1ZI8A

Crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVASKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTGSSGYVASAAALANERTLDFLVPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi8A00
4J3JA 4AN1A 1WOMA 1ZGBA 2PPLA 4BZWA 1AURA 2OCGA 3D0KA 1UK6A 1FFDA 4KAFA 2W22A 2QMQA 5FDFA 4BC1A 3V9AA 5AOAA 4RNCA 4AZ0A 5JIBA 4X93A 4Y2QA 5BWCA 2PSFA 1FFAA 3IB3A 3ED1A 2ZSHA 5ALJA 2CEKA 5K5EA 1MJ5A 1NX9A 1Q0ZA 2HA6A 2VA9A 4LKOA 5IVHA 5AH0A 4EY7A 3C8HA 5HKBA 4E14A 4Q3LA 2ZJ7A 2QTBA 3DLTA 1J1IA 5A71A 3ESCA 1QONA 4OUKX 1HLGA 5HCUA 4W1SA 5AKYA 1TCCA 4H77A 2WIGA 5D7BA 4BZZA 3KWFA 3WK4A 5IVIA 1KU6A 3P2MA 4KAAA 1XRRA 1XKLA 4OB7A 2R8BA 3T52A 5CTAA 5YASA 3DS8A 3I1YA 1GPLA 3WK6A 4HXFB 4ETWA 3DOIA 1PFQA 1W1IA 2XDWA 4B84A 2XQFA 4WFKA 4FFWA 1DWPA 1XFDA 2EDAA 2DHDA 5DLPA 1CUUA 3LS2A 4BYMA 3SK0A 1XZCA 3I2HA 3L1JA 1A8QA 3RLIA 1MTZA 1E5TA 2JEZA 3WL7A 4DGQA 3VKFA 3STVA 4PNZA 4GI1A 4DNQA 4Y2UA 5CMLA 3BWXA 2PSHA 3R3XA 4MXDA 5A7HA 3O95A 4TVKA 1H2WA 3KDAA 3I6ZA 2XMRA 3BXPA 3H2JA 1DWOA 4N8SA 1CQZA 4YK7A 1CLEA 4QZVA 1G5FA 5E4YA 2HA3A 2Y6UA 4X95A 3FBWA 3A2NA 4M0EA 4C6HA 1N1MA 1VKHA 2WFMA 3VVMA 5ALLA 2XMBA 2BJHA 4UUQA 5AKJA 4CCYB 2JGMA 3IURA 2H1IA 4WY8A 2XQGA 4H7FA 3LCRA 2WHRA 3VDXA 4QDUA 3VJKA 5FXMA 4BTVA 1XKTA 3F96A 2ZYSA 4P08A 1D07A 1UFOA 2XUGA 1ODSA 1UZAA 1C4XA 2HU7A 4BAZA 2WILA 4AX4A 2ES4A 3DD5A 3W9BA 1BEZA 2BGNA 4GWLA 5FPPA 1EDDA 5HF6A 4CI9A 4DMHA 2DCMA 2QXUA 1H22A 2JGFA 1VOTA 4CCYA 3OPMA 5FKJA 1CUHA 1TQHA 5ALMA 1VE6A 5JZBA 4AN0A 3V1MA 4C89A 1WPRA 1XLVA 5D6OA 5JALA 4WY5A 3QM1A 1Q83A 4FTWA 4K5QA 4DSAA 4PSCA 3ICWA 3G8YA 4GW3A 3F9CA 3H2KA 3G9ZA 1YAJA 1LBSA 4AO7A 5CT5A 2Q0XA 1EB8A 2O2HA 5AKHA 2WUEA 1LPPA 5ALDA 5AKEA 1VA5A 1Y7HA 2IIVA 3O9VA 3WK5A 2OGSA 4J0HA 4X3CA 2JGJA 3WWEA 4FHZA 4B9EA 4JNCA 1CUFA 5E2IA 4EY5A 2BAGA 1TIBA 4G8CA 2I78A 4ITVA 5JAUA 2GZSA 2RONA 3O0DA 3M3DA 3E0XA 2GBFA 1QFSA 3PI6A 4GXNA 3WK7A 3Q8WA 2ECFA 1Y7IA 4J0DA 3HJUA 3TRDA 4OU4A 2WHQA 3ZLUA 4KACA 2Z8ZA 4BDTA 4DLNA 4OCZA 1R50A 4QWWA 3STUA 3DEAA 4AMYA 2HDWA 4X94A 1MU0A 4INZA 5T4FA 1W76A 2ROQA 1ZIYA 5IKXA 5HQ3A 1MT3A 1ETHA 1QIEA 2ACKA 5C8VA 2XUJA 4Q3KA 3AIMA 4ZGBA 3WI7A 1XZMA 4HXGA 4F21A 2YASA 4BAGA 1LPNA 2OPHA 5C81A 2CBGA 5T4EA 4DMCA 3FYUC 4Y9SA 5AHXA 2ZYIA 1YASA 1A88A 3AIOA 4OB8A 3W05A 4Z49A 5EHNA 5FLKA 1E3QA 3V48A 5E4TA 4GBGA 3STYA 3VJMA 5IVKA 3AZQA 3WL8A 3BJMA 1SC9A 3G9TA 4G8BA 2HA0A 3QPAA 2BFNA 4Y2SA 1CUVA 4MQLA 5JAHA 1CUAA 1X2BA 1EXWA 5C7YA 2VT7A 3NWOA 2PU5A 3I6YA 3G0GA 3I2JA 1IUOA 1GT6A 1TCAA 4NZZA 4RPCA 5CH3A 3AUKA 1SFRA 2CKMA 2WU4A 3R41A 5EGNA 1R88A 1JFRA 1OILA 4U2GA 4MWSA 5ALIA 5AI9A 4J0CA 4FKBA 5JD6A 3WQHA 4IH1A 2C58A 4W1RA 1TK3A 2AJDA 5AOCA 4EUSA 4RGYA 4AMZA 2FUKA 1MO2A 2ZSIA 4EY8A 2AJCA 3C87A 3D59A 1ZI9A 3DJYA 4K2AA 1QO7A 4NMWA 4QDZA 2PKYX 4KE8A 3K2IA 2HRRA 1SCIA 5HK8A 2VJDA 3IBTA 3ESBA 5LLSA 3IULA 5JZSA 5FP0A 4B85A 2VQ6A 4UFPA 4I3FA 5AM2A 2E3JA 2C0PA 1DTEA 5CT4A 1R1DA 3DL7A 2PVSA 4NS4A 1CQWA 3QMVA 3L1HA 4UHBA 4F60A 2OAGA 1UT6A 4H7DA 2WUFA 4AXBA 4OYLA 1GXSA 4LYEA 5I9IA 4EA6A 1DX4A 4UPDA 5EIAA 4UBJA 2C7BA 4HZGA 2O2IA 4XJVA 3WWOA 3K6KA 5EHQA 1AKNA 1XLWA 3BL8A 2XQJA 4KYVA 5H3HA 4X92A 5ALKA 4J0IA 1ACJA 5K3DA 2BUCA 1C7JA 5CH8A 2R11A 5E4JA 3WJ1A 2OCLA 2XMGA 3B5EA 4B80A 4GEGA 1YS1X 2J3DA 5AKZA 2JBWA 2OXEA 1XZGA 5CH5A 3UUEA 2JGIA 4UBLA 1VE7A 2Y2VA 5K3EA 1YR2A 3PUIA 3E4DA 4BVJA 4YX9A 2BKLA 4FNGA 5AKIA 3WWPA 3WK9A 2XMZA 1XZHA 1XROA 4FBMA 4AB1A 1R4ZA 4IHAA 2DHCA 3WYDA 4BE9A 1JT2A 3GA7A 4KAJA 5FUMA 2V98A 4UBNA 3BF7A 4OYYA 1ORWA 5ALZA 2HM7A 4BC0A 1ZIXA 4ZI5A 5ESRA 3VXKA 4U2EA 3DQZA 4Y2JA 1WB5A 4HXEB 1CUEA 4OB6A 4DSZA 5AM5A 1IZ7A 1KU0A 3BIXA 1AZWA 2JEYA 4B81A 3DDUA 2WFLA 5F4ZA 4UHCA 2HU8A 2VT6A 3KSRA 4LXIA 1I6WA 4H0CA 5JAOA 3C6YA 5JADA 3O4IA 3OOSA 4XWGA 4WFIA 2YH2A 3EQ7A 2CZQA 3G7NA 2QR5A 5AK5A 5CBKA 3ZV7A 2XE4A 3ESDA 4BCCA 1JJIA 5JATA 1E8MA 2G63A 4MEBA 4KEAA 5AI5A 3G0BA 3MUOA 3H2IA 4PO3X 1LZLA 5EHXA 1LPSA 2AXEA 4WJLA 1CRLA 4A5SA 3VISA 1FJ2A 4E11A 3W04A 3WIBA 5K3BA 3YASA 3FLBA 3D2CA 2OAEA 1F8UA 4LYDA 5EHZA 1HPLA 1E89A 1XZLA 4HRXA 3PFCA 2B4KA 2WFZA 3R0VA 3C5VA 2QUAA 1GGVA 1BEEA 2HA5A 2H9YA 4FLEA 4GECA 1UWCA 3MUNA 1GQSA 1QOZA 1QIDA 1QO9A 3B3QA 3GFFA 4LXHA 3V1KA 2EEPA 4Y2YA 4MYSA 1XLUA 5DYWA 3BDVA 5HFNA 1EVQA 4YPVA 2DR0A 2C4HA 4BVLA 2Z5GA 2QJWA 1KEZA 3ZWQA 1YA8A 3ESAA 3RM3A 5HQ3B 3H1AA 1QIGA 3E3AA 4DMFA 1SCQA 3QMMA 3D5EA 3KD2A 2ZVDA 4QE3A 1XZJA 2RHTA 4CIBA 1IZ8A 1JKMA 3F8SA 3H18A 4OD0A 1EH5A 2PSJA 4PQEA 2V96A 3ZI7A 3SC2A 3A2LA 4EB0A 4KJXA 4N5IX 1GKKA 3BIWA 1HL7A 2YXPX 3QITA 4QLAA 1W75A 3X3HA 1QTIA 3D3NA 3O4GA 4P92A 2WU3A 3O9MA 2RI6A 5AK4A 3FNBA 3D7RA 1SCKA 3AFIA 5DTJA 5ALTA 5T4BA 5KWJA 3SX4A 2AJBA 3V1LA 1CUIA 4JUIA 1H23A 4C87A 5K3FB 1X70A 3QBJA 2B9VA 5DNWA 3D2BA 3HABA 2HHAA 3NGMA 1ISPA 3PICA 2FJ0A 4M0MA 5AI4A 5ALYA 3WKEA 2HA4A 2Y6VA 5ALEA 4OU5A 2XLBA 3PF9A 5JYCA 2ZJFA 2OQVA 1CV2A 1MAHA 1MPXA 5ALHA 1QGED 3BF8A 3LIIA 4H7KA 4X97A 3WL6A 1XRNA 5AP9A 5IVDA 4KE7A 3WYNA 3K9BA 1GZ7A 2I3ZA 1EB9A 3C5WP 2H7CA 3BE8A 2GYUA 3MGAA 2CJPA 2Z3ZA 1F0PA 3FLEA 3W2TA 3UUFA 5EIEA 2PUHA 3HYSA 1ODCA 2HU5A 2XMQA 1CUJA 1ZD4A 2OGZA 1PJAA 4ZREA 4CIAA 2VTVA 5CXXA 3FYUB 3R3ZA 5DNVA 2X5XA 3W9UA 3WK8A 3ZLVA 2Z8XA 3QMWA 2BGRA 2WQZA 1ORVA 2ZJ6A 1CUGA 3OURA 2WIDA 3FLAA 3TJMA 2WFLB 2GBIA 5A2GA 4ZXFA 4QDTA 1UOQA 2X76A 1JMYA 2XUQA 1JJBA 4KE9A 5AI6A 3WA7A 4BB0A 4B9AA 1AX9A 5ALVA 5D3ZA 3EBLA 5A6VA 2G5TA 3M82A 1R9NA 4BVKA 1GQRA 1OXMA 4UBOA 4N8DA 2GYVA 5ALOA 1A8UA 2XQIA 4J0KA 3AIKA 1QIIA 3H0CA 2PSEA 1ZJ5A 2OLEA 5LIPA 5ALRA 3PF8A 5ALSA 2WSLA 1XRLA 5LKRA 1IMJA 5JASA 3DL4A 4LHEA 1YS2X 4PV7A 5HF5A 4DMKA 1UOPA 3WIOA 4CG3A 2PX6A 3U0VA 4C4XA 3D2AA 5AM0A 2WUDA 4PSDA 2VJAA 5AM3A 1W4LA 2HADA 4BAUA 1ZI6A 2QZPA 3HSSA 3TGLA 4JYPA 1THGA 2C5GA 3ANSA 2QOEA 4Y2PA 2XUIA 4X90A 4IH9A 4FMPA 3AILA 3RKSA 1ZD2P 1XQYA 5J3JA 2WHPB 2K2QB 2CUTA 1UOOA 2J4FA 1ODTC 1EK1A 3A6ZA 4B83A 1N8SA 2DQZA 3I2KA 1GKLA 5LYYA 1YB6A 1CVLA 2XI4A 1A8SA 1QJ4A 4Y2XA 2C5FA 3HLKA 5JAPA 3A2MA 1VXRA 1TCBA 2UZ0A 3G9XA 3N2ZB 5LZ2A 4BATA 1X2EA 2OQIA 4MEAA 5LZ7A 2VSQA 3S8YA 3R3WA 4EZIA 4C01A 1G66A 4DIUA 2XUOA 2VJCA 4BRSA 1LPOA 1MNAA 4N8EA 4ZWNA 4BRZA 3C43A 4A16A 1G4HA 2HFKA 4HS9A 4RE6A 1BS9A 1ZD5A 3WL5A 4OPMA 4BCDA 5AKKA 2I03A 3STWA 1H2XA 3I1IA 1UKAA 2B20A 1QIKA 3H17A 3G9UA 3RK4A 4DM7A 1T4MA 4JEIA 1K4YA 4X85A 4UFOA 5AJHA 2P8SA 3F97A 2DQYA 2WIKA 4DNOA 1JMKC 3CCBA 3I2FA 4FLMA 3VJLA 4CG2A 5DJ5A 3AZPA 1RWQA 2EDCA 4UHHA 1F0NA 4U2CA 2BUAA 4LIPD 4X6XA 5DNUA 1TAHA 4KRXA 4AZ3A 4DNPA 2J4CA 2XUDA 1JJFA 2JGEA 3HRHA 4L9AA 1QIJA 4FOLA 3H2GA 1HBJA 3WKDA 1CUXA 1WB6A 1XRQA 1IVYA 4W1PA 4P93A 1MNQA 5LZ5A 2QUBA 2V9ZA 3GBSA 5AKGA 5CT6A 4B7ZA 5IH7A 3HEAA 3LIPA 5HF9A 2D5LA 2XMSA 4C88A 2WUGA 3CCCA 5EFZA 4QDXA 4KR0A 4K6GA 3CN9A 3EF3A 3OG9A 3C6BA 1DQYA 3H1BA 4HAIA 4G5XA 4D9JA 4AO6A 5AKXA 4ZV9A 1L7RA 5LKAA 1EINA 2HA7A 1LPBB 3DOHA 1JU3A 2BUBA 2C0QA 1QTRA 4X6YA 2WM2A 2HFJA 3DCNA 1FSSA 4QEKA 1RYYA 1EK2A 5DYTA 2QJRA 1CUYA 3OC0A 1C7IA 1YA4A 3MVEA 4PW0A 5A7FA 5HKAA 3JW8A 1K63A 1YCDA 3IUQA 2WIJA 4G9GA 2WLSA 3ZPXA 4UBKA 2PSDA 3FSGA 5LZ8A 1BN6A 1LZKA 5C8ZA 2HA2A 1O6GA 4Y2TA 2XUFA 4QWMA 3FVRA 5JD4A 3WWDA 1HKHA 5AK3A 1AC5A 5I8PA 1EA5A 1QFMA 5CW2A 3KOOA 2WKWA 3ILSA 5CXUA 1QIFA 3R3VA 1L7QA 3DYIA 4FNMA 4B0PA 2H7XA 5AIAA 5CT8A 2PUJA 3H04A 3C8DA 1ZGCA 4ARBA 2O7VA 2WJ3A 4H7EA 1CIJA 1OCEA 2ACEA 5CT9A 1LGYA 1J06A 4E46A 1HDEA 1Q0RA 4J03A 4Q1VA 1XZKA 3I28A 3WA6A 1AGYA 1MX5A 4TGLA 5ALQA 4X7BA 1B6GA 1YSCA 3WKBA 4K6HA 1VJ5A 4BE4A 2QM0A 4NVRA 2VAXA 4FFVA 2XMCA 1WM1A 3RARA 5A62A 2V97A 3SWWA 4B82A 2J3QA 2VEOA 3TEJA 5ISMA 5AIBA 4MWTA 4FDMA 1VZ3A 4UBIA 4X91A 3WWCA 2JGKA 2X8BA 4AO8A 1VXOA 3N0TA 2WG2A 4Y7DA 1XRMA 1EDBA 1UK9A 4U2FA 4Q05A 4XIIA 3M83A 3T4UA 4WFJA 3QPDA 4HVTA 3FYTA 2NW6A 1E8NA 4I19A 1GPKA 4L3WA 2OCKA 3I2GA 1XZAA 1NU8A 1MN6A 2RHWA 3CXUA 3I6MA 4Y2RA 5ALGA 4W9RA 4CG1A 2QVBA 4BBZA 5AOBA 2VAVA 2GYWA 5LZ4A 3U1TA 3C6ZA 2JF0A 1Y37A 2FX5A 1R9MA 3FAKA 1CUZA 3UMJA 1IUNA 2G5PA 4G1FA 1UKBA 1TKRA 2VATA 5LZ9A 1S8OA 5T4HA 3M81A 1U65A 1AUOA 5FOQA 1M33A 1J07A 1VLQA 1JI3A 3R3UA 4ZRDA 3HZOA 3F98A 3HI4A 2WTMA 1XRPA 4GLBA 5SYMA 5LP1A 3G02A 1U4NA 3CN7A 3L1IA 3EQ8A 3DKKA 4OSEA 3R40A 3LP5A 5DWDA 2DSNA 3HC7A 1H2YA 4G4JA 3FOBA 3IIIA 3GZJA 4UHFA 3BDIA 2OG1A 5AO9A 2JIDA 4F0JA 2PL5A 3VVLA 3QVMA 1AMNA 1Z68A 4CCWA 4BDSA 4EHBA 2OCIA 2GZRA 4BTLA 3LLCA 4H7HA 3JYHA 4WCVA 5EIHA 2Z3WA 1ZICA 3OTQA 1B41A 1XZEA 3OM8A 5D3KA 5AICA 5AI0A 3WJ2A 4F5ZA 1WCYA 2PM8A 1DT3A 4HTAA 4ARAA 1E8DA 4XX1A 3IDAA 1BRTA 1Q84A 3GROA 3EIOA 4HRYA 1ZD3A 2ONCA 1CFJA 1L7AA 4UHEA 3E1GA 2AJLI 3ZLTA 4Q82A 5KWIA 1CUCA 5A7GA 5BOVA 1BU8A 1EVEA 1XQWA 1WHSA 1CUDA 4S0XA 4DNFA 4TPKA 5JARA 4E15A 3BJRA 4G4IA 4K6KA 1RP1A 2WTNA 1UXOA 4EBBA 3WLAA 4XVCA 1XQVA 1DWQA 2XQKA 2GBCA 2W6CX 4Q34A 2CB9A 2RGUA 5JANA 2WHPA 3D4LA 3WKCA 1DINA 1ZJ4A 1WHTA 2VF2A 4X6UA 1R3DA 1W6RA 3QZUA 2H7YA 3KWJA 4FLFA 2IX9A 3IVMA 3AINA 3F67A 1W52X 3A70A 2ORYA 2O7RA 3G0CA 1K6EA 3PUHA 4J0GA 2XMDA 3G0DA 4DTCA 1O6FA 3FWHA 1YAHA 1JU4A 1QZ3A 5ALFA 4W63A 2JGLA 2I3DA 2Y2UA 3FSGD 1FFCA 3O4HA 1UK8A 2B61A 4EY4A 4L72A 4G8DA 4YASA 1EDEA 4M0FA 4QLOA 3HXKA 5EI5A 4DYHA 2FJPA 1XZBA 1UK7A 2OGTA 5ALXA 2WG0A 5SYNA 2QKYA 3Q0TA 1U2EA 3W06A 2G4LA 1DU4A 3FCYA 2YYSA 3S2ZA 2QS9A 4CFSA 4ROTA 1N5RA 1UKCA 1FFEA 4QA9A 1YB7A 4FBLA 2Y1KA 5I7UA 1SOMA 1P0IA 3WZMA 3IUMA 1DT5A 1DX6A 4H7JA 1HQDA 1XZDA 2GBGA 1XZIA 5KREA 1LPAB 3PE6A 2PU7A 4X71A 3V1NA 4H18A 1H2ZA 5JZ9A 5JD5A 4O08A 1ZI8A 1K8QA 3DYVA 4A23A 1P0PA 4UBMA 6YASA 3WZLA 4GHWA 5K3CA 1EHYA 4MYDA 1GPNA 1PV1A 2XLCA 4B6GA 4IQ4A 4RE5A 1CR6A 2PBLA 5DTIA 5ALNA 3NUZA 3QYJA 1WB4A 4H7IA 4UFNA 5FPQA 3G0IA 3KXPA 4QDOA 1QE3A 2AJ8A 3C45A 1T2NA 4I4CA 4U2DA 2BCEA 1N5MA 1E66A 1LLFA 5KBYA 5HFAA 2IITA 4Y2VA 1LPMA 2ZYRA 1QIHA 1TRHA 1LBTA 1DQZA 1A7UA 2D0DA 3PFBA 1BROA 5HF8A 4ZV7A 5HZGA 4GDMA 2XUAA 1XQXA 4QNNA 2XT0A 4KE6A 4P9NA 1LNSA 2WIFA 1EI9A 4C4YA 1K5PA 3IUJA 5AK6A 3STXA 3H19A 2XUKA 1MAAA 4PSUA 2RIPA 3WMRA 5ALWA 1FFBA 3FCXA 4AQDA 1MX1A 4MJ3A 5K3AA 2XB6A 4PF1A 1USWA 1QIMA 1NU6A 2QXTA 4U2BA 4N5HX 5AM1A 3HACA 4WDRA 2DFPA 3STTA 5HK9A 1CUBA 4J7AA 3C6XA 3PDCA 1CEXA 3AJAA 2LIPA 3GUUA 3DKRA 3DNMA 3QPCA 7YASA 5BWBA 3FYUA 4MQMA 3C70A 4G9EA 3AZOA 1F6WA 4KRYA 3IA2A 1J2EA 3B12A 4JH0A 1BE0A 5ALUA 1XZFA 4IO0A 1U8EA 1G42A 4J0JA 5C8XA 1CUWA 3NOXA 5AKLA 1BN7A 3R3YA 2HL6A 4Q3OA 5K3FA 5CRIA 1ZOIA 1ACLA 4W1QA 4LXGA 4X00A 2HRQA 2ZYHA 4FWBA 2O2GA 4IH4A 5AI8A 3FVTA 1CUSA 2WJ6A 2QRUA 2WG1A 3H2HA 5AM4A 3ANTA 4H35A 5FRDA 1P0MA 2XUHA 2DHEA 4G4GA 1IUPA 4L0CA 1MX9A 1BCSA 3ICVA 4BP8A 4WDQA 3EQ9A 1VA4A 3WKAA 3IUNA 1QLWA 5FV4A 4BCBA 5ALPA 5BV7A 3GELA 5DYYA 1BCRA 4UHDA 5CURA 1WPXA 1P0QA 1EX9A 4V2IA 2XUPA 2QT9A 4B0OA 2RAUA 3O4JA 3JWEA 1CPYA 3QH4A 4BP9A 1VZ2A 4EY6A 4JYMA 4C4ZA 3I2IA 2WJ4A 2VJBA 1THTA 2HIHA 1AQLA 2CMFA
chains in the Genus database with same CATH superfamily
2WNIA 1JSLA 3HGMA 4LVUA 4QUJA 2OXIA 3P7MA 1QGUA 2DVMA 3VR5D 3WR5A 1SUSA 4AN1A 1VSBA 1NYLA 1M6NA 2UYGA 5EUBA 4OBBA 2IQIA 1OBHA 2UVPA 2GO7A 3D0KA 1GFIA 5EHGA 1XZ8A 1UK6A 1FFDA 3NMUF 4PZ0A 3P9XA 4BL5A 4EQ6A 2W22A 4DEVA 4DMLA 1XG5A 3VC7A 2NACA 4XVUA 3DAOA 3A3OA 2EF0A 3BVPA 4QELA 3CG0A 1COWA 3DHYA 3FTDA 3LXXA 5ILQA 4EUKA 3ND5A 4TROA 3VPGA 3JD1A 4C7OA 2H31A 4YNBA 2CDAA 1SKUA 2AKAB 3ZKWB 2QBYB 3JQGB 4AZ0A 2D5CA 1KVTA 3ZH2A 2O2CA 1CG6A 1YRWA 4I36A 1U7UA 4INJA 2HDHA 4IIGA 3IUYA 4OEHA 2PSFA 4XDHA 5FOUA 5F5LA 2A5FA 5BWCA 2IXFA 1P4HA 3OLWA 1ZKMA 4QULA 5ALJA 1BHJA 3B6IA 4NYMR 4LK3A 3UHPA 1Q0ZA 1L8AA 2OD9A 5JZVA 3IP7A 1PL6A 2GR9A 4OQPA 4E31A 5FJIA 3TUJC 1M2VA 3EIFA 2AN5A 3ENNA 4E88A 4AKHA 5CXQA 4TTQA 1GNPA 1MEJA 3C8HA 3PC8C 4HFRA 3RVNA 4EY7A 4Z4GA 1JV2B 3R3JA 3SIWA 2QUHA 4E14A 2CHEA 2I4NA 3EUEA 2O8BB 3FDJA 1E99A 2DRIA 2PCJA 3Q4GA 4CTNA 2P4SA 4ETIA 1I2MA 1Z16A 3DLTA 1V4BA 3NG1A 4QL3A 1N5IA 2QYSA 2IU0A 3GEEA 3EPPA 4ZYYA 3TM5A 1K92A 4FZVA 5AKYA 3KT8A 5HCUA 3ROMA 5D7BA 2PX0A 1A8PA 2PGIA 4FUQA 4MUGA 5F7OA 1N6RA 4HZUA 3MRSA 1RXEA 4BZZA 1D2MA 1N2EA 3R5XA 5HEKA 1WXIA 3DFZA 3P2MA 5EQTA 2RCNA 1M6WA 3AEUA 4EAAA 2ZB4A 1SQ5A 2LDXA 4EEKA 3DZDA 2AOTB 2PR2A 5JWOA 3T52A 3G59A 3SJUA 4ESEA 2X22A 2O3JA 1Z2EA 1N2XA 5BRAA 2C9CA 1DV2A 3UV6A 3WK6A 5CFLA 1LV8A 3MSCA 4RKWA 3DOIA 4CEHB 1XWIA 1ZNQO 3FI0A 1Z5ZA 4KQEA 1ZN7A 3HU1A 4O29A 5KHAA 1VYVA 3G8BA 1AGRA 1H3FA 3RRFA 4PNEA 3A6FA 2ECKA 1CUUA 3JZDA 4F2WA 3LS2A 4M7RA 5JISA 4H60A 3OJXA 2JHFA 3I2HA 3L1JA 4Q16A 4D8TA 3KVOA 5IYZA 1A8QA 4RJIA 3SF8B 4PYLA 1VQ1A 1QHFA 1QO0A 3F6BX 2A57A 2ZDQA 3W3AA 4BEVA 4MR8B 4W5JA 2XCIA 3P2KA 4YECA 2X0FA 1H6CA 1VHJA 2EGUA 3OI7A 1YMUA 3MRTA 3AH8A 5JPDA 2RG7A 1AV6A 1SCUB 5ARDA 4D8WA 2N3ZA 4MRNA 1IY8A 2PQ6A 4XFDA 3DNPA 3ZWKA 1F7VA 1U3WA 3JQ7B 4I6JA 3L04A 2FFBA 3F5MA 3HXPA 3QWBA 5JBNA 1G7SA 5DX8A 3Q6MA 2VEDA 4CCSA 5HM6A 1MV8A 3BXPA 1BGVA 2PO5A 4YJGB 1KYQA 4BGIA 3PJEA 5CJJA 4F04A 1VMAA 3G1TA 3GJ6A 1DWOA 1OLXA 1ODIA 4YK7A 4YEDA 4ZU6X 1CLEA 1E6UA 1G5FA 4FMDF 5C5DA 5SV2A 2LV8A 4QZVA 1JILA 2OHXA 4JOQA 5J4VA 1C1DB 1REQA 5E4YA 2GBLA 2Y6UA 3KQVA 2HD4A 3ZUPA 1RQXA 3D54D 4OQZA 1TVEA 1J5XA 4EUHA 2AYZA 2D13A 3IV7A 3OPXA 2HDOA 1LBIA 4IUYA 4ME6A 4MW9A 2PBZA 3ZTWA 3CW2A 2XVYA 3RUPA 1T1RA 3B1JA 2VDQB 2JFWA 2ZTSA 3A2NA 2R7LA 1FMTA 1RWBA 3QYPA 4FFBA 1Z2OX 2FRVA 3JY6A 4YDHB 1K7SN 3BMXA 4I6GA 1QTNA 4IUBS 1RVDA 2KBEA 1XD2A 2J6HA 2QGZA 1D9XA 2YC4C 3KYDB 2HNAA 5CXXA 3TL3A 4BVAA 2QQGA 2WFMA 3OCVA 6ABPA 5ALLA 5CNKA 2JVKA 4UUQA 5AKJA 3BC1A 4BLSA 1OXSC 4B7CA 1VHDA 3K8YA 2YN0A 4QUAA 1BDBA 1R4MA 2XWJI 3GD5A 1DELA 3NVKI 1DWUA 3IURA 1E98A 1SU4A 2XQGA 5E6UA 5BT9A 3DPUA 3MB8A 3OQVA 3PC4A 1DIRA 4H59A 5DISB 3VDXA 4PCAA 1DOAA 3K4QA 4QDUA 1ETUA 4X84A 4BLOA 2LW7A 3I4FA 4BTVA 1XKTA 5CFPA 4P08A 5BN4A 3L7DA 4KGZA 1R0XA 1D07A 1RKQA 1UFOA 1XALA 5H80A 1GZDA 1ODSA 2Q45A 3TUIC 1UZAA 1Z37A 4ZVQA 1JXMA 1Z6GA 4J16A 2ADFA 1YJBA 2RBGA 3TXAA 4BAZA 1PHRA 5LYJB 1NDHA 3HM2A 16PKA 3O1IC 4CEJB 1GG9A 1RQ2A 2WILA 2QN6A 3AVXA 4NZYA 2NSJA 4OMCA 1LBQA 5FBRB 4MULA 3RRYA 5KINB 5LD2C 2NU9B 1K6IA 3O75A 4OHYA 2BGNA 1MGOA 3BICA 4HH3C 4JVNA 3PDJA 2YV5A 4B33A 5AW7A 3OEED 3K4PA 3Q87B 2NP7A 1XTVA 3FUVA 3G8CA 3VPHA 1X15A 1S2OA 5LQNA 4K28A 2PNFA 4RH0A 5I6DA 4EG3A 3KZCA 2H4ZA 1YA6A 1QYCA 5CAEB 2P4EA 2B2CA 3C6KA 4TYPA 1HDYA 3A36A 1CR2A 2ZSBA 1AA9A 2AX4A 1C1XB 3O5AA 2QXUA 4JJEA 3ZVKA 2FVYA 1W7AA 4D26A 5I7SA 5GONF 4YDQA 3QUSA 4JB8A 1LTQA 4HWTA 4NAUA 4RD6A 4QPCA 3OPMA 2CCKA 2PGAA 3HGQA 4MVWA 4Q9NA 1ZUD1 2ZJ3A 1JLLB 3VPDA 3C97A 3LT1A 1T5DX 3GGPA 5ALMA 3HM9A 1VE6A 3D3JA 4XYBA 4L4RA 5A02A 3F7OA 1AK9A 3PHIA 3Q7QA 4D82A 1UAYA 1XLVA 3PUZA 1XRJA 2WWIA 1HDCA 3IIJA 2M32A 2X0JA 2QUJA 1CZHA 3BE4A 3QM1A 1RWPA 4BVGA 1DG1G 4FTWA 5FR2A 1TGVA 1Z5NA 1SXJB 3H2SA 3WMWA 1Y8QB 1A97A 1T3GA 2E9SA 2QTRA 4L2IB 4M49A 1Z82A 3PQ8A 4TZTA 5CIQA 3JYLA 3G8YA 3HXTA 1DEKA 1BHO1 4R3WA 2ZT7A 3UANA 4WIAA 3V3KA 2ZT6A 2JFQA 3INNA 3BKXA 3AR7A 3H2KA 4YLGA 3ZDCA 4WZBE 2VTEA 1JSXA 3QIVA 5DHSA 3AM4A 1QSGA 4DLLA 1G20A 2R6DA 3IJRA 4QQRA 3RTAA 5JAIA 1CF9A 1CX9B 2I1WA 2X5NA 4GSKA 2DFNA 1YDFA 2BKUA 2CXOA 2R6GA 4KB5A 2H1RA 4NCBA 2K87A 1O5OA 2YBDA 2OZVA 1C9MA 1NNUA 1ZJYA 2JFZA 3AJRA 5ALDA 1ML3A 2IIVA 3AVQA 3O9VA 2GA8A 2HMAA 2HWKA 3FMPB 4KYUA 2P62A 4TMYA 1V4NA 4FGJA 1QH9A 2NV2B 5EE3A 2OGSA 1L6RA 3QTLA 2JJYA 1VKNA 1APBA 2DMRA 1RM3A 2MSLA 1BHQ1 4TXMA 4UAGA 1I2DA 3CT6A 4MI9A 1PR0A 5FA5A 4L95C 1Q2UA 1B76A 1NW3A 2JFGA 2R6FA 3SKVA 4ZOCA 4CL0A 3OO1A 2XQVA 1LKZA 1Z34A 5KU7A 2FG6C 3WWEA 2CW5A 5JEDA 4FHZA 4DQ0A 2ZB7A 4B3RB 1PGPA 2OBFA 4GRAA 5JMWA 1E5VA 4JNCA 4G5GA 5C1DA 4LF7B 5E2IA 3MIIA 4RVCA 1Q5PA 4AMUA 3OUUA 3CRMA 4UC0A 4BJ3A 4BNDA 3A3NA 3VR3D 1LD3A 3PGLA 2IHKA 3UG6A 2J5BA 2QTGA 1Z88A 5FEMA 1WDKA 4RJLA 4WGFA 4IR7A 2DPHA 4YR7A 2FZCA 5JCPA 4I5FA 4WK4B 1MO4A 3N2IA 4EARA 1PQ4A 3QVKA 2IYQA 4TTPA 2I0FA 2VBIA 3QUQA 4X8HA 4RW0A 2C00A 2YWGA 3LUCA 3NHKA 3FHOA 4XPZA 2QUKA 1OE0A 4MCIA 2HPHA 4RKQA 4XGQA 3D4OA 5BYJA 5I51A 2J46A 2AIRA 4K9SA 2C07A 1JBEA 1QAMA 1BEUB 2XXBA 3JRWA 3UJ8A 1PTJA 1RWKA 3V4RA 4KACA 1GXSB 2FGJA 1V1MA 3IEPA 3NYIA 4DLNA 5A6SB 3KOYA 1NQVA 4FFNA 3PZBA 1KK2A 3JRNA 4RVGA 1OA1A 2Y3IA 3P2OA 2HDWA 3SLKA 1V47A 1MU0A 4WCFA 1RZUA 1AE1A 5JW6A 4INZA 1ID1A 3FX2A 5B1IA 4QLBA 4RS3A 3TD2A 1QV6A 2ROQA 2HN9A 3VPSA 1BXZA 2CJWB 2GA9A 3CVJA 2PT6A 3MOGA 3N8IA 4UEOA 2SICE 5K0LA 1ETHA 2O0LA 1UFRA 4PG6A 2B78A 1WDLA 2YDYA 4QXPA 4F5WA 2B69A 2P75A 5JYEA 4UNRA 2FN3A 3G68A 2BFFB 1VSVA 3GMSA 2PGXA 3P52A 3LDFA 3VI3B 1QH0A 1XZMA 3K5HA 1UJNA 3GGDA 4HXGA 3WI7A 4ZGBA 1J5EB 1NX6A 1RT9A 2DBRA 1KYXA 3QP9A 4J4TA 1DI0A 4BAGA 4ZI3A 3R44A 3DCIA 1LPNA 4K46A 1HG1A 3CONA 5LWQA 4LFAB 4ZT6A 1T8UA 1VP3A 1XQ1A 2B6NA 2BONA 1NT4A 2Z9BA 3LP6A 4A5OA 5T4EA 1YR9A 3FYUC 3MRVA 1L1QA 1NE7A 1RHUA 1PDOA 4LZJA 4EUEA 5ICFA 4R98A 5HE8A 1CJMA 2G5GX 4ZGGA 2Z0MA 2ZYIA 4CV2A 3LQFA 2XHZA 4Q9JA 3AIOA 5KSPA 3QEMB 5C5EA 1M8PA 1PHPA 3NTUA 4FXOA 1E3QA 3PQCA 1E3EA 1OLUB 3V48A 2NVWA 4GBGA 4GRIA 3SXUB 2FQQA 2ZETA 2R2AA 3FNIA 3P5SA 3STYA 1O6BA 1YONA 4XUDA 3SXPA 3VJMA 3JWJA 1BDIA 1U0RA 4Q4AB 3T3HA 4C4AA 3WRVA 4WBSA 4BFYA 1F1BA 2J0UB 4JLKA 1LW6E 1TQ8A 4JHXA 4OSPA 1KO8A 2ZIZA 2HA0A 3KQHA 1PEKE 3TW8B 3WFJA 3Q5DA 3ELWA 3RSLA 2JGRA 5KTNA 1Y4AE 3GLHA 3L7CA 4Y3UA 5F2NA 1GWNA 3BZBA 2HGZA 1E2PA 4IPTA 4WOPA 4DM4A 4W9MC 2X2PA 2DULA 4PSAA 3LLMA 3QX9A 4C6RA 4EGSA 1WXEA 2KLHA 1RQ7A 5HIIA 1AK1A 5HNKA 2A92A 1PR4A 2P35A 1CY6A 4NYJQ 1XPRA 5C7YA 5TMEA 2ZZNA 5GV7A 3RK1A 3I6YA 1C9DB 4L73A 4JJIA 3L8DA 5HIKA 2R1VB 4JV5B 3C4VA 1XA0A 2ATIA 3THRA 1IUOA 1GUZA 1F3OA 3ORQA 5TQJA 1XXHE 2W11A 2A5LA 2VF7A 1ULTA 4IDOA 4G5RA 2LE0A 4MPDA 1GCAA 3IDZA 2VDJA 5A3VA 5IXJA 3IMKA 5TT1A 3E7WA 2AQIA 1D0SA 3EHEA 1V26A 3B52X 1GL6A 3MF4A 3RVDA 2KLBA 1CZNA 4RFVA 2CJYA 3DL2A 1KKLA 2RBEA 3CLTD 2XB9A 3DXZA 3KDPA 4IHJF 1GUBA 1ICEA 4LQ4A 4A0SA 2IZ5A 4OQYA 2W8BA 1QVZA 3LX5A 3DTVA 3ULKA 3EZLA 2CV0A 4U2GA 4MWSA 3PTZA 4LI3X 3LK7A 1WY5A 1XD2B 3KYDA 1SGWA 3N2YA 3HJCA 4DLZA 1X39A 1OT3A 2LZ0A 4WNYA 2CFCA 5LP6C 4EG7A 5JZOA 3B6EA 4YLYA 5HRUA 1WUHS 2CMDA 1IOLA 1Y9AA 1CRWG 4FKBA 3D6FA 3EAGA 3EULA 4A8JA 2QMYA 3GA0A 3T3NA 3PNOA 5BV2P 1IN8A 1NKSA 2OZEA 4XGIA 2VH2A 3CVXA 3L0DA 2NYRA 4MYCA 3ISTA 1U7WA 1OLSA 2AJDA 2Q4BA 3C41J 4HF7A 4BO7A 4FZJA 3FFWA 3DFFA 4W8HA 1MOSA 4HCJA 3TSCA 4RGYA 2QZ4A 3GLSA 1PJ2A 2FZGA 3SC2B 1BMDA 3GLKA 4XDZA 3H5AA 2JLSA 1G8GA 5KU1A 3QSGA 1AXRA 3NWBA 1PS0A 1VM6A 1ZI9A 4HNUA 2H2HA 3RRBA 3JZMA 4F3TA 2R7KA 2X0IA 1JHOA 3BIFA 1Z6PA 2PKYX 3CX7A 4WZBA 1NOKA 4ZO6A 3NHMA 5NULA 1VLZA 3CVYA 4B7UA 2C1EA 2MT9A 5BSHA 3PQ7A 3QV2A 1R0SA 2HJSA 2HRRA 2ID8A 2AT1A 1H2BA 2H07A 3AF5A 2QRJA 4WASA 5HK8A 4AG3A 3WX0A 1QYVA 1TEXA 2VP4A 4MGHA 1P45A 4UDXX 3IULA 1T8YA 1T2CA 2CXHA 1LWOA 3ID6C 3OCXA 1W48A 4LGMA 1RRKA 1X1DA 2VQ6A 4R5HA 2J9YB 3IDQA 3TBFA 2VRCD 4UDYX 5AW0A 2NADA 3CKMA 1HTWA 3G5UA 2IS4A 3KL4A 3MELA 5AM2A 4OHOA 4MS4B 3PCXA 2E3JA 4GKAA 3RIGA 2RGDA 4N4AA 1EBFA 2C0PA 2WU1A 1DTEA 3I6IA 3LBFA 3D6HA 1TT5B 4PQYA 4BYGA 1G3UA 4F45A 1X92A 4YHBA 2IDZA 4DSNA 2IU4A 3WGUA 4WAUA 5HKKA 3QV1A 3ZJVA 2WZQA 5AHKA 3PC8A 3AFGA 3DYBA 5KQSA 5TGTA 3U3RA 3OEWA 4F60A 3GLGB 4AJEA 3C3AA 4S2EA 1YFJA 1TRKA 4Q9HA 1UT6A 4CM8B 5F9HA 3BFJA 5AXCA 1E1RD 4DCSA 2AFIE 5IG2A 1Q0QA 1L5NA 3OJFA 4FJ0A 4AROA 4QOEA 3PQ2A 5I9IA 2GKOA 2PANA 5CHEA 5JCXA 1G19A 2EIHA 121PA 1XYVA 3OZTA 4OAPA 3SI7A 3ZU4A 1FPMA 5JXWA 2J31A 3RU3A 3AP2A 5IT0A 2DBYA 4HDNA 2ZANA 4PYIA 1TZKA 2YZMA 1L0BA 3K6KA 4PPGA 5CU7A 3HP7A 1YKGA 2BFEB 5FUWA 2X86A 4IIHA 2J6CA 2ZR8A 4M60A 3BL8A 4FKMA 4FR0A 2QT1A 3MT9A 2X42A 4FDUA 4AF7A 4UUOA 5FR1A 1SPXA 1KTVA 1W4CA 3DCJA 4X92A 3IPYA 4ZT4A 1C7RA 4YCNA 5ALKA 2HSGA 5JAZA 1ACJA 5K6TA 4MIOA 5EHIA 5K3DA 2V0CA 2FPPB 4JL6A 1MH9A 4NE2A 2BUCA 2YYYA 3OU2A 2VF5X 4XDGA 2J3KA 2QR3A 4JBHA 4B5LA 4GLLA 2PD6A 1B3BA 1QGAA 1UBSB 3I09A 4IJ6A 5CH8A 4EUNA 3QK7A 5JXIA 3PPXA 1LCIA 3A9SA 2IL1A 2MYTA 3QE3A 3R76A 4BASA 2H4HA 4K6FA 2UUCB 3TI9A 4C7BA 3NH6A 5ULLA 1JR4A 1VLHA 2DHRA 4YRBA 3F2IA 4IZIA 1EFLA 2ZWPA 1QQBA 4IXTA 4WINA 5AKZA 4C76A 3BSWA 4PZEA 1W5SA 3EGEA 1E3LA 3FH0A 3NKLA 5LMZA 1EFUA 4FYHA 2JGIA 4D96A 1VE7A 5KQRA 2I6GA 4QPZA 4CMAA 1ZH4A 3CO0S 2Q07A 1E9RA 4MVXA 3E4DA 3UFXA 5DHPA 4BVJA 1G3QA 1MHPA 1Q20A 1M1YA 5BNFA 1I7DA 1A9ZA 1OLOA 1J2YA 3MAGA 1TTHA 3B20A 2GZ1A 4QG7A 4RLSA 5C18A 1SKYE 1U02A 2GPTA 1IXZA 3VYRB 5KSOA 4IYRA 3VPXA 4EECA 2AB0A 1OX4B 4BX0A 4HH4A 1R0RE 4QUBA 3DTVD 3UPDA 4DLAA 3DE1X 4XM2A 3CNQS 2CXSA 3WO1A 1CS0A 4U4AA 2RHGB 3WYDA 3L2OB 1MQ9A 1CR0A 4BWFB 1RIFA 2O50A 1WXQA 3B1FA 4UBNA 1Z7YA 4XTRA 5JQWA 2JGNA 2F1RA 5A6SA 4UHKA 1C3XA 1C41A 4KP7A 3KB1A 4GXTA 3IE2A 1HLFA 2DLCX 1YRYE 1XR3A 1DADA 4JROA 1JQ5A 4F4HA 4MAAA 4ZYXA 1C3OA 2HCTA 2EL7A 2FRDC 3BFVA 3RV3A 2LXNA 3M4ZA 4BC0A 4LOAA 1XNJA 3VU0A 2XBLA 2OFWA 4WJZA 3TJRA 4LW8A 2B4AA 1E7YA 5JY6A 4DV5B 2OB1A 3DFUA 5F12A 4DIOA 3VO2A 3L46A 3DQZA 4Y2JA 4AW9A 2G04A 2WINI 1IHDA 1ZO8A 1RS0A 5HKKD 3HJFA 2XSZA 1X13A 4L5CA 2GHTA 3OFSA 3PNVA 4MKXA 1IZ7A 2FP3A 3I9V6 1DPFA 2BEVB 3UJ6A 5JJLA 3BIXA 1A69A 4NCNA 1B2LA 4A1FA 3PJRA 4B81A 4EYKA 5K6AC 3GU3A 5AUQA 3DDUA 3V97A 4R54A 1S2DA 3EIEA 3BA1A 1GZHB 1J49A 2I8LA 3R7SA 1ECBA 3GUCA 3AK4A 2G67A 5CJPA 1KVUA 1XVIA 3D81A 3KBOA 4KWHA 4ZP1A 4LXIA 1JA0A 1TM5E 3VHXA 2OVBA 4BQRA 2EX0A 3W8NA 1VSUA 1ZH0A 3E7XA 3MOSA 1ZOPA 4MIYA 1TUBB 1M8JA 3P4YA 3IA7A 1I33A 3C6YA 2OHVA 5G0SA 2DJIA 4YREA 4BX2A 4D4GA 1IHPA 4M0KA 4EFLA 1Z2CA 3CQ9A 1I80A 1W46A 1YQQA 2D62A 3EQ7A 5JHGB 4QFCA 2NQTA 2DX7A 2V1XA 3QU4A 4LWOA 1RYHA 1ZCZA 4MW0A 1T2AA 2IW3A 1PS9A 2XE4A 3JAWA 3V2UA 4NKRA 4L8VA 2AD1A 2JFBA 5HG0A 1AKWA 3TRFA 4B76A 5DWVA 1LUAA 1VDZA 2EFJA 3JPWA 4P54A 2QRPA 3F3KA 3IBCA 3KAPA 5DBEX 1KH2A 4P3KA 2BBSA 4KEAA 3QBTA 1OFVA 4TOIA 3RIEA 5AI5A 3HHPA 1QGZA 1QHGA 2QTHA 3FUXA 3BK7A 3H2IA 1KR2A 1NFRA 3LVFO 1XCMA 1LZLA 1R9JA 2I3BA 3S5UA 1W96A 4ZVMA 4EMTA 3O2JA 2PXAA 4MV8A 1M83A 3GDHA 2ZSFA 1FP4B 5GOZA 1DJPA 1EFKA 3LQ2A 4GR5A 4CTMA 2J7PD 1HT0A 3UAVA 5TGDA 4ZK2A 1U2TA 5M34A 2DU8A 4IJMA 4JBNA 2P4HX 1FJ2A 4G41A 4X65B 4EQ6B 4KWEA 3D4IA 3ZK7A 1AHHA 4LSGA 3KD3A 1N57A 4KBFA 5K3BA 2NIPA 1T0HB 4HLDA 3VC2A 4HAUA 1GL9B 5EERA 1GCIA 5EZQA 3S68A 2DG2A 1TW3A 1EHIA 4R9RA 3C15C 2OAEA 4LYDA 2J5RA 2IQ5A 1Y1SA 1YZQA 1PK9A 1FUIA 2C20A 4HRXA 4UAVA 3DMNA 3WDLA 2ZRAA 3P20A 1LNZA 3BFPA 3ESRA 4IDEA 2H4XA 2W2VA 1FU8A 1G16A 2OFPA 4DCVA 1XRSB 1KJNA 4W5WA 1MV5A 2CYAA 4MVJD 4Z9BA 4KRFA 1V39A 4UXJA 2LPMA 4RK5A 5AFSA 3DFKA 2O8BA 1MMFB 1FRQA 3LBHA 1YS4A 2MOKA 4KQFA 3SE7A 3NRCA 4QREA 3U9TA 1FRFS 3ZDYB 1T6BY 3FPLA 3FMOB 1QOZA 3IP3A 3OQMA 1QO9A 3D6MA 1X1QA 2YOFA 3VSCA 4QEZA 2BWJA 4LXHA 3ZBUA 1YL7A 4TS9A 4J1TC 2EEPA 3MTAA 2F1HA 2VC2B 4F4UA 4MW4A 2HW8A 3AR2A 1T6ZA 3V7NA 2OCYC 4DDMA 1Q7RA 1T4GA 4NBSA 2IDKA 1XNHA 3UT5B 1TX4B 3ELUA 4B4WA 1M75A 1RI4A 4YPVA 3OLXA 1WXDA 4MQEA 4TWJA 1W36D 1ILWA 2CZCA 1PT9A 4LZNA 3TRIA 1UKVY 3HJTA 1Z6AA 2QJWA 4GPD1 1H2RS 3ZWQA 3ZE1B 4ZEMA 5CGQB 3VNSA 1QS0B 1P6QA 1L4YA 5HQ3B 3TL6A 5IUJC 3BERA 2O48X 3H9BA 3TMKA 3N5KA 1Q6YA 4DMFA 3SF8A 1DPGA 3I34X 2ZJ0A 4IUDS 5FBZA 1BWQA 2B7LA 3KLBA 4GEKA 4REQB 3KYCB 1E5QA 1G6HA 1N3LA 2ZVDA 1TK9A 4DY4A 4EJSC 5C5IA 2ZIAA 2NU7A 4G0XA 4GPIB 4H4CA 3LRTA 4IL5A 4EHJA 1EEHA 2XKBA 3GRAA 1E2BA 3HADA 3HPRA 3SS7X 3NIGB 1OXXK 3F8SA 4V3BA 4YPFA 2QRVB 4OD0A 1EH5A 5JC1A 3A6KA 3R8XA 3GQVA 2C0CA 2Z1MA 3MJVA 4UULA 1CULC 3WDMA 2UXCB 4Q3BA 1Z5PA 1EWYA 3LPNA 3IBYA 3E9EA 2GVNA 4ZU3A 4AY3A 3PUWA 3H7AA 4DQDA 2QENA 4AL4A 4EB0A 3WIEA 1GKKA 3MWYW 3A6EA 1NXQA 1S8FA 4XA8A 4GBED 5EMKA 4RFLA 2GZMA 3L40A 1JR3E 3QVVA 5DLDA 3HCEA 5EVJA 3SSNA 2JA2A 4RA9A 3UWPA 1AZLA 3O4GA 4LC0A 3TRJA 4MITA 1CNMA 1GYRA 1HTBA 2A1TR 3U4QB 1DBSA 4OXIA 3FFXA 4C4PA 4P36A 4B4DA 1V48A 3EA5A 3DPIA 4GYJA 4J7XA 4PSVA 5DBHX 4CDNA 5ADVA 1QRAA 2GASA 1VRVA 1ZHFA 3HBAA 4QICA 3DM5A 1NRIA 2QMOA 5KWJA 1YZNA 3HB4X 4G4SP 4N5DA 3P4UA 2TMYA 5FBWB 1ESDA 1SNYA 5FBQB 2BP7A 2J1LA 3IQHX 1DAPA 4PZPA 1EDZA 4UTNA 1YCGA 3ZLJA 3J7TA 3NIFB 1ECGA 1ECLA 4O3MA 3V1LA 3WRYC 5KYNA 3TLJA 2WM8A 1CUIA 1D2AA 2Y92A 3K5IA 2QLNA 1H23A 1FQKA 2IT1A 3DGEC 4OAQA 1HR0B 1MB3A 1X70A 3SLGA 1QCZA 3OPYB 2EKQA 3QW2A 3PPYA 1YZHA 3HABA 3DMGA 3NGMA 4HDRB 4N48A 1M2OB 4B6OA 1G0NA 1YMVA 4JQYA 1ISPA 3DAYA 1ULZA 2P2NA 3QVWA 3GO4A 4Z2YA 4BGVA 3U4AA 1ISMA 1PJLA 4RYDA 3F3YA 3PUKA 1E3TA 1U3DA 3HNPA 1F4PA 1EFPA 3LX6A 3IQWA 4MVJI 3QY9A 2C83A 5ALYA 5CB4A 3JATA 5LOVB 4UQLA 4OU5A 4NARA 3T4EA 1IPFA 2XLBA 3I4CA 4AUEA 2OQVA 1NM5A 3PU6A 1XOIA 2AG1A 1CZKA 1V2GA 4AYXA 3SBEA 2HRBA 2P2LA 4GX5A 1MAHA 1MPXA 4NZOA 3GR6A 3IV6A 2OG2A 3EHDA 2JIBA 4FHEA 3BF8A 3LIIA 1RMQA 4X97A 3E1SA 3U17A 4G5YA 2RJNA 1RJDA 1P2GA 4JIGA 3ZGZA 4HQNA 5HYVA 4H6PA 1JEOA 3WMXA 3WZ2A 2D0IA 4LOKA 3K9BA 5EPUA 2EFCB 1TU3A 3VHRA 3B6ZA 1R0LA 3O8BA 4AICA 3TTTA 3VZSA 4L0QA 4ENPA 2DJ5A 2JIRA 2W8BB 1JR3A 3KK0A 3VZDA 5JVDB 3CCFA 3ELDA 4JY7A 3SQNA 4YT5A 4MLPA 1PJ3A 5ER6A 3MGAA 1ORTA 4MIKA 5CG2A 2I2AA 4GL4A 4DAOA 1D9ZA 3TLXA 2OHIA 3AW9A 2PUHA 4HX2A 4QOFA 3ZWPA 3KXDA 5JNWA 2E4YA 3QBEA 3E5RA 1OXTA 1P62B 3HO1A 3ZZTA 4ZQHA 2PKEA 2J7PA 3U62A 3W4JA 4CIAA 1MVLA 2CLDX 4Y6PA 4L8FA 5BY2A 4JUAA 4LNHA 4NCJA 2XB4A 1A1SA 4TLEA 2XNDA 1SG9A 2NO5A 2ON6A 2ZE6A 1WTAA 3R3ZA 1N6KA 3AJ9A 3BXZA 4CU2A 3R9XB 4GKBA 4Q00A 3W5HA 5AQ1A 1SVKA 3O03A 4K3UA 4MJ7A 4YV0A 2Z8XA 4EEXA 3ZJUA 2D0OB 3GHYA 1YVDA 1ORVA 1IN1A 1AS2A 1J5PA 3EGCA 3N0XA 4OJNA 4OQQA 4LOIA 1W5TA 1YIOA 1SXQA 1MTOA 2BKXA 4EY8A 3RF6A 1O94C 3L06A 3C6MA 3C1AA 4HB2A 3PXEA 3K8QA 3TJMA 3OU6A 3WLFA 1TT5A 2IYSA 3NUQA 4IZHA 1E69A 2WFLB 1Q1QA 3AL0C 4FHCA 2GBIA 3EWIA 1VKZA 2IFTA 2BW0A 4M1OA 2EERA 4QDTA 3EPHA 1JQAA 2PWAA 5JSZA 1UM9B 1YQTA 3V4SA 4QYSA 2XMPA 1JJBA 3OCJA 2WV9A 1XTKA 2GI4A 2ZRCA 3GAFA 4G1VA 3NHYA 4G0VA 2BGKA 3R20A 3MGKA 1WKVA 4O1HA 2OV1A 4AJPA 4DCNA 5B12A 3CO5A 1AGPA 2FCRA 5D3ZA 2AC4A 4YUZA 2E5LB 1SU7A 3W2HA 4B09A 1XO1A 2ODNA 5ETJA 1NW5A 3I45A 4EVIA 1R9NA 1TOAA 3JVVA 4ZO9A 2IY8A 5TXGA 5AXBA 3RU9A 4LVOA 1KDZA 4OHBA 1HXHA 2CXTA 2K7FA 2GYVA 2A0FA 2A30A 5ALOA 1LDGA 1JECA 1Q11A 4NBKA 1GILA 1MW8X 1FOEB 4HSGA 5B7PA 1BNCA 4V38A 3RYIB 4J0KA 1Q3KA 1U5BA 1IZ0A 3FDFA 3IPAA 4TM8A 1DO0A 3RRXA 1ZH6A 1W29A 5BYKA 3OHMA 1NDUA 3PF8A 3PQ4A 4PLGA 1K9VF 4PONA 4BBAA 5LR6A 1NBOA 2PRZA 5ALSA 5K8TA 3GLQA 2JKVA 1L7VC 3LGAA 2WA1A 1YK0A 2WSLA 1HH4A 1V7PC 4GLOA 5GM1A 1XRLA 5JASA 1FCJA 1M6YA 5TS3A 2X2OA 3C7TA 5DXAA 2IH5A 3KVYA 1F60A 3LC7O 2PIAA 4LHEA 4M9CA 3NT2A 5K0CA 4K9RA 3T7IA 2O8DA 1E6WA 4GXQA 5U4XA 4Q19A 2YWDA 3ES9A 3NVMB 4IFTA 1TEVA 3AM1A 4NBVA 4RTJA 1TKAA 3P2YA 2YIMA 4KPUB 2ZREA 2RC6A 2N46A 3DJFA 3RVKA 5A5VA 5AVRA 2F1KA 4BB9A 1M6HA 3FF4A 1W4LA 4E4TA 1OH8A 3MGCA 1ECPA 4BAUA 5LJIA 3VOAA 2QZPA 1KKMA 1U6IA 3AEKA 5EIBD 4BIMA 3AG6A 2W71A 4GVPA 2QN7A 3HSSA 1DXHA 2R6JA 1V9CA 5T3UA 1JLMA 1UXIA 5IAKA 5E3HA 4G3XA 4M0LA 1E7WA 2FK7A 2DSTA 3TTVA 2ASEA 3M5WA 4G97A 2Q6VA 4LOHA 4P1ZA 4RD3A 2QRMA 2JI8A 2ZRQA 1GG8A 4R9SA 4L75A 1N6LA 4M22A 4X1KA 3WAKA 4WQMA 1T6XA 1ZUIA 4PINA 3BZUA 2HMYB 4BFXA 2YIDA 4UEKA 5DLYA 2A9PA 2D7DA 4IQFA 1II9A 3THXA 2K2QB 2OBYA 4GMGA 1VSQA 1ZK2A 1U3TA 5BSWA 5K45A 1E1KA 1ODTC 1EK1A 2AX3A 2B21A 2BFFA 2HT6A 3A6ZA 4FZRA 2VPZA 4AZWA 1OTXA 3CMMA 1V0JA 2YRWA 4AF8A 4D0SA 4QD3A 4DMGA 3I2KA 1EUDB 2V6JA 1GKLA 2JCYA 4OGLA 5LYYA 1LSSA 1FEZA 3VSDA 5EUMA 3L92A 2ZPUA 3FUCA 5TY0A 3EIUA 1TQ6A 1M1NB 2PV0A 2EZTA 2DT5A 3K1JA 3WAJA 5JS2A 3HVUA 1A77A 3KPJA 3N75A 3NGLA 3NOOA 4GE3A 1M7HA 2BBWA 3K0CA 1DRJA 3BSSA 4RZUA 3A6JA 1J8YF 1O9GA 5JAPA 2FWMX 1VXRA 1TCBA 4LJ5A 3UKOA 4Y9DA 1BMFA 1CP3A 5CLGA 4D25A 1GRVA 3KKNA 4CM7A 1U80A 4WNAA 4E7PA 2JJ1D 1C9KA 1JFLA 5LZ2A 1TUGA 1QR2A 5CX1A 4BATA 3N74A 1X2EA 3N8HA 4DR6B 1P4AA 5LZ7A 3GJXC 2Q5HA 3EXIA 4L5YA 1WS6A 1JPUA 2QT0A 3QFFA 1WNFA 4PCUA 2Y8EA 2YICA 3T41A 3K32A 4DIDA 1G66A 3LT5A 3TKLA 4KIJA 2D1YA 2X5JO 3X2SA 5LYJF 1PNQA 2O06A 4ZZ3A 2WTEA 2CLLB 1RJEA 1LPOA 3DHEA 4R9VA 2R6AA 1JAIA 2V8OA 1TT7A 1XJWA 2QROA 3UBMA 5LDGA 2FHSA 1RQPA 4DMUB 1LC0A 3IXQA 2IYNA 3D8UA 3ZS8A 3TFWA 2V65A 4DA6A 1ZD5A 4JLMA 1AHPA 1SIUA 4BCDA 4WY2A 3KUXA 2EV9A 2IYOA 4WXHA 4D7AA 5AKKA 1N77A 2BSQA 4IO1A 3BUSA 5EYPB 3U4HA 4YXWD 5EGSA 4KNWA 5K0JA 4PTLA 1C14A 3KYIB 4Y6GB 3RK4A 4LE2A 1QGDA 4ZJYA 1ISJA 3L0BA 2JD2A 4G5OA 3D6TB 4TRJA 1E1NA 3ZQKA 3ZU6A 1C1XA 2JJ1A 1J7KA 2E6KA 3W3ZB 1P7VA 3AGPA 4RF3A 3WQBA 1YOVA 4B35A 2DP4E 4NENA 5P21A 4TQGA 2DQYA 3OY2A 4GGOA 2WIKA 3TOSA 1UZNA 1OAOC 3ADDA 1JMKC 4PQFA 421PA 3NBAA 3BCHA 3EN0A 3KR0A 3I2FA 2ICAA 3PGXA 4IY1A 3VJLA 1Z7GA 4PWYA 1X87A 2HWXA 2PD3A 5BW5A 4CG2A 2E4XA 5KMGB 1PSWA 1EUZA 2Y1CA 3L1KA 1PQWA 1Q7GA 2B1JA 2HK8A 3AZPA 3E8SA 1J8VA 2EDCA 4R8RA 2YFKA 3CX3A 1R64A 2FB9A 4FC6A 5EWLB 3F4KA 4JEMA 1R12A 4LIPD 4YJ3A 1V95A 3AR3A 1CZUA 5DNUA 3GLGE 4PO9A 1NMXA 4CBVA 2OP0A 1M2OA 2WJPA 2X0NA 3EF1A 3AF0A 4JKOA 2GEVA 4AZ3A 4A7PA 1GUFA 2JLBA 2GKSA 4D0GA 4Z7OB 5DN6D 2R48A 4XCXA 2XUDA 1JJFA 5FPYA 3N59A 1ZSYA 4KK4A 4K9NA 1NBIA 1EFHA 2JGEA 3L0IB 2BEUA 1NUHA 2G77B 3ZX5A 2I1VB 4WZBB 3RREA 3AC0A 4XB1A 4DPKA 1IIRA 3G2JA 4FFOA 3BFXA 4L9AA 1OTYA 2CNWD 3OTHA 2GXSA 4PXSA 4DLWA 1DAIA 2XGOA 4QT4A 1NVXQ 4FOLA 2H17A 2QN3A 3ZEAA 4CHGA 1HBJA 5DNYB 1UC9A 1QUFA 4RSRA 1IATA 1RWWA 5JAMA 2HC9A 1XTJA 3GB9A 2YXBA 4ZCSA 4C3UA 1YHNA 1FNCA 2WDZA 4FFSA 1KS2A 1XRQA 2FW6A 3IKVA 2PQ2A 1ULHA 1IVYA 4HVCA 1CSEE 3FYCA 4AP5A 3CX6A 1MNQA 4OBEA 4F97A 1HDOA 5CEFA 1KZ7B 2ONKA 3FFTA 4J16C 2ZUDA 3K0FA 2B98A 2BKAA 4A2WA 4BMZA 4CF5A 3CZ9A 1QDUA 3PNYA 3D0QA 4XGNA 3OZWA 4QGAA 4EX7A 1KC1A 5IH7A 2SECE 3HEAA 1EM6A 2O7QA 4JSTA 2HPVA 1E59A 2C96A 2WVJA 3KBBA 4C88A 1DKUA 2WUGA 1KZ4A 1ZA2A 4DF3A 2BMJA 5HP4A 3W78A 4P0QB 4LVCA 2D1RA 3TLAA 2MSCB 3WXBA 4YAGA 5L3SB 1Y4SA 3FCOA 3SSOA 4MUXA 2WVGA 1K66A 1LVUA 1X9GA 4Q9AA 3OG9A 1B8NA 1B0ZA 4F2HA 1V1RA 1Z4NA 2A3NA 2O14A 3N7AA 3QFRA 5HQTA 5D8DA 1M72A 2FEPA 3B6JA 5CLQA 1NLUA 2O5CA 1OUMA 1V8ZA 2CL6X 4J75A 2E37A 5AUOB 2VHCA 5BPFA 4DR1B 2YMPA 1SG6A 1SVMA 2Q1UA 2J0EA 2WHYA 1CFZA 1ZD9A 2QL6A 3FPHA 2AZTA 2WJIA 2ZJ5A 3H0KA 1DTWA 1JWBB 3V00A 5EJ5A 1SO8A 4L9SA 2PYZA 4UNNA 3FRIA 4AO6A 1KHTA 4MQEB 2C61A 2XEDA 2IS2A 2EFDB 2WF5A 2WAOA 1MR3F 2XDYA 1IPEA 2J3EA 4Z99A 5H16A 1GZVA 1RM4A 4O4HA 3FHTA 2CVHA 4FI3C 1HQYE 3T3MB 3GNQA 1FDWA 1TLLA 3INYA 1JU3A 4G2TA 4LBWA 2BUBA 5KNLA 4CF6A 4CEJA 1QU3A 1AKMA 2IDJA 5KB3A 3AQ4A 2WUWE 4XD2A 3OKAA 2PLNA 3DZJA 4LBZA 1IJKA 2V7BA 2V9CA 4D3SA 1RLMA 1W34A 2HFJA 1KPIA 1C8VB 5KC9A 1DLIA 2CVZA 1FSSA 1M34B 1ENOA 1RYYA 5G53C 3IR7A 4TYMA 5DYTA 5F1YA 3VPCA 2CHGA 1GRNA 3C3CA 1QC5B 1U94A 3IVXA 4WADA 1MFPA 2ZJAA 4H3HB 4AS3A 4O0MA 1QH1B 5AW2A 5ITWA 4ID9A 1JA1A 1C7IA 2V7XA 3CZPA 4Y98A 1YA4A 4Z5XA 4AUNA 2F1OA 1XMIA 4PW0A 1OIXA 2AS0A 4YCAA 3PQ3A 1SIOA 2YVKA 2MSWA 3JW8A 3R6DA 4GO1A 1YDGA 2W2XA 1K68A 1K63A 2WIJA 2CV2A 4G9GA 1ZIOA 4PQGA 3ZPXA 1FRVA 4BX9A 3KO8A 2YWCA 1O97D 2PSDA 1KEUA 2VRCA 3N8NA 4L02A 1W6UA 2C3PA 4QODA 3N0RA 4QAJA 1NJ1A 1ZN2A 2NUPB 2YQZA 3BFKA 4X1OA 4CM9D 5L3VA 3BHIA 2HA2A 3IT0A 3O38A 3SHWA 3W5DA 2WPDA 1QCDA 3EW7A 1Q7TA 3TXXA 1Z07A 3WSTA 5FFFA 3J81k 4RMIA 3MMXA 3REQB 3L8CA 2HTFA 1NMEA 2VJNA 1ISIA 3GEIA 3HKEA 3NEJA 3PLRA 4XX0B 1H0SA 1L5WA 1N0UA 3G49A 1Y1PA 2PUTA 4R81A 8ATCA 1RE1A 2VJQA 3KSZO 1VKJA 1XU7A 4IEEA 4ZOLB 1GUDA 2D00A 2GAJA 1U2PA 3H9UA 2ERYA 4L28A 5AK3A 5T7BA 1ECJA 1AC5A 2FZWA 3LY7A 2I55A 4MV4A 3ODPA 1XB2A 1YO6A 1EA5A 3D9QX 4MKIA 5CW2A 2QRLA 2FMXA 4OI1A 4C5AA 4MV1A 3E70C 2CFSA 3Q9SA 3HCPA 1Z6XA 4IIUA 4RKRA 4YJGA 3R3VA 4E32A 4POOA 3GRVA 8MHTA 1KXZA 3RSZA 1PEYA 3Q9NA 1U0JA 1JQEA 4FNMA 4IIJF 4FSXA 1ZWKA 2H7XA 4CQMD 1QDLB 1SVSA 2ZK7A 4K8RB 4EI2A 4ZHQA 3EUFA 4EPXA 4E5SA 2YIJA 3GZNB 3VKHA 1K5DA 2IHZA 3M3PA 1L5RA 4PGFA 3HZHA 1RP7A 2ZBRA 1ZCBA 1LX6A 2GM3A 2O7VA 5G3YA 2QNBA 5JS8A 4NE9A 2FDRA 2VRBA 5HIAA 2WJ3A 2OZLA 3AW8A 3IIKA 1CIJA 3JWHA 4H7EA 4ISCA 1M9NA 1TZMA 4L4YA 4WXEA 3GMDA 1NSYA 1E1CA 3ZWNA 4DGSA 4EGQA 3RASA 2ZQZA 5L4LA 3GEHA 3LUBA 4JL8A 4UVGA 2VQDA 1OWLA 2P65A 4PU0A 5J5AA 1LGYA 3QVLA 1XEFA 2BRUA 2QE6A 2V6MA 1YB2A 4RUKA 2QLBA 5EKTA 4ZT7A 3K5WA 4D4KA 4KMMA 2Z9DA 1JPNA 3AM5A 3R5FA 1XU4A 3BH0A 3EIXA 1HDEA 1Q0RA 3P0HA 3RTBA 2YR0A 3QWAA 1U5CA 3FA2A 1Q44A 1M1UA 4BU1A 821PA 1KQFA 3MPOA 3WA6A 3O8QA 5C3MA 1AIPA 1WAMA 2C92A 2J5XA 1Q3HA 3ICPA 4TGLA 2J45A 1A5BB 4XB2A 4X7BA 3T7RA 3ETLA 2W6IA 4M9ZA 2FFQA 2CDNA 1E4EA 4DCJA 5AJZA 3IEIA 2B92A 2JFVA 3OPVA 5AD1A 3LJKA 2QM0A 4OTZA 1TJ5A 3ZY3A 1Z38A 5CDYA 2WVAA 5TPWB 4ZYVA 3KV1A 3QVXA 5A62A 4QPNA 2PO7A 1KNQA 4L16A 3SWWA 4B82A 2WWYA 1NP7A 4RQBA 4CKEB 2VEOA 1GUYA 1PDWA 3COZA 4N5MA 2GPNA 1WU7A 3DW1X 1SHJA 3D02A 2JKZA 3MCAA 4RL4A 4TQUS 3ZHYA 5DI3A 3AI2A 4X91A 3WWCA 3VR2A 2EIXA 4BEBA 3NOQA 5JE8A 2JGKA 1RRCA 4JVMA 4L07A 5I9MA 4LAFA 5C5CA 3P32A 5L3RA 2WF8A 1NTRA 3KYJB 3N0TA 3F1KA 2QM8A 2WG2A 3F1LA 3OEEA 5IARA 4G4SO 1FDSA 1CEYA 2GEDA 3G23A 3GLHE 3OZGA 3F5QA 3QVOA 2JFYA 4KH1A 4U2FA 3HA3A 1B16A 2R3SA 4OYRA 3CJTA 4BP1A 4JYAB 2HIMA 4XQ0A 4WE3A 2HT1A 1X19A 1I6MA 1JB1A 1W0KA 1CQPA 1Y8CA 2C2ZA 2R66A 1E63A 2AHRA 2PKQO 4V0KA 3IR5A 1CRZA 2CE7A 2D2IA 4XWAA 3E9MA 5CXUA 4XJTA 2AN9A 2WSYB 2YJGA 3JQPA 4V0SA 4BEJA 4Q01A 4C29A 4BKPA 5FEUA 3AVYA 5E1OA 1Q95A 3PGKA 4L3WA 4R41A 3MJTA 3VU3A 2ZI7A 4MVJP 4ZN6A 2YZGA 1BFDA 2PL3A 5KMGA 1T1GA 4I2NA 4S04A 3AJDA 1OBFO 1SXGA 1X1AA 1NU8A 2FEMA 1MN6A 1UDCA 2RHWA 4OG2A 4KO4S 4UU7A 4Y2RA 4W6QA 1YZLA 4BJ1A 3NM6B 3K9NA 4BBZA 3L0CA 5AR1A 4ZQCB 3VX3A 1P44A 1MVOA 1R16A 3NGXA 3OU7A 4TTJA 5E2AA 5FOXA 3VSAA 3PTAA 3RAFC 1XMOB 2OWEA 3O3NB 4BHTA 1N7GA 5C8YF 5KUTA 3P71T 1V71A 1DKRA 2NTYC 2QAGC 2GZAA 4O2BF 1Y42X 4AUKA 4CLDA 4CMHA 1R9MA 3EXG1 2IPLA 2Y0EA 1IUNA 3GP3A 5KDLA 1VI2A 2ZYDA 4C7KA 2HPZA 3ZZ1A 3RGGA 2G1JA 2OKGA 2VPYA 4HYEA 4F38A 5K0SA 2EJVA 2Y66A 3ZQ6A 1S3SA 5GTDA 2C7RA 1O8CA 1L4NA 4LNUA 1PV4A 4O59O 3X1JA 1YDWA 1XUOA 4JXXA 3DP7A 1OIWA 5D1NA 1QFYA 3FR7A 4G37A 1SJ9A 2HUNA 3GJRA 1SBIA 4C4SA 3NHAA 5FAXA 1VLQA 5KYYB 4G89A 1J09A 4P34A 2YOGA 3R3HA 4EKYA 1PJCA 2DTXA 3P97A 1E2MA 4RACA 2C2MA 4BLUA 3PVZA 4KMSA 4V0QA 5IJWA 3OE7A 1RI2A 2I62A 4LQLA 3O8CA 3HZOA 3EC7A 4F8YA 2BEKA 4KQ9A 5EPOA 4Z0TA 3H1EA 5I8ZA 4HO1X 3AVWA 2Q2WA 2N42A 1XEWY 2YZ7A 4OAOA 2AF4C 2ZAYA 2VXCA 2VUIB 5J40A 5LP1A 4W5QA 1CHNA 1U4NA 4ZTUB 4Y7CA 4MWZA 2FXIA 4YQEA 3CN7A 3AEQB 2FX2A 2F8TA 1E1DA 4GZ6A 3DTVB 3KEOA 1F51E 4GQIA 5A9SA 4LF8B 2ZIGA 2GAAA 3ETEA 1OX6A 1JLKA 1H2YA 1EM8A 3F5DA 4DLKA 1DQPA 1M1NA 1XYGA 4O1IA 4G4JA 4TWAA 1BWPA 4ZZ1A 6CHYA 2NUAB 3ZW7A 1B7GO 4E09A 1JG1A 2P9HA 3HRIA 1MIOA 2PUWA 5AO9A 4ED9A 2QAIA 1JJAA 1NI4B 1M54A 2R7NA 1OFUA 2WSSD 3OX3A 3MTIA 3T1VA 3T5BA 3T94A 3T0GA 3FETA 1FY2A 3RAPR 3GH3A 4P7BA 4XUGB 5DX1A 2PTHA 1YL5A 3GCXA 4HUQA 2OCIA 3KKOA 3TVYA 4OY3A 3G2MA 3JR3A 5AVXA 2AC2A 1RQLA 1GPDG 1L5MA 3M5CA 5EE5B 4BQQA 2CMGA 1V8OA 1HF3A 4F6CA 2UYHA 5EIHA 2Z3WA 3F7TA 3G9QA 1Q16A 1CU1A 4U7GA 2JBAB 3QOYA 3EASA 3O4VA 1B41A 1X9IA 3DEFA 3UOWA 2DT8A 1YBVA 1GGFA 3G2NA 3RD5A 4R9NA 3U7EB 2VXOA 1WDTA 4LJLA 4D46A 3D6NB 5IYZB 3TYXA 1FTNA 2YHIA 4Z4IA 2QSUA 2B1RA 1AQIA 3E81A 3SU8A 4L3VA 3LBIA 2BBOA 2PM8A 4DV4B 1UDXA 3A1EA 4HTAA 4LKRA 3OLVA 4ARAA 4I08A 2EP7A 2WRZA 1WUJS 5J2TA 4BO8A 3V7YA 2XKAA 3VNQA 2HUPA 3CLSD 3ADPA 2UVDA 1G5RA 3EIOA 2UKDA 1ZD3A 4PNPA 2ONCA 4JI4B 3M6WA 4QM6A 1CFJA 1NVGA 4RFSA 4UHEA 4XZ3A 2DUWA 4CF7A 2MSEB 3O9ZA 3FCSB 2LCQA 3NT4A 1T5OA 2M6KA 2C8JA 1M6EX 3MT7A 3KPYA 5LCXA 3BILA 3FCAA 1WVGA 3A0UA 1ADYA 3MSXA 4MV5A 4S0XA 3SN6A 1RLUA 1TU0A 4R01A 4TPKA 2NWQA 3R77A 4DNFA 4JR2A 4M8NE 2E4UA 4E15A 3ABIA 2QIOA 2QTVB 1CVIA 2WWRA 3HY3A 3BJRA 1E9BA 2FV8A 1F6DA 1KY5A 3IKJA 4IFBA 4ND2A 2EQAA 3EXHB 2VK8A 3BHMA 1KORA 4QUKA 2WQ7A 2ZYTX 3MTDA 5CFRA 4XVCA 3QUTA 5MDHA 2Y93A 1JR3D 3B9QA 5A4KA 2BSXA 2EEZA 4OGFA 4U6QA 3TNFA 4MIEA 1K8YB 1NUQA 1J0XO 2OVFA 3UGKA 4TRNA 3FTCA 3DVQX 2AVDA 3PYXA 2H1LA 2CCJA 1VB3A 2Z56A 4C0HA 1NLMA 4QQFA 2QD4A 3UH1A 2M6LA 2QU7A 5FLEX 4AZ3B 1DJMA 2GPJA 4L8YA 3V5NA 2Z09A 4US0R 5JANA 2BH2A 4LDJA 3TE6A 4GPZA 1C0IA 2FE4A 4C0XA 3WKCA 3NC4A 3OF5A 4G1CA 1YRAA 2IP1A 1OZAA 2P78A 3TQHA 3HHEA 3DUFB 1ZJ4A 3UTCA 4BNJA 5E1BA 4NS1A 1RABA 5IRCD 2H7YA 1GUAA 1DO2A 3FWPA 3HCBA 3HDHA 2P40A 3MXOA 2B37A 2QVYX 3WB1A 3U81A 1GNRA 2B2NA 4JI5B 3AINA 2IHYA 4I5EA 4S1WA 4U1RA 1ZK4A 2PBFA 4MJXA 1KQGA 4YHHB 5EXXA 3GDWA 3T06B 3VZRA 1F48A 1E2JA 1W52X 4WESB 5J4LA 1ZXBA 1MW9X 3ED5A 2ORYA 3L6BA 3O21A 4PFJA 1ULAA 3RLFA 1GQFA 5B1HA 3RT9A 1N7JA 1YVUA 1SCAA 2JI4A 1RJFA 2OB2A 3FTPA 4IOKA 4WKBA 1S6YA 4DTCA 2AN3A 2FETA 2G3YA 4ZKEA 3CXRA 1IAVA 1OH6A 3RANA 1H69A 1JU4A 1QZ3A 2F9FA 3Q3VA 4W63A 5ALFA 5E7QA 3WNQA 1JG6A 5HDBB 4N6GA 5TARA 1T43A 2GD6A 3CNLA 2F9LA 4HHEA 4OJTA 4OLBA 5L95A 1NVWQ 1EFTA 5EZ5A 3GNSA 4CUJA 2Y2UA 4F06A 4QM7A 4YA6A 2WF6A 2IUSA 1FFCA 1PLLA 2Q28A 3R5TA 1UK8A 2NUBA 1C30B 2B61A 4L9RA 3ZXYA 3L8ZA 2IF0A 3O0TA 1GG2A 3N5CA 1UDBA 2BMEA 1TGYA 3RUEA 2Q6KA 1W1WA 1JKXA 1CS0B 2GEUA 1HGXA 4JIMA 4YRCA 4I9HA 5EI5A 1ZN9A 5ANRB 3R5KA 4COOA 2Q3DA 4BV3A 3BYZA 1WUIS 4DYHA 1V6AA 4EB6B 2FJPA 5CBPB 3DR5A 2I65A 4LRTB 2G83A 1XN4A 3JYPA 6GPBA 3EWSA 4DN6A 4XQCA 1I3LA 1I4LD 2XADA 1H8HA 5COQA 1L8QA 1HUQA 1WG8A 1GHTA 3GIDA 5B3AA 4C22A 2W4QA 2MR6A 2UU9B 2AMJA 5HW0A 3BG5A 4A0HA 2YUTA 4KQ1A 5AUNB 3BM5A 1R8YA 1BTOA 1W19A 3K0KA 4DV1B 3T3OA 4Q4CA 1RFLA 3TKAA 3UMCA 4FWTA 5HOQA 3S27A 5HS6A 2YYSA 4H6WA 4TKUA 2WT4A 5JSHA 1L4LA 5ILOA 2ADMA 4KIGA 2DTDA 4B6RA 2VH5R 4PRLA 4TQ9A 1ITZA 4EUFA 1FFEA 2F00A 1PGOA 4JJ6A 3QGMA 4QA9A 4HV4A 4I1UA 4IQGA 4WXPA 4UD6A 3PFWO 4URZR 1PS8A 3FPCA 3QE0A 2FWRA 1KH3A 2IVFA 2WF7A 2Y1KA 1SCJA 1SOMA 5I7UA 5H81A 1N36B 1P0IA 2OXFA 3K6RA 3ZBPA 4RFSB 4D98A 4CMEC 1YQXA 2INGX 2VP3A 1DX6A 5KYTA 1P4SA 2ZSJA 1XZDA 4NZPA 4Q7JB 4EYQA 1LPAB 2GEJA 1GVHA 1MXFA 1RJWA 2GM9A 4TTTS 4DCOA 1ZVVA 2IV7A 1LQUA 1Q91A 2PU7A 1BFUA 1GOTA 1BKDR 2XTMA 4XQGA 3ZZUA 3V1NA 4HADA 1XCPA 2UAGA 4RZ2A 3T0FA 3U37A 5CB6A 2QL5A 4HRVA 2BIFA 4FNOA 2FF7A 4B6QA 4M37A 1H2ZA 4Z7NB 2FQXA 4AJKA 2GPBA 4GD3Q 3ZJ4A 3P27A 3Q3EA 5JD5A 2IRWA 3BB1A 3H83A 1QE5A 4JJ8A 4WVFA 3TQTA 2QNRA 1Q7CA 1X6VA 1QYWA 3BTUA 3NATA 4BMPB 1KY2A 4J07A 5DEIA 4GHWA 5K3CA 2IZ7A 4MDHA 2XBMA 5LNK6 1QQ7A 4OXRA 2IP4A 1XDGA 4Q48A 2JAQA 4Q9DA 1B0UA 2AR0A 4N3NA 1Y8ZA 3UCFA 4B6GA 2YN2A 5DTIA 2ZIXA 2GCNA 3ZGOA 3VYVA 1I3KA 4Z8XA 2VR1A 2GBLC 1Q0LA 3HYTA 4JC8A 2JS7A 1IQ0A 4L85A 1XNRB 3NUZA 2I1LA 4EY3A 1QRSA 3DE2X 1DARA 2AI3A 2Z30A 5FFMA 4HWKA 1CYDA 2UYQA 4B3IA 1SD2A 3L8YA 3ZXUB 4E94A 2I8CA 2IIBA 4PC3A 4M8IA 5K3OA 1XCJA 3OOHA 4MICA 3VR6D 4QDOA 1FQJA 1XEXB 1LTKA 3OE1A 2RI0A 2HF2A 3W8EA 3PQFA 5ELMA 2BCEA 1GGKA 1GGMA 4X9XA 4RPKA 1IULA 2WWFA 5M5BA 1KI6A 1LLFA 1OASA 1BJRE 2A86A 1L3BA 5KBYA 1WOYA 2YN4A 2YXLA 1T0IA 3PR1A 1UBTS 1OXKB 2IITA 1I3OA 1R3UA 3GEBA 1TF5A 1GAJA 4Y2VA 3SJ7A 5IX8A 2JATA 4O8ZA 3L6UA 3OZRA 4JKYA 4RM2A 4AZVA 2ZYRA 3D4BA 1PLKA 4P4UA 1PFUA 2IWRA 3LLSA 4QYWA 1KWKA 1U81A 2X2EA 2XRZA 2W93A 3EZGA 4XYEA 3KVNA 4WXYB 2W2MA 5TMDA 1A7UA 4AF6A 4F4JA 3PQDA 1BROA 5HF8A 4WOBA 1I32A 2WAAA 5JS1A 3HH8A 2H2IA 3EVBA 2BHSA 1DAEA 1XQXA 2POCA 3I04A 1L3CA 4ALKA 4BNKA 3SHVA 4KVGA 1GN9A 2C9BA 1TW2A 5IJ0A 4Q7KA 3M6LA 4NCAA 1EJ2A 3BBLA 2QRZA 4TZKA 2QZSA 2BVNA 3IC5A 4P9NA 4QBFA 2OLKA 2GNOA 1QG0A 4HDOB 2CHUA 3H2YA 4C4YA 2YZKA 5IM5A 5KNBD 2JAHA 1K5PA 2VOEA 3DXXA 3MJRA 4GRDA 3UHJA 3IUJA 3STXA 4DDUA 3H19A 3PNKA 1N78A 4LBYA 2IYUA 3PUJA 1MAAA 2O57A 2OOSA 4PSUA 3M4XA 3WMRA 4UTPA 3ZDDA 2V4UA 2OGWA 2L18A 1G98A 2ADOA 3RPEA 3FCXA 1P6XA 1SUEA 1HTTA 4KFSA 5H70A 4DQLA 2FLKA 2VKTA 1T5LA 3KOWA 1L7MA 2PA0A 2XODA 4D8UA 1USWA 3UT5A 4PLTA 1VGQA 4I55F 1QIMA 3OJ0A 3AP3A 3HN7A 1CETA 2QXTA 4IGFA 4IOMA 4TUYB 1EU1A 1GPBA 1F5SA 1OKKA 4CKBB 1WXWA 5E6SA 3GRCA 1VCNA 1P2VA 3LWBA 1DTSA 3OD1A 2JJ2D 3PCTA 4FDAA 1T0BA 5JLJA 3OHPA 4LC1A 1HL3A 5FNZA 4EA8A 4HNQA 4J7AA 4I1RA 1E4YA 2BH9A 2PVPA 4ZK6A 1HE1C 3U5TA 1NR7A 1O57A 4JLAA 4UZEA 3PL1A 4NECA 3BXFA 1KAOA 3VAAA 5K1ZA 1M34E 4MAMA 2EKDA 3BSYA 3N2LA 4RD2A 1MC1A 5DHFA 2HSEA 2LIPA 3GUUA 4YCCA 1IHXA 4O4JA 3EH2A 2NXNA 4K40A 4WVLA 1Z74A 2OBNA 3R0ZA 2HQ1A 1JPVA 3ILHA 1Z6YA 3O94A 3N0VA 2C82A 4G9EA 1DOHA 1QOQB 4R83A 3HFRA 1XBTA 5M3BA 2PPVA 2GH1A 4HWGA 3OF2A 4Q4JA 2OXTA 4GOOD 5HCIA 5D1HA 3Q72A 1T2UA 2JANA 2IH4A 1T3SA 3A6LA 4K9OA 4GIBA 5C37A 2XRFA 5AKLA 1BN7A 4I5DA 1UC4B 3ZR4B 1IY0A 1LRKA 1MAWA 2Q3LA 1ZGAA 4PYKA 1PZNA 1IY9A 3IEUA 2I4TA 2B1QA 1U4OA 1EGQA 2P3QA 5CXSA 1J2UA 2I76A 2Z5LA 5L7YA 5KTSA 4RJKA 1ACLA 2HNKA 1U1EA 4BX8A 7ABPA 3OQJA 4X00A 4M1WA 1V8FA 3VO9A 3ODGA 2P9EA 4YJDA 2ZYHA 2AOVA 1R6XA 4ZYZA 1WB9A 4M7WA 1X7ZA 2Y1OA 3IP8A 4C07A 3KEQA 2DGDA 2WE8A 3FOCA 2W42A 4F5YA 3ADKA 1NQTA 5KQLA 1FYFA 3LLUA 3RVJA 5KYYA 1XHEA 2I6TA 3USZA 3H05A 3QVGA 5BPHA 1YDHA 2QRUA 2JFUA 3QU7A 2A14A 2V7QD 4ZHSA 4WN9A 1VJTA 3RJ5A 3TFOA 2WG1A 3CVUA 4TL7A 3OMXA 2Z2XA 4H35A 2VP0A 4OGWA 5FRDA 5DXFA 5EE1A 4ZI7F 3QKWA 2ONJA 3B1VA 3ZD7A 4QJ5A 1FXUA 1Z0JA 4B48A 3DVRX 1TVCA 1ZZEA 4PZUA 5G0TA 5JRDS 1I1NA 2W6JD 1QPZA 5JRJA 1JAYA 1MQAA 4RDCA 3FF1A 2NZ8A 1YTUA 3ICVA 1SN7A 5A9SB 1EIWA 4WDQA 2QU8A 3R24A 2F3UA 3JXEA 2AN4A 3RS0A 5ADWA 3AVTA 2XYGA 5KKCA 2