3OPNA

The crystal structure of a putative hemolysin from lactococcus lactis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
209
structure length
208
Chain Sequence
KLRYVSRGGLKLEKALKEFHLEINGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAWKIRSDERVVVMEQFNFRNAVLADFEQGRPSFTSIDVSFISLDLILPPLYEILEKNGEVAALIKPQFEAGREQVGNGIIRDPKVHQMTIEKVLKTATQLGFSVKGLTFSPIKGGAGNVEFLVHLLKDGKAEIAQQVNIESVLQKESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative hemolysin
publication title The crystal structure of a putative hemolysin from Lactococcus lactis
rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Structural genomics, unknown function
total genus 67
structure length 208
sequence length 209
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3opnA00
4POOA 2YQZA 5GWXA 5F2OA 3ME5A 3NDJA 3A7DA 3SM3A 3M70A 3EVEA 1JTEA 2EJTA 4GOND 3OU6A 1HNNA 1SQGA 2ZZKA 5HFJA 1NBIA 4CTJA 2NP6A 3B3FA 1VL5A 1RI1A 4C4AA 3KQPA 1EIZA 3DR5A 4MQ4A 1JSXA 4OA5A 4PINA 3UA3A 4IV0A 3A26A 4AUKA 2CWWA 4FZVA 2BR4A 3THSA 3IHTA 2C7RA 5EZQA 3UZUA 2CMGA 2CMHA 2EG5A 5DM0A 3IYLW 3HCBA 3M6VA 2GAFA 4RV9A 2ONZA 4PYJA 3LKDA 5FTWA 2BM8A 1X1CA 1M6EX 3EVZA 1XXLA 1EG2A 1JR4A 3HNRA 4G56A 5CIYA 3OZTA 4M37A 4GOLD 3LBFA 3AWIA 1R74A 3P2EA 3UJ9A 1T43A 2NNWB 3MTEA 2UYCA 3KU1A 2OPBA 1KHHA 2PX8A 4XUCA 3DH0A 3I58A 2B78A 4GBED 3E8SA 3KQQA 5CD1A 1NV8A 3FTFA 4E70A 4C06A 4EMSA 4QVKA 1YB2A 3KQOA 3PFHA 3FUTA 3BWCA 5K0EA 3UJ8A 5EIWA 2ZWAA 3FUWA 1ZQ9A 3TM4A 1G55A 3C6MA 3FPEA 5FA5A 4Z2YA 4DQ0A 4PCAA 2AOXA 3TKYA 2PWPA 4M38A 1SUIA 1L3CA 4BLWA 4E30A 3MGGA 2ZLBA 3B5IA 2IBSA 4L7VA 2IDKA 4PGHA 3T7TA 2H00A 2PGXA 3EGEA 4MIKA 5DM4A 4CWAA 5P8WA 1XCLA 4KDRA 2Z6UA 3K0BA 3C0KA 3R6TA 3EGVA 5DSXA 5E8JA 1P1BA 2OKCA 3T7SA 4YUYA 5LQCA 3MB5A 3OE4A 1AQJA 2QYOA 1BC5A 5DM2A 5D1HA 3IEIA 2IPXA 2YX1A 3HEMA 1XJ5A 4RVHA 4CTKA 2PY6A 2JH9A 5CVDA 2YXDA 4PIMA 4AX8A 3HM2A 4FP9A 3G8BA 2OY0A 4LG1A 3TOSA 3OE5A 4RYLA 3P9KA 2ZVJA 3G2PA 3LHDA 1NBHA 3PS9A 4LWOA 1FBNA 3THRA 3U81A 5K0JA 3CJTA 4YUVA 3DMFA 3EMDA 1DL5A 4WXHA 3K6RA 3MCZA 3QOXA 5F2NA 3AY0A 4IKPA 3GDHA 1EAMA 1YZ3A 1G6Q1 2NXCA 4OQDA 5E1MA 4E32A 1QAOA 5K0BA 1FJXA 2FK8A 1DUSA 5JUWA 2JHAA 1VQ1A 3BGDA 4ISCA 2E5WA 4QPPA 2BZGA 2Z6QA 7MHTA 4OBWA 3TM5A 1R00A 4P58A 4A6EA 3F4KA 1M0EA 2Y1XA 4PIPA 5GIOE 2PT6A 4YMGA 2XYQA 3FPJA 1D2CA 3B7PA 3HVIA 2OZVA 5ICEA 3HA7A 3ORHA 1WS6A 2O06A 3E7PA 3KKZA 4P7KA 2Z6AA 5DWQA 3UA4A 1R6AA 4PYIA 3HVHA 2IH4A 3RIEA 3UJCA 2P3LA 5LQUA 3MERA 3MHTA 5DLYA 2I9KA 4YUWA 2IIPA 3TRKA 1SVUA 2FK7A 3GRRA 4FSDA 4JXJA 5E9WA 2BR5A 1R8XA 2P8JA 1FP2A 3LCUA 5HOQA 3SMQA 1ZHFA 3HP7A 1NV9A 1D2GA 4P7FA 2AN4A 4RTQA 4GC9A 3QV2A 3NVKI 2PWYA 4QQKA 3NW9A 4ER6A 2ONYA 3I53A 10MHA 2P35A 2N47A 5EMMA 3VC2A 3FPGA 1R18A 5LQRA 1QZZA 2V7EA 3P71T 5EQJB 4GF5A 3OFKA 3RODA 4BP3A 4RX1A 3NJRA 4X1OA 3BXOA 5K03A 2AN3A 2XBMA 1HMYA 1X19A 2YUIA 5EOVA 2VP3A 2FCAA 4CKEA 4DA4A 1VLMA 4PYKA 1L1EA 3S68A 2G8NA 3UWPA 3FUUA 4HH4A 2P7IA 3VYWA 4O29A 5EIFA 2WK1A 1F3LA 2AVNA 2QM3A 1KPHA 3PB3A 3OZSA 4OA8A 2AZTA 5GINE 2IDJA 1EJ6A 2ERCA 2H1RA 4X60A 2F8LA 3OCJA 5E9JA 4B17A 3P2KA 3HVKA 3ID6C 3SX0A 3BGVA 2JH8A 5K0GA 1ZG3A 1VBFA 3JWHA 2P7HA 4CKBA 1RJGA 4E2XA 4ER5A 4R6XA 3DXZA 4PYQA 2O0LA 2C7OA 2B2CA 3V97A 3HCAA 3EGIA 2PX5A 3SR4A 3GJYA 4YUXA 2OO3A 4PNEA 5FWAA 1JG4A 2A14A 3I5UA 4FT2A 2YTZA 3R9XB 3LGAA 2G71A 4QPNA 4DMGA 4EK9A 2C7QA 3T0IA 3EVCA 2AVDA 1RI2A 5CVEA 2IH2A 1XVAA 4PONA 3FRHA 4PGGA 1YF3A 5DT2A 2PBFA 3O7WA 1JTFA 5FULA 3KR1A 5C9ZA 5M5BA 1EJ0A 5T64A 5DX1A 1NKVA 2K4MA 3REOA 4RTLA 5KS2A 2O57A 5CCXA 5BXYA 3PX3A 4RVDA 5HZMA 1BKYA 3I64A 4V0RA 5EGSA 2PXAA 4GOMD 4EVIA 2G72A 5KQSA 3GO4A 3CCFA 5K8VA 3LECA 4KIGA 1ORIA 3DOUA 2BH2A 1MJFA 4LWPA 2BR3A 3HCCA 2ZIEA 1XDZA 1JQ3A 2FPOA 1B42A 5EPEA 4QTUB 2DULA 3C3PA 1N7JA 2ZBQA 3UBTA 5CM2Z 3ERCA 2GA9A 3PLAE 5EKUA 5ICCA 4WVLA 5E1BA 2VDVE 1RJEA 3CJQA 3P2IA 3M6XA 3A4TA 3KQTA 1JQDA 2FHPA 3CKKA 1WXWA 4AZVA 5LQKA 3BGIA 1AQIA 2AOUA 1EQAA 3I9FA 2G70A 5GP1A 1I9GA 3FYDA 2YR0A 3LCCA 5DTRA 3BWBA 3EEYA 3LKZA 1QYRA 3X0DA 4RTNA 1KXZA 3KPUA 5DXJA 4KW7A 4OX9Y 1O9GA 1RJFA 2GS9A 3C3YA 2ZIGA 4FS8A 1ZGAA 3R0QA 4U7PB 4QVGA 4ZTBA 3EVDA 2QE6A 2XVMA 5DM1A 2HWKA 4C04A 1KP9A 3HA3A 3G5LA 3C6KA 1XTPA 1KIAA 3DTNA 1SG9A 3LSTA 2HV9A 3NMUF 3LX6A 3HA5A 1X1AA 1G8AA 1QAMA 4EKGA 3T7RA 5K01A 3BKXA 2HMYB 1WY7A 3KQVA 4RVGA 4F84A 2XVAA 2P3OA 1ZKDA 4YV2A 3BKWA 4BY9E 3FPFA 1TW3A 1KPGA 1FP1D 1WXXA 1WZNA 2H11A 1P39A 3FYCA 1L9KA 1G60A 3DULA 5C1IA 2HR1A 1NW5A 4R8RA 2I6GA 2GPYA 3KR0A 4HTFA 3ELYA 4ER0A 5LSAA 5FADA 1JQEA 4XUDA 4E31A 3B3JA 1JG2A 3R3HA 2GH1A 3MCTA 5E2AA 4C08A 1YFLA 2IH5A 3FTEA 1XCJA 2LD4A 3P9IA 4RTKA 3O4FA 2AOUB 3A25A 2YXLA 4YMHA 3LCVB 4AZWA 2PLWA 1I4WA 2IFTA 2WA2A 2O05A 1D2HA 3CC8A 2ZBPA 1IXKA 4PWYA 4IV8A 1BHJA 5EKXA 2V74B 4OBXA 2B9EA 2GLUA 5DPMA 4M36A 4Y30A 5LQAA 1YFJA 4KWCA 3ANXA 3M33A 4XUEA 4PYLA 2B25A 2IBTA 1INLA 1G8SA 1N7IA 5GM1A 1M6YA 4ER7A 2I62A 3KQMA 3TLJA 4GEKA 3QOWA 4E33A 3KPVA 2AN5A 2JHCA 3M6WA 3LPMA 3TKAA 2Q41A 5EEGA 5BP7A 1DCTA 1H1DA 4PYOA 5FQOA 1U2ZA 2PXXA 3ER9A 1Q0TA 4PYNA 5E1DA 4EKIA 5U4XA 3NTVA 3UJ7A 1WG8A 3VSEA 2JG3A 3HCDA 1NT2A 3KQYA 4PYMA 5FA8A 3ER8A 5K0FA 3A7EA 3LDFA 2GB4A 4NECA 4PCLA 2PSSA 3FRIA 2IP2A 5GM2A 3NWEA 5CVVA 4RTOA 3DP7A 4MTLA 3B89A 5EMKA 4YUZA 3E05A 3OFJA 3TR6A 4YV0A 1O9HA 1PRYA 4HTFB 2OXTA 4YV1A 3Q7EA 4QDJA 3P97A 5HILA 5F2KA 3GCZA 5FUBA 1R8YA 1Y8CA 2P41A 4U7TB 2VZ9A 4HRAA 4X41A 5E9QA 5K0LA 5T67A 2CL5A 3AXSA 4F85A 1QANA 5ERGB 1X1BA 3NDIA 1VE3A 2EX4A 5BW5A 3JWJA 3ELWA 3KPYA 4C03A 3BWMA 3CVOA 4RWZA 5CCBA 1V39A 3GIWA 1VP3A 3R24A 5EVJA 3TFWA 5FHQA 1G38A 3HTXA 2ZTHA 3EVFA 2O07A 3GWZA 4QTTB 3G5TA 5GOZA 5HIJA 3VC1A 5E1OA 5C0OE 3EVBA 4RTSA 4LECA 2AOVA 5LQJA 1SUSA 1AV6A 2DPMA 2OB2A 2Y1WA 4HGYA 3TMAA 3TPZA 4RVFA 1SQFA 2ZZMA 3LBYA 1UFKA 3BZBA 4P7GA 3MAGA 4E2YA 4QDKA 4FR0A 3P8ZA 3UJAA 2EFJA 4C07A 3FUXA 9MHTA 3FPHA 5FHRA 5LQNA 4E2WA 1N2XA 3CBGA 3SSOA 5HIMA 3LDGA 1KR5A 2PT9A 5K0CA 4QQNA 2WA1A 1RJDA 5KVAA 3G88A 3FTDA 3DMGA 1Q0SA 2OBFA 3IV6A 3Q87B 5CUQA 5HIIA 4DCGA 2ZCJA 4RTRA 2AOWA 3PT9A 2HTEA 1RI4A 3DXYA 4K6MA 5LR6A 2P1DA 3SSNA 5IH3A 1OR8A 3G2QA 3NVMB 4P7JA 4R05A 4RTMA 1X1DA 5DTMA 3G8AA 2QRVA 4FSXA 4MHTA 5EHIA 3ELDA 3AXTA 4R8SA 1NW6A 3KHKA 1UIRA 3DMHA 3PFGA 2EJUA 5B1SA 5ICFA 5JR3A 3UJDA 4RTJA 2R3SA 3G2OA 3NWBA 2NXJA 2PXCA 3UJ6A 2YXEA 5DRTA 2AOTA 2VS1A 1KYZA 2OYRA 5ICGA 5K09A 2NXNA 2ZBRA 3P9CA 4HC4A 5IKMA 3AJDA 5EMLA 2VDUE 3DXXA 3HCEA 2PV0A 3MTIA 5E8RA 5HIKA 1JG3A 3RW9A 1MHTA 2ZSUA 1VPTA 3FUVA 1VIDA 3DLIA 1IM8A 4EQZA 1ORHA 3D2LA 4A6DA 3G2MA 1SKMA 3SXJA 4CXMA 2PKWA 2PX4A 1YUBA 1ZGJA 1FPQA 4OQEA 3JWIA 5EHGA 4AZSA 3GNLA 1L3BA 2PJDA 5H02A 4CKCA 5DRYA 5GIPE 2UYQA 5EG5A 2UYOA 3BWYA 3UJBA 2IGTA 3OPNA 1KPIA 4GUAA 3MQ2A 4X63A 4DKJA 3ELUA 4RTPA 3PTAA 2P40A 2ESRA 1JG1A 3EPPA 5G02A 1NW3A 3L8DA 4HSGA 3KQSA 5CVUA 3SVZA 2PX2A 2JHPA 1NE2A 2ADMA 4Y2HA 3UFBA 3HCFA 4BLVA 2C7PA 2QRVB 1BOOA 2HNKA 2NYUA 2ZULA 1NW8A 4X61A 3G89A 3SGLA 4F86A 1I1NA 2ZIFA 1P1CA 4GQBA 5E2BA 5K0NA 2ZWVA 5K05A 2FRXA 4MWZA 2G1PA 3KPWA 1XDUA 4GC5A 3GRYA 2PVCA 3DUWA 4GOOD 3A27A 4FT4A 8MHTA 2AOTB 2VDWA 4KIFA 4KDCA 5D1NA 4FGZA 4DZRA 1XDSA 1TPYA 3E23A 4HG2A 1Z3CA 3WSTA 2NXEA 1VP9A 2BM9A 3O31A 2ZW9A 1AF7A 5FQNA 4DM3A 4M7RA 2XYRA 4BLUA 2UYHA 5EEHA 5FWDA 3V8VA 1YZHA 3EVGA 4DCMA 2UZ4A 4V0QA 1RI5A 2ZZNA 2ORED 4UOEA 5EZSA 1P91A 3GGDA 2CKDA 4HGZA 4DF3A 3PX2A 1PJZA 3BUSA 3DLCA 3CJRA 5KQRA 4KRGA 3JWGA 4AZTA 4H0NA 3EMBA 2NP7A 5DX0A 3BT7A 5MHTA 2AS0A 1KYWA 3SSMA 1IY9A 3P9NA 1F38A 3HVJA 1NW7A 4IWNA 3H2BA 1O54A 2R6ZA 3GU3A 3EVAA 5T6BA 2B3TA 2XYVA 3M4XA 2AR0A 2OB1A 3B3GA 3KR2A 5CVJA 5DTQA 2P3QA 4C05A 3EEOA 4BP1A 5DSTA 3M6UA 5EC8A 3KR9A 2JJQA 3G7UA 4ATNA 4E2ZA 5HEKA 1RI3A 2FYTA 3OU7A 2ZFUA 3PVCA 1JSZA 3GRZA 4RSRA 1UWVA 5BW4A 1QAQA 5KYGA 5DXAA 2YVLA 3FZGA 2I7CA 3GRUA 3OU2A 5EMJA 4ER3A 2QY6A 4XCXA 3OZRA 3KPJA 3TQSA 4KVZA 3FTCA 5FCDA 1TW2A 3LL7A 2KW5A 3KQWA 3GRVA 3LDUA 3GXOA 5DX8A 1L3IA 3CGGA 4R6WA
chains in the Genus database with same CATH superfamily
1YSCA 3Q9LA 4I4TA 4CQLB 3CX4A 2H5EA 3BJMA 1KQ3A 3NDJA 5JDCA 1A4RA 2V0GA 3MZ0A 3EVEA 1UZAA 1QOPB 4P3KA 2PHZA 2ZDGA 1PNRA 5IRCD 1Y34E 1C80A 1P2SA 1TM5E 1PNQA 1HRDA 3D4PA 3H5IA 1UJMA 1OY1A 1VGVA 4FYJA 4J9UE 4B0OA 3ND9A 1Y3BE 4IV0A 2G7MC 2BR4A 4F3YA 1Y48E 1GZHB 1U2GC 2PYZA 1TA0A 3LA6A 4JUDX 1E2BA 2F3RA 1NF9A 1W25A 3IVRA 5A0FA 1KFKB 2Y1GA 5AW0A 3TQTA 5CXUA 3NIBA 1IN1A 1D2NA 1PJRA 3ZE0B 2ZIZA 1V3TA 3KIPA 3LKDA 2MYTA 4S0ZA 1M6EX 4EUNA 4HXFB 2OXRA 1U0NA 1YKSA 2XD9A 3L92A 4IYJA 3SIRA 3W79A 2GCGA 3ZE9A 3L9XA 2W4IA 3ZHZA 4X5OA 2R8YA 1GKKA 2DCUA 3AWIA 2QTAA 3IX7A 5DOZA 4A92A 3QLUA 2VJDA 1O6ZA 2H48A 3W3AD 2XXJA 1AXRA 4N5IX 1JT2A 2EDAA 2EOAA 3O0DA 4YPVA 1PL6A 1GTL1 2O7SA 1ADFA 4QU8A 3R7BA 1RE0A 1VFPA 3EFOB 4MPDA 4URXR 5A62A 3BE5A 4I6EA 4EA9A 1PR9A 1QHFA 1XNHA 3OEHA 2FPPB 4ZVOA 4K26A 3KOOA 1DBSA 2AGVA 4WJLA 4UFNA 2WM2A 3AQ4A 4WKBA 4NOKA 4ZEWA 5NULA 5JOQA 2D3WA 2I6XA 3T5CA 4LX0A 2XRZA 5CLLA 3D8TA 3DO8A 1Y0BA 2O1SA 4HNSA 3GEDA 3MAJA 5AI0A 3W78A 3VU8A 4XB6B 1H8HA 1EPUA 4HV4A 1N5RA 4J90A 1YU9A 3NUQA 4QG7A 2PJUA 2J8ZA 3K0BA 3PD1A 4GYKA 5JALA 2RHGB 5FPYA 4EYGA 1ZJZA 1VBNA 1Y1LA 2WNSA 2VPZA 2WI8A 4D82A 1FXWF 3OJLA 3WLEA 1Q6YA 5EJ4A 1ZSVA 5CEFA 1HE2A 5JZVA 2OCLA 2YYSA 2R8XA 4UFPA 2XMPA 4OJMX 3WK6A 1KOJA 3L0PA 3URMA 3V48A 2X22A 3R0XA 3TUIC 3ILHA 4KO3S 4FPXA 4HPJB 4GXNA 2EQ5A 3P9YA 4FGUA 5EP3A 4EEZA 5JO0A 4WESB 3LL4A 2R65A 2ZB3A 4DR4B 2OLEA 1DG3A 1O58A 4COOA 5DLQC 4CZ2A 2ZSBA 4UUBA 3NHBA 4HGQA 3QOXA 4FNGA 4IRXA 4UJ3A 4HLUA 4CUZA 1W52X 4AO8A 1W5SA 2GZMA 3GJ7A 4NAUA 4LZOA 1BAPA 4ZVMA 2GPBA 4REQB 4DV2B 1Z38A 1Q91A 4OFXA 2BZGA 2FEKA 3DBLA 5AW7A 2IKQA 2C95A 4KH1A 4PZZA 1YZGA 2I6UA 3V8RA 4A6EA 4F2WA 1X80B 5KWSA 1M0EA 2WAMA 4PS0A 1E20A 4IHKA 3JY6A 3LPAA 3VPHA 4EI7A 5AOAA 1QGZA 4K9DA 2G1AA 5BN1A 2GEDA 1Y9AA 3QNMA 4OTZA 1PF7E 3LU1A 4N0PA 2OFFA 2V4MA 2ZXEA 4BEJA 2HHHB 4GICA 1BXRA 1JHOA 1R4NA 1VJTA 4BMZA 4R84A 2KYRA 1KQNA 3B8EA 2GETA 3TIFA 4UD2A 4TN5A 4WEQA 4YAKA 4NFSA 4FFWA 1GN8A 1M2HA 1WVIA 2P9CA 4G84A 4KQKA 3JATB 4JMLA 4MKZA 4NDNE 4ZD6A 5TEWA 4BLRA 2JC3A 4E5PA 1GLNA 2RHCA 4GC9A 3QV2A 3R9XA 2ECKA 2EJCA 3JRWA 3NW9A 3IQHX 4PZPA 4WY8A 3KP1A 1N5OX 1Q0PA 1X1QA 2ONYA 2RJ3A 2N47A 3HUUA 1RQNA 4BLTA 1MX9A 4F5ZA 5LQMA 2P1ZA 5D5QA 4D80A 5C52B 2AW5A 3SEFA 4FZ3A 1TCVA 2BFFA 3PWZA 4MVJI 1XHLA 1RJ9A 1EK1A 1OWMA 1L9XA 4PG5A 4RX1A 4P3OA 1GR1A 3BIXA 2AN3A 4XLTA 5BNTA 3DGFC 3S1AB 1JFLA 4GQIA 4WKGA 5E9AA 5KX5A 1VHQA 1X42A 3L41A 3JD2A 1PQUA 1IE3A 3UWPA 3ZI7A 5A5GA 3NT2A 5HQTA 1N6IA 4GWGA 2D7DA 2KI5A 1SOUA 3AR6A 1P29A 3L46A 3JAWB 1TGVA 4L50A 1R6UA 4D9NA 1VKRA 1HDYA 1Z6XA 4KAXA 3OO0A 5JISA 3OZDA 3W6OA 3U7HB 1L7BA 3O47A 1YONA 4UVGA 1DCMA 4ECEA 5BT8A 3GLFA 3QU9A 5A2GA 4UCFA 2V0NA 4YRFA 1CUJA 3K1TA 1KERA 3WOHA 4RIHA 1JIIA 1GT6A 4UW9A 3G85A 4ZP1A 2H2DA 1VKZA 2LIPA 2N46A 2YTZA 4J91A 3DWGA 1H05A 4I5GA 2C8VA 1V37A 2CLDX 5AVRA 1DKNA 5EIHA 1OWNA 2H5JA 2RJOA 3JQRA 4KR6A 2GEKA 2OT3B 3F0TA 3RSOA 5D51S 2BMDA 4KO1S 3RKUA 3PUYA 4R9NA 3C3AA 1IATA 3KJFA 3QA3E 3BDIA 4HDKB 1TFUA 1LPMA 2BF7A 1W0CA 2D54A 2GJSA 1XZEA 4D9FA 3V1MA 2DR0A 4Y6QA 1X0VA 3DL0A 3JQ7A 2WWXA 2V45A 4JU8A 1R8QA 3DMTA 3OPQA 4QGFA 4RKYA 2RHHA 3CPEA 3BCRA 4Y2SA 2ZRAA 4ZI5A 2PZGA 3II6X 5E7IA 4Q7QA 1MJFA 4ZAVA 2XSZD 4QUKA 1QG0A 2J0SA 1P1FA 4MQUA 2BLLA 4GAEA 2J9XB 1QJ4A 4D9GA 3UK1A 5C7IO 3JYOA 5C7LO 1W4LA 2GZ2A 4TXLA 1W4CA 2CMKA 1Q92A 4NOJA 4DR7B 3INGA 4JYZA 2NO9A 1G3RA 4N5NA 4CCAA 1JQDA 3EMVA 3V6MA 3RSCA 1Z8DA 2MU1A 2R1UA 5DE3A 1UQRA 4BEVA 4IQFA 4P2BA 2A5DA 3M83A 4KN6A 3TRIA 3A9RA 3OX3A 3EB9A 1HLDA 5A9SB 1F48A 3DONA 3UAXA 1O95A 1B6GA 5F64A 4F12A 1B6RA 3GP8A 4ZK2A 1TA9A 1G5QA 2WG2A 4ZTZB 3VDMA 2XVMA 4MHOA 3HJNA 4M9XA 4PAOA 4UEOA 3HA3A 5HCIA 5HM6A 3C6KA 3GMSA 4YUAA 2WM9B 1SG9A 4M4SA 3SLKA 4A03A 2A9PA 3NMUF 2XZPA 4EUKA 3EAGA 3N5CA 4FZJA 2CC2A 1G8AA 2R6AA 2ZUVA 3NHUA 4EKGA 5L95A 2R1VA 1T2DA 4KNVA 2AFIA 3G23A 2ERYA 3P2OA 1X14A 4Q12A 3QE0A 3AR3A 1VCOA 1XZIA 2WWRA 6Q21A 1UJ6A 3NLLA 5FUXA 4JVNA 3RGGA 3BKWA 3R6DA 1GCOA 5FBQB 4CDGA 4D74A 4D57A 4DG8A 1VL0A 2X2PA 1YRWA 1P39A 2ODTX 3JYHA 4IF4A 3QQPA 3VUEA 4BMNA 2VOJA 1DARA 1UFVA 3K0EA 1OI3A 1ZESA 5GV7A 4DR3B 4ER0A 1ZOPA 3C8DA 4LJ6A 4QQRA 3T3HA 3TOCA 1XA0A 1ZFNA 3D6NB 2X4IA 4KWIA 3ZNPA 1OX4A 1DELA 4ZVLA 2CUNA 5CITA 4KKXB 1U9ZA 4UCQA 5I9BA 5I7OA 4PC1A 4GLOA 3WDLA 4PWYA 5DOVA 5JXWA 1GGKA 1ZGCA 3CC8A 3C3DA 4PZEA 1G3MA 2OORC 1K7XB 5LZ8A 4M36A 4FMDB 2HFKA 3ZW7A 1VL8A 3ZD6A 5C5IA 4D3XA 1J20A 2AD1A 1C1DB 1WF6A 3F4LA 3KPVA 3I05A 2Y4NA 2Z2ZA 5EZYA 3WWCA 2NO7A 1FF9A 2XRMA 3OTQA 2FN7A 3B3AA 3H42B 5PGMA 5FQOA 3AVUA 5NLLA 4QGAA 2XE6A 3WLKX 2W8BB 3FSGA 5BRJA 1JPNA 3TE7A 3NJ8A 4QG3A 4ZMRA 2J3KA 2I6QA 4N40A 5TDHA 5T4HA 3AETB 3D8HA 1EP9A 3AF2A 2CFCA 2JFGA 2QMOA 2OYCA 5KNCH 2CD7A 2JH3A 4MJ7A 1XMQB 2WYIA 2W4QA 3A9CA 3Q5DA 4DFDA 2W2TA 2UZAA 3AHEA 3VPXA 4RTOA 3I04M 3P0RA 3U13A 1X87A 5IASA 3S4YA 4KX3A 1VKOA 2EW8A 4PRLA 4S04A 4IO0A 1QCDA 4BCCA 5B2EA 4YV1A 4R54A 3A1NA 1N57A 1ICEA 2FQXA 2VUSA 2P79A 4TWBA 1QANA 1Y1PA 1X1BA 2BUAA 1W29A 4J2TA 2KLBA 4YGYA 5KU7A 1EZ4A 1R0XA 1OF1A 2WSIA 5D3MA 5ED4A 2RD2A 1CFJA 2JIQA 2WHPA 2HXSA 1DQZA 1BVYF 4K9SA 5IULC 1M7GA 5AW6A 5EVJA 1Y6FA 5IC5A 5B55A 4A8JA 1FC0A 3I6ZA 4J4TA 4F46A 1FX0A 3TRDA 4BO2A 2Q6TA 2DY1A 4CDMA 4C0XA 2DPMA 3WZMA 3AFNA 2O2GA 3TMAA 2ZVQX 2JIZD 3E9YA 4O4IF 5AM4A 3DBRB 3WSTA 1HDIA 3DOIA 1DIAA 5F1KA 1H94A 5LQNA 1Z8FA 1FVFA 4JT4A 3QEMB 2X4GA 5EKTA 1DU4A 4WOBA 5ED0A 1GQRA 2H31A 3TZ6A 3Q3EA 3P0EA 3PUZA 2X3YA 2WA1A 1N6OA 2ZTVA 3PRJA 3OQJA 1SQ5A 1SU8A 3CRZA 2AJCA 4GU5A 4OB7A 3FTDA 4W8GA 1VE6A 5KVAA 2I34A 4HO1X 2VN8A 4IKEA 4F1KA 4BVAA 4F5WA 3WZ2A 4RXMA 3DXYA 5A0VA 5JMPA 1A2QA 2HPVA 4JC0A 1ZMBA 5D84A 3LOQA 3EEIA 4UPEA 3T5BA 2HW8A 3G2QA 3NVMB 4R05A 2JIPA 4Y0AA 3P9SA 1TJ5A 2J48A 1ULAA 1U8CB 4ZV4A 4ZAGA 1YJQA 2RI0A 3H9QA 4PZAA 4IDEA 4F60A 4LBZA 2EJUA 4XCVA 1SA0B 3KL2A 4I1RA 5ULLA 1TO2E 2D7JA 2TMKA 3KYCB 2BSQA 2F3UA 2YXEA 3FWZA 2C0CA 4X90A 4PFJA 4X1IA 3F1KA 3AT1A 4PQGA 5DTIA 1E98A 3P9CA 4NBLA 3TB4A 3HCEA 4HX2A 5ALLA 4M2LA 3VHXA 2PKCA 5FLEX 5HZKA 5HFAA 1OE0A 1KTVA 1SVWA 3YASA 1QH1B 5JPIA 4JITA 1ORHA 1T8SA 5ALNA 4F04A 4KP7A 5DYGA 1A4XA 1TU4A 1ZNZA 2OQRA 3ACBA 1B26A 3R23A 1I01A 4TUYA 4WXPA 4Y2PA 1Z4NA 3HR7A 5IT4A 1GCGA 1Z5UA 2X9VA 2Z43A 3DTYA 4NATA 4NCJA 4K05A 5AUNB 3VKGA 4JLJA 1O5IA 1S8NA 1XDBA 4LKOA 3BWYA 4R9SA 3ZTWA 5EXTA 3VI3B 4AJOA 1I14A 1YE8A 4KQEA 3WLLA 3SZGA 4Y2GA 3GFGA 3UPTA 4GRIA 3W6PA 4D97A 4AP6A 2UZ0A 5CA0B 2IYZA 4KGDA 4PQYA 1C8VB 3A10A 2D2XA 4TKUB 3DAHA 4TRRA 2VDPB 4BLVA 1ISSA 4ETNA 3ZCRA 1BOOA 1R6DA 4RY9A 2BBOA 1I6KA 3SXUB 2EG9A 3QNWA 1ZY2A 4GYWA 5K3FA 3VH4A 2I2CA 2H5LA 1CK4A 2GILA 3IUSA 2IEZA 1EUZA 3VU3A 5JCJD 3EPJA 1YB7A 2CLKB 2IVZA 4ZVUA 5JJIA 3N3BC 1FW8A 3IDSA 4KDCA 1ZUWA 3E23A 3ZI0A 1D6JA 2X1MA 4DZRA 3WGIA 1R0KA 2HNAA 1LDGA 3QU7A 1TM4E 3KU4A 3SF8B 2ZI6A 3GDGA 2EL7A 4LDZA 1R37A 1OC4A 1SGWA 1XZFA 2BFDA 2HA4A 1WABA 4QUBA 2O7NA 3Q2KA 4YROA 4B48A 2OLJA 2Q2QA 2WYUA 2WB4A 5EZSA 3ROEA 1NOIA 4HDRA 4OD0A 5EN4A 3SQDA 4MS3A 1ZI9A 3VUFA 3A4LA 2IIBA 2QY9A 2RIRA 2WE8A 3PUHA 1HA3A 5FPQA 4ZYVA 3U56A 4MVJE 1LTHR 3H7AA 3DW1X 4H0NA 4CKCB 3DV0B 2AS0A 4BRZA 1I7QB 1UPUA 1GQ2A 3EARA 4M0DA 2GM4A 4FE7A 4GT1A 4KYVA 3SHFA 3HVJA 3CTPA 4AG6A 3QU2A 4DLZA 2B3TA 4N6OA 1ZQ1A 1X38A 3SAJA 3LHFA 3EGXA 3D9QX 3I92A 2HSDA 2X8AA 1N6NA 4UUPA 2CHEA 5LMNB 4H6XA 1P0QA 4X54A 2LW7A 4AQYB 4WNAB 3AJ9A 5H1YA 3OCWA 4E3WA 4EJ2A 1W1UA 4TS1A 1ENPA 1NX6A 1BFDA 1IVNA 1U1IA 4JI3B 2WABA 1XCMA 4O2LA 3OQVA 2D3TA 3CNNA 1YTLA 4GECA 3WRWA 4D0RA 4IDBA 3QXGA 1ULTA 5BMVA 2CLCX 3HBAA 3ZEIA 3GXOA 1SVSA 2J0QA 1QQBA 3NTRA 4ZYXA 3RIYA 2I3AA 3QWFA 4O6VA 4MROA 3ZQUA 4F45A 2XYGA 1J1UA 4YP0A 5LYYA 1O5TA 5IUKC 2D13A 5KYWA 2JFFA 3KYIB 3KOZA 2JVKA 3UXYA 2Z08A 3IOEA 1RI1A 1XGKA 1DBPA 4CG0A 1PP4A 4PZDA 3BK2A 5LQDA 1F8XA 2BFMA 3FFBA 3IOCA 4R2WA 1KAOA 1V2HE 1YXMA 2P4SA 2H7YA 2WVAA 3FFTA 4JLUA 4CU5A 4KREA 4X8OA 5MF6A 1VE9A 1VCMA 4V2IA 5EWJA 1RR6A 4R1NA 4LHWA 1BDBA 3UFXB 1RPZA 1CJCA 2OM2A 1X9GA 4UE6A 4UTXA 4IIBA 4Y6GB 4ZOEA 2CMDA 4Z53A 4J1QA 2A0KA 2RGCA 3LJKA 4TM7A 4MWSA 5IPFA 3DBHA 3NYWA 1X39A 2ZRNA 3UJ9A 2R79A 1J00A 2G7ZA 1V8ZA 3CF2A 3ADBA 1DJMA 5PNTA 1L4GA 1JE1A 1MO3A 2XD4A 9LDTA 3FDXA 2FMUA 3IBFA 4FHEA 4CMGA 2B78A 3CZ4A 1TK3A 1EVYA 1MJNA 2JBWA 3EEQA 1NV8A 2C5AA 2P67A 2XIJA 4UAUA 2ZTMA 4J7UA 2OVFA 2FE1A 2EBWA 4KQFA 3ZQ4A 3K0FA 4CM6A 3SYKA 1BE0A 1N0IA 3KKEA 1PT6A 3T1YB 2QV7A 4BLWA 1L3CA 1T3TA 2FDRA 2J5BA 5DI3A 1F8YA 1V6AA 2H9IA 1Y3HA 2PYDA 4L7VA 4M9SA 3I52A 4BB6A 4GKJB 1CRPA 3NTQA 3GQBB 4JBXA 3UG7A 4AF8A 1JHZA 1ZHOA 2GBIA 4KSBA 4XIJA 4ZU6X 1QB7A 2LTAA 1JR3D 1VLHA 5FWNA 2PFGA 4K9PA 2HJSA 4LCEA 2A0FA 2OECA 1AQJA 1FYXA 1POWA 4AY5A 3UXMA 3T7IA 3HEMA 4FB5A 3EDCA 1P7VA 1TAUA 3PFFA 3UQZA 4AJ4A 4K0RA 2BCGY 1GN9A 3QXXA 4D2IA 3FXAA 1S4QA 4LZNA 1SNYA 5KYVA 3T9BA 2ODQA 3IXQA 1C0EA 1NF8A 3I34X 4EQ6B 3AZOA 5HW0A 4HVCA 4FIZA 2VDKB 1SELA 1ARZA 2FN4A 1E5LA 4Q39A 1NAIA 4LQ4A 3STHA 4DRYA 1JHXA 4JR0A 4YRIA 1O8CA 3BRQA 1KDTA 3N0XA 3GDHA 1D7AA 1ZITA 1VSVA 3O3MB 2IIQA 1QAOA 1PT7A 4FBMA 5JUWA 5JLJA 2JD0A 1WXHA 2O4CA 7MHTA 3OF3A 3C3KA 1NNLA 1NN5A 1XQ1A 3ABZA 3EXEB 5AK4A 2FXVA 4GI2A 3X1XA 5JRJA 4YI3A 2EJWA 5JAZA 4OI1A 4BO7A 4FYMA 1C4KA 4JA0A 2PRKA 5LNK6 1QCYA 3HVIA 1X77A 3E27A 3GRAA 3GARA 2C2ZA 1DBWA 3E7PA 1CRQA 1HURA 2IU0A 3RRFA 4EELA 3GT7A 1LSUA 1DRWA 2GHQA 5BRAA 5KYKA 1CC1S 1M9NA 5ALTA 3UJCA 4W7HA 3OMLA 2Q7DA 1FS5A 4DR2B 3EIQA 1A9QA 1SXJC 4P0TA 3SEQA 2HA2A 4DSTA 1SVUA 1BH6A 3L77A 1HQKA 1R8XA 1XZQA 2V7QA 2WP8J 1YUNA 4GLLA 4NPHA 4YECA 1VXOA 3LGXA 1A98A 4KPUA 2FWIA 2COUA 4Q82A 5K3CA 4U7JA 3N8DA 4OSOA 4L75A 4URZR 4BMXA 5A7FA 10MHA 1JNXX 4M1EA 4RF2A 3ODGA 1ND6A 2PT7A 3F49S 1ADGA 1IXSB 3PC8A 4E0BA 3OM1A 1KRWA 4P4LA 1GHTA 4Y98A 4Y2RA 1OFTA 3N86A 4ARUA 4HMQA 1QXSA 1MJGM 5U1PA 3TE6A 3E3AA 2A9RA 5A1TA 1QO7A 1XT6A 5CGZA 2E3JA 3ZWVA 5AVJA 4UXJA 3BIWA 4OH1A 1SZCA 3RIEA 4CUKA 3HGQA 2R6HA 3HO6A 4M0UA 1U9YA 1KYTA 4PLZA 5KKAA 1MEOA 3C6ZA 3JZDA 5CB0A 3SBXA 2WK1A 4YJ2F 3ZWBA 4KKVA 1XNQB 1RKUA 3I0ZA 1KVUA 2CXNA 4NONA 1TD1A 3OCCA 4O4JF 5E9JA 3GUVA 2R6R1 3HVKA 4ONEA 3S2EA 4CU2A 4C3OB 1KZ4A 1L5YA 2O1XA 3EVNA 4KXQA 2PL3A 3IT0A 2VWPA 4BFVA 4EAQA 2OGSA 4HDMA 5JNTA 2VDJA 1YS4A 5KKNB 2HK7A 3ZQJA 2J1LA 1GPAA 2G4CA 1Y7PA 4X85A 4RVSA 5MFPA 3QLVA 3O1IC 3K05A 3PUIA 2WAXA 1N8SA 3QBTA 1AUVA 3CNOA 4YI5A 2L2QA 2WUGA 3VRHA 2I76A 1I1OA 2E0IA 4C0JA 1BXKA 5EQDA 4B6OA 1NVVR 3FRHA 4NMWA 1LSSA 1W2GA 2O1WA 4HEQA 4B79A 4LPSA 5DT2A 4DIOA 2BE7A 1QVWA 1DX4A 1VYTA 2CEAA 1YDGA 1RVDA 2BKVA 2D8AA 2G1KA 1NKVA 2JFNA 3OI7A 4H0FA 4PLFA 3RD5A 5FUYA 1H3EA 3SM9A 2J46A 1EWKA 5BW8A 3PKZA 3H1AA 4RK4A 4IIGA 5EGSA 3UM9A 4BNZA 3L7YA 1TF2A 5GADl 5B1YA 4DCVA 5K8VA 1WUHS 3VPBA 5IT9A 1Y1TA 5L3RA 3ZLVA 1HDXA 4AN1A 5DX1A 3VR3D 4V0KA 1NFRA 3R75A 4MV3A 4ENPA 3HFSA 1DAFA 1W4ZA 4CN8A 4KITB 3NYIA 4UUOA 1D1TA 3FTNA 1GPH1 4EM6A 4CCYA 4HRXA 5A3VA 2ETXA 1R3UA 3E1KA 3LCRA 4Q3AA 4Q3NA 4RDCA 4RQTA 3COPA 1HF3A 4ZKEA 1JE0A 1LBIA 2WSMA 3AONB 3GCGA 4GPAA 5FL7D 3VPFA 3ZOZA 5AM2A 4Y0VA 4IDAA 5FB3A 1EQAA 5HCNA 3OQNA 5FOWA 5ITWA 4NNPA 4ZEMA 5DTRA 4UXHA 1K9VF 1QWOA 3PDIB 5EUMA 1LDYA 3BFPA 1KK1A 1ESZA 5K8JB 1J23A 2HBQA 5HQ3B 2X9LA 1YR3A 1HQCA 1KEWA 2FF5A 3FD8A 1U04A 3DVAA 2CWDA 3LK7A 2HWKA 1PUIA 4IEIA 5A3QA 4DCSA 1DMSA 1XLTA 5AVSA 4DIKA 1LBHA 4JFRA 5EYPA 3AHFA 3FTQA 2A30A 3VTZA 1JJAA 1NVWQ 5TXGA 1EFKA 3HU1A 3TLYA 1F5NA 3A6LA 2MDTA 5SZJA 3ADOA 5ILGA 4XWKA 3IEUA 1ODIA 1FPMA 1WY7A 1XUOA 2C98A 4O5AA 1MGPA 4TLMB 2QG9A 2P8SA 4GP9A 1R66A 3PQ5A 1RWVA 5FNZA 5I9SA 4I1PA 1DOAA 1F0PA 5BSWA 2EWVA 1PKEA 2SCUA 3O3NB 3T41A 1KPGA 3WGHA 1IZ9A 1BEUB 2FZCA 1YDFA 3NWOA 3O94A 5F51A 1GVHA 4XGNA 1RC1A 4DILA 2LGJA 4RCZA 2Y4OA 5EJAA 4U8GA 4CMIB 4X20B 2WAAA 1J8DA 4F8EA 1FP6A 3AW9A 4OHVA 2XYPA 1PV1A 3R3HA 2GH1A 3MCTA 4LFBB 2DTEA 3R09A 1SKAA 1KYVA 4QDZA 1XZJA 4RFVA 3IUPA 3SI7A 3U7FB 3OJEA 3O4FA 2W2PA 2XHEA 2YV2A 3NRJA 4F4CA 1N77A 2YIDA 4EUEA 1H6BA 1KS9A 2QROA 1J70A 3QTTA 2LCFA 4IV8A 5FTNA 3ZGVA 5BWBA 5LQAA 1V48A 1OKKA 2W6IA 3HWX1 3M4NA 4C7BA 2JFZA 2VJCA 3K1AB 4XUEA 4H7EA 4LJ4A 4ER7A 2QX6A 4KQ9A 1M6YA 5J58A 3WY9A 4A5SA 5IZCA 4ZVRA 1J8FA 2I4LA 2OE2A 1J6UA 1JXAA 2YMQA 3CR8A 4PR0A 3ZWWA 3SDBA 1JWAB 1PWXA 3VISA 2CW5A 3P5SA 1O89A 2C2GA 1L7PA 2O8CB 2ZBUA 3LUFA 2FSGA 2ISCA 4RELA 5K0FA 4QM6A 1OCEA 2EYUA 2BL4A 5JO9A 1EWTA 4BX0A 2VP5A 3B89A 4YUZA 1WX1A 1Q19A 2CNKA 3E05A 3MS2A 4Q9KA 2C9BA 2OXTA 4NE9A 1VLQA 3Q7EA 4GM4A 4MW6A 3V9AA 1G4UR 5LXTA 3O91A 1B7GO 3H04A 4AZ3B 4DA4A 1R6TA 3AXSA 2UYYA 3VR6D 3USCS 2I8LA 3T7CA 2D0OB 3RU7A 4LFAB 3HJBA 4TTJA 1AQUA 1E5TA 4DDWA 3ZK8A 1VC2A 2GPTA 3CMCO 1JR3E 3BWMA 1H2RS 3QF7A 4EG7A 1UEJA 4FDVA 4LWQA 2ABWA 1ZD3A 4B3TB 1M54A 1BYUA 4F92B 4Y6OA 1BW9B 4FFSA 3BHJA 4FW8A 4UVHA 4BNLA 1DCKA 3WOVA 3KT8A 4NK4A 4X8MA 2SNIE 3UPUA 4ODIA 4RIFA 2KMLA 4XDHA 3RBVA 2PX0A 4QXOA 4H7HA 3GLGA 1XZHA 1FDWA 3BZBA 3ZWDA 5BYJA 4C0HA 5JPDA 4ZYLA 2PEZA 1UIMA 1U3UA 5KAMA 4IH1A 4KPYA 3MNFA 2WTXA 4P31A 2C7GA 2ZWMA 3A4NA 5AJWA 2ONCA 5EA2A 3WL5A 1Y3DE 3OIVA 2VHCA 1UXGA 3C48A 1SWWA 4EI9A 1YB4A 2VNHA 3EZYA 1UXHA 3O9VA 5K0CA 3AKZA 1KVQA 3HXLA 3V1UA 3ZIAD 1YWGO 2OBFA 2VJNA 3FZEA 1XNJA 4OLFA 1CB0A 1DKLA 1GQOA 1M83A 3P19A 3HWSA 5IK2D 2E6UX 1FDTA 5DGXA 2Q6KA 5JSZA 2XIQA 1U8XX 3U0BA 4B35A 3BQ9A 2CEKA 3K4PA 1M34B 3OZ7A 5CXSA 3AXTA 2JIDA 4ARZA 1FUUA 4QHTA 4C5AA 4IJ6A 4X93A 1QH8A 1XWFA 5IP5A 1JFVA 1QONA 1EI9A 2HA5A 3TXAA 4G4GA 5LQSA 2HM7A 2E7ZA 5A2QA 3EUEA 4QLOA 3H75A 2L19A 4S05A 3C6BA 3W1EA 1XF1A 4BNGA 2VJMB 4HDCA 4QBIA 2VA8A 4JP3A 2ZTUA 3ZWXA 3R76A 1X1RA 1G8PA 3FY4A 1VPTA 2WDPA 3FUVA 2QD5A 3QBVA 1ABFA 4M1TA 5BR8B 5KNLA 3ZJTA 5C51B 5K5EA 1H4SA 4N3CA 3RBXA 4A6DA 5DIZA 1TK9A 2F67A 1NZDA 2ETVA 3GJ4A 3H0CA 3SXJA 1IEWA 4QDUA 5I5EA 3IHKA 4OQEA 1FPQA 1NY5A 2FTKE 4WDQA 1YZQA 4G24A 4XQCA 4UAVA 2ZJ1A 2RHOA 4P53A 5DWVA 5L3QB 2UYQA 1CZUA 2ODAA 5BO5A 4C7OA 3UJBA 1NT4A 2FWMX 2RDMA 4FFBB 2Z1DA 2XVYA 4FGWA 1YK0A 3HDHA 1EE1A 3MJRA 3U6BA 3UCEA 1M66A 3OJFA 2V4ZA 4Q47A 1Z68A 5L4LA 1W96A 4ZALA 1E6CA 3CTMA 4IXMA 5C7YA 1SCQA 2ZJYA 3PSHA 1BCSA 1JMYA 1SOAA 1UP7A 1MDFA 3IIJA 4I3GA 4MRMA 3USES 1SCDA 4ZQCB 3F78A 1NI4A 2X4DA 3TI9A 3L82B 5DMXA 3AVTA 4FYHA 3B51X 2DETA 2BHTA 3E2MA 3FLMA 1IG3A 2VDWA 2JGNA 3C7AA 1FNBA 3CH7A 4DLRA 2FGJA 1RABA 3GJZA 3L07A 1TJNA 3AEKA 4QHSA 4UVDA 2PS1A 1I3NA 4DZZA 5G3YA 2DGDA 2F1IA 1C0IA 3O31A 1A8QA 4TMYA 4AMVA 2G4LA 3MCUA 3LYHA 1I9CA 2WM3A 3L43A 5DTJA 1XWIA 3SYNA 5L53A 4QJ5A 1LK7A 2OGTA 4BWVA 1XKQA 1WXIA 1USIA 4D3SA 4JBGA 1P91A 1M6VA 1PJZA 3D4OA 3PX2A 3CF0A 2NXWA 4PZLA 4TTSA 3KSDO 3U44A 4GPD1 1Z73A 3FAKA 3KOUA 3FKJA 3OMWA 3CZCA 4G1BA 1SZDA 2OXEA 3B48A 5MHTA 2IS6A 3SSMA 3U4HA 2ON6A 5ALRA 4F3CA 5M7EA 5T6BA 3DEHA 1YB1A 3EPRA 1W2WB 5A9TA 5LLDA 5KHAA 1I3MA 1A5AB 1RWMA 3A1CA 2Z2IA 3HWWA 5DTQA 1OB5A 3OQOA 2FMHA 4FK8A 4KV9A 1JFRA 2VT3A 2PAAA 4FX5A 3H6GA 3KXKA 3DYVA 2DBYA 5DSTA 4EMBA 4JYBA 3QVJA 4QAJA 3AERA 2J4CA 3O4RA 3PVCA 3IV9A 4RDHA 1ZA1A 4BJ1A 4MH0R 3CUWA 1S8FA 5JBQA 1L4NA 1W34A 2I7CA 3O84A 5EHQA 4JLBA 3TSOA 4H1HA 1X8JA 2QY6A 2ZEJA 3NAZA 2Q3JA 1LZKA 4NZYA 2Q2VA 2XCIA 5FLXA 4WN9B 1GSOA 4JYCA 1EINA 5E0KB 3GZTB 3E4DA 3GRVA 3O1HB 2GJ8A 1E2LA 1ZD9A 2ZJ3A 4QX6A 4HNRA 5GWXA 2FV8A 4F91B 3DVQX 3ME5A 3L5KA 3QWIA 2C9ZA 3QKSB 3OZIA 2O8VA 1JTEA 2OBLA 2QRHA 4JLVA 1IM2A 4H35A 1KI1A 3S2IA 3L02A 4TL6A 3DZIA 3K4HA 5DGCA 1EFCA 1KJQA 5FOTA 2QUHA 4FKZA 2ZRLA 3MGBA 3NVDA 5THXA 3A1FA 1UKBA 1SUAA 3KEQA 4AUKA 1LS6A 3JARB 4C5BA 3FWYA 1KMQA 3I9OA 3MS4A 3KJIA 2GFQA 4ON9A 2VHWA 3C70A 2B4QA 3EIWA 3IYLW 4YHBA 5EJGA 4B4DA 2PKYX 4A15A 4L9RA 1RQRA 2GFIA 2X0NA 4E4RA 5JCXA 2JLUA 4FHDA 3HNRA 3AUTA 2H4FA 4DEVA 3MWEB 3RHZA 2LKCA 1WXEA 4E5DA 1YOBA 3IA2A 2PQ2A 2QN6A 4X1KB 1U90A 5EINA 1PUXA 1C30A 4D5GA 4JH0A 3RRMA 4LK3A 2DERA 1Y5NA 1JDBB 2VP4A 3E81A 5CD1A 4S24A 1OXTA 4FOLA 4RULA 3D6FA 1C3VA 1RIIA 4TSRA 5T6MA 5DO9A 1NC1A 2SKEA 2JEZA 2PFSA 2Y0EA 3QFHA 1ZCZA 2ZWAA 2AQIA 4P22A 4LC0A 4RCYA 3FPEA 4DNPA 2C1XA 4IICA 2C54A 4YJ3A 2AI3A 3ZS8A 4RZ2A 3R7WA 4DAOA 4EY6A 3EXIA 3HXTA 3I73A 4RDXA 4G8CA 3G17A 2OSVA 2V8BA 3B5IA 3EEFA 4OJTA 1EUCA 2EV9A 2WJGA 2HWXA 2YXBA 2YZNA 4Q1FA 2Z6QA 1R50A 1QGED 4BB9A 3C0KA 2AF3C 5KTNA 3OPYI 4JI6B 2BEWB 3DEZA 4U0JA 4URUR 3MB5A 1JF8A 1EEXB 3K0HA 3BHIA 1R6VA 2CLFB 3AVPA 4WFQA 2Q4RA 2XX3A 5HE9A 5BORA 4TZ0A 1GA6A 2PT5A 4RVHA 1Y8RB 2PZMA 3MJ4A 1DHTA 1MHPA 1IOWA 4C7KA 3ROKA 1E3MA 2CJFA 4J8PA 2F17A 4BQRA 1MW8X 3EFBA 4JLPA 1JHAA 4UU1A 4HOYA 2ZKLA 1W5EA 1DRJA 2OHJA 3N8NA 1KSJA 3U81A 3G2PA 3D6UA 4LWOA 3K7EA 4O08A 2QLLA 1NNSA 3BJIC 3VR1A 2C9YA 2QJTA 1U7TA 2C4WA 3HS3A 3B2QA 3EXHC 5BNZA 3RAPR 2DLDA 1G9TA 1QTQA 1DC5A 1EAMA 1GM5A 1FJXA 4WW0A 1OZGA 3JVEA 1DUSA 3QVKA 3HUEA 4MQBA 2JARA 3CUYA 4UASA 2XCTB 4FMPA 1RKBA 3FVWA 4ZEVA 3F1LA 5DHAA 4GKAA 1R64A 2Y66A 1S2LA 3AC0A 4Q9NA 1E79A 2A3NA 3A70A 2ZUUA 3OUZA 5HE8A 4AXBA 4Z6KA 2CV0A 3UT5A 1MZPA 1NBMD 2Y05A 4RD0A 2QQEA 1J1IA 1GPNA 4YLYA 1PEDA 3OD5A 2PT6A 5ICEA 1MIOA 2BMWA 1D2CA 2ZRFA 5E4JA 4E07A 4L0QA 1D0IA 3EWSA 1W88A 3QVUA 3BK1A 1YA6A 1H4QA 4RDIA 4V03A 4CM4B 1CTQA 1MQAA 3H9CA 4V0MA 5AOCA 5GMOA 4ASUA 3D7NA 3MHTA 1M1NA 1BN7A 1E32A 4JP5A 3DAYA 1XVTA 1HT0A 2DY0A 3N2LA 4DR6B 1ZVQA 3BK7A 1AK1A 4AJJA 1L2TA 4HWKA 5J4LA 1BHO1 4LZJA 3HP7A 4LV5B 3MUNA 1D2GA 1T9BA 2AN4A 2JATA 4JAVC 4NU6A 5K6AC 2VPWA 3EX7C 2PK3A 3ZDCA 1L7XA 3A6PC 2DWQA 1AKVA 1R16A 3U48A 1TMKA 2XITA 1EFVB 2YY5A 2P6MA 3MJEA 3DHWC 3VC2A 2H92A 2CCKA 5BUCA 2ACWA 4C2BA 2YRXA 3WICA 1UUFA 1IXRC 3BN3A 3SXPA 4H9GA 2VQDA 2XLCA 2NPIA 1PSWA 4XYEA 3L40A 1KZ7B 2XCQA 5AVUA 3AFGA 2H2GA 5KMGB 5E4FA 1N5MA 2N0SA 3VPSA 2BEKA 2WFAA 5C18A 1PHRA 2PGJA 1Y3CE 3HG7A 3QELB 1U1EA 4RLFA 1L1EA 3DNMA 1VECA 1J7KA 3JD4A 4J1SA 4WUTA 3OTWA 2B99A 3QWHA 4IUDS 1CUVA 4MINA 2AVNA 2Y2UA 1KPHA 2Q3HA 4RGQA 4EO9A 2Q4BA 1EXVA 3L7DA 3PVSA 2HYDA 1PR0A 4L0CA 4RJKA 4UZFA 5EHNA 2B0CA 5JVDB 5KYUB 3EZ9A 2QXTA 3BJZA 2QGNA 4N3BA 1ODCA 5J4KA 3OBIA 4PYQA 4E1VA 3E5MA 1DAIA 1RHKA 2X77A 1N2IA 4QEKA 3V8QA 5JARA 4ILKA 2H1LA 1U7PA 1B8PA 1T8WA 4GSLA 4G1FA 4R9UC 4XWWA 3I5UA 4QXRA 1CR1A 1Z6PA 2B4AA 3U0VA 4EK9A 1GZUA 3JAKB 2FPIA 4FQ7A 2QQ5A 3RS4A 2ID8A 2BKXA 1EGAA 1M2VA 2PBFA 1CF2O 1KP3A 3O38A 4LDPA 2R9VA 3BYZA 3TLAA 3OT1A 3DHYA 2K4MA 5ILQA 1YDHA 3ZN2A 3OBBA 5BXYA 1HSOA 5A6VA 5MN4A 4L7QA 3SR0A 2X1LA 2IE0A 2FFJA 4ZOCA 4BMDA 3G1TA 1E1CB 1V5GA 4L4YA 1RC0A 3T1HB 5B3JC 4PW0A 1N2JA 1NVKA 4Z4GA 5J4VA 1QUFA 4K40A 3M7IA 2QBYA 5C4IA 5ADWA 2BH2A 2QU8A 1AGNA 5ALMA 1STOA 3A04A 1H69A 4QO7A 3VNBA 1JFTA 4RK5A 5B6IA 1XDZA 2GA8A 5GVSA 3KOWA 3E1GA 3WB1A 3ERCA 4JYPA 1W4BA 1N5DA 4UDYX 1OFIA 2XQJA 3KZKA 4N47A 3IMEA 2YWXA 3ZU3A 3W34A 3DWFA 5HZGA 2QSUA 1LTKA 1SCIA 3IVCA 3U37A 2FHPA 4WOKA 4FNOA 1E2NA 3MYRA 1TTHA 2Q50A 4DE5A 1JI3A 4PS1A 1NJSA 3WJAA 1RC8A 3QPVA 1IEVA 1T15A 3NDPA 4IHJF 5I8PA 1KWGA 3AEUA 3OLQA 1SBIA 5B4UA 1BX1A 3MJCA 1KXZA 1H65A 2JJ2D 3KPUA 1UDBA 1RJFA 1TEXA 3G2NA 4HXEB 4RHTA 2ZWOA 1UT6A 2Y1LA 3NCHA 4PR3A 3EVDA 5CM8B 4RK1A 4ZTBA 3TFOA 1LA2A 3WXBA 4OUDA 2QS9A 4L95C 5JAPA 4CT5A 1J8YF 4N8DA 2V3WA 3JPYA 4IXDA 3PIDA 4RS4A 4WDRA 4YDRA 4CT4B 2HXGA 1I33A 1F9EA 3GAAA 1Y6RA 2JI9A 4HYYA 4MYHA 4YCJA 2RGAA 4IOMA 5CA1A 4QGHA 3TFQA 3K53A 1R0YA 1VMEA 2P3SA 4MVWA 1C2YA 1P1JA 5HKAA 3UWSA 3DWIA 1ICIA 3NKFA 2BMAA 1Z0SA 4NZMA 5DNYB 1PL7A 1A77A 1WOMA 2CVPA 3PKIA 3LT4A 1JQEA 4JZKA 4BYMA 1GNSA 1YE3A 4KI0A 5SZKB 3VJMA 3K70B 4L07A 2QRQA 2PKRA 3MOSA 3VAYA 1MTOA 1E6UA 3S27A 2HDNB 5IU6A 1IIRA 2ECQA 4EYKA 1VLZA 4TV8B 4DTIA 1XLUA 2ZREA 2DKOA 3O7MA 4CIAA 1MD9A 2PLWA 1NLMA 4Z8XA 2RGUA 2V74B 3EASA 4OBXA 2D0IA 1H1TA 3USZA 5I4IA 1NWCA 5K3OA 1T2VA 1ENOA 3QBEA 3ECAA 4TV9B 4WOPA 1N7IA 2Q9AA 3IKJA 4MR9A 4X91A 4AP5A 4E33A 3PUKA 3UBMA 1W0KA 3L4SO 1ZC3A 1XKLA 3UV7A 1MGOA 5DULA 3ZE7A 5A03A 1AD2A 5ILOA 2NQ2C 1PLJA 4I4IA 4C76A 1ISFA 1BMFD 4FR5A 4W9NC 3V3TA 2XAAA 1O97D 3DD5A 4J16A 4ZK6A 5CVTA 5KKCA 1XRLA 3UJ7A 2Q5IA 3RFVA 1QWSA 4JR1A 5G0TA 3REQA 1AUQA 1MO6A 5CFMA 4D0LB 3A7EA 5LC1A 2REQA 3F71A 7REQB 1OV6A 1XEXB 4F4HA 1XQ9A 3L06A 4EG8A 5HM8A 1XJ0A 2EFEB 1IY8A 3H0EA 3I9KA 4DQVA 1O9HA 4HTFB 3I62A 1S4MA 3HDTA 3GLIB 1VMDA 5IVDA 3PDJA 3ZY5A 2WPNA 4HH1A 4EJSC 3N2IA 4IJ5A 5E9QA 1RWNA 1W1IA 1MXHA 3GJ5A 4MV5A 1ECCA 1HDCA 4M8KA 5ALYA 1WDKA 5TC4A 3Q8MA 1NNEA 3BEOA 2EX4A 3SF0A 5BVGA 1TKAA 4A8TA 4B76A 3GFVA 3JWJA 4G65A 5IVHA 3T5TA 3ENQA 5JXIA 2RGNA 3R24A 1Y6JA 3K15A 4AG3A 1YCHA 3IDZA 5JWHA 1RCFA 4PRYA 4BLPA 3PQ4A 4RORA 1JG6A 4W8OA 2QN1A 5FLYA 2Y1WA 3WBKA 5D5PA 3Q9UA 3U3JA 3I0NA 3B78A 2H2WA 2ZP1A 3LZDA 3MAGA 4MP3A 3E82A 4ZO9A 1PG2A 4FLMA 2V3CC 4NH4A 1K0UA 5DN6D 1T6YA 1P2TA 1YV9A 4HDNA 4Y2TA 3M6FA 3GEGA 3NFYA 2RGRA 1XL0A 3M9LA 4QQNA 3FPSA 3I2FA 3SG0A 5FYQA 1W1WA 2QT1A 4IWXA 2QR2A 3Q87B 4MPJA 4CKWA 2VK2A 5AJHA 1CRLA 2ZCJA 4RTRA 2HA3A 1GTZA 4REMA 1ST3A 2GOYA 1QRAA 4LA4A 1G7RA 2B8JA 4HGPA 2HJRA 4FEGA 2V0CA 2GTHA 4IJUA 1T4CA 4W1RA 3IMCA 3S55A 4TVBA 5KNDH 1IPFA 1NR7A 4Q37A 2EL9A 4XTRA 2H3HA 3B1YA 1NF2A 4GS5A 3WGUA 4NJMB 3WYCA 4LXHA 4PVDA 5EMHA 4UARA 1TQ2A 4WBNA 2GAIA 1XRRA 4NEHB 3I1FA 2FR8C 2QDKA 5IKMA 1WSAA 2YXNA 3HEAA 5LU9A 4L8FA 3EGOA 2D5LA 3KYDA 5TARA 1KMNA 1M2KA 3L6RA 1GKIA 5ALKA 3KV3O 4ENRA 1T8TA 3ECSA 1XF9A 1K3TA 4CLDA 1GQQA 4AYWA 2OZKA 4LTDA 2HMWA 4GDFA 3QPUA 3SS9X 4PSVA 3CNBA 2QJOA 4YWHA 2PKWA 4B73A 4GSKA 4TWRA 3I3SR 1PT9A 1ZGJA 2AXNA 5EHGA 3FLEA 3LO5A 1V4BA 4ND6A 4QUAA 3IBCA 4W5HA 2JGLA 1HFEL 2IYPA 3PE4A 1L4HA 2OCKA 3D7MA 4GGMX 5CBKA 3UC9A 4LZLA 2EP8A 2FOIA 1NYQA 2BE9A 5IEJA 3IL2A 2UVDA 4PN3A 1PS8A 1KO7A 2P5TB 1JSLA 3DE3X 2VWGA 4GWLA 2VP9A 2YC2C 3LLSA 5JDCC 4DIMA 3U09A 2IU6A 4MICA 1GOTA 3BRSA 5CVUA 4LXYA 1JVBA 3HN6A 1EH5A 1GEGA 5I9TA 3W06A 2IYUA 1T6NA 5GPBA 1EP2B 3NS7A 4UHCA 2WHEA 2XUHA 4HQLA 2XUGA 1V41E 2P6OA 3D6HA 4XD7D 4CMBA 1MF7A 2VNKA 2FPGA 4RD2A 1M34E 3ON5A 1J0EA 4Q6WA 3GRYA 2AOTB 3IQGX 4KIFA 5D1NA 3WK5A 4A0GA 3LT0A 5F9FA 2AR7A 3E22B 5G1OA 4C30A 1YZKA 2PUDA 2X8JB 4XAQA 1MEJA 1OWLA 3EVTA 3S99A 4I7EA 3UAOA 3IUNA 5BR4A 2W37A 3FWPA 4WLVA 3ADPA 4JI5B 5TQVA 5AWFC 4D02A 4K03A 4ZZ0A 2R6GA 5JROA 4A0SA 3DDWA 1BXGB 2OCYC 3WV4A 1NVEA 3ZY2A 5T4FA 1ECJA 3TK1A 1ZXBA 2VRCA 4ND1A 3J80A 1UKVY 5L4SA 3Q5EA 2H4HA 3GW8A 1ONNA 4LFCB 5BOSB 1OYVA 3TQCA 4J6EA 2B98A 5D3ZA 3SICE 4LF8B 3HZOA 1I1HA 3CM0A 4FI3F 1QMGA 4HQKA 5AM0A 1BKDR 2G0NA 1P9OA 1QQTA 1TO6A 3UWOA 3PZRA 1RRKA 1WOYA 3UKDA 5AQEA 1UPCA 3ZBTA 3C15C 2VQSA 2ZSKA 4HFJA 3CLRC 4XUGB 4C05A 3OTIA 1NJFA 1SXIA 4QVIA 3BD7A 4YRAA 1P9LA 1AS0A 1AZLA 1T34A 1VB5A 1VYVA 2JJQA 3OC6A 1ETHA 1TC2A 3EGDB 2OBBA 1OAAA 1JSZA 1K75A 4GP6A 4KG7A 1WSWA 3K0AA 3F47A 4DSAA 1QAQA 4LQLA 3D5EA 5I7SA 1XEWX 2GZRA 5FNVF 5KQMA 5KYGA 2WQ6A 3ND8A 2HK9A 3AKYA 1IEXA 4Q9IA 3H99A 2ZIXB 4U4AA 4ZVTA 5H4GA 1Q7BA 4GVLA 1O7JA 3LL7A 4JGIA 4FSHA 4MQ6A 1B93A 1EBFA 3BXPA 4ZZ1A 1I2AA 5AQ1A 2DR2A 4JIMA 1HNWB 1PR4A 5D7BA 3AVWA 1WHTA 4Q3BA 5ARCA 4C6HA 2L18A 2NUPA 2QV0A 3HB9A 3LUBA 5HGJA 3SNHA 1TOAA 4NCAA 2PIDA 1OFUA 3MTJA 5DNUA 3A7DA 1TLLA 2WG0A 3IEKA 5HOEA 3EJWA 4CEIA 4U2KA 3MWFA 5BQXA 3HYCA 1WB5A 2XUOA 3ND5A 4NYIR 3GR6A 5KYXA 4JJEA 4OAPA 1TM2A 5CXXA 3ZEAA 1CJVC 1RPNA 2I91A 1XKXA 4JGBA 1Y8QB 3RREA 1ZBQA 2Q6OA 3AI3A 4QPZA 2YCBA 3K0CC 2NVBA 3LBAA 3MAAC 3NGLA 3K9GA 5COQA 1IJEA 4C0KA 1I2ZA 5JY1A 2ZYSA 1ANKA 3D8SA 4HN4B 5TRTA 3WHPA 3T1TA 4OMCA 5FOSA 2APJA 1GPYA 3TLZA 4B2PA 1L5HA 2G5TA 1DIGA 1LSJA 2NVWA 3QX3A 3GJ6A 1E1LA 3OZTA 2DOKA 4FC7A 4MSUA 3U26A 5AK6A 3A6JA 4ZKDA 4QULA 3G0IA 2AC2A 3WQHA 4ZIRA 1F17A 1Y7TA 5F1YA 2OPBA 1HMPA 2NT4A 2Z3VA 4G0UA 3O75A 1Z88A 3KQQA 1E2QA 1Y63A 2ZI4A 1SULA 4GX0A 4G8JA 4HJXA 4JROA 4ZVPA 4A6PA 2D7CA 1C9EA 1JDJA 4MO2A 1H4VB 5IAKA 3NRCA 5M29A 1CQXA 1JI0A 4TL7A 2G0AA 4CDNA 2X40A 4I9HA 4W5WA 4G9BA 2XPCA 4PC2A 3CXUA 2K6GA 2Z58A 2Z98A 3HCRA 4IDOA 4EX6A 2WKPA 2O6LA 5I4BA 1G18A 1N5LA 1XVUA 3Q12A 3G2IA 2J6CA 4WVFA 1KJZA 5KNBD 4ENQA 1FFGA 1NAHA 3H5AA 4UBLA 1HYHA 3OD1A 1XJQA 4KDRA 3R20A 3HI4A 3I6YA 1UEXC 2IYTA 4TZ6A 3WLPA 2XY4A 1JILA 1PV4A 1UXIA 1DLJA 1K8RA 2SHKA 2WYVA 5EWMB 1D9ZA 1E2KA 1DS6A 2QN3A 4D43A 1NUAA 1WJGA 1TM7E 1NL3A 1LD3A 1T10A 2B5OA 2VPPA 3K9NA 5JH7A 3L8HA 3VSCA 3DLAA 3U3MA 4PIMA 4QARA 2KSQA 3COZA 3VR5H 2WUDA 2XNCA 4S1VA 3WNZA 2AC7A 2O2HA 3ASUA 1PZGA 4MB6A 3RS8A 4A3SA 3KE8A 4KH0A 3PS9A 2YQ5A 2WSSD 2VUUA 2ZQYA 5KVSA 4HNTA 3EZ2A 4C20A 4OAOA 3T1NA 3LVBA 3DPIA 1VL6A 4WXHA 3RO7A 4XQEA 4E5UA 4NABA 5KDLA 5F2NA 1XJWA 1MV8A 1TFRA 2NO4A 3ZJYA 2H1CA 1W6UA 2AEEA 3UENA 1TYAE 1L1QA 2AJTA 2G77B 3LXRA 4K6KA 3AQIA 4XYMA 3ICVA 1TYDE 4HB0A 4UDXX 4MQ5A 2JAOA 3E1SA 3E7XA 5B58T 2B92A 2DU8A 4Q0MA 1E0DA 4MGZR 4M0MA 4FYKA 1UWKA 2HYIC 1X3SA 2EHDA 3L6OO 3RFFA 2OZVA 2XA9A 2QAIA 3HA7A 4G6ZA 1M76A 4LXGA 3KETA 4IKOA 1IBCA 4KFRA 1CIVA 4R3NA 1EFRD 2IYRA 3FNIA 3LLUA 4WSOA 4N12A 2G1UA 2NW6A 1WMSA 4GMKA 4RY0A 1SC9A 4AJIA 4ETWA 3EUAA 2QT0A 4BJ3A 2NAPA 1SB8A 3L8MA 4QYXA 3RARA 3TRKA 1CPYA 1WCIB 3VV2A 5H59A 1RXVA 1WSDA 1M75A 3W5DA 3AYZB 4EGFA 3A28A 2WJJA 1K5PA 4PZ9A 3LWDA 4QHYA 4XVCA 2WZDA 2EEZA 1UC5B 1NM5C 1YMUA 2B4KA 3BAFA 2XMSA 1E66A 4QYSA 2O2ZA 3ZJ5A 3ENWA 3OQIA 4CUJA 3FOAA 3JPWA 2OC4A 8LDHA 1S9DA 1NQAO 1Z0IA 2GESA 2ODNA 1X8LA 2RBEA 4YA6A 1QO0A 4KNYA 2XBMA 3BXOA 3GGJA 4LGMA 2JGJA 3LIPA 4M1SA 2EBFX 2YUIA 4UM5A 2YNMC 5FJJA 2NU8B 4CJXA 5IJ9A 2YHUA 4WJKB 2YFHA 3GAMA 3KB8A 4PYKA 1IU9A 4DLPA 1O95C 1TCCA 3CEMA 3NM5A 2JKZA 4BZWA 3PWTA 4GMGA 1GV1A 5KTMA 1VDZA 1NXXA 3R44A 5CW1A 3NHRA 5JC1A 1YL7A 2PU5A 5C8YA 1YR8A 2FU5C 2PGDA 3BBPA 1N2CA 2WE7A 3KXPA 3CLUC 2GHTA 3PB3A 3PHBE 1P0PA 3E18A 2H1RA 4FYIA 4MI3A 1EP1B 2VH5R 1RFGE 5CDHA 4KPFC 3FAZA 3SU8A 3IIKA 4E22A 1UFOA 3VZRA 3JCZA 1VBFA 3JWHA 3QWBA 2QVBA 2NYRA 2YZGA 1LVUA 2HUPA 5KDDA 1VE7A 4Z8YA 1KGSA 1TT5A 2PX5A 3IUJA 3OIYA 3KB6A 4QKQA 3GLUA 3D7RA 3WMEA 1WMEA 4X60A 2JFVA 3F7OA 3NPAA 3V33A 5DYNA 3OP1A 1Z45A 3EVCA 2GNPA 4OFZA 2W42A 4LSZA 1JW9B 4WLEA 3Q1KA 5GGXA 4BVJA 5M5BA 2H2IA 2RIPA 2VBFA 3NALA 1EJ0A 4I81A 3EC7A 3CBQA 1EESA 5B5SA 5FBLB 2QVGA 3R8XA 3NM6B 1YO6A 4XGIA 4BCBA 2CE7A 3DM9B 4V0RA 2P2NA 4CNQA 1KJJA 1S3IA 2JFUA 1J09A 3R8FA 2NZYA 2G63A 2Y71A 2YS6A 3RUFA 2RAFA 1SU6A 3DOUA 2YOGA 4NXNB 4KK4A 3RC9A 4C4SA 2OGWA 3CF6R 5CM2Z 3V42A 1PTJA 1H0KA 3GFRA 3JQAD 4ZCPA 3G7SA 1L7QA 1JR6A 5JHHB 3IQFA 3SWWA 2GTPA 4PZYA 5TMDA 1U9IA 4Q19A 1X2BA 1RPAA 4AJ1A 3AR9A 4XIFA 1U4NA 2JBAB 5CJPA 4BN0A 1T9CA 4NMMA 2O59A 5TR9A 2WVJA 1UDRA 3EEYA 3LKZA 4LHEA 4AQ7A 4PIVA 3GCWA 4ZI7B 1Z0ZA 4EHJA 4RPGA 1W36D 5EUQB 1D4OA 1E94E 3I4LA 3EISA 4GSYA 5WRFA 3UZUA 3ZKAA 4ZI2A 5HCUA 1KZ9A 4CF5A 1CYEA 3PX7A 4I0WB 3UB2A 2O2EA 4LXUA 3Q6NA 4K9LA 4Q4JB 4UVIA 3RUPA 3NV7A 5CXQA 4NG4A 1E9DA 1EDDA 1P0CA 2F4NA 2VRBA 2RI6A 4MDHA 4H15A 5EE0A 2BI8A 2E4WA 1H1LA 4NULA 3LX6A 3V7NA 1WXGA 4UUQA 3S40A 2IS1A 2AG8A 3E3NA 2L0XA 2W00A 3FMVA 3TQQA 1OC2A 1A72A 4F84A 5LJIA 1SXQA 1SXJB 3P9PA 4LW8A 5GGYA 2CBZA 1G2IA 1KDPA 2Q99A 1FCJA 3JQGB 5DKFA 3VPAA 1Q17A 3H4VA 1FP1D 5I5GA 3BJEA 1X86B 1ZGHA 3B1VA 5SY4A 2ACVA 1GCIA 3EZLA 4H18A 3CVJA 5DTEA 3ETDA 1PNTA 1ORRA 1VBKA 4HB4A 4DLWA 1U3DA 2B5VA 4ZOBA 3VTKA 2WQZA 5C81A 2VATA 2LD4A 1G8YA 4OXRA 1WV1A 3TINA 3ZJ4A 1KEEA 2AOUB 1RXIA 1JA1A 1ZM4A 2P62A 3LP5A 1LLQA 2H29A 3VR4H 1EMDA 3KFLA 2A33A 4LRQA 4OXYA 1H2WA 1YFKA 1ZK3A 4CG3A 1WCWA 3CIFA 4KWCA 4YRJA 2ZE8A 1YE5A 3B5JA 2LUOA 2XWPA 4PYLA 5GM1A 3I28A 5KTPA 3WBJA 5LIRA 1T5SA 1LFDB 4CV2A 3ZDXB 5HS6A 4RL4A 4H6WA 1E7WA 3M6WA 2FHSA 1GWNA 1VRVA 2J9FB 2VTEA 2X3UA 4UQPA 2I4OA 5EEGA 2YDYA 4G1UC 4NDZA 1E1YA 4EHNA 1OH8A 1XNGA 8ADHA 1J42A 1WNFA 4GMFA 4DSOA 3SC2A 2HC9A 1ZEJA 2R6JA 3CMMA 2O8BB 3R3ZA 2JG3A 1K4YA 4HXGA 3DE1X 3WKBA 3BE6A 4RAOA 3V9PA 2GB4A 2IYNA 4ND8A 2GUWA 2PL9A 5AK3A 3NWEA 2E21A 4EJFA 2V98A 1YHNA 2P9ZA 4G0VA 1S2IA 3MG9A 2O9JA 4OPMA 4QYIB 3IMFA 1A5BB 4ZAZA 5FBKA 3OOEA 1RQXA 3WK9A 2I2AA 1U3TA 3S1SA 1HG0A 1HORA 3TJMA 4HNGA 4X41A 1Z34A 4ZCSA 2HHLA 1K1EA 2WTNA 2O52A 2V7GA 3TF5A 1KSGA 4UHHA 1WXFA 1EE2A 3FI9A 1H0HA 1CS0B 5K2OA 1JIXA 2O2JA 1VHWA 4C03A 1V71A 4RWZA 3D8BA 1NN0A 1NUHA 1FQWA 1ZH0A 3GYBA 5TGDA 3WDSA 4ISBA 2UVPA 2Q6IA 4QJ4A 2XXAA 2QQGA 1ONOA 1H2YA 3G5TA 5I9LA 2C84A 3PD0A 4HS4A 5JJCA 1YMQA 3W8NA 1E58A 2QRZA 2Y1FA 3D4BA 3ONDA 5LP6B 5AKJA 4F93B 1FFDA 2CJWA 1KAQA 1V16B 4WFJA 2Y1CA 3EZ7A 3U4GA 1TYEB 3G68A 1C50A 1U0OC 2JF0A 5A4FS 3N87A 3W2IA 3W3AA 4ABTA 9MHTA 3DDSA 4FUQA 8GPBA 2WKSA 1MFPA 1QIDA 3V1LA 2P11A 5DHQA 3IULA 2ZU0C 3DF7A 3DVSX 4WNYA 1IWOA 4TXMA 3LC0A 4S1PA 4U39A 1WUJS 1DIBA 2FPLA 1ETUA 5HIIA 4K81B 2IZ7A 2WSBA 2ZI9A 3PT9A 4MR8A 1NQTA 3QHAA 1FFXA 2HLNA 3ZZNA 2ZETA 4EBBA 2VZ8A 3ZD8A 1ABEA 1L5VA 3AF4A 1KI7A 1QZUA 2VVTA 4JKYA 2OV1A 4TM8A 4YALA 3W1WA 5JMWA 1G20B 2V65A 4MHTA 2JCXA 4H7IA 4D42A 1IL0A 1E7MA 2P78A 3GLIE 1RWXA 2N9UA 2HF2A 1PYGA 4K5QA 2H7XA 3QPDA 1W48A 2Q7XA 1KVTA 2MYPA 5BSGA 3L8FA 2R3SA 1CUSA 4RA9A 1BS9A 2ZB4A 3B20A 1D1QA 1M7HA 2WWIA 3FCSB 3B9BA 1DIOB 3V8PA 3EIHA 1IRXA 1OLXB 2Q4DA 2FSIA 2VDUE 3GD7A 3L7JA 3P9ZA 5I47A 1UDAA 2C00A 5CHYA 4JJ4A 2HQ1A 3MOGA 3ABRB 1QHHA 3T38A 3ADKA 4KSYA 4MIEA 3CEAA 4ZRMA 1GKYA 3DJYA 3KC2A 2A9KA 2JAUA 2XA1A 4P83A 4YJGB 4DN6A 5IJ0A 4RFLA 4A0QA 2ZAGA 3D2LA 3SF8A 4UHKA 2YWBA 3WJ1A 3G2MA 3VKFA 1E9AA 3Q7PA 1DFHA 1Z7WA 1DJOA 2E2WA 1NW4A 3FNRA 4CG2A 1FDRA 1RM5A 4HLQB 3UTCA 1G6KA 5H02A 2YQ4A 5K8TA 3JVVA 4C14A 1KY4A 4G9EA 5T4BA 3MQ2A 4QPDA 2ZYDA 2O0HA 7AT1A 1U2SA 4QXMA 2P40A 3RAJA 2NM0A 1SXGA 1BJRE 4GD3Q 4JVLA 4DA7A 1QRSA 3TLEA 2PX2A 2FW8A 3K4QA 4LVCA 2DR3A 2QRVB 4DWJA 3G02A 1D8AA 1TXGA 2ZULA 3D4IA 4PSCA 4B6FA 4GQBA 3GUCA 3MJTA 4TXJA 5K05A 1UP4A 2OCBA 1KI8A 1OXXK 4HWTA 1I5EA 4B4UA 2JFXA 3B5EA 1T2FA 4WKCA 1GTMA 3IFSA 3O8QA 2J0EA 4FGZA 5FI3A 5KWIA 4M1ZA 4HNHA 1Z35A 3W1VA 3CLTC 5CLIA 1YC5A 1NYTA 2QD1A 4NBTA 3TSYA 2D1RA 3E5HA 1H2AS 2ZYRA 4JL8A 3KYBA 2ORED 3WLHA 1NOKA 5I9NA 1V0JA 2FXIA 1KMHB 2QTWB 5DF1A 3NTUA 4NEQA 1KDYA 2IEIA 1KI6B 3A4MA 4G63A 3A6EA 2HLHA 4FQ5A 3FOCA 3V2HA 5LIPA 1YRBA 2WJVA 4N8EA 5LXTF 4OQMA 2UUOA 3EIUA 2E4ZA 3L1JA 4DLXA 3FMIA 3B38A 2C5EA 3T6KA 1A88A 3HB0A 4Q4HA 4KRXA 2XYVA 3C8HA 2Q0HA 3I37X 5DFAA 3ZY3A 3TG8A 2OB1A 4R7ZA 3ZI4A 1RBMA 1PHPA 3CLHA 3UMJA 3EEOA 1IBLB 5IKPA 5EC8A 4KYUA 4IXNA 1GYQA 3VM6A 1JQKA 2IZ5A 4RESA 4D6PA 1T3HA 1L6RA 3IS3A 2GHIA 1J90A 2IYAA 2V59A 3K2QA 3R41A 1RYDA 2V7XA 3KZ1E 4FHCA 5J63A 2ZM6B 5IFKA 1T6ZA 1ZONA 4L8YA 5JTTA 3HN2A 1T5DX 2IKSA 2GK7A 4OJQA 1N9KA 3WG9A 2NUAA 3MBOA 3KPJA 1V4NA 3QJGA 4JLNA 4M22A 4Q4AA 2BMJA 1SOWA 4WZZA 4D8VA 1VM6A 1PFVA 1JG7A 5LWQA 2Q2NA 3IUBA 4YDSA 1KH3A 3RYFA 2PMWB 5I51A 3PXCX 1JHMA 5BN5A 2OBNA 1WKCA 2QYTA 2Y0DA 3IQWA 1GL6A 1C3OB 5IKOA 3WB2A 4LPKA 5AXCA 3Q3GE 1J0XO 2QN9A 1U1DA 1UWCA 1OTXA 3PFNA 3VU9B 2OWDA 4GM1A 2TMGA 1QIFA 5C8DA 3F6YA 2PS3A 3UA3A 1RMQA 3ETJA 3WTBA 2VXCA 2M32A 2CWWA 1PR1A 2FG5A 4XSVA 2ZRIA 2AN1A 5FD8A 3RYIB 4L5YA 4K1XA 5AKZA 2O3JA 5TQJA 1YJCA 2BHSA 1SC6A 2RGYA 1V95A 1GTSA 1SN7A 1Z56C 3VKHA 1AN9A 4HAOA 2ZRMA 3BFKA 3HKCB 5ITSA 3O8NA 2FRDA 4MXDA 1OLSB 4U7FA 2XSZA 3W77A 3AUUA 1GY8A 1I6LA 1T3SA 2D1SA 3LT1A 4UEJA 1NPTO 3NHWA 4L5IA 1DLIA 4U2DA 1VKHA 4ZYYA 3OHPA 5J4YA 3RAFC 2EKPA 4FNMA 1J2JA 1GRRA 1BHSA 3ICWA 1HY3A 4IIXA 3V8BA 5AVQA 3N28A 2QL7A 4BUZA 1TZKA 2HRRA 4NEGA 1HV8A 3PICA 1GP2A 2B4RO 2ZUWA 2W98A 2ZYHA 2F43B 1XDGA 4ZT4A 2DQZA 1WHSB 3AHDA 4ESOA 3RC8A 1KZ1A 2Q3BA 2GJAA 1WZEA 3LY5A 2B82A 2PGIA 4DABA 3SHOA 3ZWQA 3AR2A 1X7DA 1YB2A 5DP1A 2GDZA 4BO4A 4AKHA 3RRZA 3H0KA 4LYEA 4MS1B 1FDUA 3D31A 2I3ZA 2QUZA 1VHJA 1PVDA 4RETA 2H0RA 2NSYA 3NH6A 1BCRB 2F9LA 4RZQA 5HBRA 2G3YA 2JK1A 3MD9A 4G26A 1NULA 3WRXA 4UOQA 3LS2A 5J2UF 3A3PA 1NQUA 3WNDA 2IBSA 3PQ3A 2XDAA 2COEA 3OM8A 1AQ6A 4B3DA 4ZN6A 1NKTA 1ZIOA 3B82A 3CH5A 4QRDA 2JCVA 2QYOA 3VGJA 2GN4A 1L1RA 3PC2A 4S1OA 2BFBB 2JA2A 3FYUA 2G25A 2ZBDA 1Q7GA 1PR5A 2VA9A 2Y99A 4MR7A 3RS2A 4B83A 4UNRA 5COBA 4OHXA 1LCIA 3G49A 4Q3CA 5TNXA 5JAQA 3D2BA 2VTVA 4NJEA 2E6KA 4IM7A 4F4UA 4NOLA 3PWSA 4NL4H 4BLSA 1T8YA 4E5SA 3NONA 1IY2A 3KV1A 1UZNA 3PNMA 4DWOA 4ZOLA 3PEYA 5CT4A 2YN2A 2R1TB 3DZCA 1ZD4A 2BFEA 3GLSA 1P1RA 3KFXA 5T8KC 3QLVC 1ES9A 4D1YA 4Q48A 2IZ0A 1VQ1A 2ZJBA 4BQEA 5JADA 2OV6A 4DV7B 1N78A 2Q21A 4EHBA 3A1EA 1PCXA 1C8LA 4OBWA 4CQLA 4PIPA 4A6XA 1S1CA 2D2VA 3B7PA 2CKMA 2Z3WA 3JYNA 5B7QA 2HJ9A 4L1KA 3A1TA 5IAOA 3HC7A 1VFNA 1R6AA 4I1UA 1ZLXA 4R1OA 4PLCA 5IABA 5KEIA 1XRPA 4LV6A 4Y3UA 1NVDA 1OOEA 1GUZA 2B7BA 3R5TA 3W9SA 4AULA 5JNSA 2Q5LA 2WKRA 5A4KA 5I45A 4K7JA 3GRRA 5F4BA 3FNQA 2ZPTX 2A9JA 4HB3A 1CR6A 3QFTA 3ZDZB 3X44A 3KSBC 4MYDA 1G2OA 4TS4A 4L9AA 4AD8A 1E3JA 2HSWA 3W2GA 1L5FA 1N9GB 1TUEA 1XTBA 1XG5A 3T52A 2YVAA 1JIVA 4GLBA 4XWYA 4GPEA 4C22A 1FVXA 3ESYA 4R1PA 2PMDA 3SD7A 4HNAB 3HL0A 3KTAB 2P4QA 4TT3A 1T1GA 3HDVA 1O4VA 1G2QA 1YS2X 3B2NA 4U7HA 4ZT3A 2ZB2A 5EOVA 1DTWB 2QM0A 3IAEA 4K28A 3W7VA 1ULUA 3F6RA 1UODA 3TNDA 3ICEA 2VZEA 3JR7A 3TXXA 2FPPA 1DXHA 2PBZA 3A1WA 3LE8A 4FIDA 4NBRA 4DV5B 4XYGA 2W2KA 5JCPA 3AGQA 1BGVA 1XLTC 2JIZA 1QDLB 1TIPA 1HZZA 3FCAA 4JLMA 5J2TF 4Z4CA 2F9FA 3WGGA 2BMVA 3OCJA 3WZLA 4NC9A 1KMCA 4YAWA 2Q8PA 4R2KA 3OSZA 3OVMA 4UTPA 4I4CA 4B85A 3LDHA 2O8NA 2FX5A 3IVXA 5C1OA 1RJGA 3EDMA 1E4EB 4BTLA 3THXB 2CNLA 3EGIA 5B7NA 1M1YB 2J9ZB 4JZYA 4PNEA 1BDIA 3KWJA 1ISPA 4BHTA 3IPYA 4D3YA 2R8PA 3VSBA 1CUHA 3PJDA 4QPNA 4WACA 4ZJUA 5I48A 2X7HA 1EJ2A 3QENA 1KRXA 2V9ZA 4D26A 1QYCA 2CMFA 2IH2A 2R7AA 1CQIA 4MOWA 4ERXA 3ZPXA 4WESA 1BMQA 1E60A 1CUEA 1DDGA 1NF3A 2GARA 4IIEA 3T5PA 1D2AA 4IIHA 1MAHA 4NZNA 4RTLA 4U02A 5BUQA 5CCXA 5I8WA 3HUTA 3I64A 2AQHA 1DBIA 4EVIA 3TGPA 5TPWA 3MGAA 4PSKA 3GO4A 3CCFA