4AO6A

Native structure of a novel cold-adapted esterase from an arctic intertidal metagenomic library
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
243
structure length
222
Chain Sequence
b'MSWNGKDERKLSVQERGFSLEVDGRTVPGVYWSPAEGSSDRLVLLGHEYIEQVAKLLVGRGISAMAIDGPGTDVVGLDAFPRMWHEGGGTAAVIADWAAALDFIEAEEGPRPTGWWGLSMGTMMGLPVTASDKRIKVALLGLMGVEGVNGEDLVRLAPQVTCPVRYLLQWDDELVSLQSGLELFGKLGTKQKTLHVNPGKHSAVPTWEMFAGTVDYLDQRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
molecule tags Hydrolase
source organism Unidentified
publication title Functional and Structural Studies of a Novel Cold-Adapted Esterase from an Arctic Intertidal Metagenomic Library.
pubmed doi rcsb
total genus 83
structure length 222
sequence length 243
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ao6A00
1JJBA 5ALYA 2D5LA 4C4ZA 3AIMA 2Y6UA 1EB8A 3V1NA 1T4MA 3C8HA 4LXGA 1UKAA 3KSRA 1DWPA 5C8VA 5ALHA 5A7GA 4YASA 1IMJA 4QLOA 1ZIYA 1H2ZA 4ZI5A 5AI5A 5I8PA 4GWLA 4QE3A 1R1DA 5E4TA 1WPXA 3A2NA 4DMFA 1CUZA 1X2BA 3R0VA 4H7FA 3I2KA 5ALZA 3F9CA 1GT6A 3UUFA 4LYDA 5JATA 3FSGA 3ESDA 3OOSA 5CH3A 5JZSA 1YB6A 4AZ3A 2VJAA 2PU7A 3F96A 4UFOA 1XZCA 4B81A 4UHBA 1P0PA 5ALNA 3HSSA 1THGA 1DINA 4X6YA 5AKZA 2WHRA 1N5RA 3ZPXA 3GZJA 2WJ4A 4J0IA 1QIJA 4ETWA 1QIEA 2RHTA 3N0TA 5JD6A 2WUGA 4FBLA 4U2CA 3VISA 4GHWA 2C0PA 4WFKA 2EDAA 1R4ZA 2PX6A 1O6FA 4UHCA 1XRMA 4Q1VA 1IUPA 3W05A 5AM0A 1EINA 3TRDA 4BDTA 3AJAA 3CCBA 1VZ3A 2BUCA 4K6KA 2C4HA 2QJWA 4B80A 1EDEA 2YH2A 1F0PA 3EQ8A 1XZAA 4G5XA 5JD4A 4W1QA 5ALEA 1DQZA 3G0IA 5HCUA 5HQ3A 3KWFA 4P9NA 5JAPA 3H1AA 1WB6A 2GBGA 5AIAA 3WIOA 5ALMA 1CQWA 4X3CA 3WL5A 4RE6A 4MJ3A 4UFNA 1LPPA 1LPSA 3RKSA 1GKKA 4B85A 4KE7A 3WZLA 3MGAA 4TVKA 1F0NA 4GLBA 5CT8A 5CRIA 4Q34A 2VEOA 3QZUA 2YYSA 4DMHA 4Y2JA 4PO3X 2DHEA 4G4IA 5CMLA 5SYMA 3P2MA 5EIHA 2WIDA 2RHWA 1FSSA 5ALTA 3MUOA 1Q0RA 4DNFA 2O2IA 1MU0A 2OQVA 3G9XA 3H2IA 4IHAA 5DYWA 4X90A 2X5XA 2V96A 3O9VA 3AZQA 3HLKA 4Y2UA 3NUZA 4X6XA 5K3DA 1NU6A 2WUFA 1EVEA 4HZGA 2JGJA 3I6MA 2ZJ6A 5DJ5A 1BROA 2WKWA 1D07A 3FYUA 3C8DA 2WJ6A 5ALOA 2GBCA 5FLKA 2ZYHA 2IX9A 1SCKA 3ICWA 3BDIA 4FKBA 4MXDA 5AI9A 2WFMA 3G9ZA 1ODTC 5ALKA 4EY5A 1K6EA 1UK6A 4TPKA 3IDAA 4OB7A 4EBBA 2VF2A 2I03A 4DNQA 1WPRA 2XDWA 3JW8A 2BGNA 1XLWA 4J0DA 3IBTA 2C5FA 1HLGA 4LXHA 4UHEA 2C58A 4HRYA 1ZOIA 5AOAA 3H19A 4N8EA 5IVIA 4NS4A 2W6CX 5E2IA 2QRUA 4P93A 5BV7A 1UZAA 1QO9A 2CUTA 1GQRA 5DNWA 1QIHA 5HF6A 1QIFA 2PM8A 3GBSA 5K3EA 5DYYA 3WK6A 4XX1A 2GYWA 5F4ZA 1WHSA 1IVYA 2BUAA 4NVRA 2XQGA 4EUSA 5LIPA 4FBMA 3G9TA 1UOOA 1VXOA 2P8SA 5CURA 2OGZA 1QFSA 3H2KA 5AM5A 4LIPD 2RI6A 2XLCA 4AB1A 3QMVA 4OUKX 3BIXA 4MEAA 1CUSA 4ARAA 3EF3A 3GROA 5AKLA 3LCRA 2V9ZA 1XRLA 4D9JA 1YA4A 3G0GA 1YSCA 2VJCA 3A6ZA 4U2BA 3AZPA 4PV7A 4ZRDA 5IVDA 3FCXA 4DYHA 5KWIA 2Z3WA 4BP8A 2Z3ZA 5AM3A 4UHDA 1ZD3A 3O4JA 5AK4A 1TAHA 5JYCA 4J3JA 3C45A 5IVKA 4X00A 5A71A 4X95A 1E8NA 3QMMA 1XKTA 4UBOA 2ZSHA 3DOIA 1BEEA 4CCYB 1J2EA 2XMDA 1HPLA 5CW2A 4FFWA 1ZGBA 3G8YA 1W75A 4KR0A 1BS9A 2YXPX 4B6GA 2HRRA 4XWGA 1JMKC 4EZIA 4X97A 1NU8A 1ETHA 1VA4A 1J1IA 4ITVA 2CBGA 4H0CA 4BRZA 5ALDA 1XZEA 5J3JA 1FFDA 5FKJA 2QXUA 5CT4A 4ZXFA 1P0QA 3WLAA 1VJ5A 2JIDA 4G8DA 1GPKA 1UWCA 1E66A 5ALWA 3WKCA 1DX6A 1VE7A 2OGSA 4QLAA 3H18A 3QBJA 1KU0A 4N5IX 1CIJA 5HK8A 2PSEA 3WWEA 1WM1A 5HF9A 1WB4A 3QYJA 1CUBA 4MYSA 3QMWA 2YASA 5AK3A 1HKHA 3AUKA 4QDZA 3RARA 4EA6A 1U2EA 4M0EA 3I6ZA 4EY6A 5ISMA 1IUOA 2PUJA 3C6YA 4ZV9A 2XB6A 1RYYA 5C81A 2ZYIA 3WK5A 2VJDA 1LZKA 3WK8A 5AOCA 3O4GA 2GYVA 3WYNA 3IUQA 2VT6A 5K3FB 2CMFA 4FFVA 4GECA 5LZ9A 1YS1X 2OG1A 1AMNA 2QS9A 2OCKA 4FNMA 3FBWA 3T52A 1XZKA 1CVLA 3WK4A 1Q83A 4WDQA 1OXMA 3H17A 2XUDA 4H7HA 1ZI9A 5LKRA 4YX9A 4XIIA 5FRDA 4RE5A 4W1SA 4K2AA 4BCBA 4UHHA 5ALXA 3WJ2A 1AX9A 2OAGA 1RP1A 3BE8A 4U2EA 3FLEA 1XZIA 3IUMA 2WFLB 4G1FA 4BE9A 1VE6A 3V9AA 5DNVA 3FVRA 3W2TA 4L72A 4B82A 4J0KA 3DL4A 2PBLA 2BUBA 3R40A 2RONA 2Y1KA 2XQFA 3DS8A 3LP5A 3Q8WA 1VOTA 4DSAA 1JKMA 3O4HA 3A2LA 2QZPA 5AKEA 1XZGA 5JZBA 3D2CA 4K5QA 3WWDA 5DWDA 5AHXA 4IO0A 2D0DA 5AP9A 1GKLA 5HZGA 5JASA 1SOMA 1AC5A 1I6WA 2Y2UA 3C5VA 1CRLA 1QJ4A 4G4JA 1B41A 1A7UA 1CUXA 4DNOA 1DQYA 5BWBA 1W6RA 1XROA 1U4NA 1SFRA 3PI6A 5EIAA 4BC0A 5A7HA 3IA2A 1QIDA 4U2DA 1BE0A 1LBTA 4Z49A 4KACA 3KWJA 1HQDA 1P0IA 3IB3A 4CIAA 1E8DA 5ALFA 4FTWA 1YR2A 3EIOA 5EI5A 4OB6A 1W52X 1ZD5A 2GBIA 3KXPA 1WOMA 4BCDA 2G4LA 2R11A 4YK7A 1XQXA 2WFZA 3C87A 1GZ7A 3WK7A 1PJAA 2OGTA 1H22A 2XMCA 4EY8A 1TCCA 2Z8XA 3WK9A 3PF9A 2OQIA 3G7NA 1ZI8A 4ZGBA 1XQWA 5CT9A 1XKLA 1XZLA 3RK4A 4BB0A 4BVJA 5ESRA 5CBKA 4OPMA 3R3ZA 4QDTA 3O0DA 3WKAA 1AQLA 5BWCA 1N5MA 4AO8A 3DLTA 2H7CA 2FX5A 2PSDA 3SC2A 5HQ3B 2OCGA 3GELA 4KE6A 2XT0A 4CG3A 1DWOA 3TEJA 3O9MA 4QDOA 3WIBA 1CV2A 3VJLA 3OURA 4I19A 2GZSA 1JU4A 1WCYA 3K6KA 2UZ0A 2G5PA 1L7QA 4Y2TA 3QH4A 2QOEA 1A88A 4QDXA 2QM0A 1VZ2A 4Y2PA 1HDEA 1MAHA 2I3DA 5AKJA 1LNSA 1R9MA 4H35A 5AICA 1XZHA 2CB9A 1G5FA 4J7AA 3UUEA 2HRQA 1MT3A 2HA0A 3SX4A 5K5EA 2HA3A 5D7BA 1WB5A 4MEBA 4JNCA 1LPMA 3ESBA 1HBJA 3FYUB 4XVCA 1HL7A 3FLAA 2EEPA 5T4BA 4BP9A 3ZLTA 3WL6A 3IIIA 5JADA 4HRXA 4H7IA 3BL8A 4H18A 4RPCA 3F98A 2DQYA 5K3FA 1WHTA 5DLPA 1TK3A 4X7BA 2XLBA 2J4FA 1N1MA 2XUIA 2FUKA 5AK6A 5ALQA 2XUJA 3WKBA 3TGLA 2ROQA 3H2HA 1CUCA 5H3HA 1IUNA 2HFJA 4DMKA 5LP1A 4XJVA 5K3BA 3W9BA 1QIKA 3W06A 3RM3A 1CUJA 2O7RA 2WU4A 5A6VA 3HC7A 3U0VA 1LPBB 2X76A 2XE4A 3R3WA 5YASA 4C4XA 2H7YA 3G0DA 2DSNA 2HDWA 3STXA 2PUHA 3D2AA 2QVBA 1C7JA 1QO7A 2WILA 2HU7A 4LYEA 3D7RA 5LKAA 1W1IA 3WA6A 2Y2VA 4DTCA 4WDRA 5D3KA 1THTA 4AO6A 1KEZA 4N5HX 1UK9A 1XZDA 2BGRA 4PSDA 4UBJA 5HK9A 4WCVA 1CUIA 1JMYA 3I2HA 4KRYA 3SWWA 4W1RA 2QKYA 3VVLA 1K63A 5CXUA 4C88A 1W76A 1EDBA 2DHDA 5JIBA 4L9AA 3HRHA 4FLEA 2OCIA 1TCBA 5AKHA 1AGYA 4B9AA 1IZ8A 5LYYA 3S2ZA 3C70A 1CUYA 1BU8A 1SCIA 1XRPA 4PQEA 2GBFA 1TKRA 4NZZA 2ORYA 1DT5A 1ZJ4A 3I2IA 1MO2A 4IH1A 2HM7A 4F5ZA 1R3DA 1YASA 1XRQA 1USWA 4MQLA 3F8SA 2JBWA 5D3ZA 4Q82A 1UXOA 2XUPA 3OC0A 3ANSA 2HU8A 2WHQA 1GXSA 2GYUA 1EXWA 4JEIA 1PV1A 5HFAA 4CG2A 3ED1A 3VKFA 1GQSA 1XZMA 3C5WP 1EK1A 2JGIA 4MWSA 5ALSA 4BZZA 1ZICA 1CUUA 2HU5A 1C4XA 2HA4A 1F8UA 4BAUA 3B12A 4ZWNA 1Y37A 1JJIA 1FFAA 4X92A 3IUJA 4OU5A 4A16A 5EHNA 4BAGA 1QIMA 1B6GA 3OG9A 4KAAA 3I2GA 1NX9A 1L7AA 3CN9A 1H2YA 3UMJA 1VKHA 4AX4A 2VAXA 2WLSA 3D2BA 3L1HA 4S0XA 2G63A 5CT6A 3BF8A 4E46A 3E3AA 1XRRA 1BN6A 5K3CA 5ALRA 5HF8A 4IH9A 2ACKA 3BF7A 5JAOA 3ZLUA 2XMRA 4J0CA 5LZ5A 2VATA 5FOQA 3HACA 5I9IA 4ZV7A 1A8QA 2ECFA 3NGMA 2BKLA 1XQYA 2AJLI 3QITA 3PFBA 1TCAA 3I2JA 3IUNA 2B4KA 2DCMA 4H7KA 3E0XA 4BVKA 2PKYX 2WJ3A 1XFDA 3K9BA 2GZRA 4QEKA 5CXXA 1DWQA 3BJMA 4W63A 5I7UA 1GPLA 1CFJA 1YCDA 3HZOA 3WL8A 2VTVA 2WSLA 2I3ZA 1E8MA 4GW3A 4J03A 5C7YA 4MQMA 1UT6A 3O95A 1MJ5A 1JU3A 5JARA 1E3QA 4BTVA 5K3AA 2WIJA 3ZI7A 1DX4A 4P92A 1P0MA 1MPXA 2PU5A 2HA6A 3F97A 4KEAA 2HA5A 3WJ1A 3WZMA 2QTBA 4GEGA 3PF8A 4H7EA 4ROTA 4CCYA 2WUEA 1YAHA 2NW6A 4BDSA 3NWOA 4C87A 4A23A 2AJDA 3FCYA 4LHEA 1CEXA 2WQZA 3AIKA 3IVMA 5CT5A 1X70A 2C0QA 2WM2A 1TIBA 4AZ0A 1MNQA 2BFNA 2J4CA 1N8SA 1QZ3A 2DFPA 4H77A 1UKCA 2ES4A 4Q05A 4BATA 3A2MA 5FV4A 1T2NA 3WWPA 3QPCA 2PL5A 4Q3KA 5DTIA 3QPAA 4W1PA 2CZQA 5AM1A 3DL7A 1XZJA 1GPNA 2J3QA 2B61A 1OILA 1AZWA 1CUVA 4OU4A 1CR6A 1ORWA 1OCEA 4DM7A 2OLEA 2XUFA 4Y2RA 4DNPA 4G9GA 5BOVA 4E11A 1QIGA 1SC9A 4QNNA 4UHFA 4X6UA 3MVEA 5LZ7A 3STUA 4F21A 2ACEA 2OPHA 1H2WA 4P08A 5AKGA 2WU3A 4BZWA 3DOHA 2XI4A 4O08A 4CIBA 3KDAA 3D5EA 3VXKA 3VJMA 3G0BA 2WUDA 2O2HA 4BYMA 4HXGA 5FDFA 4WFIA 5AI8A 3I6YA 1MN6A 3FWHA 5LZ4A 5DYTA 3D59A 3S8YA 5CTAA 4BC1A 3E4DA 1XZBA 2ZYSA 3H1BA 4RGYA 5T4HA 1DU4A 5E4JA 3W04A 5EHXA 5AK5A 2FJ0A 4F60A 3ESCA 4G9EA 3DQZA 2VT7A 2H1IA 3F67A 4FWBA 1JFRA 2WIFA 1H2XA 3STVA 1CUAA 4Q3OA 5LZ8A 1GGVA 4C4YA 5LZ2A 1QONA 3FNBA 3H2GA 5JANA 2XMBA 3O4IA 1FFBA 5AKIA 3GUUA 2IITA 4M0FA 4N8SA 1DT3A 4FLFA 2JEYA 4K6GA 5FPPA 1AURA 2AJ8A 1BEZA 4UBLA 4I3FA 1Z68A 4FDMA 3M3DA 1XRNA 3D3NA 3DCNA 2LIPA 3G02A 1BCRA 4C89A 2XMZA 3WI7A 4OD0A 2Z8ZA 2HFKA 2OCLA 3D0KA 1JI3A 3QPDA 3WWCA 3DD5A 1ZIXA 3BDVA 4QWMA 3H04A 5HKAA 1Y7IA 2PSHA 2X8BA 4WFJA 1CLEA 1ZD4A 4A5SA 3WQHA 1QFMA 4B84A 3I1IA 1FFCA 4DLNA 4FHZA 3HJUA 1R50A 2RGUA 4L3WA 2ZJFA 1XLVA 4G8BA 2JEZA 1MNAA 4OSEA 4AO7A 1CUWA 5HF5A 1TQHA 2XMQA 4BVLA 2QJRA 3ZLVA 5A7FA 1ZI6A 4H7JA 3BWXA 4NMWA 5T4FA 3AINA 4YPVA 4Y2XA 2WFLA 4J0GA 2XUAA 2VA9A 5EHQA 3G9UA 2PPLA 3PE6A 2XQKA 5ALPA 1BRTA 5JZ9A 3C6ZA 4KJXA 5KWJA 2WIGA 1YS2X 2J3DA 4BTLA 4BBZA 2XMGA 4CG1A 2XUHA 3B3QA 3C6XA 1ORVA 3ESAA 5A2GA 2RIPA 3FOBA 4FMPA 3HXKA 4G4GA 2JGMA 4X85A 4WY8A 1EB9A 4GXNA 2QUBA 1Y7HA 2JGEA 4K6HA 3KD2A 3FAKA 5EFZA 3STYA 5AM4A 3L1JA 4QDUA 1RWQA 5ALUA 3V1MA 5SYNA 4KRXA 3K2IA 4LKOA 3AILA 1UOPA 4ZREA 5JAUA 1U65A 3I2FA 1Q0ZA 3ANTA 5DNUA 4J0JA 2I78A 1QE3A 1CUDA 4B0OA 5AM2A 4IH4A 5FXMA 3FYUC 1EX9A 4EB0A 5IVHA 5DTJA 1LPNA 3GA7A 4PNZA 1EHYA 4PW0A 4QZVA 3CXUA 3N2ZB 3BXPA 1MX5A 4U2GA 4ARBA 2WTNA 2HA7A 4TGLA 3JYHA 4N8DA 1IZ7A 3L1IA 4KYVA 3HEAA 2VQ6A 5CH5A 4OCZA 2CEKA 2BAGA 3DDUA 3CCCA 4W9RA 3FYTA 3QVMA 1YAJA 5KREA 1E5TA 3SK0A 3ZV7A 2CJPA 2AJCA 1PFQA 1CUGA 1EK2A 2AJBA 5C8XA 1K8QA 4Y9SA 2VAVA 4KE8A 3OM8A 4H7DA 4B0PA 5AKKA 1L7RA 1ACLA 3DNMA 3AZOA 4OB8A 4HXFB 2JGKA 2HL6A 2RAUA 2WIKA 2VSQA 3R3UA 2PVSA 4L0CA 3V1LA 4Y2SA 3BIWA 3STWA 2Z5GA 2QR5A 1XZFA 2DHCA 4CI9A 1CPYA 4FLMA 4JYPA 3LIIA 1UK7A 4Y2VA 2XUKA 4QWWA 3M81A 3QM1A 1VA5A 4B83A 1LBSA 3LLCA 4E15A 4PF1A 4GBGA 4AN0A 4Y2YA 1DTEA 3FVTA 4IQ4A 2G5TA 1SCQA 2Y6VA 4DMCA 3DKRA 4B7ZA 3LIPA 3W9UA 1CQZA 4UUQA 1H23A 5ALLA 3FSGD 2WG0A 4Y2QA 4BCCA 1ZJ5A 2OXEA 3ICVA 1QTRA 2DR0A 3WKEA 2EDCA 1MX9A 4HS9A 1ODCA 2DQZA 3DKKA 2ZJ7A 2WTMA 3WYDA 4WJLA 2XQJA 3YASA 3Q0TA 2QMQA 2JGFA 1KU6A 1UOQA 1LLFA 1QGED 2AXEA 1QTIA 1QLWA 2ONCA 3EBLA 5AH0A 1G42A 5CH8A 1X2EA 5ALGA 4AN1A 3U1TA 2R8BA 5ALIA 2WHPB 1Q84A 4INZA 5FP0A 1UFOA 3LS2A 1LPAB 4GDMA 5IKXA 3H2JA 3CN7A 5EIEA 1BCSA 1XQVA 1JT2A 3HYSA 3EQ9A 3G0CA 2JGLA 2OAEA 3OPMA 4JUIA 1ISPA 3WWOA 4C01A 3AFIA 5AIBA 3WKDA 3M83A 4UBMA 1O6GA 4DSZA 4X93A 3X3HA 2WG1A 4QA9A 3C6BA 6YASA 2QUAA 4AMYA 2O2GA 3R41A 3BJRA 4MYDA 4CCWA 2PSJA 4GI1A 4JH0A 5AOBA 1AUOA 5EGNA 4HXEB 4OYYA 2E3JA 2VJBA 5AKXA 5ALJA 3R3VA 2BCEA 4X91A 4AXBA 4LXIA 2H9YA 2XUOA 3R3YA 2HIHA 4UBKA 3AIOA 2JF0A 1A8UA 3WA7A 3RLIA 1K5PA 5JD5A 3PUIA 4X94A 5A62A 1EDDA 4UBNA 4G8CA 3OTQA 1E89A 1S8OA 4MWTA 3DYVA 4UFPA 3STTA 2V98A 2FJPA 2V97A 2W22A 5AI6A 2QXTA 2XMSA 4FNGA 5D6OA 3D4LA 7YASA 1MAAA 1CUHA 1UK8A 3E1GA 5AO9A 3ILSA 3VVMA 3WMRA 1LZLA 4PSCA 2ZSIA 5AJHA 5KBYA 4U2FA 3KOOA 2C5GA 1LGYA 4J0HA 1MTZA 4JYMA 1YB7A 2IIVA 4UPDA 3V1KA 4BAZA 3FLBA 1UKBA 4WY5A 4B9EA 4HTAA 5T4EA 1EA5A 1ODSA 3C43A 1CUEA 4EHBA 1W4LA 4KAFA 1A8SA 4PSUA 4I4CA 5FPQA 3A70A 5EHZA 5FUMA 2XUGA 3PFCA 2HHAA 4X71A 4EY7A 1EVQA 1JJFA 1U8EA 4M0MA 1EI9A 2Q0XA 5HKBA 1AKNA 1ACJA 4EY4A 3I28A 3VJKA 5AKYA 1QIIA 3ZWQA 5C8ZA 1G4HA 1VXRA 3JWEA 4KE9A 4Q3LA 3IURA 1TRHA 1MX1A 1ZD2P 3R3XA 2B9VA 2XQIA 3WL7A 2HA2A 1R9NA 3VDXA 4HVTA 1M33A 5HFNA 1LPOA 5JAHA 4C6HA 1CUFA 5IH7A 2XUQA 2O7VA 1J06A 4AMZA 3PUHA 4V2IA 4DIUA 3HI4A 1FFEA 3EQ7A 2C7BA 5JALA 5AI0A 3DYIA 1F6WA 2ZVDA 3PDCA 1R88A 1BN7A 4KAJA 3M82A 1YA8A 1EH5A 1G66A 3DJYA 3GFFA 2CKMA 1ZGCA 2HADA 4DGQA 3V48A 3MUNA 5E4YA 4FOLA 1C7IA 4BE4A 5ALVA 2ZYRA 3DEAA 3NOXA 2WG2A 4HAIA 2H7XA 1J07A 1K4YA 3PICA 2B20A 4Y7DA 5LLSA 4E14A 3T4UA 1XLUA 5AI4A 4CFSA 2BJHA 3TJMA 1VLQA 4BRSA 4OYLA 2WHPA 2QT9A 3HABA 3B5EA 4F0JA 4UBIA 1QOZA 2PSFA 3H0CA 4AQDA 3I1YA 4RNCA 1FJ2A 3IULA 2K2QB
chains in the Genus database with same CATH superfamily
1H6AA 3CPSA 4U63A 3ZZTA 1UF9A 1S0UA 2HPZA 2P9HA 3N2KA 4MW7A 4ZU1X 3AMVA 3IPXA 5L3SA 4CV2A 3NV7A 3B13B 2J67A 5PGMA 3NXKA 1UPTA 3NM6B 1NR7A 4HBGA 5JCJA 3EZNA 3HMQA 1BWPA 1QH9A 4U3JB 3KQLA 1KYTA 1W5SA 3A9RA 2XSZD 2PNFA 1L5SA 2B30A 2K6GA 2XNDD 3B3GA 1M66A 1YB5A 3GCXA 4IIHA 4ZVSA 3T95A 2VUIB 3C6QA 4MKRA 4Q4CA 4ZI7F 1NR1A 1BW9A 1Y5LA 1UKAA 3EOAI 5C8DA 1P2SA 2TMDA 4GOND 3W3AH 2ZRMA 1S02A 3DVSX 1E99A 1XF1A 2JFYA 4YASA 3IAFA 4TMTA 1IMJA 1QV6A 2R66A 2FSIA 3H3FA 3NJ4A 2BVNA 4C43A 4BEWA 5IABA 1H2ZA 1WAMA 4B6JA 4YUXA 1Q15A 2H92A 3ECSA 1ZIPA 4GWLA 4QE3A 4CBVA 5J2UF 2I2BA 4G5GA 4MS4B 2BGMA 3PLAE 4P8RA 1KFBB 1X3SA 3P2OA 2OCYC 1QTQA 1WWKA 3AVPA 2G0TA 1WPXA 1Y5IA 3VJRA 4PY2A 3PGJA 3MAAC 3Q85A 5AMXA 3QYFA 1SG0A 1T2VA 3C3EA 3QVUA 4TTQA 2NVWA 2PEZA 2WYIA 5CTJA 4CT0A 3ZWBA 1HYEA 3BULA 1PFUA 1MJFA 3R0VA 4Q7MB 1CS0B 1DE0A 4WADA 1SHLA 1P60A 4BX3A 2B1IA 5JATA 3OJCA 3P97A 3GZNB 4IX1A 2XD4A 1T1GA 4IDEA 3H16A 5K7SA 2O8VA 2FW9A 4AZ3A 5BWMA 2Z1MA 3ZD8A 1JJ7A 3QV2A 4BGVA 5BNZA 3H2YA 4DUGA 3F96A 1MAVA 3QGMA 1PR2A 1K08A 1LI7A 1NI3A 2GEBA 3CIFA 4U02A 5C80A 1Z0DA 4CL2A 4RL6A 1P0PA 3DBVO 1VECA 3I0NA 1BXZA 1SIBE 2OGWA 3CNHA 1ZY2A 2ZXFA 3H5VA 2R6DA 3JARA 4GMFA 4XE5A 4EB6B 3OO0A 1I30A 1THGA 4BS9A 2CF6A 1KEPA 4X6YA 2ZE6A 3GDWA 5AKZA 2WHRA 2H1VA 4R9VA 3HDQA 4CMBA 2ETVA 4J0IA 1SQ0A 2AMLA 4AMBA 1E1RA 2F8TA 4Q7QA 4MGYR 3V7WA 4HN2A 1QOPB 4M37A 2NU8A 3AEKA 3G8AA 4GWGA 4LHXA 4MW9A 5KQMA 4XZ3A 2FPGA 1L1FA 1CP2A 1M0SA 2YWHA 1GQ2A 3U56A 3JVIA 4G97A 2EEZA 4GHWA 5H3LA 3RWMB 4FJ0A 3R8XA 4P31A 3WTBA 1SC6A 4LJ8A 1NLFA 2ZJ1A 4MV8A 2PX6A 1R4ZA 3U39A 5DGIA 2C31A 5JI3E 4X44A 1G6Q1 3OZ7A 2QM8A 4RL4A 4QOFA 3VKUA 1IWPB 3F0TA 4NNOA 5E3IA 1EINA 3LUGA 1I5OA 5H02A 1IFXA 3WB0A 3UHFA 2G06A 1E7SA 5CYFA 3TKYA 4ENUA 3P9CA 5HYVA 5CHYA 3TZBA 3G59A 5ARCA 5H59A 4Y7CA 1TA9A 2C4HA 3M6FA 2QJWA 4HSGA 1EDEA 1Y5MA 1K7EB 2YH2A 2AQKA 3DFMA 3OFND 4YBZA 1JEYA 1R5NA 4US1R 4EQ6A 3PHBE 1QQAA 1QS0A 4G5XA 2NU9A 1X9GA 4CLOB 3CNLA 5FO0A 1D7AA 1TE2A 1Y6JA 3H6KA 2ZSAA 1GLVA 3GLUA 3ND8A 4X7RA 3S5UA 4B87A 2PJRA 3BAFA 4MAMA 2W6OA 3L2OB 4Y8VA 3VV2A 2CYCA 1BD4A 2PLFA 4DYVA 5KU7A 4Z9XA 1KQ3A 1TO1E 1X9IA 4I2NA 2BISA 5TEWA 5T41A 1FNCA 1MR3F 1DNPA 3AW8A 1W87A 1ML4A 3M6LA 3LQFA 1PEDA 3NTVA 5EKXA 5AIAA 1PLKA 3RTGA 3MTBA 3MJFA 1P29A 3AEQB 1B76A 1KMNA 3K9WA 3D81A 2FMTA 3IMFA 2CC2A 2JLVA 2YHAA 2VSNA 1B15A 1CQWA 2I3AA 4QGAA 1Y8RB 2YN4A 2G17A 4ENSA 2PTGA 3PNVA 3LK6A 5A1JA 1OBOA 3IODA 1UBRS 1LJ8A 4P7JA 3WNZA 3Q8XB 3CZ5A 2DWQA 2GTIA 2JZOA 4Q9JA 4MO9A 1TFUA 4RE6A 5FNZA 5F51A 1T0JB 3OIDA 1U11A 2X42A 3RHTA 3ML1A 3OLWA 4B3HA 4QM7A 4JCCA 4FHEA 3TW4A 1Z0FA 5JMOA 1TU4A 2O8DA 5L7TA 2JCSA 3PIRA 4Q1FA 2HMTA 2PUWA 4CM7A 1HMPA 1Y80A 1KO7A 2PX3A 1ONNA 3E3OA 4IIVA 5C4GB 1HX7A 2E4XA 3GRAA 5CLHA 3W3AA 1ZK2A 4GLBA 3VPGA 3FNHA 3A1SA 5BOSB 1I24A 1RJDA 1A5TA 5CRIA 1MAUA 2AS0A 3GDHA 3C6KA 2IHNA 2C2MA 1OFVA 3EGDB 3PUVA 2ERCA 2QN1A 2VJOA 1D04A 3AI1A 4JA0A 1D9XA 4PPGA 2QN7A 1NQXA 4MJ7A 4Y2JA 4EBFA 3VNUA 1G8KA 1N2ZA 2Q07A 5CMLA 1GPMA 4QEDA 5SYMA 5FLEX 5COAA 3SVTA 2ZRHA 1HY3A 3H1FA 2XVMA 4MCHA 4Q03A 1WLYA 3KZ1E 3GPBA 4ER6A 1CZNA 5BYBA 1CSEE 5K8UA 1Q0RA 2VHVA 1T6BY 5F7XA 1KPIA 1JWLA 2A0FA 3OE7A 1XNGA 2PPVA 1R0CA 4Y6SA 3MWFA 1MU0A 3C3KA 2D2XA 3H2IA 1VP9A 5DYWA 1AUQA 2ET6A 3H2SA 4X90A 4R7ZA 3AM1A 3AZQA 3HDTA 1VBFA 3NUZA 4HUJA 5TNXA 1ILEA 1GARA 4Q19A 4O4HB 3AETA 5K3DA 1NU6A 5LD2C 1EVEA 2BGKA 1CVIA 2ZPTX 2EATA 2JGJA 4M7WA 2DZDA 1W5BA 4I66A 2F4NA 4D9GA 1NVDA 5JYEA 1XOIA 1T0HB 3V4PB 4R83A 5IYZA 4JLSA 5JTUA 4WXPA 1BQ3A 1TA4A 2E55A 3DNPA 3ESRA 3RKUA 1RWXA 3RC3A 2UUBB 3AOEA 2ZYHA 2DJ5A 1ZSVA 3I52A 3JR3A 4GX0A 1J0AA 1IZ9A 2IE8A 3B2QA 4OHBA 4TMXA 1UZMA 1IBRA 1ZIDA 2A86A 2OFFA 4L6CA 3A0RB 2JGRA 2QUKA 3FTDA 3GLVA 3Q11A 4JB8A 4KQJA 1SCNE 4MXDA 1BVHA 3SGLA 2B4QA 3G9ZA 1YE5A 3DTYA 3L0CA 3S28A 2WQ7A 3LO5A 1CJSA 4PYRA 5G3ZA 4E33A 1EJ2A 1KI4A 4LSWA 3AUYA 4PAGA 3TIGA 4GE3A 2Y1WA 4TPKA 1BU5A 1LRLA 3MLAA 4QJ5A 1NQWA 3IDAA 2PQ0A 3L7OA 1IHPA 2C00A 2I03A 2VF2A 3K0BA 5LPNA 1YQXA 2LCIA 5GWXA 1V47A 1U7WA 3TO5A 2BGNA 1DELA 4XGRA 1GPUA 3IBTA 2BZSA 2V5VA 4HH1A 4W9NA 5JAMA 1Z4PX 1WMEA 3E3LA 3L8EA 2JFBA 3H19A 3PKZA 3NM5A 3KYDB 4X7MA 4BN4A 1L8AA 4OTZA 4GRIA 3W5IA 2VH1A 4BLWA 5E8RA 2YBDA 3F6PA 2REXB 3GDFA 5FYDA 4BO6A 3HY3A 2P7IA 5FJIA 3OCJA 3CRRA 3OMXA 4O2AA 3IIKA 2QRUA 2QSYA 3B5IA 4MIOA 2ZIUB 5ENZA 1EFRA 3OWOA 1OT5A 1Q0PA 2ZS8A 4R05A 2CW5A 1RRFA 1UZAA 2CUTA 2O5VA 5JQGF 1I33A 3GVHA 3BYZA 1F7UA 5DGTA 4FMCF 1KFCB 4D44A 4D2IA 3G3EA 5DNWA 1T2FA 5LU8A 1QIHA 2HZ7A 4RPGA 5KU1A 4TTIA 4MWDA 1E1DA 1KJ8A 2GJKA 3H4TA 4G4SO 2AYYA 2C5HA 2OR3A 4GOJA 5DK4A 1SK8A 4JLVA 2CFIA 4P2BA 1U2DC 2AW5A 3DV0A 3KLPX 4DBLE 1UDWA 2V9PA 4E12A 1DIAA 2IK8A 2MT9A 1YI8A 3OEWA 1DXHA 4IJ5A 3L6BA 1KAMA 4KLAA 2UUCB 3S8MA 4EZBA 4QSMA 4UREA 1S8FA 2RC5A 3PQ2A 4N18A 4PLFA 4ZK2A 3JVUA 1CJVC 3MN1A 4IV0A 5KWSA 1X1SA 3Q2OA 4IJVA 2IS1A 1H4VB 4URWR 3ZE2B 3LBYA 5KNCD 4CLEA 2CEAA 2OHJA 3A1TA 5B12A 1NE2A 4YJ2B 2GB4A 3P4UA 1KP3A 5L3SB 4B4VA 1Z29A 1UOOA 5CURA 2XT9A 6Q21A 2QLJA 5F64A 4KI0A 1OH8A 1CS0A 2I54A 1ENPA 4DSUA 2NU8B 1QFSA 4PZDA 1SHJA 1X1AA 3I73A 4TYNA 1MJNA 4FIZA 2FE4A 3OP1A 2X1VA 3P2YA 4Q9NA 4AJIA 4D6PA 5BN4B 1RFLA 3L0OA 4BO9A 1E2QA 3JQAB 4HUQA 4AY4A 1VJCA 4PCAA 5AHRA 5A3JA 4JI4B 2EQBA 3TEFA 3FVQA 4C21A 4MVJF 2HEIA 2DQ4A 2RGEA 2XOKA 2VRCD 4C2AA 5IHXA 2A8YA 2CCGA 1H93A 5DI3B 1FX0B 5BPFA 4CTOA 4EL0A 1YUNA 2NSYA 2D0PB 2E87A 3EF3A 4CR7A 4LX8A 5AKLA 3FUWA 1NLMA 3COZA 4C3UA 2F9LA 2DR2A 4FE4A 3N53A 5B2FA 2VS1A 1M0TA 2HWXA 1BFUA 3IEVA 2Z09A 4IJ6A 3MYRA 3SEZA 5DNCA 1UBMS 3JQCA 1XRLA 3P0RA 2UXDB 1T9GR 4XH9B 3UWMA 2X2EA 3G0GA 4RM2A 4MTCA 1NF8A 4GI5A 2VJCA 4H3SA 3MSXA 3PE4A 3M3HA 4PV7A 4MROA 3O4RA 4ZPXA 2Q9UA 1YRQA 5EVJA 5EJ9A 2WZQA 5IVDA 1SZPA 2GKSA 4X1IA 4A2QA 3RW9A 1E6UA 2C42A 3ZDQA 5C5CA 3FCUB 1BMTA 2P5UA 1MT0A 2K87A 4NBRA 1X1QA 2H85A 4MDHA 2HNKA 3RO7A 3CGGA 2V3WA 3U3DA 2R1VA 5B3AA 4QU8A 5B4VA 1BFDA 1RBMA 3TJRA 5DI3A 3O4JA 2C88A 2WSMA 2L82A 3OT4A 5K01A 1MG5A 4L5IA 1FCJA 3C45A 3BXGA 4OHPA 4QFBA 2FOLA 4FYWA 1KNQA 2XGMA 4X00A 3KB8A 5BYJA 1ADCA 2DPYA 5LN1A 2GN6A 2ORVA 2HX1A 3EQZA 5KHLB 5KOJB 3AKZA 3IQXA 1LS1A 2IPOA 2YJ5A 4IUCS 1I3CA 1OIXA 3A4VA 4X95A 1K75A 3QMMA 3SBEA 1ECJA 1KVRA 2ZSHA 1BGXT 2WWHA 2J0QA 1FRFS 4JI0B 1OFIA 2SICE 1FDOA 1T4GA 1THZA 3INTA 3WWYA 5BV1A 2FSUA 2YWXA 3LCVB 2DPGA 3T15A 1SBIA 3OTHA 1TCUA 4HB2A 1J0CA 1TQ2A 4G81A 3ZV4A 4GO1A 4MUMA 3F73A 3G8YA 4MP8A 3VOBA 1W75A 1FVFA 4Z9YA 1MO3A 3K2EA 3W6UA 4D9FA 4DXHA 1WEKA 1ZNYA 3DMNA 2HRRA 3PGXA 3DO6A 2M6LA 2QY6A 4LDJA 3SNHA 4AJEA 2DKNA 2CUZA 5DU2A 4QUGA 3DR5A 4X61A 3FPHA 4Q39A 3QEOA 2PKWA 4ZAWA 3LFHA 3QE9Y 3L8DA 1KEEB 1JG6A 2QTTA 1AHIA 1ZNWA 2R1VB 1NU8A 1D6MA 3U37A 4AT1A 4P53A 2AR9A 2PGIA 4TUYF 4CUKA 4HEQA 4ITVA 1NFRA 2CBGA 2V0CA 4G23A 4IEIA 3HSKA 5EJ5A 2GEDA 4I4NA 2W70A 3VQTA 2HXGA 3AJ8A 2VZLA 3FKJA 1YFLA 2O8DB 1DUIA 1QH0A 3F7MA 1TU3A 1MTOA 4WXYB 4YB8A 5EUBA 4UM8B 3EC2A 3M8KA 5F73A 4FWTA 4KR6A 2UXBB 4A7PA 2X5KO 1ZL2A 5JSZA 1C81A 1PQPA 1YKSA 1VJ5A 2PJZA 3PUWA 3ZGZA 4F11A 4JROA 3EXHA 1C5KA 3QELB 2X0IA 3DEHA 4RTKA 2BBWA 1UWCA 2GCEA 4TLAA 4WGGA 2BFFA 4J2HA 1DX6A 4UQOA 1G5RA 4KGDA 4R0MA 4C9BA 2HV8A 2YMLA 3W2EA 1USUA 1ZGGA 3HPRA 3TRIA 2BV3A 3CSUA 4HAUA 1VE7A 2OGSA 4V0MA 2COKA 4G0XA 3GK3A 1ST2A 3H8WA 4LJSA 2XYVA 4OH7A 1E0SA 4N5IX 4DR6B 1AK1A 2QRVA 3I9MA 1A76A 1Z8HA 1CIJA 4GPD1 4WLOA 1FRQA 1G0NA 1RWOA 1OC4A 3LQ2A 5AFSA 4EWLA 2PBRA 3F78A 3G6KA 2B1QA 3FVWA 1Y63A 1ZMOA 1WM1A 1ISRA 2R5WA 4V24A 4YPOA 2BC9A 4MULA 3TIIA 3LUAA 4RFVA 5CFZA 4ENWA 2C4VA 1XZQA 4MKFA 2JIZD 3PT5A 3OZGA 2PH7A 4TRJA 2CNWA 2X5OA 4GGPA 4H27A 1L5MA 3BE6A 2FCRA 3WAKA 1ZUNA 3R3SA 3EPJA 1U0JA 3T8YA 1A9XA 1JSRA 2YL2A 1TEVA 3IP3A 3ND7A 4HQ0A 5ECDA 3SJAA 5G02A 4MR9A 2BSAA 3CWCA 1OAAA 1BA3A 2OD2A 3HCEA 1I5EA 1Z45A 2O2SA 2B7LA 2PUJA 5JAZA 1FSPA 4HH0A 4AZTA 3ZYCA 4ZKEA 4MDEA 3VNAA 4OFBA 5B6PA 3WK5A 4F93B 3LE8A 3EVNA 1A3CA 1E2PA 2D13A 1RCUA 1YCGA 2CL6X 1T8TA 5TQ2B 3K6SA 1NAIA 2ZVPX 3U81A 3VX4A 5JFTA 2BFCA 5JDCC 5GJBA 2W42A 1PJBA 1SA0A 1JIQA 3P9SA 3UF0A 4CHTA 2BI8A 2HKIA 3OQOA 4DGSA 2F1HA 1HT3A 2ZWIA 3O94A 3PC2A 4BFUA 4M1TA 5DRTA 4XM1A 1BFKA 3C85A 3D1LA 4GECA 4MWEA 4NJMB 5DGDA 1M2EA 3SI7A 4CMGA 4PRKA 5CCDA 2ZCUA 2YHIA 2OCKA 1RCFA 4D8VA 1M10A 1ZO8A 2EBUA 2EGUA 5JJKA 4P6VF 2ZGVA 4WLEA 3D7NA 3BKXA 4XGQA 1OXUA 4EZIA 2GZMA 3EGXA 4MA0A 3V8QA 3VOTA 4TL8A 4ZZ1A 2IUEA 4FZVA 3DHNA 4MMYB 1T36B 4GYYA 1M76A 3LI2A 2BTQA 2PR2A 3QBEA 4XIYA 3HZHA 1P7CA 3BFJA 4XWYA 3AEUA 1Q83A 2JH3A 4JAVC 2DWCA 2G76A 1N5LA 1UH5A 4L9RA 4PNHA 5M04A 2O5RA 4X0EA 3TD9A 4CQLB 1KI1A 4BNZA 4YX9A 4OJNA 4PS0A 2NXEA 1VG8A 4RTOA 2VYFA 3D3KA 3TINA 5FRDA 3RSZA 1PR0A 1EM6A 1RXEA 2M2IA 2FWAA 3WGHA 1B00A 2E4ZA 1VKRA 1GL7A 3CF4G 3E9RA 4I36A 3BVPA 3EB9A 2W2MA 1OI3A 4K2AA 5KTTA 2OL4A 3FHJA 3OD1A 4ZDIA 1QFXA 5CDHA 4UHHA 8MHTA 3PJFA 3DDHA 5A4IS 4JSRA 3X44A 5ALXA 3WJ2A 3EUEA 4QGGA 1RP1A 1SZJG 3DVAB 1YU9A 4IGIA 1R0RE 4G1VA 4RLQA 4UCFA 4IEFB 3SHFA 3HK2A 2W48A 1QZZA 1MABA 4Y6GB 4YV2A 3BHJA 1KVQA 1HEIA 4UM7A 2RBKA 3T7KA 1C0LA 2GWRA 3HDJA 4GSKA 3UYKA 2WFLB 4URYR 4N7JA 1NW9B 6AT1A 1R5BA 2ZRIA 2CBZA 4IFBA 1VE6A 3GLSA 4TM7A 1FMJA 2R8EA 3KJFA 1TVKA 5DNVA 2XXAA 2JI9A 4XKJA 3DLIA 2CE2X 2LDBA 3KLNA 4KQWA 2FEKA 4YP1A 4CJXA 1EQUA 1YQWA 3GLIA 2Y0BA 4MIYA 2XY4A 2GI4A 3GLHB 4RSHA 2YJNA 2PGAA 3QKSB 3L7BA 1GZVA 3MTJA 4J0KA 3MMNA 4QOEA 4HAZA 5BN4A 2HMWA 4ZMSA 4AIIA 1ZISA 1JQ3A 2ZE8A 2ZWMA 2BUBA 1UJ2A 3FI0A 3VTAA 1RQXA 5JS8A 3AFMA 4IRUB 2IHBA 1JEJA 1Z0AA 2OESA 2YZGA 3ZDXB 2F4VB 2A94A 4DSAA 2BYTA 5DULA 4YRSA 2IGBA 3A2LA 4KDFA 2ZTVA 4EG5A 3BD8A 1NW4A 2FWPA 1MAWA 5JZBA 1U3DA 2YW9A 3D2CA 3EQ6A 2YFKA 3R6TA 5FOVA 4JI3B 3R4VA 3SDSA 2ZOSA 3LCMA 3SY8A 1YQQA 3IT0A 3WGLA 4ZGWA 3UMMA 4UD6A 4MICA 1MHTA 3KUXA 5JZOA 1HA3A 4YMWA 5LP6B 1AC5A 1EG2A 1I6WA 3C5VA 4HXYA 3I4CA 2QD1A 2QSZA 2WT9A 5KX5B 2OKCA 2FUG6 1MJGA 1B41A 1DC4A 1FS6A 1QRTA 4EK9A 2X19A 2I7XA 1E1YA 3EEOA 4BBJA 4HDMA 4NE7A 1O5IA 1U0GA 3PIIA 2WIBA 4HH4A 1FQOA 3USCS 1DQYA 1M1YB 2VUSA 4RBNA 5CXSA 3ZJ5A 2Q0SA 2VTKA 3NI2A 1XROA 1ZU4A 2PLAA 2ZJBA 2ZR9A 1F2VA 9GPBA 4XB1A 4FB4A 5EIAA 2GPNA 4BC0A 4O8ZA 4CETA 3AF5A 3R3HA 1E20A 2DGDA 4G0VA 1BDBA 3GP8A 1OKKD 1T5HX 2C98A 1ZINA 4L7QA 4NAHA 4QYSA 3O90A 1E58A 3GA5A 2OA0A 3TLGB 4EI8A 2H6EA 3RTBA 4QPZA 3ON5A 3MT0A 1YMVA 1G38A 2HYIC 2OENG 3VTFA 2DR3A 4ISCA 2ID8A 2H48A 4WZAA 5AJVB 4ZI2A 3PGKA 3AUAA 3NU1A 3CC8A 1IM2A 4N3AA 3T7SA 3X1YA 2KSQA 5JDIA 3EASA 1UBLS 3W7VA 1G1MA 2ODAA 3PXBA 3VZQA 3BH0A 4OI2A 4GPEA 2N1MA 4W4TA 4V0QA 5I4CA 5JYDA 2CWWA 2YNMD 4MW5A 1JE1A 4YJ2F 2VJNA 3CKLA 1ZD5A 4OB6A 4OL0A 5DHPA 2HHLA 2GD2A 2QX7A 1WUTA 3BXZA 1P6QA 2AQ8A 3JZAA 5COBA 2HF2A 5JO9A 2G4LA 3WQBA 1QYIA 2YWEA 3HQ4O 1DAEA 1Z2OX 4KO4S 1NNSA 1JXAA 2IWHA 2ZWAA 1YD7A 3I4LA 4UPVA 4D98A 1GZ7A 1T5OA 1V16B 3SQLA 3LJKA 2Y67A 3WK7A 4BX0A 2EZ4A 1H22A 3GFBA 3C5HA 1N2HA 4HQNA 4IXTA 4JBGA 5DDIP 3TM4A 4YMGA 1HNXB 5KKAA 1Z2AA 4EY8A 3I8SA 4UEKA 3TLKA 3T3OA 2WP0A 4WZBB 4XJTA 2Z8XA 3JARB 3WK9A 4JI1B 5IBCA 3OTWA 2BMEA 4HEA1 3ZOZA 2PFKA 5TQJA 1K6IA 4QELA 5LQKA 1XXHE 1T13A 4UDYX 2VTBB 1DC6A 4BVGA 4M9QA 1AQJA 1FP4A 3HJFA 3OJ0A 4D02A 4A15A 1IOZA 1YZLA 4PCUA 1XQWA 3U4IA 1L4LA 2GN2A 1WU7A 5HRCA 2P9JA 4RTJA 5CT9A 1FFWA 4OX9Y 1V8PA 3MC1A 3AF6A 2FY8A 3IMGA 1XZLA 1QNFA 1M1ZA 4G67A 3L0ZA 4BVJA 4CM9D 3L04A 3E2PA 1LVUA 1UPXA 3AGPA 3R09A 2IYYA 2QQGA 2CXUA 3HVHA 4K03A 4LF5B 4NZMA 1XCJA 2Q4TA 3R3ZA 3RGGA 1EWTA 1JFTA 4GZ6A 8GPBA 1B14A 2JANA 3CPEA 1C7RA 2K7ZA 4LBWA 4O2BA 2EJWA 4ZC8A 3L7CA 1DBWA 1XDUA 2WTBA 3KAKA 4FR5A 4AP6A 1K7SN 1JR3D 2H4ZA 2QB5A 4ID3A 4N0EA 3OEED 1ZW1A 3H6GA 4QPJC 4CEJB 4TTTS 5EUMA 3ZVLA 4I50F 4D46A 2Q99A 4UTVA 2OQ2A 1EZ4A 4IM7A 4K6OA 2CNWD 2UDPA 5E1MA 5KDDA 3CV3A 2GBLC 2IODA 4QRDA 5GONB 1I7SB 1ZUD1 1FW8A 2F8SA 3UOWA 1S4MA 4PONA 4UUAA 1DWOA 2G1PA 5TQ2A 3K6SB 5J2TB 2NSLA 1KYWA 2QJTA 5D5HA 3ZWDA 1MGOA 4QDOA 4BRUA 5H9WA 3WIBA 1P7PA 1CV2A 1XR3A 3OURA 2GZSA 2ZYGA 1P4AA 1N34B 5CA0F 1FNBA 3NHMA 5DLDA 1NP6A 2QTRA 2PX2A 3R7DA 1XVAA 3NGLA 3RIMA 1L7QA 1EP2B 3N2IA 4HADA 4Q1BA 4AYWA 3P8ZA 3CX4A 4PGHA 3WYGA 1HT0A 5ESXA 3ZIAA 3CRQA 1AS0A 1JLRA 2V7UA 2LD4A 4Q1CA 4OJTA 3NIWA 4QDXA 4LHVA 3CO0S 4B3MB 3U7RA 4ZJZA 3CONA 3Q9SA 2QM0A 3GQBA 2X4IA 1Y8RA 5FAXA 4OHUA 1BJTA 4ND6A 3HHPA 3H0KA 1YZNA 4RD4A 1SG9A 4ZV4A 3L43A 3FYSA 1IN7A 1R9MA 1VSVA 3ONEA 1SU4A 2Q9AA 2PO7A 1G5FA 1U0TA 4IVQA 2FUNB 1HNWB 5J2TA 4TL9A 3R7AA 5I9MA 1RHQA 3A3NA 3BUSA 4X60A 5ITZB 3BRSA 2PZGA 1HYBA 1MIOA 1TJ5A 1N2EA 1WXEA 3HG7A 4FCCA 1GY8A 4L6AA 2HRQA 3KZOA 4IF6A 2BFPA 5K5EA 1NW5A 2E48A 2NACA 2A5LA 2P2DA 1HUQA 3W7AA 3I8OA 4BV2A 4RDCA 2BHTA 2D06A 2AWNA 3O6VA 1NBIA 4QNMA 5KAMA 3RVKA 1JDVA 1RQNA 3JYNA 5J5CA 1VHLA 3KB6A 5FYQA 3DLAA 4FFBA 4YR7A 1LSJA 1YI1A 1HBJA 3CQ9A 2F1RA 3ADBA 3FLAA 2W6ID 3EUAA 1O6ZA 1NXPA 2G7MC 5LYJA 4RY8A 3ZE8A 3ZLTA 4F4CA 4QGBA 4TUYB 1WY5A 3AGQA 3HCWA 2R68A 3VR2D 1EHCA 7MHTA 1WMBA 2VPXA 4HRXA 5FL7A 2NQ2C 2PFSA 2C3UA 2XYHA 5KNCA 3RAJA 3ZNOA 3CLTC 3L18A 1NDQA 3MIZA 3G5MA 2JFPA 2P91A 3DMGA 4NQZA 4Z4QA 1RE1A 2GWHA 1BXGA 2CMDA 2UZ1A 3LOQA 5CNJA 1FZQA 1S3SA 4LN1A 5ARBA 3NATA 4YQFA 5DLPA 3QXXA 1F2TB 2ILVA 4NJMA 2BKAA 2J4FA 4R7GA 3N70A 1H66A 2HRDA 4Y3UA 2SHKA 3RSFA 3V1YA 2QTZA 1ISGA 2IHVA 2XUIA 3Q6MA 2FUKA 1D2RA 2Z9CA 1J49A 3FH0A 4OXQA 2XUJA 4L07A 2A1IA 5FA8A 4V1CI 5I4BA 3WKBA 4OQNA 3H75A 1FK8A 2D2IA 1C7EA 2Q3FA 2AX3A 2H08A 5K0CA 4M8NE 2Q4OA 1CUCA 1RLMA 1LJUA 2DF8A 4WERA 4J16C 5H3HA 1IUNA 3GJ7A 2WM9B 2HFJA 4B17A 2CXTA 2GF0A 2XZLA 4UXJA 3HKEA 4LI3X 1YZTA 4XJVA 3RH0A 3O4FA 5K3BA 3WR5A 1QIKA 3E7WA 3W06A 2HCJB 2W37A 5IH3A 3VFDA 1SULA 3IKVA 4B7AA 1R8XA 1VJGA 1Y7TA 1LLDA 5A6VA 3TFOA 1LPBB 4MV0A 3R7FA 1F8YA 2YFHA 3I6BA 3ZY5A 2AG5A 2XCIA 1GTVA 5JVDB 4CLXA 4AYTA 2Y77A 1D5CA 1Q91A 2C8KA 4C4XA 2WB2A 1H05A 3ORRA 1MH9A 1IOWA 3ZWCA 4AU1A 1PT6A 5LB2A 2E49A 1TOAA 2IPNA 4MQUA 3OTIA 4UVDA 5SZHB 2QUHA 2DSNA 1KJNA 4J9VA 2M6RA 1KZYC 2BHNA 4A0FA 1OYOA 4ZAFA 1WHSB 3K09C 3PKJA 3STXA 5ANRB 2C7VA 3KYCB 1TQ4A 3ZTTA 1VL0A 1U0SY 2BGLA 2DBZA 1E6CA 2HO4A 4E2ZA 3P45A 1GPDG 4DJEC 2QVBA 5DX1A 3U4DA 4DLAA 1J0XO 3DZJA 4U9HS 1Q14A 2R00A 3D7RA 2QTFA 5EYPB 2GAAA 2Y0PA 1RKBA 5E6RB 4JP3A 4DUPA 5JFOA 2X4LA 2Y2VA 3KYJB 4RMJA 4TXHA 5COQA 4EY3A 1J00A 3K20A 4BLPA 3PCTA 1TAGA 4QPDA 4F3TA 2XVXA 2IH2A 3QIVA 4B3RB 4N5HX 1UK9A 4RKRA 2GM9A 3CU5A 1QQ6A 4KQFA 1NOIA 4R2IA 5HK9A 4D4HA 1VKOA 4H2DA 1T9ZA 4WCVA 4OMDA 3FOWA 4R4JA 2XNDA 4S05A 1WS6A 3IAEA 4XPIB 3I2HA 3K0KA 5D3MA 5TY0A 3SWWA 1ZHOA 2AK2A 3QKTA 4MA5A 4ZCIA 4DBLC 2EL9A 3CVVA 4PWYA 3KM0A 2C03A 2DB3A 1K63A 5CXUA 1CR1A 1NIPA 3I32A 1ORIA 2DHDA 3SSAA 1A96A 3JQ8A 1GCIA 2LTAA 3P26A 2OECA 3HKDA 2C99A 1ATZA 5AKHA 2F8LA 1LNZA 3PPYA 4JBIA 5IN4A 1CJKC 3EIXA 4KPGA 1QYXA 3Q5EA 5DEIA 4WCDA 3FF4A 3RVSA 1PTJA 1DFHA 1NUAA 3WYFA 4X3OA 1M6WA 1PG0A 4JJAA 4M54A 1BX0A 1BU8A 3KQUA 1GFZA 1L5ZA 3DP9A 3AIIA 4MYUA 2HXYA 4KXUA 4CM8B 4ZYYA 3MLBA 1FYEA 5K8CA 5L6LB 2K7FA 1RMYA 1Q0HA 4RVOA 1C8LA 1XE3A 1R12A 4NZZA 4PC2A 1V3QE 3BFXA 4B4WA 5DTRA 4C0AC 3HGMA 4YI3A 3BZUA 4FMDF 3Q88A 4DMLA 3DZCA 4PHFA 3V2UA 3MAGA 5KYWB 1O4VA 2GQ0A 2C54A 3URMA 3VGPA 2HJRA 1GHTA 2I99A 2ZAYA 3U7QB 5IXJA 2FSPA 3UK2A 2C7OA 1SUSA 3SC2B 1G16A 3ICOA 5L95A 2CDRA 2ZIGA 3F8SA 4JQSA 4NY1A 4XW2A 4Z9AA 3RVJA 5JS2A 2N75A 3TLZA 3UJ7A 4R41A 1IQUA 4U7WA 2F17A 2PGNA 2PUVA 3P96A 4Q82A 3VZRA 4A0QA 1XD9A 2LW7A 1PFYA 3UMYA 4LOIA 4WZAB 2FV8A 2X4GA 2XUPA 3HY6A 5L45A 1ENOA 3ANSA 3SS9X 1DRUA 5BSKA 1Y8CA 1QANA 4WA7A 3TZQA 3RVQA 5DN6A 2CNNA 3JQBC 3RBVA 1CRWG 1PV1A 3BGIA 4P4SB 5HFAA 3ED1A 3MWKA 3V4ZA 4IUYA 2EBHX 3E1KA 2VWQA 4NHOA 4CXMA 1EK5A 1QYCA 3C5WP 1II8A 1XLTC 3RS9A 1VDMA 1N75A 2XJ4A 3DB2A 2L18A 4MWSA 1GZUA 2GFQA 3A05A 4PN7A 3M1IA 4H3KB 2QY9A 4TKVA 1CJMA 2QW8A 3H9JA 1AA9A 3MOIA 2HU5A 1RR6A 3DDSA 1IOVA 5KOHA 1F6DA 1MXHA 4KAXA 3WMEA 2DC1A 2NUPA 5AUQA 4YJ3B 1DTSA 3B12A 4B31A 4Z0HO 2NZJA 4RZIA 2OO7A 4CFYA 1FFAA 3IEUA 3T5DA 2RJOA 3Q0EA 1Z34A 4WWHA 1UDXA 4OU5A 3V2IA 4A16A 1VQ1A 4J1TC 4JLPA 4F7DA 1IIBA 3KU4A 4HC4A 4UU1A 1O77A 2HSGA 1BEUB 1G64A 1OLSB 1SY7A 5BSWA 4XCQA 4BEJA 1Z2PX 2IXBA 2J3KA 2X9LA 2YY7A 2OHHA 1R10A 4KAAA 5FBHA 1M2HA 4IDBA 1JDTA 1NX9A 3F4LA 3K30A 2G88A 4NMHA 4IKEA 1M3SA 4MP3A 4ZTUB 4C03A 4ZXPA 3UMJA 2W2QA 4U5QA 4AX4A 4F7WA 1DHTA 4F97A 4QUEA 2GVZC 1SXJC 1AZLA 4LJ4A 4S0XA 1Q2XA 1TKAA 3RFTA 4BNXA 3QFCA 4KITB 3SSNA 4JIMA 4CEIA 3E3AA 5L3VA 1UZNA 2QVZX 1KC1A 4D4KA 5IYZB 3W4KA 2PUDA 1WZUA 4INOA 1D7OA 1DUVG 1VSBA 7MDHA 1JEQB 1PJ2A 4LBVA 4NCHA 5ALRA 3PJGA 5H7XA 5BORA 1T3SA 4YCBA 2K5UA 5JPDA 5I7EA 1AKQA 3U31A 1IVSA 1P4SA 2AI2A 3P9KA 3G2PA 4KXYA 4AP5A 2GJ8A 4N5MA 3TQRA 2XMRA 3VKWA 2GZ2A 2VATA 3R8FA 5HG0A 4IV8A 1IK4A 1N0UA 3GOQA 3C0KA 4K26A 2D3WA 2J9ZB 3NQ41 3TOXA 4C78A 3PJRA 1OLSA 1SD1A 1OX6A 4RMHA 3LHDA 2J7PA 3AVVA 3GGGA 1F1BA 2WHEA 5DH9A 3DAYA 2FZVA 3U7JA 4G6ZA 3SFTA 3W5JA 3H5LA 2BKVA 3Q0IA 1GUAA 2UZ1B 2ECFA 3NGMA 2E6UX 2VF8A 4NULA 3QELA 2DJIA 2OXFA 1COWA 1XQYA 2AJLI 3HDYA 1YNSA 3KKQA 5ENVA 3K31A 4YLYA 2H1WA 3BH6A 3ZZUA 2NYUA 2XBLA 2O8NA 1ZEJA 3EVCA 4YJDA 3IQFA 4ER5A 3DEYX 3C15C 1XFDA 1PBTA 4P5EA 1XVUA 1C4WA 2J30A 3N6RA 3E9ZA 4PANA 1DWQA 1XZ8A 5A9TA 1XTTA 1JEQA 4OGWA 5I7UA 3CRMA 1G9XA 1Z0SA 3F7TA 1SU8A 1UXHA 1YL7A 3VU0A 1YCDA 2WYHA 3D4IA 4URUR 5LWQA 4WJZA 4B09A 4KNWA 4LZZA 1JR3A 1KY4A 3VH4A 4EQZA 3A7DA 2WSLA 2CFCA 4OJMX 4UTPA 3B70A 5AK0A 3HLYA 2I3ZA 5E1BA 3OQMA 1E1MA 3O74A 4EI7A 1DOAA 4J03A 1NPTO 1BMFD 3A4NA 4RHXA 1VDZA 1K6XA 3OQBA 4ML3A 4EELA 3W5CA 3FR8A 4REOA 1LQ2A 4WBNB 1RQGA 2H65A 3OUZA 3HU5A 5DX8A 1U80A 3LC0A 1SIWA 1MJ5A 5EIWA 3WO1A 1U0NA 3AR9A 3K96A 3NUGA 4Z1MD 1SOVA 1KARA 3UTDA 2AF3C 3ROKA 2PXHA 1MQAA 1IBKB 3TK1A 1U9IA 3IH5A 5DI9A 1GGEA 3OZSA 2GF9A 3SM3A 3SKXA 2C84A 3A14A 1FSFA 1GP2A 1XCOA 3WGTA 2JEOA 4N3CA 3TNJA 4EO7A 2W2KB 1G5HA 1JG2A 3C7AA 3E5HA 3SVZA 3RS5A 1WCWA 2HA6A 4ZHQF 1OLXA 1WSAA 1YK1A 4QECA 2HA5A 3D0QA 3D7MA 4V38A 3I9V6 4NEHB 4KTVE 3WZMA 1W0JD 4BLUA 4LVOA 1WW3A 1W581 2QTBA 4GEGA 3DE3X 4RJKA 3PF8A 2A5GA 2PZJA 3UTCA 4FW8A 2FPLA 4CCYA 1YAHA 2DG2A 5FI0B 1S1MA 3T5TA 4B2YA 2HTFA 2TMYA 2JFNA 4NBVA 3NWOA 4W5RA 3HU3A 5IXYA 3OIYA 2FN4A 1WPQA 3I4FA 4MW1A 4OBBA 1RPJA 4NOMA 1DJNA 4HSEA 3NR2A 2R85A 4HRAA 4RK0A 4EYQA 4LHEA 1MHPA 1IONA 1CEXA 2B5WA 3W90A 2WQZA 1PJZA 1WUYA 1CY1A 2XBUA 5I7VA 3WTCA 4HATA 2C0QA 2WM2A 4KKXB 1EM8A 4AZ0A 2BFNA 2J9XB 1N8SA 2PSSA 1LI4A 2FPUA 2WKQA 2XRFA 3OE1A 4IFIA 1DKQA 4DCCA 1G3QA 2OV6A 1E5DA 4L2IB 3SCZA 4L57A 2DFPA 1H94A 1CC1S 1KDRA 4HMQA 4G41A 5DV9A 4ZVLA 1TYAE 2WAOA 3SHQA 4ZJPA 4IJWA 2ANBA 5K8TA 3IE0A 2MINA 2FU5C 3CZPA 2HBZA 5LB4A 3ROMA 1KYVA 2ES4A 3MZ0A 1NJGA 1AZSC 4BQRA 2V03A 5HWSA 3U13A 1MABB 1WNFA 2HO5A 4GZ5A 3GT0A 3P71T 2CXNA 3KUDA 1QFZA 3A2MA 3A6KA 2O57A 3A1EA 3DO5A 3MT7A 2Z6UA 3WWPA 3HKDB 3P9ZA 1JHDA 2HQOA 3IQIX 3QPCA 3PRKE 4KSBA 4Q47A 5DTIA 1BSVA 4M1MA 4XYGA 1B43A 2FFJA 4A9AA 1SH7A 2JJYA 1TYEB 2PLRA 4CDGA 8LDHA 1ULZA 3SZMA 4Z2AA 4CDNA 1I10A 1R0ZA 2R5FA 4KV9A 2GGSA 4YHBA 3LA6A 5KTKA 1GPNA 3GRFA 4QSHA 2B61A 4D25A 1Z22A 1WV1A 1AZWA 1CUVA 1I8TA 5GJCA 3RJ9A 4OU4A 3TOCA 4B47A 3ICPA 4DIOA 1XQ1A 1OCEA 3T7RA 4D8UA 1PR9A 4BOYA 4PSVA 4ZCSA 3E9QA 1D2AA 4Q3DA 5EQDA 3JD4A 1V1MB 4HWGA 3SR0A 4I9NA 1U7TA 4BO3A 1H0KA 4H6VA 2I4IA 5BSHA 5DBHX 1OX4B 3LZCA 1ULHA 4ZEOA 1QIGA 1X1RA 2JLAA 3WGZA 4EJ0A 1QV9A 2IYWA 2O1WA 5B1YA 2UZ3A 2MINB 3B82A 1L5FA 3FYHA 4ZOBA 4EATA 3JQ7B 3R75A 3KT6A 4ZQGA 1I2AA 2HBQA 2QTAA 4QNNA 3MJSA 3ND5A 3PQCA 4BECA 3DHWC 5CEJA 1J21A 3IOBA 1J1ZA 3D64A 3MVEA 5G1PA 4TLLB 4F21A 2VYQA 4K9PA 1M7HA 4ZAZA 5AUPB 5CB0A 5KEIA 3FZNA 3LZ6A 1NN3A 2ZIWB 1IATA 1QVVA 2PIAA 4RQTA 1REQA 4F2HA 4O08A 2B6NA 2C4TA 4Y18A 3KDAA 1SB8A 3DDNA 4GP9A 4ID9A 1GGKA 3LPCA 4G01B 2P6MA 2PZ8A 2QRGA 4GQIA 1V2GA 2GCNA 3RVOA 1PWHA 3G0BA 4MUXA 1CJCA 1AO3A 4IG4A 4N3BA 4JJFA 4PRYA 2JLYA 1TFRA 4OV6B 4TQ9A 4URFA 3ZX4A 2H2FA 3OPYA 2BMDA 3VR6A 1BH2A 2O2HA 1SK9A 3C7TA 3KSDO 3F6CA 3KPUA 4JD5A 2Q3EA 2NO5A 3CSSA 2HLHA 2ODWA 4KXLA 1KKLA 4MPRA 4MGHA 5KKNB 3T3NA 3P9RA 3ZCVA 1P45A 5L4NA 3J80A 4WFIA 2FSGA 1YJXA 4ER0A 1KK3A 4U39A 1Q44A 2GPYA 3V4VB 3FWHA 4XSGA 1RTKA 4MHTA 2O3RA 3TKLA 4MYHA 3KP1A 3JQ9C 3AEKB 4TWZA 5IJAA 4E7PA 3EJ6A 3PL1A 5B53A 3C3WA 4JUDX 1SIOA 4QO7A 1F4VA 3FPKA 2ZYSA 2WMYA 1UXGA 3GEEA 4G1MB 1V2HE 5IYZF 4OHZA 4BQNA 5B1SA 4CT5A 3UWKA 3ZVKA 2AZDA 2ZT7A 1DBVO 3N76A 5CAEB 3MBOA 4YAIA 3CE6A 4BPRA 2YKGA 4I5GA 1GR0A 3FDZB 4RGYA 4OHRA 1DU4A 2RFLA 5E4JA 2R6AA 3W04A 2YHUA 2QNIA 4RVGA 1SURA 3AWDA 3HNRA 3KCNA 4LDPA 2ZIVB 1PF7E 4RH3A 4BNNA 2B3TA 2FPOA 4FGJA 2YWFA 4B2LA 1HE3A 5E0KB 3NEPX 1BX3A 2FW6A 2E21A 4G9EA 7ADHA 1C30B 1GCOA 2JAPA 3BL5A 3GT3A 4KK4A 1RDFA 3RS8A 1H6CA 1QHYA 2VAPA 1BHO1 1QNLA 3LF2A 4UU0A 4XUGB 2AOUA 4E30A 2WIFA 1EVKA 3P5BA 5M2QA 5IKMA 4YRAA 5FPHA 2Q0QA 2ZYUX 4WK6A 1MP0A 2PH1A 1P7ZA 5EXDA 3UG6A 3UMSA 1KTVA 2RI0A 3EFOB 4WN9A 4DMMA 1TM5E 2NP7A 5IASA 1QYDA 1E9FA 1CUAA 3N3AC 3P9IA 3ABZA 1SVIA 4BBAA 5CDSA 2Q2WA 3L84A 1PG2A 4HHEA 2H2GA 4PZ0A 5IMBA 5LZ2A 1PEAA 5IM4A 4CM6A 4P0QB 4NYJQ 4OHMA 4B3IA 4HZUA 4F96A 4C5BA 4DUZB 3H1TA 4NICA 5JANA 1LSSA 4HR7A 3JD2A 2R86A 3DXZA 4MUAA 3RG8A 1RQRA 3R5FA 1HZJA 3RREA 1ZD8A 3ROGA 2IITA 3P94A 3WDLA 5KOHB 4K6CA 2FEAA 1XDDA 2PZAA 1OH6A 2AV6A 2G04A 3ADPA 1Q12A 4BMDA 3ZDZB 3MXOA 4R6XA 1JH9A 3WGQA 1J97A 1GSOA 2F9FA 1WQ1R 4RLHA 1TGYA 1ZN2A 5DYIA 2PX4A 4O0MA 4DOMA 2W7TA 2V7QA 4CCSA 1P2FA 4DLRA 5IDYA 4WOCA 1V6AA 2G1JA 5K09A 4KDRA 3K70C 4M0UA 4LK3A 2QYTA 3CISA 3CT4A 3LH5A 2VTBA 3U7EB 4KFTA 2WAAA 2WTAA 1P1JA 1F14A 3D3NA 5HIIA 4B3TB 4ZOCA 3VR2A 3FFWA 1NHWA 3G02A 4C89A 2PR7A 3MBKA 4BIMA 4JC5A 2VDKB 4MLZA 4PX2A 3WP0A 2HFKA 2IPMA 2KE5A 3QXSA 1JI3A 2P5YA 4R84A 3DD5A 4G0NA 3EGXB 1EBFA 3TLJA 1YO6A 1TK2A 5AVKA 3WMXA 3PPWA 3VUEA 5AUNB 5HKAA 4QTYA 2GH1A 1TEZA 1Z4MA 4BVFA 3TUIC 3TTWA 1QFMA 3WQHA 1I2ZA 4NZ9A 3N58A 3ELUA 3F5QA 4BV8A 1ZLYA 3DYBA 3HJUA 1ZVJA 1W1WA 1EIZA 1V3UA 4C0WA 4YI5A 1OHHD 2RGUA 1UKYA 2QQ0A 4KXMA 3B1FA 5KWEA 1NBMD 4G1EB 4TLBA 1XVLA 3KR9A 4PE5B 3IE2A 5H5JA 5IBRA 2NPFA 4X65B 3PXAA 5HF5A 1PQ4A 1FIUA 1S3GA 4Q3CA 1K6JA 4PVCA 2P77A 2NX2A 1I2DA 4Q0MA 1EFAA 3CUWA 4NE9A 2Q6LA 5CVDA 4BVLA 5IVPA 3CZMA 1WUIS 1XQ9A 3DUWA 3S4YA 2GASA 2W2KA 4FSXA 3UFBA 4L2IA 3SSMA 4H7JA 1OLXB 1IDOA 2GD1O 3LWDA 3B6EA 5T4FA 4OKIA 1L4HA 3EUFA 3IX7A 4YPVA 1XN1A 3P2KA 4Y2XA 1X0XA 4ECAA 2J5KA 4IVPA 1JHOA 4N0MA 1EZZA 1NA5A 2VA9A 2V65A 3OQIA 3G9UA 1X7HA 2PPLA 2YMMA 3GF4A 1NKTA 2OYRA 3K5IA 1QGUB 2R8ZA 2VRNA 3PE6A 2QD2A 4HWTA 2XQKA 2CJXA 5JZ9A 3C6ZA 5AXAA 1EMDA 4QPCA 3CYFA 5E6UA 4E07A 4QQNA 2FGKA 2WE8A 4FZJA 2B1JA 2W2OA 4PX3A 5DLQC 2HREA 4JLJA 4P4TA 1S6YA 1K0UA 4BTLA 2IPXA 2XUHA 1E0JA 3HDVA 3K9LA 4O4IA 5T5QA 1N6NA 3SU8A 1ORVA 4YAWA 4ZDJA 6CHYA 3ESAA 5HQTA 4DR1B 5CDTA 3HXKA 1T9KA 2Y1XA 821PA 2E9SA 3VSCA 4M6WB 4OXIA 1OBFO 2JGMA 4Y9UA 1KDPA 1U6JA 3LX4A 3KLOA 2C7GA 1NRIA 2A9VA 1Z8FA 4A92A 4ENPA 3FOFC 1V1MA 1Y7HA 3RKRA 1COWD 1JBKA 1WQ4A 3BJZA 3ETCA 5I7HA 4HNTA 5FOXA 3HYRA 4A3SA 1OI2A 4S1WA 3M5CA 1WDLA 1UBOS 3I64A 1SXJB 3KRTA 3UHPA 1I7NA 2NPOA 4M1KA 1DG9A 5BUQA 3V1MA 5D00A 3NHSA 4CV1A 3SJCA 1BH6A 2VPIA 4KRXA 3ANXA 2VF7A 3AILA 1F0YA 4N82A 4QU5A 4X8OA 3NH6A 4ZREA 1OZFA 4LV5B 1NXQA 3S81A 3QBVA 4HDKB 2O52A 3QWAA 2FW7A 5JAUA 1O0SA 1L5WA 1RZRA 2VHWA 5HNKA 4QBGB 3ZWOA 1S7GA 1BJRE 2OV2A 4J0JA 5DBGA 1QE3A 4Q93A 2IL1A 5JJLA 2I6UA 1CUDA 1QK5A 2AYZA 2ZRQA 3B3JA 4KO2S 5FUXA 2J41A 1DL5A 2ZRBA 4A6DA 4BVEA 3TGPA 3FYUC 1UP6A 4XWKA 3OPYB 1EX9A 2GXUA 4EB0A 5DTJA 5IVHA 3CNBA 4A2WA 4LYJA 5EINA 3DMTA 3GA7A 5E4FA 2O9JA 2QSUA 4PNZA 2RHDA 3SLGA 2BH2A 3W8NA 1FXUA 1PEKE 3BH7A 1NQAO 3A27A 4PW0A 3WLJA 3N2ZB 3IEMA 4GBJA 3BXPA 3D0OA 3UXEA 4DLBA 5DBEX 1GQQA 1X1CA 2WTNA 2R4UA 3LY7A 4MIEA 4X8LA 4G0UA 4NDAA 4M76B 3C97A 1SVMA 3JYHA 2GHIA 1CRQA 1M8PA 1SUDA 4QYIA 5LBTA 5BPHA 3AI2A 3CEPB 1CCWA 2ORIA 2VN8A 4RVSA 3ZDYB 4C7BA 4M7PA 3CRNA 2O2CA 3H3XA 5BP7A 4JI5B 4C4SA 2DRIA 1YJQA 4RHTA 3R5XA 5IAKA 5BN3A 1XXHA 3K4QA 4UAUA 1YAJA 3CUSA 1OA1A 3K4PA 1EFKA 4NCJA 2OZKA 2JJ2A 3SK0A 3ZBUA 4EYEA 1YKGA 1UUFA 2X8LA 4UEOA 1OYWA 4PPNA 1IJKA 1AKUA 1CUGA 3ET4A 4JQOA 1X7ZA 4ZO8A 3DE1X 4EG6A 2I7CA 3TOVA 4CKYA 3IEPA 4J75A 4XSHA 2GYYA 1PSWA 4LOLA 1O08A 1K8QA 4Y9SA 3R8CA 5AESA 3H9QA 1UEXC 4MARA 3L06A 3OM8A 1N25A 4H7DA 2HRZA 3IKLA 3TGWA 1ICEA 2SKCA 4BQOA 3GGSA 4DSOA 1TZ2A 4TVSA 4OB8A 4HXFB 3WJ7A 1EU1A 1UM8A 3D3JA 3TQTA 3EH1A 1NZDA 1TC1A 1ISFA 5J43A 1Z08A 2WIKA 4CCAA 4QYIB 2PHZA 1PGJA 1TM1E 3CF0A 5KAPA 3E9YA 1YGYA 1UQUA 4J29A 4DAOA 3P9XA 4COOA 2IUYA 3T9CA 1V5IA 3N86A 1W0KD 1DKUA 1PDVA 1XK6A 3BIWA 3E22A 3UXMA 4DV0B 1H85A 2OTCA 2HUNA 3JAKA 2GEVA 4UDNA 1C8BA 3C4VA 3FWZA 1LTQA 2B8NA 2LV8A 2O4CA 3KHKA 4HGQA 2DHCA 2B98A 4I7EA 4EPTA 4EHNA 3U7GA 5ITSA 3BD7A 1ZUHA 1HZZC 2X86A 4S1OA 1RPAA 1YZHA 4OKSA 2AFIE 3A9TA 2ISCA 3I1FA 3ISJA 3IV6A 1XN4A 3AFNA 3KZMA 721PA 1G20E 4DWWA 2XBMA 1PSDA 5EIXA 1UK7A 2AXPA 3AF1A 1ACMA 3V8VA 4EGAA 5KNCH 1Y6RA 4E03A 3GLKA 4FR2A 2BMAA 3OCZA 3UYLA 5BW4A 3WSTA 4CF5A 3M81A 2FMUA 2C3YA 2X3YA 1FP7A 3A2KA 1AT1A 4L0QA 1K2VN 2QDKA 4BBPA 2O0HA 4B83A 1RM0A 2BEVA 4M0PA 4PF1A 3ZWMA 3E15A 4B8ZA 2CLIB 3IOYA 5IULC 3FR7A 3ZJVA 4NTZA 1M2FA 2G9RA 4HQLA 1U8FO 4I4TF 4UUNA 4ENTA 1VL5A 4IQ4A 4KOEC 4DCSA 2FQWA 5D1NA 2AL7A 1SCQA 2RAVA 3TMKA 4JQZA 3A0UA 4TKVB 4DJAA 5C32A 3DONA 1B3BA 2Y6VA 1G4UR 2EJVA 4IMRA 4PYIA 1PO7A 3PFGA 3U7QA 3W9UA 1NRXA 5K4HA 1CQIA 3NHLA 2NUPB 4WUVA 5ALLA 1JA1A 4AKGA 1ST3A 5E1OA 1WBDA 4XQ9A 2G07A 1SM4A 2WG0A 4TZKA 2YY6A 1I5RA 3V8MA 1ZH4A 4Y2QA 3FFBA 2ZIEA 2BM0A 2J9GA 3ZZNA 1BDHA 2OXEA 4MLDA 121PA 1QTRA 1X77A 2A58A 2DR0A 2IEGA 3ZZ0A 3PL5A 1MX9A 4DKXA 2DPXA 2FX2A 2OO5A 1J1UA 4WLFA 4BNVA 5FBLB 3DA8A 2ONYA 2HDNB 5GZ3A 1QZUA 2RCNA 1J70A 1OXTA 3WYDA 4EW6A 4WJLA 4KC0A 3JYOA 3YASA 2ECOA 1XYVA 1WQ3A 3Q0TA 2GZAA 4N3NA 4YJGA 1UOQA 1LLFA 5ITVA 1SVOA 2XXJA 3AVYA 2AXEA 1QTIA 3M4JA 3HL0A 4AKIA 3D1VA 5J58A 2KI5A 2ATVA 3I6IA 3M9XA 1NXOA 1CKEA 3DMHA 5BWOA 5HS4A 1LWOA 2VG8A 2EKPA 3FPJA 1H4SA 1VL2A 3BIJA 4MYRA 3RS4A 3S70A 3WRWA 2O1EA 3ZDFA 1LDEA 3WRXA 3TQSA 1RABA 2R8BA 3G9QA 3O3CA 4M53A 1VGRA 1LTKA 1MLDA 4UUBA 5FL3A 3V6MA 3V4OA 4B48A 1JIIA 4OLAA 1UFOA 3LS2A 2F1KA 3Q3VA 4KREA 1E1KA 1P8AA 3I5AA 4EFKA 3Q7EA 3HJHA 1JKJA 3CZAA 2B94A 3LSYA 3IQHX 2WWIA 1PP4A 2QN3A 3A6DA 3IV7A 4NV3A 3RU9A 4LY6A 4ZICA 1HE1C 2IYAA 4YMHA 3H2JA 3N2GA 1E64A 3OLZA 2GK7A 3CN7A 1AQIA 4FR0A 5TS2A 3RFVA 2IE0A 4Q3NA 2Y68A 4X1YA 2ZRFA 5THKA 16PKA 2V0GA 2HLDA 1AGNA 1JT2A 2OAP1 4XTCS 3HYSA 2PJDA 3EQ9A 3UJ9A 3CJQA 2OZLA 3VNQA 1D0SA 4JUIA 1ISPA 3WWOA 4C01A 3AFIA 2YNMC 2EYQA 4WXRA 3RJZA 4UU8A 2CDAA 3OQ1A 3E9EA 4Q7JB 4MPTA 4RH0A 1Q3HA 2ZUCA 3D4BA 3HBAA 3V4FA 3GMSA 4RZ3A 2XA1A 4BJ3A 4BFWA 4YT4A 3X3HA 2JG3A 1JIVA 3REFA 1D4FA 2V0NA 3JY6A 3S2YA 1N2OA 3AESB 4QA9A 1XKQA 2FQXA 3KPWA 4TMYA 5DT9A 3M1YA 3RUPA 4BJ6A 4BFZA 1D2CA 1SQGA 5UKDA 1RRCA 3ZGXA 4IDHA 4PYLA 4J43A 4IDNA 4Q00A 3O2NA 4RADA 3R41A 2PLWA 3T9BA 2HQBA 5C37A 4EJMA 3EVFA 2Y1OA 4MKXA 5CVEA 1XO1A 1CQJA 1Z38A 2YY5A 3C1OA 3QFTA 2ZYDA 3ZHXA 4E32A 2PT6A 3ZIDA 4G2TA 2CSXA 4BMSA 4GI1A 4JH0A 2XYQA 1OGJA 5AOBA 3BZWA 2VJMA 5EGNA 1TKBA 3T4EA 4OYYA 2EFHB 1Z3IX 1FUKA 2E3JA 2VJBA 3R0JA 4I1IA 4TM8A 4P83A 1NVUQ 1ZKMA 4YECA 4ZZIA 3FIJA 2BCEA 2AT1A 3QRWA 1NQ5A 2ZJAA 2NOAA 3AG5A 3EW9A 4HD8A 3V34A 5EESA 4H1TA 2TMGA 4ATNA 4AXBA 4BRWA 4HYQA 2H9YA 1XSEA 4JJ8A 3WO0A 1FNMA 3GN2A 2NAFA 3AIOA 3BMQB 3FOCA 1A8UA 4IRMA 5E38A 3WLRA 3KAPA 2F3SA 3RFCA 1F0KA 2AF4C 2NSDA 1C1XB 1FMLA 2BWJA 2RCYA 1QTNA 3UFXB 5K0SA 1R0KA 4EYKA 2WICA 4UMFA 1E2EA 5I47A 4RTSA 3KSAC 2ST1A 5WRFA 1DCFA 4RD0A 4X94A 421PA 3HA7A 3OJWA 5A62A 4ZO9A 1PNVA 4F8EA 5E6UB 2NWQA 3FZQA 4UBNA 5G0WA 4G8CA 2F3QA 1H0SA 3L1VA 1U7PA 2TRSB 1X7DA 5BQ3A 5JHHB 2ODNA 4HH3C 1I1QB 3C41J 3H4IA 4PZLA 2V98A 3OBIA 1KZ6A 2P6NA 3JQFA 4UU7A 5AI6A 3AUJB 1KNXA 1QCYA 1ZHHA 2O7NA 4RPLA 4WSOA 4RZ2A 3DWFA 1X7YB 1XXHB 7YASA 2BZGA 5KHAA 1UK8A 1N0IA 3VVMA 5I5GA 1X13A 2X2FA 3AB7A 5TB5A 1Y8ZA 1XYGA 1GNLA 1U31A 3NCTA 1QB7A 4PU0A 1JUDA 4II3A 3V7NA 4JT8A 4CU5A 3CVUA 1NBWB 1RPZA 2WJIA 2IHYA 1ULTA 5JNVA 3QBDA 4MPPA 1LGYA 5JXJA 1T24A 4JYMA 4YONB 5K05A 1RZ3A 1P2DA 3VPCA 5C8YB 3DDCA 2HLPA 1H4QA 1A50B 3FHCB 2WDZA 3LPLA 3O03A 4WCFA 5CJ2A 4EX6A 3Q2IA 4FBGA 4PAQA 3LA8A 5C5IA 3G49A 1UKBA 3LUPA 3U3OA 3UQZA 2MJLA 1TGVA 4GR5A 1ODSA 3A6GA 1CUEA 3S2UA 3AB3A 4DUYB 1EUDA 4XVUA 4LYGA 1NVKA 3T7IA 2J0EA 1Z36A 1WJGA 2VQ3A 3SMVA 3SHOA 1HWYA 4PSUA 3EOBI 2GBLA 3NHWA 5EHZA 3VYSB 1XDWA 2P8JA 3IERA 3DXXA 2M1ZA 1PJ4A 4PVDA 4ZFNA 1EFVB 2HR1A 2HHAA 3IL2A 4X71A 2QTGA 4HT3B 5EJ7A 3L6DA 2O0MA 4I1VA 1DKNA 3CX3A 1U8EA 3KPJA 1MOSA 2EX0A 4F4JA 2M98A 1Z73A 2OFWA 4MKIA 4I14A 2Z58A 1DC7A 4GMXA 3VJKA 2NO4A 5HX7A 2QEQA 4ILEA 1W49A 3ROZA 2W2LD 2EFDB 3ZWQA 5I7SA 2GFIA 1QYRA 1G4HA 1UFKA 2C5AA 3JWEA 5C8ZA 3RG2A 3ZW8A 1M6VA 2A1TR 1TRHA 4LTMA 3DE6X 3ZVNA 3TSAA 4MS1A 3T12A 5HMMA 3WYCA 4NE2A 3LGSA 1KO4A 4ALMA 2ATXA 3MCZA 5CCEA 5JOQA 4DXDA 4IHKA 1GUFA 1L7EA 1GPYA 3VHXA 1PZHA 2XQIA 2VPZA 4FHFA 3W6ZA 2JLXA 1WBBA 3PG5A 3IHTA 3NDPA 1R9NA 4OVKA 4AI6A 3ROFA 3BWEA 2R1ZA 4AFNA 2JI6A 3CLKA 3QW4B 2IP1A 3E61A 4AS3A 4YMVA 4ZCMA 2IS4A 1LPOA 1NG1A 3T54A 1B74A 4UASA 1TM7E 5T3UA 4FYMA 1DGQA 2XUQA 2O7VA 1WDTA 3ZY3A 4ER7A 2DPHA 4HQ6A 1S2OA 2P7HA 4QPNA 3DZGA 3WB9A 3SG0A 3GAFA 1S3FA 2P2NA 2ZSUA 1ZD9A 3ZR4B 3FCOA 5EZYB 3VHQA 4LQLA 4LY9A 4YFVA 2C7BA 2XNKA 4XJSA 1XVTA 2ZVDA 5JWOA 2QIPA 5CDFA 1J2JA 1R88A 4KPYA 1BN7A 1WKBA 4M0LA 4ZRMA 2HIGA 1VSQA 5BT9A 4AO7A 3JZDA 1G66A 3LVRE 4FWIB 5CNMA 4H1HA 2F43B 2HADA 5LMNB 1M9NA 5IJWA 3V48A 2Q5FA 2H06A 5KYKA 4UMVA 1RJGA 2QE6A 5HJ7A 5CUQA 2ENWA 1SEVA 4GVLA 2A14A 4MUKA 1E2FA 2YFYA 3EX7C 1LX7A 1TM3E 4NLLA 2ZYRA 3DEAA 1FOEB 2ZBPA 3RD5A 3SHVA 1TMOA 1DAGA 3UJNA 1U7ZA 4EJ6A 4XJXA 2PMEA 3VU9A 2FHPA 2XCUA 4B40A 3U4QB 1J07A 4D3SA 5KJCA 2X2PA 4I8DA 4E14A 2YOGA 3EA5A 1X7XA 1PHPA 4CFSA 1H3EA 4HDRB 3WGMA 1KOFA 2Q0HA 1ESEA 3ZOKA 1RMQA 3HRIA 1AKRA 3Q3GE 1DAHA 4JP8A 2IYFA 2D59A 4BRSA 5TEVA 4BZPA 1QKJA 3CB2A 3FUVA 4WLVA 3DBRB 3IO5A 3JQGB 3FI9A