAA 4MIEA 1T1JA 1BOOA 2P2LA 2PMCA 3PR1A 1LY1A 4D6XA 4TGLA 3RVRA 4IH4A 2IWRA 2QE6A 1Q84A 4ZV9A 3HBNA 2O5EA 2VC2B 1OV4A 5IXJA 3DEKA 3M3HA 3TSCA 2QZPA 4GW3A 2AIRA 2YY6A 3KDAA 4FFPA 3I2IA 4PRKA 4Q01A 1L8QA 4XOIA 4C4TA 4TXNA 3MUOA 1WHTA 4XVCA 1JU9A 1OYWA 3IURA 3CURA 3QE2A 4RVCA 1DJQA 1KHHA 1NW4A 3GJYA 3DZHA 3M6WA 4KPUB 3PX2A 1GPWB 2AG1A 3W7BA 2QBYA 3F9CA 4GR4A 1EXMA 4M0UA 1DADA 5FAKA 1AZLA 3MQ2A 3NW9A 2WWIA 4CV2A 1T2UA 1QYWA 4V24A 1M2HA 2VTKA 1M6EX 2OG1A 2QF7A 4KH0A 2QM0A 3G2PA 4MTLA 4N6OA 1LBEA 4N7RA 2FP3A 1JEOA 4C20A 1UFOA 4AUKA 5KNDA 3DYVA 5EZYF 2P3SA 3UB4A 3LHIA 1YDGA 2WVAA 2XOEA 5J4HA 1BXRA 4IDPA 1KQOA 3GJ8A 2PD4A 3IH5A 5CB8A 4GWGA 5C7IO 1SUPA 2ORIA 3SCZA 1CIPA 1ZW1A 3EA5A 3QVMA 5K4GA 1ZHFA 4HK4A 2YVLA 3RD5A 2OC4A 4PQYA 1OD6A 4L7QA 3RUHA 4IDHA 4K86A 1BDBA 1H4SA 1DAHA 4WXMA 3ER6A 4P0PB 2ENWA 1JEYB 5JYCA 4A8JA 5IK2D 3QFTA 2JF0A 3TS1A 7AT1A 4CCYB 1AQYA 1R88A 3KSUA 2X9QA 4U8HA 4GP7A 2GAJA 4J3FA 4OIFA 1RE0A 3STHA 5CVCA 4AY4A 4D9NA 4RFSB 1TUGA 1SCIA 4M99A 4M46A 5F2OA 4ZYLA 3RRFA 1RKBA 5EGSA 5LXTB 2QL6A 1AV6A 3KLBA 2UZ1B 3C8HA 1MGPA 2YVAA 3LG2A 1T5HX 4F1WA 4CKBA 5EJ2A 3G79A 5ITWA 2J5BA 1G20B 1W9HA 4RK0A 1ODSA 1CY0A 1RXIA 1I7NA 2WNIA 5FNVF 1Z8FA 1JH9A 3LPAA 5JCZA 5KOHA 5ADUS 4QPJC 6NULA 3PX7A 4EH1A 4ETNA 3KU4A 3L6EA 1TFRA 3H0CA 5EIBC 4LBVA 3OKAA 4BUCA 1QB8A 3EISA 2QMHA 3QJ5A 5C31A 5C1OA 1SC1A 2PKYX 1YU6A 5K99A 3AR5A 4Y6RA 5EIHA 3F5SA 3JVVA 4R8SA 3Q88A 2PG3A 1IBCA 3M4ZA 5KTRA 3B1FA 4JB0A 1Z2DA 2GJAA 1TT7A 5AKZA 1LS6A 3B9RA 2JK1A 4KSBA 3RUEA 3PNQA 2P7HA 2XMZA 3HRIA 4IUDS 3BQNB 2Q2QA 1XWWA 1YIOA 3DKKA 3WWEA 3C43A 5BNZA 2L42A 4V0RA 1AZTA 4FDLA 4YJHA 4D44A 4HZGA 3BF8A 2AZMA 1E0JA 5CT4A 1JEJA 5ALMA 5CH8A 1J8QA 1LRJA 3JASB 2VKTA 4RTPA 1Q7CA 4H6PA 1F0PA 2ZJ0A 4TMVA 2GJ8A 1T8TA 2I4LA 3WTBA 1LRKA 2IXFA 1PG0A 2XT6A 1N2EA 5CD9A 3Q7SA 1ZM9A 4E5YA 1WUKS 1YZFA 2IUTA 1GNVA 4OXKA 2XZLA 2OFXA 4EHLA 1NI4A 5ABPA 1GAQA 4IH1A 4YMIA 3U81A 3WJ1A 4MQMA 4EGFA 2NPIA 4YO7A 1FFBA 1X7ZA 4JBHA 2WUEA 4U2FA 3F9RA 1L4HA 5FUXA 4DLBA 3RSSA 2ZULA 1FRFS 4BQSA 4DJDC 1KMQA 2ADOA 5EIFA 3YASA 4XPZA 4F2WA 2WF8A 3MJRA 3MAAC 4DM4A 1TMYA 1F2VA 4DB2A 4IIGA 4KXUA 1NF8A 3OEED 4XDGA 3AM4A 2FHSA 4HRVA 2EJVA 1O5TA 4BAGA 1G3RA 1OMOA 3MCUA 3N2YA 1VCOA 4YCDA 3UKOA 3WLEA 4FDVA 4JLDA 4MV8A 3I9KA 4PSKA 5IN4A 2I7DA 2ZVQX 3G68A 3SDZA 3ZEIA 4K0RA 2VIIA 4D43A 1SRRA 1V48A 2ACKA 4RKRA 4FNAA 1I9CA 4NI5A 1S2DA 1RYHA 4B8WA 4GOOD 1Y3AA 4PZYA 4B84A 2RI0A 1W73A 2AYYA 1ZC3A 1QG0A 3GUHA 4L3WA 4LXTA 4HNGA 5DEIA 3UUEA 4CMHA 2YVKA 4WFKA 4J0HA 4GWKA 1E0AA 4QU5A 5BWMA 2HA3A 3FTQA 3DC2A 3OQJA 1C9DB 1O3YA 2Q2OA 4L95C 3AIMA 2IDZA 4ZO9A 1AS0A 3F3MA 4X41A 5CG2A 1MC8A 4URYR 2XUQA 1D4ZA 3GZNA 3ZGNA 2IUEA 3DUFB 4LSGA 3S2ZA 2R4TA 4BNUA 2OWDA 4MUHA 1J1UA 1I3KA 4N39A 3PXXA 5EMMA 2CB0A 1R15A 2D5CA 3D4BA 3F6YA 1YVEI 3KYCA 2EZ4A 3LBIA 2VNIA 3O7MA 2WV7A 4ARBA 3KDSE 4HMOA 1XTIA 4BVFA 4PNEA 1NQ5A 2BRUA 4F4DA 3ROXA 1C0EA 3BD6A 4MWOA 2FRXA 2FEMA 2VOEA 2XR1A 4HDKB 3O73A 3SFVA 4Z3OA 3TQCA 1TJPB 1PZFA 3F0TA 4JP5A 1T2DA 1Y3FE 3MS2A 3C16C 1N2XA 2YFHA 4QUJA 3KJGA 1J2YA 3CMMA 5I7OA 4LY0A 3OH8A 5K3FB 1DMRA 2GAIA 4XVHA 1D7AA 1J39A 3AQIA 3SY8A 5LLTA 3SLGA 3GLHB 3MT7A 4BVHA 1I1OA 2R6CA 3CSUA 1LDNA 4R05A 3VZRA 3H8WA 5K3OA 4LCEA 3VH3A 2VQFB 5KYTA 2E5FA 2G7ZA 2OCPA 1ZMBA 4A8PA 4O4JA 4WFIA 2R60A 2GUWA 2YNMC 4RK4A 1DINA 1F48A 1Q16A 5CLFA 1L7QA 5ALLA 4V0OA 1G7SA 3A0RB 1UAGA 1YJXA 3EXFA 2XXJA 4CGZA 1NJSA 5EZYB 3WNQA 1VLJA 1DQRA 4ZAWA 3FPBA 1ISPA 4JT4A 1ZM7A 3K0BA 3RG2A 2WJWA 4E1VA 2W4QA 1JG4A 3OEEA 3QKRA 5ERXA 5LLSA 1XR3A 3UJDA 1PL0A 4R1OA 1UKZA 2ZYVX 1P6QA 1R0ZA 4LE0A 3FWYA 3NYQA 4E14A 2ZUCA 5HRAA 2P2YA 3RBZA 3HJFA 1P5RA 1T36A 1Z7YA 1LF5A 2AI1A 2PSHA 3N3AC 2F8SA 2GGSA 2RBEA 3L7IA 4UULA 2YZGA 4AJKA 5JCOC 4CF7A 5BXQC 1VKZA 2O8FA 2YFKA 3DPIA 5G4KA 2EKPA 1MOPA 1XD9A 4JJAA 1H3NA 5I48A 1KMHA 1T34A 2F9MA 4BEJA 2HI0A 3R8XA 1EVQA 4FJ0A 2O3RA 4TS4A 4ZU3A 3OP4A 5A71A 4ALKA 2XEDA 4EG6A 2V9CA 2I2WA 1JQKA 2Q45A 1AMOA 1JAHA 1RJWA 5FNVB 1HC7A 4Z4HA 4DIUA 2HU2A 2P1ZA 5KYKA 1SCBA 3SX0A 3WKEA 3KAJA 1K97A 2AC4A 4BBAA 4DSNA 4ZHQF 4HAZA 1YTUA 4LPKA 3QEMB 1CD5A 2V4UA 3P4YA 3KYDB 4KE8A 1E2EA 4HWKA 5LBUA 5IH7A 3HXTA 2VUHB 4KQ1A 1HNZB 2W71A 3HM2A 1ZL2A 3SGLA 2FR8A 1ZJ6A 2NADA 2HCTA 1BKDR 1W2HA 1W46A 1R4MB 2EG9A 2PKQO 5ARCA 8ATCA 4DMGA 1YRYE 3I8OA 5I9LA 2PZFA 3LPNA 3ODGA 2PSEA 3AB3A 4Q3CA 1DS6A 5E3IA 1Q6YA 4KRXA 1HYBA 3GGSA 1YHNA 4MUXA 2ZUFA 4HB4A 3WRWA 4YUYA 3SMVA 1P6XA 2WD7A 5BY2A 3GLFB 2LPMA 3IAFA 4ABTA 1V7QA 4EAQA 4OBXA 1T25A 2HT1A 2DQKA 1N25A 3Q0IA 1XWIA 3I6QA 4L4UA 1OXKB 1ZIPA 2FXVA 4NCJA 1ESCA 1E79A 3NHUA 1N92A 4IQGA 2Y9PB 5CJPA 3PYLA 4K9SA 3VBCA 3H2GA 4J2TA 2QQEA 5HIJA 1Q7TA 3VPDA 2EATA 5CM8B 3SF8B 1BWRA 5CTAA 1MIOA 3TR6A 1P4AA 1PQYA 4XSGA 4YB8A 1F8XA 3NNSA 4IYJA 3A6LA 3A4VA 2QLBA 4UCQA 4WV3A 2PZGA 2NM0A 4DDMA 1WPRA 1P9RA 3D8NA 1P62B 4YJ2F 1QGED 3E9QA 5JROA 2QTLA 2IXDA 3ZQ6A 4ALMA 5JZVA 1J0AA 4HNAB 4BOYA 4C7BA 2R44A 3S3TA 1UMDB 5JYBA 1IL0A 3GELA 5D86A 2FMIA 2IF2A 2REQB 3I45A 3UHFA 5K0FA 5TXGA 3IE1A 4MQFA 3ET5A 4QGAA 1VG0B 2Z8YM 3O84A 5TS3A 3UWDA 3WYDA 4B9EA 4Z0NA 4DA9A 3LBYA 1SG0A 2IYTA 2J32A 1NU8A 2QUJA 2J7KA 3DZKA 1TOAA 3B7GA 3RRNA 4CTJA 3GHHA 3PFNA 3LF2A 3GRYA 1AO0A 4M38A 1G21B 2W98A 4V0MA 1BXGA 4X94A 2J3DA 4OHMA 2Y92A 1MA3A 1ANKA 3K09A 3EPRA 2UUCB 1VZ2A 2WKWA 3AL2A 4KREA 1L5LA 1WMBA 1P0IA 3H8JA 3NUQA 1KE1A 4DBVO 4DXAA 4QFBA 3IAM1 3G2IA 1ZCFA 4FP9A 2BFDA 5EE1A 2HIMA 4A3SA 3R8FA 1QRUA 5FOQA 1D6JA 3IIJA 3QXCA 4MVCA 5C4IA 1KJWA 4MVJM 1W25A 2XE6A 5SZHB 2GJSA 2WG1A 2ZJAA 3C5EA 3HS3A 3VTKA 1T35A 4RIEA 4X7RA 1VGRA 2CCJA 1A88A 3ET4A 3Q5EA 1VB5A 1BTOA 4FMCF 1W35A 3ABSB 3OOHA 4ZIRB 3IBCA 3TOVA 1UFQA 3OX3A 1C3EA 1PD0A 1BDHA 3C7DB 5JXHA 1SXQA 2BZ1A 2PT7A 1HY3A 1QHHA 2PKQP 2BONA 3BTOA 3QYPA 4OGWA 2F1IA 2QZ4A 1N6LA 3ZE7A 5HZHA 5KQSA 4Q39A 5AK6A 1DKPA 3M49A 1KERA 1PS9A 1I5RA 5H82A 2GDJA 1G8JA 1UH5A 1ZESA 5KSYA 3TNYA 3ZHBA 3VU9B 1FDSA 3BOSA 3AU8A 4Z9AA 5IVIA 1T4GA 2RK6A 4DAOA 4Z2AA 2V8BA 4PQRA 2QD5A 1I5EA 1Z4NA 5KQLA 1F3LA 3BIWA 4CM1A 1SVSA 2DFTA 2QQ5A 2ZATA 4BZWA 1H85A 2HM7A 5KX5F 3PEEA 1N6IA 4NEQA 4EHNA 1YV9A 1U7UA 5CR9A 3PNOA 4NU6A 3FYUA 4QJIA 3CXUA 4PLYA 1P1KA 3G3EA 1L9KA 2NTJA 5JD3A 1SD2A 1UEXC 3JQ7A 3GEMA 4L9AA 2X6RA 1DC4A 3I5YA 2C3YA 1CQPA 1Q0LA 1UK9A 4NZOA 4PU0A 3W78A 1IVNA 1HEIA 1MOZA 1FDWA 1NRJB 1WWKA 2ZCVA 3FLAA 3H87A 4P22A 4QL3A 2O2SA 3DZIA 1CEYA 1CHDA 3QE4A 3TBKA 1GGEA 3MRXA 3JD2A 1XNJA 3P5BA 1CUDA 1L4YA 2JEOA 4OB8A 3V1TC 4HLUC 3V6LA 3OZXA 5L3VA 1UL1X 3A2LA 1EFTA 2ZJZA 3G8YA 1HFKA 1NURA 4Q3EA 2DM6A 1IYZA 1EK1A 3EHDA 2JAUA 2JBAB 4G89A 1A9ZA 2HDHA 3LRTA 1HETA 4PLHA 5AKJA 9ATCA 4BB6A 1IEVA 3HYSA 4IY1A 2JHPA 3NOVA 2QZZA 1RQGA 2DPLA 3EVAA 2YWCA 4E94A 4AX8A 4KKXB 1G2PA 1N8NA 5DI3B 4ZHQB 1TIBA 4S05A 1JHRA 3SS9X 3W4KA 2H48A 3G7SA 5DK6A 2KW5A 2PGLA 3JZAA 1J9ZA 3DAYA 4P32A 3QMVA 4PYNA 2CXQA 3V4SA 3KBBA 3HDYA 3X1XA 4QUIA 5IDQA 3IQZA 1RM0A 4G4IA 5D01A 2AXPA 3NFYA 3U40A 3QY0A 4DR5B 4P58A 2HKIA 3LWBA 4KYUA 1D2MA 1ZJYA 3E7XA 1JJAA 4MEJA 4OHBA 1XZIA 2I9PA 2ID8A 4QPPA 2NO7A 3FAKA 5ENDA 4BTLA 2E37A 2WSMA 1JLLB 3TZCA 2I6UA 3A05A 2H8KA 3SBOA 1A4UA 2WU4A 3G2HA 4H3VA 1RW4A 1P2UA 4HNSA 4OOFA 5TQ2A 3UKDA 5EP3A 3TVYA 3ROQA 1FFEA 1O97C 3GNLA 3PE3A 3PRHA 2XUAA 1G5RA 3DZCA 1PNQA 2F59A 1Z06A 3R3XA 4W7HA 2L19A 3E3MA 5B7NA 1WUHS 3EXIA 3Q87B 3MNFA 2R1TA 3FE2A 4QD3A 3OU2A 2QRGA 4G1FA 4QUBA 3AEXA 4PS1A 3T3HA 1RHJA 2FOIA 5FPKA 1MB4A 5L6LB 5LDDC 3QBTA 1AQ6A 3CLSD 2FEPA 3LPCA 3I5AA 4QELA 5TF0A 1N5IA 3OICA 3PDWA 4KJXA 4OB6A 2PNJA 5ARBA 5HKOA 4IRUB 2ET6A 2NU6A 4NABA 3CEMA 5I7SA 5LQMA 5BW5A 2BGWA 5ALTA 3ZPXA 2VL7A 3PB3A 2J87A 1RWXA 2XNJA 3PNMA 2WSIA 5CA0A 2ZTHA 3USCS 4WCFA 4RSRA 4YJ2B 2XVMA 3CPSA 3QF7A 3WLQA 4N6GA 1X1TA 4PXSA 2F3PA 4OJNA 1GARA 2O2YA 2HOQA 3TSYA 821PA 3K6KA 1L5SA 4IV8A 4M3NA 1E2PA 3D7MA 1T26A 2IYYA 4U2KA 2Z3VA 3WKCA 4CMKA 4BXOA 5I7FA 1ODCA 1JFFA 5BR1A 3M5DA 4MVYA 4ES6A 5CCBA 2WMDA 4P34A 4B8ZA 2GZMA 1C30B 1Z5ZA 4MB0A 5EHGA 3L9WA 3RF7A 3ZUGA 2JFNA 1GL6A 3NJ8A 2JRCA 5H4HA 5BMVA 2WQ7A 3CX4A 5FADA 4IQ0A 2YXPX 2IHTA 2J6CA 4JKIA 2XAAA 3KTDA 4E07A 3IUJA 1A97A 4WADA 1OILA 4EY8A 1EGHA 1RWBA 4UEOA 3BUSA 3OTWA 1GZUA 1AM4D 4U9UA 3UGKA 1O0BA 3LCCA 4MUAA 3M8KA 3DLAA 3E81A 1XJWA 2BBSA 1JHZA 4DLYA 1TMKA 3EBPA 2EFGA 4NS4A 1L1FA 2GF2A 1WW2A 2GAFA 1KO1A 1KKLA 4JH0A 4UBOA 2X7JA 2W42A 1PIWA 4JAVC 3OE1A 3D54D 4YV2A 4B3TB 4B4KA 4FMCB 3DXXA 3R4VA 1JR3A 2YHUA 1GZVA 1NQWA 2J8ZA 2I2FA 2QV7A 2Z8XA 3U1VA 2Z5GA 1H9AA 2OCYC 3DEAA 3ZI4A 1EUZA 2YHSA 1TQ6A 4G67A 4GMGA 1WF3A 2R6JA 3F98A 4GKAA 1OUMA 2A5DA 4DSTA 1IXYA 2FOXA 1EWQA 5IC5A 1GL3A 2O8VA 3SZUA 3QOYA 4AQYB 1UR5A 5EJFA 3C1AA 3N2GB 1O5IA 2ZE5A 4R3WA 4N8SA 1CQXA 2Q6VA 5BORA 2BFEB 3UK2A 4B2PA 2Z43A 1GU7A 1MZVA 1QK5A 1ID1A 3LXRA 4PIVA 2OZKA 3GRUA 4JJ8A 5AI0A 4BATA 4ER7A 3CLTC 1NWCA 3PGA1 3PC8C 4W9NA 2OBNA 3U6BA 2BFAA 1G3UA 2PA3A 4CM9D 3K9GA 5BSFA 3ND7A 5KX5B 3FFBA 2WSYB 5A6VA 3B9QA 1OWNA 5JJCA 5IYZA 5C34B 1BAPA 4N47A 4A0RA 3NWBA 1J2UA 4B6JA 1QTNA 1SBIA 4P5PA 1NJGA 3I5MA 2XODA 4EDHA 8GPBA 1RQXA 2OL4A 3O3NB 1RWQA 2GEFA 3PQ6A 1YA4A 2GKOA 3P9SA 5DB4A 3H5RA 2DP4E 5K4HA 4QGGA 1EVLA 3BHNA 3TB6A 2GASA 2EYQA 2IHVA 4FHCA 4G3XA 3UEOA 3EUAA 3X1WA 1DJMA 5CM9C 2V74B 2FSUA 1G6OA 3O8BA 5D84A 5KVCA 1RRCA 5TR9A 4AAYA 4HWRA 5JLJA 3TXXA 4KHPB 2HT6A 5CX4A 2Q9AA 1DIRA 2HV8A 3UOWA 4TKUB 4PLGA 1GRCA 1X19A 3LQ1A 3RVKA 4ZCSA 1NLMA 1ZR2A 3GDGA 2MYUA 4ZQEA 1KJZA 4D0SA 2J08A 3K15A 1RAGA 5EEHA 1O8BA 1CYDA 1E3TA 3QG5A 1YVDA 2NZWA 3H3FA 5A4IS 2NMVA 2IW3A 1MTOA 2QIPA 4GKKB 3R9XB 3FCOA 3WQHA 4OLAA 1A5SB 3QXGA 1LPMA 3FXAA 3AM5A 4LXHA 3OT4A 4GPIB 3PUZA 3WQBA 4QDKA 1E0DA 2PLFA 1B0PA 2WVGA 2GZRA 4MP3A 4K6GA 1VGVA 1E2DA 1P80A 4IZIA 4PY2A 1YR9A 2B4YA 1PWXA 2XZDA 3II6X 1NXVA 1IZYA 4QO8A 4DV4B 4RF2A 2CJFA 3L02A 1NT4A 2I7TA 2G72A 2WTNA 3CEJA 4IHJF 1FW8A 4J0GA 4EMBA 1TA4A 3H1AA 1K4MA 3WWZA 3UQYS 2P35A 3VX4A 1IUOA 1KP3A 1PG5A 2YJ3A 4NJEB 1JX6A 4GQAA 4AI6A 2Y71A 1U31A 2CNWD 1I51A 2J07A 2KE5A 4X91A 2X0NA 2PH1A 3EGDA 1WQ4A 4CKEB 1QVRA 3EVNA 4H60A 1Z82A 4D6PA 1QQ5A 1N0HA 3DS8A 1FU7A 3FUWA 1XP5A 4YFYA 4CM9A 4D41A 4WVFA 2OV8A 4D25A 3PUVA 3OECA 1EYZA 1MX9A 5GM1A 5L53A 1UMBB 5KKNB 4MYHA 3LVBA 2CNBA 3K0AA 5E1MA 3MF4A 1HLFA 1YAJA 5F12A 3G0IA 4OSEA 1T9AA 1XKLA 1J90A 3OPYA 4HADA 4BVEA 1JDNA 5CEJA 3AJDA 3ZNPA 3PXEA 2H7XA 2F4VB 3GLIA 4UQLA 1IZ0A 2WHEA 1Y8ZA 5GJCA 1E5LA 1Q1NA 2Z3ZA 2FPIA 4XYGA 1BMFD 2JA1A 4TL7A 4J0KA 3W7VA 1G20E 3MJVA 3Q7IA 2WM8A 1TYDE 4I2NA 4PHFA 5AVZA 1EFVB 2Q5HA 2R62A 8LDHA 3BWVA 4QOGA 1CZOA 4HDSA 3C2QA 2L17A 5D87A 2Q0SA 4PONA 4A16A 4CT5A 1UBCA 1BYUA 1A2BA 4YHBA 3A3NA 3BMQB 4P82A 2XMDA 1U2PA 4LF7B 1NTOA 1YI8A 2E4VA 1U2DA 3B1XA 2HJSA 3PU6A 4JJKA 1OW3B 3QITA 4GI7A 4Y9RA 1K1EA 3TLGB 3ECAA 1TJYA 3TVDA 3EAQA 2CB9A 3D3WA 5FTNA 5FI0B 4IGEA 4JENA 2XTMA 4UVGA 3VR6H 3Q5DA 2O8NA 3O3CA 3ZWYA 3R9KA 2DBZA 3MVEA 1Y8QB 4IDCA 3M6UA 2CLIB 4R1MA 1K2WA 1WVMA 4NQZA 4UXJA 3BEDA 4M9CA 4V0QA 1F1JA 2XUOA 3FPGA 1E7RA 3H16A 3LOQA 1T9GS 3L7LA 1FSSA 1E7MA 1XDBA 1XFDA 2DY0A 2PGNA 3S4YA 4F7DA 2NSHA 4JQZA 5H16A 3SYNA 4REMA 3W9BA 4MWSA 4CFYA 2ZFUA 4EB6A 5JR3A 1XHLA 3NOQA 3K4PA 1IOVA 4PV7A 2VBFA 1S01A 4N18A 1G2QA 3ZU4A 1KEEA 1TTHA 4KPEC 1F2DA 1GOTA 1NLFA 1TGVA 4AZ0B 2CEAA 3TPZA 1PFYA 4Y2JA 2CNWA 4MKHA 3G02A 2Q1SA 3QLVC 1IBRA 3QV1A 3G59A 3NETA 4GZ3A 4X20A 1WMFA 1CUVA 2G5TA 2IHUA 2IS4A 3I9MA 4KE7A 2M1XA 1JYEA 3LL7A 1DX6A 1EZZA 5CXQA 1I1NA 3SHOA 1QNLA 1FDOA 3ECSA 1CQJB 4MI9A 1XPUA 4XJVA 1R0WA 1SCDA 4LE2A 1N5OX 1JDPA 2GF0A 5KAMA 3SNHA 5IEBA 2VHWA 4BE9A 4DE5A 2RD2A 1ZL0A 2Z04A 1I24A 3VKUA 4C5AA 2Z57A 2XI4A 4TVOA 4QUAA 4GE0A 1J1IA 1DQPA 3VU1A 4WHMA 3T3EA 1BMFA 1GQQA 2AMYA 1AQNA 1JKMA 1S2OA 1C81A 3B3GA 3JQAB 3G9QA 1XRQA 4B8YA 1FDUA 1JZQA 3V3KA 1IBKB 2PUBA 4FHZA 4X1KA 2CNKA 4UEWA 3EJ6A 2WF5A 3IX7A 3BXGA 1BN7A 1N9GA 4YBZA 4MYRA 5I9BA 2B98A 2NO0A 1BFUA 1A5ZA 3OX2A 2DWCA 1Z6GA 2BGJA 4H6XA 2I6XA 2QGNA 3ANTA 3THRA 4WZAB 1DCMA 3GEEA 1GTMA 4YRCA 3ZI7A 3EJWA 1LJ8A 1OLSB 2FV8A 4KW7A 2P8SA 4Z5XA 3ONVA 5FEMA 1G42A 1H2EA 2HBYA 1U3FA 3T38A 3D6MA 1W9MA 1PKXA 1RKUA 1O4WA 3BCHA 1NW6A 3JVEA 4W7IA 3PXUA 4IZ6A 3FUCA 5AD1A 4EI7A 3QUCA 3UWPA 1HYEA 3M4YA 1UM9A 3WMRA 1NGSA 1E1CB 4IIJA 4Y6OA 2CW5A 5DIZA 4N5IX 2CYAA 3X1DA 2H4FA 3WQQA 3C74A 3KOOA 3RRYA 1PR4A 2K7FA 1ZNQO 3N0XA 4MYDA 3D59A 4IHJB 2Q6KA 5HX7A 4RHEA 4US1R 3RYHB 3AL0C 4WKPA 4LYEA 2UYYA 3H0EA 3KVYA 4NFSA 2BGGA 5H4GA 1ZRMA 1JR2A 2BMJA 1LQUA 1O96B 1N0IA 1XTPA 2B3DA 3HABA 3QYFA 2FI1A 1DUSA 3IBSA 4YBRA 2PZ8A 1TGYA 4D4HA 1JQAA 4NCAA 5LMNB 1ENZA 1NJ2A 2ZSEA 1CR4A 1T9DA 1NQUA 1U28C 1OLUB 1P5ZB 2J0EA 4DADA 5AVRA 3ZW9A 2JAOA 2WF6A 5TNXA 3L4KA 5COBA 1WSDA 2XYQA 4IKEA 1VA5A 2VHCA 3SR0A 3V4PB 3WYAA 4B6SA 3QF4B 4HYEA 3W5UA 4UNPA 2G4LA 3DO6A 3HJHA 4OLJA 5GP1A 5HDQA 5KWEA 1TZBA 2QMOA 3TLYA 2H3EA 4Q1BA 5ICSA 1M1ZA 2HHCA 1JRLA 1RACA 3OJEA 2G36A 2P2CA 4ROTA 4X85A 3V1LA 3D8UA 3LX8A 2C4VA 4YS6A 2UYGA 5ILGA 1V8DA 2DU8A 2PZJA 2X2FA 4YRSA 2QOEA 3P19A 2Y0EA 1NXQA 4IOMA 4DEVA 3PFGA 3ROPA 3OA2A 4E46A 1Z9BA 3GH3A 1U94A 4PEVA 4ZZ2A 4HH0A 4UVEA 3RWOA 2QV0A 2EW2A 2WJZB 3L1JA 4YMVA 1NL3A 2D7DA 1UXKA 1EK5A 2HJHA 3SIWA 4TLAA 2QVBA 4I50F 1ODJA 2JGDB 4B71A 2W2KB 1QF6A 5AOAA 5GONF 2J6IA 1JHXA 3V8RA 1E2JA 3FYSA 1P5JA 3GBPA 3R7LA 3EHEA 3RVDA 1AE1A 3SK0A 5JS8A 1P7YA 4J9VA 3SKXA 4UUBA 4ZOCA 3M34A 3L1UA 2HRDA 3GJ3A 4GGPA 4OM7A 1C14A 4YDSA 2G1PA 3STYA 3QELB 5DNWA 1PT8A 2GCPA 4OJKA 3QPUA 4B4UA 3B1KA 2F62A 3HMQA 2MYPA 3K16A 2NPFA 2AL7A 1C4XA 3FN4A 2QLLA 1CETA 1Z8HA 1KJYA 1UFKA 2CCKA 2RHWA 1SUBA 3L0OA 3LUAA 1QR6A 1ISMA 4B82A 3JW8A 1DTWA 2OQIA 4W8GA 1KSHA 5H0IA 4CG0A 3NANA 3WGHA 3HI6A 1FP4A 3P0JA 2C96A 2C7BA 3GFQA 3I2GA 4KQ6A 2GNPA 2LD4A 1EXDA 2QTZA 5MGNA 3JQPA 4FGLA 2AHOA 2W4IA 2WR8A 3QSGA 3O90A 5FOTA 2YZ7A 4RAQA 4ZO8A 4Z1MD 1OFGA 1RLJA 3EXG2 5DDIP 3N2KA 2WUGA 5HS6A 2PH5A 2BGUA 2VJMA 4EFNA 4HXEB 1B16A 4CM4B 2BGIA 3LT0A 4MWBA 2RH4A 3AY7A 3HGMA 3JZFA 3PC3A 1N7GA 2DUUA 1CLUA 3AHEA 4P83A 3WIOA 5JAMA 4CL8A 3SXUB 4BNFA 4BO6A 2X0JA 1N2CB 3I72A 4GXRA 5KHAA 2Y1GA 3HUFA 4ZYYA 5KQGA 4QLBA 1S7CA 2BJVA 2H2FA 2QN8A 3EGVA 5DGHA 3FOZA 3AZOA 3LT1A 4PO3X 4LOKA 4ZCIA 1U9CA 2IUSA 3RS5A 3BAZA 3N2ZB 2EGGA 3BXXA 2ZSJA 2BPOA 4OFBA 2JFVA 3BA6A 1G7TA 1IDN1 3DMTA 4FFNA 1P7PA 4CQMD 4NYJQ 2FW9A 2IOFA 2ZR9A 2O2ZA 1N2ZA 1LLCA 1EK0A 4XCQA 3K1TA 4DLAA 2MYTA 4NE7A 1P4JA 1SHTX 4TLLB 2IYZA 2OYCA 3W5JA 3EXAA 1WCV1 4KN6A 3M0EA 4AXXA 1EUDA 2ZJ5A 3DV0A 3PUKA 4HPXB 2A9JA 1DP4A 3IMKA 2ODAA 2X9VA 2F8MA 4LJRA 1XN1A 2C2YA 4UZSA 2J3IA 4WBNF 1T4BA 2VDLB 4A10A 3QMMA 5DHRA 2IDKA 1LFDB 1OI4A 2IPMA 3INYA 2JLZA 3DO8A 1YDFA 2BZ0A 4HKTA 4KC0A 1PUXA 4YT2A 3EEQA 1W76A 5IHPA 1YZGA 2A0XA 5JRDS 2O5RA 4YVFA 1EGQA 3A1CA 4Q1CA 1QRSA 5JY6A 3FVQA 3LUPA 4W5HA 5CLLA 3IIEA 2ZJYA 1AK1A 3DBRA 3JS5A 4CV1A 4UTNA 3HDGA 1PEYA 1KOFA 1IHDA 4ID3A 1E6EA 2FNAA 4O29A 3WBBA 1UK6A 1V8FA 3DTVD 4RVFA 2SNIE 2C9OA 4MUEA 2Q3LA 2CJPA 3ZX4A 1PZHA 3VYRB 5TV2A 4CWAA 2Z08A 4KIWA 5K6AA 4F3CA 1U8UA 4ARCA 3RJ5A 1DKLA 3FTCA 1FB5A 4OXRA 2N9UA 4Z1MA 4YFVA 3CZRA 2YWGA 4JYZA 5BSWA 1EFAA 5LYJF 5LZ4A 3OOEA 3AESA 1OFIA 1TUBA 2WZDA 3RKSA 4UTZA 4CTOA 2C54A 4DWVA 2XCSB 2WE8A 3DM5A 1GQFA 1Z39A 4KXWA 4UQOA 1RJDA 4OOEA 5T4HA 4X8LA 4BVBA 3D0KA 4EKGA 4PSUA 1QCCA 4QVGA 4DUPA 5IT5A 1Y80A 3CRVA 1RTKA 4Q03A 2B8NA 4PAQA 2O2DA 2B0JA 2ZBUA 5F1YA 4W7SA 5F33A 2IEZA 3O4IA 2WB4A 2SCUB 5FBHA 2Q7DA 4B3CA 2ZSKA 4DBZA 3GVPA 1U0SY 2P9JA 2RSLA 2Q4TA 3IP3A 5FTJA 3H9GA 4HDCA 3GIWA 3TE6A 4WEOA 4YJGB 4B80A 2N47A 2RHLA 1T2VA 3OZSA 5IUJC 4JV5B 3D64A 2NU8A 4DG8A 3QVUA 4N3GA 2FFQA 2A59A 2VDNB 1E9BA 4ALNA 4BUJA 5T8KA 4L08A 5KJ6A 1QK3A 4Q6BA 4RMJA 1I2ZA 3DNPA 5G3ZA 3ZD8A 4OGLA 4DL9A 2RGEA 1KZ1A 3HVKA 4NQRA 4PYLA 5E3JA 3FFXA 5DGTA 2WFAA 1ACJA 4HV4A 4HB2A 3M82A 1DQZA 2TMDA 2VRCD 4D3SA 4QYXA 1GWNA 4EHJA 5T7BA 3GB9A 4LNUB 5I5EA 3VSCA 2CLCX 5HFAA 1Z4QA 4IQ4A 4YP0A 4AY3A 2KLBA 4DCCA 5C8XA 2C1XA 3DBHB 4I50B 2IKSA 4PAOA 5GONB 3KWLA 1V26A 3DWIA 5CTJA 3I39X 4RLHA 5DPMA 4D82A 2RK4A 2YQ4A 5H5JA 1Y3BE 3KP1A 4O4LF 5IM4A 1Q7EA 1S4QA 4BLSA 4RMHA 1YFZA 2OR3A 3KQTA 3CKYA 4WASA 4WXRA 5THQA 1PLJA 1A27A 3MSXA 1J33A 1KBQA 2IXEA 1U81A 3VC2A 1GGVA 1RHQA 2H0AA 3QUAA 4P6VF 4IHAA 1U8TA 2PMDA 3WB9A 4BRZA 5CB4F 2V54A 2B36A 3C70A 1OXVA 1I7DA 2ZRMA 3DTVA 2HV9A 4TKZA 4AROA 1NX9A 1U5BA 1JJVA 2GFQA 2HEGA 3WGUA 4X5OA 1E3QA 1KZYC 1E7YA 4PGAA 3ENQA 2FETA 2IK8A 1ZRSA 3O94A 2GF9A 2ZWMA 3BSYA 4PWZA 5JAOA 2HR1A 3B13B 3OLZA 3BZBA 1R0CA 4XWWA 1KI1A 1XEXA 5G1PA 4L78A 4HXGA 4DDTA 3WHKA 2LGJA 5KNBD 4HN2A 2W6OA 4Y30A 3RSHA 1MENA 1LW6E 1Q2XA 3KVRA 3SSMA 1RRMA 1ZNWA 4R98A 3O74A 4UKDA 3R0QA 1PQPA 1KBOA 2EGUA 5KVAA 1SUWA 2HSDA 2ASEA 4CT4B 1V7ZA 5BOSA 2XE8A 2BFBA 5JRJA 5EXXA 5AVUA 2KYRA 1XDGA 1PDOA 4JLBA 4UCWA 2AOXA 4UDOA 4EAAA 2WYVA 1G2IA 1N8SA 3RGGA 3W8NA 4EFLA 2C5HA 5EJIA 2NU9A 5I4BA 1JQLB 2I6TA 4YJ3F 4C4OA 4YAFA 2H07A 1Z5NA 4U0JA 1M2OB 4X1YB 4LCBA 2HZ7A 4J16C 4AJIA 1ADBA 1PS8A 2ZUTA 1B93A 3HB1A 3LX6A 1MABB 3G9ZA 2CXRA 4ZKEA 4MR7B 3H17A 4HO1X 4DN6A 2XHZA 1Y63A 2VRCA 1L7NA 1JLSA 3B1WA 1LC0A 2GMWA 3H9CA 3M81A 3NHRA 4LVCA 1U8CB 3MTIA 4F6RB 2VQDA 1DAEA 2R7MA 4KWIA 4TOIA 3IUSA 3OEWA 2X14A 1YKGA 5FI1B 4F4UA 2ZYUX 2IPAB 2IYSA 3GLSA 2ES4A 5F4BA 1ZC4A 3ZNNA 3OLXA 1GTVA 1N7IA 2VQEB 1BHO1 3REGA 1DOZA 3FOCA 2A94A 4LF5B 2AMFA 1JXOA 1DXOA 1U1GA 3QEKA 3LTEA 2VQ6A 5F3DA 4E12A 2ID4A 2LP4Y 4UE6A 2WJAA 4WBNB 1KL7A 5JC1A 2XRYA 1X8KA 3BEOA 3DAFA 3NZEA 1DBPA 4GHWA 3NIGB 4OUDA 2ACVA 4LHWA 1TJ3A 2A1UA 3SVTA 4KQKA 1Q1GA 1QYVA 2XCOA 5EXPA 2CLMB 2ZW9A 4MEBA 4LWZA 1ZHHA 4BX2A 4G5GA 3C6XA 3I04A 4M37A 1YD7A 1HFJA 3QOWA 2QJRA 4H17A 3V2GA 1MUUA 4D9FA 5C52B 3KT8A 1GGJA 3L1VA 4V2UA 1IY9A 1QH0A 3OTGA 3RKUA 3SF0A 4C0AC 3Q3GE 1EWRA 4A82A 4EWLA 1WCXA 3QVOA 1H8ED 1XZDA 2JCBA 2PQ0A 1R5BA 1VHTA 1I7LA 2GBIA 1CUFA 1E6MA 1E98A 2AW3A 3BSWA 3T7JA 3VZCA 4B85A 3F6PA 1P4RA 3T9FA 1K68A 2PRIA 2RJNA 2WKRA 2O3JA 3O6VA 4NYMR 3T5BA 3U9TA 2BDUA 5LYJB 3TZLA 3H6KA 2BEUA 2AI3A 3EY4A 3LD9A 3IILA 4KDRA 4OIMA 1U9JA 4G24A 5E7MA 3ZWQA 4V03A 4PG6A 5ILQA 1V5FA 4DV5B 5AVKA 1IY1A 9GPBA 5ALGA 1HE4A 1L6RA 1WPXA 3ETNA 1CZHA 4Q19A 2C2OA 5FTKA 4Y6QA 5TRTA 3KKKA 1KVTA 5EJ4A 2QXUA 3NAZA 3WGZA 2O8CA 2B4TO 5CA1F 4R71A 3T1VA 1DKOA 3TTYA 5DCLA 4B09A 4RK1A 3KALA 3WLTA 1ADYA 1S9DA 2BL4A 2DF8A 2Z1NA 3ROZA 3RSQA 4F72A 3HBAA 3L6CA 1WO8A 3IALA 3PQ2A 1HSOA 1VLQA 4HDNB 2R8BA 4UCXA 2PGAA 5T3UA 4UDXX 1WG8A 1YDHA 2X8AA 3INTA 2IPXA 3AOGA 5KYVA 1VLMA 4TKVB 2QQ0A 3U7JA 5JQWA 1VSUA 3B53X 3FOEC 3EAFA 3O2JA 3OA0A 2FSVA 4PC1A 3KZCA 1QLWA 2WJVA 1QJ4A 5TQVA 1GPBA 1TA0A 4J1TC 1U2GC 4DNXA 5BVGA 1SKYB 3BS4A 3E2PA 4D92A 5LVAA 3W8EA 2XV1A 3UBTA 1YFJA 1S8NA 1P0PA 4LHXA 1NQTA 3TXAA 4O4LB 2ZIEA 4XIJA 1JA0A 1Z63A 3AHGA 3H2KA 1R8JA 1SKQA 3QLJA 4JQSA 5EKUA 4FR2A 4E6PA 5KJ1A 3CRMA 4R83A 3SQWA 1FY2A 1RQNA 3FOAA 4CG3A 5CB4B 5BVHB 4BE4A 2XOXA 1IG3A 1BQEA 2NXJA 3COVA 1DLIA 1XC7A 3H5IA 3KB2A 4O3FA 1W36B 2JLSA 4FJ2A 3EW7A 4OUKX 3OP1A 1NNEA 3JSXA 2GBFA 1HR0B 1H8EA 5K51A 2GCEA 2HIAA 5IK2A 4CM3A 4CTNA 4M1MA 3EEOA 5KJFA 1FTGA 5LN1A 3A3YA 4YRRA 1CX9B 2OAEA 1JH8A 2YMLA 3LQQA 2ATIA 1CP2A 1B7GO 1V37A 3BSFA 1I9GA 1K6MA 2Y0PA 4Q47A 5B2ZA 3V1YA 4HYQA 4F5YA 4WXEA 3GP5A 3JU3A 1O87A 2J4DA 2P9TA 2O0KA 1EP3B 1Q92A 4Y1RA 4Y9SA 3PITA 1EJ0A 3Q2KA 3AIKA 3C8DA 4KPGA 2CF6A 4R6WA 4EYEA 3M5CA 4DTCA 2FPRA 1TT5B 4E5MA 4EMUA 1E3EA 1LPPA 2ZR7A 4B6EA 3FOFC 4YRGA 4IMRA 4F1KA 3ZCRA 1PZNA 2ODNA 1JIIA 4BO8A 4YJ3B 1FCJA 1N0VC 2D3WA 3UXYA 3UMYA 3QFFA 1MAAA 2RHOA 3CTPA 2JDID 3KEMA 3NH6A 2QJOA 2V7UA 4CRWB 4LC1A 3LC7O 4GLLA 1CV2A 2JANA 3GAFA 4B3BA 2QLTA 4D7AA 4FONA 2GBLA 4CNBA 3EUFA 5CDFA 3RM3A 2G4CA 3FH0A 3IYLW 1E1DA 3QLUA 5JH7A 3DDCA 1Y6JA 3H9JA 2GO1A 4RTRA 4BV9A 5CP8A 1A9XB 4BP3A 1TCCA 3KFLA 3PDCA 2H2IA 1Y9ZA 1Y3CE 1QGDA 3I83A 2P6UA 2WF7A 3CWQA 2EBHX 3MMZA 3QJYA 5EXSA 3BXHA 3TR0A 5B7PA 1BCSA 1V16B 2H2WA 4ZQGA 3AI7A 3JWHA 4KQEA 2UYQA 4BYGA 5CAEA 3BXPA 2PA0A 3UA4A 4F8EA 2VP3A 4Y2HA 1W5BA 4ZEVA 4G8BA 5F21A 2RHMA 1QTQA 1CS0B 2XXAA 4GUDA 4E4RA 1T9GR 3C3AA 4WTOA 4D3YA 4DNOA 1SPBS 3AHHA 4YRAA 1QIDA 1H1DA 1FSZA 2O8BB 1HTWA 3PRJA 1S8AA 2XF8A 1IJBA 3F8WA 4LAFA 4G4GA 4YRTA 5B1HA 1QYRA 3I9V6 1BRMA 2A6PA 4PYJA 4URXR 5KNDH 3OZWA 3N76A 5F1KA 3SXPA 1TM1E 1NMYA 2A14A 1YUMA 1AQIA 3IQGX 3WC4A 1NVVQ 4PNPA 5K2MA 4E7PA 3C6BA 3HKCB 5J2TF 3RI3A 3E1KA 3CNEA 1N7JA 3L77A 1V6CA 2XQGA 4QEDA 1I6MA 3FPJA 3O3OB 3K4QA 5IJ9A 3THXA 1RC1A 2HPZA 2OHHA 4L15A 4OEHA 2XVYA 4YK7A 4PG8A 3DVSX 4KQWA 3KL4A 1CB7A 2J4FA 3FY4A 3TTVA 2JFGA 4I3HA 5J3JA 2ZTLA 4DLVA 1V2GA 4MKZA 5JY1A 3WSWA 4UD2A 4D4JA 3ESQA 3IKLA 3TPFA 2BR5A 2AW5A 2CUZA 3C6YA 8AT1A 2DPGA 1NIPA 5B55A 1PWHA 2P6NA 2QRHA 4FYYA 3S2YA 3ZWMA 2A9PA 4YGXB 1C7JA 4R4JA 4D9IA 4MUKA 1NNSA 2P2NA 2D8MA 1GQYA 4HXYA 5KWVA 4TLDA 3GJ5A 2AJDA 2I3DA 2P5TB 3QWFA 1K9SA 4M6WB 1T3TA 1LI7A 3MW8A 4QBGB 4MV1A 2FYTA 4RSMA 2FVYA 1U4NA 1ZH8A 2B25A 2JDIA 3MB8A 3NHJA 1MGOA 4RHUA 1RKQA 1BYIA 1Y9DA 5CA1B 1J8DA 2E4WA 3RFXA 2JH8A 2PBLA 2E0IA 2NUTA 1NASA 3ROFA 5JBNA 1Y7HA 4QPZA 3V7FA 3KQPA 1V5GA 3UG6A 3NC4A 2RHBA 3OM1A 2NYUA 1F7UA 2ZTSA 4WZAE 2XMPA 1GUYA 1N6RA 4YIHA 3G89A 1H1TA 1F2TB 3VTAA 2IH5A 3ONFA 4XGRA 2JLUA 2AQ8A 5ESDA 2DLNA 2AOVA 1CT9A 3SXJA 1E1LA 2DQZA 3GAAA 1Q2UA 3FNBA 4G0XA 4HLQB 1Y1QA 4BMXA 4DCJA 1VSVA 2VR1A 4XIFA 3HTXA 3WLLA 5BN5A 2OAQ1 3TG2A 4UOQA 1FNMA 4ROSA 3ORQA 2ZUEA 4EKYA 3I6IA 1ECPA 3GR6A 5GTDA 1H9CA 5DTIA 4C0XA 1H2FA 3PTLA 1TW3A 4AY5A 1XRJA 3LKBA 5FL7D 4HNUA 9ABPA 3L46A 1H8HD 1EUQA 3NDRA 3ILSA 4PNZA 5LQDA 2DPMA 2Y77A 4BN4A 1J2JA 2MMGA 3QPCA 4GMHA 2ZDGA 2OO7A 4HRXA 4DY4A 3S99A 2ZE6A 4FCVA 3TL6A 2D1QA 1MNQA 2ECOA 3CPJB 4J0EA 4W5JA 4CLEA 1SU6A 2B8TA 4OATA 3U56A 2IYAA 4IOLA 2EP8A 3GNSA 3UJCA 2C2XA 3CVXA 2CV2A 2VBIA 3GEHA 4IG9A 2H4XA 2WUVA 4ZMBA 5HG0A 3ISJA 1U7DA 3TZBA 3K5HA 3URMA 2D74A 3BD8A 1TVKA 2E87A 2O1WA 2P9CA 2VLIA 1SZDA 3HR8A 2E4UA 3A1WA 3DE6X 3L05A 2OCLA 2PUHA 3MMPA 4UE2A 1PFKA 1JJBA 2HU8A 1KK2A 1PSZA 4YJDA 1U3CA 5JAUA 4EG8A 1A96A 3ZK9A 2VDUE 4R8LA 1EZ1A 3PDJA 2Z2IA 3UFBA 3NVKI 4KO1S 1KDVA 5BSGA 3RAGA 1XD8A 3N0RA 1ZCBA 4JB2A 4KQIA 2Q3MA 2REXB 1L8OA 2ID7A 3I6BA 1B14A 1G3IA 1PYGA 4RA6B 3LVQE 4JODA 4JITA 1SXJB 4FGZA 1PWEA 3GLGE 2E5WA 9LDBA 3TW0A 4EO7A 1P2VA 2VUTA 3NDPA 4WRRA 1T8RA 4B17A 3E7FA 5HF6A 2ZSBA 3EIUA 3VZSA 3MGBA 1EBBA 2IWHA 5JWRA 5KTYA 5GADl 4A36A 1XQYA 1I01A 2HUPA 1A7KA 1QDLB 1J8MF 1PDWA 2GN6A 3QA3E 1QZXA 4RA9B 5IZ4A 2BEWB 3NJ4A 1UP4A 1JR4A 3FGNA 3OX1A 2VDMB 1RVDA 4WT7A 3B48A 3WBKA 4EZEA 3FMFA 3HCCA 1S2GA 3T3OA 4WINA 1ZUWA 5F9HA 5KSOA 4OU5A 3WMFA 5AKEA 3F49S 3R3HA 4LISA 3RS0A 3TKAA 3ZD9A 1XKTA 2FMTA 2UYOA 2ILVA 3MAGA 1BC5A 1IAVA 5FL7A 1C8VB 3FUTA 1SUEA 3M6LA 2Y4NA 4IF6A 3ZH9B 4BE7B 5L3SA 1H8HA 3HCFA 2G8LA 1UBLS 4GICA 1VMAA 4FKMA 4F4FA 4WH0A 5KSWB 4A0HA 1JKJA 3X1KA 1IQUA 3K9NA 2BV3A 2G70A 2FR1A 2W2LD 4N12A 2V3WA 2II6A 4ZYUA 1E3JA 2JPDA 4FHEA 3QVXA 1UOPA 4ZCRA 5CBKA 5J2TB 3ETCA 1Y98A 2ZI4A 2IX9A 1SCKA 2A33A 2F1JA 3CVUA 5I6DA 4Q9LA 3BT7A 3LDGA 4OB7A 1FNCA 4ILEA 3GN1A 3Q3VA 2BFFA 2JAWA 2UZAA 2J3HA 5LP1A 1L7EA 4KK4A 4OCZA 4P4LA 1KOLA 4FT4A 4P80A 1X9HA 4QLOA 2JLBA 4D96A 4AP6A 3GLKA 3D6NB 4EVIA 1DC7A 2QMUA 4K9OA 1FX0A 3SDSA 2WY2D 2I29A 1TPZA 4EHDA 3PF9A 4EY4A 1S2LA 2ATVA 5IN5A 1DEKA 1YNSA 4GG1A 3HN6A 2NX2A 2W0MA 4F2GA 2VHZA 4BGEA 2JI6A 2ZSIA 3CA8A 1AKRA 3HDQA 4NLLA 4KO2S 1ZMRA 4QJ5A 2GESA 5AI6A 1IQRA 3E23A 3H4MA 2D4AA 3AC0A 3MMXA 2GX6A 1X92A 4MI6A 5M34A 5IT0A 4I9HA 1EDBA 1M8JA 1PTJC 1U2ZA 4WQMA 2Q4BA 2QVLA 1NUSA 4CIYA 2CFCA 1CG6A 2PM8A 3GFGA 1I7QB 2ANBA 3GUUA 3H99A 3OZFA 3IBFA 5J63A 4YJHB 1ZS9A 3T5DA 4B73A 1GGKA 4X8OA 2C7RA 3ITNA 1CEEA 1R6VA 5KCZA 5AUOB 2A84A 1Z0ZA 1ND6A 1T0IA 2HA6A 3GI1A 2OHOA 2XB4A 3K0FB 3KLMX 4A1FA 2BBOA 2QL7A 5EIEA 2ZT7A 3TI9A 3PQCA 1KK1A 1DC5A 1KK3A 4REOA 4RJIA 3FBWA 4WGFA 2FN3A 3AINA 4FHFA 4UHDA 5LBTA 3RRMA 1EX6A 2Y93A 3KR9A 4Q7MB 1P1BA 4QO7A 1Y1RA 4MROA 3VPAA 4N7MA 1PYOA 4N7JA 1H0RA 4J0DA 2D3TA 3EXHA 4NNJA 5CLJA 1E63A 3TQFA 1SBCA 1VP3A 1QH9A 2W2XA 3LYAA 4DOMA 2Z2JA 3DOOA 4E2XA 3NPMA 4Q18A 5K0JA 4XCVA 2BYTA 1GSIA 2W2LA 3BMOB 5D85A 3MJFA 1ELOA 2QG4A 5JXIA 4V3BA 2IZ0A 1HA3A 3PEUA 3OWXA 8ADHA 3IPRA 4W82A 1HT0A 4ZJYA 2D54A 3DLBA 2R86A 1WD7A 3E9ZA 5FLKA 2FPMA 2BE7A 3OE4A 5TGDA 1TO1E 4ZAXA 2MINB 2PIAA 4QNMA 4L3OA 3WBFA 2RFLA 5A9SA 4U5XA 1TF7A 3VO8A 3TW4A 3PR2B 1JEDA 1K7CA 1QPGA 1Y8RA 3IEVA 3N86A 4IIEA 1SM4A 4MAFA 2DFKB 2B5OA 2FPUA 5LC1A 2VF2A 3JWIA 2PYIA 3SQXA 5T4FA 3A1NA 3HRKA 4RY8A 4XWKA 2MSKA 4C4RA 4P81A 4AN0A 4YCBA 1ECGA 4ND8A 3ROKA 5DW0A 1ADJA 2PT9A 4K3VA 3DD5A 4UTPA 3WDMA 1DFIA 1C7QA 2CUKA 1XFAA 4X8MA 3V48A 1TQDA 5B37A 1BDMA 3RWMB 1CJVC 3AEZA 4KX5A 4B5KA 1GSAA 3C97A 3AV0B 3KQVA 4HFMA 3OJOA 3ZGVA 5IXYA 3RV3A 1M1YA 3IT0A 4DGSA 1NJ6A 2AN9A 1TLFA 1EDDA 4GBJA 4HNTA 2ODWA 3HFSA 4MW6A 1I30A 4NU0A 3U4QA 2X0EA 2GA8A 2NXWA 1A9SA 1NKVA 2ZYDA 5TT0A 2VP4A 4I1PA 3LUBA 5F98A 4FGWA 5C8YA 3NALA 2C5SA 1D0VA 3KOWA 4TSKA 1SOMA 1RQPA 3OPNA 3PVSA 3D7SA 3E58A 4KLRA 4UW9A 5FLYA 2GUGA 2Z56A 3ZWOA 5KDOA 4ZVVA 4DIBA 1I6KA 1DWOA 3QNMA 1HL7A 4BLQA 1EXVA 3I5XA 2GN9A 1SUIA 1JLHA 1NNI1 2WU8A 3NHWA 3ZWXA 2RGCA 1YS2X 3CX7A 3HKDB 2UZIR 3T7IA 3JQ6A 3DOCA 1X1DA 1KBZA 4DM3A 5HCIA 3MWYW 3GFRA 1FFXB 4AJ9A 4KN9S 1LX7A 1QO7A 3M3PA 1NQVA 1OLOA 2PAFA 2VHYA 5HWSA 1DXQA 1UXHA 2QW0X 2FN7A 4XM0A 3GFOA 2W00A 4C4PA 4MHTA 4B2LA 1ETHA 3CH6A 4QTYA 1O8CA 4S35A 4HVAA 1FVXA 2JEZA 4X61A 5HXAA 3AM1A 3C3WA 3PCTA 2A35A 3O8DA 3MTQA 1MRZA 3U26A 2A67A 3RU9A 3HY4A 2NXCA 2AOUA 2H6EA 4IDNA 2O8FB 5JSQA 3A6FA 3BGDA 4JVMA 5G4KB 3ICVA 1UC4B 2AX3A 4Z8YA 3U48A 1ORDA 1ULUA 3T52A 2BR4A 3O47A 4Z7QB 1SCUA 5TS2A 2XBLA 4ZO6A 5ADVA 1ZEMA 2ZBEA 2AB0A 1C5KA 4NH4A 4ZRNA 3BHIA 5EA2A 1Y1PA 3O03A 4MA4A 1K7FB 4XLZA 4LBZA 2ZWPA 3PC2A 4G8CA 1YT5A 3DT9A 4FQ7A 4OQMA 5GZ1A 4E2FA 1Z25A 1OBCA 2BTQA 3BKWA 3OF2A 3BA1A 3UTCA 1QOPB 2RAVA 2E6UX 2V03A 2YMMA 3RFFA 4D46A 4DTIA 5B3JC 4R51A 1W5AA 3NKLA 4M1KA 1IZZA 2W9XA 3O91A 3IELA 3EGCA 3R7NA 1GZ5A 4FW8A 2GD6A 4K8RB 1RWNA 5E6UB 1UZLA 4RZXA 5HMMA 1PCXA 2AEJA 3TIXB 1WU8A 2QVXX 4CR6A 5A5GA 4MDYA 4Q24A 5DJ5A 1B6TA 5SY4A 3L18A 4IGAA 3ROEA 1YZHA 5KYYB 5TB5A 1CE8A 3OPQA 2WFLA 1O4VA 5C5CA 1OXBB 2OECA 1O1YA 4B43A 2NVBA 1RVV1 2FPXA 1MBZA 2Q4EA 2V8OA 3OPMA 4RGVA 5JAQA 3TWOA 3PPVA 2XQIA 4BMSA 4C2AA 5FYDA 4E03A 4OHZA 2BF7A 5IABA 5J47A 1HZZC 3ZU6A 1R5NA 2Q5IA 1Q11A 3WIUA 4BQOA 1Z7GA 4E5VA 1IN7A 4XYMA 3TMAA 1G0OA 3LT2A 2AR0A 1YQQA 2PKRA 3A58B 3H04A 3L4SO 4WN9A 2Z30A 2EKQA 4A9AA 1GZ3A 2D00A 3DQPA 1R66A 4GYKA 3UGQA 5CFLA 1DIAA 4RZ2A 5LBIA 5ICEA 4RNCA 4FJ1A 1EVYA 4BLRA 3IUQA 4Y7CA 1R6AA 3I64A 3LVFO 1T6YA 3HR4A 4DZZA 2X6TA