3OPNA

The crystal structure of a putative hemolysin from lactococcus lactis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
209
structure length
208
Chain Sequence
KLRYVSRGGLKLEKALKEFHLEINGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAWKIRSDERVVVMEQFNFRNAVLADFEQGRPSFTSIDVSFISLDLILPPLYEILEKNGEVAALIKPQFEAGREQVGNGIIRDPKVHQMTIEKVLKTATQLGFSVKGLTFSPIKGGAGNVEFLVHLLKDGKAEIAQQVNIESVLQKESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative hemolysin
publication title The crystal structure of a putative hemolysin from Lactococcus lactis
rcsb
source organism Lactococcus lactis subsp. lactis
total genus 67
structure length 208
sequence length 209
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3opnA00
1N7JA 1N7IA 5F2NA 3LPMA 2IFTA 5M5BA 3KR9A 5BW4A 5LQCA 1WS6A 3SVZA 2ZWAA 3CVOA 3GJYA 4K6MA 3F4KA 3IHTA 2PT6A 1VPTA 5K09A 4X61A 1O9GA 4A6EA 2PBFA 5KQRA 4PGHA 1VLMA 2AOWA 4Y2HA 5EG5A 4C07A 2ZFUA 5GIOE 4RTMA 1H1DA 3TOSA 2Q41A 2BR5A 3KU1A 3M6UA 4HGYA 5K03A 2ZCJA 3NW9A 4X60A 1L9KA 3UJDA 3A27A 2YVLA 5ICEA 2WA1A 2EFJA 3MAGA 2Y1WA 3TR6A 4WVLA 5GOZA 1XCJA 3KQVA 5FULA 5DT2A 4HGZA 3R24A 2G8NA 3OU6A 3M6XA 3FPGA 2GPYA 3FUXA 3OU2A 1VP3A 3DLIA 3BWCA 2PX4A 4RVFA 3SXJA 3UA4A 1R6AA 3THSA 5K0GA 5DXJA 1R74A 1X19A 3ELDA 3M6WA 3CJRA 3R9XB 4B17A 3DLCA 3HA3A 1QANA 1SVUA 3KQTA 5JUWA 3EVDA 1XDUA 3AWIA 3FPHA 3KQPA 4PYLA 3P2EA 5T64A 1EJ0A 2BH2A 3KR1A 1ZQ9A 3X0DA 3LCCA 4DZRA 2FHPA 3KPVA 4AZTA 5LQRA 3FUTA 3CGGA 2OB1A 1BC5A 3CJQA 3DUWA 1ZGAA 2XYQA 2C7PA 2PLWA 3M33A 1B42A 2O57A 2YXEA 3LGAA 3HA7A 4F85A 1L3IA 3DOUA 4X41A 5GWXA 5KVAA 3UJBA 5GIPE 3NDIA 2EJUA 3TM4A 1NV9A 1VBFA 3OZSA 4OBWA 3MHTA 1JSXA 3EVCA 3FUWA 3LBYA 3PT9A 1PRYA 2B78A 4YV1A 3ORHA 3ER9A 2UYCA 1R00A 3Q87B 1WZNA 1WXXA 2N47A 3LX6A 2R6ZA 4C08A 4ATNA 3QOXA 4PINA 5FHQA 2JH8A 4IKPA 2ONZA 3T7SA 5K0JA 1RJDA 3FUUA 3WSTA 2H00A 4E31A 4RTJA 2XYVA 3UA3A 2DULA 4EKIA 1JSZA 2OB2A 3O7WA 3DXXA 1JTFA 2QRVB 3GRRA 3D2LA 2FCAA 3HCEA 3VSEA 5LSAA 4RTQA 3DXYA 5EIFA 2FRXA 4L7VA 2IDKA 3EEOA 3NDJA 3GO4A 4E2ZA 2GB4A 3B3FA 5K8VA 3VC1A 3KR2A 1NKVA 2UZ4A 2ZWVA 3FYCA 4HC4A 4JXJA 2JG3A 4MHTA 2ZZNA 4GC9A 5FWAA 2QRVA 1VQ1A 2LD4A 3EPPA 4HG2A 3FPFA 3FZGA 2ZIEA 1WY7A 4V0QA 2HWKA 3BGDA 3NWBA 5DTRA 3REOA 3U81A 2OXTA 3UZUA 2BZGA 2AS0A 2HNKA 3TKYA 1BOOA 1M6EX 3FYDA 3HTXA 2QM3A 1M0EA 4C4AA 4PYKA 2PT9A 2C7QA 2GS9A 5DM4A 1QAOA 2ESRA 3EVZA 3GWZA 3P8ZA 2NXCA 4ZTBA 3UJ9A 3KPYA 4RVHA 4YUZA 4OQDA 2OKCA 3AXTA 2I62A 3A25A 3B3GA 5FTWA 1JQDA 4MWZA 2AVNA 3HVHA 2OYRA 1D2HA 2ERCA 3K6RA 4ISCA 1DCTA 5FA5A 5C9ZA 1F38A 2P8JA 4F86A 4RTKA 4FGZA 4RTLA 4C04A 3BXOA 3OCJA 1U2ZA 2UYOA 3ELUA 1Y8CA 4GOMD 5P8WA 3KPJA 5HEKA 4YUWA 5T6BA 3M6VA 3FTCA 4BP1A 3PLAE 2WA2A 4X1OA 3CC8A 2OO3A 4QVGA 3UJ7A 2UYHA 3DH0A 3E05A 5CVDA 1NW8A 3GNLA 3P9NA 2HR1A 5IKMA 3ANXA 3MERA 3QV2A 2PWPA 1NE2A 3TMAA 3FTEA 2HTEA 5EMKA 3G8BA 2NXJA 5K0BA 2AOVA 5E1DA 3LECA 4QTUB 2I6GA 2BR4A 2VP3A 4XUDA 5DTMA 5FA8A 5C0OE 3TLJA 4PYJA 4CTKA 1EQAA 2JHAA 5ICCA 2YUIA 1EIZA 1TPYA 4A6DA 4FSXA 2Z6UA 4DA4A 1KPGA 3AY0A 5KS2A 10MHA 2YX1A 2R3SA 3JWIA 1G60A 3P9CA 3HCCA 4KVZA 5DM2A 3SX0A 2QYOA 1AQIA 1X1BA 4FS8A 5GM2A 3E7PA 1AQJA 1YB2A 2P35A 5FUBA 2YQZA 4RTOA 1YFJA 4YUXA 5EGSA 1NW6A 4RSRA 4G56A 2I7CA 4P7GA 3G8AA 3KQMA 4FR0A 1T43A 4MTLA 2H1RA 5CCBA 3BT7A 3EGEA 2AR0A 4PNEA 4E2XA 3GRUA 3ID6C 4E33A 1ZHFA 1JQ3A 5EHIA 3VYWA 2ONYA 3MQ2A 3TRKA 1UFKA 4OBXA 4NECA 3OE4A 5LQKA 4KDCA 1WG8A 2PXAA 1P1BA 3DTNA 3TPZA 5KQSA 4RTSA 3P9IA 2Z6QA 9MHTA 3GRZA 3G2OA 4KWCA 2P1DA 1QYRA 3G7UA 4PYQA 1ORIA 1XVAA 3UFBA 2IDJA 3LSTA 3LCVB 2KW5A 5DX0A 2IBTA 3NWEA 1KIAA 2BR3A 3DR5A 2UYQA 1BKYA 1SUIA 1TW3A 3KR0A 4R6WA 3G5TA 4YMGA 5LQJA 2P7IA 3BWMA 2ZBQA 2IGTA 3JWJA 4RVDA 1D2GA 3PX3A 5CVEA 3T7TA 3UJCA 3OPNA 2EJTA 3FTDA 4CKEA 1INLA 3G2QA 2CWWA 3FRHA 2PX2A 5K0LA 3M70A 1RI4A 2OZVA 4RTPA 1RJGA 5U4XA 3FTFA 4IV8A 4E2WA 4YV0A 2AN4A 4PYNA 3HM2A 1XCLA 2IPXA 3G2PA 3HCBA 3O4FA 5CIYA 3G2MA 5EMMA 3FRIA 4KIGA 1MHTA 1V39A 1XXLA 3PVCA 3PFGA 5E1OA 3SSMA 3EVAA 5CD1A 1UIRA 3MTEA 2Y1XA 5T67A 1XDSA 4DM3A 3HP7A 4C03A 2GA9A 4LECA 1HMYA 2V7EA 3PB3A 4P7KA 4DF3A 4M38A 2ZTHA 3I9FA 5EKXA 3RIEA 1NW5A 4ER7A 3HNRA 1KR5A 2ZVJA 5EMJA 1RI2A 3KQQA 3LBFA 5G02A 5DPMA 2K4MA 4P7FA 2EX4A 4PYOA 2VDVE 2YTZA 2NP6A 2ZULA 2JH9A 2ZLBA 2QY6A 3SR4A 4M7RA 1VL5A 2BM9A 4CKBA 2I9KA 4RVGA 1Q0SA 4GOND 5BP7A 4EMSA 1YZ3A 1YFLA 2YXLA 4U7PB 1YUBA 2QE6A 3IYLW 4P7JA 1FPQA 1NV8A 1VE3A 4QQNA 2PX8A 3TKAA 5F2KA 4C06A 5DTQA 4BLVA 5K0NA 3KQYA 3LDFA 4GEKA 3MB5A 1SUSA 2XVAA 4YUVA 3VC2A 1N2XA 5LR6A 2G70A 3P97A 1I4WA 5E9JA 4ER6A 2B9EA 3GRYA 5EZSA 2AN3A 5EVJA 5F2OA 2ZZMA 3C6MA 5LQNA 3OU7A 4QPNA 2NXEA 2P3LA 3C0KA 4MQ4A 5EEGA 3FPJA 2XBMA 2O0LA 5EMLA 1JG4A 5E1MA 2ZSUA 1NBIA 5E9WA 4DQ0A 3I53A 1ZKDA 4GOOD 4GUAA 4CXMA 4HTFB 5CM2Z 3FPEA 3A26A 4PGGA 1EAMA 4R6XA 3C3YA 3HCDA 1QZZA 1VP9A 3MGGA 4XUEA 2PJDA 4R8SA 3C6KA 4RYLA 1F3LA 2AVDA 4EQZA 3B3JA 3ELYA 4FSDA 1XJ5A 3MTIA 4M37A 3OZRA 4IV0A 4XCXA 5D1HA 5DX1A 4BP3A 3P2IA 4POOA 4HTFA 1JTEA 1JQEA 2CKDA 3HVKA 1O54A 1DL5A 2A14A 1RJFA 1L3CA 2VS1A 5E2AA 2GH1A 4H0NA 2NP7A 5EHGA 3RODA 1SQFA 2P40A 3UJ8A 5DSXA 5B1SA 2G72A 3DXZA 3T0IA 3P2KA 1L3BA 2IH2A 3P71T 1UWVA 4XUCA 2YR0A 1L1EA 4KDRA 4KRGA 5CVUA 5EC8A 5E8JA 5EIWA 5EPEA 2PVCA 4CWAA 3UBTA 2WK1A 5FWDA 2B3TA 3PFHA 2CMHA 3V97A 5C1IA 5K01A 1NBHA 1TW2A 5ICFA 1RJEA 1QAMA 3EVEA 3AJDA 3EEYA 2NYUA 3OZTA 2VDWA 1VIDA 5DM0A 4RTRA 2ZBPA 2AOXA 2NNWB 3A7DA 3BWYA 4QPPA 4AX8A 4DCMA 2ORED 5CCXA 3SSOA 4BY9E 3GU3A 5E1BA 3HCFA 4GC5A 1X1CA 3ERCA 1DUSA 1X1AA 2VZ9A 4O29A 3G5LA 5HIJA 4C05A 4RWZA 1XTPA 4HSGA 3KHKA 5ERGB 2O07A 5DWQA 3TQSA 1G8SA 4P58A 3NMUF 4KW7A 4E2YA 1OR8A 3CJTA 2ZIGA 3UWPA 4FZVA 2JHCA 4QDKA 3HVIA 4QQKA 1P1CA 4E32A 4YV2A 2G1PA 3E8SA 5E9QA 1R18A 3ME5A 3V8VA 4CKCA 3DMGA 5LQAA 3KQOA 3KPUA 3DMHA 1YZHA 4DMGA 3T7RA 3OFKA 1IXKA 1NW7A 2ADMA 4FP9A 3LDUA 3EMDA 3I64A 3HEMA 3LL7A 3GCZA 1PJZA 3NJRA 4PWYA 4E70A 4DKJA 5DM1A 2IH4A 2CL5A 3BGIA 1ZGJA 5DRYA 5DX8A 4PYMA 3KQWA 2PSSA 1G8AA 4RX1A 1G6Q1 1NW3A 5FCDA 5GM1A 3KPWA 3SM3A 3NVKI 3R6TA 2FK7A 4UOEA 2CMGA 4GQBA 1AF7A 2HMYB 3I58A 1KHHA 3SSNA 3B5IA 3G88A 3GRVA 4AZVA 2PY6A 3LKDA 5K0EA 1SG9A 3R0QA 1O9HA 2ZIFA 5K0CA 2IH5A 3O31A 2BM8A 3UJAA 2V74B 5K0FA 2P3OA 1XDZA 1RI1A 2OBFA 3DP7A 5D1NA 3LDGA 3BKXA 4QTTB 2AOUB 3E23A 3IV6A 5CUQA 3LKZA 4Y30A 2YXDA 4YMHA 3MCTA 4ER0A 3UJ6A 3CBGA 1ORHA 2P3QA 4KIFA 1M6YA 2B25A 3GIWA 4OA5A 5DXAA 2C7RA 3FUVA 2IBSA 1KXZA 2JJQA 2PXCA 3DULA 1G38A 4PCLA 4WXHA 1KPIA 3L8DA 3MCZA 1FP2A 2AOUA 2Z6AA 3A4TA 2B2CA 4GBED 4Z2YA 2H11A 2OPBA 3HVJA 1D2CA 4M36A 4PIMA 4QDJA 2ZBRA 5BW5A 4RTNA 2O05A 3QOWA 3NVMB 1R8XA 1FP1D 2ZZKA 2AZTA 1HNNA 4FT2A 4LWOA 4QVKA 1AV6A 5HILA 2OY0A 3B7PA 3ELWA 3OFJA 3GXOA 1Q0TA 1P91A 2FK8A 3CKKA 4V0RA 1RI5A 4GOLD 4X63A 3TM5A 5EOVA 3HCAA 2O06A 5ICGA 3PTAA 3HA5A 3BWBA 5HFJA 2F8LA 4FT4A 3BZBA 1YF3A 2AN5A 1BHJA 1JG2A 2PGXA 3KQSA 2FPOA 5HOQA 3IEIA 3RW9A 4EK9A 5H02A 1JR4A 2EG5A 3OE5A 5LQUA 2G71A 3EVBA 2DPMA 2AOTB 2FYTA 3C3PA 1IM8A 1X1DA 1SKMA 1ZG3A 3GDHA 4YUYA 5K05A 5DRTA 5GINE 2PXXA 4GF5A 4IWNA 3THRA 1EG2A 1G55A 2GLUA 3B89A 3TFWA 5GP1A 3P9KA 5DLYA 5IH3A 4AZSA 1QAQA 1WXWA 2AOTA 3DMFA 3LCUA 1KYWA 1JG3A 5CVVA 4AZWA 1Z3CA 4OA8A 5MHTA 2PV0A 4MIKA 1P39A 3LHDA 2IP2A 5EKUA 3EGIA 4ER3A 2VDUE 4ER5A 3AXSA 8MHTA 2XYRA 3PX2A 4EVIA 4PYIA 5CVJA 4BLUA 5HZMA 5BXYA 3ER8A 3JWHA 4LG1A 4U7TB 3G89A 4HRAA 2IIPA 1FBNA 1FJXA 3SGLA 2E5WA 1IY9A 1KYZA 5HIMA 2XVMA 4BLWA 5FADA 4PIPA 5FQOA 7MHTA 3EGVA 5E8RA 2NXNA 1KPHA 2PWYA 3CCFA 4RV9A 3EMBA 3EVFA 3H2BA 5HIIA 2P7HA 3JWGA 4CTJA 4PONA 3BGVA 3GGDA 3M4XA 5FHRA 1KP9A 4DCGA 2PX5A 2ZW9A 3Q7EA 4R8RA 5HIKA 2C7OA 3I5UA 3NTVA 3A7EA 5EEHA 5KYGA 2PKWA 1SQGA 1JG1A 4E30A 5DSTA 4PCAA 3K0BA 1MJFA 3BUSA 2GAFA 3BKWA 3KKZA 3EVGA 3R3HA 2HV9A 1RI3A 3PS9A 4HH4A 4OX9Y 5EZQA 1NT2A 2JHPA 5JR3A 5E2BA 3SMQA 5FQNA 4R05A 2P41A 4AUKA 5EQJB 4EKGA 1I1NA 1I9GA 1EJ6A 1R8YA 3S68A 4OQEA 4F84A 4LWPA
chains in the Genus database with same CATH superfamily
5DNCA 1W88B 4NCHA 1T10A 3KR9A 4G9GA 1CZRA 1XJQA 4H0FA 1RWOA 3CY6A 4FGKA 5C51B 5LMUB 2HFJA 1VPTA 3CLTD 5K09A 3A6EA 1XD9A 3DWEX 2W2LD 3GEIA 4IINA 3GF4A 4PGHA 5CH8A 5GIOE 2GZDA 3AGPA 5D7BA 5TMEA 4DV0B 1DB3A 1RMQA 5JSKA 2IHTA 1CJMA 2HW8A 4J43A 2GESA 4AAYA 5E3JA 4GMHA 1FIUA 3AILA 4HQNA 2WA1A 4DLKA 1KAGA 2Y1WA 1U1FA 1XLWA 4QIHA 3EW9A 4WVLA 3DVQX 5GOZA 2ZI9A 4MULA 1J99A 1JDNA 3A4LA 3AIIA 2GPJA 2QLLA 3QWBA 4K3UA 2WMDA 1N5MA 2OGSA 3M6XA 1XI2A 2ID8A 4CTMA 3OU2A 2BEVA 1L4GA 1YKFA 1XVUA 2H18A 4BFVA 2GEFA 3D2AA 3WLFA 3UA4A 4MW5A 3GLIA 2BWJA 4QU8A 1Y5NA 5AVZA 4L0CA 2C9CA 1NXXA 2YICA 4MP3A 4RQUA 5IAEA 1XDUA 2OCAA 4V02A 2WU4A 2X4DA 3H65A 3L3BA 4OJKA 5BSMA 1PK7A 3D4OA 5HTOA 5LIRA 1PNTA 2OHOA 3AESB 3BH0A 3HUEA 3MLAA 4I14A 4J4TA 3FNQA 1EK6A 1FXWF 3D3JA 4TMYA 3WNBA 4PAGA 1MO4A 3QMMA 2YWRA 1EM8B 4DUPA 4A9AA 3G2KA 2VHUA 4KMMA 1JSLA 5AVQA 1LI5A 2ZB7A 4M1EA 2WFLA 4LAFA 4R69A 3SJAA 4L5BA 3TW6A 1QG4A 1KOJA 4EECA 4N7RA 2R84A 3UHFA 2HK9A 2XQJA 2Q6LA 1ZVMA 3KBBA 1KEWA 4IG9A 3ZD7A 4QOHA 1YGPA 5ADHA 5KNDA 1X7ZA 3FBWA 3TO5A 4JYPA 3CH5A 4OKIA 2A33A 2EQBA 3F98A 4ZQCB 3PEYA 1ONNA 4F38A 3UA3A 4ABTA 1YIOA 4TKUB 3OZBA 4MI1A 3ZY5A 4MW9A 4UCWA 5FDFA 4AKGA 2A1UB 3IBTA 2GZ1A 4DBVO 4I3FA 3CNNA 4XWGA 1XTUA 2OQVA 1ESNA 1SN7A 1ZU5A 4QRHA 2QP4A 2L0XA 4XM0A 2VAMA 4EHLA 1UBMS 2LW7A 1B73A 3UJNA 4E2ZA 1BSVA 2XTNA 4S2EA 1XVVA 4HDQB 3SQDA 4JI2B 4P98A 1VQ1A 1WMDA 4TSKA 3FZGA 1DEAA 5BNFA 2XDWA 3EC1A 2W2KA 3WV4A 4EFMA 2IX3A 4BIIA 3E6AA 1RVDA 3B9RA 4ZVTA 3ZQJA 5BMVF 1FFBA 4ND1A 4D4IA 4G0WA 3DEZA 4TUYA 2J3DA 4HLUC 5DM4A 1EAYA 2MCFA 1ZRSA 3W2GA 4PFKA 4KPYA 1UP6A 1ZVJA 2NSJA 4ZOEA 2ZJ1A 1W36B 3OF3A 3Q9UA 1DC5A 1DMSA 2F9LA 3ETLA 3WYDA 1ZPDA 4XD2A 1SZCA 1BE1A 1ONBA 4MVJI 2AVNA 13PKA 1XZMA 1WZUA 1YQUA 2FX5A 2GOYA 2XRMA 4JK3A 2OYRA 3TXXA 5H4HA 4BZZA 1U63A 2R7LA 1NUSA 4IIHA 1CWUA 221PA 2FF5A 4HS4A 4JBIA 3R8CA 4PPNA 1A9OA 3O5AA 3RKRA 5T4BA 3OPMA 5HKLA 3M6VA 3TW4A 1KMNA 1ENYA 4YYEA 3ZTWA 2Q5JA 5DGHA 4C6TB 5K2OA 4IHAA 5T4HA 4FN5A 6LDHA 2RJ3A 1QIJA 2KM1A 2AZXA 4BKOA 3P2YA 4CETA 4TM8A 4UUOA 3P9NA 2ZRMA 4GPBA 2QMZA 3G8BA 2Q9BA 3T41A 1UDRA 3QTLA 5BWLA 1PZXA 3CW2A 3C5EA 3NONA 4RIFA 1W25A 1QFXA 3AEQB 3JD1A 3WGHA 2XUGA 4XUDA 3EFEA 2WNHA 4ZQEA 3R1IA 1A88A 2C4HA 1EQAA 2I2XB 1OTYA 3M81A 4CFSA 2BAGA 1Y5IA 4KN5A 5DYWA 1XP5A 1K6IA 1ULTA 2J3EA 4IIXA 2P69A 4OY3A 4CTNA 4ZVSA 3N0XA 3Q3HA 1Z82A 1S89A 4BHTA 3NU1A 1X0VA 4CF4A 3T3DA 1MABA 3WIBA 1CERA 1U8XX 1G63A 3AFMA 4TS3A 1TM5E 1YDEA 2IYPA 4KX5A 1H2WA 4V03A 5FKJA 3W8DA 1JYEA 1X8XA 3OAAA 1J00A 4EI8A 3ZZNA 1KAQA 2JBHA 4K9PA 1HRKA 2YQ4A 4V0ME 3UV7A 1H9CA 4ZQHA 1SQ6A 4B81A 3GPCA 3U60B 2CEKA 3KKNA 3FJYA 4MW6A 2BL4A 4QFDA 3WK4A 5JS8A 4I1RA 5B7NA 4A0FA 3GUYA 3CGWA 4XSVA 1FTWA 1RPTA 1KO7A 5DASA 2ZSDA 2O2DA 3B8EA 4KDCA 3DTNA 1PYDA 4L3VA 5HFNA 3WGKA 2G6TA 5B12A 2D3TA 2UUBB 5BOSA 5B57C 5B58T 3INRA 1B16A 1ID8A 1Z68A 4P0QB 5TNXA 4PLTA 4LJKA 5DGDA 1LJ8A 3HO8A 1FRQA 1SCNE 4YGYA 2JGNA 1Y4UA 5B55A 4L5CA 2XKAA 2X8JA 1P5JA 1KQNA 5FTMA 2PIDA 1UJBA 4V3BA 5AW4A 3W5BA 1ZICA 1CKEA 2P7IA 4EF5A 2Y1FA 1WDTA 3NZEA 3SYMA 4J07A 4YXWD 4YRPA 3MVEA 2EYQA 3HM9A 1KI7A 1NR1A 2F90A 4M3NA 4PLGA 2ZAOA 3ISVA 1JBEA 1NJ2A 2Q9CA 5L45A 1CJCA 3IAS6 3M70A 3RRNA 1ZVQA 1Y4ZA 4P33A 1E3LA 5DHFA 1J4AA 1GHTA 3F8SA 2XMRA 2FP4A 3L0IB 4I1VA 4XSHA 5AOBA 4GL4A 2NUPB 3H8WA 5FUWA 1B1AA 4RVOA 3SHVA 1F1JA 1A82A 4R1QA 3ADDA 2TMGA 1GNTA 3MTEA 2QAGB 3AZQA 2HHCA 2FX3A 1D4OA 3FVQA 3SJ7A 3UGTA 1UCFA 5K0ZA 1U2EA 1R6UA 2GA9A 2VJQA 5C4IA 5GADl 3BCSA 1JIKA 2ZRDA 3R4VA 2K2WA 3QUBA 2BGWA 4P7KA 1XVIA 2SKCA 2YWJA 3RIMA 3C4JA 3QPDA 3BZWA 1AXGA 5ALVA 4LYYA 1G9TA 5CR9A 4YRIA 1H4TA 4X6XA 3DQZA 1J2UA 1RFLA 4D9FA 1BDBA 2NQTA 3HXLA 5CPFA 2C2ZA 2I55A 3A4NA 1B8PA 2HI0A 3QXSA 1JDBC 4RD0A 4UBIA 2Y1DA 1ZAYA 3C8MA 1Y8RA 3KQNA 2NZUG 3LRXA 4MUYA 4CM6A 2RH4A 1Q0SA 1V41E 1QQAA 3BN3A 1YZ3A 1LI4A 3C3XA 3V4FA 2PRSA 1RVV1 3A6ZA 2WB4A 2X0NA 1MAUA 3UWDA 2HA2A 3K2EA 3ROPA 1BDJA 2O52A 2PFGA 3R7NA 1Y1SA 1FNSA 3DV0B 3BXHA 1M34B 1FYXA 3V8BA 1HFEL 1N5RA 2QR2A 4AWXA 2OE2A 1J5EB 4XZ3A 5T57A 4YNBA 2ZT5A 2PLNA 3TG8A 1XL0A 3IUEA 5DBOA 2XGOA 3I4LA 4ZAFA 3EXFB 1UXJA 1MJNA 1J8QA 5BW6B 1RKUA 2PJUA 4HB3A 3MJCA 5EEGA 1WOYA 3QVKA 1N78A 1A8PA 1CQZA 2E82A 2EW2A 1RDFA 2QPLA 2WU8A 2ZE6A 3MRTA 5M3BA 4RPIA 4PGMA 4RV4A 1EAMA 3RTAA 5BR7A 5L3VA 3HCDA 4WFQA 1S96A 3Q8KA 4XUEA 2DETA 3OCWA 2PMWB 3C6KA 3KOZA 4RO0A 1WV0A 4C7XA 5IAOA 5IG2A 5CCEA 2AMYA 1T6BY 1OXMA 3C3MA 5ES3A 3VSDA 4HTFA 3NAZA 4DQXA 3DOIA 1J09A 2VSXA 5AI9A 4FJ1A 1GNLA 3AKEA 4H0NA 2Z6VA 3UXYA 4B2IA 1XXHA 2NV2B 3VSBA 4KREA 3TJMA 3EEIA 4ZC8A 5TXGA 3SBXA 5JQGF 2Z9BA 4DNOA 2ZQYA 4CV3A 5L4NA 1E1MA 3GY0A 2PUFA 2D13A 3NHYA 3V97A 4ND2A 1XRLA 2CMHA 4ZGGA 5K01A 3MOIA 1FYWA 2CJFA 1TQDA 2SCUB 1Z6GA 1QAMA 4XB6B 1M76A 4MINA 1Y0BA 2AFVA 1STOA 3BPSA 1U98A 2Q4BA 2FPMA 3KZOA 4LDRA 2BJWA 1Z2CA 2QD1A 4GHWA 2WZQA 4KSYA 5JCZA 1PR0A 3FB4A 5CCXA 1T9CA 5TPWB 3FHCB 2JKYA 3GU3A 3PZBA 4NDAA 1XU7A 4LV6A 5FWNA 1IU9A 5CX1A 3ERCA 4KNYA 3OUUA 4GPTA 4X85A 3U2QA 4F2WA 4K0KB 3GJXC 1RM4A 3KHKA 5DFAA 3RC7A 3ZWXA 4A6XA 5G3YA 4X5OA 3VVCA 5DGXA 5IYZF 3GYGA 3D0RA 5AUOB 1RLMA 2JIPA 3DZDA 3T52A 4AYTA 2B1IA 1I4TD 1TEVA 4RLFA 4W5NA 5HZGA 1ARZA 2HEGA 4QQKA 3HVIA 5LP6A 3OD1A 3R8XA 3U7JA 1EWYA 4RC9A 3ZCUA 5HPYB 4YCCA 4TMTA 3QU2A 5JIBA 3R3WA 3FCAA 3R9KA 4CKWB 5HX7A 4NBWA 3B12A 4J2TA 4ZFNA 1K7CA 3AU9A 1L7RA 1HYEA 2RI0A 3HN7A 4W5RA 1C3JA 3U17A 4C5CA 3KKOA 4G36A 4FFDA 3LDUA 1ZI9A 3UWOA 1DAOA 4L8VA 3A2NA 5KAPA 3D1VA 4IJQA 1N9GB 5DNWA 2A84A 3KELA 4BFYA 2F1OA 1T9GR 1Z38A 3ORFA 3O8DA 4LV5B 1NKTA 3LVRE 4RDXA 2QIPA 2VDLB 2EKBA 4R0VA 1BJRE 1E9SA 1U3CA 3N7UA 1E6KA 3VMMA 1KHHA 1QZUA 3IESA 3SSNA 5EAIA 1ZVVA 1R0KA 4IRUB 1I4OA 1NX6A 1S3SA 2FX2A 4PPGA 5CW2A 1YU9A 5JS2A 1TKRA 3E7FA 3LT0A 1GGKA 5JXGA 2ZRKA 1IEQA 4RK5A 1E8NA 1SC3A 4RS4A 1Z06A 2ZJ7A 4EF6A 3DCIA 3OLZA 1VJTA 1CY6A 1R0RE 2OENG 1YZVA 5F4BA 1BA2A 1LY1A 2PKCA 5EFZA 3MGAA 4ZN6A 1P4HA 1JVBA 1KFEB 5MN5A 2BMEA 4X95A 4DXDA 1U8TA 2B25A 3JU3A 4RZSA 3JAKB 2AZDA 4XD7D 3DC2A 3FYTA 1J0CA 4Q05A 1KE1A 5GY7A 4WXHA 2NTVA 1KPIA 2FSUA 2QD3A 1QZXA 3T1VA 1PNRA 3DXFA 2FWPA 3SR0A 5T5QA 3IAM6 1LZLA 2O05A 3RF6A 1D8AA 1R27A 3ND7A 2IV7A 3NVMB 4WD3A 1KK2A 3LT2A 4YI5A 2C07A 2Z2ZA 5KHOC 4AQ7A 1MQ8B 2LVBA 4FEAA 4JT2A 4IQ8A 4Z49A 3DO5A 2HSGA 4EBFA 3EC7A 3I05A 4JY7A 5LWHA 1C50A 1WO8A 4OUDB 5CA0F 1HDYA 1YOVB 1N6NA 1R4MB 1VKNA 2O3QA 1USIA 2J9RA 3ND9A 4TMFA 3GG2A 1D2RA 4IP0A 4YHBA 4H16A 4YAEA 5SV2A 4FZ5A 4P81A 5KTYA 1IY2A 4P3PA 2A4MA 5KYNA 2F8LA 4FT4A 4RVNA 2CVZA 3Q12A 1BHJA 5F9MA 3VX4A 2JFUA 2ZSAA 3W3AA 2YUTA 1NMYA 3DZKA 5LQUA 2G71A 1FU4A 1L5RA 3B5EA 3WK8A 1OA1A 4K2AA 3ODGA 2WINI 3UAVA 2XUHA 3G5UA 2IP1A 1CFJA 1D5CA 4MWGA 4F0JA 1X7YB 3E1GA 1NATA 3SQNA 3B89A 1UBNA 1W0KA 4IUBS 4WLVA 1YCDA 3HU2A 4LXYA 2HF2A 2ZTSA 1H9BA 4I8XA 4K0RA 4M54A 5F1YA 3RUPA 1Z08A 2CL6X 2VYVA 3ZBTA 3K9BA 3UKOA 2PWAA 3BYZA 1S1MA 2ZVQX 3NIDB 5FT9A 2IEDA 2FSHA 2HLDA 4YJ2F 4AZWA 4F6RB 2JLYA 3K1YA 1TUGA 3MTJA 1DC3A 4ZVUA 4COOA 1MO3A 2IC5A 1RQ2A 2ZE8A 4X1IB 5D3MA 5PNTA 1AKRA 2O8EB 3QLUA 1H3NA 1PL7A 2JF0A 4IGKA 1FJXA 1PFKA 3PDIA 1UDXA 2X1LA 3OH8A 5EN4A 5HIMA 4DIUA 2WM3A 4JROA 1T5BA 4R0MA 1F2TB 1TKAA 3R40A 4Q02A 1LDNA 4O2AB 4QRDA 4BKPA 4F7DA 3CCFA 5HJ5A 2GX6A 2TS1A 3K9FC 1SVMA 4TL9A 1T2FA 2C4TA 1C3LA 2EKQA 2NVUA 1JN0A 4D98A 5BRAA 2GETA 1YE3A 4UTRA 1TOAA 2ODPA 3EWIA 3GEGA 1EJBA 4R3NA 3G2IA 5D5QA 4D46A 3ZEAA 4TTSA 2B2XA 4S12A 4GQAA 3JVIA 1DI0A 2R6CA 1XRPA 1OX6A 1ORRA 4KKVA 5M29A 3BUSA 5LN1A 1UEIA 1ULZA 3ZK7A 2ZTVA 3D6FA 3O8RA 3H42B 2Z5LA 3CPSA 4BATA 1OLXB 3OJXA 2X1MA 2HHAA 4JLKA 3KTAB 8ATCA 2QL5A 1UBGA 2MYNA 3L7IA 4EGQA 1RHMA 4YXFA 2PZJA 1Z2OX 4L51A 3FM9A 1HG0A 4F84A 5I9LA 2PKQP 3WKCA 4EB6A 1JPVA 2AQ8A 4DG9A 1MA3A 3MIZA 3E8MA 1NZDA 2N1BA 1LK0A 3FH0A 3ZVLA 3STYA 2R7KA 3FA2A 3VZDA 3ANSA 2QSUA 4HLQB 2RAFA 1O94D 3H1TA 3T9EA 2EFDB 1YJBA 2ZFUA 5JWRA 2A9VA 3QMPA 1DO8A 2AJ8A 2FEKA 2PN1A 5K99A 4ZI7B 2OBLA 3KSMA 4I5IA 2HRDA 1IEWA 4L8WB 4RIIA 4KVFA 2WT4A 3MWDB 4L78A 4TROA 1FDRA 4HQKA 4QUGA 1ML3A 3K5IA 3NAGA 1ZR4A 4LA4A 3OFNA 5CJPA 1XG5A 4Y7DA 3RS3A 4RFSA 1ZY2A 2PL3A 1HG1A 2RH9B 5J5CA 1ZK2A 2XXJA 3E7WA 4HBGA 3RC3A 1SB9A 5DGCA 3WSVA 2BUBA 4B6GA 1I9CA 1F8GA 4ZAGA 4WKOA 4JKIA 3JQPA 2OAQ1 2VDMB 2BHTA 3KQTA 4DOMA 4CLRB 1R8QA 1QRRA 4BGIA 5T64A 3NDPA 2JZOA 4AZTA 2I6XA 3COWA 2YFHA 2H1IA 1BVUA 3PEUA 4ML3A 5AW0A 2H3HA 2BISA 2Q3JA 4BN0A 3T35A 4JLOA 3NHPA 4N8EA 3AEXA 5KTPA 3R5JA 3NM4A 3PIDA 2B6NA 3ENVA 4ZOAA 3G8YA 1TA9A 5GIPE 2DT5A 5C46F 4K5QA 2HD4A 1TZBA 1B6RA 3FDZA 3AERA 3DS8A 4Z2AA 3O1LA 3KOUA 2WVAA 3A4YA 3QOXA 4WVFA 4ZIRB 3GJ6A 3L1VA 1P2DA 4E1AA 4DCPA 2XRFA 2HNBA 5C1OA 4U7DA 3PGA1 4KMRA 1DLJA 1M8PA 4A5OA 3OTOB 1SG6A 1JSZA 3CVUA 4OLBA 1C7IA 3W06A 4LJYA 3VSEA 1FTYA 2OBBA 3TTSA 2QW1A 1MT3A 1B0UA 2GEJA 3BJEA 3L7LA 3RYHA 4EQ6B 4EVQA 4BZQA 5JS6A 3NDJA 3GO4A 3IUQA 3F3YA 3UFXB 1U1DA 5JASA 1V8PA 2ATXA 1TA0A 5DI3A 2ASVA 1DT5A 1OIWA 5CB8A 1HTTA 2P30A 5I4IA 1DCKA 4J1TA 4YBRA 3DCJA 4ZANA 3REOA 4AJ4A 3PUWA 1X7WB 2E9SA 3FBTA 2WJ6A 3H97A 3TQTA 1LX6A 3ZKAA 3NQ41 3HTXA 4JSRA 4G0XA 1P31A 2B7LA 4ESOA 1W76A 1WMAA 1XRRA 1R5OA 2PRIA 1A9XB 2RKBA 3FD8A 3GFSA 1VGQA 2J41A 1TJ3A 3JARB 1C9JA 3OICA 5AJYA 3KKEA 1KQOA 4S0ZA 5IAKA 4BO4A 1U8ZA 1RM0A 2F43A 2IPNA 4X93A 1G0OA 3WTBA 3G5MA 1FW6A 4ZJUA 5K3BA 4N82A 2V7UA 4ISCA 5IT0A 1H8EA 2R85A 4MWBA 3P94A 4FGSA 1EEXB 2JGIA 3VKWA 3VGJA 3ZV4A 2HCJB 1TFRA 1ECFA 2LPMA 3LQYA 4BKRA 5LOVF 1VCNA 2ZBVA 4EYKA 4XKJA 3VZPA 5AI4A 4NV0A 4MA0A 1G5RA 1DXYA 1I4LD 5EP2A 1GNVA 5IJZA 1XC7A 4NKRA 3TGLA 5JEDA 2Y1GA 2BGMA 3HCPA 2C7VA 5K1ZA 4LVUA 4BMNA 4NIMA 1U1IA 4R9SA 1OGYA 3KC2A 3BTVA 5AUQA 4TX1A 2Q3HA 1KMHA 1VLHA 4BUZA 4LOAA 3QW2A 4TS1A 1ZXBA 1JHOA 2HSEA 3QWIA 5BQFA 1SHLA 2IYZA 3LECA 1IY8A 3OLWA 5DYIA 4ZOLA 5JAPA 1YZUA 2JBAB 4LWZA 5HCUA 3O84A 2CLSA 3F90A 4KYUA 4ZCLA 5IBQA 2TMYA 1UZMA 2NZ2A 2RDMA 3X2FA 1ZEJA 1II0A 2Q5HA 4RD4A 5FWXA 5G0SA 3WLLA 1UMDA 3NOVA 2B7BA 5JU6A 1YS6A 3V7WA 1U7TA 3AHFA 3R7LA 4IHJB 3TEFA 1AVTA 3KSDO 1L8LA 4B0PA 1JXAA 2UZIR 1YB2A 1EX9A 2B4YA 4KI0A 4KXUA 2B8WA 4KXYA 1HORA 4QOSA 4BNIA 1BVYF 2OBXA 4KWIA 3NHUA 1ONSA 1R4NB 3PIRA 1WDLA 4P54A 5TQ2B 5KINB 1GUFA 4O4HA 2ZU6A 5G41A 1KETA 5AM5A 3DBLA 2BBOA 4M1TA 5BSFA 2E1RA 1UBUS 3HBAA 3G0HA 1Y98A 2PGLA 4IGIA 1JIUA 4JZYA 3NTXA 4GNRA 4NY1A 1W52X 2FCRA 4NZMA 4F5WA 2E5LB 4XPIA 2RB5A 4JLSA 2PLAA 2XDYA 4JLAA 4CU5A 4CKXA 4KEAA 3ZGOA 3F71A 1BXRB 2Z6QA 4KG7A 4L02A 2ARKA 3T06B 3TL3A 4ZHSA 1ZK1A 4W5QA 2POQX 1JKIA 1QYRA 4ZYTA 4XR9A 2W83A 3H13A 3LQ2A 5E2IA 1PN3A 2IDJA 1VCOA 3LCVB 3RGWS 1KL7A 2R5WA 4YB8A 4E5NA 1L7QA 1UBTS 2CHUA 2EGGA 4M1OA 4KDEA 4PGAA 1W0JD 4JKOA 4R6WA 5EPOA 1C0PA 3IAFA 1KDYA 1V7ZA 1POWA 1Z88A 4UC0A 3KXPA 1EX1A 2OLJA 4C7MA 5F64A 1UKAA 3PX3A 5D7NA 4E3ZA 3PFNA 2H7XA 1S2OA 3KDSE 3UAOA 3TNLA 3AI3A 4NYMR 1Y7HA 3HUDA 3PXXA 4KBGA 1C1XB 4OF4A 3OQIA 2JAUA 4Y2RA 3T4XA 1TB4A 1Q0HA 3CLKA 4YYZA 1C30A 4IJ6A 5COQA 3O93A 1YB6A 1TK3A 2OHGA 4ZZIA 5GZ1A 2ODBA 1YRQA 2P79A 4PS1A 3HJCA 1A2BA 5CD1A 1U94A 4X1KA 4DDKA 2H9YA 3S28A 3WWCA 3QLUC 3BIXA 4GMFA 1KAHA 1VJRA 3ZBUA 3K70D 2X0EA 3USCS 2XMCA 5HRCA 5LKRA 2MHCA 2V7EA 2A3RA 4UHBA 3DBRA 3WC4A 1PQWA 2FXVA 1QS0A 3M8KA 3TUJC 1O5TA 5JZMA 3NXKA 3IDQA 4KFSA 3H84A 1G7CA 4Y9SA 4Q1CA 2CZQA 1HE2A 2FPGA 3DE7X 1Z7YA 4IFTA 3L6RA 3V8NA 3ZY4A 4CM8A 1Z13A 2VKQA 3TSCA 4YPVA 3GJRA 3BEOA 3M4ZA 8AT1A 5H8WA 1JI0A 3DHEA 1U3VA 2GASA 4D99A 4DE5A 3IYLW 2B1QA 3HR8A 1IAVA 4H3SA 5A0VA 4P0TA 5K8LA 3AKCA 3PWTA 3QVJA 1DJMA 3HZRA 1XMSA 2B3DA 5IT5A 1RMYA 1H6BA 1SVNA 1NVXQ 4HXGA 5HBGA 1UKYA 3HYNA 4F56A 4DB4A 1FQOA 4OATA 3GLFA 2VDRB 3VR6A 5T4FA 2H17A 2ECOA 1TTQB 2M6LA 2NU9A 2Q4EA 4GD3Q 3RWMB 3TRJA 3EIHA 3A0RB 4G5YA 3RM3A 5F3WB 4ITRC 5BR4A 2GPNA 4ENPA 3P4UA 4Q9KA 4PRLA 4ZYUA 1RWNA 1E2EA 1YJAA 4A2QA 2RIPA 5DOZA 4GUAA 3JRNA 2ZJAA 3LF2A 3FPEA 5M04A 3STVA 3L8FA 2IOHA 1USGA 1P9RA 4WGFA 5EXPA 3TZHA 3UJPA 4EW6A 2WKRA 1U1CA 2MWMA 2ZPTX 4MVYA 5U1PA 1WP4A 3MT0A 1MW8X 3VV2A 3HGMA 1FQJA 3GP3A 4XYEA 1SUEA 4GZLA 4RJLA 4U6SA 1XEWY 2X6QA 1Y1RA 3P2IA 3CB4A 3PNYA 4QWMA 3DQPA 4AG6A 5JAUA 1AMNA 1HDOA 1UKEA 5CHYA 1KRWA 1DL5A 1G16A 4NBKA 1NBMA 1E2LA 1YC5A 1TYDE 4XQGA 2O0MA 4OFZA 4HJXA 4B79A 4A23A 2IH2A 2XJ4A 4KDRA 4RIGA 5E8JA 3ZHBA 4BLTA 4BMZA 3MTDA 3QRWA 2XH8A 4E03A 3V8MA 3NUQA 1WCWA 1TW2A 2G9RA 1BW9B 1RJEA 3W5UA 1I7PA 1UAGA 3JAWB 1ZM3A 3QNWA 3BXZA 2NYUA 4KXXA 4MCAA 4PRZA 3VJLA 3N75A 5C7OO 3FSGD 1J23A 4ARIA 3H5OA 4G0NA 2RI1A 3BMQB 3HGTA 2UU9B 4QGFA 1HRDA 3GBSA 1VRWA 2VI5A 3PICA 1ADBA 1Z0DA 5LYJA 4AURA 3OP4A 4OSEA 5HIJA 4CMKA 3TB4A 3ENWA 2BGTA 3B6MA 2M1XA 2RHTA 3KRTA 1G0NA 2H7YA 3L41A 3RJZA 1RZ3A 4ID3A 3WHIA 3LKVA 3QXJA 1E6MA 3AFOA 1X8KA 2JASA 4X3OA 3BSYA 5AW9A 5CD9A 5LWQA 1W85B 3D6UA 1CQIB 3L92A 4JL5A 1M1NA 4KUHA 2O50A 2G1KA 3K9LA 3OHSX 4HQ0A 4WESB 4Q9LA 5JS7A 5K6RA 1UXGA 3REFA 5EZYA 4BEWA 5KYYB 2PBRA 2HLPA 2B8TA 3GGOA 3LUGA 2GPWA 3QELA 4KZKA 4ZO7A 4YFVA 4Z0NA 4CKCA 1XA0A 1AZTA 3L4EA 2WTBA 2XB2A 4FIDA 2O8DB 4MWSA 3UYKA 1NIJA 2R87A 1UT5A 5CDFA 4DV2B 2VEOA 3EXHB 1Y6GA 1KI4A 3GCZA 1B0AA 4GIBA 4RD2A 4N4AA 2P68A 5DX8A 3GOHA 3TECE 1ANKA 4AKIA 2JC3A 3C2QA 2PQ2A 1Z74A 2IYWA 2LKDA 2WIJA 3CNEA 4J1TC 4RIHA 5DGIA 3LP6A 2FRVA 4IOMA 1JZQA 5GM1A 1FS6A 2PA3A 1USUA 2XSZD 2NO7A 2HMYB 4P3NA 4QJ3A 2IHBA 1V1MB 2V6FA 5BYKA 3CNHA 1OASA 4FS3A 4EO7A 4IYJA 1SG9A 4J7XA 3V7YA 3A6JA 5JRDS 1MV5A 1QP4A 3VR1A 2AMFA 2Q5FA 1B4DA 3FFTA 4MUIA 2ZWOA 4XRRA 5HQ3A 4DT1A 1JI3A 4LRSB 4IIJF 1A8HA 2WIAA 3KLNA 3W04A 3LLSA 5T7BA 2XW6A 1UBFA 1RD4A 2V7WA 4JDPA 4LHZA 3TEMA 3X44A 1U4OA 4EEXA 3FGPA 4EYSA 3H9CA 3FAKA 1LA2A 3N8IA 3GJQA 3PXCX 4JYAB 4D9KA 3H3XA 3R3VA 4BRUA 3RC2A 2C94A 2GM9A 2JDIA 3ESXA 3K35A 1YD7A 4QEDA 1L8OA 4UNSA 3WLHA 5BPFA 2IBSA 4FHGA 2IYVA 5JW6A 4F8YA 4GR9A 5DK4A 3CIFA 3NHJA 3OWOA 5G1NA 1XWIA 1FP2A 3HDGA 2DT8A 5H59A 4FR5A 4MKIA 4Z2YA 1N5IA 1XB2A 2OPBA 4LC9A 4NV3A 3VX3A 4B7ZA 2Y1OA 1P1RA 2DPLA 4F21A 5A1TA 2CBGA 1BHQ1 2NIPA 3T61A 3H5NA 4D4JA 3HHPA 3QWFA 5JCOA 3EQ6A 4QLAA 4L2IB 3MSCA 1JGTA 3B7PA 5EIBD 2G28A 3RYCA 1QRUA 3U4CA 4A7PA 1NX9A 1P91A 3NHSA 4BMYA 4BWFB 2MINB 4DDHA 4F72A 3VHXA 3T1OA 1DBPA 1R0BA 4FD2A 2GM4A 3VU9B 1DAFA 3UJ3X 3DMDA 2AA3A 4Q9DA 2HWXA 2OV6A 4NVRA 1R0WA 2VAWA 2KLHA 1V1JA 2ZROA 3CX4A 1ZXLA 1P1IA 1JBQA 2BKUA 3QVGA 3OE5A 4AKSA 3FVTA 2EZ8A 1APBA 4CGZA 3HA2A 4UHKA 3E9MA 3G49A 4RETA 1SXJA 4RK7A 1G7SA 1RJ9B 3M3PA 5KSOA 4DIDA 4JXKA 5K05A 2X77A 4WUTA 1RIFA 4KH1A 4YMVA 5IT9A 3S8MA 2RK3A 3U3KA 1BNCA 3TVDA 3NHZA 4ITVA 4Q19A 4XDHA 4XEUA 3TFWA 3G9UA 3KOYA 5CFNA 2XCQA 5MF6A 3AUYA 4HQRA 3BA6A 2CUNA 3BBLA 1ZNWA 4JGBA 3KQKA 3K8OE 5AXBA 2NW6A 5HKBA 1X14A 2BCJQ 3OZ7A 3LHDA 2VTBA 4HY3A 1C4WA 3MBIA 2LWIA 3B70A 4M9ZA 2YYAA 4E5KA 1KI8A 5HA5A 4PG8A 3RAFC 3TL2A 3RAEC 1R7RA 2CXHA 2OV4A 3DFMA 2HDWA 1T35A 4TV8F 3ZDCA 3ITNA 3EGVA 5TARA 5JISA 4LF8B 1YL5A 2C2MA 5FTKA 2OQIA 1TEXA 3K0FB 1SUDA 2IUTA 4GYJA 1AMUA 4MW1A 3JPWA 4K03A 5IK2D 1ADCA 1XZLA 3NEYA 1NAIA 1J2TA 1S8AA 3DM9B 3O82A 4QU9A 2OV1A 1ELOA 5AVWA 1T26A 2JLBA 3NTVA 4BGDA 5EEHA 1EGMB 3LC7O 3G0DA 2FUG1 1UWCA 3FZYA 3RFVA 1QZ3A 1LQUA 1UBKS 1L5NA 3PC7A 1T15A 1M1YB 2GO1A 3SC2A 2G5PA 2E3JA 3H19A 5JSZB 3G0GA 2X86A 3ZN2A 1U5CA 1GG5A 3I2JA 5E2BA 4CM4B 1OI4A 5JR3A 5FQNA 1AB5A 3BWXA 2QT9A 4V38A 4AUKA 5DTIA 4PQFA 4BGVA 1HT3A 3WMWA 4TGLA 5KQMA 5CAEB 1N7JA 5BVGA 1WF3A 4GXRA 1GLVA 4BTVA 2BSAA 3LJKA 2I65A 2QN2A 3GJYA 3PXUA 3TIXB 4EITA 4LOIA 1FRVA 1M2FA 3QPVA 2V7PA 1A04A 2FUCA 2OHJA 3P20A 4FFMA 4IIVA 4M9QA 2RKWA 1R5BA 4R2XA 5EG5A 5KQRA 1UQRA 5HKAA 3OPYI 4R71A 3HJFA 3RFXA 1B6SA 3A6DA 3DE3X 4J0EA 1WD5A 4ND5A 4EYQA 3LG2A 2ZCJA 3U31A 1WB6A 5A7FA 5BSGA 2LTAA 1I0LA 3E2IA 2J5QA 3JRWA 3ZWKA 3EOBI 3AW8A 4GLJA 3ENQA 2BOVA 2HSJA 3IXQA 1US8A 3LDHA 3NETA 5B5SA 3TQFA 5KYWB 1U7UA 1XQXA 3DONA 1R66A 1DFIA 3JALA 3OU6A 4X00A 4X1YA 4BQPA 1E20A 2HN9A 2JJMA 1Y8QA 4MV4A 3WDMA 2J5RA 4JGIA 3DLIA 4O1IA 1G66A 1ABFA 2PX4A 3JQ8B 3SXJA 3T5DA 4ASUA 4V0MA 3NDBB 3R9XB 4N3AA 1OBOA 3COJA 3D3EA 3MZ0A 4OJQA 3NBXX 3IT1A 4UW9A 5CEFA 1C80A 1B3BA 4LISA 2JIQA 1EJ0A 2HO4A 3GELA 4PLPA 4QU5A 1XNRB 4FDUA 1Z2EA 1DXOA 2ORYA 3FUTA 3N6XA 2VXYA 4F97A 1EDOA 2OB1A 3KWMA 2EHDA 2HSZA 2QX8A 2W2OA 4L4ZA 4A1FA 5BVHA 5I7WA 3EGDB 1OX4B 5TVKA 1CJVC 4DUZB 3M33A 4F3RA 3HPQA 1MN6A 1OZ0A 3NVDA 2X1VA 1L3IA 3HY6A 1L5HB 1PL6A 2BMVA 2M6SA 2NXWA 2ODEA 1E1QA 4Q3DA 4BAZA 3NDIA 1TAGA 3RSFA 1FJGB 4M1YA 3EVCA 1NQAO 5BWNA 4EEKA 2DEUA 1CZHA 1GTMA 1WZNA 2CBXA 2VG8A 3MGBA 4WY5A 5AYVA 1AY0A 2PX3A 2XD4A 4Y6PA 3T7SA 2GBFA 4NTZA 5G1PA 3P9YA 4R8KA 2Y27A 4C7JA 1WW8A 3AVOA 4ZTUB 3NLLA 2XMGA 3OC6A 4IXTA 3TNJA 4KXLA 2ZB2A 2VO1A 5FV7A 1PR2A 2WPDD 1HL7A 2AD5A 2C9YA 1A7JA 5TEVA 3W5HA 2O4CA 5ECWA 4RD1A 3L1IA 4DNFA 1GFIA 4NMLA 2YFKA 4MICA 1M3SA 2VRWA 3IFSA 3OE7A 1Z2AA 2XZTA 3FJOA 5EJ5A 4MHTA 2F1IA 5FPPA 2ZI6A 5H7XA 4H3KB 4L72A 1TZMA 1U3WA 1AH2A 2CMDA 2HBYA 2VA9A 3S81A 3BGDA 2CDCA 2BZGA 2NM0A 3NAQA 1ZGGA 1NXQA 4CYMA 1PVDA 3OF2A 1DP4A 1GTJ1 2BMFA 3F9IA 5FI5A 4D45A 1EP3B 2EFEB 1Y7IA 1MORA 2NXCA 2QQ0A 2WSIA 5TS3A 3ACCA 3NGLA 2JFFA 4JHLA 2JAXA 4O6VA 1JR2A 4E14A 1GZVA 1WCIB 4JP8A 1U7ZA 2FPIA 3BDIA 2IYTA 2ZCUA 1IIRA 3HVHA 1NONA 1YMVA 2QMQA 4QG7A 5DP2A 5EUMA 3H9EO 3V4OA 2CHVA 4D1YA 3EUAA 1GP2A 1BYUA 5AJXA 2IYOA 1GKYA 4YQZA 1I3KA 3JQAA 1SNYA 1T9KA 3JYOA 4N7JA 4UNNA 4I3HA 4BWYA 4C2UA 3U9TA 5KQLA 1LRJA 2Q0XA 4UOEA 2R0QC 1M10A 1RPAA 3FTCA 4FUTA 3HFGA 4PG6A 4PHCA 1RC1A 2OO3A 3UJ7A 2UDPA 1XQVA 1GCAA 4UMEA 4UNPA 4CEJB 3QJ5A 1KK3A 1DOHA 1Y6FA 4UPVA 2P5UA 1DPGA 1LNSA 5BUSA 3GCWA 4O4LF 2OHXA 3PDCA 1YB1A 1DDGA 1Z4KA 3M4NA 1XU4A 4OAPA 1KZHA 2C57A 2ZUUA 1TEHA 3N0VA 4ALLA 2BR4A 3KYCB 4G65A 3T7CA 1GUBA 1GSIA 5H83A 1NOJA 2JHAA 4QYIA 4GWGA 4A6DA 4BPBA 2D00A 4UUBA 4DA4A 2H2GA 3V7FA 1IQUA 2JKVA 1RHJA 4MYUA 2CZGA 1IPHA 5KMGB 4O3MA 1P9WA 3D6VA 2MR6A 3F2VA 5AM4A 1NNEA 2O19A 2CLDX 4BC1A 5DBIA 1CY7A 3UWKA 1RQLA 1Q95A 1YFJA 3NIWA 3L5KA 1NW6A 1DKQA 4HH3C 4NPHA 5AM1A 1D0SA 4GKAA 2W2QA 4N3GA 3PHCA 4EA8A 1XMQB 5LZ9A 5BWCA 4AJHA 5J2TF 3RNLA 1OXUA 2GPSA 2OFWA 4DYHA 3PUXA 1QH0A 4HAYA 3UQYS 2VF2A 2YOFA 2A35A 5CH3A 3SQMA 4B4WA 5JCOC 4MUAA 3KZNA 3AHIA 5EHIA 2PGNA 1DJPA 5C8VA 1KA9H 1XLTA 2QM8A 2QLMA 2PU7A 1T1EA 1IDOA 3WGQA 1JXOA 1UFQA 3D8NA 2R6GA 1JG6A 2PZAA 2QN8A 3N87A 4B2YA 2FMTA 2VK4A 1D2AA 1UMCA 2HWYA 1F60A 2Q5EA 3EQZA 1XALA 3UIEA 5BV7A 1ORIA 1OVGA 2I1WA 3KZCA 5GJCA 3ZE1B 4LZJA 1QLJA 3TLEA 4PGFA 1PV1A 3ZIAA 1QCZA 4JFAA 3I09A 1RXIA 4ABYA 4BKQA 4DMRA 2P6RA 4DPKA 4KACA 4O25A 4A92A 3LLUA 3R09A 3AEZA 4E22A 4TT8A 1K98A 1PGJA 1YU6A 1VSBA 3MCAA 4AXXA 4QPJC 4W8GA 5AVOA 3SZGA 4EJ2A 5JJLA 1JHAA 1RBQA 3EIFA 1A7KA 2IE8A 3NT2A 1Z4MA 3Q5DA 4FQ7A 4ZO6A 1KI3A 4CKEA 1F1BA 2P8SA 4Z0PA 1PTJA 1QJCA 2QRKA 3B36A 2CL7X 4DLRA 5BURA 4B3MB 5C53B 1AQUA 3UXMA 3PD7A 3QZUA 1KRHA 4RTPA 1GDTA 1VSTA 1TVKA 1KSJA 1U3FA 5AXCA 4B09A 1E7WA 4Z6KA 4GKKB 4R54A 1XNJA 4R1NA 3ZJ4A 4RYDA 1OV4A 4JOCA 4F91B 1VYHA 1F9AA 1YCFA 4RULA 3O0TA 4D9JA 1GPYA 1Q14A 1U0LA 3EIXA 1GPMA 2R1TA 5LU8A 5T67A 4CL3A 3G0OA 5COBA 2PKEA 1NLMA 3I2GA 4GBMA 3WMXA 1G2PA 1XZKA 4C03A 1E9DA 4DBLE 3BF8A 3OEHD 4I5FA 2O8CB 1W19A 2VJCA 4R8MA 1Z0IA 4Z1MA 4XIFA 1HTWA 2I3DA 5BPHA 2VNAA 2Q6KA 4DR7B 4MJ3A 3HNRA 2KBFA 2IOYA 5ALWA 1RI2A 1SGWA 1UEJA 3IJ5A 3LBFA 3L7YA 1E4EB 3LTEA 3SF8A 3CW9A 1ODJA 3DWGA 1GVHA 5C5DA 3PQ4A 1AO3A 1NJ1A 3PKIA 1TTPB 3GK3A 4FZRA 5B7PA 5JNRA 3ZXUB 1NG9A 2L2QA 3BCUA 1GDDA 3LX8A 4IFEA 2I9KA 4MMZB 1Z35A 4EMSA 4WCVA 2C61A 2OXFA 3Q4GA 5H3CA 4QPDA 4F1JA 1AXEA 1S4MA 1NPYA 5C7IO 5BO5A 3KEMA 1BGVA 1NBAA 5JVDA 4BVEA 1Y5RA 1IN1A 4DXAA 3FI0A 2D62A 4C06A 4YR7A 2QUKA 5LU9A 4GEKA 4K9RA 4MVJD 4ALNA 7MDHA 2W2MA 2VNSA 3DUFA 1N2XA 5A4IS 5KNLA 4FFNA 1JEQB 2A5GA 4OGLA 5EQTA 2VHVA 2E6UX 2QGNA 1YDFA 4RDIA 3DDZX 1KZ1A 3RD5A 2GWHA 2ZZMA 2ZJ2A 2QG6A 2PG3A 3RSGA 1ZDMA 1F8UA 2JFXA 3S55A 3PCXA 3V3KA 5CFQA 1G7TA 3LQ4A 2Y68A 1NI5A 2O1EA 2VCEA 3PF9A 5C2JB 3NIBA 3X1DA 5ARCA 2HBRA 1GO2A 1VFNA 4I2NA 3AUAA 1IZYA 4M0FA 4QA9A 1W48A 3HVKA 4E1BA 4BB6A 4W99A 5E2AA 1FLNA 1M72A 3T3EA 3WB0A 1YASA 3GEEA 3K5PA 1EFRD 1E5QA 1JHZA 1QDUA 1R4AA 2R6AA 1NQTA 3DXZA 3EMVA 4KZPA 5GV8A 4TVBA 5CPBA 5H9VA 3WSWA 2CHQA 2XITA 5CVUA 1GIAA 2RJOA 2P4QA 3V4PB 4C0LA 3MUFA 4J6EA 1DRUA 4X7BA 3ROTA 6REQA 3GPLA 4U7HA 1J2RA 5C1IA 3HDJA 4AMUA 4RVCA 1LDYA 2ZYRA 4Q4CA 3DLAA 4TKMA 3UK6A 5JZBA 1ILEA 5F3DA 1EVEA 4DCMA 2OCPA 4BVJA 4G1MB 4HPXB 4RSMA 4YEDA 3SSOA 4BY9E 1ZH8A 4OO3A 5JATA 3DVAA 4FKZA 5KYXB 2C8VA 4O4JB 3FFBA 2XIQA 2V8OA 2VZ9A 2HK7A 4O29A 1EYZA 1TF2A 4HNAB 3FX2A 1NVDA 5J59A 1ZIDA 4LF6B 3JZIA 4ZMSA 4FQ5A 5KTMA 1PT6A 5BQPA 2X13A 3PZRA 1M33A 3ULKA 5AKIA 1RWPA 3VH4A 1RFGE 1DHRA 2GJ9A 1A97A 2NZYA 2ZR8A 1SCDA 2J5BA 4P3KA 5CLGA 1CUWA 3RVNA 1UDWA 3SLRA 4B85A 5SYAA 1O96B 4HPWA 2CYAA 2O7SA 4GM0A 3T0GA 1P77A 2JLCA 4OVKA 4FHFA 1RTKA 4BDSA 5F1PA 5LQAA 6CHYA 4ENTA 1QCYA 4CR8A 4RADA 1YA8A 2AL7A 2HMWA 5AT1A 4P92A 5KOIA 1KS9A 1KDVA 3TCKA 3LL7A 3ICOA 3PJDA 3LHSA 3V8EA 1KQPA 3ROKA 2PUBA 3EQ2A 2JIRA 3RCBA 2YN2A 1KFCB 2VHWA 2JLXA 4AS3A 1GFSA 3V6MA 4IWXA 1YI0A 4DABA 2FK7A 3S2GA 2C4VA 2CVFA 3EXIA 1CUIA 2Z56A 3KALA 4ND3A 4UAGA 5D3QA 3TZCA 2I7DA 3NV9A 2VTDA 1P6XA 3DT9A 2I9PA 1P1KA 1IN7A 2H31A 3O4RA 5I9TA 2Q6IA 1KEPA 1O9HA 2V9CA 4ZV7A 4P31A 1JYFA 1SKYE 2ZIFA 3F47A 3QPWA 1AGYA 5IDXA 1SEPA 4BE7B 2A58A 5DEIA 2WF9A 2YWCA 2P2ZA 4J3FA 4OIMA 3RVPA 4YJGA 1RI1A 2P9HA 1HFJA 1TAQA 4GSKA 1YT5A 1M1XB 3BKXA 3I72A 4YJ3A 5CEJA 3EWSA 5CUQA 2HRBA 1HE8B 1ISMA 3AHHA 4U1RA 3K0EA 2QEQA 2GFHA 3AR6A 3UMYA 2XGGA 2AC7A 2JAOA 5ICSA 5IFKA 3E1KA 1T8TA 3WAJA 3TQCA 3ZCQA 4E2FA 3U49A 3JQ6A 3ZV3A 2EZ9A 3IOCA 5AW5A 5JNSA 1O0BA 5YASA 4UFNA 1ODCA 3A8TA 3JAMA 3OKCA 5K9ZA 5BW5A 2J0EA 3X2SA 4PIMA 2LP4Y 4CQMA 1IJEA 4KITB 1B2RA 1SG0A 3EN0A 3QOWA 1K4MA 4PYRA 2E55A 4W6QA 1N6PA 2PUVA 3U7QB 4B3JA 4NH0A 1L5QA 5J2UB 3TX2A 4RGVA 5FYQA 2WG2A 4EM6A 3FYUB 4F11A 3CNQS 3A6FA 5AM0A 1S02A 3LCJA 2GN9A 3O3MB 3Q3VA 4JYBA 3SVLA 4QBKA 1B2LA 1RI5A 3KL2A 3TM5A 2DHCA 1HT0A 1E2HA 1RAFA 3CH6A 1SCJA 3HA5A 5KOJB 5JARA 2Y0PA 2G9NA 2FMFA 3OM1A 4RZIA 5B3KA 1LPPA 1QYVA 2CMFA 2FH5B 3KQSA 4MYCA 3ZDDA 1RE1A 3IEIA 5AP9A 1Z7WA 2QMYA 4YT8A 4XH9B 1L7DA 4GG1A 1BVHA 3ZXIA 1RKBA 2DPMA 4PHGA 2C54A 5IBCA 1IM8A 1BX1A 3T7AA 1DHTA 4MS4B 2CUKA 4K6GA 3SFVA 4G5HA 4Q16A 3LXRA 3R3XA 3H4TA 3AVUA 4KGXA 3P9KA 5HG0A 1FSPA 3DVLA 1QAQA 4BX2A 1LPBB 4UHFA 1PK9A 2QDXA 4GRIA 4ECEA 2VCYA 1WL8A 3GNTA 3D6NB 4PLWA 1QHGA 3MTAA 1XLTC 1ZM4A 3N58A 1P39A 3U48A 3DJYA 1WDMA 4Z7NB 4OK6A 3GLSA 4J2HA 2VDUE 4U6NA 4JI1B 1GN8A 2EEPA 1CJBA 3C5VA 5KYTA 5LVAA 3G7NA 4LHVA 4R8LA 2QRLA 3JWHA 1A9SA 3C85A 5CA1B 1DS6A 1N2EA 1FBNA 1V5WA 2BFMA 2HPHA 5DN6A 3SGLA 3GFVA 3GR6A 1PJ8A 2XVMA 1JB9A 4FBLA 5IN4A 1M74A 3T5AA 1NRXA 2NVOA 3L8GA 1FY2A 1R0CA 3U3JA 1JWLA 3PQ6A 3C14C 1W94A 1LJUA 1D9XA 1GPJA 3LU1A 2WICA 4TN1A 2PUAA 2JLRA 3HYRA 2M98A 4E5PA 5CP8A 2HRCA 2QBYA 3GP5A 1G20B 1D4AA 2QZ4A 1MGOA 2F3SA 2ZRQA 3BD8A 1PTJC 1BEEA 2CFOA 3K0CA 1A27A 1JG1A 2ZG6A 4B4DA 2IPLA 3OX1A 3SSAA 2XCRB 4LYHA 2W9XA 4IJMA 3BKWA 2K2QB 4OB6A 3I6MA 4YA6A 3WYCA 3ZGYA 1TUIA 2BZ0A 1R5NA 1NT2A 1CDOA 3EQ9A 4CRWB 4QUHA 4FYWA 3FTQA 1QC5A 3N2EA 3TW8A 1LTKA 4LJSA 5CB4F 4CZ2A 1LV7A 2X0JA 4KC0A 3KB2A 1GGVA 4BU1A 1ISJA 2X2OA 2DM6A 2CNWA 1OX5A 4OHFA 2NNLD 3CB2A 5FLKA 3GLUA 4WJLA 1HURA 4HX5A 1X39A 3OCZA 4EB8A 2RD2A 4RTMA 2QENA 1H1DA 3OCVA 3HXQA 3WLOA 1N57A 4MIYA 3EDRA 2BR5A 1W88A 3EEBA 1FNDA 3R75A 3DO8A 3QWHA 2DYKA 2O6LA 2ZI5A 3D3KA 3UJDA 2VT6A 4R84A 3U7RA 2X9QA 2ZBUA 3EG5A 2PYIA 3F6EX 4E21A 4QOGA 3HYLA 3M6LA 1E3EA 2QUJA 5CFRA 5DNDA 5F52A 5CLHA 2GA8A 4EFDA 8LDHA 1Z7EA 5H3LA 1I2BA 2P5TB 3WGIA 1HLFA 1ZC4A 4PRKA 3IMFA 1GCGA 2IS2A 1X0XA 5JD5A 3W0LB 4ZI2A 1W30A 3EQ7A 4B6EA 4M46A 2RBEA 1ND6A 3L06A 1E1YA 5DXJA 4DDTA 3M6WA 1JQAA 1VI6A 1AOXA 1YRBA 2D2XA 4TN5A 4YQEA 3L0PA 1QANA 5JUWA 3BTSA 4MRRA 5ESWA 3KTDA 3E9YA 1DG3A 1ZQ9A 4MVJH 4AJJA 4B7AA 3KPVA 1WMEA 2ONJA 4EG0A 2A59A 4BE4A 2PWBA 5C4GB 2P0YA 2XMSA 5FXMA 1CK4A 4UUAA 4RZQA 1X70A 2EFHB 5A7GA 5THXA 4N3NA 4FE4A 3NV7A 2YXEA 3P45A 3N59A 1AKUA 3QX8A 3AESA 2X0IA 3H83A 3SLGA 3CIOA 4HWRA 3F7NA 3OZSA 4ZEOA 4F7WA 1V7CA 3CURA 2B78A 5F23A 1EM8A 3VNSA 4FC6A 2ZJ8A 2VK1A 1EP9A 2G4CA 3O3NB 4MEBA 4PTYA 3I9V1 5ALZA 1X9GA 2CLHB 4FYXA 2ONZA 1AHNA 4HDCA 3WSTA 4E31A 4UEOA 3R74A 4QUJA 3INTA 4BAUA 1F14A 1Z39A 3RADC 1ESZA 5B30A 4MUGA 2FLWA 3DFIA 1IHUA 4XVCA 1XPOA 5LSAA 2CJWB 3L7BA 3W5VA 4NOLA 3RUHA 2BM1A 4EKEA 4UHDA 3UMBA 3S1LA 3M83A 2XNDD 3HMQA 2GB4A 4X94A 2Y4OA 1LPOA 1A9YA 5KEIA 2ANCA 4UTXA 3PQFA 2A1UA 1PGNA 3MINB 1V2HE 4LDNA 1FDVA 1V16B 2XLCA 5IWAB 2PD3A 3O2QB 3EEQA 3UV3A 1EWQA 4MV1A 1TPZA 4R2LA 2CLFB 3TKYA 5H5JA 3QF7A 4NAVA 3KFLA 4B48A 3EPKA 1Q3KA 3JQRA 4M83A 2BTQB 1COWD 2GS9A 3K8ZA 4RY8A 1LLDA 1MVNA 1TJ4A 2B35A 4HYQA 2ESRA 2EP8A 3AW9A 3LA6A 4OFWA 4B3XA 1KSFX 4YUZA 4RVHA 2A9QA 1WDKA 1CY2A 2VEDA 1D4ZA 5FTWA 5K6AA 3OBIA 1DWOA 2XTAA 1XAGA 3DGFC 3NANA 2W42A 5DW0A 1T24A 3G2NA 4JOBA 4TLBA 3ZLTA 2ZUEA 4EG5A 1NLFA 3USZA 1UK8A 1XZJA 3MD0A 3MJ4A 4KJZA 2SECE 4R2HA 5TGZA 1NMSA 3SI7A 3VAAA 3K9CA 4AC9A 1LLCA 5FUMA 3FMFA 3GVIA 5EUBA 3CUTA 5HEKA 3EXAA 3GUVA 2DSTA 2QSJA 1DKMA 2RK6A 3W2EA 2AQHA 3SIXA 4ZK6A 5ANRB 5IX8A 4L0QA 3G1UA 4UZSA 3ZUGA 4GOXA 5AVVA 4BDTA 1AKTA 1NW8A 1D4FA 2ETVA 4WXMA 1XWFA 4XGKA 5B2EA 4XTRA 3FTEA 3LYUA 2HTEA 2DLNA 4CFZA 4PSAA 621PA 2ZYAA 4FK8A 4ZGWA 2O1XA 3K9GA 2NZXA 3QX9A 4C6TA 3G1WA 4DMHA 4JP3A 1GPDG 4LMAA 4NBVA 5IFLA 1RLUA 3B6KA 4RW0A 1E2JA 3SE0A 2HCBA 5JTTA 5F3RA 3EFHA 4EPRA 3MWGA 3PQ5A 4MQUA 1BX3A 4BRWA 1BHSA 1MPTA 1WWKA 3QUSA 4BLRA 4B80A 4WN9B 4B1FA 2OD7A 1X1BA 2Y9MB 3F1KA 1K27A 3AEQA 3IILA 2Q07A 4X8LA 3STTA 5A3JA 2H2FA 3QPCA 3P2OA 1WVIA 3HJNA 4KP7A 1J1UA 5DT9A 3GLTA 1VZ3A 2ACWA 1TIBA 5HNKA 4I50F 4TTJA 1U5BB 4KXVA 5JSHA 4TXNA 1F0PA 2C4WA 4P7GA 1UKBA 3PUZA 1H2HA 3VPFA 4XLTA 4HDMB 3ZHQA 4HVCA 4M53A 2IIVA 3T7IA 2RGYA 4Q93A 3GRUA 3UT6A 1GTL1 3WLEA 1T0PA 3IEPA 4YRDA 3VYWA 3UMFA 4DA7A 5J4KA 2O8BB 1UFKA 2FLVA 3L4SO 1QRTA 5C8XA 4NECA 1O03A 1V3VA 3ORSA 2FR8A 1J1IA 1FFGA 2WABA 3NATA 1Q0RA 3GRZA 1FFCA 3SEFA 2GEVA 1V4NA 4XWOA 3ASUA 3MS4A 4ZO9A 5DJ5A 1XVAA 4B7CA 3F97A 2IYSA 2QTFA 3NASA 3W9BA 3LIPA 5CB0A 4ZKEA 2HGZA 1OYVA 3DBVO 5DX0A 4HZIA 2ASEA 1IONA 3V48A 5A6VA 3S2ZA 2JCXA 5IJAA 3BIFA 4RHEA 5KNDD 2X3UA 2X9LA 4BMPB 2ZBQA 3D0QA 2PNFA 2CNNA 1FP6A 2WQZA 2WWRA 3BICA 3E9QA 3IT3A 5ERXA 5CVEA 9ABPA 2AMLA 2YCLA 1HTBA 3B2EA 3AVXA 4NFLA 3TG2A 2PX2A 1RI4A 3A05A 1SCAA 1IVNA 2ZREA 1Q2UA 3ZGVA 1LRKA 2QTAA 4IV8A 2CMKA 1ZZGA 2IYYA 2FPSA 2P9QA 2IF2A 3EF1A 3HM2A 3G2PA 4L1KA 1KOFA 3O4FA 3V2UA 3W6UA 3NFYA 5TF0A 5DHPA 4ZMBA 3GJSA 1UK7A 3SSMA 1YVEI 3WL6A 5LNK1 2HJGA 1FSSA 4P5PA 1XP8A 3N5CA 4PF1A 5DP1A 3SXUB 3A9CA 5BQXA 2VRBA 3NBKA 1QIDA 2IHYA 1LH0A 4Q9JA 1EVYA 2NUPA 2HPZA 1E6UA 1FMLA 5J9FA 3USES 3I9FA 1AA9A 4WKPA 1NI4B 4EUSA 2AG1A 2QAGA 3OHPA 1SUBA 5SZHB 3M5DA 5H4GA 5L7YA 4KWHA 1IH8A 4FEEA 5ESXA 4GZMA 3RRXA 4AXBA 3TZKA 1YONA 6PFKA 1NSTA 1RWVA 2YMPA 5KQGA 2C3YA 3GROA 1ZJJA 2H51A 5JCPA 3R8FA 5DCUA 2FW6A 4PG5A 4NBTA 5LXTF 1NU8A 2QY6A 2CXTA 5LKAA 3X43A 3ZHCA 3PKJA 4GXTA 1XEAA 4GOND 2Q6TA 1LC3A 4GSLA 5M34A 3LRTA 2WWFA 1ZRHA 3ZJYA 5AUPB 2FMUA 4BMCA 1N7HA 2QVGA 3ESCA 3HXPA 4W1RA 1UANA 4IIUA 2GD6A 3RIGA 4AZ0B 1ZSVA 1QYCA 3QKRB 2CCJA 4OQYA 3V4SA 4F71A 4D3FA 4YCBA 1CB0A 3GD7A 5I7HA 3U6KA 2WD9A 1TKBA 2AFRA 4OQLA 5HWSA 3ZWPA 4QATA 1GWNA 1QGYA 1QVRA 2C9OA 4ZU1X 5C3UA 1IWOA 2DKOA 1E64A 3AVQA 3P97A 5F5NA 4EA7A 5B3LA 3GLGE 2QTTA 4LF5B 4RZHA 4ER6A 4EY8A 2JCYA 1CUGA 1PBTA 5ED0A 1JJAA 3DV0A 3NFRA 1M34A 3TLGB 2VZEA 1YIDA 1A7UA 1W4BA 1ZHOA 2OFPA 2PRKA 2I67A 2I4NA 1NRJB 7ADHA 4E94A 4PGGA 3JR3A 3O47A 3DE1X 3C3YA 3EXFA 1YFKA 1XRSB 3G2JA 3QVTA 4R6XA 3UAWA 1JQBA 2HCRA 2NACA 2PJDA 3IP8A 1K0UA 3HB1A 4FZ3A 3T7JA 3WK6A 2E49A 2TMKA 3OEWA 4QYMA 3VRHA 3AF3A 4IV0A 4CM9D 1AV7A 4RNCA 4Z54A 2UZAA 2IS6A 1G4HA 2ZUFA 4LDZA 1HE3A 3OAAD 2GH1A 1N8SA 3ZUPA 1LW7A 1AZWA 1DV1A 4RCZA 3YASA 5CFOA 3AZOA 2G72A 2CXQA 2G1UA 2NN3C 1HDIA 1U9YA 2H06A 4K9SA 3B7GA 4DGQA 3FVVA 3C1OA 4L8YA 4KYTA 4MQEB 1QUFA 2G07A 4B2PA 3FNGA 4QPCA 1NBHA 2ICAA 4I9HA 5E4YA 2GN2A 4PQYA 3HRIA 4AP9A 1JLLB 2ZRFA 2ILVA 1RQGA 2VDWA 4KFTA 4NYJR 3U4IA 5JSQA 2ERYA 1UEXC 2CNOA 4Y0NA 2B34A 2IUUA 3LC0A 3S5JA 2XCTB 1EVLA 1J49A 2FZWA 1EK5A 1S9HA 1WQ4A 5E3HA 1OZAA 2SCUA 3MJDA 4AU1A 1V3QE 2IQ5A 3CLVA 3JXEA 4XFKA 2O07A 4EY7A 2W4QA 3I2YX 3TAXA 3V2HA 2WE8A 4B6JA 4AROA 1ZUD1 1C2TA 2ZIGA 2BV3A 3DW3X 1Q3TA 1U9IA 2EHJA 1WRBA 4MRAA 3AVYA 1MJGM 1IRIA 1REQB 1ZGBA 1GLNA 1TO6A 2F62A 5I5GA 4AS2A 2UYGA 3C41J 1J2JA 5LCXA 5KX5B 3V8VA 3IMCA 4WLOA 3FCOA 3KQOA 4CJXA 4F2GA 1CS4C 4JBYA 1MXHA 2A1TS 3OD5A 5IM4A 1PFWA 1ZJ5A 4AF8A 1OT5A 4CKWA 2IPAB 3OA2A 5EWMB 3TR0A 1E3QA 3MHPA 1Z34A 2Z2KA 4RHUA 1FTGA 1HFWA 4JOSA 3KPWA 4EFLA 4JUAA 1XKTA 3WGLA 4DA8A 3IQFA 1RRPA 5ITZB 6ADHA 4D0LB 4US0R 1HT1E 2IPOA 3G88A 1PD1A 1RYDA 2FEAA 2E4ZA 1N9GA 2WJGA 3KXIA 4JMLA 3EUWA 3GFQA 5LA6F 4M8IA 4BBZA 4CE6A 1UDAA 3RYTC 5CITA 1NNI1 5IU6A 4BIMA 4UM9D 5C37A 1JILA 3CKLA 2BTOA 4RJIA 2ZCVA 5K6AC 4EGJA 3KVYA 4ALMA 1OJ7A 3H5LA 3W34A 1W36C 4C20A 2A0XA 4BNGA 1ORWA 1BRTA 1CF2O 3I6IA 2OORA 4CMEA 2BDUA 3CEPB 4HLCA 1MO2A 4MQFB 1KJZA 2RG1A 1KOLA 1YRAA 3PQ2A 5E9AA 1QPZA 1AF4A 3JAKA 1FP1D 1ADGA 1L5OA 3I12A 1I6KA 1Y3CE 2WIKA 4FT2A 3DYBA 3L0OA 4PR0A 2HBZA 5HILA 1BDIA 2DPHA 3D7LA 3Q2IA 4R1UA 5DBGA 1D1SA 2P9EA 3B1JA 1RQXA 1YWGO 3FSEA 1MV8A 3GMDA 4DSAA 2H16A 2H4HA 2KJQA 5F21A 2WJHA 1E62A 3KCNA 2IDMA 3ZWMA 4JKYA 1EVJA 4NJMB 4YXWA 1E2GA 4RENA 4JBNA 4X6YA 4YT5A 2G7ZA 2XIJA 1AQ6A 2O54A 5EPUA 3E8XA 3PUKA 3OIFA 4KGZA 2Q1YA 2CLCX 3AYZB 4OUDA 3RSLA 3AM3A 4FOPA 4EPWA 1YOVA 2G76A 2DOKA 2IGBA 2PT7A 4BEVA 1NVVR 2Z1MA 3A4VA 2EOAA 3HB9A 4J29A 3KX2A 1LK5A 2QVZX 4LXGA 4N3BA 5JRJA 1Y42X 3GDHA 3DF7A 3IOEA 4WECA 3P19A 4F3TA 3LUJA 1A5TA 3W9YA 2HUPA 5D5PA 1AGRA 2GLUA 5FFNA 1GRQA 5DLYA 4INAA 4AO6A 2BKAA 4AZSA 4ZZ1A 4NWIA 1GSOA 4JLVA 3ZU6A 2JIOA 1JG3A 4J3NA 3OI7A 1LC0A 4OA8A 2MSLA 5M2QA 5IDYA 4JQOA 1X7YA 3X1ZA 5EP1A 4NU5A 1L5FA 1I4DD 1M6HA 3IB3A 4YPOA 1L5LA 5L6MB 3CE9A 2ORWA 4OHOA 5I9BA 1K63A 2XT6A 3KYDB 3AHDA 1XA3A 3QV1A 3SG0A 1ETUA 1ETHA 3I04M 3ZGNA 2CK3D 1UPXA 4ND8B 4X91A 1N3LA 5AJZA 4EI7A 3HVRA 1J56A 3OT1B 3SZLA 4F6RA 4BJHB 1R10A 3VKGA 5LZ8A 4PC6A 2P6PA 1X15A 1Y6RA 2QN3A 4JJFA 4X1IA 1OFIA 4X20B 2YDYA 4GO1A 2QV7A 4B3CA 3KSUA 3ISTA 3M4XA 1THGA 2P62A 1KP9A 3QVSA 4TTVA 5KNDH 3PJRA 1QCDA 4EY4A 4FN4A 1SUFA 4UXIA 4QASA 4NXMB 1PEKE 4Q4DA 3N3AC 4J1SA 1Z2PX 2C2WA 3IAS1 3CLTC 3MIIA 1NL3A 4NOJA 2AI1A 4J0KA 1S8FA 3PYXA 4PIVA 1RYFA 1Y1PA 2A2ZA 4H3HB 5HQTA 1Q1BA 1NXVA 3IV9A 5EZQA 1E6CA 1QJ4A 4DZZA 2VFAA 2IELA 1MKYA 4DLTA 5HKKD 1EM6A 4R2JA 3AM4A 1BYIA 3FGZA 1CRZA 4DIBA 1F7UA 1TVEA 2J87A 1N7IA 3B38A 1P2BA 4ZREA 1SU8A 4F92B 1OPRA 2Y6UA 1HNZB 2RGNA 1YZTA 2QM7A 3MAAC 3KIPA 1OZHA 1ULBA 3KTAA 3QKUA 4FGUA 4O1MA 4TLDA 2KLBA 2Y9PB 3FZEA 3RANA 3UH1A 2HJRA 4FYYA 4GT1A 3U56A 2ZIUB 2ZJ5A 3BM5A 3IAXA 2IWHA 3KM0A 1ZX1A 1M2WA 2IOFK 2J7KA 2Q41A 4JUIA 4JSTA 1JR6A 2O0HA 4GBGA 1L4YA 2JLWA 3A1DA 5JG7A 2DTDA 2HXGA 2REQA 4HN4B 3TR6A 2B1JA 1MNQA 4IF4A 3PHLA 2YRWA 3SM9A 2WAMA 1O8CA 2HFKA 2WIDA 4GXNA 4PS0A 4DJEC 2Y92A 1SOMA 2X8JB 3UMJA 1A98A 4GECA 4KLCA 4W5OA 1YQTA 3LFUA 4G0ZA 2QRPA 2Y93A 2D5CA 3MWDA 1WNTA 4KL8S 2MYUA 3THSA 1IN5A 1X19A 3GFTA 2ZXFA 2J1LA 4RH0A 2Y67A 4DLUA 2H48A 3EVDA 3NYIA 2W00A 4Z8YA 5LB2A 5FH9A 3EPHA 1G42A 3PNVA 4DZRA 4ENVA 1LNQA 3TLCA 1EFAA 5ELXA 4OB7A 2VP6A 5FOWA 2XLBA 2BBTA 3PL1A 2BGUA 3WGTA 4CLRA 2OHFA 3A1EA 2O57A 4YMUA 5KHAA 1X2EA 1GEEA 1XAJA 3BJRA 4B76A 4H59A 3A9VA 2IYNA 2P9TA 4UOZA 2FB9A 3W3AD 1JSXA 4TYWA 4QU0A 2VSNA 3ZD8A 3CZ5A 3KUKA 4E15A 1ESEA 1N92A 5ILOA 1AZLA 1ZD9A 4N54A 4NOMA 5DBFA 3WWYA 4FTWA 4NBSA 3VPHA 3W7AA 1BS9A 1LCIA 3WVNA 2W6ID 4XYGA 1W0KD 4CIDA 4EKIA 1E7RA 4JC5A 2VPZA 1EFPB 3L07A 1IATA 5A71A 4Q3OA 4I55B 3GG9A 4ZIRA 3H4IA 1SD2A 4W7HA 2DWUA 1YRYE 3RFFA 2I34A 4IZOA 5ICMA 1Z45A 3P9XA 2HU8A 4JR2A 2FSIA 2DR3A 3ASZA 4L74A 4CW7A 2ZSKA 4JT4A 2CB9A 1HO3A 3IV7A 4KQXA 3UUFA 3HACA 2W8ZA 2ZTMA 2C9DA 2OXTA 4J75A 1KK1A 3R6GA 3ZX5A 1DQSA 4EQ6A 4XJVA 4HCJA 2PBLA 1DQZA 3L7MA 3N8NA 2RARA 4MW7A 4RVSA 3UFXA 2Q5CA 4PX9A 4MLCA 2Z2IA 3QEJA 2OV2A 5JPIA 3CZMA 4U39A 1N1MA 1DX4A 4KTVE 4BFCA 1U9IC 1X7WA 5CB6A 4F6CA 5DNAA 4K26A 3VR5D 3IQIX 2PS1A 5A2QA 3KHSA 4MVJE 3PGLA 1MXFA 4DSZA 1JE1A 1KYIA 5E0KB 1ULUA 4ZA2A 1G9SA 2R6R1 1A9XA 2J9FB 1GZHB 1QBKC 1X7XB 1WW2A 1NW9B 1VCMA 1YJ5A 2M32A 2O7RA 1CIJA 3IAAA 3ITDA 3JARA 3IAUA 2AYZA 3QUQA 4UHCA 2FPLA 3SN6A 4NU0A 3M1LA 1S2GA 3C3WA 5HK8A 3TD6A 2HDNB 5IWCA 1G5HA 1H05A 3IA2A 2JJYA 2DWPA 2PMDA 3CC8A 1RQ7A 1W75A 4QVGA 2HIAA 1QMPA 2BZ1A 4F4IA 2FDCA 4N49A 1JW9B 2W7TA 1U9CA 1U2RA 1JL3A 4OH1A 4TXHA 4WERA 4Q00A 5AI5A 3VU1A 3ANXA 1YDHA 1B74A 4YC7A 1U81A 2CL0X 1A5ZA 1M7BA 5A9SB 2XPCA 4NONA 3CCBA 3PE4A 1YBMA 1BQ3A 4RHCA 5KPDA 3U40A 1PR4A 1RM5A 1EFLA 3HR7A 4H17A 1OCEA 1POXA 5JBIA 4A16A 4MYSA 2Y99A 2PKRA 2X15A 1GAXA 3KL4A 1QG0A 1KC3A 4HMOA 3DOCA 3SX0A 4KVZA 3OFND 1QWOA 1U5AA 3VMFA 1TE2A 3WAGA 2YWGA 2JBAA 2I2DA 2ATVA 2OORC 4CMEC 4FFOA 2YMQA 3AEYA 3O4JA 1D6NA 1A9ZA 3BERA 1U8FO 3RJ9A 1XD2B 4DADA 4KIUA 5LLSA 3PA6A 3TX6A 2P6UA 1CHNA 3L1KA 4LHWA 4M1QA 2WWYA 2RHRA 4IHJA 5AHWA 1ZMOA 3IAM1 3MJSA 4HX2A 3ROXA 4P2GA 5FF9A 3WP0A 4E33A 3ID6C 1G1AA 5CLIA 4YQFA 2XGJA 2A0UA 2ZJFA 4O4IB 4OG2A 3PLNA 4O4LB 2YHAA 3TFOA 1R4NA 1Y80A 5TQ2A 3EUEA 2XMZA 3ZC3A 4A2WA 2ECPA 1DV2A 1WG8A 3IUYA 3FLEA 2W37A 3WE7A 1SB8<