3OPNA

The crystal structure of a putative hemolysin from lactococcus lactis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
209
structure length
208
Chain Sequence
b'KLRYVSRGGLKLEKALKEFHLEINGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAWKIRSDERVVVMEQFNFRNAVLADFEQGRPSFTSIDVSFISLDLILPPLYEILEKNGEVAALIKPQFEAGREQVGNGIIRDPKVHQMTIEKVLKTATQLGFSVKGLTFSPIKGGAGNVEFLVHLLKDGKAEIAQQVNIESVLQKESE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative hemolysin
publication title The crystal structure of a putative hemolysin from Lactococcus lactis
rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Structural genomics, unknown function
total genus 67
structure length 208
sequence length 209
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3opnA00
5E9WA 5H02A 3TKAA 5M5BA 4EKGA 5HIKA 4PONA 3SGLA 3BGVA 4ER3A 3G8AA 4KWCA 3SVZA 3M4XA 4FP9A 3THSA 1H1DA 3SSNA 1EIZA 2HR1A 3BUSA 4GOMD 1DL5A 2VP3A 3G2PA 3SX0A 3C3PA 1RI3A 3I58A 2P7HA 5K09A 1M6YA 2P3LA 3C3YA 2G72A 1G55A 3ID6C 5DM0A 3TPZA 1BC5A 2YXDA 4E32A 2ZULA 5CM2Z 2EJTA 5GINE 1D2HA 4LG1A 4M36A 4A6EA 3C6MA 1JSZA 1WG8A 2AOUA 2OXTA 4QTUB 1QAQA 3HVJA 3PTAA 2V74B 1JTEA 5E2BA 3GRUA 4RVFA 2PGXA 3EEOA 2ZBRA 1Q0TA 3P2IA 3NVKI 1N2XA 1NBHA 3B7PA 2R3SA 4GOOD 2YR0A 2ADMA 3LGAA 5FQOA 2OB2A 4RTRA 5DSTA 3SR4A 3BZBA 2XYQA 2PT6A 2VDUE 1EQAA 2G1PA 1IM8A 5FHQA 2DPMA 2IIPA 4RX1A 2A14A 5E1BA 4ZTBA 8MHTA 3TQSA 3PLAE 2P40A 2PKWA 4LWOA 3GNLA 1MJFA 2CWWA 4PGHA 2EX4A 3GRVA 5K0GA 1WZNA 2AOXA 5E1OA 3K0BA 1SVUA 2JH8A 5EC8A 4R05A 3GRZA 4PYNA 4X61A 3TM5A 4E33A 2ZZMA 2PXAA 3FPHA 2FK7A 1NW6A 3DLCA 3HCDA 3AXTA 3VC1A 1KPHA 2BM9A 3DXXA 4AUKA 3BWBA 1ZGAA 3JWHA 3EVZA 3KQVA 2B78A 1XXLA 2Z6UA 3UJ6A 3FRIA 3NTVA 4IV0A 3UJAA 5LSAA 3G8BA 3EVDA 1SG9A 4MWZA 4YMGA 2HV9A 4P58A 2K4MA 2YX1A 2VDVE 2NXEA 2WK1A 3P8ZA 4QVKA 5EZSA 2AOTA 2IP2A 4P7FA 5P8WA 1ORHA 4P7GA 3G2OA 2C7PA 1R18A 1TW3A 3PVCA 3QOWA 4QQNA 2C7QA 2O05A 3G5TA 5E1DA 2PX4A 3OU2A 3IYLW 1NBIA 2NXNA 2ONZA 1V39A 3P9NA 4MTLA 5D1HA 2ZFUA 3KQQA 3HCAA 3MCZA 3P9CA 4DCGA 5JUWA 5MHTA 3OZSA 3KPVA 2KW5A 3OPNA 4U7PB 1O54A 2AZTA 4MIKA 5F2KA 3ME5A 5EPEA 2OY0A 1AQIA 1Y8CA 2VS1A 4DM3A 3M33A 5EMLA 3BKXA 3T0IA 1QZZA 3UJ9A 5HFJA 5DSXA 1YZHA 5CVUA 1XTPA 3V97A 3EVBA 3FPJA 4M37A 1D2GA 1RI4A 3KHKA 4Y30A 5LQAA 2PLWA 2DULA 3KQYA 1YFLA 1JQEA 1KYZA 2ZZKA 4HTFA 1JSXA 5DT2A 3DXZA 5BXYA 3UBTA 4DCMA 2UYOA 2CMGA 2O57A 1BHJA 2XVAA 3D2LA 2ONYA 5EEGA 3KQTA 3VC2A 2QRVB 3FPFA 3FRHA 3GIWA 3HA5A 5EKXA 3CJTA 3UJCA 4EKIA 2IBTA 4FS8A 1KR5A 3DR5A 4MQ4A 5E9QA 5EIFA 1YF3A 5HIMA 2I7CA 3AY0A 5KQSA 3BWCA 4A6DA 2ERCA 2YVLA 2AOUB 2ZZNA 3MQ2A 2Y1WA 3E7PA 3LX6A 4FSDA 3L8DA 3KR2A 4GOND 2I62A 3IV6A 3NVMB 5EMMA 3FTFA 1YZ3A 4KIFA 4DZRA 5GP1A 4WXHA 2IDKA 3A25A 4HC4A 1D2CA 3PB3A 4R6XA 5E8RA 4V0RA 3GGDA 3B3GA 4U7TB 1VE3A 5FTWA 1XDUA 3HCFA 3IEIA 5CIYA 2CKDA 2P3OA 3LL7A 1JQ3A 2ZIFA 3FUUA 5B1SA 4YMHA 2JHAA 4EMSA 3HVIA 4C07A 3C6KA 2QE6A 2BM8A 2JG3A 2IGTA 2UYQA 3O7WA 4V0QA 5EMKA 5KQRA 2AN4A 3JWGA 3A27A 4KRGA 4HGYA 4DMGA 4RTNA 3C0KA 1X1CA 2PWYA 3OE5A 5DWQA 4DKJA 2GAFA 3DH0A 4ER6A 5K8VA 5EGSA 1BKYA 4UOEA 4DF3A 5ICEA 3IHTA 3KQOA 1VL5A 4GC9A 5HOQA 1KP9A 3ELWA 4QTTB 5ERGB 1XCLA 3TMAA 5CUQA 3OFKA 5K05A 5DM1A 5CCBA 3HEMA 3EEYA 1X1AA 1EAMA 3R6TA 3LBFA 4OBXA 2AOTB 4RTQA 2CL5A 4QQKA 5JR3A 3EPPA 3MTEA 3ELDA 4BLWA 4C06A 1RI5A 1VIDA 1AF7A 2XYRA 3LDUA 3OZRA 1RJFA 5HEKA 2JH9A 4CKCA 3KR9A 5CVJA 2BZGA 3HNRA 3HCCA 3I5UA 4EQZA 3CBGA 3MCTA 4LECA 4DQ0A 4F84A 3SM3A 1XCJA 7MHTA 1XDZA 5K0FA 3DTNA 4PWYA 1O9HA 3TR6A 3NDIA 4PYMA 1XDSA 2C7OA 5G02A 3FTCA 5E8JA 4PYOA 3KPYA 3Q7EA 2NP7A 3UZUA 2P8JA 4C03A 5ICCA 3HVHA 2IBSA 2GPYA 2AVDA 4DA4A 2YUIA 4E2XA 4RVHA 10MHA 1I9GA 3GJYA 4GC5A 3OCJA 2PJDA 5EEHA 3CCFA 3R3HA 4CKEA 1RJEA 5BW5A 2GLUA 3RIEA 1RI2A 4PINA 4YUWA 1F38A 4ISCA 1P1BA 5EOVA 1XJ5A 5FCDA 2YXEA 4POOA 4P7JA 3TOSA 5T64A 1SUSA 3U81A 3HVKA 5DX0A 4X63A 1NV9A 2WA1A 1VLMA 1NT2A 1SUIA 1T43A 3EGVA 4OQEA 1M6EX 4RTOA 1Q0SA 2BR4A 2AN3A 3CGGA 3DMHA 2ZLBA 4FT2A 4BP3A 4PYKA 3X0DA 4L7VA 2IFTA 5K0NA 4KVZA 4F86A 3KQWA 4FGZA 5EMJA 4NECA 2ZW9A 3KKZA 5GM2A 3REOA 1KPIA 2HNKA 5DTRA 4RVDA 5EQJB 3FUWA 5FA5A 5LQUA 1L3BA 1X1BA 2OB1A 3ELUA 2YQZA 4IKPA 5F2NA 2O07A 5K0JA 4B17A 1JTFA 3AXSA 5DX8A 1EJ6A 3TFWA 2PX5A 1Z3CA 4KDRA 5LQCA 3MERA 4O29A 1NW5A 2WA2A 4HH4A 5LQKA 4M38A 4E70A 5FQNA 1AQJA 1SQFA 2GA9A 2IPXA 4PNEA 1RJGA 2P35A 2OPBA 2AOVA 3BWYA 3HP7A 3NDJA 3A7DA 4RV9A 4AX8A 5ICGA 1M0EA 1KHHA 4BLVA 3EVGA 3ER8A 4FR0A 5FADA 5CVVA 2ORED 1I4WA 3P9IA 4HGZA 2FRXA 1N7IA 3CKKA 5K03A 1G8AA 4RVGA 5C0OE 3S68A 1KYWA 4OX9Y 1ZKDA 3UJ8A 2ZSUA 4E2WA 5K0LA 2QM3A 3EVFA 3BGDA 4PYQA 5HIJA 1SKMA 3R9XB 4CTJA 1FJXA 2H00A 4ER0A 3HCEA 2PXXA 4R6WA 3UJDA 2XBMA 4XUDA 3DLIA 5CVDA 4YV2A 2B3TA 2B25A 1RI1A 2PV0A 2YXLA 3KQPA 3T7TA 2G8NA 3DUWA 3V8VA 2PXCA 3DXYA 4PCLA 3MAGA 2FYTA 2HMYB 4M7RA 3DMFA 1UFKA 5C1IA 4RTSA 3DMGA 3ORHA 1ZQ9A 3LCCA 5HILA 4CXMA 2BH2A 1JG2A 2I9KA 2P1DA 4EVIA 3F4KA 5EVJA 3GDHA 4XUEA 3PS9A 1R00A 5T67A 2C7RA 5FHRA 3FUVA 4LWPA 3MB5A 2H11A 2HWKA 2OKCA 3LDFA 5CVEA 4YV1A 3BWMA 1P1CA 3E05A 3FUTA 1I1NA 1TPYA 1L3CA 2EG5A 1P39A 2QY6A 4PYIA 4RWZA 4WVLA 3EGIA 1JR4A 2P41A 2OO3A 3EVCA 5CCXA 1L1EA 1EG2A 3G88A 4F85A 1HNNA 2NYUA 1EJ0A 5EHIA 5LQNA 4RYLA 3A4TA 3H2BA 3KQMA 3SSMA 3EGEA 4E30A 5LQRA 2PT9A 1RJDA 2EFJA 2QYOA 4QVGA 4OQDA 2NXCA 2Z6AA 1FP2A 3G7UA 4JXJA 2EJUA 1YB2A 5GIOE 3O4FA 3PX2A 3NWEA 3I9FA 4E31A 2H1RA 3UA3A 4CKBA 5BW4A 3HA7A 4C4AA 3R0QA 3FYCA 1OR8A 1WY7A 2GS9A 3P2KA 2UYHA 1PJZA 1TW2A 5K0CA 1NW3A 3GO4A 1KXZA 3NJRA 2N47A 4X60A 5EHGA 3K6RA 4YUYA 2GB4A 5EG5A 3SSOA 4YV0A 4FZVA 3ER9A 2G70A 4PIMA 3T7SA 4HSGA 5DRTA 4GQBA 3LSTA 5DM2A 3GWZA 4RTPA 5U4XA 3KPJA 3LCVB 1JG1A 3JWJA 3OU6A 3FPEA 2VZ9A 4MHTA 4K6MA 2AOWA 3HTXA 3LBYA 2Y1XA 2JJQA 1G8SA 1UIRA 3ANXA 3OE4A 4GUAA 3T7RA 1G38A 2QRVA 4YUXA 5LQJA 1O9GA 1NE2A 1UWVA 2XYVA 1PRYA 1R6AA 4YUZA 4X1OA 5K0BA 4ATNA 1L3IA 2VDWA 5HIIA 3BGIA 3G2MA 5C9ZA 3GCZA 4R8RA 4HTFB 3I64A 5GM1A 4HRAA 1ZGJA 2GH1A 2O0LA 4PCAA 3OZTA 1N7JA 4ER5A 2PBFA 5DTMA 5KS2A 3B3JA 3EVAA 3UA4A 2P7IA 5DXAA 3RW9A 2PWPA 3BXOA 3FZGA 2P3QA 2R6ZA 3UJBA 2B2CA 3UFBA 3G89A 3KR1A 3FTDA 4YUVA 4RTJA 1X1DA 5FUBA 3TKYA 2F8LA 2AS0A 4C08A 5DTQA 5GIPE 4P7KA 3QV2A 5GWXA 2OZVA 2UYCA 1AV6A 3RODA 1VP9A 5T6BA 1QAOA 3G2QA 2Q41A 4HG2A 3I53A 5IKMA 4RTKA 3A7EA 3E23A 5EIWA 4QDKA 2OBFA 9MHTA 1G60A 2NNWB 4IV8A 4AZSA 2NP6A 4AZTA 3R24A 2ZVJA 4GF5A 3WSTA 4OA5A 3MHTA 4CTKA 3AJDA 1QYRA 2AVNA 3B5IA 3M6XA 5FWAA 1FP1D 2Z6QA 3EMBA 1WXWA 1DCTA 3MGGA 3NMUF 1R8XA 4G56A 4XCXA 3TLJA 5DLYA 5LR6A 3LKDA 2FCAA 3CVOA 5EKUA 4AZWA 3B89A 1IXKA 4GOLD 3CJRA 3KPUA 3BKWA 1P91A 4XUCA 2XVMA 3BT7A 3VYWA 3GRRA 3DULA 2PY6A 3DP7A 2HTEA 5D1NA 4ER7A 4QPPA 4C05A 1KIAA 1YFJA 2PX2A 5KYGA 1VBFA 2BR5A 2O06A 3A26A 3LECA 3O31A 3PX3A 3P9KA 1QANA 3QOXA 3M6UA 2PSSA 2ZBPA 1DUSA 2JHPA 3EMDA 4PGGA 4PYLA 4Z2YA 2ZTHA 3EVEA 1G6Q1 2CMHA 3LCUA 5K0EA 1U2ZA 1R8YA 1ZHFA 2ESRA 2PVCA 5GOZA 3TRKA 2LD4A 2OYRA 2JHCA 2ZIGA 2ZWAA 5DPMA 4E2YA 3GRYA 3FYDA 3M6WA 3HCBA 3NWBA 3E8SA 3HA3A 4PYJA 3HM2A 4QPNA 5F2OA 1MHTA 1BOOA 3Q87B 4GEKA 3CC8A 3CJQA 4FSXA 3UJ7A 3ERCA 2FPOA 4BY9E 1INLA 3OFJA 1ZG3A 2IDJA 4QDJA 4AZVA 3KPWA 1JG4A 4BP1A 3KU1A 1NV8A 3GXOA 3FUXA 1SQGA 1NW8A 4FT4A 3SMQA 5HZMA 2FHPA 2AR0A 1FBNA 3B3FA 1JG3A 3JWIA 2IH5A 3P71T 4KW7A 3PT9A 5E9JA 3PFGA 1JQDA 3LDGA 3AWIA 1VP3A 1VQ1A 2G71A 3M70A 4R8SA 3NW9A 4C04A 5DX1A 2ZBQA 2YTZA 4CWAA 1HMYA 4GBED 1L9KA 2BR3A 4E2ZA 5DM4A 4RTMA 3SXJA 4X41A 2PX8A 5FWDA 5ICFA 1QAMA 5FA8A 2ZWVA 3DOUA 1IY9A 5E1MA 4H0NA 1X19A 1WXXA 3P97A 3TM4A 3PFHA 4Y2HA 5E2AA 3ELYA 2FK8A 3LPMA 1WS6A 4PIPA 5DRYA 3M6VA 2E5WA 2IH2A 3THRA 3FPGA 3MTIA 2ZCJA 1YUBA 1ORIA 3OU7A 4EK9A 4KIGA 2V7EA 1XVAA 1KPGA 2I6GA 4KDCA 3VSEA 5EZQA 5IH3A 5K01A 1FPQA 4RSRA 4RTLA 5CD1A 2IH4A 4IWNA 3UWPA 5BP7A 1R74A 2B9EA 5KVAA 4OBWA 4OA8A 3GU3A 3KR0A 2ZIEA 2AN5A 3LKZA 2UZ4A 3FTEA 2NXJA 1B42A 1F3LA 3G5LA 5FULA 3KQSA 3LHDA 3P2EA 5DXJA 4BLUA 1NKVA 1NW7A 1VPTA
chains in the Genus database with same CATH superfamily
3BL6A 5L40A 1RYDA 2PWZA 3D6MA 2B4QA 1X6VA 3NCTA 4R41A 1S2MA 1ESCA 4L2IB 4F5YA 2PDAA 4TTTS 1UC5B 1Q21A 5A05A 1C3VA 3ZHVA 2HL6A 3SSNA 3WDLA 3HSKA 2RK3A 2VP3A 2NTYC 3TUZC 4S1WA 2VOEA 3AGQA 3H05A 1KORA 4EUKA 4IHQA 5EJ7A 2DGDA 4XSVA 4EEXA 1HYQA 1XC7A 5AVSA 1QZTA 5IAKA 4EHLA 1UF9A 2WF8A 4R8LA 3KVYA 4Q7LA 1SXJB 2ODTX 1EG7A 5JZVA 1F0NA 3PTAA 4QTUB 3AUAA 2E1PA 2P9TA 2V74B 3DHYA 1KVSA 1WJGA 1Z75A 2SCUA 1CUWA 3MCAA 5BN5A 1TXGA 3HZRA 4ZC1A 3WJAA 2ZQYA 3E0QA 4G0MA 4C6TA 4LY3A 2R3SA 1KO7A 3BDVA 1O58A 1ZN7A 2BHSA 3N07A 4ISBA 3RK0A 1BH6A 4UZEA 3FPSA 4JA2A 4DDHA 1RWNA 5IC6A 3CB2A 3TIGA 4CUKA 5E1BA 4YAFA 4BKQA 1U8TA 2PVPA 4U9IS 1K7YA 4Q00A 2P40A 2XXJA 4MR7B 1XZKA 3LVBA 4MA4A 2BM1A 4P31A 3C7AA 2GX6A 4YRIA 1MX9A 2ORVA 3CU5A 3ZKWB 1RC0A 2I0FA 5JMWA 1CQJB 3CEPB 5KO2A 3K0BA 1SVUA 1DOZA 2A92A 4U7WA 1XLTC 2EFDB 2Z2IA 4QRHA 1NW6A 4XQGA 4DJTA 1RPNA 1S8NA 4AUKA 3QSYA 1RMQA 4YJ2A 3LUJA 4A23A 1OVGA 1BOFA 2WZDA 2B78A 1FS6A 3N2IA 4UD2A 2HREA 3TZEA 1JZQA 4IDNA 2FETA 1G20E 3R9IA 3MVEA 3FHCB 2EBUA 4CLXA 2H0AA 1W5TA 5BV7A 5I45A 1TZKA 2YX1A 4NRDA 4Y6PA 1OPXA 1NT4A 4DUPA 3FH0A 4EUEA 3ROMA 2H2DA 4C76A 2ZRCA 5A06A 2J85A 5EHZA 2AZMA 3GB9A 2VJMB 4TLMB 3IYLW 3TTXA 4DS3A 3IALA 4Y1RB 1BGVA 1UJ2A 3ASYA 3RYCB 4NMMA 3QVVA 3DV0A 3OPNA 4WJLA 3D1LA 1UDCA 2G5PA 2IL1A 2Z4RA 4JJKA 3Q3IA 3OX2A 1M9NA 1PR2A 1HTTA 1ZIXA 3A9RA 2GJSA 2K87A 4ZYXA 4OHRA 4BTEA 3TLGA 5F76A 2R5WA 2OCYC 4ZC8A 1U1IA 5EESA 3AL0C 4ZQEA 4QGAA 3ZIUA 4M37A 4UHJA 4DZTA 1LBQA 2DAPA 2XCTB 4D44A 2OBNA 3LUAA 4PF1A 4AF8A 3Q3EA 4B7XA 2ZE5A 5FR2A 4F7WA 5MN6A 2FMIA 3R6DA 1J8DA 5CBKA 2A9VA 2BFDB 4BV8A 3LCRA 5HNKA 2ONYA 1F2TA 5K2MA 1L8XA 4L8FA 3ETNA 1DDGA 2BDTA 3KELA 1KS9A 2XRYA 3M4NA 4LYEA 3KZNA 2IBTA 2C5SA 3HWSA 3MUOA 1HT1E 3ZWPA 3DR5A 5K3CA 4GZMA 1M34B 1NSYA 1EEHA 5E7QA 4IHAA 1PFQA 2V55B 1ITZA 2ERCA 2IZZA 1P72A 2YVLA 3F6EX 3LF1A 4QBIA 3RANA 3ZCSA 3TL3A 2JVKA 4EO7A 1FTWA 3U5ZB 2Y76A 3CA8A 3DLHA 3E03A 4MKHA 5F3RA 1ODTC 1U4NA 3MGCA 4EHBA 5C52B 1D2CA 1Y1PA 2CCGA 2IHKA 4JT9A 2VQFB 1KH3A 3S2EA 3KKQA 3P0RA 1J5EB 2IUSA 4UVDA 5L8VA 1I2DA 3IEIA 1E1QA 4D9MA 3TFOA 4N82A 2F9MA 3AKEA 3DVAB 1JEOA 3KL4A 2Q2QA 4GR5A 3TSYA 2B9VA 3HVIA 4UAUA 5D00A 3U39A 3ZHSA 3KLBA 4E09A 3OJXA 1JXMA 1CUGA 4DBZA 5HM6A 5HRUA 5KQRA 2OAEA 5ER6A 2JGIA 2CF6A 1O96B 4JBIA 4ZVPA 1OX4B 2CLCX 3H0KA 5K8VA 4ZT6A 2QYTA 1PQ4A 4CEIB 4NZOA 3ZIDA 4C29A 4IMPA 1SHUX 1YXMA 5K3OA 4EB0A 4RKEA 2HJ9A 3FVRA 3EGCA 4M7PA 3R6TA 3TW4A 1LPAB 1L5SA 4JBNA 1XZAA 1RCFA 2CL5A 5IARA 1EVLA 3OESA 4QM6A 3ELDA 5AKKA 4C06A 5G4KB 1RMYA 2QVZX 4XYEA 4CLDA 3UWMA 2L82A 4G5FA 4ZV7A 2G4LA 1ZUIA 3IIKA 3VHLB 1XQ1A 3FSRA 4RZQA 2H6EA 3H4VA 4H3VA 4R9SA 5SZJA 2IS1A 2JGDA 3JYQA 4BP3A 1OYWA 4P32A 3G13A 4G0VA 1M8GA 3FPAA 4K26A 1O6BA 5JV5A 4KLAA 5DN6A 3SHFA 2VK8A 3JATB 1PL7A 4JB8A 3W3AD 1XTJA 1KP3A 5J2TF 2COEA 2XKAA 1OF1A 2VDKB 2I1LA 1BWSA 3F96A 2W6CX 1OBFO 1X9IA 3NHZA 4IXDA 4LVOA 3ZU6A 4EKYA 3AF6A 4ZXPA 1MC8A 3RJ5A 3G2JA 1DIAA 3IMCA 1TA4A 1WF6A 2AH5A 1TJ5A 3DZIA 3WGUA 4EYSA 5HWSA 2ACWA 1DMSA 2FW0A 4LW8A 1T1SA 1U7TA 1Z29A 3GEIA 4YXWD 4M1MA 5I7AA 2G5CA 1DX4A 3RS8A 4ANFA 2PK3A 3T7KA 4DIEA 4MUXA 3KEQA 3ED1A 4NSNA 2G08A 2VJBA 1RTTA 3P0FA 5JSYA 5L3ZA 4Y7CA 3W2FA 5CH3A 4LYHA 4CMIA 3FGPA 2VP9A 1GUBA 1DMRA 2JH3A 4L8WB 3PUVA 1W9HA 2HSGA 4IVQA 1CWUA 3ET4A 3VKHA 5DMXA 4B71A 1PNRA 3BGSA 5K51A 2X8LA 3PQFA 4OQEA 4RPLA 5IZCC 1LQUA 2VHWA 3KE8A 3EWIA 3ZWCA 2Q3LA 1I1HA 2GERA 3KQWA 3FLMA 2WOJA 3O9MA 4FGZA 4GI3A 4IG4A 5AKYA 1R0RE 2FG6C 2W83A 2R6DA 1LTHR 2QLTA 4D8VA 1QPZA 2J8ZA 3UT5B 2YN2A 3O8NA 5ALPA 5F2NA 2AEJA 3T7IA 2O07A 3GEHA 1EXDA 4KQCA 1YRHA 2GJ9A 1M2VA 4DNFA 1Y6RA 1XVIA 3P9SA 3U40A 3HN7A 3RUDA 4KV7A 3LCJA 4J4BA 2FSFA 2Q1YA 1GTZA 4FEEA 4K5QA 3L02A 1UCFA 3U49A 4CEJA 4BLTA 3KV3O 3DDHA 1JB1A 1XU4A 3LU1A 2P6UA 1H65A 3D02A 2DTEA 3G7SA 3FOWA 2FGJA 3H84A 4FR0A 3F4LA 4OKIA 4CIXA 1H0HA 2FEAA 3G3EA 3TAXA 1UBCA 1T3LA 2OWDA 3NEJA 4OHZA 4GI1A 1ISFA 3ZHTA 5BWBA 1I7QB 1X3SA 3UJHA 2D2EA 3L7JA 3AONB 3KYJB 4JK3A 4BNVA 2XWSA 1TUBA 4R6WA 3OEHA 4MKZA 3VQTA 4K9OA 3I61A 1E6UA 4NENB 3LQFA 1A5AB 1Z4JA 4HLQB 4MV4A 3PNKA 5FV4A 2HAEA 1DBQA 1QE5A 1B23P 3IIIA 1MVOA 3CZ9A 3IAS1 1A8IA 2F59A 3HZZA 4UBNA 4D9HA 5IWAB 4FYMA 3ORHA 2D1QA 3OIVA 2V54A 4CMAA 2YN4A 2OV1A 5LKRA 3PGXA 1NN5A 3AZOA 2IPMA 5T7BA 1NP7A 3REQA 1TK2A 5JWOA 3HXOA 4Q3DA 3WYCA 1PV4A 2GN0A 2I6QA 2M2IA 2ID9A 1ZCJA 5SZKB 2F9FA 2DBYA 4P93A 3UYKA 1R4MB 2G1KA 3UAVA 1XQVA 1A7JA 3C1UA 3O82A 2YZNA 4ZDIA 1BYUA 1L8QA 3BL8A 4PFSA 4YQZA 1JEAA 2RHWA 1U9JA 3A6FA 4ZDKA 1HGXA 2GSDA 1J7KA 4PYIA 2XNKA 4RWZA 3V4FA 4DUYB 3BGWA 1W4RA 1EWTA 3FFBA 1UBMS 4D9KA 4NBSA 3PBKA 3WDSA 4F1KA 1H2ZA 3G9XA 3R7SA 4C0KA 3LXRA 3OZAA 2RJ3A 3T99A 4F6LA 5EHIA 1OLXB 3LE8A 2FF7A 1U8XX 3A4TA 3KQMA 2IIBA 4PO1A 3LUCA 1GGKA 1S8AA 5A7GA 1WPQA 4AC9A 4URXR 5JBIA 4C4OA 5KNLA 1K8YB 5JH7A 1PZEA 3I9NA 4P5DA 4YRMA 3R44A 1HI9A 5BORA 1UWCA 4JR0A 4YLYA 3PICA 4QBKA 4ZZ2A 1JDBB 3CF4G 1FDOA 4IIVA 3H17A 1GAQA 2JGKA 4R2JA 2WJAA 1TUEA 2GTIA 2Z2YA 2J3MA 1XLVA 1KS2A 3F5QA 1E58A 1WX1A 2XZPA 2ZBVA 4OSEA 3RAJA 2HA5A 1TB4A 3L05A 3GEDA 2OBBA 2RCYA 2ZVPX 4J0KA 1DFIA 1P1RA 4AY5A 2Y0PA 4ZICA 1CFZA 1P3DA 3JQ7A 1ODFA 1UIRA 4PXAA 3PJDA 4L3OA 3C85A 1U5CA 1ZOOA 3E4CA 3LT1A 5F73A 2Z2JA 3X1ZA 5JISA 5AR1A 3LP6A 2EGUA 5LB4A 1V71A 5MGBA 1NUAA 2IY8A 3L77A 2XNDA 1E1NA 4KV9A 5HBRA 3G2MA 3PNLA 3MSXA 2B82A 1YCDA 3JQAA 4B9AA 1IOWA 4R84A 1ZGJA 5JANA 4PCAA 1YAHA 2QZPA 1FSSA 1NKTA 2BI8A 1E2NA 3SD7A 3VR5A 1Z9BA 1ZR2A 3GW8A 2P7IA 3TCKA 5ABPA 1CP3A 1VRVA 5MF6A 3VPAA 2FV8A 3JASA 4AD8A 5TSDA 5IVPA 2V7QA 3RASA 4DJFC 1TTHA 3O1HB 3U1BA 3A10A 1HT0A 2JD2A 5C7OO 5CCEA 3R9WA 2PMKA 3JARB 1WHTB 2JD0A 2V1UA 2OZVA 2P65A 1ZN2A 4RS3A 1ZK1A 3T5TA 1HNZB 1LTQA 3MOIA 5LXTB 1WMFA 3NASA 1EE2A 3I53A 2FJPA 3B20A 4QDKA 5LOVF 3RE1A 4OGWA 4BFLA 4CI0B 4QM7A 1ECPA 2NP6A 3CSSA 1QQ7A 1Z4OA 2C4KA 2PBRA 3ND6A 2J9ZB 3DM9B 5A9RA 3PF8A 1SHLA 2FPRA 1FP1D 1FYDA 4H7IA 4MW0A 1NXTA 2Y1DA 4G0NA 4NCJA 4D0SA 4Q1EA 2IX3A 1B93A 4A5SA 2PBLA 3I34X 4LXQA 4GNKA 1N3LA 1NQOA 3KP1A 3KXPA 1I6MA 3CLRD 2XNHA 2QNBA 3VYWA 1DT3A 1PDWA 2IXDA 2WJ3A 3DP7A 1DJNA 1LC3A 4JD5A 5BUZA 3WRXC 4WPGA 4BQRA 2VF4X 5CJPA 1T9BA 1YFJA 3PFCA 5F7JA 4CLRB 3O31A 1DWUA 1QANA 2HCTA 2PSSA 3MQFA 1DUSA 1Z73A 3L9XA 1N9KA 4JP5A 4NE7A 1SHKA 3K09C 3TBKA 2HMVA 4AMGA 3TUIC 3N2KA 1NF3A 2VRWA 1B6RA 4JB0A 5EJ5A 3S6JA 1TQ8A 1PKEA 1YL7A 2X0RA 3HB5X 3L7BA 5CU7A 4C7VA 4R2IA 3FYDA 1RWPA 3KUUA 4OLHA 1E1LA 3CUVA 4G5SA 1RFLA 1V5IA 3JQGA 1T1GA 4G9EA 4F91B 3Q3HA 3ERCA 4BY9E 4ENSA 3HWWA 5FTKA 1WTAA 4AUEA 3GIDA 1Y5IA 3HBJA 1UKAA 1GGFA 4GW3A 1RU3A 1BXKA 2O0JA 2FHPA 4C20A 3VSCA 2CV2A 1ZJJA 3KJNA 4NTZA 4X0EA 1Y6FA 1UP7A 2MYPA 5B6PA 2BFCB 2NUTB 3BF7A 3M70A 1QGED 2WF7A 4R8SA 2HHHB 2SECE 1UJMA 1L9KA 4E2ZA 2OGSA 1KKUA 3G1UA 2BJWA 1PJBA 5DM4A 1T8WA 2RH9B 2LWIA 1V2HE 3FETA 3IXMA 4L75A 4MS4B 4YRQA 5G0TA 5A3SA 5REQB 3SS9X 4EY6A 3Q1LA 4QOJA 1LEHA 3SEFA 3QGMA 1X19A 4WCVA 1VRWA 2GJ8A 3OZFA 4XIJA 5TC4A 3LGXA 2FP4A 3IAM1 4QPCA 4R8KA 3V8EA 3OFVA 3R40A 4R81A 2FPPB 3SQOA 4PIPA 3ZGOA 1GRNA 4TROA 4YAUA 2IGBA 2JEZA 2ZJBA 1AN0A 3MMNA 3MTIA 3I0NA 1WUKS 4QXOA 1P1HA 2JB9A 3GA7A 1PR6A 2NPIA 3R0XA 4DT1A 5EZQA 5CD1A 2VTBB 4BL5A 2I34A 3EXG1 5K4GA 3UWPA 4W5TA 5AYVA 1SC4A 2E0IA 2YXPX 5DVZA 1P7YA 3GU3A 4Z49A 4BNYA 4P54A 3DL7A 4I5IA 3DNFA 1JDTA 4DBVO 5FOSA 4KE9A 3L7CA 1NF9A 2I7TA 3UB3A 3VKUA 1ZXBA 3F8TA 4UU1A 2POCA 3MUEA 3WGZA 4MGKR 5ALJA 5CAEB 3TQHA 4CUJA 2V59A 3IR7A 3UMSA 2Q5OA 1JR3A 2NU9A 2VG8A 4G24A 3ZY3A 2XCOA 1CFJA 1E1KA 4KO2S 4MROA 4QLOA 1STOA 3ZY2A 3M4XA 5IHPA 3ZDFA 5L53A 1B0UA 4TUYB 1BJRE 4GOMD 4JYBA 4PEVA 5FBRB 4AULA 4OBBA 5LP1A 1CUVA 1UM9A 4HEA6 2EJBA 2P7HA 1NGSA 4RY8A 3CMMA 5KYVA 1Q3HA 1U28A 1M6YA 2ZR9A 1T5OA 4B8ZA 4DV6B 5D5QA 3VZBA 3ID6C 1G5FA 4E32A 2C61A 2PGIA 4TLLB 5IM4A 2EJTA 2LVBA 3DAYA 5HUJA 4HGRA 1RKBA 4RNDB 5TR9A 2WSYB 2B5WA 2IYSA 2YJ6A 2NPFA 1WG8A 2H5LA 1RYNA 3HVJA 4MDHA 4RF4A 1JTEA 1FIUA 3E3NA 2ATXA 4F2GA 1PWXA 1QX4A 1SOWA 3MWEA 3WXMA 4EPWA 3VBCA 5C7LO 5JNLA 4OYHA 5BQXA 1UDRA 1ZQ1A 1A04A 2I8CA 2FPGB 3C3DA 4HJXA 1Z08A 3LGAA 4KU4A 5FQOA 2ANCA 3BMCA 3OEWA 4IV5A 4EI7A 4Z4FA 1DELA 2O2SA 3I6MA 4AFNA 2JK1A 4ZTBA 1UT6A 1CY1A 3PLAE 5T8KC 4GLOA 4II7A 4G4SO 1MJFA 2ZUWA 4J0EA 3K8OE 5CEJA 3PR1A 1X8LA 2OHIA 3R4CA 4TWZA 5BSRA 2HA3A 4DR3B 4LZPA 3AHEA 1CZUA 2C88A 2PPVA 3DQQA 4V2UA 5AUQA 3GEGA 2O8CA 1S2DA 2BKXA 1G5HA 1NNI1 4DLVA 3D3JA 3AETA 1S2OA 2AZDA 5CITA 4JVSB 3U3JA 4BV2A 4EB6A 3PHBE 3JWHA 2J0UA 3ZLVA 2HQSA 2NVWA 3GDFA 8ADHA 2WWHA 3ZY5A 1QYDA 3P45A 1Z37A 5D2CA 3T1NA 5KTYA 3FRIA 4D0NA 1D4FA 2CL6X 4B3MB 1L4LA 2B1QA 3FKQA 1W34A 2ECPA 2HEIA 3N2EA 1DQPA 3DO5A 4QJ4A 2C0CA 2WK1A 4QVKA 5CLLA 3GVCA 2XOXA 5CNKA 3OOWA 5AQEA 1O6FA 1W87A 4FFLA 4JB2A 5GZ1A 2F55A 1IY8A 3ABRB 2GOYA 3P9NA 4L7QA 1RM0A 3CS3A 4KQ2A 1U8YA 4J1QA 1KARA 4ZO4A 2C2YA 1J8YF 2MCFA 3UENA 4KUGA 4ITUA 1PW7A 2HBQA 3C98A 3VYUB 2W22A 3CR8A 1KRXA 1WLSA 4U7PB 3ZWKA 1NG1A 5FPTA 1AGYA 1ZD9A 4TT3A 2AD1A 4CKXA 4K0RA 2XVYA 1LQTA 1TAQA 2XD4A 5NULA 3HNOA 4DCVA 4RY9A 2XXAB 3FPJA 5JXJA 3L4BA 1J33A 2JFGA 4UVIA 9LDTA 4EG4A 1U9IC 2ZJFA 2ZZKA 4UUNA 4UD6A 5B3JC 2BMDA 4Q7QA 2UYOA 2CMGA 1WBBA 5LIRA 4HRYA 3WB1A 2VJNA 4CYMA 2FPIB 3C1TA 3SYKA 3MRXA 2N42A 2VTDA 2JJ8A 1T29A 4LDZA 5JTUA 2OFPA 3PFBA 5HRCA 5EIFA 1JMYA 1P60A 3VPFA 1XUOA 2EFGA 4UHEA 2ZDHA 3SXUA 3PQ5A 2Q6TA 4QECA 4L6IA 1M74A 3DMTC 1DE0A 5B2EA 4HXYA 4D8WA 4KWTA 2Z98A 2MDTA 1KP2A 1D4ZA 4B7CA 2MU1A 1VDZA 5HJ2A 4E5SA 3VAAA 3GUHA 5KQPA 5E8RA 2TMYA 2Y1GA 4M0CA 4HY3A 2PHZA 2XUZA 4QWWA 2XCIA 3S2YA 5U9CA 4RLFA 2JI7A 2C97A 4DWVA 2GNAA 1AA9A 3E82A 3FLBA 2XE4A 5MGNA 2P9JA 5L4NA 4XJVA 1JAHA 2R65A 5AVRA 1P62B 3TS1A 1DKRA 5K8JB 3G8CA 1POXA 2WIKA 1WA5A 1VI6A 2UYQA 1P1IA 2FE4A 3BD7A 2WJYA 3BRQA 4FGWA 4H1HA 2BFMA 1NXVA 4G5RA 2O8VA 4IIUA 4INJA 1JHXA 1WXEA 2Q0HA 3PGA1 1ZGBA 4RJIA 5AHKA 4BO2A 4UBLA 4B2YA 6AT1A 1Z16A 2H16A 1A9XB 1NFRA 2P5UA 4J9UE 5JSHA 1DADA 1XL1A 3NIBA 1NLZA 5HKKA 1V7CA 1SD1A 2W2PA 2GZAA 1H22A 3JXEA 2XRFA 2C96A 2JLBA 1JG6A 1N2HA 1XEXB 4NBRA 4NS1A 3WNVA 4TL9A 2HLNA 3HY6A 4G5YA 1XRNA 2F90A 4A1OA 2FQWA 1SHZA 1C9MA 1E9BA 2A8YA 2P4HX 2QKYA 3GPIA 5IH7A 3E5HA 4MPRA 3WWPA 1Z82A 2LDBA 2O3SA 3QKRA 4RV4A 2EYQA 3X1YA 2MWMA 4DV5B 3OZUA 5CB4F 3T3MB 3IJPA 3QEMA 2DT8A 2WB2A 2GCEA 1WD7A 5FUMA 1RQLA 1U3UA 4LGMA 2Q2NA 5JCJA 2JLUA 3KK0A 4TM8A 1CUEA 2AB0A 2FW8A 3QENA 4FLEA 3RV4A 4CMCA 2H9AA 3WJ7A 4E7PA 2C83A 1U0NA 1NI4B 3ZZTA 3QHPA 4IMIB 3AP2A 5CIQA 3E48A 5LDGA 4P36A 4WFKA 5G02A 3JR7A 1K6JA 2XGSA 4PE5B 5C18A 3PSAA 4LWQA 3UT6A 1DEXA 4OJNA 1N36B 4C0WA 3AUJB 3KKNA 4U2CA 3TH5A 2X5XA 3HLTA 3HVHA 4NP6A 3QZUA 4DA4A 3CX6A 2CBGA 1ZISA 5AFSA 2TMKA 3PFNA 3GJYA 2ZJ7A 5TV2A 2XMCA 1DQSA 1T2FA 2EG9A 4UBIA 5J63A 1AC5A 1Z0IA 3LYAA 2WM8A 5BW5A 2BZ1A 5G0VA 4YUWA 4ABTA 1XEAA 4QGGA 4UTRA 5CEFA 4UDNA 4EJSA 1XFDA 2YXEA 2F4VB 1QOPB 3PYLA 4QUGA 4Y9UA 3T1TA 4FIDA 3F49S 3CO5A 5ITVA 3O5AA 2LIPA 3P0IA 4RKRA 5I7UA 4LX0A 1NNEA 4MLDA 4J75A 4LKRA 4DLLA 4HLNA 4RPIA 1H4TA 4PZ0A 1ZM9A 4TTVA 1V25A 3OSUA 1GV0A 2WHPA 2O7RA 2ZLBA 3JQFC 3N8IA 2ZT8A 3A9WA 5ALUA 4ZA2A 5AKEA 4ENTA 1CVRA 3C3JA 3TDKA 2DLCX 3MTAA 3OEHD 3REOA 2ZB3A 4MQFB 1EGAA 4DB4A 4RLHA 3B1XA 5K3BA 4AURA 4IDBA 1RE1A 3C41J 3RVKA 2OM6A 2R00C 1A0OA 3D8SA 3MJRA 2VKTA 2WW8A 3LNTA 1NDUA 3TE7A 1GPKA 4G8BA 1GVHA 2VJCA 4TYYA 2HK6A 3VR6A 1YQWA 3R3JA 2Q5EA 4BKOA 4R9UC 1ORDA 2Z5GA 2EWMA 4H18A 4ZXFA 1NZJA 3SZ3A 2A33A 2RHBA 3E2IA 3P9XA 3I2JA 3WGKA 1ZKDA 2YDYA 2CJFA 1K8ZB 1T8TA 4WN3A 5JC1A 2XLBA 4R2MA 3NB0A 3V80A 4A73A 2D3WA 3OPXA 1BAPA 2G06A 3U4AA 3TTSA 4H9GA 2JFWA 1VI5A 1YR7A 5A0TA 3BMNB 3V8VA 3DXYA 3VPDA 4DC0A 1BIFA 5JD5A 2YJ4A 3GJ6A 4DC9A 1XAIA 3HJCA 3Q2OA 1C7JA 3RYIB 2XTMA 3RS9A 3T38A 4YPFA 1JG2A 4CL8A 3K92A 4PQGA 5MN4A 4WBNB 3UN1A 4DW8A 2I9KA 1TAGA 3UAGA 4E22A 4MRMB 5E0OA 1HT2E 2WIBA 1NDQA 3BWXA 3GDHA 4P83A 2ZJ2A 4Q1AA 5CDFA 4PBTA 1B15A 4S1OA 4BRUA 4HFMA 4M21A 4DC1A 1D8AA 2QWXA 2P78A 5T67A 5DNCA 4JH0A 4TXHA 3EH2A 5FO0A 1FQWA 1ZKMA 2NACA 4CCYB 1JTVA 4YJHA 3I92A 4QUEA 2RH5A 5BN1A 2OSVA 4QG3A 3PSHA 2ZXEA 1QTIA 4MYCA 1O89A 2A94A 3SF8B 1W1IA 1C29B 2P41A 3O0TA 3CN7A 3P2JA 1KSJA 4YDRA 2C95A 1ZUNB 4ZKEA 4D57A 1XRSB 5JAQA 4F85A 1SCDA 1RM5A 5A3VA 4KLZA 4TV9B 2X6RA 1PKXA 3CNBA 1NMSA 2IYPA 3UJ3X 4AXXA 4S35A 4JUBA 8LDHA 5JXGA 4IUCS 521PA 1PT6A 2BISA 5GONF 1LS6A 4OXYA 2Q6VA 1Z18A 2VQ3A 3A36A 3ELBA 2GVZC 2O2JA 1K75A 2B6HA 2GD6A 3C3CA 1MDBA 1ZFNA 3COSA 2QSUA 1XMIA 3JQAD 3JZIA 4I3HA 4E31A 5IT0A 3NBXX 5EKDA 2A3NA 1UBFA 4K87A 4O4JA 1Y5NA 3VR5D 2PV7A 4AJNA 1WY7A 4FFPA 4OI2A 3ZK9A 2FWPA 2YWBA 4JX9A 5LYJF 3LCMA 2FPXA 1NNLA 3ULKA 2C4TA 3PUKA 2CXXA 3SAJA 3TTWA 1NPDA 2V7QD 4FFVA 5CFNA 1HSZA 2K7ZA 3NDPA 5DSZA 3IBSA 2XNCA 1XK6A 1XLTA 1ZGCA 1DUVG 2EQ5A 1F0YA 4UPEA 1L7RA 2AYZA 2HMUA 3AP1A 3OI7A 4BFWA 4NXNB 1LX7A 3V4OA 2Q4TA 4BGDA 3U60B 1CZHA 1G66A 2J3QA 2A1UB 3M6IA 4FDVA 4G0QA 3T7RA 4EO4A 1G38A 2AX4A 2CV0A 4HLUC 4YCLA 4HUQB 1C7ZA 3Q9UA 2JGFA 1LV8A 3WL5A 4IKOA 4RFVA 2H1CA 1WU8A 3QX7A 4M1WA 3NHBA 2Q1TA 3VI4B 4BC0A 1I10A 4E21A 1S0UA 4UEOA 3KG2A 5IXYA 5JSZA 1K7SN 1ECJA 4B6JA 3T95A 1RTKA 2HPZA 3U19A 4GBMA 1GR0A 4OGFA 1Q6ZA 3FGNA 5E0KB 3TTVA 3ILYA 5JAZA 1QHGA 3GN2A 1IZ0A 3U3XA 3P4XA 2PRJA 2C9BA 2P3QA 2G9ZA 1RPZA 3UFBA 4GLFA 4INPA 2GZHA 4IWYA 2X2EA 2O0MA 1A95A 5EZYF 3DPSA 2F1HA 1EVYA 4W1SA 3ZJYA 2HIGA 4IILA 4XJTA 2QOEA 4NAVA 1M66A 3UMCA 1S3SA 1VP9A 4PX9A 3WWEA 3RD5A 4I50B 3OA0A 1Z7GA 1XZQA 9MHTA 1G60A 4AS3A 2FSSA 4OHXA 5B12A 3PFFA 1IZ7A 3ONFA 2XAUA 3HYRA 4IV8A 4OUDB 3NBQA 1YCHA 2HHCA 3RWOA 3WSTA 1TM2A 2VF2A 1KSGA 5FI5A 5KU1A 2GRUA 4L02A 2V3CC 1ZM7A 3MGGA 1QRUA 2NSHA 2XD9A 4WKCA 1KK1A 1ZPDA 3MCUA 4YRLA 1P3Y1 4GSKA 4UEWA 1O94C 2CK3A 2RHCA 3FIUA 1KI9A 4HL6A 1V8BA 3BT7A 2Q8QA 5EIAA 1PG2A 2J4CA 2IEYA 2VJOA 3G6KA 4PBSA 3D7KA 3I23A 4PGFA 4S1PA 4O4LF 4YI3A 1SK9A 3TL6A 1L7PA 3HKCB 4X92A 5LJIA 3AKZA 2XX3A 2JIZA 1QVRA 3RS3A 4DNOA 1P5HA 1BJTA 1YOVA 4M53A 4TL6A 1MRSA 4KYVA 4UEJA 1KDYA 4D4MA 3NTRA 1I0IA 2EW8A 3EGDB 1P2VA 4HSEA 4YRZA 3VJKA 4O4HF 4DDUA 2YYSA 3TOZA 4BNGA 3OO0A 5AJUA 2LZ0A 5KKNB 3AEUB 3FKSA 1YQGA 4GX0A 2ESRA 3CXUA 3TRKA 3ITKA 2R66A 3W90A 4LV8B 5J2UB 3IL2A 2EZ8A 5I7OA 1VKHA 1HLDA 1M5TA 3O91A 4QWMA 4C7OB 4BNJA 1KIFA 3OPYA 1TYZA 1UZLA 4OOFA 1F8XA 1I4EB 4YQFA 1N3IA 1LJ8A 3DHVA 1RLJA 3T41A 2QSYA 1QG0A 4NESA 3TX6A 3M5CA 2JAXA 4D25A 4MV6A 3B3FA 2VO1A 4IO0A 5IJAA 1CB0A 1E63A 1LH0A 3P71T 1A4IA 4CFSA 4DABA 5CB6A 5ALFA 2IH5A 4JV5B 3ENNA 3I6BA 1UPUA 5IUNC 3R5SA 4W5OA 2Y93A 1BE6A 4MW4A 4DM4A 5CDTA 4NZZA 1SU6A 3CLSD 4ZVKA 1IN8A 1EP3B 3R2JA 4B6PA 5EJEA 2SHKA 3VO1A 1OLUA 2OD2A 4PSKA 1KTVA 1W19A 2FA9A 3AT1A 5DNYB 1RRVA 1LSSA 3ZCUA 4Y2HA 3L82B 3IUPA 1N5LA 1TA9A 2B0CA 3QU4A 3ZWOA 6CHYA 1FLNA 3CF4A 3HPRA 3CT4A 5F7OA 4KIGA 1YRBA 1YZUA 1NFFA 4L5CA 3N2NA 3W1WA 3V4VB 1ZOSA 1EK5A 1C9NA 4XASA 3S44A 1V1MA 4KN5A 3KJQA 2Y4OA 4EDFA 2R44A 5I48A 3QBTA 5E6SB 4KPUA 3EXIA 4AJEA 1BH2A 5AT1A 1CQZA 4HDRA 3OCCA 1X7GA 2QIOA 4C4PA 1T2CA 4D81A 1QH0A 1W48A 5H02A 4B79A 3DAFA 5BSFA 2RAFA 1SAYA 3L6EA 2GM3A 3BH0A 2PCJA 1SVKA 3BIWA 4F3CA 2Q4EA 1KZHA 3SVZA 2R4TA 3TL2A 1EIZA 4YAKA 3FCSB 4LBZA 2QXYA 3CVXA 4LZNA 4Y1GA 1OUMA 3AVPA 1HDEA 4Y2PA 3HXKA 2AUMA 1O2DA 1IWOA 5JO9A 4A92A 4ZFNA 3K6SA 4JGGA 1FNSA 5H8WA 1WWKA 1AHHA 1H69A 1SQ5A 2P3LA 3CUYA 3QKIA 2Q4BA 3MD0A 5L51A 4W1QA 1S3GA 2CF5A 1OHHA 2HPAA 2A57A 3BFKA 1H5QA 2XUGA 1M0SA 3IPCA 4DSNA 4D26A 3D0OA 2PZBA 4QGHA 1WXDA 5F2EA 2PAAA 5AQ1A 1BJKA 4XA8A 4DCNA 5BW8A 1BG6A 1QHNA 3K53A 3NJ4A 4C4YA 4JBXA 1XD2B 4A1FA 4KQ9A 1XAGA 4M98A 1JGTA 5K3EA 1QQTA 3MJEA 4OFXA 5E3IA 3IOEA 4OHWA 3EXG2 4GE3A 1JAZA 5JVDB 2ZRQA 5JPDA 2J0QA 2D1FA 1S96A 3Q3JB 3NIDB 3V33A 3EDYA 1CD5A 4HVTA 3QXXA 1BYIA 1ETUA 5FHQA 2A14A 4XEHA 4HB0A 1GNQA 1VHLA 1THTA 3HDVA 1GUDA 1CKEA 1ONSA 1Y7PA 4YASA 1OH7A 2Z95A 4FQ8A 4TQGA 3TZHA 1CJVC 2VP6A 4GX1A 4MQBA 3HSYA 1R8SA 4UNNA 1N6LA 3KBOA 4O1HA 4TQUS 4XVUA 6YASA 4L8LA 5FA6A 3VX3A 5K5EA 2JLYA 2KS6A 4K6FA 2IXEA 3E3OA 4CIYA 1N77A 1OXKB 2GCOA 5AKLA 3ZH9B 3PUJA 3DFKA 4I3FA 4HH0A 1RQXA 3DNMA 4WE3A 1UBHS 3ZDRA 1W29A 4CM9D 4DJEC 1C7IA 3K6KA 1G4HA 3QK7A 3W5VA 1UMDB 1FS5A 2YV4A 5P8WA 1YU6A 1ORVA 3EF1A 1FU4A 1UEJA 4GPZA 3QX8A 1CUDA 2J46A 3PVCA 4JP2A 2FCRA 1PFVA 2QIPA 4TSFA 5GVRA 1YNOA 3S7ZA 4R7TA 4PHFA 1FRQA 3C4VA 3ZGXA 1C80A 1TJPB 3GJZA 4RZ2A 5INTA 3ER6A 2N0SA 1QO0A 4J4TA 4EUNA 5CDUA 4A8JC 5KZMB 2CJYA 2I55A 4HDSB 4PBRA 4J4HA 5HF6A 1BRTA 1Z36A 1XVTA 5DISB 3UMVA 3M6AA 3LPNA 2NVUA 2ZOSA 4Q24A 4HNAB 3ONEA 4KQFA 3ZR4B 1BTOA 1DBSA 3MCWA 3T0IA 4DDVA 2QW1A 3RVDA 5LWHA 1DC6A 1VSTA 1KEUA 2V6MA 3TPCA 1T0UA 2KSQA 4HK4A 1ATZA 4JT2A 3V97A 3AI2A 2RI1A 3EQ8A 4ZHSA 1HFJA 3BSFA 3D3KA 2AJCA 3G68A 3GR6A 1SPXA 3FE2A 3HXLA 2VHEA 4K9NA 2XB2A 2NVOA 1XHFA 2RFLA 5FOTA 3KQTA 2WYIA 1EB9A 3AHDA 3FPFA 3L92A 1C3OB 4I5EA 4N9WA 4WLOA 4Z9FA 5JPIA 1ILWA 3GLFE 3N86A 4S1VA 3A6DA 4ZO7A 1JLKA 3C43A 1KEEB 3RTBA 5AP9A 1NC3A 2DBVO 1AGNA 1LRLA 1XYGA 3MLBA 4WESB 5HKKD 1CT9A 1USWA 2FB9A 1DHTA 1VECA 2JFNA 2WWTA 3HEBA 3K2QA 3OICA 4FSDA 4Q9DA 4DMCA 4F6RA 2ON6A 1OBCA 1XMVA 2PKQO 3PLNA 4DPKA 5ADHA 4L6CA 3PWSA 4L4ZA 3ECAA 1UEXC 2ZBFA 4HC4A 4UU0A 3V1KA 5JU6A 1DAGA 4FYPA 4UZFA 2H2AA 3FA2A 3QLUA 1GTMA 2XWQA 3KE9A 4MVJG 1ZVVA 2YZKA 2QT9A 4PZPA 3HACA 4YCCA 1PAUA 3GFQA 3WV4A 4KAAA 4L4RA 4W7SA 5TB5A 3KLMX 3MJVA 1AUQA 4PCVA 2J3HA 2NAFA 3FUUA 1G2QA 1GJRA 4X94A 4KOEC 1MC5A 4M2LA 3RSHA 1N6IA 2FW7A 2XT6A 5KX5B 5JCJD 4YCBA 3RSQA 3ZW9A 2UYYA 3GUZA 1B76A 2RHJA 3ZZMA 1IJBA 1QORA 1D03A 3H97A 1FDIA 4ONEA 4RMHA 1DSSG 3OQVA 4U0JA 2GBCA 1D4OA 2RHTA 3GGPA 3UF0A 2X3UA 3D8TA 3DWGA 4LFAB 1EHCA 2I1VB 1G9SA 2D7CA 3IERA 4KIJA 5D5HA 5DTJA 2R0QC 3AR7A 2Q50A 4YJ3A 1W44A 3T7DA 4QICA 1U3FA 4LNUB 3C14C 4NKRA 4YAOA 4Z1MA 5CCBA 4IZ6A 5SYNA 4V1CI 2HFKA 3TW8A 1KO8A 1T8UA 5A7HA 4KXUA 1YJXA 4DNPA 3WWOA 2XGMA 1G9TA 4BAUA 5DB4A 3SBEA 1Z6TA 2CXTA 5LUAA 2WZCA 5HEKA 3D4NA 4LJYA 2HKIA 4JBWA 1QTRA 4MQUA 1DZ3A 4RPJA 4YCNA 1EXVA 5GJWC 3SZOA 5F4BA 5LIPA 2ZXUA 3LWZA 1QBGA 1E94E 3DTNA 2RE8A 1E79D 1AZWA 4IHJB 2V98A 3T5BA 1A2BA 3V8MA 3BG5A 3WGJA 4BVGA 3D5EA 1CV2A 3T8YA 1ZYUA 4P4UA 3HLYA 3T1QA 2NZYA 1QHSA 3ECCA 4OLJA 4X1YA 4NYMQ 1V41E 2DPXA 3L6RA 1H2WA 2NU7A 3JZFA 4KLNA 4QO8A 4C5CA 1OFGA 1ESZA 2AFIB 3LDAA 3LOQA 2PUWA 3PDWA 4PZEA 5FLYA 4X9XA 1YJBA 3D6UA 2BFPA 1LSJA 2H51A 2VAMA 3ESAA 2JCGA 3L2OB 2I3BA 4OHKA 3WRXA 1QF7A 2CLHB 1U3CA 2FLWA 1LBTA 2IUEA 4A5OA 3B1YA 3SJAA 5A6SA 3LQ2A 4L95C 2BSQA 1BSVA 4IIJA 5KHAA 3MIIA 4UU8A 1J56A 4MVJP 4I0WB 4BRWA 5ITZB 3GOHA 3K09A 5KDDA 4DR7B 4ZAYA 5KYYA 3S5UA 4Q4JA 2NV0A 2VATA 1AURA 5H59A 1T9AA 3OM1A 5L3QB 3RR2A 1QDUA 5KYWB 1DBVO 1SUIA 1JKMA 1FSFA 3AJ8A 4G0WA 1M5RA 4I9FA 4ALLA 3E5RA 4ZOCA 3Q5EA 4MYTA 4HYQA 4GSYA 5M7EA 2VHTA 4YTEA 1Y9ZA 1GPWB 5HJ5A 3W9UA 3KKZA 4U0KA 1EWRA 4G1UC 4CM4A 3F0TA 3L04A 4GHWA 5IZ4A 3CTPA 2BMAA 2OB1A 4B3CA 1Y1TA 1C0IA 1HYBA 1L4YA 1P7ZA 2OORA 1WSDA 3MERA 5DBGA 1ZSVA 3ABQB 2O1SA 3Q3CA 3U3ZA 3TR5A 5FD8A 1QK3A 2B1IA 2HSEA 5BQFA 4YIHA 5IJ0B 2BCJQ 5LFAA 3U2QA 1Z33A 2FN7A 4Z9BA 2QTLA 1Z4MA 3NDJA 4G1EB 4WK4B 5DBHX 3EXEA 2J31A 5CPBA 2WICA 2CYCA 4CLHA 4TTSA 4CV0A 2QS9A 3BCHA 1NP3A 1BX1A 3EN0A 1Y7LA 2M6LA 1ODKA 1I4WA 1R4AA 1Q1BA 4G3XA 4LHWA 4V0LA 2VBFA 3CH6A 4IIHA 2IU4A 5FEUA 4S2EA 2XZTA 5IKXA 3LUHA 4U5XA 1JIKA 3LQRA 4LDJA 2QX9A 2YH2A 3OIUA 4ALIA 1TM1E 2H4WA 1GGJA 1BS1A 1C30A 1C9YA 1N5IA 1NUPA 2YY6A 2YXLA 2Z2ZA 5KHOC 2AUTA 3LLMA 4MWGA 1IJKA 3TQRA 4G2TA 1U90A 2X7XA 3O26A 1JI0A 4PCLA 1KK0A 1EM6A 1QH9A 3K9QO 5E4YA 1XJQA 2JLXA 1H5UA 4LV6A 4WI1A 5D3QA 1ZQ9A 3CVUA 5CT6A 3K9NA 2VYCA 3FGOA 1ZAYA 2PNJA 1WOMA 3WX0A 3KVVA 4J2OA 2P9YA 2BVNA 2HO4A 2W6NA 3WNQA 3L6OO 3WB9A 2WMOB 3GC6A 2QLNA 3NCHA 2IYNA 4Q1DA 3QELB 3GJSA 4IX9A 3WC4A 4AMBA 1CIVA 2XMZA 2FRDC 3B48A 4GGPA 5CNIA 4BQPA 5DYYA 4E5DA 1SHTX 3T06B 4IWXA 3WLJA 2PL5A 1IXZA 1PNQA 4M1QA 1XQ9A 4CKEB 3EGIA 1KYXA 4NHOA 2CDCA 3L8ZA 4F92B 4CTOA 2O54A 1FE8A 1Z45A 3LBAA 5BR8B 4BVLA 3DOJA 1QO9A 4LOHA 2QD2A 3DCJA 5KKAA 2GEBA 3EAQA 4U6QA 2MSCB 3TLYA 1D1PA 3HDYA 4MJLA 3TSZA 3KOOA 3USES 3HVRA 4WJZA 1FP2A 4LJRA 2V7TA 4JXJA 3TNYA 2QTMA 5KNDA 1EWVA 1YTUA 3AR3A 2ZYHA 3KXDA 4BPBA 2HK8A 3NIWA 5B30A 1HZJA 3U9TA 1CF4A 1ARZA 1E1MA 1Z4KA 2PKQP 3THOA 3OZ7A 3KSUA 4P3NA 2XA1A 4JLPA 4S04A 1E6LA 3EZGA 4RMNA 1ZZEA 4E5MA 5DK4A 5IF3A 3MUFA 1H1LB 2J9RA 3GEBA 4JP8A 1ID8A 1TAUA 2PRSA 3Q41A 4PIMA 4Y0VA 5DBOA 3VV2A 3EB9A 3CUWA 3PA6A 4LIPD 4YJGB 3TZ6A 1VBMA 4AWAA 1E89A 1NXXA 3LCVB 3QJYA 3ANYB 5LOVA 3JWJA 2J6CA 2ZPUA 4K9DA 4K9LA 2XLCA 2OYSA 3LS2A 4K6MA 3ZU2A 5JZMA 3HTXA 5JXHA 1QU3A 3M4YA 4GNRA 2GZ3A 1FDTA 1CS0B 1HDGO 2B4RO 3H5VA 5CIWA 4Z4EA 3SCZA 1QF9A 2QRVA 4QU9A 1RJ9A 4DSOA 4CM1A 1UWVA 3H4TA 1OWNA 2WM2A 3VDMA 2AMFA 1WMSA 2ZSJA 3PXXA 4R1TA 1U0GA 4ACBA 3N28A 1JLSA 4M8NE 5K9ZA 1I7NA 1TZMA 1MV8A 1VJCA 2BWJA 4LOAA 4E11A 5LP6A 4ZZ1A 2PXHA 1UADA 4JYCA 2WYHA 3ZQJA 4O2LA 1UXOA 4EBFA 3QX3A 1BZYA 3KLNA 5CGQB 2WV7A 3ABZA 3NKFA 1IG0A 4D79A 4J6EA 4LSZA 1KAQA 1XVUA 1XB2A 1Z25A 4KQJA 5D85A 2PRYA 2CB9A 2ZVQX 1QS0B 2GUGA 5I3ZA 3U44B 2JFFA 1AKUA 2JIZD 4BKMA 3PHCA 3JD1A 4N8SA 1IN1A 3P5SA 1KYTA 2A5YB 1W2GA 4JBYA 3AEZA 3HKDB 4PRKA 3VZRA 1KRHA 2E9SA 4J0FA 4YRBA 2X1VA 2J33A 3D3WA 4J0CA 5AXBA 1JFSA 3E23A 4P5EA 1A9ZA 5K6TA 4AN0A 2JI6A 4OQNA 1NRWA 2W6MA 3MLEA 4F3YA 3PFKA 3ZEAA 2O8BB 3W3ZB 3MA0A 5J4HA 2ADFA 4C9BA 1MPTA 3KKEA 5CHEA 3R24A 5B3JA 2J5RA 4P4SA 4YH1A 3ZEIA 1G3IA 4Y7DA 1QYRA 2VPIA 4OJQA 3ZI0A 3SK0A 1JXQA 1AO3A 1BFUA 4ZYYA 3BQNB 4M46A 3ZJ5A 5EKUA 1IXKA 3CLTD 1W94A 1G21A 2GD1O 2VQSA 3DVSX 2C3PA 3R7FA 2D74A 1QHHB 1OT5A 3GJ4A 3GRRA 1SB9A 3RC8A 4BO9A 1T35A 2O5RA 1OX5A 3DMTA 1UQRA 1ZBQA 1R10A 1HEUA 2YWXA 1H0RA 3L0BA 6LDHA 1TUGA 4R1PA 4QHTA 1I9CA 3ND8A 3T6KA 3OCYA 4D6XA 4C4XA 4DM7A 2ZBPA 4NZPA 5DP2A 3DKPA 2QF7A 3EPRA 3O8OB 5AI4A 3LCUA 4KO3S 4OK5A 4F71A 3C6QA 3CF6R 1QQAA 5ALDA 3MWGA 3HBFA 4ITVA 1ENYA 4MMZB 4UEQA 4DILA 3W5BA 1LI5A 3Q2IA 5HTKA 3U1TA 3OZCA 1Q15A 2ZQ5A 2HO5A 3H6KA 3FPBA 1WVMA 3EOBI 4QPNA 1NBWB 4HXGA 3ZHCA 3CX3A 4BX0A 1P0CA 3ZBUA 1SMKA 1OTYA 4QHYA 4BZWA 1S2GA 1D5CA 2J9YB 4NZMA 4V02A 4MRRA 3H2ZA 2YW2A 2P0AA 3L1VA 4LQ4A 3QHQA 4H7HA 1D07A 3KJEA 4KW7A 4RZSA 3DVRX 4Y6LA 1P74A 1P45A 1VQ1A 2YHBA 3GVPA 3QLTA 3GLKA 1K3TA 2HPVA 3O3NB 5DCLA 2HYIC 1M2GA 3K30A 2PUEA 1Y6JA 2IZ1A 2Y0DA 2DTDA 3NPMA 4GE0A 4PZZA 3QMVA 5FPHA 3DOUA 5K3FA 3F5SA 3GK3A 4FOOA 4GR9A 4MWDA 4DCPA 2YYAA 3P97A 2A0XA 3L5OA 4JXKA 3TM4A 4US1R 1BGWA 3U0BA 4HX9A 4KO1S 2VK2A 3FWNA 1JYSA 3RSLA 3W6UA 2IH2A 1SUDA 3FPGA 4KYIB 1ONNA 3FM9A 3NTUA 4ND8A 1LLFA 1PJ2A 3QUAA 1Z6GA 4OG2A 4R4JA 1WP4A 3LUPA 4HDNA 3VSEA 1Z06A 4R1UA 3RF7A 1OHHD 3SZUA 3VDNB 4IWNA 5KOYA 1C2TA 1PL6A 2ZS9A 4Q4AA 4Z4GA 3G7NA 3UM9A 1IHXA 1FFGA 1RXEA 1VYHA 1N5OX 2XUIA 4O1IA 5DNWA 2BGRA 1UP6A 2QU7A 3DBRB 2W6ZA 2G9RA 4AF6A 4CODB 3KD3A 3UFXA 2WAMA 3H6GA 2JFUA 3GCXA 3WKDA 3JAKA 1K5PA 2O2XA 1G63A 3BGVA 1WPRA 3SHTA 4JKYA 2OP0A 3H5NA 4MUAA 4AG6A 2P69A 2HR1A 3LC1O 2F1RA 4I4CA 4L07A 1G6HA 1ISIA 1NBME 1A5ZA 2YMPA 3FUCA 1EP9A 1X3LA 5JZ9A 3VO9A 3OT5A 4H6WA 1OJLA 3DAPA 3QG5A 1DRKA 1Q0HA 1XN1A 2GBLC 1QCYA 1Z0KA 5AW2A 2B4YA 3ACCA 3DG9A 4IHKA 4M1OA 1NBMD 1ISJA 3AI7A 2BF7A 4M4SA 3LUGA 1SU7A 3KQLA 3RREA 3TG2A 2ATIA 3E9ZA 4CETA 4OXNA 3CVYA 2WTAA 4ND5A 1SIWA 3OZIA 3A1EA 1EVEA 4QUAA 5F77A 3CUKA 2IZ7A 3ZU3A 3WDKA 5B3AA 4M83A 3QEBZ 1KWGA 4UVGA 1A9YA 4AJ9A 4ZJUA 1XRMA 4JNKA 1Z83A 2BM0A 4ZU6X 5ITWA 2CFTA 2QXTA 2AXQA 1JX6A 2R00A 3FGZA 3HM9A 2QP4A 5JQGF 4KBFA 4QIHA 5A4FS 1P0QA 3R74A 4GU5A 4F93B 2E2WA 2BCGY 2GRJA 4Q9KA 4HQRA 3NC4A 3Q3VA 3ZD7A 1Z6ZA 1PT8A 4BWGA 5BV8A 4K6HA 4QQRA 3VDXA 4AWXA 1IBMB 1NUUA 3J7AC 1IHOA 1K2WA 2B8JA 1A9RA 4UOZA 4U2EA 3TM5A 1IEQA 4WCFB 4UQPA 4IICA 4XTRA 3ADDA 4QFDA 3T7CA 4BZXA 1RM4A 4ZI5A 1J00A 2V6JA 1PZMA 1PTJA 1HDYA 4NCBA 2OHJA 2PMDA 3VR6H 4OVKA 4PV7A 5F5NA 3T61A 1VLHA 5FWXA 3WXBA 1JFFA 1K0UA 4GGOA 1WUJS 2FSPA 4E6EA 4NBUA 1YHYA 1J39A 3EDMA 1Z5OA 2O8DB 5FUWA 3DCYA 1AKWA 3C3KA 3E4DA 2FZEA 4N8EA 1TW3A 3M9LA 1J24A 3OU2A 1Z74A 5H82A 4B3JA 2QG6A 3QWAA 4Q21A 2ILVA 3FOFC 1GGMA 3UMFA 3ONWA 4DCGA 5BMVB 3IDFA 3CUUA 4Y2JA 4DLXA 2P75A 2JJ1A 3N75A 3PIIA 3OZSA 5EWMA 4BIMA 1KGDA 2WG2A 1Z17A 3PZBA 1L8LA 5KYKA 3JVEA 1O54A 4EHDA 1CBUA 1X86B 2DHRA 1KBQA 2VRCD 4PHHA 4ETMA 1SUCA 2H8GA 2IX9A 3LVRE 3OHSX 1TKCA 1US8A 2D0DA 4KN6A 4P0TA 1RC8A 1Z4PX 2G25A 2WJPA 5EMLA 1GG2A 3WLOA 4KLCA 4JGBA 1I6KA 4AJPA 1G2IA 5A3RA 2NTNA 4H7PA 5ALOA 1Z0UA 3NEAA 5CVUA 3ZC3A 1N9ZA 3B1VA 2EAUA 3BWEA 4YP1A 2LPMA 4V3BA 3KQYA 4GRAA 3U7EB 1CUXA 1J0DA 4WXRA 5FNVF 3AEKA 1K89A 1S2LA 2WWWA 3RVSA 2NZJA 3T3GA 3WGMA 5IULC 1GR1A 1Q16A 2DBZA 3DZGA 4F46A 4LXIA 4EKIA 1CUBA 1T6ZA 2NU6B 2WPDA 4RPGA 4M76B 2ZAIA 1L7MA 2VDWB 4X1KA 1T0JB 1U6KA 2CJWA 3WWYA 5IHXA 4Z4IA 4BE7B 2ZP1A 3L79A 2DKFA 1LI4A 3COVA 3Q8XB 5J5CA 1QBKC 3HU2A 5LOVB 3ZD6A 3ZBTA 3GP8A 3ANNA 2CDNA 4HRVA 1RCUA 5HYVA 3HUDA 1BQ3A 4QL3A 5CB4A 1D1SA 3DFUA 3RGGA 4JP3A 1CE8A 4BNZA 1UOQA 2A88A 2AV6A 3IS3A 3IELA 4RABA 3ZXXA 1VMKA 1E4OA 3N2GB 2QXUA 3R0ZA 1PFGA 1NJ2A 3GLGB 2B7BA 2P3OA 1K8RA 2Y99A 2YRWA 4KH1A 5AJVB 1FCJA 4YMHA 1G4AE 1OH8A 2PSEA 4G4GA 4JQCA 3VI3B 1VLVA 5TQ0B 1JEQA 2QDXA 4V03A 3TLZA 3ZE0B 2OMKA 4JAVC 1N2CA 3ST7A 4EVRA 1PGNA 2AZ4A 3EAFA 2G0NA 3JWGA 3GLGE 5I9SA 3E70C 4Q93A 2GAOA 4QULA 4MW9A 1D7AA 3OZGA 2QV7A 5EGSA 4J0DA 2VNSA 5DCWA 5ICEA 2E4ZA 2MINB 3G0GA 3HR8A 1ONBA 1RWKA 3IHTA 2E6UX 1Z34A 2WU3A 3PPVA 2ZETA 3TGLA 2C3YA 3L0OA 4MUJA 1JQ5A 3UK1A 2WJVA 2QTHA 4NATA 2I66A 4RORA 4RHYA 4Y2SA 4MRAA 4ZTZB 1MO6A 1T9DA 4PLZA 1Z2NX 5JR3A 3RFVA 1VHWA 2HHAA 4GLJA 4MV8A 4B3SB 2CL7X 3N87A 1RJFA 4RHFA 4DCCA 2II6A 3Q4GA 5E38A 2WC1A 1I6WA 4LBWA 3RTGA 4F3NA 2BHTA 1U0HC 5I47A 1DKNA 2A1TS 4LHSA 4L76A 3K70B 2I7VA 2NT4A 3DT8A 3SC2B 1NAIA 2KX7A 2FKNA 1F48A 4I6GA 5BO5A 3B9QA 4QARA 3KAKA 1E3QA 1JDNA 3BMQB 4PWYA 1MJGA 1G8PA 3O4RA 3ANMA 3D59A 3WB2A 3RV3A 1TEZA 3W4JA 1PNOA 2G0AA 3KX2A 4JEUA 1DOAA 2ADOA 3WGQA 3QVTA 4F7DA 2G6BA 4Q9AA 4PXSA 1O94A 3W5UA 1XZGA 3SC3A 3UZUA 3EVTA 4BNDA 3BHMA 1F5SA 3FNFA 4FYVA 4C0QC 4RGVA 4WN9B 3QVGA 4BO5A 2CXOA 2DQKA 2QM8A 2JLRA 1HDRA 3O1IC 4FQ7A 4OO3A 4WAUA 2GCGA 1TYEB 4NZ9A 4DCJA 3G2NA 4KFRA 3THXB 5JI3E 1G8MA 2LXNA 5JJIA 2AQKA 8ABPA 3U1VA 1O08A 2FFQA 3E22A 1RPTA 2RK4A 4KFCA 4DG8A 2Q0XA 1KR2A 3HVKA 1LVGA 2BKVA 2QD4A 2IYRA 2PGOA 2WBLC 3C97A 5KDLA 5THXA 3PQ8A 1FTGA 1JPUA 1W35A 3SG0A 4QDOA 1A5SB 3GAMA 2OOKA 1DLIA 4YRFA 1OYYA 2AN3A 4EG6A 2ZB4A 2E4XA 5LD2C 3X0DA 4E08A 2AMLA 1KI1A 3NNNA 2VJAA 4EUFA 4P08A 3C6XA 2X0DA 4K1XA 3I32A 4I99A 3EWSA 3LFUA 4YY3B 3GH1A 1JH8A 2VTKA 3WQRA 4TZKA 1GARA 4DLUA 6ABPA 2QVYX 3UANA 2QD1A 3VH2A 5CFQA 1X1BA 3NONA 3ELUA 1A2QA 2X40A 4FIZA 5K0JA 1A1SA 2R751 5U4QA 3TFWA 2NZXA 1TLTA 4EYGA 1YRWA 5JY6A 5K6AC 3OLVA 4MB6A 1F14A 1HM5A 1DC8A 3GFVA 2HIAA 5AXCA 5I9BA 5KWVA 4P0PB 4M1YA 4Z6KA 2QN6A 4RANA 5FOVA 3CF2A 5E9AA 1OLSA 4QC2A 4EATA 1SKQA 1UPAA 4NG5A 2JAQA 4MQEB 1IB6A 4CN9A 3P9PA 5AI6A 3EVGA 4IIGA 1N78A 4F5WA 2VJYA 2ODEA 4LWZA 1HC7A 2YXNA 3WGHA 1HV8A 3EQZA 2Q3MA 4HI0E 4NDAA 4YAEA 1Q44A 2QAGC 4LVNA 3STUA 2ZSUA 5FI3A 4UNQA 1L7EA 4ZCLA 3Q10A 5HIJA 3WOHA 3GLIB 4CTJA 4B2IA 5LA6F 1GQYA 3UCFA 2BEVB 3HCEA 2XBMA 3TIXB 1YZKA 3DOOA 5HX7A 4YV2A 2KYRA 5C5CA 4HNQA 2C7OA 1GKYA 4I46A 4KQIA 4MVJA 4XGQA 5GONA 4BASA 3VAZA 4UPDA 3CMCO 1OSNA 3E7DA 1QCZA 2DUUA 5G40A 2HMYB 4ZDWA 5C1IA 1A3CA 3JZAA 3ZWMA 2XUHA 3AFMA 2B5OA 3DMGA 4YI5A 2PUGA 3Q0IA 2SCUB 3DEYX 5BN5B 1J2TA 2XRZA 2P30A 3GJTA 3GGOA 1R1DA 3AH8A 2OV6A 3MS4A 4F96A 4P3XA 5KNDD 3RUCA 2GPWA 1SVWA 5LYJA 4C6TB 1GWNA 3OJ0A 3OECA 3OKPA 4I1PA 3CW8X 2F67A 3TCXB 4NFHA 3WLFA 2V97A 2Q21A 4Q48A 3IKTA 2HJGA 4W9MC 3LT2A 2BKUA 4RWEA 1PR3A 1O4WA 1W4BA 3HZOA 3C3XA 1YS4A 1KJ8A 2ZWIA 4OJMX 3VX4A 3WFIA 1E18A 4EFMA 1RD4A 1N34B 2ALJA 2BH9A 3H4IA 1SKUA 1GSHA 1V95A 2V4MA 4YRPA 2XT9A 3W2EA 1FF9A 4D3SA 3EVCA 3WYFA 1A4UA 4O2BF 1FOEB 1B6SA 2R6HA 1JJIA 3X1DA 5BMOA 1C4WA 5LQNA 3WRYA 2E5LB 5K3AA 1U8AA 1VBKA 1ZIPA 4MR9A 2R1VA 3H5IA 4H15A 1N5DA 1MAAA 1VE9A 1WO8A 2RB5A 1U3DA 4UXIA 3EZ7A 4RK7A 3VVBA 3R1IA 4B09A 4R16A 3UHFA 3PE4A 4TMVA 2GEUA 1NLYA 4Q03A 2YFYA 1XKTA 3PGKA 5EZYA 2GHTA 4RIHA 3MWKA 3DEAA 5EZ6B 3L18A 1EX9A 4Q7JB 1Y9EA 1U8CB 2ZI5A 2DRIA 3GCGA 3ILXA 3Q3GE 2QE7D 4HQNA 5A5VA 5JAPA 4HP8A 4RTPA 1FZQA 5AHRA 4FB5A 4XWKA 1C4OA 3OU6A 3FPEA 4W9RA 2E85A 1U0LA 4O0MA 2NTEA 4PG6A 4YRGA 3ZW8A 1BE8A 4KPFC 3IT1A 3QVWA 1L4BA 5JW6A 2WUEA 2XVZA 1RLIA 3QNMA 4WLFA 3RK1A 1HOXA 3RJMA 3KQHA 2OUIA 2VNJA 5LQJA 1HDOA 1Z4NA 1EFKA 4O08A 3H5AA 5EL0A 3RBXA 4KFSA 4ZVOA 3GFOA 1GPUA 3IX7A 4HDMA 1ZH4A 2P2GA 5C9ZA 2ZRKA 3LZDA 2Q28A 4MUIA 1H2BA 1YB4A 5EWLA 2BIFA 1RFGE 5COBA 1HMPA 1NY6A 2HU2A 1JW9B 1NONA 2WWFA 3FNEA 2CNDA 3HBLA 2ZRJA 3K6JA 4O4LA 5T4HA 1F2TB 1YASA 5LZ9A 4GL2A 2QQ5A 5EQFA 1K08A 2C2OA 1KSHA 1C3XA 1E4YA 4TLEA 1ZEJA 5HGXA 1JQBA 3Q1KA 2HLHA 1BWQA 2BRUC 4OCZA 3M1AA 4KXNA 3ZV3A 4LRSB 2CNBA 1PYOA 1ABFA 4O4HA 2I91A 4JA0A 2AR7A 4P7KA 2JIMA 4ECAA 4JUAA 4PANA 1P9LA 2BUBA 5FFNA 5D3KA 5TQJA 2AKAB 1AE1A 3BEDA 4P86A 3QHAA 3NORA 2OAP1 1PNTA 1YONA 2C5FA 2QAIA 3GUUA 4P4TA 1FRFS 2BFBA 3SZLA 3FMVA 4OUKX 2EKQA 4JI0B 3GHHA 2IXBA 2JJMA 3DAHA 3B13B 3K4PA 4Q3NA 4ZANA 3CEHA 1A1VA 1DAPA 2QUZA 4ASUA 2Z6QA 2YZMA 4W1RA 1NIJA 4JNCA 2CVPA 3GN1A 5DLYA 5FOXA 2VA9A 2RSLA 3INYA 2LKDA 1QHYA 1LW6E 1SH7A 2BKAA 3ESQA 3GRPA 4XLLA 1BEZA 4YMLA 3LHIA 3R8XA 4C0AC 2CDBA 2I22A 2XVMA 4XUCA 3ICWA 4BB0A 1M7HA 1QJCA 2PY6A 5AK0A 2SBTA 4IDOA 2YHUA 4IIFA 4C14A 2GPNA 5DKFA 4C21A 1DIOB 2YS6A 3K72B 4PS1A 2I4MA 4D7AA 5C3MA 5KMGA 5A9SB 3LECA 4CG3A 2G9UA 4X95A 5FBQB 1PK7A 3RCBA 4TWBA 4JKIA 4B2LA 4ARZA 4IJKA 1Y3BE 4JN6B 3WICA 4OHCA 3CO0S 5CLHA 3I9LA 1NX9A 4EA7A 5CDSA 2FE1A 2PTGA 2G4VA 4I8XA 4LHXA 4Q19A 1G6OA 1R8YA 3U6BA 1QQ6A 4ZQGA 3B1JA 2OLJA 2OYRA 2WRZA 5DPMA 5AD1A 3R4VA 1RAHA 5CDHA 1AV7A 3OJLA 4M0UA 3E8SA 1NLFA 3RUHA 2DHCA 2B37A 3L8CA 3Q87B 4GXQA 3CC8A 1XMXA 4PN7A 4HPWA 1WZIA 1LDNA 4C87A 1X7YA 2JGDB 3IE0A 4HDKA 4M54A 2HF2A 2PKCA 2W4MA 2RHDA 3QYJA 3UQZA 1OTHA 1VMEA 4I1UA 3RPEA 2BW0A 3A3YA 1RC1A 1SOVA 3D7MA 3MZ0A 4OJTA 4KSCA 4OLAA 2WYUA 3W79A 2FMFA 5IS2A 1X15A 1S3FA 2WJGA 3SQNA 4ZCSA 4D46A 4AQ7A 2HU7A 4O2AA 5FA8A 5H80A 3A3NA 4C7KA 4E15A 4EFKA 2X2PA 1REQA 1N4DA 4KZKA 2MMGA 1OI7A 2R5FA 3AJRA 5SYMA 1ODIA 1OXBB 3F90A 1OBOA 2VQDA 3WNZA 3H8WA 3A6KA 5BT9A 2FZLA 3FR7A 1IEXA 3BA6A 1MB2A 1QIKA 2E5WA 1CZNA 2FFRA 2M6KA 1N7HA 3GMTA 3OU7A 1E5LA 1KMIY 1XYVA 4IXTA 5AJZA 4CMIB 1KPGA 2PSJA 3UXHA 1EFLA 2IPOA 4RSRA 2MR6A 4D97A 3QTTA 5D86A 1CUSA 1RXWA 3ICQB 2PNFA 1EJ2A 1GPLA 5CXUA 1ZAKA 2NX2A 1NL3A 2AN5A 3ESDA 1NATA 3FTEA 1N6RA 3D81A 3MBIA 5AM0A 1F9EA 1R9NA 2PUAA 4TS3A 5I51A 1CRPA 3PK0A 2EFYA 2QGNA 3JALB 2GN2A 3TI9A 4JLDA 2WHQA 4G1MB 1OFHA 3TKAA 3FAKA 2C00A 5LLDA 4G4IA 4OU5A 3LQ1A 3K9LA 1M2VB 1G3UA 4QPJC 1THMA 3A0UA 2PH1A 3TJZA 5FEMA 3QU7A 3C24A 4CEJB 3EEIA 2C03A 4QBFA 5A6VA 2G0TA 1MB4A 3DDOA 3RFXA 3SR0A 1DJOA 4NU6A 4QYXA 4ZCRA 1A8SA 4JLKA 2WE8A 4UNSA 3U13A 2ABWA 2WUVA 4HEA1 5CM9C 3L40A 4CQLA 4N48A 4NBLA 4UCQA 4QXRA 3W1VA 2I4OA 1Q0TA 1EBBA 1ODJA 2M6SA 1IIBA 2JAPA 4XOIA 4UHBA 2WTEA 2AW3A 3AI3A 2Z2KA 1YDWA 1RHKA 2O3UA 5TE9A 3DSRA 1GTJ1 4OI0A 2XMGA 3TNDA 4GECA 2VDUE 2C2XA 2G1PA 1NC1A 1P7WA 3N5CA 4JVLA 1N4AA 2QMUA 3HSSA 1E32A 1QCCA 4LRYA 4DG5A 5LDDC 3I4LA 4J03A 3TQFA 1C8BA 4KVGA 2JJ1D 2XADA 1EZ1A 4GYKA 1DV1A 1FRVA 1RABA 1I2AA 4L22A 1L5GB 5B1IA 1KXJA 5AJTA 3IBYA 4XPZA 5ALXA 5TEVA 3REQB 5J3JA 5ADUS 4PTYA 1H5NA 2V4ZA 1WCV1 4JU8A 2FK7A 5G41A 2GVNA 3HCDA 4BOYA 1KPHA 1UDAA 3ENVA 4GPAA 3WKAA 2EGHA 1J49A 4JLVA 4TX1A 3UAYA 5FLKA 3U3MA 3KCQA 2H18A 3AM5A 4L0QA 3AR9A 3EVDA 3VNAA 1G5TA 1QIMA 2FVYA 2WUFA 1GOTA 3K7EA 4C43A 2NXEA 5LZ7A 4NZYA 2AOTA 3ZHBA 1YJ8A 2ZYWX 3UWSA 3DYVA 3V2HA 5KYUA 3REFA 3Q6IA 2MYNA 1JMKC 4OXIA 4TS1A 2GZ2A 3KRTA 5LQSA 2JFVA 1ID1A 3NH9A 4M9XA 1H6DA 2AKYA 1RQRA 4DV3B 1F8UA 3ODPA 2GRAA 3R0VA 5B64A 1PR5A 1XZJA 3LTNC 1C3JA 3N0TA 5JH7B 3OMWA 5KWIA 3FCUB 4JVMA 1SVLA 1ZDMA 4O4IF 5IAEA 3RTAA 3V8NA 3WLSA 1FK8A 5FBLB 1NR7A 2V7UA 1UBEA 3ZXUB 3LLCA 2FRDA 2A78A 1Z2DA 2FFBA 1MZVA 4W5QA 2ZROA 4HB3A 2EW1A 2EX1A 2V8BA 4GVLA 3KD2A 1HBJA 3LC7O 4N76A 1ZW1A 4C01A 3N6VA 3BFXA 5EAIA 1N1GA 2VN8A 3A1FA 2ZI6A 3K1TA 4D74A 721PA 4RPHA 1UQUA 3IAS6 2N3ZA 3JQ7B 4KXYA 3U26A 4DAOA 1AGRA 4INOA 1T0PA 4DV7B 1QB8A 5G1NA 4XYBA 1I13A 3T0FA 4P22A 1OZFA 4YMVA 1CERA 4NZNA 4II2A 4CDMA 2FVXA 5IFLA 1P4GA 3OCZA 3GZ4A 1OV4A 3GQVA 2BGWA 1U4OA 2AG1A 4NX2A 2PS9A 1HZZC 2XPCA 5B53A 5A1JA 4RSGA 4GOND 4FMPA 2FN8A 3OOYA 1YR3A 4MEBA 2QQFA 2YJNA 3OUTA 1EGHA 5EUMA 2PO7A 2XQFA 3EPHA 3RVLA 4UE2A 4CF6A 4RA9A 3O8QA 4W63A 2H4HA 3WAKA 2DQSA 2OZLB 4KAXA 3W6OA 2AGVA 3HUFA 1L1FA 4OIMA 3V42A 3CLKA 3LL7A 1VMDA 3D8UA 4PW0A 3IR5A 3I6ZA 4FEGA 1N8NA 4F11A 3UG7A 1KDOA 4GOKA 5AKZA 2Q5JA 4WZZA 2HA2A 3FLAA 5EMKA 1GFSA 1KMHA 3IULA 4KRGA 3IE2A 1S7GA 2C9ZA 5J4LA 2BUCA 1I4OA 4M0EA 3V55A 5C81A 1SHJA 1Y0BA 2RIPA 2HLPA 4ER6A 4URVR 1BDHA 2A35A 3NBUA 4BUJA 1Y98A 4OMUA 2PKRA 4UCXA 5EE0A 4DHWA 5ISMA 4WOPA 4DA9A 1KP9A 3D7NA 1ELOA 5ERGB 1GDDA 4BVFA 4LJAA 3NJ8A 3AR6A 4A0SA 4KJZA 4OB8A 3NHWA 3TRFA 3JYLA 4HO1X 4OI1A 3WKBA 3TQCA 2H7XA 3FDIA 1A2KC 1CR6A 2FZWA 1JLHA 2D5BA 3A1VA 4IINA 3AF5A 1Y89A 3KR9A 4KGVA 4OP3A 4V2IA 5B1DA 1JHMA 1C3LA 3X1XA 5JAIA 1XMOB 3IRUA 1J22A 3HL4A 1ONOA 3P94A 1QP4A 3I5UA 5HMMA 3TLAA 4FONA 4F84A 2DFTA 1QMPA 3PQDA 4CFZA 1RAFA 5AOVA 4J2TA 1Y4DE 1NJ1A 1D5WA 2OMEA 3V6LA 3CRMA 3W8RA 2CYBA 2H5EA 3IUEA 2FZKA 2XCRB 1UEIA 1DRUA 3VZCA 1QMGA 3E6AA