4AO6A

Native structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
243
structure length
222
Chain Sequence
MSWNGKDERKLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGHEYIEQVAKLLVGRGISAMAIDGPGTDVVGLDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGLPVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVSLQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Studies of a Novel Cold-Adapted Esterase from an Arctic Intertidal Metagenomic Library.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 83
structure length 222
sequence length 243
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ao6A00
1VLQA 2RHTA 5KBYA 1M33A 3MUNA 2PKYX 2GBIA 2WFLB 1XZGA 3QMVA 1YA4A 4CCYA 4UBIA 1DWOA 2OQIA 5HK8A 4LXIA 3STXA 1QONA 2WG2A 1XZIA 3PICA 4HZGA 1D07A 2ZYRA 3SC2A 3M81A 5ISMA 3R3WA 1WHTA 4RGYA 4ZREA 4BATA 2J4FA 3H19A 4V2IA 5JZBA 1DINA 2JGLA 1GPNA 1XQWA 5AKZA 1B6GA 3C8DA 1AZWA 4HS9A 4FDMA 1CFJA 5AOAA 5E4TA 4DYHA 2WIKA 2V96A 2PM8A 4BP8A 3W06A 3G9XA 1DQYA 4YK7A 2I3DA 3R3UA 1GQRA 2Z8ZA 2Q0XA 3WYNA 3X3HA 3SWWA 1UWCA 4ZI5A 3IULA 4Q34A 2VT6A 4O08A 5JARA 2XMCA 1YA8A 2OGTA 1JU3A 2FJPA 4HVTA 1ZD5A 4X90A 1ZI8A 3AZPA 1A8UA 1FJ2A 4X91A 1XQXA 4BRZA 3MGAA 5EHQA 4MEAA 4EBBA 3BDIA 3G0CA 3GBSA 4E14A 1QGED 4UBJA 1ODSA 2XUHA 2HADA 4U2GA 1QTRA 5C8ZA 1UKAA 1CUIA 2XLCA 3IVMA 4E11A 1LZLA 3PFCA 2O2HA 2IITA 4PW0A 2QTBA 2WKWA 4ZGBA 4DNFA 2WFLA 1HKHA 2ES4A 4HRXA 5EFZA 1A8SA 2WHPB 4J0DA 2OLEA 1A8QA 4J03A 1XRLA 1JFRA 2QS9A 4BCCA 5YASA 1IUOA 4PO3X 3STWA 4U2FA 3K2IA 4G8BA 3WL7A 1DTEA 2Y2UA 5A6VA 4G5XA 1ZIXA 1MT3A 4OB6A 4GW3A 4H0CA 2WUFA 1EK1A 3G9TA 1Y7IA 2HU5A 4W1SA 3WKEA 5DWDA 1LPOA 1RWQA 2WM2A 1CUEA 1BU8A 5CT8A 4IHAA 4WDQA 1HQDA 3KXPA 2C0QA 2WU3A 3I6ZA 2ZYSA 3HI4A 4E46A 3A2MA 1R1DA 1X2BA 3QVMA 2D0DA 4W1PA 2VAVA 2WJ3A 2Z3WA 1SFRA 2VATA 4Y9SA 4B82A 4KE8A 4FFWA 4H7HA 2HRRA 3DL4A 4AN0A 3STUA 5CT4A 1PFQA 4UBOA 3AIOA 3B3QA 3G9UA 3H18A 1WB6A 4FOLA 3QYJA 5AI9A 4IQ4A 3AUKA 5ESRA 4BP9A 5J3JA 5BWCA 5FPPA 1L7AA 1TCCA 1H23A 4X71A 1QIMA 2DHEA 3I2KA 4UHEA 4Q05A 5AM4A 2YASA 2PSEA 4QWMA 4L72A 2HM7A 4TPKA 2RONA 4DIUA 4MQLA 1K5PA 5T4BA 1P0PA 1E3QA 3TEJA 2D5LA 4G1FA 2B9VA 1IUPA 4MQMA 3FSGD 4DNOA 3WI7A 2CMFA 1QIFA 1NX9A 1CPYA 3WL8A 5JASA 2CEKA 1UKBA 4CG2A 1GQSA 1XZLA 1R3DA 2OCLA 2PSDA 3KSRA 1JI3A 5D7BA 3ZLTA 3CXUA 3LS2A 2O2IA 4YASA 4RNCA 5ALUA 3WK5A 5EHXA 1XRMA 4BC1A 2QT9A 1MJ5A 3I1YA 2K2QB 3BDVA 2YYSA 3O9VA 4H7JA 4U2BA 3STTA 2BGRA 1F0PA 1N1MA 5AKXA 1BS9A 3BF8A 1JMYA 4J0HA 1QIJA 5K5EA 3HABA 2G4LA 2ZYHA 5HKBA 1YB6A 2QRUA 5AK5A 3CCBA 3WZMA 3H0CA 1MO2A 3O4IA 2ZVDA 3I2GA 2DCMA 1NU6A 5AK3A 4EY7A 5A7GA 3UUEA 3SX4A 5IVHA 5HF6A 1H2YA 4OD0A 1CUWA 1LZKA 3E1GA 5ALGA 2BJHA 2UZ0A 3FCXA 4ZRDA 3PDCA 1VZ3A 5T4FA 1IUNA 4GBGA 3WWPA 4FHZA 1EHYA 4OCZA 3QZUA 1R9NA 3D0KA 4Y2QA 3ANTA 5DNVA 4BVLA 3QMMA 3KWJA 1UT6A 3KDAA 4FWBA 1DT5A 4X94A 2HHAA 5K3DA 5LIPA 5HF8A 4X3CA 1UK9A 4GDMA 4DNQA 2EEPA 3KD2A 5SYMA 3F97A 3WWOA 4KYVA 1MX1A 1C7IA 3M82A 3BIXA 4W9RA 2YXPX 1CRLA 1FFBA 2LIPA 1CLEA 5C7YA 5E2IA 1FFEA 1QO7A 5FPQA 1DX6A 4UHBA 1JJFA 1B41A 1XZFA 4Z49A 3C6ZA 2XUJA 5DYYA 4FLFA 4PSDA 1DT3A 3OTQA 3GUUA 3AINA 4ZV7A 4OYYA 2J4CA 1VE7A 4X00A 1W52X 1W76A 1HPLA 2WIJA 2XE4A 4OB8A 3DCNA 2ZJ6A 5FKJA 3DS8A 4QDXA 1RYYA 1ZJ4A 3GA7A 4DNPA 1O6GA 2J3DA 3R0VA 2V9ZA 2XMSA 2WHRA 5AI6A 1XZEA 5JAPA 5IKXA 3I2IA 3R3VA 3BE8A 5ALEA 4D9JA 5AM5A 1CUZA 3I2HA 2GYVA 4F0JA 4WFKA 1JKMA 3HRHA 1IZ7A 1SC9A 3PF8A 1ZJ5A 1KEZA 1F6WA 1K4YA 4G4JA 3CCCA 5JD5A 2B61A 4HXGA 4BCBA 3H2KA 5CT9A 4BZZA 1Y37A 2Z3ZA 5DYTA 1VOTA 5CH8A 5KWIA 3QPCA 4EHBA 1ZICA 1YSCA 2HA6A 4UPDA 5CH3A 3IIIA 5AHXA 2VT7A 3ICVA 4KE6A 3AJAA 3DLTA 4FFVA 4YPVA 4BVJA 2JGMA 4FBLA 1MNAA 5LLSA 2C0PA 1XRQA 2IIVA 1QIKA 5ALKA 4DSZA 3GFFA 1LPAB 3QMWA 3F96A 1DWPA 1X2EA 4Y7DA 5CBKA 1W75A 1WPXA 1CUFA 4OPMA 1J06A 3MVEA 2WTNA 5LYYA 2XQKA 5I8PA 2ZYIA 1TAHA 5ALTA 2AJDA 3RARA 3LIIA 3G0IA 4KAAA 3VXKA 4K6KA 5EIHA 1CQWA 2RAUA 2HA3A 5FP0A 1YCDA 1CUJA 1XLUA 4FKBA 5CH5A 4M0MA 3WWEA 2IX9A 3HEAA 1IZ8A 2OQVA 2QR5A 4UFOA 3WLAA 1CUUA 3ZI7A 1JMKC 2HU7A 2OCGA 3B5EA 2JGJA 1EB9A 3WKAA 3EF3A 5HF9A 1CUHA 1WHSA 1BN6A 4BDSA 1UOQA 1QFSA 4JEIA 4G4GA 5T4EA 1EINA 1FFCA 3UMJA 5HFNA 1THTA 3GELA 4C88A 3NWOA 5AOCA 4J0GA 1UKCA 5A2GA 3FYUA 2QVBA 3ICWA 5FV4A 3QBJA 1VZ2A 3ANSA 2EDCA 4Y2XA 5EIAA 2DHCA 3OOSA 1VXOA 1T2NA 2WUDA 3WMRA 4EY4A 4CIAA 1TK3A 3WQHA 2XQJA 4GEGA 5CURA 3BJRA 5ALJA 3GZJA 4C01A 2EDAA 3N0TA 3BJMA 4HXEB 2PVSA 2QM0A 1J07A 3EBLA 3ZV7A 1C7JA 1XKLA 3WK6A 2VEOA 5AM1A 2G5PA 4BVKA 4CG3A 3EQ8A 1Z68A 2BFNA 2HFKA 4HRYA 3WIOA 4L3WA 1EVQA 1OCEA 2O2GA 1CUCA 3HACA 4CFSA 1P0MA 1DU4A 4DLNA 4BYMA 3VJLA 1T4MA 2B4KA 3QM1A 2HA4A 3V1LA 1VXRA 1CVLA 3V9AA 2C5FA 1F8UA 4KRYA 1JJIA 3M3DA 1QIGA 4W63A 3WZLA 3VKFA 2AJ8A 3WA6A 1QZ3A 4DMFA 1OXMA 4ROTA 1XRRA 1LPBB 2PSFA 2QUBA 3DEAA 1TRHA 2HL6A 5AKKA 4BBZA 4EY5A 1F0NA 1MTZA 3G02A 3NGMA 5AIAA 2QUAA 4AX4A 3WL6A 1G5FA 2OGZA 5AIBA 2BUAA 1MX5A 3D2CA 2DQYA 3FYUB 1N5RA 1XZJA 4Y2PA 4PSCA 1ZIYA 5CXXA 5JYCA 1IVYA 2JBWA 4UBKA 4ZWNA 4NMWA 4QE3A 4MWTA 3WWCA 4KR0A 1QO9A 1XZHA 2AXEA 3I6YA 4KEAA 3G0GA 1BEZA 2WU4A 4PNZA 5D3ZA 2WG1A 4WCVA 4X6YA 4P08A 2FUKA 2W6CX 4JH0A 2XLBA 1CEXA 5IH7A 4K2AA 4G9EA 4WY8A 2ROQA 5CT6A 2VSQA 2WIDA 1EH5A 1IMJA 1RP1A 4C6HA 3DJYA 2XDWA 4BB0A 2WJ4A 4FBMA 5CW2A 5CT5A 2PPLA 2WLSA 1W4LA 1EB8A 3U1TA 1LPMA 2PU5A 4BDTA 2JGIA 2JEYA 2VF2A 3RM3A 3BF7A 1VA5A 2C7BA 1VKHA 2VJAA 3O4HA 2XUDA 4QDUA 5IVIA 2I3ZA 4FNMA 1XRNA 4BC0A 4M0EA 2HIHA 3IBTA 4K6GA 3DKKA 4F5ZA 2QMQA 2YH2A 2W22A 4Y2UA 3AILA 2Y2VA 1G4HA 3NUZA 7YASA 5ALXA 1S8OA 4Q1VA 2WUGA 3BL8A 2WHQA 4BAUA 3D4LA 1UOOA 2I03A 3W9BA 3HC7A 1H22A 4WDRA 4F60A 4WFIA 2WFMA 2Z8XA 2XQIA 4YX9A 4B83A 4TGLA 2PUHA 5H3HA 2PL5A 1PV1A 5E4YA 3ESDA 4EA6A 4ARAA 2BGNA 5LKRA 1JT2A 4LYEA 2JGKA 3V1KA 5AJHA 1AC5A 3F9CA 3FLBA 4B81A 1W1IA 3EIOA 4KJXA 2XMRA 1ZD3A 4OUKX 4WY5A 3VJMA 4G8CA 2HRQA 1QIDA 3LIPA 1QJ4A 1FFDA 3R41A 3G9ZA 2HA2A 4X95A 1EI9A 1KU6A 1LLFA 4B0PA 4GXNA 3PFBA 5HZGA 1ETHA 3WIBA 3K6KA 1JJBA 4PSUA 3A6ZA 3PUHA 4P92A 3IB3A 1ODCA 1DWQA 3RKSA 5AOBA 5ALIA 4Y2YA 3FLEA 2CUTA 5JIBA 5HK9A 2OG1A 1ZD2P 4HXFB 2BUBA 4AN1A 2J3QA 2JGFA 3V1MA 3QH4A 1XZKA 5ALOA 4U2EA 2JIDA 1R50A 2DSNA 4GWLA 2XMDA 1BE0A 5JANA 2XUGA 4QNNA 5EI5A 5DTJA 4KACA 3LP5A 5IVDA 2C5GA 1H2ZA 3I2JA 3YASA 2PUJA 2XQFA 3H17A 4AQDA 2QXTA 3PE6A 1BEEA 1U8EA 2BKLA 4EUSA 2VAXA 5AK6A 3PF9A 3O9MA 5JATA 4BAZA 1LGYA 3IUQA 4U2CA 4Y2RA 5JAHA 3OURA 3IUJA 1QIEA 5EIEA 2OCKA 1A88A 3C70A 1EVEA 3IA2A 2WSLA 4CCYB 4BZWA 4H7IA 1WPRA 2JGEA 1SCQA 2WJ6A 3D7RA 2E3JA 4UBLA 5CRIA 5A71A 3SK0A 3IUMA 4AB1A 4X6UA 5BV7A 4QA9A 4P9NA 3WKDA 1YS1X 4EY8A 1E89A 4M0FA 1ACLA 1XZMA 2CKMA 3DQZA 2P8SA 3TRDA 3ZLUA 4EZIA 1LPNA 4OU5A 3I6MA 3WYDA 4NVRA 5K3EA 5JALA 4AO7A 2ECFA 3G0BA 1U2EA 1CUYA 3LCRA 5ALZA 4JUIA 2WIFA 1QLWA 5K3CA 1VJ5A 4OYLA 1WM1A 4UUQA 3L1HA 4W1QA 3V48A 5K3AA 3DD5A 3GROA 3N2ZB 5D3KA 4PF1A 4AMZA 4INZA 3ESBA 2XI4A 2Y1KA 5SYNA 4B84A 4C4YA 4Y2TA 4UFPA 4N8SA 2H7YA 2XMZA 2HA7A 2QOEA 5FDFA 1ZOIA 3S8YA 1GXSA 1EDDA 1X70A 1YR2A 4U2DA 2H7CA 4RE6A 4L9AA 5ALMA 5BWBA 3F8SA 4Q3OA 5ALLA 1BRTA 1R88A 4J0CA 2O7RA 3BXPA 2XMGA 1LBTA 1CQZA 4E15A 2V97A 5AKLA 1EDBA 2FX5A 5F4ZA 2VJBA 4ARBA 3WKCA 2QZPA 3D59A 3C5WP 4XJVA 4PQEA 5LP1A 2ACKA 3B12A 4FMPA 1JU4A 2RGUA 4J7AA 4Q3KA 2B20A 5JZ9A 1CUVA 1E5TA 3G0DA 2OXEA 4X93A 3EQ9A 1E8MA 1AUOA 5BOVA 3BIWA 4UFNA 1XROA 5ALNA 3ESAA 5FOQA 1O6FA 2XUFA 5ALVA 2DHDA 5HCUA 3CN7A 1E66A 4BCDA 1EXWA 1UK6A 5DYWA 3OM8A 3FVTA 4H7FA 1GGVA 1CUSA 1USWA 4X92A 3S2ZA 5LZ9A 3FWHA 1BN7A 1TIBA 3VJKA 1XLWA 2XUQA 3D5EA 5DNWA 3A2LA 2H7XA 1H2WA 2OAEA 1NU8A 4H7EA 3C87A 4N5IX 4PV7A 1XRPA 3QPDA 3OG9A 4WFJA 2ORYA 3O4GA 4F21A 3AZOA 2BUCA 4B7ZA 4AO8A 4J0IA 3M83A 4LKOA 5FUMA 4XWGA 3HZOA 3AIMA 5JAUA 3IDAA 3O95A 4BTLA 3D2AA 1BROA 3R3XA 1ZD4A 4DTCA 1QFMA 2PSHA 5FXMA 1BCSA 2ZJ7A 4Y2SA 4P93A 3O0DA 5K3FB 1ACJA 1CUGA 1LNSA 5KREA 1L7RA 2ZSIA 1U65A 1TCAA 4FLEA 3WJ1A 1VE6A 4HAIA 1EA5A 3EQ7A 2WQZA 4LYDA 5CTAA 3E3AA 5AKHA 4J0KA 3DNMA 3H2IA 2AJBA 3FSGA 4JYPA 3R3YA 1H2XA 3IURA 5AM3A 3ESCA 4WJLA 4X97A 4W1RA 4G8DA 5AM0A 1A7UA 4MJ3A 3FYTA 3W04A 2JEZA 5EHZA 1DX4A 4OB7A 5AKYA 1UK7A 2VJDA 4MYDA 3VVLA 1FFAA 1QIIA 2DQZA 5EGNA 4RE5A 1LPPA 3FAKA 1WOMA 2WILA 4C89A 1TKRA 3AZQA 1EDEA 4BRSA 5I9IA 4S0XA 3I2FA 5ALDA 3HYSA 2PX6A 5FRDA 5T4HA 4FNGA 1QTIA 5DLPA 3OC0A 3H2JA 3RLIA 4J3JA 2Z5GA 1AMNA 2RIPA 2X5XA 5A7FA 5K3BA 4KE9A 5AM2A 3W05A 5ALPA 3HXKA 1ORVA 2Y6VA 2VTVA 2WHPA 4J0JA 3TJMA 3HSSA 3FNBA 4I19A 4N8DA 3C43A 1OILA 3FCYA 4LXHA 4UBNA 3STYA 1WCYA 4BTVA 3UUFA 1MX9A 1U4NA 2PU7A 3VDXA 2XUPA 4DMCA 4I3FA 3WWDA 1CV2A 5C8VA 4C87A 3O4JA 1XFDA 2BCEA 3L1JA 1VA4A 4XX1A 4AMYA 2VQ6A 1GPLA 5LZ4A 3WK7A 1GKLA 4KE7A 4KRXA 4X85A 3H1AA 3ILSA 2XMBA 2C4HA 1YASA 1ZGBA 2PSJA 3G8YA 1DQZA 3WK9A 4X7BA 5LZ2A 2HFJA 1Q0ZA 3ZWQA 3H2GA 1FSSA 5JD6A 1UZAA 1MAAA 3C6XA 4FTWA 4A16A 4H35A 2R8BA 4JYMA 2GYUA 2WFZA 5DJ5A 1HLGA 1P0QA 3F98A 1ISPA 1UOPA 4L0CA 5LZ5A 1EX9A 3R3ZA 5AH0A 3WK4A 2GBFA 4N5HX 1CUXA 3VISA 1CR6A 2HU8A 2WG0A 4A23A 4Y2VA 3P2MA 3D3NA 3C8HA 1XLVA 4FLMA 4MYSA 3DKRA 5AI4A 2VJCA 3PUIA 1Q0RA 1Q83A 3HJUA 3RK4A 1EK2A 3C45A 1TCBA 1W6RA 1ZGCA 3C6YA 5CMLA 3V1NA 5A62A 1K63A 4X6XA 2BAGA 1YB7A 3NOXA 4B6GA 1ORWA 5AK4A 1MN6A 5LKAA 2XUIA 3H1BA 1XZAA 4ITVA 5C81A 4QDZA 3MUOA 4NZZA 1XZDA 1XQYA 3W9UA 4B9AA 1CUBA 4IH9A 5HF5A 1K6EA 5HQ3A 4I4CA 5AKEA 1MU0A 1HBJA 3I28A 4H18A 5E4JA 2GYWA 3WK8A 1E8NA 2RI6A 4BAGA 4RPCA 5JAOA 3H2HA 1CIJA 2NW6A 4GLBA 2I78A 1K8QA 2HDWA 4DMHA 4G9GA 5ALWA 2GZSA 2GBCA 4UHFA 5ALHA 2OCIA 4QZVA 3DL7A 3Q8WA 4B9EA 2OGSA 1TQHA 1SOMA 4AO6A 1R9MA 4A5SA 4HTAA 4CIBA 3FYUC 5LZ7A 2PBLA 5JADA 4CG1A 3JWEA 1CUDA 3DDUA 1XZBA 3JW8A 4Y2JA 5AKIA 3F67A 1I6WA 5CXUA 3CN9A 2O7VA 1LPSA 4N8EA 5ALYA 4BE9A 2QJRA 4CI9A 1SCIA 2XQGA 4C4XA 4H77A 1QIHA 1AURA 5LZ8A 4QLAA 4DSAA 3W2TA 4B80A 2XUAA 4XIIA 1MPXA 3AFIA 5D6OA 4B85A 3DYVA 3T4UA 2XMQA 2WIGA 1BCRA 4LHEA 1G42A 2ZSHA 3LLCA 3Q0TA 4DMKA 2CB9A 3L1IA 5ALRA 4QLOA 3H04A 3DOHA 4Q3LA 3FLAA 2CJPA 1GT6A 1MAHA 4MWSA 2FJ0A 4BE4A 1N5MA 3DOIA 5I7UA 4QDTA 4CCWA 3STVA 1C4XA 3KWFA 1AKNA 2X76A 5FLKA 4GI1A 4EB0A 4JNCA 5AI5A 4IH4A 5A7HA 1XKTA 2GBGA 1CUAA 1AGYA 3C6BA 1AQLA 3E0XA 2CBGA 1ODTC 3BWXA 2XUOA 1SCKA 4DGQA 3K9BA 3WA7A 1GKKA 2ONCA 2C58A 2XUKA 5AI8A 2VA9A 2ZJFA 1XZCA 1MNQA 2R11A 5ALQA 1QE3A 1YAJA 4UBMA 3JYHA 1E8DA 5AICA 3HLKA 4UHDA 1HL7A 3PI6A 2G63A 4QEKA 3A2NA 4ETWA 5JD4A 4IO0A 1ZI6A 3U0VA 2DR0A 1WB4A 4AZ0A 4UHCA 4IH1A 2WUEA 3ED1A 3VVMA 2HA5A 1L7QA 1GPKA 2XT0A 3QPAA 5AKGA 2H9YA 3KOOA 5AO9A 4UHHA 3D2BA 5AP9A 3FVRA 2WTMA 1R4ZA 4K5QA 3OPMA 4QWWA 3WL5A 4ZXFA 3ZLVA 1J1IA 4MXDA 5AI0A 5C8XA 4K6HA 3IUNA 2OAGA 2H1IA 4EY6A 4OU4A 6YASA 5ALFA 1LBSA 2RHWA 3QITA 3AIKA 4H7DA 3G7NA 1UK8A 1UFOA 1KU0A 4B0OA 4DM7A 5JZSA 4NS4A 1THGA 3TGLA 1Q84A 4G4IA 4ZV9A 5K3FA 4KAFA 3ZPXA 1UXOA 5HKAA 3A70A 3I1IA 5AKJA 5DNUA 1N8SA 4H7KA 4AZ3A 4KAJA 2XB6A 3DYIA 1G66A 2CZQA 4QDOA 4C4ZA 2QXUA 4LIPD 2V98A 5HFAA 3E4DA 4GECA 4TVKA 5KWJA 3WKBA 4AXBA 1AX9A 1GZ7A 1PJAA 2QJWA 4OSEA 1XQVA 3T52A 2QKYA 2AJCA 3FBWA 5ALSA 3WJ2A 2Y6UA 5IVKA 1HDEA 2DFPA 2OPHA 3C5VA 4MEBA 1WB5A 2G5TA 1P0IA 3FOBA 5HQ3B 4LXGA 2AJLI 1QOZA 2JF0A 1ZI9A 3R40A 4Q82A 5DTIA 1Y7HA 5EHNA 4XVCA 1YS2X 2ACEA 2X8BA 4GHWA 1J2EA 2GZRA 1YAHA 2HA0A
chains in the Genus database with same CATH superfamily
1N9GA 3OQ1A 2RGDA 5J5AA 3TLGA 2W5UA 1QP4A 2QTVA 3MTEA 2VYFA 1Y6QA 5EZ5A 3JYLA 1XBTA 3W4KA 1TNDA 3K6SA 4CM5A 3K1TA 5CCEA 3ED5A 1GTRA 1N4AA 3OESA 1I2CA 3OIGA 3IMCA 5H68A 1G8FA 1YCGA 3X44A 4OM8A 1K6MA 2D5IA 2FDXA 1T6NA 2VJLA 3MUNA 4I0WB 3AF6A 4IDGA 1VE3A 2BL4A 1YA4A 2Z8YA 4I66A 4F45A 4HLCA 5GM2A 3PHJA 4D46A 3GGPA 3AVOA 2F3QA 3MJHA 5E3IA 4B3TB 3E82A 3PICA 4E2YA 1ZJJA 3WWZA 5EJ7A 1A9QA 1GPYA 2QYOA 2DUWA 3SJCA 1H1DA 2XOKA 1XHLA 5DBFA 1WHTA 5LA6A 4EATA 4BATA 3B2NA 4A9AA 3R7NA 4ZCQA 3FIUA 1SB8A 1KPHA 1W5EA 4Z1OA 1GG2A 1JQJC 1W4ZA 3VSCA 4FM9A 5F7OA 2FPSA 1YZHA 3ETNA 1NSFA 1YQEA 3S2UA 3R3SA 1QF6A 4TLCA 3DOUA 2UYOA 4MUFA 1EVZA 4ZYUA 3ZX4A 5L6LB 2PIDA 1Y6FA 2QX8A 2JZNA 3GJ4A 3VV2A 1EUCB 2ERCA 1W36B 4ZK2A 2WY2D 5AOAA 1NP7A 1EE2A 4MV3A 1X9GA 1FVOA 5KOIA 1X7WB 4G5SA 2ZIFA 2GPBA 3DE4X 1AKMA 3ZY3A 4DYHA 2J59A 1MXFA 1OGIA 1UPBA 2PM8A 2PZ8A 5ADHA 1YACA 2QP3A 1BA3A 4MYHA 3W06A 1VPWA 2CC2A 2ZDGA 2BI7A 1ZZGA 1E2IA 2QM8A 1R8YA 1S4MA 2GB4A 3AUTA 3FA2A 1JWLA 2UU9B 4EFKA 3SNKA 5EQTA 1BWRA 1E7RA 3PWTA 3NDRA 1WZCA 2XDQB 4X44A 1WSWA 3O7MA 3WA7A 4D9FA 1XPUA 3GPLA 1CS0A 1TZJA 1G5TA 1SVKA 3KX2A 3X3HA 4B48A 3Q12A 3RTDA 3SWWA 5D86A 1J1UA 2F9MA 1UWCA 1YOVA 4YP0A 1NVMB 3ITEA 5CB4F 1IJBA 2ZI6A 4IYJA 3WYBA 4HMOA 4G56A 2V4ZA 2IHTA 3U62A 1E61A 2NSJA 2O4UX 5H5JA 1HDGO 4NV0A 5K05A 2DPHA 1IOLA 1PGOA 4EX7A 1A1VA 3N6XA 3S4YA 4QHTA 1W5SA 4LYHA 4YCJA 5BUZA 5LL6P 2FEMA 2YRXA 1LU9A 3M4ZA 2PXXA 4CLRB 2GTHA 1ZD5A 3E53A 3E3OA 4X90A 3AZPA 2PRKA 3FDIA 2AKEA 4UATA 3TZEA 3BWMA 3G85A 2P11A 1KI1A 2XIQA 4M1TA 4X8HA 4ND8B 4R31A 5GVSA 3WAKA 1QGUA 1Y34E 1YT5A 3ZWCA 4CR6A 4JEHA 4K86A 1XTJA 2PX3A 3E9DA 1XALA 1WRBA 4KZKA 4NCHA 3GXBA 4EBBA 1GJRA 2QYTA 3BDIA 3G0CA 2HR1A 4FJ1A 1G1MA 3UFBA 3M6IA 4DDMA 3L93A 4MVXA 4WZAA 1GLGA 4DUPA 1MR3F 1CNMA 2OFWA 5I7WA 2AR9A 4I99A 5BV1A 1QMGA 4E14A 2YR0A 1YMUA 3DO8A 1HOXA 1UBEA 4I4LA 4KNVA 1E9VA 3WNQA 1W93A 1IIRA 2VP0A 2YWBA 3DLIA 4RK4A 5K2OA 3CPSA 3WGYA 5C8ZA 3ROZA 1UPAA 1XK6A 2GVNA 2ZZKA 4HAZA 4XEUA 1O87A 1QXSA 4J0FA 2SHKA 4NMMA 4R3WA 5JCXA 5EP2A 3A3OA 2R6CA 3IVMA 4PXAA 1SUEA 1LZLA 1C29B 3RAGA 1GZ4A 3QXSA 5K6AA 4PW0A 4OHRA 4Q4AA 5F2NA 1ZG3A 2QTBA 3HMKA 2WAMA 3NLLA 4QECA 3AR6A 4Q1EA 1L5LA 1DV1A 1K7CA 3QI7A 4ZGBA 2ZIGA 3A4LA 4TLLB 2NAPA 4EUNA 3LV8A 4LV5B 1HKHA 5EFZA 4HRXA 1OE0A 1MRSA 3DCYA 4O6VA 5AW2A 3OSZA 1P2VA 1XKXA 1DQNA 2ZB2A 1BKYA 5FTJA 4JELA 1VI5A 2BDTA 5LXTA 2VI5A 3I76A 2FP4B 1E2JA 4RGBA 2B98A 3NBUA 3PNYA 2JEOA 3ZNQA 3DZBA 3EXG2 1XRLA 3EOAI 3CUEF 3E9EA 3JQ8B 3RF7A 1JFRA 2QS9A 4N03A 3EW9A 4BCCA 5CFPA 3QFRA 5YASA 4D3DA 3HO6A 2NG1A 3ODGA 2GF9A 3CNOA 4ZVOA 4ENPA 4D25A 2QG9A 1IUOA 4PO3X 5M7EA 1HQKA 1EBBA 1S2DA 3ABOB 3K2IA 4G8BA 1DTEA 4U2FA 1YZLA 3ASVA 3WL7A 3D3KA 4EI8A 1EFVB 1P9OA 1Q7GA 1UIRA 2HSZA 2V6JA 2QLBA 5A6VA 1N2CA 3L6DA 2COKA 4IYRA 3U7QB 3DXZA 1A4XA 2HIGA 4G5XA 3LVQE 4HRAA 5HA5A 1C80A 4L4YA 5BMVA 3BSFA 3WNBA 3HU1A 5HZMA 2VDNB 4YT4A 1JBEA 3W34A 3ORFA 2ONKA 1C9NA 5CDUA 3HL0A 3ZDXB 2A0YA 2B4YA 3RYCB 4FMCF 2VTBA 3AF3A 1L7EA 1MA0A 2ZYDA 4S2UA 3WIVA 1D7OA 2HU5A 4AQYB 1UH5A 4NOLA 3IAM1 2Y3IA 3NAMA 3TFOA 1LPOA 1T6ZA 2PZGA 1COWD 2J87A 3U60B 2JHGA 4JI4B 4LN1A 1P44A 1TMKA 3OQHA 3UUGA 2GCGA 2WM2A 3T9DA 4GP7A 1KXZA 3IAM6 4BOYA 1PZXA 1U7XA 5D3QA 1BU8A 4NBVA 5CT8A 1TB4A 3IRUA 4IHAA 4MLPA 3VSBA 1MQAA 3EDRA 1C4WA 1AT1A 3F7TA 1KOGA 1F51E 1Q3HA 2VJOA 4PLPA 1RP7A 2C0QA 3JASA 4MKXA 4JBIA 4MQEB 4JQZA 4LDRA 1YVPA 2ISQA 3I6ZA 3KKLA 4AN4A 1M34A 3HI4A 4PCUA 1PUIA 3O8OA 5E6UA 2CBXA 2IWHA 1R8SA 2PX2A 4PU0A 1JEDA 2BH9A 3MJEA 1E2QA 6LDHA 1R1DA 1NR7A 5M2QA 5AVQA 3SI7A 3EVZA 1W88A 3LT5A 3DBIA 1NIJA 1G16A 4QBHA 3TW8B 2ECKA 3ZKWB 2VAVA 2Q8PA 4LJ9A 4GR5A 1E6MA 1KYXA 2HDHA 4BMZA 3MW8A 1D2HA 3A11A 4Y9SA 2JL1A 3INRA 4IS3A 2JIZD 2P79A 3DL4A 1WBBA 5AQEA 1N3LA 3CR8A 5FEUA 3UHFA 4P1ZA 3CTMA 1JHAA 4LQLA 3B3QA 1Z06A 3G9UA 1GCAA 1R66A 1NVVQ 2BBOA 2YRWA 3IHTA 4FOLA 5KTRA 4O2LA 3AKDA 1G41A 1NIPA 2GS9A 2TECE 3QYJA 4HPJB 3FY4A 5GAJA 3IERA 5J3JA 2GJ8A 3OTWA 2GN0A 5LJLA 2ZSUA 1H23A 4GC9A 1PFUA 2BFWA 2KPOA 3SFZA 4YJHB 4JLSA 1QIMA 4G5YA 3TE7A 2DHEA 3I2KA 3SXUA 3MCAA 2EL9A 3A05A 3EA5A 1E1QD 1DIBA 1IPHA 4TQGA 3W1EA 1VHLA 5AM4A 3RSOA 2YASA 5CLJA 4F8YA 2E4ZA 2O0KA 2YZ2A 2PSEA 3MJFA 4FN4A 4NDNE 1P0CA 4YRDA 5DNAA 5FIUA 2ZULA 1KHTA 3R8XA 3PD1A 3UC5A 4PRYA 1W87A 2AYXA 2I8AA 1QKIA 2RONA 4HEA6 1QQAA 1ZCFA 2FPLA 4FFNA 2FMIA 3AUAA 1Y8CA 1E3QA 1UJ4A 4P4LA 3TEJA 4G1FA 1PFYA 3HY3A 2X8LA 1QUEA 2GILA 1OFUA 4B1FA 1E9RA 2BEVA 2CMFA 2GN1A 4QPCA 1QIFA 1ODLA 1G20B 2VYVA 3ORYA 4GYWA 3UYKA 2CMDA 2ENWA 2ZVJA 4YCCA 3H9UA 4XLTA 2VTBB 3RJTA 3RR2A 2LNDA 3F7NA 4C0QC 1UKBA 5B7QA 3LXRA 3NT4A 1AK2A 2JJMA 3WICA 4RXMA 1A04A 1SOWA 2FPPB 1R3DA 5EVJA 2PSDA 2PZEA 3VYTB 5KQSA 1C3LA 1X92A 3N8HA 3V2IA 4DLLA 5KNBH 3CXUA 4BN4A 2OVBA 3HZRA 4V0ME 4X1IB 4OLAA 2BDEA 3IOEA 2W6ZA 3K0FA 4YASA 2OFFA 2FDCA 2C78A 3KJHA 1EFLA 1QMPA 5ALUA 1JH8A 1N3IA 4QGFA 3EJ6A 1Z5OA 2PAFA 4K9OA 1TVKA 1KC3A 3QOWA 4RW0A 2BGWA 5KI6A 2ZT8A 4N0MA 3T38A 1IM8A 1L4UA 1OFTA 2L42A 1E4EB 1OTXA 1QB7A 2W6JD 1KYZA 4CJXA 3UMRA 3ND5A 4FNOA 1NM5C 1PJZA 2G76A 2B3DA 3HU2A 3KG2A 4LJYA 5BVGA 3O31A 3BDVA 1NZFA 4ZCSA 1YU6A 2XNKA 2HSWA 3GCDA 4F46A 4AKHA 1E2NA 1WVGA 3VU8A 3EXFA 2ZJBA 2XVMA 4H7JA 3Q3IA 1ATZA 4FHGA 4D8XA 2BGRA 4FYKA 2AEMA 5IC6A 3NYIA 5DT2A 2WR8A 3BF8A 3KV3O 2C4TA 1JHQA 3OUTA 1A5AB 1V25A 2H5EA 4K9PA 3SYLA 3ZQ6A 2XD9A 1S3SA 3LXMA 4C7BA 3IDFA 5A4KA 3VHQA 5BSTA 3UJNA 2FOXA 5HM8A 3HGMA 2KLHA 3HR4A 4HYYA 4IS2A 4P35A 5C52B 3VBCA 5JT1A 4KPGA 1GPBA 3X1JA 5G1NA 1GNSA 3BSYA 5DX1A 1OB5A 1LK7A 1XF9A 1R0YA 4D7AA 5FOVA 4L16A 3IEVA 2YJTD 2AQHA 1UKVY 1NVEA 5FBRB 1CF2O 5EJEA 1G59A 4OQFA 3OQPA 1N92A 4U6SA 4ZCMA 4CV3A 2ZVDA 3OZIA 2IH5A 4BO4A 1NVKA 4AWBA 3SR0A 1L8QA 3PNVA 3A1WA 4MWCA 3GMDA 3B9BA 4D3YA 1AU9A 4JYBA 4NP6A 3GJ5A 2BFPA 3NKVA 4QQKA 4X3OA 4HFJA 4NPCA 3SX4A 1Y8ZA 4FONA 4M9XA 3TSWA 4A2PA 5JLJA 2OQRA 1DAKA 4EWLA 5IANA 2PMDA 4JI1B 2DB3A 1TYEB 1Q22A 1VJ1A 2I1QA 2DQSA 2Q4EA 2IYPA 2R8PA 1XF1A 5JHGB 1RYNA 5HDBB 4EG7A 3MQ4A 1IQPA 2IXAA 2G06A 4DBLE 4DUGD 1XG5A 2G6BA 1IHYA 3LJKA 4C0KA 4KO8A 7ABPA 4XSHA 2HJVA 2HQOA 4XR4A 3RB8A 5EEHA 3WE7A 5E9QA 4BN5A 4D4KA 1C0KA 1SD2A 5HPYB 4ENVA 5LQKA 1IUNA 9ATCA 3U61B 1I4WA 2J6CA 4FHZA 4XIJA 4OCZA 1W4RA 3F8WA 4QFDA 3WWPA 1KEKA 3ZU3A 5HOQA 1X7DA 1R9NA 3NT2A 3IBGA 4BGEA 5JRZA 2GRUA 3BIFA 2GJSA 4R2MA 2C2MA 5I6DA 2ZIXB 3PGVA 5JS8A 3D3WB 1PWXA 1QG0A 4L4RA 5I9MA 4A8PA 1VYHA 3ANTA 3AV0B 4KQFA 5D1NA 1TJPB 5A5EA 2G8NA 1WDLA 4BV2A 4RJ2A 3QUBA 4Q9AA 4JZKA 3KDAA 4E6EA 3JZAA 2E37A 2GEJA 2RB5A 3I9OA 1J56A 2NYAA 3VPHA 5I45A 1DT5A 5AVSA 4PSAA 4X94A 5EP1A 3M4NA 1ID8A 1KY2A 3FYHA 1IDOA 5IDXA 1HYQA 3ESQA 4I4NA 4IJWA 2BBWA 4GBMA 5HF8A 2IU4A 4KR7A 3HHPA 2B8JA 2FN4A 2AOWA 2MWMA 2Q3MA 1TRKA 1YC2A 5ERYA 3KZ1E 1QHEA 2JFNA 5DVZA 3KZCA 4MI3A 3LRPA 4GSKA 4QARA 4RCVA 5SYMA 1O6ZA 3ETDA 1KDVA 3S5JA 3VSAA 3ETLA 5J63A 2GMWA 4OIFA 4Y7CA 4K05A 4GWKA 1L1QA 1EBUA 1MX1A 2GK4A 2I4NA 1HWYA 3TR5A 2H52A 2YBEA 3F2IA 2W2NA 1BS1A 4AUNA 4W9RA 1J09A 2JLRA 2YXPX 3ZHOA 4JBGA 4RD4A 4YRIA 1GPH1 4J4TA 2VDLB 4MGYR 2I55A 2NO0A 2Z2YA 3KT8A 4IFTA 2HK9A 3GRCA 4PC2A 1IBLB 5E2IA 3CLUC 5GZ6A 1PS9A 3UJPA 3WRWA 2MYNA 3QLUC 5LOVA 1DX6A 4MULA 1ZMOA 1B1AA 3NFRA 2QMYA 4PGGA 1P6QA 4UHBA 1PX0A 4CMKA 2ZJ3A 4RJIA 2REOA 2HKIA 3G9QA 1OLSA 1U0NA 1XZFA 3WG9A 2OOSA 2QY9A 2X5KO 5CFMA 4X84A 4G0YA 1G7TA 2JAQA 2AMYA 3MCUA 4G1UC 1KSHA 3WXMA 3E7PA 3GOHA 3PFIA 4D4HA 3M2PA 3D4NA 3LX6A 3MJVA 3OTQA 4PSDA 1SVMA 3GUUA 3B6EA 2BFFB 3CNBA 2IOFK 3T4PA 4ZV7A 2MYPA 3TVTA 5BRAA 3EMKA 4HWGA 4IICA 4INJA 4A92A 2D1YA 1L5SA 4CMCA 1VE7A 2QNIA 4URUR 3BHJA 1Z63A 4J2TA 4QT4A 1HPLA 5KC8A 2WIJA 2C9CA 3T7AA 2XE4A 3RANA 3RSLA 3DCNA 1PEDA 5A4DA 2ZB7A 3PYLA 1AHHA 1QTNA 2IE0A 4YRTA 4BGVA 1T4CB 4GRIA 1U9ZA 3A8TA 3WQBA 2J3DA 1PGQA 4H60A 4IIHA 3WVNA 1ZD1A 3AVPA 2V9ZA 1K4MA 5AI6A 3LQYA 2ZB3A 2QY6A 1JYEA 1Z8NA 2REQA 4KR6A 3HJTA 1PJ8A 4LZAA 2XYVA 3E8SA 3D3JA 1NJGA 5ALEA 1RACA 3VI4B 5CDYA 3X2SA 2PMWB 4AU1A 2K7ZA 1JKIA 1LRKA 1SMKA 1W2GA 1X8XA 2YWRA 3M1LA 1ADGA 1CUZA 4PINA 1X39A 3I2HA 5SZJA 4P22A 3UG6A 4YMHA 2FP3A 1JKMA 3JVUA 3KSUA 4D5EA 2X0FA 4TLBA 4K03A 5FLXA 4DLKA 1P81A 2C2YA 1IZ7A 1T9KA 2AIRA 1CU1A 4V0KA 3S8EA 3GLKA 4RTJA 3DM5A 2KE5A 2FSUA 1KEZA 3VC2A 4NQZA 1F6WA 1K4YA 1X86B 1ZUNA 2JIPA 1SWWA 8ATCA 4PO8A 4OHXA 4R2XA 5IJ0A 4FK8A 1QVVA 3UKJA 3JQPA 5JD5A 1U1GA 1FDSA 3A9VA 4IIBA 3ELWA 3RU2A 2IU3A 4BCBA 3ZXSA 4BZZA 4NE9A 4EAQA 4UXHA 1VKNA 1ZM3A 3SYKA 4CM8B 4X1OA 3OUUA 2QENA 1UC5B 1VOTA 3CZMA 3DPIA 3GJ3A 4I8IA 4XCVA 1H5UA 5KWIA 4KN9S 2P41A 2YFHA 4LVUA 2DR2A 3OIYA 4G1MB 4DLSA 1EAYA 1T8YA 1LY1A 3OU7A 2BJVA 4G1VA 3KS9A 2B69A 2FPGA 4RELA 2HH9A 2IU0A 2X8AA 5AHXA 1N5JA 4KE6A 5P21A 3ZNOA 4NK4A 3DLTA 5J23A 3WX0A 1IY0A 4GXTA 4O33A 1WO8A 2JGMA 4FBLA 4F6RA 1J49A 4R9SA 3OIDA 2C0PA 2WWFA 5LLSA 3RKUA 2LCFA 3D31A 4KPUB 4GYKA 4R2IA 2IIVA 2GN6A 4JVOA 4YTEA 3RVPA 1INLA 3L92A 3SS9X 2ZZNA 1KMCA 1J21A 1DJPA 2B30A 2BE7A 2HMYB 1V4BA 4P7KA 3F96A 4TUYB 2FZWA 3FHJA 1DWPA 1N9KA 2ZSFA 5CGZA 1ZO8A 5AT1A 3SN6A 5DXAA 2VNIA 3VA7A 1QKJA 4GZ5A 4D96A 2JS7A 1W35A 5BN4A 2PEYA 4DFDA 4B2LA 2O6LA 1Z5PA 3QFFA 5CBKA 1W75A 2ZE6A 1MCZA 3PHBE 4DJEC 2D1QA 4YAUA 2P2ZA 1MD9A 1XJ0A 1WPXA 2H08A 2NXJA 3A1VA 3EB9A 3IQXA 4MPRA 6AT1A 1OC2A 1KO4A 3EIHA 3ZU6A 3IPCA 2A58A 1VMEA 3DLPX 4KTVE 2CLDX 1ST2A 2A0XA 5A0FA 4YJ2F 3GU3A 1LTQA 3R8FA 5COQA 4F96A 4FE4A 5LYYA 2PUEA 3T7SA 1UWVA 2GPJA 1A9PA 2JFOA 4DS3A 3OF5A 1LDEA 1TAHA 5ALTA 3II6X 3TKLA 4YI5A 3TECE 1CERA 4Q21A 4X60A 1JEYB 2PZKA 5C5EA 3T1VA 3B89A 4NU0A 2X7JA 1FLVA 3OC6A 5G0UA 3VR3D 3GRPA 3I6IA 1KDOA 5ERGB 4QVIA 4ARCA 2J3IA 1SRQA 3VXKA 2B8EA 4EFNA 5G2OA 4YMUA 5EJ8A 1LDGA 3OLXA 4R7ZA 4OHYA 1NUUA 2X0IA 1TO1E 1YI1A 3VZSA 2BGGA 1OI7A 4N0PA 3HJGA 1MGOA 3CF4A 3IOMA 4PGMA 2RK4A 5CX1A 3SG0A 5ECGC 1BC5A 4TYWA 3O75A 1KSJA 1XLUA 4CTJA 2Q5LA 5IKPA 2C5AA 3OU6A 2PL1A 4KKVA 4M7WA 1KJZA 4ECEA 3L0OA 5F3RA 4Z7QB 5IN4A 1KZGB 5LJIA 1GVNB 2CVHA 3E18A 3WLAA 1LC3A 3E3LA 4GO1A 4RSGA 4A82A 2XA2A 1JMKC 1C3XA 4R8MA 1LS1A 3KOXA 3TFQA 2PUGA 5KQRA 3B6IA 4CTKA 1XJWA 2W6IA 3NJ4A 3FPHA 1XXHA 4GP6A 4RIEA 3NBMA 3QVXA 4HGZA 3MTJA 3AM1A 3PR1A 4MUGA 3FOEC 3DOOA 5CIYA 4RACA 2XF8A 3DCJA 3WZ2A 2RGCA 3N1UA 4OQNA 4XGQA 3HXTA 3EFBA 4HQOA 4FT2A 3WLJA 2WJPA 4JEIA 4XQGA 4XYEA 1UJNA 1I5OA 5COBA 3TMYA 1OH7A 4L50A 1WIWA 3INGA 1XDGA 1YZGA 5J1SB 4ICIA 1GN8A 1EINA 3UMJA 3K0SA 3MD0A 4ND8A 1BFKA 1U81A 4G5GA 4J3NA 1RWXA 3SHFA 1SBCA 4L2IA 3CNLA 2OA0A 1WU8A 1QHIA 3LX4A 2XOEA 1RYBA 1UKCA 2VZEA 3B8HA 4LYFA 2XNSA 1KIAA 1DO8A 1JWAB 2P78A 3FYUA 1HYBA 3S0JA 4XM0A 5EJ2A 5A2GA 3K1ZA 4MW7A 5FV4A 2QK4A 2PT6A 2QM7A 3T7DA 3PE4A 3H1FA 4HDQB 1YZVA 2M6RA 2UYGA 2YYZA 3GCXA 3Q7EA 2DHCA 3H84A 3B7WA 1Q7BA 2E49A 2UZ4A 4XD2A 1T2NA 3RNLA 3JQGB 1JDJA 2NU6B 3S99A 2QA5A 2V6FA 2GN4A 2EP7A 1S8FA 2NVBA 3CMMA 2EZUA 2G07A 1B3RA 4WY2A 3ESYA 3JQAD 3SQNA 5ALJA 3A1CA 3BFVA 4P81A 2EDAA 3A9SA 4J7XA 1B16A 1JLSA 1SCNE 4C6TA 3EZ6A 4EW2A 1HOTA 4WADA 2Q4RA 1SCUB 4C7XA 4ENSA 2PWYA 4QBFA 1TPYA 4HXEB 5J1TB 4XIYA 2F1RA 4B35A 1VI6A 5ICGA 1BMTA 2XR1A 2PVSA 2QM0A 3HBMA 3QPUA 4I4IA 3QGMA 3EH2A 4ZT2A 5FULA 3WLLA 4DJDC 3HTXA 3SEAA 2P9QA 1RXSA 5FUWA 4AL4A 1AJEA 2HXGA 2BHLA 2Z95A 4LXXA 4QELA 2FRXA 3TSAA 1P77A 4PX9A 3WGIA 4B3MB 4EQ6A 1OVMA 1JMVA 1C7ZA 2IOFA 3U5ZB 3MINB 5AM1A 2C54A 3KPVA 1K7YA 1UR5A 3HBNA 3PI7A 1XQ1A 4GPIB 1HSZA 2R7NA 2XGJA 4K0KB 2A4MA 3AETB 3DE5X 1SZJG 2O50A 1E59A 1QHXA 3GUHA 3F5QA 3P0IA 4PS1A 2QVYX 1M2OA 2YJGA 3RFXA 4ZN6A 3U44A 1LSUA 4OGWA 3QWHA 4OXIA 1F1JA 1Z8DA 2QXYA 5JRJA 4M1WA 3QYFA 3TWOA 3HACA 3GPIA 3GLIA 2VRWA 4GZLA 4UXIA 1MJGA 2VP3A 3CEAA 3UMVA 1T3TA 3CRMA 3UAWA 4ZGGA 1E6CA 3PQ6A 3KUKA 1T4MA 2V0CA 2JRCA 1FJXA 4ZA2A 3BX1A 5DIFA 4A0SA 3I3OA 4EQ6B 2P2DA 4OHBA 3ML1A 1ZW6A 1KYTA 4AF6A 4AUKA 1AUQA 1M5TA 1QH8B 1Y5RA 1ZXLA 3MBKA 4YCSA 3ZWWA 2GASA 4XJSA 4URXR 4NU5A 2QRLA 3H8VA 5JJLA 5JNSA 1BIFA 3DMPA 2FZEA 4TLMB 1W2WB 3T7JA 1Z88A 4KRYA 4F5WA 5EKSA 3TD2A 4W63A 821PA 5AVKA 1FEZA 3O2JA 4EYKA 1IHUA 1L8XA 4O4IB 1ZINA 4Z86A 5EMNA 2QT1A 1DBRA 2YS7A 3BQ9A 3E9CA 3GGOA 4EL5A 5B5SA 1KOLA 1NW4A 1VJCA 1XRRA 1N2IA 1ZFNA 2EWMA 3ACCA 3FOAA 4FE7A 2PSFA 1QC5A 2QUBA 2OORA 2RJNA 2HSEA 5AUPB 2IV2X 1GZVA 1TRHA 3SKYA 4BBZA 2CJYA 5MHTA 3B3FA 4JAVC 3ST7A 4DG8A 5B7NA 4UUBA 1F0NA 2I76A 1MTZA 3NGMA 1MOZA 3T06B 4ESOA 1E32A 2VZ9A 2NVOA 3L8EA 3PSHA 4KVZA 4L3VA 4OAQA 3WL6A 4C29A 4D74A 1VKOA 2QTFA 4V1CA 2FE4A 4OH1A 1THZA 2JIZA 1V8FA 2DQYA 3IT3A 1P1KA 1Q7RA 2RI1A 1E1KA 4KH0A 3ZWKA 1XZJA 3VR5A 2OT3B 3A6HA 2YC2C 3EPPA 5FJIA 3D4OA 1QNFA 1O97D 1E5QA 1WKVA 4N7JA 2FLWA 4UD2A 1KS9A 4BQEA 4V0RA 4UBKA 3KOWA 2ZFUA 4HCJA 1NTOA 2D3TA 2HJWA 4YONB 3WWCA 5DSZA 1ZM7A 3RRZA 3UK7A 4MVJA 2MINB 4AULA 4CF6A 1GPMA 3L4BA 2F3RA 4D82A 1NDUA 1Q7EA 1SQ5A 2IHKA 2QQFA 3CX8A 4BBAA 1YVDA 1BEZA 1OZHA 2WU4A 2ZBRA 8ADHA 3QXHA 1XZNA 1N0HA 1TFRA 1FMLA 2CLIB 1PJRA 4XWKA 4FEYA 5IDQA 4YJ3A 3IAS6 2XLBA 1Z4OA 4GGOA 5A1JA 3KR2A 2PRIA 3M3HA 3HKCA 3VNAA 4K2AA 1E1CB 2P27A 3N2NA 3T4EA 4QG7A 2ROQA 3OJEA 5I7OA 3QKSB 1M75A 1V2HE 5ELLA 3CH6A 5KJFA 1IG3A 4OXKA 4PZEA 2Z9DA 2GFHA 4I1RA 3QLEA 4ZVKA 4HNHA 4H16A 3GGJA 3L4SO 2WJ4A 4HNRA 4ND2A 1ODKA 5FWXA 2CYCA 2V7EA 3K2BA 3WNVA 3DAGA 4HN9A 2W9XA 4DW8A 5CT5A 5HFJA 1JHXA 4KV7A 1N2SA 1RQ2A 1PNRA 3SVLA 1XVIA 4V0MA 5G3YA 3D0OA 1VHTA 3VPBA 4M1YA 1NRJB 2AMFA 1RE0A 2PU5A 1FDTA 3U5TA 2JGIA 4JB3A 2O1XA 5EHGA 2JEYA 3LFHA 2VF2A 3KR9A 1J2RA 1JYSA 3K35A 4ZOLB 3RM3A 1N5IA 3FTFA 3BF7A 2VPIA 3HLTA 1Y82A 4WZBB 4BXOB 1NR1A 3IIMA 4HB2A 4KWIA 3VMFA 4OQLA 4BLUA 3WGKA 1VKHA 2B4TO 4AZVA 2I3ZA 2UV8A 3IXLA 1TU4A 1HEIA 1QQ6A 2Q1YA 4JCOA 1XRNA 5KS2A 4QPZA 2IPAB 5LB4A 1YNSA 1CEQA 2FZLA 1MT0A 4KYUA 3IBTA 1D7AA 1M72A 3BXZA 5HM6A 1ISSA 3MWDA 4MR9A 5EIBD 3DMYA 2YH2A 4C9BA 4EEKA 2H7VA 2A86A 2XWPA 5A03A 2POCA 1FYEA 1VE5A 2MSEB 1L5HB 1NN3A 1SBYA 2WWHA 3EE6A 3QYPA 3RJ5A 1GD1O 2EF0A 4UEWA 1G4HA 4LX8A 1I2BA 1I3MA 4LE1A 1L0BA 1QLJA 4TL6A 5ALXA 1S8OA 4Q1VA 1JHZA 2WSMA 4DXAA 4AJOA 1P17A 2ZS9A 3OLWA 4RHUA 4RWZA 4CMGA 2AZXA 1L4BA 3SC3A 1KKLA 1AV6A 3UJHA 5ULLA 3C39A 2JFWA 1R8XA 3P9YA 4BFYA 3WQQA 2HSDA 4Y6GB 3AU8A 2IHBA 3BFPA 1OAKA 2H65A 3HV0A 1L5WA 1ZQ1A 2CD9A 2E4VA 2JGDB 2NTEA 3HKCB 4LHVA 1WQ1R 3MOIA 3NBAA 2XWBF 1T25A 4WFIA 5CUQA 3REGA 3OZEA 4AJPA 4RPGA 1VMKA 2Z8XA 1GKIA 4L2IB 4ZVLA 3SHVA 4F5EA 3C1AA 4MRNA 4PLWA 4QFMA 3TR6A 4E5MA 3Q5DA 3BWVA 4B83A 1E9BA 4WBNB 1V8DA 5KHAA 4BGUA 1OZFA 5IASA 1HFEL 2CT8A 4MQ5A 1TD9A 4BFSA 4HDSA 4QXMA 4LMPA 5HHTA 1ULHA 2P2GA 1EDOA 4WUVA 3VKUA 4D6PA 4LV6A 1OLXA 4MVJP 4Q66C 1RC8A 5KEIA 1ZCBA 2ZGVA 3UC9A 4WI1A 3F3SA 3SMQA 3WGOA 1G9TA 3VZBA 1GUDA 5EUBA 4BNYA 1LC0A 1T2FA 3IVGA 4FX2A 2WB2A 4R1OA 3D5QA 1JT2A 3ESXA 4YQEA 3T7TA 2JGKA 2RAVA 1VLLA 2EWWA 3D02A 3PE3A 3BILA 3E0QA 1OVGA 2DBVO 2QNBA 2Q5OA 1J2UA 4DQUA 3EISA 2K6GA 4AI6A 2ALJA 4EJMA 3SR4A 3OZWA 4GMDA 4AG5A 1WW8A 2V74B 3GJTA 3DPUA 5KNLA 3EIOA 1JQ3A 3HVJA 4EW6A 3TLAA 2YHUA 2JVKA 1BOOA 2B2XA 5AQ1A 1PZNA 4BNFA 4IJVA 1DAGA 2CFRA 3BHIA 4JI5B 5B3LA 1RI3A 3VJMA 1BTOA 4O2AF 4S1NA 1RTKA 4G8CA 1LRJA 3LIPA 3D4PA 4GT1A 2QL7A 1QJ4A 1FFDA 3QNWA 1KEWA 1C8KA 3FCOA 4P4SB 3AERB 2AEJA 3B6JA 2R44A 4K6OA 3JQRA 1TX4B 4X95A 1YIDA 4JCCA 1NQOA 3SNHA 3GWGA 3IEIA 4XSVA 4MR7A 2P65A 5DH9A 1I32A 3G79A 4R0VA 3JATA 3TZLA 4EA7A 4F1WA 2R5FA 1LK5A 4MV6A 4QQFA 2ZPAA 3O92A 2P0EA 1K8YB 2R62A 3LT2A 2G08A 2ZWMA 3WLEA 3KLBA 1PVVA 5TQ2B 1ETHA 4II3A 4M88A 2JD0A 1JJBA 7GPBA 5I4IA 1TM1E 5JLAA 3CB2A 1F4LA 3K71B 2OC9A 1TQ2A 3GEGA 1OFVA 1L4NA 2HRDA 5DP1A 3WS7A 2YXNA 3N2KB 4A15A 1XQ6A 2CFCA 4CEIB 4G0WA 1ISIA 2XOKD 1UKEA 2DGDA 2W0SA 1SU6A 5IEBA 5JROA 2CUTA 3BDAA 5TGDA 3T61A 3DT8A 3W7BA 2XCSB 3V4SA 1SNYA 4WN9B 1H2HA 4F3YA 2ZUCA 1RU3A 4OQ4A 4IX1A 1MC5A 5CGQB 5C2JB 2BUBA 3RGGA 3TZHA 3U6BA 3D6UA 3VR4D 4RF2A 2J3QA 1LUAA 2JH8A 2Y0PA 3LOUA 4F71A 2LD4A 4LZLA 3V1MA 3QH4A 3G2HA 3PT9A 1ZEJA 4LPSA 3UV6A 3PNPA 3VV3A 2BEJA 4C7OA 1PQWA 2V6BA 2AZMA 5ALOA 2WM3A 3U49A 3BMQB 3AVVA 4MUYA 3FGPA 3I9MA 3DZJA 3HN7A 3OD1A 5AOVA 4MP8A 4ZJYA 2G9RA 3ZY6A 5JANA 1R5NA 1IQUA 1HFKA 3QFCA 4HDNB 2YZGA 4LWPA 3LPMA 4LVOA 4GOKA 4F2WA 2WT9A 5KYTA 1Z2OX 2CWDA 4LI3X 2D13A 4WLEA 4X20B 2WHYA 2R47A 4F5DA 2JFFA 3JAWB 1E1RD 2I2WA 1NUSA 1Q57A 1X7XA 1XMXA 2X7HA 4LRTB 4ZI3A 3NDBB 2WWYA 2DPGA 2Q6OA 5IVDA 2C5GA 3COWA 5HNKA 2VP4A 2RKOA 1H2ZA 1YS7A 2P9FA 1UMBA 3YASA 4OX9B 1ZU4A 3N70A 3CX4A 2ZQ5A 5BN1A 2ZU6A 1KQ3A 1WXGA 2C9OA 3OFNA 1NMYA 1OI3A 3K70B 4EKDA 3L6BA 1JXQA 3WGNA 2YWDA 4UVGA 3N53A 3BFKA 4B3GA 2X40A 4IXMA 4OSPA 4P6VF 1HE5A 3I9V6 1W0KD 4UAJA 4LF9B 4MW2A 4WEOA 2ZRNA 4E03A 1NQWA 3PE6A 1RC1A 1BEEA 3TNYA 2ZP1A 1M1YB 4TX1A 3ZS9A 2IXGA 2P9TA 4Q7LA 2BKLA 3I30X 3I0ZA 4MIEA 4HDSB 2RJ3A 1KDZA 2VAXA 2EATA 1WCV1 2OP0A 1NLZA 3QG1A 1KZ1A 5TS3A 1YZFA 2WINI 1TC1A 3IR5A 3PUXA 4QXPA 4RXUA 5K8VA 1JJVA 3W3AA 1IAVA 1FS4A 2VRBA 2ID8A 4IQFA 2HN9A 5JAHA 3UMMA 3O3MB 4Z3OA 3MXTA 1FL9A 1OQAA 2UYYA 4TN1A 1NI5A 1V5IA 1Y1KE 2RARA 3AM5A 3A9RA 5EIEA 1G5QA 1LBHA 3GHYA 1T5HX 4MV4A 3GDFA 4AJLA 3QEAZ 1HDZA 4HBGA 1OZ0A 3DW1X 3HM2A 1ENPA 4AS3A 2O19A 4CV0A 3R3JA 5LYJB 3H8JA 2W6QA 3LSYA 2FK7A 1G18A 5A3QA 1KK1A 1T0UA 1JR3E 4KR9A 2GM4A 3GD5A 4IKEA 2PV0A 3A1FA 2POQX 4ZOCA 5H81A 3LUHA 4Y9UA 2ZRBA 1JSXA 1NOJA 3TSCA 4NFLA 5JJ5A 1ZDMA 3EX7C 4EYQA 2V7WA 4DF3A 1XE3A 3IV7A 1O0CA 2ZBQA 2ODPA 4WTOA 4UBLA 2NMVA 3OHSX 4PHCA 5CRIA 3K6SB 5A71A 2AEFA 2Q3LA 4AB1A 5KMGA 3VU9A 3IUBA 3L3BA 4A8JC 1MLDA 1ENYA 2ZSJA 3FWNA 3QVKA 4GR4A 5I3ZA 1H6BA 1ZSNA 2FMXA 4EUHA 4P9NA 3C85A 1V1RA 3QY0A 1U2ZA 2XCTB 3DP9A 4HTFB 4JR1A 2QSZA 4CLDA 2IHYA 1E89A 3DZDA 4MRPA 5BORA 1UBSB 2C29D 3MTBA 3ZWAA 3PT5A 3ILHA 5F78A 1WNTA 3FDFA 2P8SA 2EG9A 4I08A 3TRDA 3SYNA 4ZU6X 4OU5A 3E22B 1H65A 1XJCA 2HLPA 2XB2A 2JA1A 1ZUD1 2QRNA 3BEDA 3HFGA 3M0EA 3ZE8A 4GOMD 5CD9A 1RZ3A 2JLCA 4BMOB 1QRTA 5K3EA 4PHFA 5JALA 3CIOA 3KJFA 4WLVA 2VPWA 3G0BA 4PLCA 3MK31 2VNHA 4JT8A 3RUCA 3SZUA 3VZDA 1JN0A 2HBRA 3KSMA 4FILA 4HGQA 4MX8A 1CUYA 5D5PA 1U31A 9MHTA 5DYIA 4U1RA 1NV8A 1DC7A 1GFZA 1N5DA 1XD2B 5FPYA 2ZAIA 1NVGA 4CF5A 1N2HA 4XCXA 3U3RA 2C92A 4RHTA 3SZRA 3LCVB 4H6XA 2OBFA 5K3CA 3NTUA 2Y1OA 4X7RA 2C4KA 1PR3A 3BK2A 3CF4G 3L41A 1TXGA 2PTHA 2X3YA 4KWCA 1WM1A 4M86A 1SR8A 3IAUA 2ZK7A 3SZOA 2YOHA 4W1QA 4QUGA 3GROA 3V48A 1NXTA 4PF1A 2AKAB 3L77A 2YVLA 4H6PA 1E62A 3HJBA 4RKQA 3LT4A 4EOGA 5CDFA 1E2EA 1F2TA 3HVHA 5ELXA 2PQ6A 2BKEA 3KQKA 2I6GA 5KTOA 4C4YA 4FFDA 1ICIA 5LQDA 1U7OA 3RADC 5BUCA 5FWYA 1ZM4A 5EXDA 3VUEA 5K8TA 4HF7A 3UHPA 3P9RA 2HA7A 3FVVA 2ZDQA 1YU9A 5HE9A 2WM9B 1S2OA 5CCDA 5FDFA 4B6FA 3JS5A 3VNQA 1TM2A 2P4QA 2I6FA 5AWFC 1XEXB 3UK0A 1QZZA 1JDZA 3L6CA 4U00A 5HCIA 2PCLA 1QYDA 4TMZA 2XB4A 1CR0A 4M0KA 4U2DA 4DJFC 4FJ2A 4EITA 5GMOA 1VSTA 1CIVA 1HDCA 1RPTA 3DT6A 4GMGA 1Q0SA 3WMEA 2OR3A 5BWBA 4Q19A 1VECA 5HGJA 2ZSEA 2OORC 1WTCA 3ELYA 4PX3A 4RVDA 1BRTA 3ROKA 4M1KA 3S29A 3ZV6A 1CY7A 4IIJA 1CJTC 2PJDA 2O7RA 4XM1A 4UTPA 4TWRA 4G65A 4Y8VA 4YJGB 4M0UA 3T0IA 5A9TA 1K88A 2C2KA 4ALIA 1X7WA 3BE5A 4QVKA 2CHUA 4D6YA 2CJXA 5JUWA 3Q41A 3UPTA 1G2IA 3F1KA 3KVVA 3F6RA 1ZW1A 3OIUA 1I7LA 5CPBA 4A73A 2HQBA 2M98A 1UDCA 4EPXA 2E6UX 5MFPA 1RMTA 3R9XA 2GAOA 4B71A 3VPXA 4P4SA 1JIKA 3GDOA 4MV1A 4PPNA 2Q0HA 3FF1A 1EXVA 2R1ZA 4L5BA 4UDYX 1O9BA 3C5WP 4GPD1 4XJVA 4PQEA 4F56A 5CDTA 3W4JA 2P6OA 5LP1A 1B23P 3V2GA 3ZI0A 1PUXA 2Z56A 1PVOA 1VPEA 1IN5A 2EL7A 1T9HA 3FAZA 3I39X 5HQJA 1J22A 4A2WA 2Q1XA 2WD7B 3VKWA 3ZE2B 2ATIA 2NSLA 4JODA 4BFCA 1U7HA 1WF6A 5DB4A 5ICEA 4PAQA 2I7TA 3K0EA 4B43A 1AS0A 4ZT6A 2G7ZA 1RVDA 2B20A 3FCAA 4KMOA 3KXIA 3W6NA 4EF4A 2PUDA 2DFLA 1HEUA 2CY0A 1C9YA 1UPCA 3KJXA 4P4UA 4UM8B 5BN3A 2ZRKA 3EQ9A 4J1NA 3IT2A 1E8MA 2OP1A 4P7FA 3VUFA 1DRJA 1JDBC 4V0LA 4ZHSA 5ICCA 1PW7A 2QN3A 2OKGA 5EXEA 1S2GA 1V1RB 4KQ9A 5K8CA 2IYTA 1TEHA 1W25A 2I7VA 1Z3CA 1FRQA 3BIWA 3BD6A 3DXFA 3GDGA 2NT4A 2VWGA 1XROA 3PJGA 1UBHS 4PZLA 4Q01A 2QORA 3RI3A 4B17A 1UIMA 1T1EA 2RHJA 1A9TA 1GYQA 3KT6A 2DHDA 3JQ8A 5ALVA 3ROTA 1Q0LA 2O0JA 2A5FA 2JLYA 3O84A 2VSXA 5DOVA 5F3WB 2F8SA 4OY3A 3TLGB 1ABFA 3ELBA 4BCDA 1L5KA 2DLCX 3ILVA 1RBQA 3LQFA 3MC1A 4KUGA 5JQGB 3HLYA 1V3VA 1MFPA 1U3WA 2G5GX 2G88A 5BSHA 2BMFA 3LBIA 1S8NA 3ITNA 3O03A 1T24A 1Z15A 3FVQA 4MVJI 3JALA 4XE5A 5AJXA 5DYWA 1E7SA 3ERCA 3S2IA 4FI3F 1M1NA 4CQMA 1GGVA 1JPUA 3OCWA 4NDZA 5DCYA 5ARCA 1RIIA 4NH0A 2AG1A 2OCXA 4DM4A 5IXJA 4GOOD 4II7A 3T6KA 2V7BA 3Q8XB 3GI1A 3HR7A 4M1ZA 2B1IA 4MVJH 2XZTA 3ABSB 3CNEA 3FWHA 3LXUX 2FOIA 2A9RA 4A7PA 2YW9A 4U4AA 5ADWA 5J2TB 2ZRHA 5M3BA 4JXXA 2BIFA 1T2UA 1XLWA 1LF0A 5E2AA 3KL4A 1P91A 5E0OA 3ZHRA 1R64A 1Z16A 2CXRA 3QVJA 1YR3A 3KSBC 1OF1A 1YHNA 1TQDA 3G89A 1V5EA 3CNNA 2Q2QA 1H2WA 4KNWA 2UXDB 2OAEA 2D1TA 4JVMA 1NU8A 1V39A 2OHHA 1X14A 4L5JA 4N5IX 2HJHA 4PV7A 5ADUS 3QPDA 1ZRMA 3AGQA 2WP8J 3KJEA 2RCYA 3NTRA 3O4GA 4WFJA 5DCLA 3ET5A 3VYSB 5B36A 3QK7A 1O6CA 5DM0A 5C53B 1OWOA 3PKJA 3QU4A 2I7DA 3UJ7A 2P7HA 1C7QA 1BH6A 2QD2A 3RYHA 5IM4F 3DAYA 3M83A 5PGMA 3HKDB 3PRKE 1JE1A 3AFGA 3MD9A 1P1FA 4XWGA 5TGTA 3URKA 5EA2A 1SBIA 3WGHA 3ZIAD 3ZTWA 5C80A 1UPFA 2XTJA 3Q7RA 5DHAA 1QDEA 4G01B 1DDGA 3R3XA 1V0JA 4G84A 5KNDA 2VUSA 2O8BA 3TOCA 4JXKA 4CR8A 1H2FA 3MSCA 4B8ZA 5C32A 1QANA 4QD3A 2GXSA 1HI9A 3NEPX 5KYWB 3EPRA 2DC1A 3UK1A 1B4DA 4BFXA 4NU6A 4B6SA 3VAYA 3R9IA 1AOXA 1YS4A 2OBLA 2ZBEA 3KYJB 2ZUVA 3MG9A 3MS4A 4JQCA 2H8KA 3V7YA 3EW7A 1IN8A 2XWQA 5E7MA 2R48A 1CBUA 2J9YB 3LQ1A 4MCIA 1HG1A 2V45A 3KJQA 4R0MA 2X1HA 2A67A 5JCPA 5KREA 4YUWA 3C3XA 2PL9A 3THOA 4BO7A 2D00A 3UCEA 1YBHA 3WMWA 1TUEA 3KPJA 1K4KA 2PQ0A 3GD7A 1QORA 3CSDA 2GDJA 5IJAA 5IC4A 2YWEA 2HI0A 1Q77A 1ECGA 2IIBA 3WJ1A 1PFWA 4S24A 5AHKA 4WBSA 1G8AA 5FBQB 1MZVA 4F86A 2YHAA 4FC7A 4ZC8A 1BQEA 2A84A 1PJ4A 2AEEA 3ANLA 4MEJA 3UMYA 3NDPA 2VH2A 4XZ3A 3ZHCA 2VYVD 3BRSA 3VPFA 3GLVA 3OPYA 2W2TA 5I8ZA 1XDZA 1Z17A 4K1LA 4RIFA 1BHO1 2GETA 3WP0A 4D2IA 1PYGA 2EKPA 3V8RA 2DUNA 2H0QA 3PXDA 3RRBA 1H6AA 1U9YA 3IURA 1UWLA 3DDCA 3PGMA 4R2KA 3INTA 1MX3A 3ESCA 5JNWA 4KRFA 5J9FA 2RGEA 1A8IA 1D4OA 4FNAA 1U6KA 5DCWA 2AW5A 3S2SA 1ULZA 3KB8A 1A7UA 4CRWB 4N4AA 1V8ZA 1H6CA 3MILA 1CQJB 1UXHA 4XJTA 4KO2S 4U7GA 3W04A 4I1VA 4QXQA 2YDYA 4D02A 3AX6A 4H3KB 1KNXA 3GLTA 4OB7A 1UK7A 5AKYA 4I4TF 1YZQA 2Z98A 4MYDA 3V4LA 4YFYA 5IP5A 2HLDD 3IE0A 1RHMA 3BCUA 1LQTA 5EGNA 3NIGB 2FWRA 1E4EA 1AO3A 5IZCC 1WOMA 2NU9A 3KFVA 5JH7A 1Y6GA 1Q0TA 3TZCA 3A3PA 2JGAA 3DPSA 1VFNA 2IWRA 5IVPA 2FPRA 3EIXA 3PNMA 1KQPA 5AW0A 5TY0A 1NHWA 3C14C 4LSMA 5ALDA 3I8XA 2AMJA 1WSDA 1U2PA 1EGVB 2EIXA 3DVAA 3TB4A 5C8YF 4QGAA 4RF4A 5FRDA 2CK3A 2LVBA 3D6JA 4DQLA 4ZXPA 3E7FA 2AZ4A 2HIAA 2QGFA 3U4IA 4FNGA 1ILWA 1QTIA 5IAKA 5T4HA 3CF2A 1JALA 1RYMA 4ZOAA 4DR1B 3WMGA 1QO0D 1OXKB 5E9JA 5CPFA 2I9PA 2FFBA 4DT1A 1E2UA 5JS7A 3J81k 4QYSA 3TLEA 1W7AA 2CV0A 4NCXA 3JXEA 4G85A 2JI8A 4DDWA 5K3BA 2HTFA 4BX9A 7MDHA 3NDJA 5BXYA 1TMGE 3UYLA 3BMCB 4HK4A 1DMSA 2C9ZA 1GL7A 4MAAA 1XZ8A 2JDID 9ABPA 2NP7A 1T13A 3JCZA 4DL9A 3L8HA 2JGDA 1XZPA 3F9RA 4IOKA 2M32A 1ADJA 2Q0SA 4RA6B 4G0QA 4G1BA 3H87A 1WZUA 3FNBA 1YJBA 4JT9A 2DPLA 1UFRA 4KPUA 4WV3A 4B6RA 4YMVA 1WOYA 1JIJA 2JATA 3B9RA 4MVJF 2DT8A 4BNMA 4NJMB 1LA2A 13PKA 2I65A 5DBEX 1XEWX 1PNQA 1U7UA 4L02A 2VCEA 3WYCA 1RYFA 1QAMA 1V16B 4ALLA 4N48A 4C76A 2GTIA 4LY3A 3P5BA 4LMAA 4QPPA 2KQUA 2V6GA 4HQFA 2FWAA 4I1IA 4LBVA 4S1WA 2QW0X 4DMCA 4I3FA 3WWDA 1Z38A 2ANBA 3MJDA 5C8VA 1LNZA 4JVLA 3SDBA 1JG4A 4NHEA 3LRXA 4NBNA 3HH8A 5J2UA 4W5TA 4WN9A 4N5LA 2CXSA 1YQGA 2ASVA 1CVRA 3B53X 3NYQA 2VA8A 5K0ZA 3TW0A 1BXRA 4IPTA 3FJYA 4HAVA 1EWQA 1ZISA 3STHA 3I2YX 3U31A 3EZ9A 3A4VA 5K45A 4OGFA 3EXEA 3KAJA 3V4FA 2AS0A 5INTA 2IODA 2PFKA 2E82A 1PSWA 1JHUA 1PR6A 3AO0B 1C1YA 4KE7A 1PJSA 1FSFA 1LQUA 1WWKA 2HB6A 2I6XA 2HWYA 2WKRA 3OTGA 3OZCA 1X9IA 3ILSA 4RBNA 5G4KB 4AECA 4EJSB 1A9OA 1YASA 4HS4A 2C4WA 5SICE 1XCGB 3MHPA 1AGXA 1K8RA 3PL5A 3G8YA 1YRQA 4RZQA 4TTVA 4DSUA 2Z30A 3CZ9A 4OX9Y 3QE9Y 3IBSA 3WK9A 4HB0A 5EZYA 1Q74A 4HGYA 4R1QA 3HNRA 2IF2A 3H2GA 4D0LB 1FSSA 4Z4QA 1UZAA 3MB8A 4TYYA 3X1ZA 3TZKA 2JJ8A 2WJAA 3L6RA 1MAAA 3MWFA 2YICA 4HVAA 1YJXA 1Z6XA 2EKBA 2OB1A 1XT6A 4JYMA 4KX5A 4GBJA 2PVCA 4Q3BA 3KETA 3DVAB 3I4CA 4NENB 1LJ8A 1RABA 4NCIA 2VF4X 1DLIA 4WW0A 4PC6A 4YPFA 1G21A 2YL2A 4L0CA 4X8OA 4DTIA 2V0GA 2A78A 2FSHA 4GSLA 1NATA 2Q6IA 3A14A 2R8RA 4PQGA 2BGMA 1YQXA 2XVYA 3R3ZA 4W5OA 1NKTA 4G0OA 2F8TA 5IUNC 1NLUA 2IFTA 3QJYA 2C98A 1E1RA 1AZLA 3CKMA 4QPJC 3L4BC 5AH0A 4TYPA 1TMYA 4W5JA 3SHQA 4QC2A 4LXQA 1ND6A 3LA6A 1LLCA 3ZJYA 1ZH2A 3VISA 4TKMA 3ZEAA 3RABA 1MG0A 3P9KA 1QH9A 1C9MA 1CR6A 1TZKA 3EJWA 3VTFA 4BKQA 3KQHA 1GR1A 3NM4A 3R6GA 5K0SA 2IBSA 4U7HA 4H1WA 4LFCB 1I3OA 4Y2VA 4LHSA 3B36A 1R15A 4RKFA 5JY6A 4AKIA 3NRBA 4TUYF 4LRWA 1QVAA 2GCOA 2ZWOA 3NHUA 4JLUA 1NN5A 4Z4GA 2H54A 3F5SA 4TROA 1KDYA 3UWPA 1ZRNA 1UFKA 4LY9A 3TUJC 2YY5A 4YBZA 1QS0B 1MRZA 4UC0A 1DWUA 2AYYA 2GN8A 2OWDA 3VR4A 2CJFA 3N39C 4TXNA 3ZS8A 3KKKA 4P83A 1UC4B 2VJCA 1P75A 4XRGA 2O8FA 3FH0A 4HDKA 4Z4IA 1A72A 1Q0RA 4KXMA 4S1VA 1W36C 1Q83A 1EFRA 1FTSA 1RYZA 5FCDA 4QJ3A 1T26A 2B34A 4GBED 3UKOA 2ZQZA 2J41A 2VDPB 1DJQA 1I33A 1C1HA 1RHQA 2YIMA 4TVOA 3QTTA 5SV2A 5IAOA 3WP1B 3I5XA 4ALMA 4G63A 3JD0A 3V8MA 2NWQA 1B3BA 3MXOA 1QYRA 3Q4GA 1TCBA 1W6RA 3OTHA 3RFVA 3SICE 4C0AC 5TIIA 4HH1A 4P33A 4S0ZA 4AZTA 5F7ZA 5CMLA 2VPZA 5T6BA 2BAGA 2I2XB 3K72B 1YR7A 4G0VA 4IGKA 3A3KA 4R84A 4EHHA 2ZAGA 4D9GA 1Y98A 3H9CA 2XNDD 3BKXA 2PRZA 3HB0A 5CEEA 2QVCA 1P1JA 2EP8A 1ZWLA 4PO9A 4AJHA 3WLFA 2YUIA 2CFIA 4R83A 3OZAA 3K0CA 2CUZA 4QDZA 3WBKA 2BFCA 2D7CA 4UNSA 2Q6KA 1D2MA 1UPUA 2ZRQA 1PI3A 3PUZA 4FSXA 2WMOB 4TSFA 4EGAA 4M0DA 1ZYUA 2VHEA 4JKYA 5BPHA 2VSOA 3MQ2A 5BVHA 5CXQA 1NVFA 1N6NA 1SHTX 4DM3A 4IH9A 3I09A 4FYPA 3V55A 1H2RS 3N0WA 5DP2A 3X2FA 4U02A 2WJVA 1Y1RA 2AD1A 3AYZB 3WDSA 4I4CA 1PDVA 1WD5A 1VGQA 2QZ9A 2RBKA 3PFNA 4QOIA 5CVEA 5AKEA 10MHA 1DFIA 3MWDB 1HBJA 4IP0A 2PUCA 4IZOA 4XDZA 2P5TB 5ITSA 1Y42X 4QUAA 4X54A 4LV8B 1WVMA 1FYVA 3ZC3A 4D98A 5E4JA 2GYWA 4KXLA 4KPYA 2NPOA 3RASA 3K5IA 3WK8A 1CP2A 3GPBA 3LYUA 3OJ0A 3GL9A 3I9FA 4JJFA 4MRRA 2BWJA 3BVPA 3RS3A 1IWPB 3CT6A 4M8KA 1Z26A 3C8ZA 4BO6A 5LQUA 1ELOA 1UODA 2IT1A 4CXMA 3LM8A 2K5UA 1NZJA 2XT6A 3CIFA 4GLBA 4JR0A 1YTUA 1KI3A 2P91A 3S2YA 5FWYB 3JD1A 5MF6A 1QYXA 4H1VA 4XOUA 4WACA 3U4QA 2BMVA 5EWJA 2GZSA 4NJEB 4PONA 1C8BA 1U02A 2A94A 2E87A 3ZHQA 1KQGA 3I9NA 1EX7A 1NBMD 3NJRA 3UXHA 1SIOA 1DIOB 3L7KA 4QUDA 1Y9JA 5K8LA 3AUFA 1BSVA 3IDZA 5H3LA 3WLIA 4KNYA 2X8JB 2OE2A 4DKXA 1FP4B 1LVGA 2V4UA 5DYNA 5SYAA 3DMHA 2XD4A 3FR8A 3FYUC 1SG9A 2HX1A 5LZ7A 2PBLA 4DJAA 3UB4A 2G25A 1QK4A 4CG1A 1CUDA 2OHIA 3K2EA 4OOEA 1KL7A 1YONA 3GGSA 2Q1TA 3I64A 4JLWA 3F6YA 5ETJA 2J9GA 4WZ6A 1U8UA 4XIGS 3CVUA 3F67A 1HF3A 2W42A 5CXUA 1UBFA 2O7VA 5GZ1A 4PQRA 1HZJA 2FQWA 1T5TA 1BX3A 4RYLA 2ZRLA 1Z18A 1DZ3A 1C4KA 5E2BA 3BUSA 4YXFA 3KWMA 1SQ6A 4I3HA 4QFCA 1Z36A 4URVR 1YS6A 4Z9YA 2QJRA 3JRNA 1SCIA 4RVCA 3ZJVA 3D3QA 1NC1A 5DN6D 4AX8A 1NUPA 4CQNA 3EGDB 4BIIA 2ZCJA 1QIHA 3D8NA 3ODPA 3EMDA 1GEGA 5EYPA 3SLGA 4BWFB 4BASA 2FUEA 4HXYA 1RXEA 3N59A 4KO3S 3GZNB 1FQKA 1Q0QA 4JP1A 3F3MA 4L4SA 5LZ8A 4DSAA 4CKWA 3EY9A 3LX5A 5EJGA 3T4XA 3W2TA 3UY4A 1GRRA 3LUCA 2EBHX 3F4BA 3CRNA 3BRCA 3JVVA 4NY1A 1V9SA 1ZESA 1S02A 1X1TA 1JUDA 4ZAZA 1CJUC 3JZIA 1EUDA 4KQXA 9LDBA 4Z7NB 3UJ9A 3QU9A 2Q2NA 2NN3C 3LLVA 4YYEA 4B6EA 1B6RA 2HWKA 3D3WA 5C46F 1C14A 4ZT5A 4EKIA 4IKOA 2KS6A 3R24A 4E70A 4TLEA 2YQZA 1LX6A 3GJXC 3RRXA 4NONA 1NUTA 2CVOA 4RMIA 2WU0A 5EZYF 1XR3A 3IMFA 4LQDA 1E4VA 3CLUD 3M6UA 521PA 4NJEA 3UM9A 1YQTA 3BRWA 4KKXB 2W71A 3CKYA 4BRWA 1IQ0A 1PIWA 2A9JA 3HB5X 2WYHA 1DVRA 1TM3E 3LUBA 1TK9A 3FJOA 5DBGA 4MWSA 3NW9A 2P4SA 1N5MA 2R6R1 1M8KA 3E3NA 1B0AA 3Q6IA 2IYZA 3PHLA 1VLJA 4MW5A 5JZOA 5JSQA 2ZUEA 3QE3A 4RCZA 3DOIA 4F1JA 1VIMA 4M98A 3L84A 1ULTA 4IIYA 1P1CA 4F8EA 1N75A 1JT9A 1B76A 3RAJA 3L18A 1CQIA 2PT7A 1P62B 1S0UA 4MI1A 3VGJA 1AKNA 4LRQA 1YULA 5JQWA 5FLKA 3B7PA 3KD3A 3VR5D 3H2SA 1G6OA 4K40A 4EMUA 3VC7A 2HQRA 2PL3A 3AR4A 1Q91A 3G8BA 4F6CA 4RV5A 4D41A 1Z2NX 2C9YA 5DHRA 3Q8KA 4F92B 1D6JA 3DQPA 2XHZA 4DMLA 1CUAA 1OY1A 4X24A 4PWZA 2EYUA 4YMGA 2W37A 3ZWOA 3UMFA 4ASUA 2BR4A 1F8GA 1AV7A 2PS0A 1TLLA 4RVSA 5MFZA 1FPQA 3OWOA 4ZEOA 4IJ5A 1JRLA 1UKYA 2B99A 4PFJA 4XYBA 1XKQA 3RRMA 4TLDA 1G19A 2J5KA 3CBQA 4KQ6A 3Q5GA 1KJ9A 1QVWA 3PG5A 4RHCA 4IGFA 4PAWA 3DR3A 2VTKA 4GUAA 4W8HA 3NCTA 2X1LA 2QL6A 1C2TA 4H4EA 4JJZA 1RWKA 3KQSA 2RGAA 4UZEA 5F2OA 4HV4A 1E3WA 1U7PA 2J6IA 4UOQA 2C58A 3PXEA 5LQJA 1KYVA 2ZI7A 3MMXA 3PUVA 2JI6A 2YQ5A 4AK9A 4GRAA 5LNK1 2YKGA 2JFGA 3NVKI 1QE3A 2VF7A 1KJQA 1NXSA 1PNVA 1R4NA 3B85A 2BFEB 2FGKA 4DV0B 2AR0A 1M0WA 4F3KA 2F8LA 6GPBA 2I4OA 4NLLA 1T8SA 1HL7A 3G2PA 4KO4S 3C7AA 5BR1A 1MC1A 2GHQA 5FORA 1DO2A 1GRVA 4QEKA 5G02A 3IB6A 3A2NA 5GONB 4KPFC 4XASA 1B0ZA 3G6WA 5G40A 1ESDA 2CHGA 1T2CA 4E88A 1GO2A 4LTDA 4H08A 3Q10A 5JD4A 2GKOA 2NGRA 1Q16A 1ZI6A 4FZRA 3TRJA 2ZAMA 3PNBA 2ECPA 3DEJA 1VL6A 5G4LA 4RY0A 2VNSA 1E9FA 1Q3TA 1TZMA 3IT1A 1WB4A 4UNQA 1NV9A 2HLHA 2M1ZA 3C1OA 4NXMB 4Q9LA 4EGCB 4GD3Q 1FPMA 5D2CA 3IE1A 3IJEB 1UBNA 1L7QA 3HB7A 4HYEA 5B1EA 1Z2CA 1CHNA 2Q2VA 2NO1A 5EIOA 2D7JA 4TWIA 3AERA 3GLRA 1IFXA 4D8VA 4GG1A 1BO6A 2OZKA 5CYGA 4HUJA 1Z2AA 5AP9A 1HNWB 1SXJE 2PS9A 1XPRA 3BT7A 3CU5A 3KBBA 2C96A 1OV6A 1QFZA 1YE8A 4L8GA 4P3XA 5BMOA 1AA6A 1NBAA 1RNLA 3OPMA 1IY9A 1DJOA 4Q00A 2CJWB 4ACAA 5D7NA 2ZXEA 4M8NE 3H6KA 1IM5A 2EFYA 3ROEA 3JPWA 4QG3A 4MXDA 3JZDA 4IHJA 4K6HA 4D3XA 2H1IA 3I9JA 1IQRA 4JL6A 4OU4A 2J9XB 3C3EA 3IE2A 4RD1A 1KZ6A 3MMZA 1LBSA 3WRYC 1NW9B 3HB4X 3M1YA 5IWCA 2Q4TA 4I9UA 1J70A 4H7DA 2F7SA 3ADPA 3G7NA 1GPDG 2M6KA 1TW2A 3U4HA 1B8NA 4ZVNA 3E9ZA 4GKVA 2Y4OA 4JL5A 5T57A 4ALJA 4COKA 5JZSA 2CFOA 4ZP1A 1M2VA 4FXPA 3O2SB 1I4EB 1UXIA 3HXPA 4QKQA 3H2ZA 5FO0A 2I8CA 3ZLJA 3MPUA 4G4IA 4NZNA 3SXUB 1YKGA 4FR5A 4YC7A 1DQRA 4YRQA 2GK6A 3ZYZA 5IMSA 4PZUA 4PPQA 1K6JA 3OAAD 1RRGA 3K9NA 3BMQA 4M4SA 4E4RA 2OZLA 5HKAA 1WZEA 3NTVA 4QOHA 4RAQA 4CEJA 1NBEA 3NANA 4CKEA 3LQQA 4NCJA 3ZQJA 5LR6A 1PO7A 3D6VA 4OQYA 1N8SA 3LHSA 2HY7A 5ANRB 1GCOA 3J80A