1ZI8A

Crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVASKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTGSSGYVASAAALANERTLDFLVPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi8A00
4X91A 1BN7A 4BCBA 3WL7A 2OCLA 1XLVA 3B12A 2XUJA 2BKLA 3G02A 3C5VA 4M0EA 3BIXA 3L1JA 5FLKA 5EIAA 1ZGCA 5JZBA 1MU0A 2R8BA 4DNFA 4C88A 3V1LA 4PV7A 2DHEA 5HFAA 2WHPB 3DKKA 3D2BA 4KE9A 3OTQA 4H7FA 1YS2X 4OB8A 2VF2A 1A8UA 1E66A 1JKMA 3O4IA 2I78A 1LPOA 1QZ3A 3I6ZA 1XKLA 2YYSA 4BAZA 2HA5A 5JAPA 3WL5A 3AIKA 1JJIA 4RNCA 3VJMA 2XMBA 2JEZA 5KWIA 1CUZA 5AK3A 3WL8A 5JAHA 3STYA 5FPQA 3WKBA 3ZWQA 5BOVA 5AM3A 4PNZA 1U8EA 2H7XA 3D7RA 1QIEA 4DM7A 4BBZA 2ACEA 3BXPA 1XRPA 3DOIA 4UHHA 3W04A 2CUTA 3BF8A 3KSRA 1SCQA 4JH0A 3WYNA 1H2XA 3ED1A 2PM8A 3EQ8A 5EHQA 4W1RA 3QBJA 5C8VA 2BFNA 1L7RA 2AJLI 1DU4A 3B3QA 2G5TA 2PBLA 1UK6A 3C6BA 4WY5A 5CURA 1E3QA 5K3FB 1TCCA 2UZ0A 4X95A 2HM7A 1XZJA 3YASA 5AOCA 5FV4A 2ZYSA 2X8BA 2QZPA 2HA3A 4KR0A 1LZLA 5HF5A 4DMHA 4H77A 4LXHA 3WWEA 4FNGA 2I03A 4U2EA 1FSSA 3L1IA 1KU6A 2ZJFA 5FUMA 2VT7A 2WFZA 1GKLA 2NW6A 4V2IA 5ALIA 4IQ4A 4YK7A 3HACA 2PPLA 4N5HX 1C4XA 2OQVA 2WTMA 2QJRA 1JJFA 3ESDA 1PFQA 2HL6A 1VOTA 4OCZA 4DNQA 5AK6A 3W05A 3D4LA 5IKXA 3N0TA 4WCVA 1N5RA 2V9ZA 4QDOA 3HZOA 5FKJA 3C70A 1CPYA 3OURA 3V1MA 3BE8A 4INZA 1YSCA 2Y2UA 3BDIA 4X97A 3H18A 1TQHA 2X76A 2XQJA 4UUQA 4UHDA 1UK9A 1AURA 1CUSA 3WJ2A 1MX9A 3IA2A 4Q1VA 1DT5A 1E8DA 3O4HA 1VE7A 5K3EA 3G0CA 1XLWA 4FKBA 5DYWA 5LYYA 3ZLTA 3WWOA 2XMCA 5KWJA 1A8SA 1K5PA 2ZJ7A 4B6GA 3WK9A 1KEZA 3DQZA 1CLEA 1VXRA 2AJCA 1J2EA 3DCNA 2BGNA 2GYWA 5AKYA 3PFBA 1YA8A 1EH5A 5FDFA 5AKGA 4BC0A 1W75A 5A62A 2JGIA 5EFZA 1CUDA 5T4EA 1EB9A 3O4GA 2GYUA 2Q0XA 4Y2VA 2DCMA 2PSEA 1UOPA 1U2EA 4AMYA 4QE3A 4BRSA 1J07A 4P08A 3WYDA 2ZSIA 2WUEA 1G4HA 3IURA 2XUIA 1W1IA 3T4UA 3AZPA 4HVTA 1Y7IA 4KE6A 4X94A 1EVQA 3GA7A 1BCSA 2OLEA 3HRHA 2AJBA 2PSJA 3F97A 2HHAA 4QWMA 5AKIA 2X5XA 2XMQA 2VA9A 4MYSA 3DOHA 1K6EA 4D9JA 4MEAA 5AK4A 4MQLA 4XWGA 2CJPA 2XLCA 1SCIA 3FBWA 1MX5A 3STTA 3CN7A 5CH3A 4LXGA 4UFOA 4G4IA 5LZ8A 1XQVA 5AKHA 3QPAA 2V97A 3LIPA 4KEAA 5A7HA 2B9VA 1GZ7A 3OOSA 4B9AA 3FSGA 4BRZA 3LIIA 3BWXA 1PV1A 4OYYA 2WSLA 2H7CA 2XQKA 1CUCA 2C7BA 3WL6A 1TAHA 5JAUA 2K2QB 3WJ1A 5IVIA 4B83A 2ACKA 3D2AA 4IHAA 4J0IA 3F9CA 1HDEA 4Y2QA 3ILSA 4Y2TA 1CUJA 3I2KA 1E8MA 3IVMA 1XZEA 1N8SA 1LBSA 4F21A 3G8YA 4KAAA 4DLNA 5CW2A 4CCYB 4BP9A 1LLFA 4LIPD 4Y2JA 3AJAA 4DIUA 1Q83A 4FFVA 2OGZA 5AM1A 4BVLA 1IZ8A 1BCRA 3V1NA 3DD5A 2FX5A 4E46A 1YAHA 2J4CA 2XUOA 4XX1A 3PUHA 6YASA 1AGYA 1GPNA 3IUMA 1DQZA 3I1YA 3PE6A 1H22A 1YS1X 4UBNA 5HCUA 3D2CA 1EDBA 2CEKA 5JAOA 2ZYRA 5HF8A 1XZIA 5BWCA 1WPRA 2V96A 4H7HA 4WJLA 2JGFA 4O08A 3RKSA 2C5FA 3G0BA 4BAUA 4EY5A 2PX6A 1CUGA 3AILA 5JIBA 3AIOA 4H7EA 5CT9A 1WB6A 4CIAA 1JU3A 5LKRA 1XZHA 2GBFA 1JI3A 4X3CA 3MVEA 4IH4A 4W63A 4BDTA 1F0PA 1ISPA 2WIGA 1GKKA 2WIJA 1DX6A 5EI5A 2XUKA 4N8SA 4Q3OA 3VISA 1HPLA 4Y7DA 1VLQA 1AX9A 2XMZA 4JYPA 1GT6A 4HAIA 1CUIA 3EQ9A 2W22A 5ALKA 1SC9A 3VKFA 1ETHA 1WOMA 5ALNA 1LZKA 1EXWA 1CRLA 5JARA 4PO3X 5ALVA 1ZI9A 2XQGA 3S8YA 1TK3A 4H7DA 4EY8A 4ZXFA 1XFDA 4B82A 1EI9A 1CQWA 2VAXA 1LPMA 1UT6A 1CUXA 3CCBA 1IUOA 5AHXA 1R50A 2AXEA 4QA9A 5ALEA 2W6CX 4DYHA 1YCDA 4G8DA 5CBKA 5EGNA 3G0IA 4HXFB 3E1GA 3FVRA 2LIPA 5I8PA 5KBYA 1ZD4A 1EHYA 4J0HA 3WLAA 5AICA 4EY7A 4IO0A 3NWOA 4X71A 1HQDA 2DQYA 3ZLUA 4BDSA 3KD2A 4QEKA 1BU8A 1BEZA 1R9MA 5DWDA 2VAVA 1VZ2A 2BUCA 1EX9A 4GWLA 2DHCA 1W6RA 1QO9A 3RK4A 4KAJA 5D6OA 2WQZA 2VJBA 2VQ6A 5H3HA 1YB7A 2ONCA 2C5GA 4MEBA 5CXUA 1WHTA 3QITA 1WM1A 3FLBA 1IUNA 3FYUB 3I2HA 1QJ4A 2OCIA 4L9AA 2C0QA 1WB4A 4HRYA 1ZI6A 1VKHA 4H18A 1JJBA 2HRQA 5C7YA 4F60A 1XZLA 3ESBA 3ICWA 5HZGA 4U2CA 3C5WP 1QIDA 2JEYA 3R40A 4DMKA 3H04A 4ZRDA 4G9EA 3WWCA 5HQ3A 5IVHA 3WKAA 2EDAA 3EF3A 2DR0A 1XZBA 4EHBA 2PVSA 1A7UA 2GZRA 4EZIA 3L1HA 4U2DA 4UPDA 3DYVA 1ZOIA 4F0JA 1QFMA 7YASA 4Q3KA 1CUHA 1OILA 4XVCA 5LZ5A 1TIBA 1ACLA 4LKOA 2ZYIA 3QH4A 1UOQA 2OXEA 4FTWA 4LYEA 5ALDA 4OB6A 3OG9A 2YH2A 3PUIA 2XUFA 5AKZA 4MYDA 4J03A 2P8SA 2H7YA 3LP5A 3JWEA 1CEXA 1XRRA 3WK5A 1EK2A 4Y9SA 1BE0A 5CXXA 4DSAA 4B81A 5DJ5A 5ALPA 2QTBA 1GPKA 3M83A 2ES4A 4ZV9A 1SFRA 1ZD3A 4C89A 5AM5A 3PICA 3E3AA 1Z68A 3G7NA 3FVTA 3G0GA 4G4JA 4AO8A 4BCDA 5JD5A 4KRXA 5KREA 4J3JA 5HF6A 1QIJA 2DHDA 1HBJA 4HRXA 3FCYA 4KJXA 2XUDA 4FLFA 1UKCA 4TGLA 4AQDA 3WKCA 1MNQA 2XMRA 1Y7HA 1ZIXA 5EIHA 3RM3A 3WKEA 3GROA 5ALOA 4ARBA 3WMRA 1XRMA 3C8HA 4QDZA 1E5TA 4AO6A 4DTCA 2HADA 3WQHA 2OAGA 1G66A 3N2ZB 1T2NA 2VSQA 4Q82A 4CIBA 1ZD2P 5C8XA 2CBGA 3KXPA 4L0CA 3G9XA 4N5IX 2OCGA 1DX4A 4BATA 4Y2RA 2RONA 3O4JA 2O2GA 5D3KA 1O6GA 5YASA 1M33A 3IUQA 4X6UA 1CUYA 4AZ3A 2XQIA 5DTJA 4W1QA 3O95A 5AIBA 3MGAA 2B4KA 2CMFA 3FLAA 5HK9A 3WK4A 2CZQA 1R9NA 3V1KA 4CFSA 2XB6A 5K3DA 3FLEA 2PKYX 3WA6A 3M3DA 1KU0A 4UFNA 4DMCA 4WDRA 1AMNA 1QIIA 3P2MA 4UFPA 2WJ3A 4AN1A 2WFLA 2HDWA 2ZSHA 2H1IA 1HKHA 4GXNA 4FMPA 4ZGBA 4K5QA 4PW0A 4XJVA 3W2TA 3QMWA 2JGMA 4JNCA 4HS9A 4X6YA 3Q8WA 4DMFA 3QPDA 5C81A 3I2IA 4J0GA 4BAGA 2QJWA 1MAHA 2I3DA 4C87A 1H2ZA 4MWSA 1J1IA 4ZWNA 1FFAA 5DTIA 5AKJA 3I28A 2RHTA 4GBGA 5CT4A 5ALYA 3HJUA 5EHZA 5JALA 4FFWA 1E8NA 3TEJA 5LZ2A 2IIVA 1QIHA 4DNPA 5AKEA 2Y1KA 4QDUA 5CT5A 1TKRA 4H7JA 4ROTA 3DKRA 3STWA 3BDVA 3SK0A 2HU7A 1CUBA 1HL7A 3HC7A 2JGJA 1DWPA 3RARA 2WHQA 4CG2A 1XZGA 4J0CA 3V48A 3WWPA 4A5SA 4B80A 2WILA 4A16A 4AX4A 2OQIA 2BUBA 3LS2A 1EVEA 2V98A 3TJMA 1XROA 3F8SA 5LP1A 3X3HA 1WPXA 1R88A 3H1AA 5JD6A 3QVMA 1ODCA 4H7KA 3R3WA 5A2GA 1TRHA 2WM2A 1B41A 1LPPA 1D07A 2XQFA 5JADA 4BZWA 4B0OA 2ROQA 1H23A 5ALZA 1GPLA 3ANSA 2QVBA 5AM4A 3OPMA 4UHBA 5K3BA 4G8BA 4GI1A 4QWWA 2WHPA 5T4BA 3STVA 1XQYA 3C6YA 4UBOA 4WFIA 4GLBA 5F4ZA 3G9ZA 3IB3A 4B7ZA 1MT3A 5HF9A 3IUNA 1E89A 3OC0A 1YR2A 4Y2YA 4AMZA 3KDAA 1ODSA 5A7FA 1FFCA 5CMLA 1UZAA 2C4HA 3WK7A 2GBCA 4RPCA 2WKWA 4UHEA 4BP8A 2WUGA 1GQRA 4RE6A 2PSHA 2HA6A 4X93A 2DQZA 1EDEA 5LLSA 4X85A 4OB7A 4JEIA 4NVRA 2QM0A 3DYIA 5EHNA 3PDCA 3PF8A 3Q0TA 1EB8A 5ALQA 1XZCA 2G63A 3VVLA 3HYSA 2JGLA 5AM0A 4L72A 1VJ5A 1S8OA 4QDTA 2FJ0A 4BVJA 3EQ7A 2HA2A 2FJPA 5FRDA 1U4NA 3WKDA 3HSSA 2GBIA 2OPHA 5K5EA 5DYTA 2Z8ZA 1L7QA 1LBTA 2QKYA 4FNMA 3B5EA 4YX9A 2YXPX 1I6WA 5LZ4A 1MAAA 5JANA 1CR6A 2XUPA 2Y6VA 4QLOA 3LCRA 5K3FA 3VXKA 4X7BA 2WUFA 1QTIA 1ZICA 2JBWA 4L3WA 3WIOA 5AH0A 1MN6A 3UUEA 1EDDA 1T4MA 3M82A 3O9VA 1QIFA 2WG0A 5T4HA 1LPAB 1XZAA 2XMSA 1C7JA 3H2KA 3WK8A 1MJ5A 2G4LA 3F98A 1AC5A 5ALUA 4UHCA 3DL7A 5ALGA 4BB0A 2C58A 5A6VA 1C7IA 1W4LA 2OCKA 4P93A 4ITVA 5DNWA 5AP9A 3S2ZA 4FWBA 4G8CA 1HLGA 2HFKA 4P9NA 3RLIA 5E4JA 3V9AA 1G5FA 1DQYA 1RYYA 4HXEB 4KACA 5HK8A 3G0DA 4X00A 1XQXA 3HEAA 3MUOA 2EDCA 3NUZA 3WWDA 2D5LA 3GBSA 5FOQA 2XT0A 1AKNA 2O2HA 2VATA 3OM8A 2XMGA 5DLPA 1UK8A 4A23A 1XKTA 2FUKA 4B9EA 2ZYHA 3R3VA 5AK5A 2WHRA 3D5EA 5CH5A 2B20A 3HI4A 4ZI5A 1BRTA 4M0FA 1YA4A 2J3QA 2QOEA 3ESAA 1BS9A 3D3NA 4CCWA 1Q0RA 5AM2A 1QIMA 1CVLA 3R0VA 2DSNA 5AKLA 2JF0A 2OGSA 1IMJA 2RHWA 5E4TA 1P0IA 4WDQA 4PQEA 4EY6A 1WCYA 4K6KA 3FYUC 3WZMA 3QM1A 1J06A 3CN9A 2Y6UA 3EIOA 1QIKA 2XUAA 3A2LA 2WIFA 4EY4A 1ACJA 1QTRA 1R4ZA 5A7GA 4FBMA 4E15A 1CFJA 1QO7A 4XIIA 4OPMA 2HFJA 1DWQA 3O9MA 5SYNA 4I3FA 3CXUA 1TCBA 3C43A 2XE4A 2B61A 4G4GA 1JMYA 4TVKA 4BE4A 2VT6A 2WLSA 4YPVA 4GW3A 1A88A 4BCCA 1CUUA 2XUQA 1R1DA 5T4FA 2HRRA 3EBLA 1FJ2A 1AQLA 1UFOA 5AI5A 3A70A 5BWBA 4EBBA 1XZKA 3KOOA 1X2EA 1GQSA 1AZWA 5HKBA 3MUNA 4EA6A 5JATA 1YB6A 3BF7A 3K6KA 1ZJ5A 4MJ3A 4WFKA 1CUVA 4CG1A 5AI8A 2VJDA 1ORWA 1SCKA 4OSEA 2ORYA 4GECA 2I3ZA 4C6HA 5K3AA 1CV2A 4UBJA 5SYMA 2RIPA 3C6ZA 3F67A 2O7VA 4M0MA 4Q05A 5AI9A 5ISMA 4J0JA 1VA5A 1NU8A 2WU3A 3NOXA 2WIKA 3ZI7A 5ALHA 5AOAA 1XLUA 2VTVA 5HKAA 5ALTA 1DT3A 1LNSA 4MXDA 1XQWA 3BJMA 4J0KA 1LPBB 4CCYA 3IBTA 4Y2PA 5JASA 2XLBA 2WTNA 3A2NA 2XUGA 2QMQA 3JYHA 2WU4A 2WFMA 4HXGA 4GDMA 3I2GA 5AOBA 3FYTA 4DSZA 1G42A 2BJHA 1Q84A 4OYLA 4GEGA 3WIBA 2WUDA 5FXMA 1XZFA 1DTEA 1F8UA 4G5XA 4Y2SA 4U2BA 3C87A 2PU7A 1NU6A 1F6WA 5I7UA 3GELA 3A2MA 3SX4A 2G5PA 5AI6A 1QIGA 1ZD5A 4CG3A 3AINA 4JUIA 3PI6A 5IVKA 1XRNA 1XZMA 2AJ8A 2AJDA 1PJAA 4W1SA 3DS8A 3M81A 3R3ZA 4N8EA 2Z3WA 5BV7A 4NZZA 4UHFA 2QUBA 4H35A 4KAFA 4PSUA 1QONA 4E11A 2PL5A 3BIWA 4QZVA 1FFBA 3E4DA 2PUHA 4MWTA 4HTAA 2BCEA 3I6YA 1A8QA 1X70A 2CB9A 1H2YA 1VA4A 1LGYA 2QRUA 3HABA 2VJCA 5DNUA 3H2HA 1B6GA 3H2IA 3R3XA 1YASA 3IUJA 3ANTA 3FAKA 5ALSA 5FP0A 4BYMA 3C6XA 4Z49A 3TGLA 3QPCA 3G9TA 3DL4A 4NMWA 4UBIA 2WIDA 2XUHA 2GYVA 5ALRA 4EB0A 3WK6A 4J0DA 2BUAA 3KWFA 4AZ0A 1H2WA 5LZ9A 2QT9A 5EIEA 5AKXA 2CKMA 2PUJA 1JFRA 4H7IA 5E2IA 3I6MA 4KE7A 3H2GA 1CUEA 4FLEA 5HFNA 4QLAA 4S0XA 1RWQA 4Q3LA 1THTA 5D7BA 2J3DA 5ALMA 1RP1A 4QDXA 3O0DA 4U2GA 2IITA 5JZ9A 2JGEA 2OGTA 1MX1A 2HA4A 3WZLA 3STUA 3FNBA 4LXIA 1GXSA 4J7AA 3DJYA 4X90A 3AZOA 4BE9A 3CCCA 4OD0A 4GHWA 3H19A 1JMKC 4UBLA 3FYUA 1EINA 2RAUA 4UBMA 5JZSA 2RGUA 1W76A 5DYYA 5AIAA 2VJAA 5AJHA 4FLMA 4PF1A 2J4FA 3DNMA 4K6GA 1UKBA 1MTZA 5ALLA 2JIDA 2YASA 3U0VA 4PSDA 4FHZA 5CH8A 4K2AA 4LHEA 1WHSA 4ETWA 1ZIYA 4C4XA 2GZSA 4IH1A 3FOBA 3H1BA 1W52X 1P0PA 3R3YA 5EHXA 1CQZA 4KE8A 3W9UA 1BROA 2OG1A 4DGQA 5AI0A 3QZUA 3K9BA 2WJ4A 1ODTC 5JD4A 5LKAA 1K8QA 3D0KA 1FFDA 1QGED 4G1FA 4AXBA 3H17A 3G9UA 5E4YA 4OU4A 4UBKA 1IUPA 3DDUA 4RGYA 2OAEA 2IX9A 3HLKA 5HQ3B 3NGMA 4X6XA 3BJRA 1L7AA 1P0QA 2XDWA 3DLTA 4WFJA 3SC2A 2ECFA 4FDMA 1ZJ4A 2QXTA 5IH7A 4X92A 1USWA 3FWHA 3GZJA 2QXUA 4DNOA 3VDXA 3ZV7A 1XRQA 4C4YA 5LIPA 1WB5A 3ESCA 1OXMA 4FBLA 1MO2A 1FFEA 2WJ6A 4I4CA 1GGVA 3PF9A 2Y2VA 4E14A 3FSGD 5CRIA 3ZLVA 4JYMA 4BTVA 1R3DA 1TCAA 1LPSA 1XRLA 1N1MA 4BZZA 1DINA 2Z5GA 5AO9A 2RI6A 2GBGA 3UUFA 1ZI8A 4Q34A 1LPNA 3FCXA 4BC1A 4Y2XA 1UWCA 1UXOA 5CT6A 3QYJA 3I1IA 3R41A 4ZV7A 3TRDA 5ALJA 1SOMA 4B0PA 5ESRA 4FOLA 3W9BA 3W06A 1CUWA 1N5MA 4PSCA 1CIJA 4ZREA 1ZGBA 4WY8A 3JW8A 1UK7A 3H2JA 2R11A 2Z3ZA 2WG1A 4C01A 2Z8XA 3AFIA 1X2BA 4BVKA 1VZ3A 1BEEA 1MPXA 2EEPA 3AZQA 3BL8A 1F0NA 3VJKA 5ALXA 3LLCA 1O6FA 4W1PA 5I9IA 4W9RA 2QUAA 4AO7A 2O2IA 4KRYA 1CUAA 2VEOA 5J3JA 3IIIA 1EA5A 1IZ7A 4G9GA 3STXA 3ICVA 1K4YA 3I2JA 3D59A 1OCEA 1QFSA 4P92A 5CT8A 2PSFA 3WI7A 3ZPXA 1JT2A 2BGRA 1THGA 3QMVA 4MQMA 1VXOA 3H0CA 3T52A 4AB1A 1AUOA 2HA0A 2BAGA 1JU4A 2PU5A 3A6ZA 3R3UA 5AI4A 4U2FA 2XMDA 3KWJA 4AN0A 3C45A 4H0CA 3E0XA 4F5ZA 1MNAA 5IVDA 2PSDA 5CTAA 1DWOA 2E3JA 1VE6A 3VVMA 4BTLA 3DEAA 1QLWA 1EK1A 1ORVA 3PFCA 3GUUA 2HA7A 3WA7A 1U65A 3F96A 4I19A 5C8ZA 2ZJ6A 1IVYA 3QMMA 1XZDA 3UMJA 2WFLB 4LYDA 5A71A 2HU5A 4OU5A 1BN6A 3HXKA 3U1TA 5ALFA 2DFPA 5DNVA 4OUKX 3IDAA 2QS9A 3SWWA 2HU8A 4C4ZA 5FPPA 4TPKA 2JGKA 1UOOA 2D0DA 3K2IA 3GFFA 3C8DA 1P0MA 1CUFA 4ARAA 3AIMA 4N8DA 1QE3A 4IH9A 4Y2UA 5JYCA 2O7RA 1YAJA 4EUSA 1NX9A 4KYVA 1QOZA 2QR5A 3VJLA 4B84A 5D3ZA 2C0PA 3AUKA 4B85A 5K3CA 4NS4A 2ZVDA 4RE5A 4CI9A 2WG2A 2HIHA 4YASA 5LZ7A 3I2FA 1UKAA 1Y37A 4HZGA 4QNNA 5AKKA 3IULA 1K63A 2XI4A 5ALWA 4K6HA 1Q0ZA 2H9YA
chains in the Genus database with same CATH superfamily
3IJEB 2Y1CA 4Q02A 4NBTA 1KL7A 5KMGB 4CYMA 3OQOA 1I6LA 4BCBA 4LZOA 2VJQA 5L51A 1M5RA 4M98A 4MR9B 2OFPA 4LZPA 1GYRA 1M7GA 4TYPA 4EPXA 5BSVA 5G0UA 1C9JA 3K0FA 1A82A 2NP6A 4JUBA 1H3FA 3G02A 3PCXA 3JAMA 1E5QA 4XR9A 2FWMX 1R15A 2PRSA 3IP7A 4M0EA 3BIXA 5CB0A 5GJCA 1ZGCA 1G41A 4B79A 1FF9A 3GVXA 2QJTA 4WAUA 2DT8A 3L0IB 1L4UA 3KJIA 3PSAA 5H3LA 4ZO7A 2OXTA 1RI2A 2BBTA 3C24A 3ABSB 2FOXA 4WPGA 5F9FA 4EHNA 4PC3A 4FUQA 4ZVVA 4QO7A 1VLLA 3PEFA 1VHWA 1E0SA 4IVPA 4DAEA 2VDNB 1YS2X 4JZYA 1N2XA 1Z47A 4OB8A 4B3XA 1I5OA 4RJKA 1E66A 4OGKA 2AVNA 3GLSA 3ABQB 2RB5A 1QVRA 4QJBA 1V3QE 1JKMA 3NNNA 1UEXC 5KDOA 2IYZA 4YY3B 5EOVA 4KXLA 2AZXA 1J5XA 4IVRA 3OT4A 1CJSA 1YRYE 2ZTLA 1HX7A 2NAFA 1QZ3A 3HG7A 4CHGA 4ETIA 1SUFA 4DW8A 4QBIA 3AF2A 3CNHA 3RD5A 2BCJQ 2GCIA 4IJ5A 3D8RA 5KWSA 4RL4A 3NYIA 1DJPA 5B12A 1KEKA 2AQHA 2WTUA 3AHEA 3AU9A 3Q7EA 5JAPA 4XUGB 2A0WA 2ZIUB 3P9KA 4LEIA 1KJIA 4NX2A 4EUNA 5KWIA 4PIMA 5BN5A 4XEHA 1XXLA 1QYXA 4LFAB 3WL8A 1CS0B 4H1UA 4PRYA 3VHRA 2C31A 3ZW9A 3UAGA 4O1HA 1SVLA 3WKBA 4AUNA 5HW0A 4FN4A 1PS0A 5JXIA 3G7SA 4YPOA 5AM3A 1FYVA 1M8KA 4EG7A 2ZWVA 5HOEA 1KVTA 1Q1GA 2DKFA 3NP9A 2Q5QA 5CEEA 4AKHA 4KI7A 1U8EA 4WZBB 2J3KA 4HDMA 5BMVF 3F5MA 4BNZA 2WAMA 2P2SA 3DE4X 2O0KA 3KEFA 3D7RA 2AEEA 5HFJA 4IJKA 4Q7KA 4DY6A 1LRKA 5FUBA 4EPYA 3PUWA 1HH4A 1UBOS 1X92A 5CDHA 2IU0A 3B3AA 3K9LA 3Q8KA 3P0JA 3WGQA 2X6QA 2IYTA 1XRPA 4JLNA 3H3FA 1P6QA 3WLNA 4R2MA 5L3SA 2FR8A 3JQGB 1TGVA 4JYCA 4MR7A 3AI1A 2FUCA 1BE8A 1W49A 2CUTA 5IBCA 4W7IA 1UWKA 4QXMA 3ORSA 4FDTA 1FFGA 4ZC1A 1VDZA 3Q7RA 2P8JA 3VNUA 1N7JA 1H2XA 1M7BA 3ED1A 4QIHA 4W1RA 1QF9A 3EGCA 3QBJA 5CX1B 5C8VA 1I9CA 4NFYA 4BASA 1UBRS 4EI7A 4DLWA 4DQ0A 4C4SA 5A5VA 4DV4B 3AHGA 4Q3EA 1QUEA 4PLHA 2AJLI 3MD0A 3GRZA 3LDFA 4B34A 2C84A 4QRDA 2GF2A 5A3JA 3B3QA 1Z0DA 4HWKA 3RQIA 3K5HA 4DRZA 3P20A 1JEAA 2YJGA 3DO6A 3VR5D 1ZH2A 1ZUWA 4XQGA 4JI7B 1VBMA 4AF8A 4CM8A 1GFZA 3UWMA 4HDSA 1O95D 1K2WA 2FN7A 1XTSA 3L1VA 1E3QA 3U4IA 4HB3A 5CURA 1OTXA 2UZ0A 2WJHA 2IXFA 3GCZA 3PBKA 4Z9XA 4AURA 2HQRA 5BOSA 5JT1A 4J2HA 1HFEL 3VHXB 5K0FA 2HHCA 1FUKA 4R16A 5CM2Z 2GARA 3A06A 4PLCA 4D4KA 2PXCA 2ZYSA 4Z86A 1DZ3A 3ASVA 3EBPA 4KBFA 2PNJA 4YMTA 5A3QA 4HTFA 4D2IA 3VPXA 2O54A 3U3DA 4LAFA 1L8QA 1LVGA 1LZLA 1KOFA 1YZQA 2WJAA 3QEOA 4HQNA 4REQA 3AI2A 3UAWA 4A0SA 3ZW8A 2WJYA 2Y27A 2VH2A 1I6KA 4PO8A 1AE1A 4XWTA 2GN0A 6REQB 3F6EX 3P9QA 1H65A 1J9EA 1XU7A 3OY2A 1FYXA 1O7JA 3NH9A 4UNPA 2ZJFA 3I62A 1T5IA 1A9TA 1Y9DA 4N6NA 1DJNA 3KRTA 1GKLA 3ZG6A 2C54A 4J4HA 1E9SA 4DWOA 4EI9A 4MRMA 2ZUDA 4BFXA 1E6UA 4RF2A 1B8UA 4A03A 2KS6A 1T8TA 2QLMA 4IQ4A 2O3JA 2MWMA 5DI3A 3UMVA 5KCMA 1RE1A 3HACA 3W7VA 1TJNA 1SR8A 2YFQA 4NCJA 4XGNA 4GXRA 2YXNA 2D7CA 2OQVA 4QVIA 1HDZA 3VM6A 4QEZA 2QJRA 3ZDCA 3WGYA 2Q5FA 1H2EA 1RQLA 2UUOA 3L18A 4O0LA 1PFQA 2IZ1A 4CLDA 3T1YB 2NUPB 2BKEA 1G2PA 1P1BA 2VYNA 4ZHQB 1U5AA 4BFCA 1SBIA 4PHCA 3R4CA 2W2TA 3X1XA 2H2WA 3E15A 3EZLA 4FGZA 3OEEA 4HZUB 3ZWPA 4AC9A 1XN4A 4KITB 2A9RA 4ND7A 4NCIA 3TOCA 1R37A 4I4IA 3RG2A 5KHLB 3Q2IA 4HDOB 4M1YA 1VMKA 3IP5A 4L0QA 3FCOA 5F73A 4JB2A 4WVLA 5FULA 3WQSB 2VHZA 5FPKA 1QHEA 3C70A 2HDOA 2VDOB 5E38A 1CPYA 3OURA 4RHTA 3WV4A 1PRYA 3CV3A 4ZYVA 3LQ4A 2DULA 2HWWA 1E2LA 2NSHA 3AFOA 3KXIA 3BPSA 1CNFA 4L9SA 4UNSA 3UJ8A 3GK3A 3GT0A 4UDOA 1KZ7B 4D8UA 121PA 4LRXA 3A6JA 4MCHA 3VNRA 3HP7A 2X76A 4UUQA 4UHDA 3LX4A 3WJ7A 4CLEA 1UK9A 1XTKA 4XDGA 4HX9A 5BSMA 1I3CA 3UMFA 4YRBA 1QTQA 3CNBA 1MX9A 1N1EA 5EWMB 2I1WA 4NS1A 3VQTA 3OIVA 2OHHA 3BZBA 1DT5A 2R7AA 2G6TA 2V55B 2WAYA 2NQTA 3NGLA 4M8LA 3UK0A 3TCNA 4ROSA 3EWNA 4HP8A 3VI4B 4DQVA 3TZEA 1MT0A 3GLRA 1XNGA 4JDUA 4CV1A 3DCJA 4NPAA 4EW1A 1OW3B 1PUXA 4FKBA 4MUKA 5LYYA 1DWUA 4PSVA 2IYVA 3WWOA 1I94B 1PGQA 4MHTA 1SU6A 5KWJA 1WSAA 1P2BA 4IW3B 2RHLA 4L1KA 3IHWA 5KKCA 2J6IA 3WGNA 3L8ZA 4JAVC 3G1WA 2JFHA 2OVBA 1Q16A 3NU1A 3VR2D 3WK9A 1KEZA 1Y63A 2NG1A 2QMZA 4JIMA 4B6GA 2E4ZA 3I6IA 4G0QA 2O9JA 3FDZA 4LBWA 4RD6A 2GILA 1NMYA 3AUAA 2V7GA 2WDPA 2C8VA 2AJCA 3BA1A 4YP6A 1J2EA 4HNVA 3QVUA 1A50B 1HLPA 2X8WA 3R5JA 1FNBA 3OD5A 1YF3A 2JK0A 2ZBDA 4TMZA 4XWKA 4WEOA 5AYVA 4M0PA 1PNOA 2FMIA 5DWQA 2FPUA 3IPCA 4AZTA 1KDZA 2VJMA 4QLBA 4PCUA 4EATA 5JVDA 3ZGZA 1TRKA 1D5WA 1P0FA 4I1OA 1RMYA 2XQVA 1S3SA 4X0EA 4OHZA 5TEVA 4E09A 2HWKA 4PGFA 2QTWB 2X15A 1L5MA 1W75A 4BC0A 4EG6A 1J24A 3SR0A 5F98A 2TMYA 5J2TF 1EB9A 3QKUA 4LYJA 2PSEA 3BE6A 2A1UB 4KSCA 1U2EA 5COQA 1FL9A 1PR3A 1OZ0A 1QH8A 4FQ5A 5B2FA 1QKJA 1YZ3A 4ZU6X 4AMYA 2MSKA 1MD9A 1Y4ZA 1I3OA 1QU2A 1NSTA 2DQ4A 4A27A 5CPBA 2XWSA 1TXGA 1RLOA 3IMKA 4PR0A 2HK7A 3HV0A 2H9AA 3RV3A 2ZRCA 3I8OA 4B43A 4D5EA 1MVNA 5C9ZA 3FPGA 5LLDA 2XE8A 4U7FA 4D0RA 2VSXA 3CRZA 1QVZA 1S2OA 4KPUB 3P9SA 5T67A 3MGBA 2M2IA 4BWFB 2Y67A 1L7EA 5GV7A 3QX9A 3G17A 2E48A 3L7LA 1BW9A 1X7HA 1U1CA 1J2JA 3FI9A 1EVQA 3FW1A 1SXJB 4HQFA 4Y9TA 4E22A 4KQXA 2JIZA 5C3MA 5AR1A 4RTJA 2OESA 3RS0A 4WT7A 4DSTA 1XTJA 3LVFO 3MJCA 4BQQA 1VCHA 4PM4A 2J31A 2FSHA 3F97A 5EUMA 2NN3C 1VKRA 3P96A 4FDLA 3FSRA 2XMQA 3L7NA 2ZANA 2J08A 4Q1CA 4N9QA 3UTCA 4DLSA 5BUSA 3DOHA 3U37A 4D9JA 1P1HA 4OI4A 4FP9A 4ZEWA 1P2DA 3O31A 5ADHA 1B74A 2OC9A 3ZWKA 2CJPA 2OG2A 2VBIA 3G5AA 3OEHA 4M83A 4WWHA 5KJFA 5LP6F 1H9AA 2AWOA 3FBWA 3OX1A 1NR1A 3ONVA 4GSYA 3B85A 3CN7A 3STTA 5CH3A 5F7XA 5KVCA 3JASB 3LJKA 4HK4A 3WLIA 1FQKA 5HM6A 3ROQA 1LK5A 1XQVA 1Z08A 2KYRA 2X9GA 2ZWAA 3WGGA 5KJ1A 3DHEA 2V7TA 1IG3A 2VYCA 1KDVA 2B1GA 3N2KB 3OPQA 1RQXA 4KEAA 5A7HA 3GF4A 3U4CA 1IJEA 2YWBA 3NWJA 2NPFA 3W9YA 1EE9A 3ZE7A 3FSGA 3JQBA 1RWNA 2VTKA 1Z2AA 1UJ5A 3H9GA 1A5BB 3HU3A 4X6LA 1PV1A 1SPBS 1XRSB 4DZTA 3CGWA 4EQ6A 5F23A 4PQYA 4OHVA 2X0EA 4C0KA 1I36A 1I4DD 2PS0A 3ITNA 4PXYA 2WSLA 2H7CA 1ZX1A 3QFRA 3RAJA 4FYVA 3OU7A 2XQKA 4MI1A 1O94C 4J49A 2XGSA 4TRNA 1E3SA 2VCEA 1XHFA 2OHGA 1UZNA 1KDTA 1Z6GA 2ZBGA 3V00A 4JI6B 2K2QB 2P65A 2VVTA 3WFIA 3WJ1A 1XSEA 4KGVA 4C0AC 4C7OB 5LU9A 3RS9A 5GVRA 2ACKA 2WJWA 3D2AA 2Z3VA 3NWPA 5KDLA 2AMJA 1JBQA 4G3XA 4I46A 2IBTA 3F9CA 4W6ZA 5HKKA 3FNGA 4QPPA 4Y2QA 3PNKA 2IYQA 4M54A 1KZ1A 1YOVB 3KTAA 2Q5JA 1PFUA 1JIXA 3W6UA 1P7CA 4IPTA 5JTUA 3M9LA 3DWIA 2GZAA 5CVDA 5AMXA 5ITSA 3LUCA 1PUIA 3BOSA 2J9GA 1MC1A 2ZJ4A 3GG9A 1I3LA 3KZMA 5FWNA 1GSAA 3A9RA 5E7JA 5JNVA 3MWEA 3FFTA 4BP9A 3I9NA 2H0QA 3BXGA 4BO5A 3L2OB 5EP4A 1W73A 3TOVA 2FKNA 5DM60 3RHTA 1Y5RA 4DIUA 1GTG1 1NXXA 5HS4A 2WD9A 3QKIA 1Z3IX 1BQEA 1OY1A 1ZOLA 3H3XA 3SQOA 1OLOA 4EHDA 2OGZA 4QT4A 4HDRA 3BSWA 4X41A 1ISMA 4B7UA 1Q20A 5AD1A 1SAYA 1KYWA 2PGJA 4DILA 2ZJ0A 4MVJI 3TKAA 4PLFA 3P2YA 3SYMA 1GA1A 3DTVD 1SHUX 4MVWA 4AULA 4E46A 3BTSA 3RTDA 1RVDA 2J4CA 4NCKA 2ZE5A 4EGAA 1H05A 2QZ9A 3PUHA 1O0CA 3NHWA 1AGYA 1J0AA 1GPNA 3ILYA 3IUMA 2FR8C 2WOOA 4TWBA 3HDJA 1KOLA 4EX7A 5CJPA 1UPXA 3C48A 3PXBA 3VTAA 3DTYA 2XVXA 1B0ZA 1TX4B 5HCUA 4DZZA 4WNAB 5BUCA 3PX2A 4FQ8A 4IHJA 1LWNA 3TLXA 4MPJA 3TLEA 4NECA 3A4NA 2Z1MA 1KE2A 1EDBA 3K8ZA 1MOSA 1UZMA 5BVGA 4UCFA 4KIUA 1AV7A 4F86A 2G40A 2HNBA 2WW8A 2JGFA 2O3SA 1FEZA 2F3UA 1TMGE 3PJDA 4MJ7A 1DTSA 3TMKA 3RKSA 2QE7D 3BICA 3VC1A 2PUTA 3A6DA 1OV6A 4L8WB 3ROEA 5JC1A 1RRMA 2I7DA 2D6FA 1NF3A 3L7OA 5HBRA 3DTTA 3B3JA 2GKGA 2XHEA 1EDOA 4K9OA 5EVCA 1M2JA 2PVCA 3AILA 3VAAA 4AMGA 5DNCA 1ZVQA 2CV0A 1D7OA 4G01B 1YA6A 1I33A 5EUCA 3KVOA 1PT5A 3AIOA 4QXRA 4YBRA 3G0OA 3BREA 3K9FC 3CG0A 3NFRA 2HIAA 3TRHA 3UHOA 2D5IA 3ZX4A 3MVEA 4ANFA 4IH4A 4LOJA 1JIQA 4PS0A 1L4EA 4Z4EA 3F3YA 2P2LA 1ISPA 3BMNA 4AZVA 5KNBD 1JHAA 2X4IA 1JR6A 1PX0A 2NQ8A 5IAAA 4CQLB 2V4UA 1DX6A 2HSEA 3NRCA 2QD5A 4X7PA 1ZCJA 1NF9A 2R65A 1TUBA 3ZHRA 3IEPA 5C46F 3WDSA 4IS3A 3AR9A 4N8SA 3GP8A 1SRRA 3VISA 3L7KA 4C14A 2JHPA 5KU1A 1N2SA 4IHQA 3CUYA 6PFKA 1Z35A 3N74A 2YJ3A 1Z63A 3U31A 2GXQA 3H99A 4HAVA 1X7XA 2PKCA 1EJ0A 1GT6A 1JQBA 1JNXX 1VPLA 1NBME 2ZSKA 3I9MA 1SIBE 4MWEA 3VBEA 3WLQA 5DCWA 2O59A 3KEGA 2QTVB 5EESA 4HNUA 1NOKA 1MEEA 3A1NA 4URFA 5A0FA 5JI3E 4ETNA 1OI2A 3VKFA 3DDNA 1ZH6A 4QGSA 2EZ8A 4EO4A 1NDUA 1A97A 5EIFA 1PSZA 5CFNA 4MDEA 1QGAA 4EJMA 5ALNA 1LCIA 1LZKA 2P6MA 3IQIX 5LXTA 4GZLA 2HPHA 3URMA 4ARCA 4ZMRA 4OK6A 5JSUA 5JU6A 1RXCA 4PO3X 4FFPA 5CEJA 5ALVA 1R4NA 1NXSA 4PQRA 4C5BA 4KSBA 4L4YA 4DYDA 2PD3A 4QU5A 3JVEA 1WZCA 1X7YB 1CKEA 1KJNA 1JFLA 1OZHA 1UKEA 3KM0A 3PI7A 2CLDX 2LUOA 4EFLA 3EUAA 3HYLA 4RJ2A 1YFLA 4BLQA 4DARA 1XFDA 5REQA 1Z5GA 4B82A 2NTEA 3BRWA 5B1EA 4DFDA 4AKGA 2VRCA 1JLRA 4EZEA 4MOWA 2W2OA 2JFOA 1N5JA 3N39C 4WTOA 3PC2A 1EUYA 1RWKA 2O8EB 2RC6A 2ZKLA 2VAXA 1I0ZA 3LKDA 4UEJA 2DH6A 2JKVA 1E9AA 1UT6A 2Y4NA 3TLZA 5IT9A 3IH5A 4GMHA 3QX3A 1CUXA 4QUIA 2HRCA 2I6TA 4M7WA 1BGXT 5JS7A 4AYWA 1R50A 1HEIA 2AXEA 2RAFA 3B2NA 4G0OA 3RSQA 5JPDA 5JTTA 3IDZA 1V16A 4BOYA 1LKZA 3N2LA 4Y1EA 4DYHA 4LYYA 3VR1A 5KU7A 5CDTA 1FQOA 1GZ5A 4YRQA 3R5KA 1P2TA 2EIXA 2BTEA 1Z0UA 3RSZA 2FMXA 1MDBA 2FKAA 2KB0A 3GEPA 4HXFB 1BDHA 1Q1ZA 4KV7A 1CY0A 4MUGA 1EHYA 3EVBA 3FNFA 2H1HA 2J59A 4GC5A 5D01A 1K6XA 1T6ZA 3MD9A 3WLOA 4L4RA 2FWAA 2WWGA 1SBQA 1TK2A 3F6RA 2EXXA 2XF8A 1H85A 1VZ2A 3GHYA 3KQQA 4YJHA 1E3WB 1W9HA 1VMIA 5CCDA 3WLKX 2P6RA 3SE0A 5EKDA 3DE0X 1NIJA 4KQKA 4C7XA 1RXVA 5A1JA 2H6EA 4WOBA 5DH9A 4R2IA 5DZSA 3I9OA 2DHCA 4I1SA 1W6RA 2GERA 3O3OB 1QO9A 5K8VA 5E1DA 4WLVA 4YN3A 1W9MA 3VH4A 4ZJZA 1M2OB 1P91A 1JKIA 4I5DA 4YALA 3FB1A 2VQ6A 2AQ8A 1ZKMA 1GXSB 1HOTA 2JZOA 2FV8A 4OIFA 1SULA 3NW9A 4ZA2A 1N5LA 2YFKA 4REMA 2ONCA 4YRAA 2X0DA 2HRDA 4DJFC 1B0AA 3QITA 4G5GA 2VK1A 1EG7A 3MRTA 4FCTA 3H1EA 4N3AA 1PSWA 1P4JA 5GP1A 4RPHA 3U7QB 3EMBA 1LX7A 3I2HA 4HEJA 4ES6A 5JCZA 4L9AA 2C0QA 1JWAB 1LTKA 1PT9A 4HSGA 2YWEA 2A9VA 4Q24A 2ZWMA 1B16A 4BNIA 4H18A 1W88B 2JEOA 3ISJA 2XSZD 4P4GA 5C8YF 2J1LA 2IXAA 5BO5A 2ZT8A 5BW4A 5C7YA 3S1LA 2EF0A 3PIRA 1U28C 3DPIA 1DO0A 4MUNA 3TINA 3DDSA 3TRIA 2LVBA 5IYZA 3JATB 3ZE1B 1GR1A 3DV2A 3K32A 3LPAA 3C3XA 3Q6NA 4LJRA 2R7LA 5ADVA 4TQGA 1L8AA 1LVHA 5HZGA 1CZUA 1U2RA 5DNEA 2GEKA 2OP1A 2QL9A 3ESZA 2XCOA 4JT2A 3IAXA 2NPOA 5E3JA 1ZM3A 4IIHA 4KG7A 4PPYA 3ZHCA 4D92A 1M1UA 3W8RA 2IUFA 3R40A 3U0BA 3EC1A 4KFRA 4DMKA 1GZVA 4C7VA 1IXYA 3N1UA 4CF7A 3TPCA 2VYQA 1KARA 3NANA 4NMHA 3LI2A 2J9XB 4FW8A 4G9EA 1XXHE 4M99A 5EERA 1CBUA 5IVHA 1MMFB 4D9FA 3K0AB 2EDAA 1OB2A 1R27A 1DB3A 1R00A 4PIPA 4UASA 4R1QA 1G9SA 5A9SA 4BX3A 2ZUVA 4Z3OA 2JFFA 3M5PA 3Q7PA 4MIOA 2B99A 3RB8A 1U7UA 5EL0A 2Q5CA 1IWOA 2QW8A 3V4VB 3SHFA 2FLWA 1YR9A 3BFPA 1UDXA 1P1FA 3P0IA 3IRUA 3M6AA 3MTDA 2VYFA 2PVSA 4H17A 3T5BA 3TI9A 3L6RA 4PYKA 1HDIA 5G0VA 2HD4A 4CU2A 2CVZA 2FP3A 3BD7A 1OIXA 3KT3A 4UPDA 5G0TA 5TS2A 3D64A 4HADA 3CH4B 3PV0A 2NTYC 3FRJA 3DFKA 2D2FA 2YHSA 3LVRE 4ZYYA 5T7BA 1ZOIA 2FZLA 3D81A 4C29A 1KMNA 4TLCA 4V0ME 2XGMA 2A30A 3KKEA 1BE6A 1KS9A 4UKDA 3U17A 3OICA 1S2NA 3VYRB 1AHHA 2ADMA 3P9ZA 4I8DA 5LNK1 1NVKA 3OZSA 2XD4A 1CUHA 3OM0A 2IWHA 1W36D 1XVTA 5EJ6A 4HLDA 4S1OA 1TIBA 3E58A 1VPTA 1YDWA 3PFIA 2EFDB 1IEVA 2WWIA 1ACLA 3DB1A 4P1ZA 3EUEA 1QV6A 4E88A 1UOQA 1YD7A 1CX9B 2FR1A 3DAYA 4FTWA 3TJRA 5EIOA 5BSHA 2LBPA 4IJVA 5HG0A 4YYEA 4XGKA 2VHQA 3OG9A 1J4AA 2X22A 3C7KA 4L16A 5JNWA 3RVBA 1Z45A 1ESMA 3PNPA 3FNRA 1T4DA 3HADA 1B6RA 3PUIA 2XUFA 3B5JA 1HUQA 5JMOA 3UGJA 4GS5A 3RG8A 2UV8A 4WV3A 2YWFA 2DTXA 2EGGA 2CXSA 2CUKA 4MYDA 1NMXA 4PLYA 4TUYF 3VTKA 2WWYA 1P2SA 2D5AA 4J03A 2PUCA 4B7XA 3ZU2A 4DR6B 3P9YA 2JAUA 3A0RB 3BRQA 2FSGA 4J6FA 5DHSA 5HNKA 1J5PA 1GEEA 1XRRA 4MW5A 4LVOA 5J2UA 3FZQA 3K15A 3SKYA 1IRXA 1J99A 1HMPA 2RHJA 3HHEA 1ZXLA 4KRGA 4YI3A 1T3ZA 2CDAA 2O05A 2P0YA 4AQYB 3E82A 1QQ5A 2O6HA 5H8WA 1N75A 1VCNA 3ZC3A 1ULHA 3KQYA 3MF4A 4BVBA 4JI0B 3SFZA 4R9NA 2HF9A 2IH5A 2F9FA 4MMZB 2QTBA 1QE0A 3SM3A 3SZRA 4FYJA 4BNJA 3L0CA 4Q3BA 2OYCA 2ES4A 2GRUA 5JY6A 4CT0A 5JOQA 3VR5A 3O7WA 1ZD3A 4W5RA 3GLFA 4DBLE 1O95A 1J56A 3GUZA 4BKMA 3LH5A 1MPTA 3PTLA 3B52X 1QHXA 2NUTB 2W2PA 2F43A 3BFJA 4YJ2F 4AYXA 4X24A 4DCNA 3E3AA 3EXG1 2E2WA 1ZK3A 1MAUA 3WMXA 3U6KA 1V1MA 4AO8A 1U4SA 3V7WA 3ZGOA 4MLDA 4BCDA 4W5HA 3F5QA 4GH5A 1WUTA 4KRXA 3RSCA 5JD5A 1I80A 4AY2A 5KREA 4FWTA 4K86A 3EC7A 3UWDA 3B7WA 3QXHA 4O2AA 3TW4A 4YCSA 1HBJA 1RBQA 4TMWA 2FFJA 4YAIA 5C1DA 1NFRA 2I7TA 3WGMA 3Q5DA 1PKXA 3NS7A 4ZFNA 1HNXB 4TGLA 4AQDA 4F1KA 3DEJA 4F8EA 1G0OA 1MNQA 2CW5A 5EIHA 4O4IF 1OD6A 4JJ6A 5GOTA 1JQDA 4N5MA 3G8AA 1MOZA 3UCEA 5AVYA 4Q4JA 3AL3A 1DNPA 2OAQ1 1E58A 3EFOA 1LVUA 2V1XA 4AK9A 5IF3A 2WWXA 3GN1A 4KH0A 3N8KA 4JLKA 2VTBB 3PEYA 1RWVA 1SKYE 4Q21A 5KWEA 1Z15A 2BFOA 4YRMA 1VG0B 1UXKA 1KERA 2EWMA 4B4VA 4CQJA 4CIWA 3A9CA 3DZDA 3O2QB 1LBHA 4JFRA 3D6FA 1ZMBA 5CLQA 3RSGA 2F8TA 4HMOA 2OAGA 1VP3A 2FZKA 3GVCA 5H80A 2WP8J 3RFXA 1XKXA 1T2NA 2EX1A 2IELA 4HZIA 4LI0A 1SY7A 2FAXA 2KBFA 4LDPA 2IZ5A 2XJ4A 3E9YA 1ZD2P 5C8XA 2CBGA 3I83A 3ZZUA 4RVCA 1Y4DE 3BXHA 3UATA 1G5TA 1NUHA 5J4LA 2OCGA 5KSWB 3KNZA 1ZO8A 3WO0A 2ZYTX 2JG3A 2VG8A 4OJKA 2PUDA 5C34B 3RC9A 1FSGA 1O6GA 3L0BA 5ESWA 1HORA 3T94A 2MU1A 2EW2A 2QM7A 3EGWA 4MS1A 4NL4H 1EIZA 4MTLA 3CZCA 1EAMA 1C2YA 1JPNA 1XK7A 5HTKA 1ADCA 1UDBA 5EKTA 5KTNA 1DELA 2HAEA 5JNTA 3RYCA 1QMPA 1A9SA 2TYSB 1MGOA 5ARDA 4HCJA 3LT5A 1ADBA 1WXWA 3CLTD 5EYPB 3KPUA 1PNVA 3PEUA 4BLTA 3FR7A 2CMFA 4MUMA 2C5BA 3KKKA 4QGBA 3ZHYA 4XSGA 3SEAA 1UDCA 2VP3A 4HFNA 1VPEA 3K9QO 2W8BA 3AEUB 2CZQA 1Y8AA 3Q3EA 1DJLA 1R9NA 2ZAGA 3F5DA 4PFKA 5G1OA 3UM9A 1U3TA 2GYYA 4WADA 3RW9A 4HGZA 4C04A 4CFSA 1QE5A 2OBBA 2XB6A 3VR2A 2DLCX 5LLTA 2I1LA 1UQRA 4UPEA 2YS6A 2ZBUA 1K66A 4Q4HA 1X14A 1W0KD 1DC6A 3DO5A 1T5LA 4J3FA 3LGAA 2R1TA 4DV3B 2QENA 3T3OA 3UC5A 1PN3A 2RH5A 1AGRA 2ODEA 4CF5A 1E1YA 3FDJA 1QCZA 4WKOA 5CVEA 1KMMA 1CHDA 3JQPA 1QIIA 2E18A 2H1SA 3PX7A 3OEWA 3GYGA 4ESVA 1JDNA 5LQAA 5JLJA 1Q92A 2HDWA 1Y8CA 2XZDA 1HKHA 1UJCA 2ZSHA 4GXNA 4FMPA 4FM9A 1RADA 3HA5A 3H05A 4R5MA 1N0WA 3OPVA 2WAOA 2F1HA 4RENA 5BMOA 3EXHA 2FWNA 3RS4A 1GARA 3QMWA 1HQCA 2HDNB 3LKVA 3P0RA 1OWMA 4JNCA 4L78A 1I2MA 1MOQA 2QRMA 4QC2A 4YJGA 1O08A 3Q8WA 4U7TB 1AS0A 4DMFA 2PHZA 4IKEA 4OFWA 4C4RA 5C81A 5HM8A 1Q14A 2J6BA 5BRJA 3G88A 4PO1A 4BAGA 2HLHA 5BN1A 1UC8A 4M8NE 3UCFA 3O8DA 4S05A 4RKYA 2AD5A 3HBNA 4L6AA 2V59A 4ZWNA 1RTTA 3DP9A 3GUHA 2ZIFA 4KFUA 2VAPA 3GFSA 5AKJA 5K0EA 3E3NA 1XEXA 2IGBA 4ND8A 3I28A 1PZGA 3CFYA 2CJWB 2RHTA 4FMBB 2VF8A 4GBGA 5CT4A 2CF5A 2NO7A 3O92A 2OZLA 2P9ZA 3HJUA 4WBNA 3OOEA 4E2YA 1A0OA 4B46A 1EWKA 2J87A 3U4DA 3JXEA 4BEVA 3VZQA 2IIVA 5DNDA 3T8YA 4BL5A 5BN3A 1NNSA 1NT4A 3GT7A 2H2HA 1QQTA 2Y1KA 5AKEA 2AX3A 1FVFA 3QVOA 1AKRA 2HMTA 3DGEC 3O82A 4QDUA 4B48A 3KALA 1MA3A 1RCUA 2R87A 5CT5A 3F3KA 3OCCA 1D1SA 1G20A 5FT9A 2V3CC 5IVPA 3NAQA 1F6BA 3DKRA 1XDDA 3STWA 2AZ4A 4DCOA 4X1KB 1OWPA 1M2VA 1U0JA 1R4AA 1OVMA 3ORFA 4FE7A 4LOKA 1HL7A 5I4BA 1YHYA 2HWUA 4EYQA 1NP7A 2QTAA 3V2GA 1IHOA 3C41J 2R2AA 3RARA 1H42A 2IK8A 2BFWA 3A3KA 3K3PA 5J5CA 1Q0SA 1YRBA 2J5XA 3EVTA 1K5HA 2FMFA 5H4HA 2J0UA 3WWYA 1EQUA 4MGKR 3KB6A 3IBGA 4EWLA 3S81A 1CFZA 1WZEA 3OUTA 3V48A 4BRWA 3IEMA 2P6UA 4MVYA 1DFIA 1B8PA 1IN5A 2FPXA 3BMQB 3ILHA 2OE2A 4I2NA 1ZQ1A 3VZRA 4HGOA 4R05A 3MGGA 3AQIA 5EP1A 3FJ1A 3OPNA 3TR6A 3T6KA 1GG5A 3LS2A 1EVEA 1SVNA 2GJ8A 1VYUA 5G0WA 2H0RA 1MC4A 4ERNA 1OXUA 2IEZA 1E63A 4LWZA 3BXZA 2AGVA 1PWEA 3FE2A 4HO1X 4M6WB 4NENA 1BMDA 1TQ4A 3H6KA 1VE1A 4RVSA 3RFTA 1EEXB 1J0BA 1JLMA 4O4LB 2EBFX 1U9ZA 1FW6A 4JI3B 1CNMA 2O2DA 4HLNA 1ODCA 4K8RB 4KIFA 5DXAA 1V9SA 3DE5X 5JD6A 1P45A 3PTAA 4UAUA 2A0UA 4XW2A 3MQ4A 3KR2A 5LWQA 1C8VB 3EG9B 5H81A 2X3UA 1P3DA 2KE5A 3LX8A 1PVOA 1LPPA 1ML3A 2X5JO 1NZJA 3PFFA 1D07A 1S2MA 3I4LA 3ASUA 1UJ2A 2XQFA 2QY9A 4P54A 3M1IA 4BZWA 4II7A 3E2MA 2JBHA 2NO9A 4B0OA 3NHYA 3WGTA 1GPLA 1TT5B 3FD8A 4MUAA 1GL7A 1YZLA 4HL6A 3SC3A 4DT1A 5BNWA 1DVRA 3SF0A 1E92A 4DR7B 3AF6A 3HBJA 3TTWA 2O7QA 1GOTA 3I34X 4G8BA 2FQ1A 5T4BA 3OSZA 1XQYA 1I1HA 3AHIA 3AGPA 4Y6PA 5AQ1A 1PDWA 2NP7A 4TLEA 5F4ZA 1P0CA 1M2KA 2QWXA 1MB9A 2JNWA 2CCKA 1PWHA 3T5AA 4YFYA 2B36A 4I55A 1ESZA 1L4HA 3PDIB 4DJAA 4LF6B 1FJGB 2PKWA 3K73O 1E89A 4H08A 2QNRA 4CQMB 2WTXA 1AF4A 3F3MA 4I7EA 2UVPA 3PIIA 1CY2A 2QL7A 3O5AA 1Z25A 4HH4A 3ROZA 2FZWA 2QGFA 1ODSA 4Q1FA 4A0FA 1PG2A 5DRTA 5A7FA 3IGFA 1V3UA 4FZ3A 4INPA 3GLIA 3UAYA 1RPZA 1OLSB 4JV5B 2ZRHA 1NN0A 2A0FA 2FEAA 3DTVA 4G65A 3T1VA 4TVSA 5GJWC 2A35A 2GBCA 2VOEA 1APBA 3SVLA 3HM9A 1IPFA 4NNOA 3GRUA 1SUWA 3AFNA 3F1KA 4IDCA 4UHEA 3QBTA 1G4AE 2X42A 5FOXA 1J8YF 3AKEA 4GAEA 2QMOA 4FVTA 4QFCA 4YAOA 3LT0A 4ZRNA 1QQBA 4L5BA 1U3VA 1AN0A 3SC4A 1S8NA 1GQRA 2PX5A 2HQOA 3ROPA 3PCTA 4QVGA 2B3TA 4WECA 5E1BA 2QR3A 2WY2D 3WYAA 3HDGA 1P29A 2A9PA 1JI0A 2QM0A 2ZWPA 3H1TA 4JLOA 4D3YA 2NQ2C 3PC6A 3PDCA 2GFHA 2YOHA 5ALQA 4J76A 1ZJJA 3U49A 4ZI7F 1J2YA 4V39A 3T5CA 2F3RA 2G63A 4PZCA 5JBQA 2QE7A 4EHLA 3KAPA 1N9ZA 1ETUA 4MR8A 1J0XO 5EKXA 3FTFA 1YONA 3SHWA 1UPCA 3BSFA 3TKYA 4L72A 3AVYA 1VJ5A 2GAIA 1E94E 5FF9A 3SDBA 4QDTA 3TLYA 1YZNA 4BVJA 1NW7A 4QFBA 3EQ7A 3AP1A 3NAGA 3LD9A 4IXTA 3EXG2 3LUAA 2RG7A 1O97D 1ZN9A 2Y1EA 1G3IA 2ZRFA 2R1VA 2FRXA 3HSSA 4H27A 4EYEA 3GEHA 4FGJA 4JS0A 5COAA 1EZZA 1PFWA 1KC1A 3U40A 5DYTA 3T3DA 2X9LA 3O4FA 1N6HA 1TZCA 2BDUA 1TAUA 4PIVA 2IRWA 3B5EA 3DWEX 5FJIA 4RDIA 5DHUA 2EERA 1DG9A 3FUCA 5LZ4A 5LQCA 4WN9B 5GY7A 4JASB 3ZNNA 5JANA 5SZIA 2JKZA 1YHNA 3DHYA 5KOHB 2PZAA 2R0QC 3MWKA 4ZJUA 1NLFA 3D7NA 5LMZA 3B8HA 3OQ6A 3CLKA 4HEA1 2YW2A 1XI2A 3EVDA 1J8VA 2JPDA 2HLDD 3PNMA 1FU4A 1ZCZA 4WOKA 1VHQA 2FFQA 4ZCPA 4RFSA 4FFBB 3UHJA 3OQMA 1WRBA 3PKZA 1ODIA 4FR5A 4Z4GA 2B6NA 3SP1A 1L1FA 3UEOA 2DERA 5FTJA 1GTJ1 5CFLA 1MN6A 3KXKA 5K4AA 2R6AA 5JEDA 2G1PA 2PV0A 4QREA 3TL2A 1QS0B 1L7BA 1T4MA 4KO1S 3M82A 4DRXB 1ZIPA 5CM8B 5M04A 1QIFA 2BEKA 1XGKA 4A0HA 1Q7EA 1W4ZA 3BJEA 1XE3A 3U7GA 1XZAA 4D9IA 1SJ9A 2G4LA 2QLTA 3SHTA 3NIDB 3QUBA 4R8LA 1FFHA 3GNSA 4OFBA 4BFYA 2KHZA 4NXMB 1T3SA 3SE7A 3ZKWA 1FVOA 1GDHA 4UHCA 3DL7A 4RXUA 1N32B 3NWBA 3ENKA 2C58A 1LLQA 3IDFA 1C7IA 2FEXA 4PONA 4DAOA 2Z6UA 5IJ9A 3ACDA 3LUFA 1OBVA 5JNRA 4C4PA 3IIMA 4JP8A 1GUBA 3IJ5A 4HX2A 4UNQA 1RPTA 2ZRAA 5IAGA 4PNEA 3EVGA 4NLLA 2JFXA 3PNVA 1IOWA 3RE1A 4P22A 5I9NA 2TS1A 4UMFA 5AP9A 1GAWA 1DIBA 4CEIA 5K99A 2BH9A 5LD2B 4G8CA 3WVNA 3P5BA 2DF8A 2O8DA 1J09A 1GU1A 4CPDA 5GONF 1RYEA 3KQNA 3NG1A 1SXQA 2A14A 1NW3A 2W8ZA 1OT5A 4ENUA 1BQ4A 3RVSA 2QK4A 3RVKA 1RYYA 2Q46A 2X23A 4Y0VA 3BCSA 1GQ2A 1T24A 1RYDA 4KACA 2VZ0A 3P9XA 4MZDA 1VYVA 4H0NA 3ADBA 2IYRA 5HVNA 5LWHA 3OSUA 4KC0A 4YRCA 3L4BC 4D0LB 4OHOA 1TYAE 4LRYA 3W5DA 1TLLA 3SNHA 4YAKA 3TFQA 1YB5A 3AWDA 4WZBE 3IQDB 2XWQA 4V02A 2EDCA 2OB2A 1CDOA 3A3PA 3IP8A 2D5LA 4KWIA 4XM2A 2H65A 1GDTA 3TOSA 1IIRA 5EKUA 2GT1A 2QTNA 4DXDA 2D7JA 4BMSA 1UJMA 4QOSA 1I7NA 3I73A 4IXNA 2GF9A 5J59A 2PTGA 2VATA 3B3GA 2EJBA 4LJKA 3K70D 3ES9A 1ARZA 2WSYB 1FLDA 4IUCS 2ZBRA 3D4BA 5DHPA 1E5LA 1UK8A 3DT6A 3RHFA 3MLBA 5KUTA 4HEQA 3L92A 3PC8A 4B9EA 3KKMA 5AK5A 5BPHA 2OGWA 4MJXA 1TB4A 3MQ2A 2F48A 2DEUA 4GLJA 4UHJA 1D6JA 1DLJA 3P4XA 4Q5IA 1KAOA 3B6KA 3D5EA 4OJNA 1LLCA 3RS7A 3QQ5A 4POOA 3R8XA 3ZVNA 1FXUA 4LZJA 5ARCA 2X5OA 3HKDA 2H4YA 1TYDE 4URVR 3BEOA 3RFVA 1YA4A 3JARB 2QTGA 1BS9A 1FUUA 4CCWA 3A4IA 3DNPA 1EVKA 4FZ5A 3SSNA 4LOLA 3S99A 1VL5A 1CVLA 5DMXA 2I4LA 2XSZA 3KUDA 1P3Y1 3BCHA 5AKLA 3LF2A 2C95A 3LFUA 5AW2A 2WPDD 2QAGA 5F2KA 5D3MB 3TQCA 3SZLA 4G86A 1EQAA 2OGSA 4LNUA 3LGSA 3ZQ4A 1I0LA 4BS9A 4MTCA 5FWYA 1UJNA 1ZG3A 4WNYA 1JX6A 1JZQA 1S1MA 3IVXA 4Q15A 1OI7A 4JYZA 1AKQA 4MVJE 4QUBA 5H3CA 1P0IA 1YS4A 2DHRA 1N3BA 1G19A 1T9KA 4LGMA 1GYQA 5ADUS 1FPMA 2VHCA 3CO0S 1H5QA 1WQ4A 4XJXA 4UPVA 1ST3A 1Y6FA 3P71T 3CN9A 3JWHA 1N3LA 3EIOA 3EXEB 3PQDA 4HYYA 3EVFA 4WGFA 1QIKA 3NT4A 3RIGA 4MRVA 3IODA 4RX1A 4EVRA 2HCBA 2IGTA 2WIFA 4K2HA 5DVZA 3TSCA 3VV3A 1TECE 1LNQA 1G5RA 2NYAA 3CUKA 3VR3D 5I47A 2GEFA 3RDPA 1UCFA 2GSWA 1QCCA 3D6JA 4E15A 1OXBB 1FP4A 5FR2A 2CLKB 5EG5A 4FFSA 2YC4C 4KQEA 4E31A 4G5YA 3MG9A 1DWQA 4M1QA 1NQXA 2WYUA 3JSAA 3BGWA 4YREA 2GN9A 3C43A 3KZXA 3L4SO 1L4FA 1XCBA 3GJ4A 4G4GA 4XVHA 2YV1A 4EHJA 2OHXA 5DV9A 4DPMA 5B30A 4ABYA 1U2SA 2BFEA 4YFVA 2VT6A 2CLFB 3ETDA 2GD1O 1G64A 3A32A 1CZKA 4IDFA 4R8MA 4EMBA 4M55A 3CX7A 2QPOA 2XUQA 1E61A 3A1SA 5EZYF 3ORRA 5T4FA 3VH3A 2MSLA 1R6DA 1J6UA 4NTZA 3UK1A 5LUAA 1AQLA 2QTLA 1TM4E 1BTOA 2O14A 5JE8A 1NV9A 4ARVA 4E5UA 3N8NA 4FJ0A 3I8SA 4LE2A 4Y9RA 3ND8A 1W8IA 4TLLB 3U26A 5CBPA 3KOOA 1KJJA 4AP9A 4DR2B 3D8SA 4ZOLB 1THZA 3IOYA 2Y05A 2A9QA 3QP9A 1PDVA 3KOWA 5A03A 1FW8A 4E33A 3MUNA 4EA6A 3K20A 1H6AA 2PLWA 2UZ3A 2C99A 4TMTA 1UT5A 1ZJ5A 3QHAA 4FCCA 1X9HA 1QH1B 2R9VA 3SYRA 4YRTA 1HKUA 2PL1A 1B0UA 2R3SA 1QR6A 2VKQA 2YWRA 2VJDA 1SCKA 4MLZA 4PBRA 5AI8A 2ORYA 3OF3A 3X1MA 3HK2A 1VJDA 3H13A 4TV8F 4GE3A 1DRKA 5CA0F 3PLAE 3LPDA 4DDHA 1ZK4A 4B2LA 4ZK2A 4GECA 2BJWA 3NVAA 1NOJA 2I3ZA 3PHLA 5B36A 4RO0A 1SXPA 4PYNA 1Q0PA 1P5ZB 4I4NA 4XZ3A 5FTNA 2C5HA 2GHRA 2RGAA 2DJIA 3M6FA 4WFQA 2IHBA 5SYMA 3N76A 4PAOA 3LECA 3BTOA 3U61B 4YLYA 2X8JA 5JSKA 1YFZA 3ADPA 3REQB 3OLXA 4CLRB 3DUFB 3OLZA 5IUKC 4DXHA 4UEKA 4HPXB 3B9QA 2JFNA 2YWXA 1Z2EA 1DAFA 2AMYA 3AY6A 1VA5A 2WU3A 4QG3A 1YQXA 3IIJA 2DFKB 5C5IA 1ISIA 3U19A 3UGTA 2HB6A 1ZUNA 3H2YA 1JIIA 1N4AA 2OR3A 4M8SA 4TTVA 1YE8A 1IH8A 4WZAA 1BD3A 5ALHA 1DC5A 4FOOA 5TT0A 1XLUA 2VTVA 4D9NA 4F8JA 4PS1A 2LR0A 3OAAD 3U7RA 1HFKA 1YR1A 2CHGA 5ALTA 3EOAI 1M6EX 4K9KA 4MEJA 2ADOA 1GCGA 5CHEA 4DG5A 4AJOA 5C2JB 3QPVA 1XQWA 3BJMA 3N3AC 2WT9A 1G291 5T6BA 1D04A 4CCYA 3EMVA 5EZSA 1J5EB 2M6RA 2PCJA 3O4VA 4AF6A 2BTQA 4I9HA 4BN4A 1Y8QB 4BNKA 3VPDA 2BGUA 3RRYA 5JASA 1CDEA 1LA2A 3HLYA 5KX5F 2H4JA 2Q6KA 1EUDA 2XUGA 3JYHA 3N87A 4HN9A 1NMSA 4IDPA 5FO1A 1XWWA 1EJBA 4PRKA 3HMQA 4GDMA 1VI5A 2DPLA 1N2CA 3ZHZA 1CR1A 4RTLA 1N5OX 4W5WA 1OH6A 1A9RA 5K01A 4ZXPA 1UBLS 4JJFA 1Q84A 1M2GA 5EEGA 4PZLA 1UAAA 2HSZA 1P9LA 1MRZA 3CF4G 3TBFA 4G97A 2ODWA 4GPZA 4BVHA 4I5FA 4GE0A 2IYPA 3ZEAA 4BX9A 1PZMA 4IRUB 3IQEA 4AMVA 2G0AA 1X7ZB 1V7CA 3BSSA 4KTTE 3RUIA 1XZFA 2AXQA 4LMRA 3UPTA 4QUDA 1DTEA 1XDBA 5GAJA 2XNSA 4LC0A 3GPDG 5CVUA 2ZUFA 3TECE 5KNDD 4HDNB 2ZDQA 4U2BA 3C87A 3TWOA 4MGEA 2FSPA 3E3OA 3E9CA 2E9SA 4M9SA 4GMKA 1B42A 3IE1A 1ADFA 1SXJE 3THWA 3AYXB 5I7UA 1GPYA 4O4HF 4YVFA 3LUBA 2ZUUA 9LDTA 4BEJA 1SUAA 1TW3A 2AOXA 5THQA 1QWSA 2P9EA 2VN8A 2Y1DA 5LVAA 4DLKA 4DCPA 1A77A 1AM4D 3TAHA 1ISFA 1W46A 3FPAA 4HDQB 2BGLA 3OCZA 3HN7A 2BFPA 5IVKA 1XRNA 2I80A 3DG9A 2JI6A 3IXMA 4XRRA 5LIRA 2VQEB 1ZD9A 4M7RA 3GVPA 2I4MA 2FK8A 1EUCB 3FKQA 4LW8A 4ME6A 5JS8A 4W1SA 3M81A 3CLSD 1GL3A 3R3ZA 4N8EA 1QFYA 2OBFA 3PPXA 5BW8A 1XYVA 3H9JA 3D8NA 3U7IA 2XE6A 4U0KA 4MJLA 3A4MA 3QEMB 4AIIA 3HL4A 1CY6A 4KXWA 2EKBA 3GWZA 2YVQA 2EKPA 3O8QA 5DLYA 1XCJA 4D6PA 2QUBA 3GVIA 5ELMA 1M1NA 3FUVA 2HDHA 3IUPA 1B1AA 3LPNA 1KHTA 1IZYA 2X9NA 4OIMA 1DOZA 2CVQA 3PVSA 4PSUA 4P58A 4BO8A 4CV0A 1U0BB 4I50F 3BIWA 3T3GA 4EDFA 6ABPA 4R40A 3Q3CA 3A4VA 3R76A 3FOZA 3GAMA 4B4DA 2HMVA 1SBNE 3FYCA 1JVSA 3N7UA 3OTWA 5ILQA 2FDCA 2PUHA 1KKMA 8OHMA 4HTAA 3EASA 3NHRA 4MWDA 4MI3A 2RHCA 1YQQA 2QD1A 4YQFA 3VNVA 4JC8A 2VA8A 2J9FB 4OLAA 1HL3A 3SJAA 4L57A 3FZYA 3RBZA 3EEQA 3AV0B 2WKSA 3TN7A 1T91A 4HEA6 3OUUA 5CEFA 1D6SA 2HF2A 1X70A 721PA 5LMUB 1GADO 2CB9A 2VXBA 3UJPA 2JBAB 4Y0NA 5HZKA 2XCSB 3OZVA 4AUMA 1NHWA 1DAOA 2IUUA 3D0OA 3OZRA 1D2GA 2VJCA 3RIHA 1MQ8B 3UCXA 7ABPA 3CM0A 2O0LA 2PUAA 3GOHA 1AKMA 5L7WA 1SQ5A 1WXEA 1B6GA 3PGKA 4FI3F 4KHZA 2J85A 1W0KA 1XVVA 3H2IA 3H5VA 2CJXA 2X14A 3JPYA 4Q12A 1QRSA 4MLCA 1EFCA 4AVYA 1N77A 5CB4A 1ECPA 3ZGYA 3G2OA 5IXYA 1U6IA 3UB4A 5FP0A 1D4AA 1GTZA 1KIAA 1YT5A 2HIMA 2JRLA 5A05A 3NBQA 2FRDA 3DMTA 2QG4A 3PD1A 3ZZ0A 4ZP1A 1Q2XA 1SCUB 3LA8A 4O2BA 5ULLA 2ETVA 2R4QA 2VSNA 2AUNA 2GRAA 3HDQA 2A67A 2WIDA 2XUHA 1HTBA 1UM9B 2LDXA 2RGDA 3QOYA 4MVJG 2Q4TA 4EB0A 1GQYA 1EVYA 1W0JD 3PA6A 4IP0A 4AZ0A 3RR2A 2QT9A 4HUQA 1PL6A 2XIQA 2JZCA 4JQCA 3TCKA 1HYQA 4RK6A 2VP9A 4EB3A 2GPJA 1O54A 4MGYR 4EB6A 3T3PB 4ED9A 2O06A 2CKMA 1JFRA 5DI9A 4IDBA 1BJKA 4P6VF 3O91A 2FSVA 4AKSA 1G63A 5FEUA 2Q2NA 4I08A 2GFQA 4FLEA 2PL3A 4ZVKA 4QLAA 2IX3A 4EG4A 2BIFA 3AWIA 3MBIA 3ITDA 1E62A 1R6TA 2VSOA 4JSTA 3ZE8A 4BX0A 5IUJC 1TW2A 1Q3TA 5EP2A 4DMUB 1MABA 4Q9JA 3KQLA 1A9ZA 1P73A 2H00A 2HK8A 3DCIA 4R84A 1THTA 1XEWX 3KQOA 4CEHA 5CIWA 3U44B 4KR9A 2QU7A 1LC3A 2J3IA 2GF0A 5F35A 2PX3A 3E5NA 2VT3A 5I48A 1IAVA 4JYBA 4TVBA 2FZEA 1K6IA 3W3AH 1HGXA 3P1JA 1WV0A 2CJYA 2IE0A 3U4QA 4MQBA 2WB4A 1LF5A 1XMQB 4HPWA 2G77B 1JN0A 2JGEA 3BTUA 1ES9A 3FHOA 1QORA 1XMJA 1JECA 1RJDA 2IP2A 4R7TA 2QT0A 2DPYA 4WKNA 1K08A 2PIDA 2H4WA 4FNOA 3GJ7A 4O8ZA 1DIGA 1HLDA 3MS2A 2Y0BA 4ILEA 3VAYA 5EGSA 1WG8A 2ZS8A 1U7TA 1W2WB 1YZFA 5ES4B 5HYVA 4P98A 3HNPA 5B2EA 1VG1A 3E2IA 1H5NA 4K03A 1NMQA 3CMMA 3AI7A 2KX7A 4I5EA 4GDFA 1DDIA 3NT2A 1O8CA 2Q2QA 2RGNC 2GJAA 3HS3A 3VUFA 2XB9A 4IJUA 4A7PA 4O4JF 4JVNA 4BNDB 1I4EB 1P1RA 1ZAKA 1X0XA 3H19A 1G6KA 4HN4B 1JMKC 5DLEA 2PH3A 3FYUA 3LK6A 3D1LA 1ELOA 1EINA 3QTBA 1EM8B 1C0KA 1JUDA 2X1VA 2X6RA 2Y4OA 4G56A 4OM8A 4UBMA 1A5ZA 3Q3GE 1IQPA 4UCQA 2GA9A 1U04A 4PG5A 4D43A 5MN5A 1O6CA 4IF4A 3G3EA 4HLUA 4FLMA 3REGA 3OQPA 3QU7A 1YHZA 3D0RA 3FDXA 4FONA 1WHTB 2YASA 2YWCA 1OX4A 3LW7A 1Z6QA 1OGIA 2YVLA 5JQGF 1MDFA 3LCUA 2P1DA 4UD6A 2ATEA 3AESA 4XKJA 5DKFA 5CA1B 1QVVA 4EGSA 3TJZA 4DCGA 5KOIA 3ON5A 3AK4A 1PK7A 4EG3A 3EPRA 1L2TA 5EMHA 1ACMA 5BSEA 4LRTB 3PXEA 3RVNA 1ICEA 1P0PA 1W52X 1KK1A 1YBHA 4B4WA 2FRVA 4ZTUB 3EG5A 2WABA 5LQSA 1CQZA 1DCMA 3Q8LA 2RGWA 2WINI 2YW9A 4KE8A 3W9UA 4A82A 1M5UA 1SMKA 4FJ2A 1BDBA 1X39A 3KXLA 5DGIA 3F4KA 4DGQA 3I39X 4ZICA 2V9CA 2GCEA 1RIIA 1UWLA 3A9UA 4G85A 5AI0A 2JLZA 3QVKA 4ARIA 1H3EA 2B0JA 1U2DA 2WJ4A 2ZIAA 2NVUB 2FP4B 2I87A 4X1YB 1JILA 4A6XA 4ESOA 1ODTC 3OPYB 4QT0A 2H51A 4RMJA 2ZM5A 2GN2A 2Z2YA 2ZSUA 1F2UB 3ZWCA 5JJKA 2O2EA 3PT9A 5TXGA 2QMEA 2NACA 5TC4A 3MTJA 1JHMA 1KMHB 1QG6A 3NKVA 4F97A 2D1TA 4UBKA 1XYGA 3A9WA 3DDUA 4EF4A 1L5HB 3R6WA 3TX6A 1O6BA 1XMIA 2IY7A 3Q0IA 3MHTA 1XIVA 2ZRIA 1UQTA 3A6LA 3IAAA 2LZ0A 5F78A 4CGYA 3RRZA 2AS0A 5HRUA 2DUWA 1PU2A 1Z8FA 2CXNA 3KKLA 4IXDA 3OBIA 1BFDA 4Q7EA 1NHGA 1DSSG 1YTUA 3K0FB 4TL9A 2CJFA 1RXSA 1II8B 2PZBA 3CKYA 1ZJ4A 3L7MA 4M86A 5IH7A 4Z1MD 4X92A 5TQ2B 2RK3A 3ZY3A 1TCUA 2C2BA 3VDXA 3GFTA 4JBGA 2MHCA 2CVOA 3ZU3A 3K2BA 5FOSA 4HKTA 1QP7A 2O52A 2CXQA 1U3GA 4G41A 4F11A 1F0YA 4ZT3A 4CEJA 3VU1A 4BNVA 4RTNA 4XRGA 3NUGA 3PUKA 1X38A 4FBLA 1SO8A 4PCAA 5MN4A 4J4TA 4BVFA 1FFEA 4RESA 4MRPA 2WJ6A 3RVMA 3U4HA 1LEHA 1G8GA 1HF3A 3PF9A 4OREX 5EIBC 3DVRX 5HDBB 2TMGA 4D97A 1ESCA 2I2AA 5I7EA 1J90A 4QARA 4TV9F 1KI9A 1SK8A 3EEBA 1RYMA 3CRQA 2GD0A 4Z4HA 4Y1RA 3AEXA 3K71B 2C8KA 1E7QA 1JEDA 1X87A 3K0CC 4BTVA 4KX5A 4BBAA 1R3DA 1TCAA 2JIBA 2GHTA 3HM2A 3KOUA 3QXXA 4FKMA 1DEAA 1NOIA 4GOMD 2CHEA 1LPSA 1OJLA 5C1PA 1Z0JA 1JE1A 3C5HA 4J07A 1N1MA 1VCOA 4BZZA 4KU4A 3RYHB 9GPBA 5LSAA 2XA2A 4B6OA 1E4OA 3GLGA 1U3CA 3X43A 2RKWA 2RI6A 2PZFA 4R2KA 2GBGA 3UUFA 5IF9A 1IVSA 1QP8A 3R3SA 1V9CA 1A2OA 4ZRMA 3UY4A 3SU8A 3FCXA 3HR8A 1AJEA 4O02B 2V5AA 3FR8A 3UW1A 4RA6B 2ZT7A 2ZB3A 3CNEA 5CT6A 4G9BA 2HLDA 1FBNA 2WKPA 3GCGA 2O3TA 1RD4A 3R41A 5LP6C 3TRDA 3BD9A 5DPMA 1HE2A 2RH9B 2QTFA 1ZUIA 3N3BC 2UZAA 4Z53A 3DV0B 1QC5B 2C00A 2PX4A 4H3KB 4KXFB 5BRNA 3WMEA 5TIIA 5DBEX 3CLUD 3F78A 3ZDRA 1N5MA 5FORA 4W5QA 1CIJA 2J33A 3GFBA 4ZYWA 1F0KA 2YJ4A 4IGAA 3WLTA 2E4WA 2RCNA 5JCOC 1L5RA 4O0MA 4ZYXA 4DV6B 3COVA 1RYZA 3O3CA 2O8CB 2R11A 5CYPA 3H6HA 1VBFA 4C01A 1BO6A 3E0QA 3OLYA 4LVNA 2EP8A 3EGDA 2WP0A 2JFYA 2Q1TA 5FNVF 4C21A 1VZ3A 3V4LA 5B6PA 3SG0A 4WNIA 2BEUA 4HLCA 3QW2A 1FDUA 4XLZA 3WGVA 1OAAA 5JNSA 4JK3A 2QJOA 3IOMA 4OV6B 2EEPA 3FFBA 4CWAA 3M6IA 2DU8A 4D4GA 4UUOA 2CMKA 4N65A 3S2YA 1I3MA 2Z6AA 3C7DB 1ECBA 4S1TA 2I34A 3BL8A 3VX3A 5BOSB 3C4JA 1U9CA 3VJKA 4B09A 3TFOA 4CW7A 1O6FA 2XGGA 4BN0A 1V41E 2FB9A 4XVQA 4KPGA 4RZQA 2H1FA 4W1PA 4ND3A 5F5NA 4ZEMA 2V7WA 3OT1A 1N92A 1O9BA 3E9DA 3UJ6A 1QHHB 3ICCA 4KRYA 4M36A 2GBLA 4NY1A 3UT5B 1CUAA 1TVMA 2FXVA 4GVLA 4F84A 2QHXA 3PX3A 5G3ZA 3LVBA 1Z06A 2GDJA 5DO9A 3IIIA 1OYOA 3QYFA 1JQJC 4MUEA 1EA5A 1XVIA 1IZ7A 5FPSA 3KEMA 3JQ9C 3QX8A 3R9IA 3IEVA 4GM4A 3EGIA 4XA8A 3ICVA 3P9CA 2EZUA 2R8RA 5AW1A 4JLPA 5A4MS 4RPGA 3ZV6A 4EH1A 1GWNA 3INGA 4PRZA 5CT8A 3M4ZA 2ET6A 1U2PA 2GSDA 3CONA 4G81A 1KZ6A 4MZXA 3ZPXA 1JT2A 1T6NA 1HT0A 2BGRA 1THGA 3QMVA 4R8KA 4CKCB 3ZVMA 4UUPA 4RPKA 5F3DA 1VXOA 4NBRA 2WEKA 3SEQA 4JOBA 2GEJA 5BXQC 1ODJA 3DKVA 3KD3A 1GUYA 1V5FA 2G83A 2VAWA 3DBLB 1S6YA 1Z73A 2I62A 4OTZA 2IEBA 3A3OA 4GI7A 5AHOA 3TUIC 1XQ1A 1A9YA 1XCMA 2HNKA 2WZDA 1M67A 1TOAA 2D1FA 3IT0A 4RHFA 3OY7A 1L8XA 2HCJB 3PS9A 4CMAA 1CJKC 1F7VA 5C3UA 5C31A 1QFJA 4U2FA 2B8JA 1JAZA 2XMDA 3IKMB 4G5OA 3VZSA 4JIGA 1W4CA 3OFKA 4QYXA 1NM5C 2A1TS 4J1TC 5HGJA 4AS1A 5DEOA 5EP3A 2B6HA 3E0XA 3DVAB 2HJVA 1RQPA 4E2WA 3U3MA 4IMIB 4AJJA 2IDJA 2AG1A 4I9GA 4KL8S 1UODA 4EMSA 2GPTA 4FDUA 4B3MB 1H2HA 1VSUA 2FQXA 2WPDA 1L8LA 3M4YA 4TT8A 4WLOA 3VVMA 1X1EA 2TECE 3I9LA 4H31A 3DEAA 4D4JA 3MUEA 4QFDA 5CX4A 3R6GA 4OKIA 3OKPA 3O26A 1C1DA 1WNFA 3PFCA 3ZZTA 2HHJA 3A9VA 3QPWA 1G21A 4RACA 5F76A 1O87A 5AXAA 1S3GA 3T12A 2PYDA 2MSEB 4HLQB 1P9NA 2ZTUA 3AB7A 1EGVB 2HREA 1SUSA 3AEZA 4NH4A 3UKOA 5MFZA 1EZ1A 1PD1A 3OJWA 1ABFA 2ESRA 1X7GA 5JQWA 3Q72A 4LMPA 5IZCC 3B48A 1ZWLA 2E87A 2WFLB 3A6EA 4EKDA 2Z6QA 4M87A 3PKIA 5FYDA 2O8FB 1T9GR 2FN4A 1PEYA 2OMKA 1BFKA 4NC9A 2R97A 3UAOA 4BNLA 4HNQA 4CF4A 5KX5B 2ENWA 4MV8A 1KQGA 5T5QA 3U1TA 5ALFA 3VR3A 2GZMA 1H0RA 2IUSA 2KW5A 1SVUA 4LCJA 1KDOA 3P9PA 3B38A 4BLRA 1V48A 3A1DA 3FDZB 3OPYI 5G1PA 2G36A 4D82A 2ZE6A 5B4TA 3IAUA 3SWWA 4CMHA 2BC9A 2HU8A 1Y4AE 4I6JA 3SKVA 1LI5A 1RWBA 4TPKA 5JZOA 4I1YA 4KTVE 2NSLA 1DEHA 1NLUA 2QVLA 1VMAA 3I9V1 2YHUA 3IUSA 4INJA 2A6PA 4GWKA 2VHXA 4IGFA 4J43A 4NG4A 4QATA 5IM4F 3B6IA 3E7PA 1J21A 2IHZA 3K2IA 3QBVA 2I1VB 5DOZA 3LNCA 3VSEA 1QDEA 1NUTA 2BP7A 4N8DA 4XAQA 5HJ2A 3ZZMA 3DW3X 1QE3A 1U2GA 4JR1A 3VPAA 1Q7RA 3BILA 3S8EA 5IT0A 3CX3A 4UVHA 2H4HA 2NZVG 4Y98A 4UU1A 3TB6A 1YAJA 4DG9A 4EUSA 3BQ9A 4MWZA 5BT8A 4V0RA 1LS6A 3FYDA 4UAJA 3GHHA 1UPBA 1IWPB 1CF9A 1P17A 1TYEB 4KYVA 4E07A 4KXUA 1U3UA 1YL5A 5ETJA 3VJLA 3EEOA 2BRUA 1NDQA 4TYQA 3ND9A 4BGVA 4MV7A 5D3ZA 5BXYA 2FOIA 4OJQA 4CKZA 3JYQA 5IJAA 4B85A 5JSZA 1XO1A 2QLFA 5K3CA 3UOGA 4N76A 2D1QA 2IUYA 3T9AA 1FUIA 2FPIB 2XOKD 3ELUA 5COBA 4CM4A