4AO6A

Native structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
243
structure length
222
Chain Sequence
MSWNGKDERKLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGHEYIEQVAKLLVGRGISAMAIDGPGTDVVGLDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGLPVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVSLQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title Functional and Structural Studies of a Novel Cold-Adapted Esterase from an Arctic Intertidal Metagenomic Library.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
total genus 83
structure length 222
sequence length 243
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ao6A00
4BC1A 1ODSA 3E4DA 3H0CA 4Y2UA 1O6FA 3H1BA 4AO6A 3STUA 5LKRA 4X91A 2X8BA 1LPPA 5JAOA 4EY7A 3HXKA 5JYCA 3DCNA 1CUZA 4BVKA 2WIGA 2Y2VA 1Q0ZA 1XZLA 4X71A 1XZHA 3JW8A 2PUJA 1SC9A 2BKLA 1A8SA 2XUJA 4BZZA 3H2KA 4Y2RA 3V9AA 4QDUA 1F0NA 1W6RA 4W1SA 3SWWA 1FFEA 2XMGA 3WZMA 4B9AA 4FLFA 5JASA 3I6MA 4P08A 3SK0A 3D59A 3HLKA 3DJYA 2ZYSA 1MN6A 1XZIA 3KWJA 3MVEA 4F21A 4C4ZA 1I6WA 2RHTA 5DYWA 2HRRA 4U2BA 4ITVA 2ZJ6A 5AI5A 2PVSA 5CBKA 5D7BA 1WPRA 4EUSA 2HA5A 2G5PA 5FV4A 2W6CX 5AJHA 2OXEA 4Q34A 5EHQA 4BDSA 2RHWA 5AM0A 4QDOA 1X2BA 5LLSA 1H2ZA 4B9EA 3W9UA 1W52X 3CCCA 1YB6A 4Q3OA 2LIPA 5E2IA 3I1IA 4FMPA 5LKAA 2WILA 4RE6A 2WJ4A 3AZOA 1X2EA 1CRLA 3IUMA 1J1IA 4GWLA 1XZKA 2PKYX 2VT7A 5JARA 2ONCA 4X94A 2ORYA 2WFMA 1DINA 4LYEA 1C7IA 1QE3A 4G8DA 1N5MA 4FNGA 5HFAA 5HF6A 1QTRA 4ROTA 1P0IA 4Y7DA 1P0QA 2WJ6A 4CG2A 3FLBA 1ODTC 4X6XA 2AXEA 4BYMA 2XDWA 3HC7A 3W04A 2BUBA 2D5LA 4X00A 3RM3A 3HI4A 2DHEA 5JZ9A 1XRQA 3LP5A 1LPAB 3VISA 1TCBA 3V48A 2I3ZA 3D5EA 2VJBA 2PPLA 3GFFA 3WIBA 4QA9A 3WKDA 2DFPA 5AK6A 1MT3A 4KJXA 3ANSA 5AKYA 4E15A 2WJ3A 3FYTA 1J06A 2XQIA 4HRXA 3HEAA 1ZIYA 4OYYA 4ETWA 4P92A 3R0VA 2K2QB 4OU4A 1EK2A 4S0XA 3H1AA 2XT0A 2HA2A 1UOQA 3ILSA 4M0EA 4B83A 3WI7A 3PUHA 3A6ZA 1EK1A 1MO2A 2B61A 4HZGA 3JWEA 3FYUC 4J0GA 5EHZA 5AO9A 4WFIA 4DNFA 1FFBA 1MX1A 3P2MA 4OCZA 1CUJA 4HXEB 2ZSHA 3QZUA 5KBYA 1UKAA 1A7UA 1UKBA 1Z68A 2AJDA 3BE8A 4FHZA 2H7CA 3GA7A 1EVEA 1F8UA 5ALNA 2XLCA 2VF2A 1GT6A 1KEZA 4OYLA 4AZ3A 1BN7A 1XRLA 4C4XA 2OQIA 2VJCA 4BTLA 5E4JA 1T4MA 2WIJA 4J0DA 1R3DA 4OB6A 3OPMA 4G8CA 4OSEA 2PX6A 5HK9A 4OUKX 5CRIA 4KE7A 2VA9A 1W76A 3AINA 5AI8A 3IUNA 3IUJA 4L0CA 3C5VA 3O95A 2C5GA 1FFAA 3WYDA 4PF1A 3GELA 2VEOA 2J4FA 2WUFA 5E4YA 4UBJA 2WKWA 3BF8A 4Q82A 3VVLA 4FFWA 2OLEA 2CEKA 5LZ7A 3ZLUA 5ISMA 1UK8A 4H7JA 5SYNA 2WTNA 4X90A 1QIEA 3U1TA 4BVJA 1AX9A 2XMZA 3ZPXA 1IUNA 5ALUA 4OPMA 5D6OA 5JD6A 1MU0A 4KE9A 1CUBA 3FVTA 1N8SA 1E8DA 2XQJA 2QZPA 1NU8A 1BS9A 1CUIA 5C81A 5CTAA 2HFKA 2QUBA 3O9MA 4PQEA 1EINA 4HVTA 1U4NA 2O2HA 4U2CA 4OB8A 1AC5A 1CUFA 1T2NA 4Y2YA 1YCDA 4P9NA 3MGAA 5AI0A 1TKRA 2CUTA 1FFDA 4P93A 3R3UA 5T4BA 5DYYA 3ZI7A 3S2ZA 5AKJA 4PNZA 4WFKA 3ZLTA 5AHXA 5HF8A 1ACLA 3QBJA 3GZJA 4AB1A 2JGJA 2JF0A 1FSSA 3G9ZA 3HYSA 1ORVA 3KXPA 3PFBA 5KREA 3H18A 5EIAA 1MX5A 4X92A 4IO0A 3VKFA 2ACKA 1BCSA 1DTEA 2WUEA 4ZREA 4B0OA 2H7YA 3FBWA 4YPVA 5ALVA 2C5FA 2WG1A 3I2FA 1KU0A 4ARAA 1BCRA 2VT6A 2OCGA 4LKOA 4QDTA 3VJLA 4GI1A 5ALWA 4CI9A 5FLKA 2PM8A 3WL8A 4QWMA 2Z8XA 5EIHA 1LPMA 1EA5A 3L1HA 2PBLA 1XRPA 5EFZA 5JANA 5H3HA 1YA8A 5LZ5A 1QGED 3HSSA 3FSGD 3R40A 5FPPA 4H7FA 1ORWA 2DHDA 2J3QA 5K5EA 1BEEA 1BN6A 4Q05A 1YA4A 2P8SA 5DLPA 3FWHA 4JH0A 3WIOA 1ZD4A 3WL5A 1SCKA 3O4IA 3CN9A 3Q8WA 5DTJA 2PSDA 4XWGA 5CXUA 4PSCA 4QLOA 1L7AA 2JEYA 1VA4A 4H7DA 1XZGA 2GYUA 2HA6A 5I7UA 3VDXA 2VSQA 2ZYIA 2V97A 5JAHA 3B5EA 4B0PA 3RK4A 1QIIA 5I8PA 3FYUB 4DSZA 1LPOA 1IUPA 3EQ8A 1QO9A 4PSUA 4WFJA 5ESRA 3D4LA 1ZI9A 3W05A 1IMJA 2WU4A 2VJAA 5JADA 2GBFA 4DM7A 3OTQA 2CBGA 5HKBA 1CQZA 1WB6A 1F0PA 2FJPA 4MQLA 1QIDA 2BCEA 3W2TA 1HDEA 2AJCA 2IITA 4ZGBA 1ZGBA 1E66A 4UHFA 4BE9A 4MQMA 4Y2TA 1E3QA 3G0BA 2EDCA 4UUQA 3FYUA 2HA0A 3H2JA 1Q0RA 3A2LA 4XJVA 5C8VA 2DQZA 2WG0A 5DJ5A 3JYHA 4W1QA 2PUHA 3WL6A 2OG1A 4Q3KA 2WHRA 5CW2A 1AQLA 2HU7A 3ZLVA 5IH7A 4AQDA 4IH9A 3C6YA 1MTZA 2YH2A 3N2ZB 5ALGA 1HLGA 3LS2A 5LYYA 2AJLI 2JEZA 4C4YA 1XKLA 5T4FA 1HL7A 5AIBA 2OQVA 2G4LA 3F9CA 4L3WA 4WY8A 4GXNA 3L1JA 2XUOA 2Z5GA 3IURA 3AIMA 5ALHA 2H7XA 1CUHA 3LCRA 2ZJ7A 2VAVA 2QTBA 3M82A 5ALDA 1JI3A 5SYMA 2J3DA 2QMQA 1MAHA 2HADA 4HRYA 4BATA 1AMNA 2OAEA 1XLUA 3EQ7A 2OCKA 5K3EA 3QVMA 3WKCA 1XROA 3ZWQA 4QWWA 3G02A 2PL5A 2YYSA 3S8YA 4XVCA 1R1DA 2HFJA 1LZLA 2QOEA 4G4IA 3D2BA 1QONA 2HA4A 4UHEA 4C88A 3DOHA 4QNNA 2JGMA 1TQHA 2VATA 2RI6A 4QEKA 3O4JA 1C4XA 5AOAA 1UK9A 1THTA 3G9TA 1W4LA 4UBNA 4QDZA 2NW6A 4INZA 5BV7A 3C8DA 3H2GA 1LPBB 4UBKA 1JU4A 1CEXA 4EY4A 2RAUA 1P0PA 3IDAA 4QLAA 4B84A 3ESCA 4K6GA 4F0JA 2BFNA 3D2CA 3QMMA 4EB0A 5ALPA 1R9MA 3I1YA 2ES4A 4QE3A 3LLCA 1LBTA 4C6HA 3IB3A 4ZI5A 4BCBA 4DMFA 5JALA 1UK7A 1A88A 2WTMA 4BB0A 5K3FB 1SCQA 2CKMA 4X7BA 5BOVA 3HABA 3T4UA 3BDVA 4O08A 1MAAA 4AN1A 4AMYA 3IBTA 2ACEA 2BGNA 5A2GA 1JMYA 3DDUA 3QH4A 4B82A 2AJBA 4X6YA 2ZYRA 3C6BA 1Y7HA 3HRHA 2GYVA 3WZLA 2DSNA 4E14A 3FCYA 3BL8A 3UMJA 2WFZA 4H7KA 4G4JA 2XQGA 4WY5A 5AI9A 1BE0A 1P0MA 3I28A 5CT4A 4I4CA 4WJLA 2Z3WA 5K3FA 1VXOA 3DKRA 1UT6A 3ESAA 4C89A 4G4GA 3R41A 5T4HA 3SX4A 5AKHA 4AO7A 1UWCA 4PSDA 3N0TA 4A16A 5ALMA 4J03A 4W1RA 4DYHA 3IVMA 4UPDA 1D07A 3IIIA 4GHWA 5AICA 3WKBA 2HA7A 3PFCA 5AM5A 5EGNA 2WIKA 4H7EA 3PF9A 3B3QA 1PFQA 2H9YA 1E89A 3QPCA 3FVRA 2XMSA 5AI4A 5EHXA 5DNUA 1X70A 3STYA 3O4GA 5AM1A 6YASA 5ALOA 1J07A 3E0XA 3L1IA 4AXBA 4UBMA 1EHYA 1B41A 5C8XA 1RYYA 4MYSA 4TPKA 5K3BA 4A23A 3A70A 4MEBA 1WHSA 5FXMA 3NWOA 1EDEA 1ZJ5A 3G0IA 1DWOA 3TGLA 4GEGA 1FFCA 5AOBA 4KAJA 5AI6A 3TJMA 3C43A 4AZ0A 4UHBA 3DKKA 4XX1A 2XUPA 1GPLA 5ALYA 1HKHA 1AUOA 4J0IA 5JD5A 1UOPA 4B6GA 4LIPD 4BCCA 1DX4A 4KE6A 5HQ3B 1QIFA 5ALZA 1ZD5A 1JFRA 4DTCA 2QR5A 5AIAA 2I3DA 1GQRA 4UBIA 2CMFA 3H2HA 3AJAA 1CUWA 1Y37A 2YXPX 5A7GA 5IVIA 4CIBA 1NX9A 1IZ8A 1G4HA 2DHCA 1XLVA 5IVKA 3I2KA 4N5IX 4F5ZA 3V1MA 2HL6A 4EBBA 3EQ9A 5HK8A 3WQHA 4C87A 2PU7A 4FWBA 1CUDA 1LPSA 2ZSIA 2XUIA 5JAUA 1U2EA 4EY6A 1QJ4A 1JJFA 2I03A 3STWA 2ZJFA 4RNCA 3PUIA 3WWEA 5HQ3A 4KRYA 1YASA 2XMCA 4OB7A 1EX9A 1MNAA 1BROA 4X95A 2OGTA 3R3VA 3C8HA 1XZCA 3WLAA 3R3ZA 2CB9A 1CUUA 1WPXA 5AM3A 4Y2PA 2PSHA 5HF9A 4GECA 2G5TA 1XQYA 1H2XA 3M83A 1TK3A 1ZGCA 5K3CA 3B12A 1G42A 3WYNA 1EB8A 5AK3A 3KOOA 2I78A 2WHPB 4B7ZA 4MWSA 4CG1A 1TAHA 1BEZA 4FTWA 1QIJA 1LNSA 4G8BA 3C6XA 3U0VA 2JGEA 4G5XA 3I2GA 2B4KA 5ALEA 3BIXA 3A2MA 1G5FA 4BC0A 4CCYB 4H0CA 2ROQA 2IX9A 3AIKA 1JT2A 1XZFA 2XUGA 1E5TA 1A8UA 1VLQA 1W75A 3F67A 3WJ1A 3D2AA 3WWDA 1QIHA 5IVDA 4BRSA 3FNBA 1OXMA 5JIBA 3QITA 4HXGA 1OILA 4EHBA 1QOZA 2WHPA 5AKKA 3QM1A 5FRDA 3VJKA 4BTVA 4QZVA 2QRUA 2C0QA 2GZRA 3WK7A 1EXWA 2QVBA 4UBLA 4DNOA 4U2EA 1SOMA 1MPXA 1YAHA 1DQYA 3R3XA 2WQZA 3IULA 2AJ8A 1U65A 4CCYA 3F97A 4G9GA 4LXHA 2ZYHA 2WIDA 5K3DA 4I19A 1JU3A 1NU6A 5DNWA 1E8NA 3SC2A 4XIIA 1LGYA 2Z8ZA 5ALRA 1QIKA 3WA7A 2VAXA 1EVQA 1BU8A 2WLSA 3D0KA 4MEAA 3BWXA 4C01A 4U2DA 1MJ5A 1WM1A 2OPHA 1IZ7A 1XKTA 3F96A 4LHEA 3W06A 3TRDA 4BAZA 3C45A 3MUOA 5AKIA 3VVMA 5ALIA 1WOMA 3WK6A 2JIDA 2EDAA 2FUKA 3RARA 4WDRA 5LIPA 3NUZA 3WA6A 4B80A 1XRNA 1R9NA 5C7YA 1QFMA 1TIBA 2V9ZA 5DTIA 4N8SA 1EI9A 3AIOA 5ALJA 4RE5A 2HRQA 5JZBA 5AP9A 3BJRA 3AZPA 5AOCA 4IH1A 3G9UA 3IA2A 1SFRA 3STVA 4LXGA 4BVLA 4GDMA 4FKBA 2CZQA 1ISPA 5E4TA 3WWPA 5A7HA 1KU6A 3DLTA 1XRMA 2VJDA 4YX9A 2FJ0A 3DEAA 4WDQA 4DSAA 2GBCA 3WWOA 2XUHA 1L7QA 4FLEA 4E46A 4BP9A 5FDFA 4ZV7A 5HCUA 3LIIA 2WUDA 4H35A 3GROA 4DNQA 5A71A 1AURA 5LZ4A 4W9RA 5CH8A 5FP0A 3ICWA 2JGKA 4FBMA 4X97A 5CH5A 4AX4A 2BAGA 1VE6A 4QDXA 2XUDA 1WHTA 3BDIA 1DT5A 3HACA 2XUQA 2Y2UA 5JD4A 5KWIA 1DQZA 1XZBA 4JYPA 2D0DA 3CN7A 5CMLA 1TCCA 3ANTA 1JJBA 1PJAA 4X93A 1H2YA 4EA6A 1R4ZA 3V1LA 3WK5A 3YASA 1YSCA 2O2GA 5BWCA 1A8QA 4KEAA 1GKKA 4EY8A 2B20A 4NVRA 5IKXA 4B81A 3M3DA 1J2EA 1LLFA 5FOQA 2HU5A 3R3YA 1DWPA 5ALXA 3K2IA 3X3HA 2C0PA 3T52A 3GBSA 1G66A 1R50A 5HZGA 2C58A 3FAKA 3WKEA 4AMZA 3ESBA 4FOLA 2HU8A 1ZD2P 3PI6A 2PSJA 3C87A 5LP1A 2XMBA 4PV7A 4NMWA 1GGVA 1ZI8A 1CQWA 3QPAA 5I9IA 1VZ2A 3FOBA 1GZ7A 5ALQA 5AK5A 4KR0A 4IH4A 1UFOA 2PU5A 3ZV7A 5ALTA 3NGMA 3O0DA 1CVLA 1L7RA 4M0FA 1DT3A 1Y7IA 3DQZA 1ZJ4A 4LYDA 3AZQA 3H04A 5AKLA 1CUAA 2BUCA 5CURA 5CT8A 1VKHA 1VJ5A 2VTVA 2WUGA 3QPDA 3KD2A 4IHAA 5CT6A 4H7HA 3CXUA 4G1FA 4MWTA 4ARBA 3DNMA 3DS8A 1ACJA 2HA3A 1LBSA 1ODCA 1TCAA 5JAPA 2XMDA 3H19A 1ZIXA 1ZOIA 1MNQA 1HPLA 2E3JA 5C8ZA 1WB5A 3WK8A 1C7JA 3DL7A 1GXSA 4K6KA 4CCWA 4JEIA 1XZJA 1SCIA 4UHCA 3UUEA 2QM0A 5CT5A 1XRRA 4B85A 4MXDA 2W22A 3WMRA 3V1NA 2HIHA 1WCYA 5A62A 4K6HA 3G0CA 3C5WP 2QUAA 2VQ6A 3DD5A 1XZAA 1UK6A 3WWCA 5LZ8A 4DIUA 5ALKA 1VZ3A 1U8EA 5T4EA 2RONA 4BAGA 1N1MA 5CT9A 4N8EA 1RP1A 4J0HA 5HKAA 3HJUA 1BRTA 1K63A 4TVKA 2GYWA 1M33A 4UHHA 3OOSA 2QKYA 4X85A 1Q84A 1UZAA 5EIEA 1VE7A 1XFDA 1UOOA 3CCBA 3PF8A 1ZD3A 1DU4A 4WCVA 3H2IA 2XI4A 5EI5A 5JZSA 3UUFA 4UHDA 2JBWA 1HBJA 3E1GA 2BGRA 4PO3X 2Q0XA 4I3FA 2QT9A 4LXIA 2GBIA 5BWBA 3BF7A 1FJ2A 2QJRA 3WK4A 3GUUA 5JATA 4JNCA 1QIGA 1RWQA 4HAIA 4MYDA 1THGA 3OC0A 4KACA 3EF3A 3LIPA 5AKGA 1CUEA 3NOXA 1QLWA 4EZIA 3BIWA 4D9JA 4V2IA 3OURA 5AKEA 3K6KA 4H18A 2X5XA 7YASA 2RGUA 4UFPA 4Z49A 4Y2SA 3DYIA 3STTA 1QFSA 2OAGA 2WSLA 5ALFA 2O2IA 4Y2VA 5A6VA 1XQWA 2GZSA 3F98A 2DR0A 2Z3ZA 4KYVA 4DMHA 3OM8A 5CH3A 5FPQA 2XMQA 4BP8A 2QXUA 1ZICA 3I6YA 1CPYA 1QIMA 5D3ZA 5AKXA 4Q1VA 4BE4A 4G9EA 1OCEA 4H7IA 1JMKC 3QYJA 1JKMA 4BZWA 4ZRDA 5AH0A 2PSEA 3IUQA 3TEJA 3AILA 3PE6A 3AUKA 2WIFA 5F4ZA 2BJHA 1GPKA 1K6EA 1PV1A 1Q83A 2WM2A 5AKZA 1GPNA 1WB4A 1AKNA 4BDTA 5IVHA 1H23A 1QO7A 2FX5A 2Y6UA 4Q3LA 1XZMA 1CFJA 3PICA 4U2FA 3WKAA 4U2GA 2G63A 4ZWNA 4RPCA 5YASA 1E8MA 2OGSA 4J0KA 1XZEA 5ALLA 1YB7A 5EHNA 2UZ0A 4X6UA 4OD0A 2BUAA 3D3NA 4A5SA 1MX9A 4J0CA 4YK7A 1GKLA 3RLIA 2ZVDA 2JGFA 2RIPA 3D7RA 2XUAA 4J3JA 4L72A 1AZWA 4X3CA 3KSRA 4FDMA 2ECFA 1VOTA 3WL7A 2WFLB 4H77A 2WHQA 5AM4A 2Y6VA 1CIJA 3WJ2A 4Y2QA 2XMRA 4NS4A 1EDDA 1USWA 2JGLA 5CXXA 4DGQA 3ESDA 1K8QA 3H17A 3AFIA 3K9BA 2QS9A 1YS2X 1CUXA 3G0GA 4DLNA 4KRXA 4HS9A 4BAUA 2XQFA 3A2NA 1DX6A 4HTAA 1AGYA 1H22A 4N8DA 4CIAA 4Y2JA 1O6GA 4GW3A 4K5QA 1B6GA 1UXOA 4FLMA 2OCIA 4PW0A 2O7RA 1YR2A 4Y9SA 3O9VA 3M81A 4BBZA 1QZ3A 3F8SA 3I2HA 3DOIA 4KAAA 3QMVA 2WFLA 1H2WA 1VA5A 1YAJA 1N5RA 2QJWA 2C4HA 1CUCA 4AO8A 3FLAA 3R3WA 4GLBA 2HM7A 4J7AA 3KWFA 1DWQA 3PDCA 2IIVA 4JUIA 1ETHA 3RKSA 2O7VA 4RGYA 3FCXA 3VJMA 2C7BA 1XQXA 1CUYA 3G8YA 1CUSA 5LZ9A 2R11A 5K3AA 3BJMA 4W63A 3I6ZA 1ZI6A 1UKCA 2DCMA 2V98A 4IQ4A 1EDBA 1W1IA 4UFNA 3G7NA 4EY5A 3BXPA 5FUMA 1R88A 2V96A 4W1PA 5KWJA 4YASA 4CG3A 3C6ZA 4Y2XA 5FKJA 4BCDA 1CV2A 2PSFA 3DYVA 2H1IA 3ICVA 3G9XA 1XLWA 3DL4A 3KDAA 5HFNA 5D3KA 5J3JA 1CLEA 5AM2A 3OG9A 1QTIA 2B9VA 1CUVA 1IUOA 2HHAA 4ZV9A 3W9BA 1S8OA 2XE4A 2WG2A 2HDWA 4L9AA 5DYTA 4DMKA 3QMWA 4GBGA 1YS1X 4N5HX 5DWDA 4AN0A 5AK4A 1EH5A 3FLEA 1CR6A 2XB6A 3O4HA 2R8BA 2XQKA 3E3AA 4DNPA 3WK9A 3ED1A 5LZ2A 4F60A 2OCLA 4MJ3A 4NZZA 2DQYA 3HZOA 1LPNA 1XQVA 2JGIA 1GQSA 4TGLA 2YASA 4UBOA 4OU5A 1IVYA 2OGZA 2EEPA 4FNMA 4K2AA 5DNVA 3Q0TA 4KAFA 3EIOA 4CFSA 1LZKA 2XUKA 4DMCA 1CUGA 1K5PA 2XLBA 3FSGA 5A7FA 3MUNA 4BRZA 4JYMA 2QXTA 3G0DA 3C70A 4FFVA 1TRHA 1HQDA 2J4CA 4J0JA 2WU3A 4M0MA 3STXA 2Y1KA 1F6WA 1K4YA 3I2JA 4ZXFA 1XZDA 1JJIA 2GBGA 4KE8A 3V1KA 4FBLA 4HXFB 1VXRA 3EBLA 1EB9A 2CJPA 2XUFA 5ALSA 5HF5A 4UFOA 2X76A 4E11A 3VXKA 3I2IA
chains in the Genus database with same CATH superfamily
3WGOA 4BNUA 2MYUA 4Y2UA 3LC7O 4MR7B 1MORA 4OK3A 3DZIA 2ZRBA 4Q1BA 4CM9A 4DL9A 3B9PA 2P2CA 4X41A 2I2CA 4AF8A 3J81A 4WH0A 1V5GA 1XWFA 5AW6A 1A9PA 2KB0A 2ODAA 4FE3A 1I3NA 2PWPA 1EBUA 4NE7A 4RK1A 3RBZA 3SHQA 4D41A 1VJ0A 4Z2AA 1EGVB 2A9KA 4QUJA 1TC1A 3TE6A 1QB8A 2AR0A 5HMMA 3AI7A 4JGGA 2QE6A 4HV4A 3NTQA 3FHLA 3KT6A 2WIBA 5JAOA 3OM9A 3AKEA 1EP9A 1ZVKA 3FSJX 1GA6A 2G36A 3GX1A 2PO7A 2P3SA 3BBPA 1FFGA 4N3AA 4ZO4A 1BHSA 1NP6A 2GNPA 2VJPA 4TWZA 5IDYA 3I83A 3T9AA 5H7XA 5MFPA 1JMVA 1L5QA 1YR1A 3PX7A 2Y0PA 2AN3A 2H17A 1FFSA 3ECSA 2C7QA 2Y0CA 4RZQA 4YRFA 4D43A 3R8CA 3NHYA 2R751 3LUGA 5FFNA 3S2UA 3T7IA 1R8SA 3MIZA 1MIHA 1Q0ZA 1GA1A 2L18A 3CO0S 4X61A 2R1TB 3SF8A 4MS4B 1UBCA 2HN9A 1EFAA 5J63A 3IILA 2BKLA 2PRYA 4Q37A 3NMUF 3IBSA 4F91B 2XUJA 2ZVQX 3V9AA 4F5EA 1UAYA 4UNRA 2VH5R 4OHYA 3R0JA 3R6TA 3JWPA 4LF9B 2FEOA 3U1VA 3KEOA 3PG5A 3KJZA 3MD0A 5AMXA 1G38A 3I6MA 4BNJA 3NM4A 1PT6A 2WJWA 4MR7A 1OAOC 4NEHB 4BUZA 5HRUA 4DJEC 4P08A 1U8XX 3EZFA 1MFZA 3D59A 3TTTA 2IEDA 1FTYA 2W2KB 4B3JA 2ZYSA 4LVOA 3K0CC 2HK6A 3CVOA 1IN5A 3VYTB 5FL7D 3TJZA 4GLFA 5U4QA 1N3BA 5EIBC 5MFZA 1QYRA 3W34A 3DMNA 4OHOA 1J22A 3OCZA 2RHTA 4I46A 3RCBA 4BKRA 4C5BA 4EYSA 1IB6A 4LYGA 3HE3A 3QUSA 3ONWA 1G8FA 4O1IA 4QTXA 1RWMA 1JF8A 1YQEA 2J7PD 3PX2A 3Q9UA 1CKEA 1CY6A 2O3UA 5LMCA 3ENVA 1FLDA 1W1UA 4IIGA 4YQYA 2H63A 3BCUA 5EIOA 5FNVF 2PLFA 2H57A 1ICEA 3GUZA 1V3VA 4KRGA 4IIYA 1GSOA 1AGPA 3S2SA 5DM0A 3LVRE 5F1KA 1LV7A 3UAWA 1OROA 2A9FA 2FRVA 3KLBA 1J70A 2VYCA 2HA5A 2G5PA 4P3XA 3H3XA 5CX1B 4CEIB 1XP5A 2ZYVX 2OXEA 2C4MA 3H2ZA 4L08A 4UNSA 4IXNA 1E2KA 3VPGA 1RAGA 1J8MF 1RQNA 1X2BA 3TLMA 2C2GA 1SOWA 3HZRA 5LLSA 2V9CA 4GF5A 4B9EA 2H1CA 5EWLB 1HOXA 2NO0A 4MS4A 4P82A 3W2HA 2HK7A 4J0FA 2I3AA 2WJPA 2LIPA 3AP3A 5E2IA 2BEVB 1JIVA 2R6CA 3WP1B 2G70A 1QKIA 3ANLA 5DEIA 1XCOA 3TEFA 3L1KA 3ZCQA 1SHLA 1J56A 5BQOA 2FMTA 1NXPA 4FR2A 3FH0A 4MUMA 4RE6A 4JCCA 2A6PA 4P34A 4ABYA 4NYJR 2X4DA 3L6CA 3ROPA 1PZGA 1NSTA 2G1AA 2W2KA 4GWLA 1XZKA 2DE0X 4CT0A 4F5YA 5LQRA 3PGMA 3MJCA 4ZYTA 4KV7A 4NPHA 2GH1A 3WX0A 1TF5A 1FDVA 4Z7OB 1CZUA 2Z4SA 5B7QA 4IKEA 2DERA 1VQ1A 3RJZA 2ORYA 1YC5A 2CV2A 2UXDB 1S6YA 4PSKA 3LDAA 1NJSA 3T5PA 3MJHA 4G8DA 1G7SA 1N5MA 3C1AA 4FCVA 4B6OA 2O57A 3GGSA 4CIYA 4FNGA 4UEOA 2OMEA 3V4LA 5CAEA 3F3YA 3F78A 4JQOA 3M6VA 4F2HA 5I6DA 3AEXA 1P0IA 4BKPA 2W6OA 1YBMA 1J5EB 5CX1A 1RTKA 4HWSA 3F6CA 4C0XA 4CEIA 2C8KA 2QTRA 1SKQA 1JDVA 2JCSA 4GG1A 4IG4A 1X6VA 5IBCA 2V7XA 4L28A 1LDYA 3EDQA 2R00C 2F1HA 3DO5A 4XGIA 4JC5A 1BXKA 1BXRB 1P0QA 3VBEA 4CG2A 3OCXA 3FLBA 4JLWA 1UWLA 3VNAA 2IYVA 4C0SA 4MUEA 4RFLA 5EWLA 3ROZA 1G20B 3D7KA 4YRBA 3RIEA 2IYZA 4BYMA 2VJKA 1H1DA 2UUBB 4BLPA 1N5JA 4DARA 1SUAA 3ES9A 4BFLA 1MOZA 3K9GA 4XEHA 2BUBA 4BMDA 2C1ZA 4LC9A 2XVMA 1NBOA 3LYUA 1K3UB 2GHQA 1Y4DE 5B6JA 3MT7A 4OP2A 3AFNA 3U7EB 3K9LA 1WUTA 2EWWA 2AD5A 1XTRA 2L69A 1AM4D 2IS1A 3TSYA 4UAGA 4UTPA 3VPBA 3VISA 1TW3A 4EYEA 1V4BA 3LPDA 2WWWA 4JXJA 5ICGA 5ILGA 3GLFE 5JPCA 2OFPA 2O1SA 1HSOA 2I3ZA 2YFHA 5F7OA 4DAOA 4NFHA 2B92A 1YOBA 5TMPA 4IIHA 1UEIA 1JI0A 1JDUA 2PGLA 1VSVA 4R9RA 2ZE6A 3GFFA 3RRXA 5KYYB 4QA9A 3T4PA 3WKDA 2QVXX 3AFOA 3DT8A 2R1ZA 5HBGA 1Y5LA 2WIAA 3E15A 1CERA 1RMQA 3BFVA 4GQAA 4PPGA 4KIUA 2QNBA 1O77A 4OSOA 5AKYA 2Q4DA 3C7CB 2NSLA 3BCRA 4E15A 2ZKLA 1SO8A 2V45A 2XQIA 3MWLA 3NNNA 4GC5A 5JH7F 2LE0A 1BXRA 4JZKA 3DEFA 5EY5B 5HXAA 3SVLA 1NDQA 3ASYA 1AGRA 4BLOA 1WB9A 2UU9B 1G20A 2DOKA 2O2EA 3HEAA 4GBJA 4MLCA 4OYYA 5EQJB 3QQ5A 4JKIA 4ETWA 3L7MA 1C8VB 1SCNE 2V6MA 3QX7A 3CIOA 5TSDA 4PZ0A 1XXHE 3CY6A 1KDTA 1AT1A 3BB3A 2L82A 3F5FA 3UUGA 5IASA 5L8VA 3E82A 3S40A 4QT4A 2W2LD 3UPUA 1HYHA 3HQ4O 3OQIA 4OXRA 3ZLBA 1SQ5A 1AXEA 1BD3A 3UBMA 2QN2A 3H1AA 3SOZA 2XT0A 2V3VA 3WQRA 1A2QA 1I2MA 2W2TA 2DBYA 4OQFA 3WMFA 2C9CA 1L4YA 3P0IA 3TFQA 2DPGA 1FJXA 3MGKA 3SNKA 1NC1A 2QNRA 4ZAWA 1EK1A 2C00A 1SC1A 1NQTA 4IAOA 4M99A 4EJ2A 2IH2A 1KGDA 5CITA 4NU6A 2C2OA 1NJ6A 4HS4A 1X1RA 4QRDA 3M9LA 3UB4A 3JWEA 3TSWA 2P9TA 3DFKA 3BXFA 3FYUC 4ER6A 2R86A 3DKVA 5KYYA 1CE8B 4P36A 3EPJA 3B6KA 4WFIA 5DM60 4DNFA 2ZGVA 3HDTA 5D1HA 4F6LA 3JRXA 2LIVA 4RJ2A 4UMVA 2JGNA 3MYRA 3HWWA 1Q95A 2BFCB 4F2WA 3T06B 1L3BA 1CUJA 5CM9C 2KHZA 3LO5A 4QHSA 4UU1A 4PCLA 2OHHA 1T8WA 1YDMA 2R87A 4LXYA 4ND4A 4EF6A 5JI2E 1VHLA 4M37A 4BE7B 4BQIA 2VYVD 4CF6A 2XDAA 2XNHA 2IHTA 2FGKA 1E6LA 5KDDA 1LJUA 3ABQB 1UKBA 2ESRA 3RQSA 4A1OA 2BFFB 4NCXA 5EERA 1NLYA 2GPAA 4DHEA 4F06A 5LD2B 3BD9A 4ITUA 1U0GA 5E95A 5KQSA 3D7NA 1FRVA 1IE3A 3M1LA 3TECE 1WO8A 1GT6A 2O0LA 3D8RA 4U7WA 3OOWA 2NUBA 2QN6A 4K6CA 1W59A 5LJIA 2JFQA 3S8MA 2ZBDA 3TF5A 1I9CA 2VK1A 3MOIA 2OP0A 5LYJF 2EFHB 2HLDD 2VJCA 1KZ9A 3RUIA 2GN6A 3EXEB 1UBSB 2I6QA 2DKNA 1NXOA 3Q5GA 4OB6A 2AQ8A 1GN9A 1ZMTA 3FMVA 1XJCA 4HAYA 2B3TA 4LDPA 3VYUB 3ZUGA 1GQYA 1TXGA 4I0WB 1XVUA 1YZLA 4OSEA 4OUKX 5ARBA 1QUEA 2CLLB 3GR6A 3MMNA 3QK7A 4TRRA 4DCJA 2R6GA 4PTLA 4DUPA 3QX3A 1J5XA 1CE8A 2XT6A 1W76A 5JBNA 1N5KA 5BO5A 1V6SA 1JYEA 4ENSA 4YJ2B 5EHIA 4FM9A 2IJGX 2HSJA 3VO2A 2X0NA 3TOSA 5FF9A 1K8YB 2IYWA 1TYZA 3CX4A 3UMFA 1TD1A 2EBHX 2WVHA 3GJ5A 1KDYA 2CSUA 3QIVA 5B1HA 3JAMA 2C5GA 1U7PA 3CTMA 3FDJA 1SCUB 2W2XA 3EG9B 4MW0A 1Z5NA 1IRIA 1D8AA 4D9GA 4F5WA 3O8DA 3N2YA 4XOUA 4PHCA 4PF1A 3NHBA 1QR6A 3RAGA 2BFFA 3WYDA 1E1DA 4FD2A 3I2YX 3OU2A 1K6JA 1T9CA 1YL7A 2WUFA 5E4YA 2BTQB 3OMWA 5I5EA 4PLPA 4V0LA 5CR9A 4PIPA 5ABPA 1T9GS 2OZKA 1FTQA 3CF4G 3AR6A 1QFYA 3PNOA 4GX2A 4ANFA 4BN0A 4DDUA 3VVLA 4CGZA 3DCJA 3QVUA 2VHCA 3H4TA 2FYTA 3T0FA 4DYVA 4ZDKA 4FYVA 3SEQA 2PIDA 4RQUA 2PMEA 3EXEA 3ZI4A 5BSRA 1ZVMA 3FOAA 3ZLUA 4WK4B 5FLXA 1BGWA 2V6IA 2QLFA 2H3EA 5GVRA 5HE8A 2JANA 4GRAA 5SYNA 1QIEA 1DUVG 2F55A 1JIUA 1HDYA 4IINA 3QLVA 1ZW1A 3ZPXA 1R0ZA 5EXPA 3K0BA 4GZ5A 1U0JA 3P9CA 5ALUA 3UK0A 8LDHA 2C3PA 3ND8A 3MTBA 1VGQA 4YJ2A 3TSAA 1YVEI 2CNOA 3A1DA 3ZWAA 5D7NA 2IY9A 1OB5A 3JQ8B 2XQJA 1CJKC 1NU8A 1ZGHA 2O8VA 3F9IA 3ELYA 1C8BA 3IR7A 4G5FA 1N5LA 1OXBB 4L0DA 1QP4A 1ZK0A 1DJOA 1Q3TA 2AQHA 5CTAA 3WLHA 1DE0A 2VN8A 1RZ3A 2X4IA 4G07A 4D8XA 2GILA 1DC8A 1BCSB 1RYZA 2Q5LA 4M6WB 1SCUA 3EG9A 3QEKA 3R74A 3ZXSA 1CUFA 1ZMOA 3B1ZA 3QYAA 3I5YA 4Y2YA 2V6GA 4P9NA 1LSJA 1SNYA 4P8RA 1AD2A 1B15A 3H3JA 4JLDA 4E07A 2GLUA 3CEPB 3F4LA 3I72A 1IWBB 4GUAA 5JNWA 1K7FB 4ZEXA 4KGDA 4GP9A 3W1WA 4K05A 1TKRA 1JPUA 4KVFA 1Z2AA 1A9YA 1SOUA 2R5FA 3AUYA 1U1EA 1CRQA 2LD4A 4YLEA 2CNWD 1I3LA 2BFEB 4YCCA 2BEKA 3FNIA 5ANRB 1GRRA 2I4LA 4UOQA 2M1XA 4U5XA 3RVLA 1BVYF 2AX3A 3QX8A 2B25A 2FXVA 5C5DA 3S2ZA 1E6WA 5AKJA 2OYRA 1LI7A 2IPNA 3MTIA 3W0LB 3ZLTA 1XPOA 3MS7A 1HMPA 3E5RA 3RJTA 3EK2A 1SA0B 2B5VA 3QBJA 3VC2A 4AB1A 1ND6A 3J7TA 3NTXA 3A6PC 1C9MA 1ZG3A 2GHTA 3EIXA 1FSSA 4HZUB 4ZQHA 4A92A 1ORVA 1XHEA 3JQ8A 3KXPA 1VIAA 2DFKB 3O4FA 3GEPA 4N0MA 5JG7A 3SHWA 4OA5A 2XYHA 1J2RA 4J76A 3FCEA 2HWXA 2PAAA 4O2AB 1O94D 4BGVA 2ZXUA 2HHLA 1NL3A 2WABA 3JQBC 1JXOA 2E49A 3IPLA 4FEAA 4FZJA 2W4MA 4M6WA 1BCSA 2P2LA 1GT91 2XCUA 3PQ6A 3T1NA 5HWSA 2BTOA 2I7DA 2WUEA 2PLNA 4QICA 1K4KA 2FLWA 2H2AA 3OC6A 1QDUA 5L6LB 1PNRA 2JHFA 4ESHA 1NP3A 2ETXA 5BNFA 1RI5A 1MGOA 3FBWA 4J29A 4R68A 2FHSA 4BJ3A 4YPVA 1E3EA 2NVWA 1ECPA 3QUCA 1YMQA 5ALVA 5KTSA 3PYXA 1KMMA 1NMSA 2WG1A 3I0MA 2BFEA 1Z7BA 2FG6C 5F3RA 5DHTA 3HA2A 4FUQA 3LT5A 1AKWA 3DB1A 4KQCA 5DK4A 4LKOA 1WQ1R 5JSYA 1DRJA 3QPBA 2IW3A 2H06A 2DWCA 3C8UA 5ALWA 5L7YA 5FLKA 2O48X 3WL8A 1J97A 4H27A 4MRMB 3O8OB 5JRJA 3DP7A 3LCJA 1EA5A 2PKEA 3GLUA 3VTAA 1XBTA 2PBLA 2YN4A 3BHNA 2Q5EA 2OC4A 4AZSA 1SA0A 4MPDA 5TPZA 4X8HA 2IXTA 1G55A 5LZ5A 4PG5A 1QGED 1SURA 3WRXC 1J9EA 4HZUA 1CY0A 3FSGD 4XDZA 4DR1B 4CBVA 1PT9A 4OL9A 4UDOA 1RRGA 3P19A 1DI0A 4O2AA 2CMKA 2G88A 3Q8MA 4YMVA 1N3YA 4H08A 4RF3A 3RPEA 5DLPA 3FWHA 1GPWB 1FXWF 2QL9A 2FFAA 1FUKA 1WZNA 2XNCA 4J49A 4JELA 5HEKA 1R9GA 2ZJ0A 1OXKB 2ZU6A 4HJXA 3GLFB 1R74A 1QF9A 4FT2A 4RY2A 2C04A 3G9QA 4NABA 1KARA 2PSDA 5IKMA 3Q12A 3ESZA 2PGDA 2Q5QA 1GSIA 5ADVA 3TTSA 2Q0HA 4LCJA 4AY2A 5HA5A 2F43B 3N2NA 2CCJA 3C5CA 2ZUTA 4Z4CA 3AR8A 1RYBA 1Y3CE 4C0BA 3U5TA 1RWPA 1M73E 2YWEA 5CXUA 4KQ9A 4WXYB 4BO5A 1TCVA 1XNGA 4LWPA 1O87A 4ALMA 4G1BA 4LHVA 1KXZA 1HLPA 1L7AA 2FK7A 1VA4A 2FSPA 1CEQA 3NT2A 4MRMA 3O8OA 1KI4A 2DECA 1ECJA 5K9ZA 1NNEA 2QRQA 1FDRA 3QKTA 2YMMA 4CM9D 2BGGA 1VGRA 4PGFA 2O50A 3W6UA 2JFNA 2KJQA 1GZ5A 5A3VA 3L0CA 2AOXA 1QIIA 2H2WA 4N6NA 5I8PA 5LA6A 4ESEA 1IUPA 4Z3DA 5TT1A 3TIFA 4ZHQA 4PSUA 1XXHB 5JXHA 1X1AA 3P27A 2W48A 3WLTA 1O5OA 1YBFA 1ABBA 1ISSA 3UAZA 4AUEA 3CLTD 3D4LA 5EP2A 4LF5B 3VSCA 2YN2A 4XVHA 2XUZA 2WU4A 4EUFA 2VJAA 4Q4JB 2ZIUB 3EQZA 5BORA 4S1VA 1YR3A 5IAJA 1M2KA 3FZYA 1WRBA 3QJ5A 3GLFA 2Y1OA 1T0UA 3ZDDA 3IQFA 3R0QA 2VHJA 4JBIA 5CLIA 5HKBA 5KSOA 3GCGA 1CQZA 1LF5A 1ZVVA 1RKXA 5KVSA 4N7MA 1F0PA 1GLVA 1T13A 3MM4A 2DUWA 5HP4A 4POOA 2F43A 4LCBA 4XI9A 1WMSA 1HDEA 3NB0A 3M89A 2YHUA 2IITA 3DULA 4I99A 2XZLA 1JUDA 4PYQA 4ZGBA 1OXSC 2FQQA 4YDRA 4Q7QA 5K8VA 3NEAA 2WBLC 3RK1A 5HKKA 3QOFA 4BLUA 5IDXA 1Z2PX 1SCDA 4LTDA 2VQ3A 1E66A 4UHFA 1WZIA 2P0AA 2CLHB 3ZEAA 1VYHA 1X7HA 2VSXA 1ZNXA 3PUZA 5FBWB 1E3QA 1VYTA 4LOJA 2P9JA 2W0MA 3NJ4A 3MIIA 4B3MB 3CUKA 1NY5A 1UDWA 3NM6B 1QZZA 1WAMA 1XCJA 2AZ4A 3P0JA 4K28A 4F2PA 3TBHA 3AVOA 5FWXB 3A1TA 3LUHA 3V2GA 1H1LB 1TLLA 2C5LA 4TYNA 3D81A 2PUDA 1XXHA 4XJVA 1EFUA 5KU7A 4N01A 3T5TA 4N0PA 1ZBQA 1YIAA 3HDGA 4K9RA 3W9YA 2P2GA 3ZHSA 5IZCA 4KH0A 4MRSA 1VM6A 4CM8B 2RHJA 4Z8YA 3W78A 3DEIA 4AZ0B 1TT7A 2QSJA 4Q4JA 2MSCB 4HH4A 2IYFA 1ABEA 4U4AA 5CW2A 5A0FA 4W9MC 3THWA 3BSSA 4QAJA 3USCS 2OHXA 2YHBA 3BWYA 1E6EA 3ZLVA 5FNVB 2YJZA 2I4TA 4IH9A 1BVHA 4PIMA 1MTZA 2DFTA 4YI5A 4EPWA 1HLGA 1WEKA 3LS2A 3LL7A 4IZIA 4C4YA 4ZQBA 1XDGA 4X1OA 4QOEA 2BM0A 4D4IA 3M6LA 1HG0A 4YJ3F 1PQYA 5T4FA 5IXSA 4I55F 1M2NA 3T3GA 3GAZA 1ATZA 1FUYB 3QV2A 4NV3A 4WY8A 1L5HB 1NJFA 1LBQA 1I1NA 2Q2OA 3H9JA 2XGJA 3IURA 4Q0MA 5BSUA 2BW0A 2C03A 2GFIA 3GOHA 5ALHA 3NGXA 4FDAA 4D57A 2BONA 2H7XA 3LK7A 1NUAA 4NS1A 3UJCA 4YT4A 4MYUA 1H66A 3Q41A 2ZRQA 5I01A 1NVGA 4R1QA 3SJZA 5F51A 3EA4A 1ARZA 4TMTA 4G0YA 5FWXA 1XFAA 2QTBA 1STOA 1JV2B 3CV3A 3ROTA 2KQUA 3EF1A 4JBLA 3OWXA 2BHRA 5GADl 2QMQA 3KEFA 4MS3A 3TQFA 4JP1A 3CLSD 4CM8A 3C1OA 2AG0A 1NRXA 2FVXA 3PWTA 3T4EA 3ORQA 3WZ2A 5GIOE 2GPJA 3EQ7A 5BRNA 3TZCA 3VR5A 1RIIA 4AI6A 1N2BA 4I7EA 3L8ZA 3WKCA 3VO8A 4CMIB 4HH0A 4E0BA 1YACA 1SR8A 5FNVA 1A71A 4YFVA 3AL3A 3H2BA 4CMKA 5KWSA 3KELA 3TPZA 2A0KA 4RPJA 4NICA 1N2CE 1NXWA 3WWZA 1NA5A 5C5IA 2PQ6A 3N5CA 3DR3A 2HCTA 3CIFA 1XU4A 5KPDA 3JAKB 1EUDA 1WD5A 4YCLA 4FMCF 2AYXA 1VG8A 2OQ2A 2WSMA 2YJ3A 4P4LA 3RASA 4G4IA 4ODIA 4PX5A 2X15A 2JH9A 1F0KA 1XN4A 1F51E 2DH5A 3N3BC 1J6UA 2Q7DA 3TLCA 4DBZA 4BX2A 1UZMA 1O2DA 1XPRA 4QNNA 2JGMA 2NTNA 1JLHA 3NTRA 5CNJA 5SZIA 2JFBA 4ZQFA 3SS9X 3TOZA 3PJRA 4DJAA 4JYBA 2VATA 2IX3A 4QYIB 1AK1A 1Q1GA 2Q99A 2FSUA 4NXNB 1C4XA 2GTIA 2IH5A 3UKDA 3L6DA 1THTA 3G9TA 1X1TA 3H65A 2JIZA 4UBNA 3MXTA 5FYQA 3IKLA 4ZEWA 1BO6A 3PEFA 4ND8B 4ARZB 4CQLB 3C3AA 3FCCA 2JW5A 4KHZA 2YXEA 1KJJA 4QDZA 5K0ZA 4Y2GA 3KS9A 1FF9A 2O23A 2WD7B 2H8KA 4DSTA 2YIDA 2NW6A 1XTVA 1PX2A 5BV7A 1UCFA 3CTPA 3R7FA 3A9RA 3C8DA 3H2GA 1L1EA 1LPBB 2R8RA 4UBKA 1YDGA 2DPYA 1CEXA 1XB2A 4BJ5A 4EFMA 3IDAA 4WLUA 4CMIA 1TPZA 2PKRA 4MA5A 4R2IA 4B84A 3EFOB 3QVTA 3ESCA 2XW6A 2EBUA 4N76A 2ALJA 3P2KA 4ZYUA 4CXMA 4MAFA 3GIDA 3KU1A 4MQEB 2ZRGA 5EMHA 3LRTA 1ZK1A 3O84A 4PQFA 2EFGA 1GAXA 3JAKA 1MZVA 4V0SA 4L4YA 3X43A 1O89A 5JH7B 1DJPA 2YMPA 3LLCA 2J45A 3CZAA 2EEZA 4PLCA 1WMEA 2JJMA 1IB0A 4KFRA 4PZEA 4XRGA 5HR5A 1AHIA 3ETGA 1E1YA 1KJ9A 5AVSA 2V1UA 3ZV5A 3FKSD 3DTVB 3CRZA 3HB5X 2QVLA 3KSMA 4NBSA 1E9AA 5BOVA 4GE0A 3HABA 3LBYA 4QYIA 2NVBA 5IARA 1V2HE 2JPDA 2WYUA 5FR1A 4C7XA 1E1MA 5EJEA 4ASUD 5HDQA 1P2BA 1ADGA 3BDVA 3R76A 3C5EA 4I5IA 3V1UA 4LXXA 2PZLA 1PJCA 1Z35A 1DEHA 2CHUA 5SICE 1M7GA 2FGJA 2ACEA 3M34A 1Z2NX 4ND8A 2DAPA 1HTWA 1W9HA 2BGNA 2F90A 1QDEA 3DTYA 4MIYA 4Y9DA 1JMYA 1MA0A 4G67A 2H08A 2WD7A 3QJYA 4AG5A 1DEXA 1EZZA 4TRNA 3I01A 5CVCA 2A86A 4W9NC 3EGVA 4R5MA 2CLEB 1D0IA 4P3PA 5CVEA 4UCQA 1W44A 2E4VA 1YJBA 5M7EA 2ZYRA 5JRZA 221PA 4ARUA 3C6BA 4IIEA 2PUTA 1E4VA 1N6IA 2AOVA 4PFSA 4TWIA 2Y0DA 4FOSA 4WXPA 3RANA 5BYAA 3L0PA 1G8YA 3EFOA 1M1YE 4IIUA 2ADOA 3DVSX 5EFOA 5HOEA 3L7CA 3AB8A 4FOTA 1BDMA 4INAA 3FCYA 2WW8A 4OGWA 4N48A 4X5OA 4MQEA 5CYFA 1GPH1 3MJDA 3X1DA 1Y5RA 2CJFA 1QPBA 2QPTA 2VOJA 3ZZNA 4AURA 1QVWA 5KPJA 2ZM5A 3K70B 4O4HF 2UXCB 1X15A 1BDJA 3I28A 3KOMA 4X7RA 5JH7A 3OF5A 3ZVMA 1SVIA 2GJ4A 2XGMA 3NH6A 5F7XA 1U8UA 2A5GA 3NZEA 5HTKA 3QEBZ 4DCUA 3WRVA 4ZDWA 3DTVA 4LQCA 3OKCA 3TGWA 1QK5A 2D5IA 2V0NA 2ZSBA 3E7XA 4QTUB 3ESAA 4B3DA 3OOYA 3IL2A 1P75A 1KWKA 2YVLA 2ZB8A 1P1KA 4U7TB 3K94A 1A1SA 1BJTA 4GXRA 2HDNB 2XWBF 1JZTA 3SYLA 4DIDA 4YR9A 5AKHA 1RLTA 5U9CA 5LYJB 4AO7A 4PRLA 1GCIA 2C3UA 3EIUA 1KDPA 4CCSA 2GDJA 4IW3B 2WVJA 3N0TA 4PSDA 4A16A 3FUXA 4W1RA 3U62A 2HSEA 1KPIA 1PS0A 4D6XA 5D87A 2V55B 1ISGA 3BRWA 3EVBA 3N2EA 3IVMA 5TQ2B 4K9OA 1D07A 2R6JA 3R5SA 3L7NA 4GHWA 1X7YB 3IMGA 3R8FA 4FHEA 1BX3A 2HA7A 3E6AA 4U7DA 3IKMB 3WNCA 4OP3A 3R75A 1K6MA 3BTVA 4EPXA 5JSQA 3GLGE 2AI2A 3D3KA 4AKEA 2FSGA 4ZV4A 1PR3A 1PZFA 3N2GB 3VYWA 1OE0A 2IHUA 4KSCA 3TW0A 5EESA 3ZY6A 2VUSA 3PF9A 1KC1A 1C3OB 5COBA 2JA2A 3N58A 4JLNA 5A9TA 3V8RA 1YNSA 2FSVA 3AM4A 4MVJI 3AVUA 2VK2A 4NENB 2Q9BA 2V03A 2PLWA 4GSKA 3RYHB 3LWDA 5HRCA 2WK1A 1NW7A 1M66A 1T2AA 3LO8A 1YUNA 2XMSA 3B6IA 3HDYA 5F5LA 4KQ2A 2FWMX 1TYCA 3AYZB 3LQ1A 1SHJA 2A35A 2QRPA 2XTMA 2H29A 5IMSA 1A3CA 3OF3A 4M1YA 1KORA 1XLTC 3R0IA 3O4GA 4O33A 2MU1A 2CXQA 3OZTA 3QVXA 1AOXA 4P0TA 4GR4A 7AT1A 2IHNA 1EWTA 3DR5A 1VMEA 3O90A 2IFTA 2YCLA 1XNQB 5F2KA 1C4OA 4OIFA 1SKAA 3B9RA 4JBNA 2C2WA 2JAOA 3V2HA 1W36C 1YQGA 4IGFA 3ZDYB 5LYJA 1F7UA 1XCMA 1G3MA 4G5RA 4J1QA 4Z1MA 3DVRX 2B30A 3LOPA 1H3FA 3OD1A 3WLOA 2TECE 3TAUA 3IR5A 4RFVA 2ATIA 1G16A 3PITA 3QLTA 4BUCA 3A4IA 2FB9A 1CNEA 2IHKA 1ZJYA 4YUZA 4CKXA 2IXGA 5F78A 5KYGA 1OGJA 1B41A 2PGXA 5C8XA 1CF2O 3F7TA 5TQ2A 3QXGA 1NFFA 4CR8A 3EBPA 2V65A 1GZHB 3P4YA 4IBOA 3PX3A 4JC0A 2CXRA 2PKXA 1PK8A 3FLMA 1ZRMA 4JFRA 5K3BA 4BS9A 5KJFA 1SCAA 3CMCO 4IEFB 2A7XA 3LXXA 1I10A 3N2GA 3DE2X 1EDEA 3NWOA 2AC4A 1MOPA 1DOZA 3G5AA 1Q1QA 3E4CA 1C3OA 3GH1A 3KFVA 4TSFD 4GEGA 1FDSA 1Y4UA 4J16A 1VJDA 2SICE 2VJMB 3RC3A 4NENA 1FFCA 1DADA 1P7VA 5AI6A 2W7TA 3RYHA 3TJMA 4UHBA 1Y1PA 3LA6A 3QHPA 4FOOA 5F9FA 3DKKA 4B8ZA 1PZXA 3TNFA 2XUPA 1HFJA 5FLEX 3K5WA 4BKOA 4YQZA 4FNAA 3VNBA 1HKHA 4YROA 3CKLA 3IUYA 4OMUA 3H9UA 1AUOA 3GWZA 4RMIA 4BO0A 1H2RS 1TO6A 4CQJA 2Q6VA 1E1QA 4B6GA 4EHLA 3AU9A 3TS1A 4LIPD 4BKMA 4KE6A 1IM8A 3ET4A 1A69A 4OHRA 5IM5A 5HQ3B 5CB0A 3QWBA 2CE7A 2DJIA 4UOEA 2A59A 2ID8A 2E37A 1MV5A 4FZ3A 5I5GA 1Y4SA 1E2FA 1ZD5A 2VHEA 2PL3A 1E3TA 2J3KA 3A6LA 3K0KA 1RYDA 1Q7EA 4DTCA 2I3DA 2JJ8A 3UAYA 1GQRA 1LVUA 3H13A 3O2NA 5CLGA 2CMDA 2WUWE 1Z82A 4JI7B 1M1ZA 4PYNA 5HOQA 5B1DA 3O8CA 2UYGA 3DT6A 2VSFA 3H2HA 4HNQA 2O3QA 2XB8A 3OFSA 2O7QA 4IZOA 3QKUA 1M8GA 2Q9UA 1AKUA 5A7GA 3WB1A 2NZWA 5IVPA 2C42A 1NR1A 2FPPB 1NX9A 3LMKA 3HMQA 4G4SP 2WF6A 5K51A 5EZ6B 5BQ5A 1XX6A 3VKHA 3TQSA 2BMEA 4N5IX 4C76A 3B8EA 4MX8A 4OM7A 4F5ZA 2PXAA 2WE7A 2X1LA 1FP6A 4RK0A 3PDJA 2FP3A 2WM8A 2QRZA 2PAFA 3EQ9A 3WQHA 2YOFA 4URXR 3W5UA 2VJMA 2FPIB 1XK7A 4ZVMA 4FWBA 5AXDA 4EG8A 1W4CA 1EA7A 1QKKA 4WBXC 2FWNA 1SUEA 5EXTA 3WS7A 3KDSE 4B5KA 1KK1A 3KKKA 5A9SB 5JJKA 4EY6A 2PQ2A 3LHKA 4P3YA 3K0SA 4P2BA 5C53B 1SQ0A 3I0NA 5I4IA 2JFHA 5LL6P 4QPDA 1JJFA 2I03A 3O2JA 4TROA 1E4YA 2OVBA 4I1VA 3PQ3A 5U4XA 2XMPA 4O0MA 4TZ6A 4AJLA 3ZWBA 4D42A 3AR2A 3CX7A 3FI0A 3MYYA 1L6IA 5HQ3A 1CT9A 3QBTA 4KRYA 3ZK9A 1QORA 4E3ZA 1I24A 1YHYA 2JD0A 4EUEA 3IVRA 2O2ZA 4EYKA 1IQUA 4K40A 3X1MA 5TPZD 4TWRA 5LIPA 3KWLA 1FVFA 2C7RA 3NC1C 4CODB 5HZMA 1JLSA 1N2CB 2AMLA 5BRAA 3KG2A 3V32A 3NAZA 3KJIA 4O5OA 4Y2PA 1Q19A 1N2GA 2REXB 4PYOA 3SE7A 1DLIA 1C5KA 2WNIA 1NZJA 3LY5A 1IY2A 1Z0FA 4L4UA 2FPPA 1GSAA 4GECA 4UNPA 3NYWA 4WIAA 1H2XA 3EDRA 4R41A 1LDNA 1L7PA 1IN6A 2QA5A 3FOCA 3M83A 4GGPA 5GY7A 3MTDA 1GGJA 4Q02A 9ABPA 1ZGCA 4YRAA 1WG8A 2JAPA 4FFLA 3HBAA 3S99A 4BJHB 1SKMA 4KN6A 1IXYA 5FUWA 3T5MA 2W8BB 1KMQA 1NULA 4D25A 3SZMA 4Z54A 2I78A 3UYKA 3SJUA 3U4GA 2FPIA 3FFBA 3H75A 4H3VA 1UWKA 3S6JA 4BLWA 5K03A 4B3RB 1XQ9A 3U40A 1BEZA 5A9SA 5GONB 2Y0BA 2J6CA 1E1LA 3RVJA 3B5IA 4KNVA 2YV2A 1JU9A 1Q6ZA 4ND6A 2AN1A 2AFRA 2EGUA 3E18A 2JIQA 5FWNA 2P77A 4IGEA 4QECA 4F9TA 5EJ6A 5LB2A 5C1OA 3I2GA 3JVEA 4P5PA 2B4KA 3H8WA 5I9MA 3I52A 3VKWA 5CFZA 2R0QC 3A2MA 3D8UA 1HUQA 3VO9A 1G5FA 3VTZA 4QTZA 3DE6X 4B31A 5IM4F 1PTKA 4EG0A 1JDJA 4JJ8A 2V4ZA 3DXYA 4LMRA 1E3DA 2PCJA 1TTHA 4RXMA 4LRYA 3IQEA 4BKUA 1BRMA 1OU4A 3QWHA 1JT2A 1MVLA 1XZFA 3DVAA 5DXJA 2ICAA 3ROXA 1N2CA 4OQLA 3ENQA 1MQSA 2AUTA 4HNAB 1A8UA 3IC5A 5DCYA 4WOJA 2NSHA 3D2AA 3UHJA 5KOIA 4BRUA 2A9RA 1Q14A 3OMLA 3MJEA 3HGMA 3PKJA 1NOJA 2BELA 3OE4A 3S2YA 3UGQA 2PKQO 4RF5A 5JIBA 2YQZA 6ABPA 4C30A 4UARA 3ETCA 5DNYB 1FNDA 4L3OA 1M7HA 3W4KA 4DN6A 3CT4A 1I14A 2W8BA 2QTAA 5EAIA 5DF1A 3P8ZA 1Z56C 2GFHA 4KO3S 2BT4A 3SYRA 4BIIA 1Q7BA 1SG0A 1TYBE 2Z8YA 3BZWA 5KB3A 2OORA 1MEJA 4AX8A 1I36A 3WGUA 3ZQUA 1YJQA 3OLCX 3AR3A 4BTVA 5EHGA 3M6XA 2JA1A 1NMZA 2GZRA 3OJWA 1FXWA 1OH6A 3D31A 3FYDA 4OK5A 3HCPA 1JB1A 5ERYA 1MRNA 3FRJA 1UT8A 2QTTA 4MGEA 5JQWA 4MHTA 3UJ8A 4IJVA 2XNSA 4HG2A 2WQZA 1U4OA 1TF7A 2ZYAA 5HKKD 2LWIA 1WXIA 1DDOA 1ZK2A 1F3OA 1L5OA 1BA2A 5IYZF 3F97A 1R10A 3CH6A 1Z06A 4RABA 4WXHA 3BN3A 4UXIA 3V8MA 2GWHA 1M1YB 4LJ5A 1YB5A 2P4HX 4QYWA 2WIDA 1QHHB 5K3DA 4ZODA 3Q3JB 4HNAA 3OPYI 1P3DA 1NU6A 4P4SB 1Z7YA 1Y0BA 1U1DA 1Q11A 2FN4A 4CV3A 1LGYA 4KX5A 1WX1A 1G4UR 2AXNA 1RBYA 3EWSA 2I3BA 4JOCA 3RS7A 5AW1A 4CLOB 2YN0A 3L4SO 3BRCA 1JQ5A 2POQX 3R0XA 4HTFA 4JU8A 3G68A 2C57A 3BGSA 4D0NA 2QTZA 1PNTA 2XOKA 2Q4BA 3SLGA 5KNCA 3ZZ1A 3TB4A 3TXXA 1QAOA 1GRCA 2Y1FA 1U1GA 3T1QA 3A3PA 4NAHA 5JTTA 2FW0A 1ZJZA 4C01A 1G0OA 4U2DA 2HF7A 4B47A 3HBMA 2XA2A 4PGMA 4EJSB 2FN9A 1ML4A 4NBUA 3W6OA 2D1YA 1XKTA 3F96A 2PKWA 3K5PA 2IYYA 1RLIA 1IPFA 2R1VB 2Z2XA 3H5TA 4KC0A 5ITVA 3F6EX 2IPXA 2YXBA 4Q6BA 1G5QA 1VE9A 2PRSA 1HX7A 1P5JA 2AZXA 4MUXA 4US0R 3RS9A 2QMUA 1U7TA 3IPRA 1LU9A 1G21E 3LL4A 5DHRA 5LC1A 4YLYA 4Q9IA 1MKYA 1ZU5A 3OJ0A 3PD1A 4X84A 2HCBA 3A1CA 3F4KA 2DKOA 5E7QA 3ZVNA 3HCWA 1LSUA 1D4AA 4BVAA 3R77A 3GYBA 4WDRA 3T3DA 4YJ3B 2H8GA 3CF6R 3NUZA 3QVOA 1L7VC 2Q2VA 4N3GA 4B80A 4I55B 4EQ6B 1M1YA 5JAZA 3GLGB 1QRTA 1AK2A 3IFSA 2F1KA 5DTIA 1IJFA 1CETA 1QHHA 2W90A 4I81A 3OY7A 4P4SA 3CLUD 4K86A 5KX5F 1DAEA 3MMSA 5ALJA 3MA0A 2ZRCA 4L6CA 1GZUA 1QHXA 3OECA 4CLOA 5AP9A 5JZBA 2B98A 3BL5A 3RWMB 3PP8A 4KK3A 4EG4A 1JAIA 1QQ5A 4IQGA 3S7TA 5IKPA 1DBSA 2C3OA 2HMTA 1RJGA 2PZJA 3MJVA 4EG6A 1BMTA 2BWJA 4IDHA 2ZT7A 4QKQA 3UY4A 3EBOA 2EP7A 3KEQA 2IDMA 2QAIA 2JI8A 2PGJA 3FWPA 4DC1A 3DW3X 7MHTA 4CDMA 3BULA 3B3GA 4KUGA 4QBIA 1RU3A 4F11A 3DMPA 4EJSA 2QN1A 4YUYA 4FINA 1H4SA 1KZGB 1U99A 1ISPA 2NTYC 3CJTA 4QL3A 3M4XA 2EKDA 4NCNA 2FEPA 3DMTA 4Q7KA 4R6XA 2JARA 3R0ZA 3AR7A 4W8GA 5HJ2A 5IT5A 2R1VA 2E18A 5BSFA 2EJVA 1E5XA 3KX2A 2P40A 3LQ2A 2W83A 4GWGA 2VJDA 2IU6A 1Z73A 4KLZA 5TT0A 5D8DA 1U3TA 4N1AA 1B4DA 5AK0A 4A27A 3CRMA 2HBQA 2JI4A 5CBPB 3RVPA 4B33A 4DSAA 2GBCA 3QUQA 1V8PA 1T4GA 3H9QA 5CDFE 1XTKA 2O2XA 5LNK1 3ZDBA 2PO5A 4ZRMA 4YJ3A 4TLLB 4E46A 3OQPA 2GKOA 4EQ6A 4FMCB 4OQ4A 2ZIXB 4I55A 4NWIA 5H68A 3RRZA 4FGZA 2OHVA 5DIFA 4N5DA 2OWEA 5J5CA 1Z5VA 2OQRA 4BQRA 4RTMA 1GO2A 2IA5A 1G6KA 3GUVA 2JIZD 4V0NA 3C98A 4YRNA 1BFKA 1O8CA 2A4MA 5ITZB 3ADKA 2IOFK 4OBWA 2XV1A 3RRJA 2OZVA 1KR5A 2H00A 2IXEA 3ZD7A 3SSAA 3IDFA 2XF8A 3GROA 4CHGA 3AXSA 4DNQA 2B83A 4F72A 1L1RA 4U00A 1RMTA 2ZI5A 4LRSB 4TQGA 4XARA 2YBEA 2QPAA 2C9OA 1EHCA 2QV0A 3GCXA 3NFYA 1XJQA 4IF4A 4TZKA 4YAGA 4A7PA 1XDBA 5CNIA 2Y27A 2I54A 3P4UA 1KZ4A 5FQNA 4LJRA 4OXQA 2B1IA 2P9ZA 4X97A 1Z16A 1L4HA 4AX4A 1M0WA 1O6ZA 1SKBA 2XY4A 1QMGA 3V4SA 2BF4A 3WLEA 4L5BA 4FP9A 4EP1A 5KVVA 2C99A 3DPSA 2DXIA 1A5TA 4IUBS 1Y1LA 4KQJA 4RPIA 4Q9KA 1W93A 5G53C 4O5AA 4YBZA 5DX8A 3FTEA 4W7SA 5CBPA 1WA5A 2FAXA 1OZ0A 2TYSB 1BMDA 5EJ4A 3PXEA 2I80A 4MVJG 3K92A 4YS6A 3KALA 2Q6OA 2ZBEA 3V8EA 2ZIXA 3DAHA 3LVBA 3I34X 4WE3A 3NTOA 4WNAB 1PQPA 2BGLA 1ODIA 3QHAA 4HVLA 2D0DA 1KSHA 2Z98A 3CN7A 3IPCA 5B57C 1G5HA 4H59A 2NO1A 3I01M 5KVCA 1R5JA 1RCTE 2VCHA 2QLBA 2I91A 1YKFA 1JJBA 3ANTA 1U9IC 3KAPA 1H2YA 1RCUA 1NV9A 5FUYA 3S29A 2NSYA 2OR3A 5ITZA 2NMVA 3TI7A 3TLZA 3ZN2A 3N39C 5IUJC 3Q9SA 3SFTA 4Q1DA 3AY0A 1DXHA 3QLEA 4PTZA 3VKUA 3VUFA 4ZHSA 3HS3A 3SJAA 1EK6A 4TXHA 4PINA 1WCIA 2QYOA 3QQPA 4XTRA 1A8QA 5THQA 5BMOA 1UQUA 1JHUA 1V6CA 3ODGA 5DCWA 2BFDB 1Q91A 3HHPA 3QSGA 4QVKA 5IEBA 3UANA 1P39A 1GTSA 5IKXA 2C2MA 3LZCA 3MLEA 1ENOA 4B81A 1B3BA 1LFAA 3G2LA 5AHWA 2C7GA 1A2OA 1J2EA 4OXYA 2GAFA 4CKYA 2XDQB 1NUHA 1SXGA 3ME5A 4G86A 1YRQA 3D6JA 2GNOA 4K3UA 3D8HA 1DG1G 2HH9A 3U3ZA 2C58A 1E6CA 1LQ2A 4PLTA 1JH9A 2ST1A 4NATA 4AMZA 4FWTA 1YU6A 1NVMB 1SVKA 3ZWVA 3IP6A 3PI6A 3VR3A 3IKJA 3JYPA 1E9FA 2PSJA 1KH2A 5K6AA 3PLRA 4B6EA 5DT9A 4UUAA 4XSHA 3ZWKA 1VBMA 2QY9A 1GUFA 1KI2A 3DTVD 3ED5A 4NMWA 1WETA 4ZOAA 2O59A 1CQWA 5EKDA 5I9IA 1JHOA 2VUIB 3CZ9A 1VLMA 4IOKA 2QTNA 1GZ7A 5ALQA 1N1DA 1CRWG 2GF0A 1DC4A 3IJEB 1RXEA 1AF7A 2F6RA 4IH4A 3A6KA 4FGSA 2PU5A 3FPBA 1XL1A 3SN6A 3FDXA 4NBRA 3PFHA 3AFGA 2XNDA 4XYBA 1CP2A 1E6MA 5F33A 3J81k 2FW6A 5P8WA 2JK1A 2GWRA 2WJYA 3THRA 1HZJA 1L4KA 3NGMA 3TPFA 4C29A 3HHEA 1D1PA 1X7GA 1Z5OA 3KZKA 3ZQKA 3O47A 3RUAA 1NVWQ 2C97A 3M1AA 3BRWD 1ZJ4A 3DQZA 4NAVA 5EJ8A 1WXWA 5AKLA 2YC2C 1GTRA 2J5XA 4AP9A 1GEEA 4CKWB 3EVDA 1EGHA 2JFFA 3A4TA 3OHMA 5FFMA 4RANA 4BO9A 1VKHA 5FTMA 3M7IA 2XDQA 4JMPA 4GBED 2G76A 1YHZA 2VDUE 3DZJA 3Q2KA 1VJ5A 4H17A 5TMDA 3K30A 5I9NA 3KD2A 3HA3A 3SZOA 2VP6A 3K70D 3D4OA 4G1FA 5K0SA 4HAWA 1NVVQ 2OXTA 5BV2P 3CPJB 3D6NB 3BZUA 3DNMA 1IMOA 2QRMA 1ZOOA 3T7SA 3KQLA 4LGVA 2H1HA 2CF6A 3K1AB 3VSDA 5JAPA 4O4HA 1V48A 2ZULA 4JP3A 2IWHA 2HT1A 2P79A 4LW8A 1HLFA 4EUHA 1IY1A 5D85A 3ZDRA 4G36A 1RJ9B 2J59A 3CRRA 3ZJ4A 1IN1A 1KYWA 1ZOIA 3IP3A 3WSTA 6REQB 1HPLA 4RKQA 4KP7A 5HMLA 4LE2A 4PAWA 3SQMA 2FRDA 2PZ8A 3QVVA 2ZTSA 4I9NA 4I08A 4BJ6A 3MBKA 4X66B 2HU2A 1UJCA 5EMKA 2X0EA 1Z0SA 3I9V6 2PRZA 1LBIA 2GLXA 2DFVA 3O74A 4I4NA 4K6KA 1DC6A 4WOBA 2YY6A 3M33A 4KXWA 4CCWA 3UJPA 5ITSA 2Z1NA 4YJHB 2QZZA 1ISMA 1RXUA 4WNYA 5AW4A 4TYYA 4J8PA 4UHCA 3SYTA 1GFZA 1W19A 1I6KA 2XXBA 3KQNA 3LNCA 4PSVA 4CKWA 2ERXA 2OUKA 3FKQA 1PJBA 1E62A 4GMHA 1SD5A 4BFWA 1XRRA 2EHDA 4C0WA 4MXDA 1VFPA 3C85A 1Z4QA 1L5MA 2JAQA 3EYAA 4RM2A 1RKBA 3V1NA 4R83A 2BI7A 5CVJA 3DHYA 1V37A 1JA9A 1P1BA 1WKCA 4BLQA 4PRKA 4FSDA 5KYNA 1IG3A 1F5SA 2H31A 3DA8A 3EH2A 1PSWA 4MUYA 3NGLA 2GXUA 3QPVA 3USZA 2A67A 5IF3A 1K92A 2A1TR 3BEDA 2IQ5A 5KQRA 1LCIA 4N7RA 1RHQA 1QVZA 3K1AA 3JQ7B 1ZCBA 3CZ4A 2CYCA 4CF4A 1R4NB 5GVSA 1E1QD 3HL0A 4KITB 5LZ8A 4DIUA 1SG6A 1LI5A 5FCDA 1ND5A 3W79A 1BWRA 1R7RA 2RONA 1RJ9A 2YJGA 5T4EA 4BVFA 5KAPA 2EATA 6REQA 3GDWA 1Z08A 4HWOA 1NOKA 1RP1A 2DRIA 1N6HA 4J0HA 5HKAA 3AW9A 3K8ZA 2EJWA 3L93A 3REQB 3NDRA 3AUXA 1FX0B 2B5WA 3RBXA 3L05A 4P7FA 2JNWA 4QO8A 5IAGA 4K9MA 3U9SA 5GZ3A 3VNQA 3LZ6A 4TVKA 4YJHA 2ZYWX 4B44A 3CH4B 1ZK3A 2XVXA 4EF5A 3HZHA 2YV5A 4WNCA 5K0FA 5GJBA 2MDTA 2C82A 3L7IA 1Q84A 2AWOA 5EIEA 1TMGE 4CMEA 1XXLA 1G21B 1KP3A 4E08A 3D3EA 4QQ8A 2IOFA 3RJ9A 1KL7A 2ZR9A 4RACA 2F48A 1MV8A 3PF8A 1DU4A 1HFWA 3Q85A 4I9GA 4R2XA 3ZIAD 2VBIA 4BZPA 1DAKA 2HYDA 3QELA 1Z4OA 3PFWO 3FTFA 3ULKA 1F17A 1VG0B 5B4VA 3LE8A 3A3KA 2B1JA 4QASA 4UU0A 5FUXA 4F5DA 4TN1A 1WUKS 3D6MA 5JC1A 4ZEMA 3ZQ6A 1YFKA 4MWDA 5F7JA 1SK9A 1V8FA 2BGRA 3CU5A 2JZCA 3F47A 4PONA 4LXIA 4S3MA 3HY3A 3JQ7A 1RWKA 1T9ZA 1R4NA 1KRWA 4BV3A 3EEBA 3WK4A 3LTNC 2WAOA 4Y98A 3GUUA 4JUAA 3ZK8A 2B4AA 4UOZA 4JNCA 1G7TA 1FXUA 1W88B 3LDGA 1VSBA 1NBMA 2ZQYA 1N8KA 1RWQA 1G64A 2KPOA 4HAIA 4J7UA 3T5BA 3REQA 4DAEA 1Y8ZA 1CW2B 1FX0A 4ER7A 2IYSA 1II8B 4JMLA 3NOXA 1DB3A 2ZUWA 3TTXA 3PEVA 4GEKA 3B9QA 1J2JA 1HDCA 1HFKA 1PJ2A 2C5HA 2MIIA 3K5IA 3BIWA 4K8RB 1XMSA 2R4TA 5JR3A 1TTQB 5ECWA 4XR4A 3C3KA 1XEXB 3KKMA 1K8XB 4OLHA 3H3FA 1PJ4A 3Q3HA 3VHXB 4DEYA 4WN3A 2CHFA 1ZSYA 4WWHA 3O1HB 4B4UA 3CEHA 4FHFA 1G21A 3KFXA 1O3YA 3KFLA 1FB5A 1TQ2A 1NYTA 1Q44A 1S2IA 3Q6MA 4EUKA 3AOEC 1YO6A 4O4IF 3DYIA 3STTA 4JB2A 4EIWA 1RLJA 5FBRB 2WSLA 2QYSA 2JRLA 1L4FA 4GOLD 3AWIA 3PFGA 3LP8A 4UXHA 5JAIA 2DR0A 2II6A 4EPRA 4KYVA 3GK3A 4YMHA 4RZIA 5FPQA 1A97A 2AG8A 3F9RA 4IGKA 3DZKA 4CF3A 3IP5A 4HN4B 1LQUA 4WPGA 2QXUA 3HWSA 4IHJF 1ZICA 5G1PA 3JQQA 3ZXXA 3I6YA 4BNDB 1HE8B 3KT8A 2DUMA 5J2UF 4P3KA 2B34A 1Y6FA 5I7FA 1WZUA 4I8XA 1BHO1 4Q1VA 1J1ZA 2B78A 2PN1A 3NTVA 3TX2A 3C24A 1OCEA 2FZWA 1JMKC 4LGYA 4JJ4A 1TVMA 3H11B 2CLMB 1DIRA 1II8A 2G77B 3L7LA 5AH0A 3SIWA 1F7VA 2VYQA 2Q1XA 3UFBA 3NKFA 2A0FA 3ZV6A 4ZEOA 1AA6A 4J43A 1XEXA 5M3BA 3VPSA 3W5DA 4LFBB 1KSFX 3VHXA 4YVFA 1OPRA 1U1FA 1OZAA 1SUBA 2XCRB 3MPOA 4WNIA 1VI6A 3A9UA 1Y6ZA 1OKKA 4MIOA 4DQ0A 2Z8YM 3HCRA 3BB1A 4MWZA 2Z56A 2FN3A 1RI2A 5AKZA 3B3FA 5E4FA 1VLJA 1AKNA 2HJ9A 2XIQA 5CDFA 5HRAA 4OMDA 4ZTBA 1H23A 4PO9A 4CIWA 1WBBA 4QJBA 4HATA 1QO7A 3DLBA 4OOEA 3TIVA 2Y6UA 2K6GA 1M1NB 2D59A 4TS1A 3ZE1B 1SQ6A 3P9PA 3DHEA 3NHKA 1ZD9A 2CLDX 2WZBA 1Y9DA 3PNPA 4U2FA 2QW0X 2G63A 1CS4C 4ZWNA 3SQNA 1E69A 1K66A 5DSTA 3NHLA 2JFOA 4RPCA 5DBIA 5H8WA 1GR0A 5YASA 4GIBA 4OEHA 2WTEA 1SCBA 4J0KA 4Y6LA 3CLTC 5CPFA 1N6NA 2VRNA 2RGAA 4G5OA 4HDOB 1XZEA 4TKMA 5ALLA 1GL3A 2QZSA 1KYZA 1YB7A 3OSUA 4LZAA 2QTGA 1B8NA 4MP3A 4QOSA 4QX6A 4X6UA 5EHNA 4OD0A 4DIEA 1XNRB 3V2UA 5TQ0B 2ZVJA 1ZESA 1OLOA 5ETJA 1TRKA 4FPXA 3U56A 2Y76A 1GKLA 4FSXA 2CT8A 3N53A 3H11A 3AVQA 3EUEA 2FDRA 2JGFA 2KYRA 2RIPA 5JNLA 1CR2A 1TEHA 1UC9A 1Y6RA 5CFOA 1IK4A 1D5WA 1Z39A 2AF4C 4XM0A 1IHUA 1Z83A 1F6DA 4J3JA 4U6NA 2PFKA 3PE3A 2ZSEA 1EFHA 4L72A 1VYUA 3DDWA 4RZUA 5IYZB 3JQGB 4LV8B 5HQJA 3T6KA 1XMQB 1BDHA 1AZWA 2HJHA 3DE4X 5FQOA 3M8KA 4DUYB 3H4IA 2XOKD 1KDZA 2O4UX 4LZWA 3ETNA 4UVHA 3UC5A 4CM6A 2ARKA 2X1MA 1VMKA 4FU0A 5BXYA 3VR6A 1XZNA 1TX4B 1Y7TA 2Q1UA 2QROA 1S3IA 1Y81A 2PZFA 3AY3A 3HMKA 2M98A 4OFWA 2B8NA 1QMPA 2UZ1B 3NV9A 1G8SA 3WDMA 2ECFA 1OYYA 2P5TB 1ZHFA 4MW6A 1M1NA 2QD5A 4AZWA 2WU0A 2PD6A 4HL6A 1X9IA 2B1GA 3EZ2A 3FFXA 5CGZA 4FKZA 1JVSA 5CCBA 4XWWA 2XBMA 2RARA 1PJRA 2WHEA 2FQ1A 3G5UA 4MQBA 3HJBA 1FNMA 2X0IA 4XM2A 4BO7A 4F4IA 3L9WA 3K9WA 2ZXFA 4QOGA 2JGLA 4NZMA 3K9FC 2C2ZA 3ESDA 1K8QA 3T7AA 3NO4A 2FUG6 4BGDA 5LMZA 2FPLA 4WLFA 2QRHA 2BKXA 3C3PA 4PU0A 4JQCA 4TV8F 5A4AA 4DLPA 4BX9A 5FTKA 3G0GA 1W5AA 3GI1A 4DLNA 4Q6WA 3U2QA 3F2IA 2M1ZA 3OAAA 4DG5A 5JYEA 3L4KA 1C3LA 4IZHA 5CJJA 3PFFA 1PZEA 1ENZA 1DX6A 4OQEA 4Z9BA 1FYFA 2VDJA 3EASA 3LT4A 3TZKA 1P2TA 4AN4A 1C1YA 1E20A 2QUZA 5IYZA 1Q16A 2HUPA 4HTAA 1IM2A 1AGYA 3F3MA 2XZTA 1DC3A 3JQGA 4N8DA 1XRJA 2BLNA 2PZMA 2DU8A 1DRKA 4GW3A 1GLNA 4I5GA 2EW2A 4RLHA 3U80A 5JVDF 1D6NA 3PEEA 1UZLA 2JASA 3F1LA 5CHYA 4Z9FA 1OZHA 3O9VA 4QGBA 3DFFA 1ULHA 2UZ1A 5L45A 4DYDA 4BMYA 4G1EB 2VOEA 2R7LA 1TMKA 2E9SA 4RGQA 2CFIA 1IZ9A 4MLZA 4S0ZA 4NCHA 4TS3A 4M0UA 3JRWA 1GTJ1 1YAJA 1F4VA 4D3XA 1V7ZA 2ZE5A 4BMCA 5EJ9A 2QJWA 1NJ1A 3EIEA 2EL7A 1T1IA 2C4HA 4U6QA 3ZYZA 1QQTA 4OHKA 3RKRA 5CA1F 1R8JA 1K3FA 1W0CA 3EFBA 2WMYA 2ZETA 3R3WA 3TB6A 1LKZA 1WWKA 1YVDA 3IEVA 1CR0A 1UPCA 3T3NA 3F2VA 4XSGA 2L2QA 2IYAA 3U81A 4AXXA 2EP5A 1Y3HA 5C7IO 4C3UA 4BO6A 2ZB3A 4IEEA 3UV3A 1P19A 2FQXA 3F46A 4P4NA 4P6VF 4BZXA 4EL5A 1K8ZB 1W73A 4QUIA 2ZIVB 4DJTA 4L5AA 2IT1A 3UWPA 4N3BA 2JVKA 3ZBTA 4E12A 3FHTA 3T38A 1I4OA 2VHXA 2OCDA 4FFDA 4G2TA 4BO3A 3W5BA 2P4SA 2IUYA 4LEIA 3NJRA 1O54A 1CUYA 2HQ1A 2BDUA 1CUSA 5CB4F 4QQFA 2AEFA 1E99A 1ZN7A 1DO8A 2R25B 4L22A 4AF7A 4YUXA 3G5TA 9GPBA 4MUJA 2O9JA 3ZHTA 3BJMA 2D1QA 5T6BA 5KO2A 4B6RA 3I6ZA 1E2EA 1ISIA 1P1JA 2YZGA 5HM6A 2NUTB 4F56A 1KH1A 3RB8A 421PA 2GEDA 5IAAA 1BVUA 3MBIA 1F2UB 1FYXA 2BDEA 2AEMA 2FV8A 2V98A 1ISHA 1MO4A 2VKQA 4GPAA 5JLAA 5KX5A 2XWJI 2AHOA 3INRA 3G7NA 4MUAA 5I4BA 4ARIA 1K27A 3D6HA 4O2LA 2VBFA 2Z95A 3JALB 3B1XA 3Q1KA 4PXAA 4ALJA 5C7OO 4Q3BA 3RT7A 1EFTA 2V96A 2BM9A 4C07A 4BMZA 3P97A 4HPJB 3R7LA 1HL3A 3FPSA 4YASA 1EP1B 3CW8X 4CG3A 3C6ZA 1QOQB 2O2YA 3IPYA 1N5IA 5BP7A 4AM8A 1Z0ZA 1ZA1A 2HSDA 3S68A 3LBHA 3BERA 1SBHA 4BNWA 2CDRA 5FKJA 1EJ0A 2PSFA 3DYVA 4QTTB 1KS9A 3A9SA 2PV0A 1E2UA 1EWYA 2IOHA 2KI5A 3O5AA 3DEZA 4TTIA 4UUNA 1KS2A 2EX0A 5EKTA 4F45A 3DL4A 3FCAA 2WJZB 4MPPA 5HFNA 3LYLA 3Q7RA 4RHCA 10MHA 5D3KA 1H1TA 1S3SA 1QTIA 3SXUB 2O8FB 5B4TA 1NWCA 3OKPA 4GPBA 5AVTA 1HT0A 4U6SA 1UBUS 2R00A 1AQ6A 4PX9A 4TZTA 4OK6A 2B1QA 2NZ2A 4TYQA 3Q10A 5FUVA 1RZRD 3K0EA 3RKUA 5DN9A 4MQUA 2D8AA 3FI9A 3LHSA 3NV7A 4EHNA 2YFKA 3NUGA 5EXXA 3LBNA 4CL3A 1H4QA 2IVZA 3MWKA 1DRUA 4KVZA 4UMFA 3NIGB 1SEVA 3B89A 3FX2A 2NUTA 2XE4A 1PKXA 5EVCA 3NBUA 3WRWA 4AICA 3ADDA 1F2UA 3W7VA 3VH3A 4DMKA 1J2TA 5C51B 2BH9A 4HADA 1IHPA 1EIZA 2UV8A 1P18A 3JALA 4I2VA 4TKVB 5KTKA 1N8TA 2XADA 4IX9A 1T2UA 2E87A 2OFWA 1Z4NA 3AJEA 3GLTA 4N5HX 2P9YA 1J39A 1JBKA 4A8JC 4AN0A 2DGDA 2UZAA 1EH5A 2HRDA 2QLJA 3GFGA 4Q18A 3L8FA 4OP1A 1C7RA 1EBFA 4R1OA 2QAGC 1KJIA 1R8QA 4EKYA 3NX4A 4U7FA 2XKKA 4F1KA 4C4OA 3E9DA 4IFIA 3EZ7A 1FYVA 3FVQA 4M0KA 2R8BA 4EI9A 4ZN6A 2XQKA 4MR8B 1OH5A 1YVRA 3B1JA 3ZV4A 3E3AA 4GYWA 2BSXA 2GZ1A 1F9AA 3QXJA 4FC6A 1MQAA 3B1VA 4DNPA 1ULZA 2BMAA 2BBWA 3U3MA 2O8FA 1J8FA 4BMVA 2BDTA 3HJFA 1N0HA 4GUDA 3ED1A 1AMOA 2B8EA 1X77A 4ZDJA 3TG2A 4DPLA 1TLFA 2YNMC 5BQXA 5I47A 1OR8A 4ZYWA 1QG6A 4FMBB 5DWQA 3U6BA 4AJPA 1Z29A 2JC3A 1R5BA 4MJ3A 2HV9A 5BQPA 2DQYA 1GGMA 4JUDX 3ZDXB 2XNDD 1BE6A 1QNFA 4RIEA 2AD1A 2AOWA 3HN2A 4QYTA 4R84A 2R79A 2ZFUA 2R5NA 4YUAA 5I7VA 1SXPA 1PJTA 2XAAA 2JIPA 1RM5A 4R2KA 4AECA 5SY4A 4D1YA 1MO6A 2LUOA 2X2FA 2KLHA 2ZYUX 4J2TA 1JLLB 4RV4A 1GQSA 2VK8A 2YASA 3GD7A 4TGLA 4W5HA 4GP7A 3AGQA 3FYHA 4UBOA 1FZQA 3H2SA 1IVYA 4OU5A 4YO7A 1EJ6A 3SLRA 4TKVA 5B3KA 2PFSA 2YUTA 3DZGA 1T3HA 4M88A 4OLFA 3G2OA 1JALA 2JLYA 5AXBA 3VHRA 1Z5UA 5FI5A 4ZJUA 2IV2X 1Z6GA 1JPJA 1Z4LA 4QATA 1J7KA 2CBXA 4V3BA 1BKYA 1YE5A 4RMGA 2BFWA 5L3RA 2RHBA 1GHTA 4CFSA 1GG5A 4DIFA 2QQFA 1QQAA 4DMCA 1PGOA 3LFHA 3ISTA 4DWWA 2G1UA 1E7YA 2Y1WA 2ZWOA 5EE1A 2IYXA 2EL9A 3RNOA 4MR8A 3KSUA 3GN2A 3MUNA 5A7FA