1ZI8A

Crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
b'MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVASKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTGSSGYVASAAALANERTLDFLVPLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi8A00
5FPQA 2HU8A 4G8DA 4QA9A 4H7KA 4BP8A 4W1SA 4EB0A 4K2AA 2WUDA 3FCYA 5ALVA 4WFIA 3JWEA 5ALEA 1XZKA 2OQIA 3WJ1A 1CUZA 4LXIA 4PV7A 3ANSA 2RHTA 3QPDA 4XJVA 4C89A 1GT6A 3C70A 3DL4A 5AKYA 3FOBA 4UFOA 2PU7A 1DWOA 2CMFA 4WY5A 5K3FB 1BEEA 1H22A 2XMZA 4Y2PA 1G5FA 2AJLI 1IUOA 2UZ0A 5YASA 1CUIA 1TIBA 5AKJA 1ACLA 2BJHA 1YASA 3LS2A 1F8UA 3D2BA 1LPPA 1E8MA 1PV1A 4IO0A 4GLBA 3F97A 2QXTA 5AP9A 4ZV9A 1TCBA 5A6VA 4AXBA 3KWFA 2V97A 1UOPA 5JAUA 4RNCA 4MYSA 2PSJA 4MQMA 4X97A 5D7BA 1EB8A 4B9AA 4E11A 3I2JA 1BU8A 5AI6A 3C5VA 1YS1X 4DNOA 2EDAA 3FYTA 4OSEA 4Q1VA 5LZ2A 4IH1A 1G42A 2QT9A 1CUXA 1E8DA 1R3DA 3C8DA 1QO9A 5JYCA 3H0CA 4V2IA 5ALGA 1XZIA 2VQ6A 4FBMA 1E66A 4M0MA 1F0NA 2XUIA 1JFRA 4U2GA 1U65A 4H7DA 1QIKA 2B4KA 1CUCA 4BAUA 4AX4A 1JJIA 1F0PA 3LLCA 3U0VA 3ZLUA 4X6UA 4K6KA 2YYSA 4ZGBA 3DQZA 2OLEA 2HADA 1LPNA 2G5TA 5HKAA 4C88A 4DNQA 1MX9A 4IH4A 5KREA 4MEAA 4H35A 2XMGA 4BC0A 1D07A 2ACEA 3BJMA 3RM3A 3WI7A 3VVMA 5ALQA 3G7NA 4BZWA 5C8ZA 4BCDA 4DGQA 1HPLA 1JJBA 3WK5A 2ZYRA 3R3VA 2XT0A 2VAVA 1W76A 3V1MA 4FLEA 2VATA 4OB7A 3W04A 4FLFA 3A2MA 3ESDA 1JMYA 1AGYA 1AZWA 2X8BA 4AO8A 5CXXA 3UMJA 4J0IA 4C4XA 4I3FA 1WHSA 2XQKA 5AK5A 3BF7A 4L9AA 1JI3A 1XZMA 3HEAA 2K2QB 2PU5A 2ZYIA 5JZBA 1MU0A 5AOCA 2JIDA 3WKEA 3BDIA 3O4GA 3ED1A 3R0VA 1TQHA 4H7FA 1ODSA 3DKKA 1CUGA 1XQYA 2CEKA 2XB6A 3P2MA 1H2YA 2ZYHA 3WK6A 4HVTA 2PBLA 1XRRA 3DYIA 4QLOA 3PE6A 1IVYA 2PSHA 4FOLA 3MUOA 5AI9A 1XRMA 5CMLA 5FV4A 3Q8WA 3VDXA 4UHCA 4QWWA 5IH7A 3G0IA 4Y2RA 4F21A 1P0MA 4BAZA 4FWBA 5K3BA 5HCUA 4L0CA 4YASA 2GBGA 3AILA 2ORYA 2Z8ZA 3HLKA 2HDWA 4UBOA 4WFKA 2ROQA 3WL7A 1GKKA 3FBWA 3GBSA 3OPMA 1DQZA 4AO6A 1GPKA 2VSQA 2GZSA 5K3CA 4UPDA 5AJHA 4FKBA 5AM2A 5AICA 1AQLA 2RHWA 1QO7A 4MYDA 4GDMA 3KD2A 4QNNA 5DNVA 4ARAA 2H9YA 4P08A 1C7IA 5HQ3B 5AM0A 4L72A 1XQWA 5AKKA 2ECFA 4HXEB 5ALKA 3WWEA 2IX9A 2PSEA 1EK1A 5FDFA 4Q3LA 5FPPA 2BUCA 1XZGA 5AKXA 5ALSA 5ISMA 1EDBA 5CT4A 4RE5A 2BGRA 4H7IA 2HM7A 5DYTA 1CRLA 3GUUA 4D9JA 5ESRA 2WG2A 1W4LA 4BDSA 2J3QA 1A8SA 3HSSA 4LHEA 1MN6A 4W1PA 2Z3WA 3FCXA 4XIIA 2V98A 2JGJA 4J03A 1FFEA 2PVSA 4BB0A 5ALPA 2WIFA 2GBCA 5AKZA 1GXSA 2H7YA 3VJMA 3CXUA 4RGYA 4WY8A 1MNAA 1SFRA 5D6OA 4U2FA 5ALMA 1CUSA 1THGA 4KRXA 3IULA 4FFWA 3MUNA 2GYUA 3O0DA 4B83A 1B6GA 4WDRA 4AN0A 1LBTA 1YB7A 4AMYA 5CURA 2V96A 1UKCA 4H18A 3WK7A 1DU4A 1IZ8A 2CKMA 1XZFA 3M81A 4G5XA 5BWBA 2XMDA 5CH5A 4CG1A 2XUDA 5JARA 3B5EA 1EDDA 4UBKA 4FLMA 1JKMA 1CQZA 5AKGA 1R4ZA 1QZ3A 1N5MA 5FLKA 4KE7A 1CUDA 3T4UA 1VJ5A 2FJ0A 4DMCA 3H18A 5EFZA 5ALOA 1QTRA 1XLUA 1U2EA 4FTWA 5CRIA 6YASA 4MWSA 3TRDA 1GPNA 4JUIA 2XLBA 4LXHA 2W22A 2ZYSA 3QYJA 3O9MA 3TEJA 4BC1A 1QIJA 2XQFA 3C43A 2CUTA 1UKAA 1RYYA 4X00A 3F98A 4X6XA 2WJ3A 4KACA 2GZRA 1XZDA 4N8EA 4KRYA 5LKRA 4IHAA 5IVKA 1T4MA 2GYVA 1ZGCA 5DNUA 3VVLA 2QZPA 4PSCA 4BZZA 5DYYA 4FNGA 3YASA 1CFJA 1ETHA 5BWCA 4N8SA 3G0GA 2WHPA 4OU4A 4OB6A 2QTBA 1K6EA 4ITVA 3O4HA 1LNSA 4Y2TA 2Y6VA 3IUQA 4X6YA 3NOXA 1OXMA 4AQDA 1P0IA 2G63A 5ALTA 4DNFA 1RWQA 5EHQA 1EVEA 1E3QA 2I3ZA 3FSGD 2XUAA 2I03A 4K5QA 3KDAA 4EBBA 1QIGA 2C0QA 5DTIA 1CLEA 1Y7IA 2PSDA 1ZIXA 2B9VA 2LIPA 3O4IA 3STYA 3W9BA 1Z68A 1H2XA 4GECA 4BATA 1MPXA 1VZ3A 3IUJA 5J3JA 4KAFA 1WCYA 4IQ4A 1OCEA 5T4EA 3CCCA 2I78A 3O4JA 4BTVA 3DEAA 4J0JA 3WWCA 4HAIA 4LYEA 4OPMA 5A62A 1EHYA 2H7CA 4BVLA 2DHCA 2AJ8A 2QMQA 3LP5A 1BCRA 1HKHA 2OAGA 1DTEA 1ZD4A 2I3DA 4LYDA 2BGNA 4Y2JA 4Q3OA 5IVDA 5JASA 1YS2X 5H3HA 4BTLA 3CCBA 3EQ9A 1BROA 5KWIA 1Y37A 4YX9A 1KEZA 5SYNA 2QOEA 4X92A 3AIMA 2DHEA 3E4DA 5CT6A 4EY5A 5HK8A 2WG0A 4OYYA 4C01A 1I6WA 3FNBA 3ZLVA 1L7RA 1LPBB 1VXOA 5LKAA 2P8SA 3B3QA 3CN9A 2EDCA 1QIFA 3AJAA 1DT5A 1SCIA 1TCCA 2O2IA 3R41A 4BRZA 2AJBA 3C6BA 3IURA 1DQYA 3KOOA 3R3WA 3STXA 4B84A 1ZD2P 1U8EA 1W6RA 4LIPD 4MXDA 3QBJA 4WJLA 3QVMA 2IIVA 3G9TA 3H04A 1PJAA 1QIMA 4AB1A 5JZ9A 2XI4A 3PFCA 5DLPA 1HLGA 4UHBA 1J2EA 1MX1A 2Z8XA 2CB9A 4ZRDA 3WWOA 4DM7A 4AO7A 4PF1A 5A7HA 3FAKA 4PQEA 4RPCA 4UBMA 2FJPA 3WA7A 1XZLA 1FFAA 1W52X 5T4FA 3AZQA 4ARBA 1XZHA 3W06A 1WOMA 1MJ5A 2OPHA 4CIAA 1X2EA 3D4LA 3UUEA 3DNMA 4J3JA 4PSUA 4B9EA 3F96A 1ZJ5A 1EK2A 1TK3A 4B80A 3STWA 3BJRA 3WZLA 5KBYA 4UHHA 3HACA 5LIPA 4KAAA 3A6ZA 3SK0A 5AM1A 5CW2A 1XQXA 1MAAA 3ILSA 3N2ZB 5CT5A 1DWPA 3ESBA 4F5ZA 5AM3A 3VISA 1IUPA 4Y2UA 3F8SA 1ZGBA 3FYUB 1ORWA 3E3AA 3BXPA 4BBZA 4KE9A 5EHNA 2WJ4A 5A2GA 2JGIA 4QDZA 3R40A 4HRYA 1ODTC 1WB5A 4O08A 5ALLA 2XQIA 2WM2A 1R88A 3OOSA 1Q83A 1H2ZA 2Q0XA 4UBIA 3I6MA 2JF0A 4KR0A 2OXEA 4BYMA 5AK6A 3V1LA 3KSRA 1YAJA 1LGYA 5LZ4A 1C4XA 5F4ZA 2ZSHA 4HZGA 1T2NA 3FYUC 2HFJA 3L1IA 5JANA 4K6HA 3OG9A 3H1BA 4B81A 4Q82A 5HF6A 4JYMA 1L7AA 5ALUA 1GQSA 4GEGA 4FNMA 3O95A 4HXGA 1YA8A 4C4YA 3ZV7A 3W2TA 2YH2A 3RKSA 2VF2A 3WK9A 2J4CA 1NX9A 3WQHA 2BAGA 2WIGA 4DMKA 2HL6A 5D3ZA 2XMBA 2VEOA 4U2CA 1TAHA 1AKNA 4RE6A 5AOAA 5FXMA 3G9ZA 4BP9A 4K6GA 4H7JA 5EIAA 1SC9A 3V1NA 1J1IA 5HF5A 2OCGA 1TCAA 1A7UA 3A2NA 3IUMA 3DKRA 3G02A 4B85A 3MGAA 5C8XA 1CIJA 4H7EA 1HDEA 4XVCA 1FFDA 1QFMA 1ZIYA 4E46A 2HFKA 4DNPA 1EI9A 4UFPA 3ICWA 3HYSA 4X85A 5E4YA 4Y2XA 2JGFA 1WB6A 4CCYA 1QIDA 5LZ8A 2VA9A 2WHPB 5JD6A 3A2LA 3BIWA 3WL8A 3GROA 5HF9A 4HTAA 2ACKA 3H2KA 3OM8A 1QIHA 2WIKA 1ODCA 3ICVA 1DT3A 3AZPA 1IMJA 3DLTA 4UFNA 3LCRA 1GKLA 3WK8A 3PFBA 4CG2A 5I9IA 2W6CX 4AN1A 4QZVA 4B82A 2HA0A 4U2BA 1QGED 4WCVA 1YB6A 5AKIA 4LXGA 4QEKA 2RI6A 4M0EA 1QOZA 1EVQA 1CEXA 1UXOA 5AKHA 1UOQA 3BL8A 1R9NA 4QWMA 4CCWA 4AMZA 1EH5A 3IA2A 3DOIA 4UHEA 4I19A 3WWPA 4C87A 2E3JA 3IVMA 3NGMA 4C6HA 2WILA 3ANTA 3TGLA 4DTCA 5ALWA 3V48A 4CFSA 1EX9A 3WIBA 3IBTA 1IZ7A 3I6ZA 1G4HA 3HXKA 1EA5A 2VT6A 4W63A 4INZA 5AK4A 3O9VA 1HQDA 1LPAB 5CTAA 5JZSA 1AC5A 2OCLA 2DSNA 3EQ7A 4J0HA 5ALIA 1AUOA 2ZJFA 2PSFA 4FDMA 5E4JA 4BDTA 2XMQA 1CPYA 3C45A 2HA3A 3HABA 3WKDA 1XZEA 1LLFA 1LPSA 3I2FA 3DYVA 1PFQA 2PKYX 2PPLA 3N0TA 1USWA 3H1AA 5CT9A 2HU5A 2O7VA 3G9UA 1Q84A 3I2IA 2OCKA 2Y2UA 3C87A 2WIJA 5EI5A 1WPRA 4H7HA 5HFNA 2QUAA 1CUJA 5LZ9A 1UK7A 2WTNA 2OGTA 3D2AA 4PW0A 2FUKA 3I6YA 4HRXA 1VZ2A 2PX6A 1H2WA 4X90A 4CG3A 3IDAA 4B7ZA 1J06A 3QPCA 4FFVA 5BOVA 4TPKA 4UBNA 4MWTA 1NU8A 2WUFA 1BEZA 3H19A 2QUBA 5C81A 2VJBA 3G9XA 4J0KA 2CJPA 2XUPA 3OC0A 2O7RA 4P9NA 3VKFA 1X2BA 1SOMA 5CH3A 4G4GA 3WMRA 1XKTA 4M0FA 3VJKA 4BE9A 5IKXA 4GW3A 3WYNA 5K5EA 4N5IX 2VT7A 3AIKA 1BE0A 3BE8A 5AI5A 2DQZA 3DCNA 3H2IA 4QLAA 1B41A 1SCKA 4GHWA 2WFMA 1S8OA 3FWHA 4KEAA 1GPLA 3I2KA 3G0CA 2XMRA 1CR6A 1CVLA 3QM1A 4QDTA 1ZI8A 5AO9A 5ALHA 2JBWA 4ETWA 1GGVA 4AZ0A 5DJ5A 3NUZA 2HRQA 2VAXA 1UK8A 3JYHA 3VJLA 3LIIA 4DSZA 5JAOA 4XX1A 3OTQA 4QDXA 3G8YA 4H77A 4L3WA 1MX5A 3D0KA 3STTA 2QKYA 4HS9A 1DINA 1VA5A 2PUHA 4GBGA 5JD5A 3C8HA 1BCSA 3QITA 4JNCA 1CUYA 3G0BA 3STVA 4G8BA 5JAPA 1E89A 2WLSA 4Q34A 5I8PA 1XROA 4Q3KA 2DHDA 4DLNA 2C7BA 1FJ2A 3DJYA 2WG1A 1A8UA 5SYMA 3EQ8A 1KU6A 1W1IA 3BDVA 3RARA 5ALRA 3H2JA 4BRSA 4UHDA 4WFJA 3DOHA 3WA6A 1UZAA 4OUKX 5AI8A 2OQVA 1E5TA 1SCQA 1CUVA 3U1TA 3OURA 4GWLA 5C7YA 4J0DA 1XZBA 3D2CA 1P0PA 4PNZA 3C6XA 3QMVA 2XMCA 2Y6UA 4G4IA 1YCDA 3IB3A 5FOQA 1QTIA 1NU6A 1XLVA 3ZI7A 1WM1A 4C4ZA 3PUIA 4BCCA 4Y2VA 2H1IA 2WJ6A 1BRTA 5LP1A 3T52A 4ZXFA 5JAHA 2WUEA 1VE6A 2XUGA 3B12A 3GA7A 4OYLA 1U4NA 1JMKC 1XLWA 4EZIA 1QLWA 2EEPA 1A8QA 3EBLA 4FBLA 1ZICA 4CCYB 2XUJA 2Y1KA 3MVEA 1DX6A 3I1IA 3QMMA 2JGKA 1MO2A 2WU4A 3WL5A 3FVRA 5JADA 4A23A 4CIBA 2HHAA 4KAJA 2QM0A 4W1QA 3WWDA 1MTZA 1R9MA 3C6ZA 1XRNA 1N5RA 4Z49A 1QONA 4TVKA 2QXUA 4J7AA 1UKBA 5FKJA 4QDOA 1J07A 1F6WA 2OG1A 5JD4A 5E2IA 5CXUA 1FFBA 2HA4A 3WKBA 4A5SA 1ISPA 1CV2A 1UFOA 1W75A 3M3DA 3DS8A 2AJCA 1EB9A 5IVHA 1THTA 3FLAA 4DMFA 2RONA 3WLAA 4G9GA 2WTMA 2G4LA 5DTJA 4S0XA 2RIPA 1CUEA 1EINA 1LZKA 2JGLA 4ZWNA 1QFSA 2OGSA 4NMWA 4MEBA 3WL6A 2OAEA 4W9RA 5JALA 3D7RA 1Q0RA 3FVTA 1JU3A 2V9ZA 3DDUA 3KWJA 4GI1A 2C0PA 2R11A 2WU3A 3GZJA 2HA2A 1R50A 3E1GA 3R3UA 5DYWA 2XUOA 2GYWA 4FHZA 3WK4A 4YPVA 1XRLA 1ACJA 2HA6A 4UUQA 5FP0A 3WIOA 1VLQA 3QPAA 2PL5A 3PI6A 1YR2A 3WYDA 2XUKA 2GBFA 2R8BA 4BCBA 2O2GA 4EUSA 4BVJA 5A7GA 4UHFA 2OCIA 5AKLA 1JT2A 3X3HA 1YAHA 1JJFA 3AUKA 3D59A 2YASA 3WKAA 4G4JA 3D5EA 1CUAA 2DQYA 2H7XA 5ALJA 5E4TA 3C6YA 2Y2VA 1AX9A 1VOTA 4G1FA 1ZOIA 2Z3ZA 4B0OA 2D5LA 5DNWA 5AIBA 2BFNA 1K4YA 1K8QA 4X93A 4P93A 2QS9A 4P92A 4HXFB 3AINA 4Y2YA 1QIEA 1WHTA 2JGEA 3V9AA 5AHXA 2IITA 5AIAA 1QE3A 3H2GA 1LPOA 1ZD5A 5ALZA 2RAUA 2J4FA 5AK3A 1P0QA 3ZPXA 3C5WP 2QR5A 3EF3A 1AMNA 2JEZA 4X3CA 4X7BA 4BVKA 2AXEA 1WPXA 3R3YA 1G66A 7YASA 4NVRA 5K3DA 1HBJA 3S2ZA 3H17A 5K3EA 2HA5A 3KXPA 1LBSA 3SWWA 3PF8A 3AZOA 3NWOA 1YA4A 4X71A 1CUBA 4Q05A 1CUFA 2WFLA 4F60A 1QJ4A 2C5FA 1R1DA 4UBLA 1XRQA 3HI4A 5EIHA 5FUMA 4KYVA 5LZ7A 5HZGA 3A70A 1QIIA 3RK4A 5T4BA 5JATA 2ONCA 3QMWA 1TRHA 1AURA 4BE4A 5LYYA 3PDCA 2ZVDA 3G0DA 3PUHA 4PSDA 4EY6A 4EY4A 5EGNA 4ZI5A 2XQGA 5FRDA 2WHQA 2VJDA 3W05A 4TGLA 2JGMA 4Y9SA 2HIHA 3HZOA 3E0XA 1EDEA 5K3FA 1XFDA 1E8NA 4DYHA 5AM4A 3V1KA 1BN7A 4FMPA 3LIPA 3I2GA 5HF8A 4N5HX 3RLIA 2XE4A 2WQZA 5LZ5A 2ZJ6A 5AH0A 1IUNA 1CUWA 2XUQA 3HRHA 4WDQA 4G9EA 1ORVA 3I1YA 3PICA 1XZAA 4XWGA 3H2HA 3S8YA 3DD5A 2PM8A 5CBKA 3K6KA 3M82A 2QJRA 1TKRA 4F0JA 2B20A 3CN7A 4AZ3A 2D0DA 5ALYA 4W1RA 5BV7A 1CUHA 5D3KA 5I7UA 2HU7A 4QE3A 1ZI9A 2B61A 2BUBA 1A88A 1BN6A 3R3XA 4GXNA 3D3NA 4J0GA 1UT6A 2C5GA 1LZLA 5JIBA 2WKWA 1O6GA 3GELA 4EA6A 4J0CA 3ZLTA 1XZCA 2VJCA 1ZD3A 1C7JA 5HK9A 4I4CA 3FYUA 3K9BA 2BCEA 3SX4A 1EXWA 1ZI6A 2AJDA 2DCMA 4MJ3A 4B6GA 2ZJ7A 1Y7HA 4OU5A 3FLBA 4OCZA 4BAGA 1MT3A 1DWQA 5AOBA 1O6FA 4X95A 3BWXA 2YXPX 2CZQA 1UK9A 2C4HA 4OB8A 4QDUA 5AM5A 2NW6A 3WZMA 4E14A 2VTVA 4KE8A 4IH9A 3PF9A 2C58A 3UUFA 1FFCA 1XKLA 2PUJA 3IIIA 2JEYA 5CT8A 2XMSA 2O2HA 3VXKA 1ZJ4A 5A71A 1VXRA 1VKHA 2WSLA 3ESCA 3WJ2A 4E15A 1JU4A 2WIDA 5ALFA 1YSCA 2WHRA 4N8DA 4DSAA 3STUA 2ES4A 3EIOA 5T4HA 4JH0A 1Q0ZA 1RP1A 2GBIA 4U2DA 3F67A 1VA4A 3ZWQA 3WKCA 2RGUA 3L1JA 5ALXA 1MNQA 3L1HA 4YK7A 5ALNA 2XLCA 1LPMA 1KU0A 3HC7A 1FSSA 3K2IA 3QH4A 4EHBA 3JW8A 4ZV7A 4CI9A 2DFPA 1K63A 5EIEA 1UOOA 2OGZA 1BS9A 3ESAA 2XUFA 2G5PA 3QZUA 3I28A 1X70A 2XDWA 4JYPA 4KE6A 4NZZA 4OD0A 1M33A 2QVBA 4JEIA 3DL7A 4Y2SA 5DWDA 4NS4A 1GQRA 3F9CA 2X5XA 2HA7A 3AFIA 5HFAA 2ZSIA 5IVIA 2QJWA 5KWJA 1XQVA 2XQJA 3AIOA 3I2HA 1DX4A 3GFFA 5AI0A 3HJUA 3FSGA 2CBGA 3IUNA 4ROTA 3M83A 5EHXA 1N1MA 2FX5A 2XUHA 1L7QA 4H0CA 1UWCA 5C8VA 3R3ZA 2VJAA 4UBJA 2DR0A 2BKLA 5A7FA 1VE7A 1MAHA 5HQ3A 1UK6A 4DMHA 5LLSA 3TJMA 1WB4A 2HRRA 4KJXA 5HKBA 2J3DA 1OILA 2BUAA 1GZ7A 2Z5GA 4PO3X 1CQWA 2WFZA 4LKOA 5ALDA 1N8SA 4X91A 4G8CA 3SC2A 5AI4A 4B0PA 1K5PA 4DIUA 5K3AA 4Y2QA 4EY7A 1CUUA 5CH8A 1H23A 1HL7A 4X94A 4ZREA 2WUGA 4U2EA 1XZJA 2QRUA 3BF8A 5AKEA 3Q0TA 2X76A 2WFLB 4A16A 5EHZA 3BIXA 3FLEA 4MQLA 3W9UA 1XRPA 4Y7DA 4EY8A
chains in the Genus database with same CATH superfamily
4G8DA 4PZAA 1OROA 3F8WA 4GT1A 2VT2A 2PYZA 3R6WA 4H7KA 4W8HA 4W1SA 5AHOA 3TLYA 3PNSA 3KOMA 1XJ5A 4TLBA 4GOKA 1SA0B 3F5DA 3ZK8A 2ZBRA 4HGOA 4WFIA 5ALVA 1UZMA 3DE3X 4LFBB 3HZZA 4KN8A 1XWFA 1OXTA 3OCUA 1TTHA 1VIAA 3QU4A 3S1AB 4JBIA 5K0NA 1KJ8A 4KXWA 2OAP1 3GN1A 2JARA 4J29A 3PL1A 4XUDA 4EW1A 3D6UA 4PV7A 3CU5A 3EISA 1OXXK 4FS8A 5KNCH 1ZUHA 4NFYA 1Q2UA 1J2JA 3GZTB 4WXEA 3U4DA 1X7WA 2RHTA 3FMVA 1I36A 3H9CA 5G0UA 3AKEA 1H2FA 5CCDA 5HRCA 4CKEB 1GPAA 1T3TA 1JSLA 3I23A 4CL2A 2D2FA 3OEHD 5HFJA 3DL4A 4D92A 3KZOA 1PKEA 3FPKA 3N0WA 4L8GA 4BNYA 3M89A 1KMIY 3FOBA 2CV0A 1MXFA 3EXG1 1DWOA 1KI6B 3P0EA 5EZYA 4OF4A 1ZK4A 2VJLA 3DT6A 4Q01A 3UNXA 4CMKA 4UU7A 2BFCA 1DSSG 2XCUA 1G5FA 2H7VA 3OE4A 4U6SA 4QU9A 3FYHA 4BGIA 2FW8A 4BO7A 4ZICA 4GZ6A 1NV8A 3OHMA 2XCLA 3NS7A 5DX0A 1TIBA 5AKJA 4IYJA 4EB6A 2BJHA 5D5HA 3A05A 1B6RA 5A6SA 2CCKA 3SLGA 4MP3A 4EAQA 1F8UA 5F9FA 1ZRMA 5TGTA 1DLJA 4RY8A 4YMUA 1E8MA 2IYXA 4WOBA 4IO0A 3ZXXA 4GLBA 2GZ1A 1HNNA 3WDKA 1MBZA 3V4VB 1G19A 3OUZA 1SVIA 4MR9A 2HWWA 3PD7A 3KHUA 2H31A 4I1OA 4B7UA 3FMGA 1XT6A 2V97A 4PC1A 3KVOA 4RNCA 1HH4A 4KJZA 4WCFB 2VWPA 5LQJA 5A5FA 5F2EA 1P91A 5BN5B 5KDOA 4FYXA 4FI3F 1IHOA 2ZT8A 5D7BA 3OZRA 2X0RA 1E3TA 3B70A 4WMLA 1QZTA 3ZH2A 1P2TA 3N7UA 4TLAA 2H3HA 1NRJB 3T3DA 1EXVA 1N6NA 3W7VA 2G9VA 2KYRA 2ZXFA 5E8JA 5LPNA 1BU8A 2PTHA 4KUEA 1AO0A 4TRMA 3BWVA 2PR2A 4OSEA 2VJMA 1JDSA 1G42A 1FDRA 4RZ2A 3V4ZA 2X5KO 3H6HA 3KUDA 3OPYI 4LW8A 2VF4X 5JZOA 2QT9A 1CUXA 1TO6A 3EODA 4RWEA 2YYAA 4OBXA 4QUEA 2ZCJA 4CT0A 2REBA 2WSYB 2W2TA 4OM7A 1WSAA 1TAGA 1NLUA 1Z0JA 1QO9A 2BGJA 2V6JA 4IJWA 1NSTA 4LJ8A 3AUSA 3GBVA 3S2UA 2JD0A 3ASVA 3E70C 4V2IA 5EPEA 1CW2B 4F38A 3ADPA 4WLFA 2ZRDA 5FWXA 4IXWA 1NULA 3VPFA 5IYZA 1J2UA 1JALA 1W4AA 2FSIA 4Y0NA 5KAPA 4CQMB 3EDOA 4UXIA 4D81A 4U2GA 2C9BA 3UA3A 4ZC1A 2B4KA 3E18A 5J4LA 1VL0A 3UGTA 1T15A 2DH6A 1D2CA 2WTAA 4BAUA 5BN3B 2WU0A 5CIYA 1KOLA 3WISA 5KAMA 4GLOA 3THSA 1F0PA 2A1TS 2QXYA 2Y1GA 3WGIA 3ZKWA 5CNIA 3QKWA 4EYGA 1ABFA 3KXLA 3ORQA 2OCAA 3LV8A 1ZUWA 1BA2A 4LNUA 4P3NA 5DGHA 2HT1A 1RHMA 3BJZA 1YR1A 4LHZA 4Q3DA 2EGUA 1JQAA 3TSYA 3LA8A 1KSJA 1V71A 2ZPUA 1Y1TA 3R6TA 4K6KA 3PE4A 2A88A 2C0CA 1R4MB 4BEWA 1T9GS 4PX9A 4MDFA 3DQZA 4OEHA 4LEIA 2ESRA 4Y1FA 1JLLB 5BW6B 3TQRA 4ZCIA 5HKAA 2JS7A 2PRIA 2GN0A 3P2OA 1R66A 2WHEA 4DNQA 4TYMA 1EZ4A 1Z4PX 3PC2A 5CXQA 5KREA 1TJ3A 2OO7A 1JR3E 3FSEA 3OZDA 5ES3A 3NIBA 3I52A 2PY6A 1OWMA 3LVBA 2XMGA 2XVAA 4UULA 3NEAA 2XT9A 4Z3KA 5F35A 3UHFA 1D07A 2O50A 2ZVQX 4OK3A 1Z63A 3C3WA 5BN4A 4LKRA 2CZCA 1F8XA 2PGNA 3AI1A 1HNZB 2IY8A 4OK5A 4UM9B 4BZWA 3VH3A 1ONNA 3KPVA 3QFSA 1N0HA 1OPRA 3EWNA 4Q02A 2CE2X 4HQLA 5KYGA 3UB4A 3DLHA 4QUHA 3K1ZA 5B3JC 3B1VA 3EW9A 3T12A 4DQDA 4JZKA 1W5SA 4M98A 4PGMA 1IZZA 5EZ5A 3SFVA 1RXWA 2VF5X 3U9SA 1LA2A 1R6DA 1Y3IA 1YK1A 3NU1A 1D4FA 4YO8A 3CX4A 4JDUA 3W5HA 2OORA 2V7XA 4DA8A 2J3HA 3VNUA 4J16A 3RV3A 3BZBA 1AF4A 1LQUA 1OIVA 4FLEA 4J0QA 3TN7A 2J48A 4IOLA 1X7YB 2HMTA 3ZCXA 5FNVF 3JQGB 4ER7A 4OAPA 1BXGA 4DJ5X 1BD4A 4OB7A 3T1TA 3FB4A 2E6KA 5GJBA 3NBKA 4RTSA 1K5GA 4I6GA 5TXGA 1W94A 3THWA 1WUIS 3V2HA 1OT3A 4D4MA 5M3BA 4HR7A 3RVRA 4EL0A 5J43A 2HCTA 3DP9A 1AGYA 3EN0A 5L40A 2MSWA 1YRQA 4AFNA 4AWBA 4AO8A 3LNTA 4IRUB 4RH1A 1KQFA 2IYAA 5EC8A 3DNFA 2FFBA 5JCOC 1P1CA 5L3RA 1IH8A 4GLLA 5H7XA 2HKIA 4J0IA 2DJ5A 1EFVA 4REQB 1XTIA 2HQBA 3CJRA 3ADKA 4LVNA 2IHBA 5BSFA 3PQ6A 4M9ZA 1ILWA 1V5FA 4AX8A 2NVWA 3DV0A 2IXAA 3AMVA 4JROA 1ZD9A 3EIWA 1HMYA 1IAVA 1MO6A 2CHUA 3DZIA 3HEAA 1E63A 5A5GA 4ZVTA 3UMYA 1PWZA 1NXWA 2ZYIA 3F6YA 4Q7EA 2F8SA 2GK7A 1F06A 3JYQA 5D3MA 4RMIA 3T7IA 2QMEA 1BH2A 1CNFA 4L22A 1G59A 3E8MA 5TS3A 3QJYA 1XTUA 1IOZA 3O1LA 1MLDA 2C88A 3ABQB 4B75A 1OXKB 2X4GA 2VNSA 2CXQA 2GFIA 4Q1DA 4CLOA 2AC4A 4H7FA 1HORA 1KZYC 2CKDA 4I81A 2BF7A 3UG7A 3OTGA 1JPNA 1XQYA 3RJZA 3OX4A 3DBRB 3KLPX 2IEAA 3WK6A 3FCSB 4CKCB 4W6ZA 1FVXA 3GEIA 5DIZA 2LUOA 2K4MA 2YHAA 4DAEA 1XRRA 4HZIA 1E5DA 3UQZA 2ZULA 5K0JA 3OJWA 4QRDA 2HSJA 2WE7A 2WOOA 3ETJA 1SBZA 2F17A 3CF4A 3MUOA 4FOLA 4GS5A 3ROEA 4LZAA 2WWXA 3L3BA 5NLLA 2FG6C 2Z8YA 2VWGA 4EF6A 1EWQA 4DB4A 2AQ8A 1K9VF 3G9QA 3Q8WA 2E7ZA 5FV4A 2VBGA 5LNK6 5SZJA 1CZOA 2EBHX 2H1RA 2WJGA 4RH0A 4TWBA 3T3GA 1PI3A 3NEJA 4ND1A 1N6OA 1ZJZA 2PS9A 4PG7A 4QWWA 5K4AA 1FB5A 4FZRA 4L4SA 3TLBA 1HY3A 1XALA 3SZGA 3UCEA 5IH7A 3G0IA 3H5WA 3NIDB 5E3IA 2JCXA 2MTBA 3M3HA 5L53A 4C6TB 2W0SA 1TYDE 4OKNA 4XVRA 2P2NA 3K70C 1JKIA 2HPHA 2WNIA 4XVQA 3CRNA 2A58A 2HPAA 2LGJA 4IIXA 4FWBA 3UMCA 2D62A 2C2KA 2QUIA 5DYGA 1RU3A 1L4MA 3TW8B 3PSHA 3V33A 2HV8A 1N77A 3R9WA 2GPTA 3WYGA 5DBGA 1RJ9A 2EJCA 2HDWA 1UWKA 3E0QA 3LY8A 1CR1A 3IOBA 1YR6A 3OX1A 2IHYA 3EEBA 1Q0QA 1ZSNA 4UBOA 3RPEA 5AVVA 1RFLA 2ROQA 4D57A 2E82A 3FBWA 16PKA 1TZBA 3EEYA 5GONA 3LY9A 4R9SA 2P4EA 3PHLA 4RVOA 3OPMA 4D8UA 4Q3NA 4YCMA 3QP9A 4ZZ1A 2GZSA 5FH9A 3LWNA 3N5KA 5AJHA 3PNBA 4HQ0A 1KXJA 3JSXA 4P4UA 5AICA 2GARA 4ARZA 4LBYA 2A5DA 1V9CA 2Z58A 4FEEA 4QNNA 4D9FA 1MC1A 3P9RA 3RGWS 1R5OA 3H7IA 1F12A 1T6YA 1X42A 2BR3A 1S3IA 2IXGA 4FQ8A 3W2IA 4ARAA 2Q9CA 1EK5A 4PG5A 2HR1A 1GFSA 2YNMA 2ZROA 4P08A 5SY4A 1FDOA 1M34A 3U31A 1LDEA 5B58C 5BW5A 2R6FA 1L4UA 1M2OB 2H4FA 4HMQA 4OMUA 1SAYA 1L5HA 3JZDA 4MS4B 3TM4A 4CNQA 4D9GA 4PG8A 2A1IA 4OXNA 3M6IA 1L0BA 2JGRA 3RYFB 1NPDA 2ECFA 3W6NA 4ALKA 5BRJA 2F55A 1P9WA 2YIJA 4X24A 4YCAA 3EK2A 4EJFA 3RAFC 3HTXA 3AKCA 3DAGA 5G4LA 2AWNA 2PSEA 3TH5A 3T7CA 3PNKA 1GTRA 1X8XA 5FPPA 5J2TA 4DG9A 1FUEA 1JHYA 3A9WA 2IP1A 1M2WA 3RIHA 2DMRA 2X7JA 5CEJA 2PPVA 2RGXA 4O4LA 4V0OA 4LOJA 2YNMD 3ACDA 3GFPA 3IKJA 4O2LA 4OI1A 4BQFA 5A4JA 3Q7QA 3V34A 3EXEA 1RHUA 4M7OA 1NBHA 1GPMA 4FIDA 5K6AA 1TT5B 5ALSA 3E9EA 1UBHS 3TQHA 5BYAA 3KQKA 3TINA 2ZDGA 3DZDA 4FGUA 1QNFA 2PMKA 3E7FA 1Y48E 4QTUB 4MWDA 3LCCA 4U39A 3MK31 4JQOA 4MCIA 3A1DA 2JJQA 3RC3A 3T54A 3ON5A 1QU2A 4RJLA 3F3MA 3OQOA 1W46A 2J0UB 3OF5A 3RFTA 4BDSA 4NESA 3PSAA 4EJSB 4S1OA 4ENQA 3HSSA 3N2GA 3LXMA 1MN6A 2JGDB 4GRDA 3A2KA 1QVAA 4PR0A 5EZSA 1ADYA 1K8XB 1W4CA 2QT0A 4GO1A 4PLGA 5I9LA 1YF3A 3L43A 5KINB 1ND6A 4Q9KA 1Q44A 3KJNA 1CJCA 1ZJJA 4WVLA 2Q3BA 3OOHA 4J03A 3RSLA 3FSJX 1XNQB 1F1JA 1BJTA 2PVSA 3EVDA 4IBOA 4J3FA 5GGXA 1I4EB 2PJUA 2WIFA 2C4WA 5D5QA 2J9FB 3RROA 4P58A 1XCPA 3CXUA 2CFSA 3VJMA 2ZUCA 4UTRA 4WY8A 3RSGA 1QZUA 4QHTA 4GSLA 1X7WB 4IKEA 3P94A 1U63A 1XTSA 1N7JA 3R3JA 5L3SA 3I8XA 2IPOA 2LPMA 4E6EA 3OAAA 1WXHA 1ID1A 2RB4A 3WDLA 1VSTA 1KRXA 2NXCA 4MV4A 3HCPA 1M2HA 4HNGA 4A15A 3CGWA 3Q3CA 1QSGA 5A0TA 1TNDA 2H8GA 3A31A 1KY4A 3CZCA 2AI2A 3I01M 3IKMB 1YBFA 3LW7A 3O0DA 4KMMA 1Q0LA 5DVZA 3ZG6A 5IW8A 3M5DA 1I2MA 1GCAA 3O03A 3VHXA 2O07A 4N5MA 4LI0A 4RWZA 1G291 3WMGA 4W5RA 2ZYDA 3ZIUA 2AR9A 3G2KA 1JEJA 3TNJA 2BDUA 1JDNA 2KJQA 4R1PA 3OQHA 5CURA 5A6SB 3GRYA 2VR1A 5HKLA 4QYTA 4AKHA 3IEKA 4LSZA 3R9KA 4JI1B 2YOHA 2QTTA 4E5NA 3WV5A 2KE5A 2BFFB 1W0KA 2QQFA 2DLNA 3L92A 4A8JC 1DOZA 3B7PA 3AJ8A 2J6CA 3LK6A 2QX8A 1DU4A 4KO8A 4DV1B 4XQ9A 5CEEA 5EIFA 2AW5A 5FLYA 3IMFA 4U4AA 2KLHA 2XBLA 4KPUB 3TCNA 3ZDBA 1UFKA 1T35A 4G5XA 3AI3A 5EKTA 3DB2A 3H5TA 3R0JA 2L17A 3MYRA 2XMDA 3VPDA 5CH5A 4CG1A 3KXDA 1CKEA 2IGTA 1Y1RA 4HYTA 3VC7A 2OV3A 4MW0A 4P4GA 1C9YA 4TRJA 4RW0A 3IOCA 1GPJA 1YFZA 3BL6A 4R71A 4DJEC 2VNJA 1QP8A 1W0KD 5AKGA 4BU0A 3E22A 4Q21A 1N5MA 3VTAA 1S2GA 2VJMB 5JROA 5FLKA 3MJDA 3WLPA 4DANA 1K6IA 1NI3A 4E5YA 1EBUA 3LTEA 2NQ8A 3JZMA 1A71A 4EJ6A 1X77A 1HDRA 3L6CA 3V8EA 3MMNA 2OHVA 1OXVA 5ECDA 4PQGA 3RWMB 1F1BA 2OO3A 3NHWA 4M0KA 4YP9A 4EENA 3DE0X 2I1WA 4B73A 5C35A 4UARA 2P79A 4FTWA 3PCTA 3OZIA 4URHA 4MWSA 5CRIA 5B53A 1YQDA 3TRDA 3W4KA 6YASA 2OFFA 3FVWA 3MT0A 4DDHA 3A32A 2A2ZA 2HCJB 3I1JA 4R9VA 3U7RA 1G7RA 1ZC3A 4R2WA 7GPBA 1W581 2DPXA 3T95A 1UJ2A 5IYZB 3RH0A 2LKDA 3QXCA 4F5YA 4MUNA 1MDFA 1YACA 4PS0A 3J81A 2WSSA 2GKSA 2WT8A 4GYKA 4LVOA 2G80A 4JI7B 3HUDA 3PQFA 1C8BA 2COUA 2Z83A 3CUEF 3QYJA 1NVEA 2ZJZA 4BLWA 5BSKA 4J1TC 3CNBA 4YCCA 2I71A 3HWX1 1LB1B 2XTMA 4Y9DA 3DC7A 2P67A 1JG1A 2W6QA 4YS6A 3VMFA 2ADFA 4OI4A 4LGMA 4UCWA 1X0VA 5A3JA 1QYIA 4X6XA 5HX7A 3OH8A 2VAWA 2ZUFA 1RBQA 2HXYA 3L06A 1CP2A 4M1MA 1JB1A 2VHCA 4KRYA 5CLGA 4IHAA 1SBNE 3V1YA 3EIQA 1LDBA 2FMIA 3JQAD 4RVUA 2JW5A 4X64B 5CDYA 3DGFC 3I53A 1CZLA 2WTBA 3QVXA 4ENUA 4LTMA 3R77A 4GSKA 4I9GA 4LSGA 1PG0A 1B8UA 1KFCB 2OC4A 1PLJA 2OBYA 2QZPA 2VCHA 3PHCA 4YCDA 5TV2A 4C20A 4QZVA 2X9NA 1MRNA 4IIDA 3R5KA 4PHCA 5DYYA 2R1UA 4U8GA 5FWAA 4GYWA 5K8CA 1U2DA 1GSHA 3RS2A 5I6DA 1GAXA 5BN4B 3C7TA 4WH0A 4J3NA 4XIFA 4ZZIA 1H6DA 3WIUA 1I2DA 4JR1A 4E7PA 3SYKA 4P34A 2JLYA 3DXYA 3H8VA 3HB5X 3INNA 4J7CA 5AFSA 5JMTA 1CF2O 2ASEA 3MWDA 4FNAA 4Y2GA 3TTUA 5CB0A 3WGUA 4MQUA 1Z15A 4FR0A 1TKBA 2AFIA 2EATA 4MJ7A 4F8YA 4WN9A 1THMA 1LSOA 1OLUA 3M6VA 3QE9Y 1KGDA 2WWTA 1ORTA 2HMSA 2IPXA 3RFUA 3UJHA 3HK2A 4ITVA 3PEYA 5KHLB 1E5LA 1Q1GA 1T8YA 2I67A 3O4HA 4FYWA 5JXJA 2C9OA 3HU2A 4UE6A 1CVIA 1BX0A 1HQKA 2P27A 2Y6VA 1YDFA 3MWFA 4TYQA 2HN9A 4W5HA 5EE1A 5L6LB 4X6YA 4F3KA 3C97A 4ABYA 4AY5A 4JBGA 2PUVA 3OIWA 4B3HA 1WSWA 1Z0SA 1KFKB 1OWOA 1ZNXA 2RHRA 3D8UA 4JEHA 4LN1A 2G63A 1S3FA 4ILEA 5ALTA 2H00A 2VSNA 4AL4A 4QM6A 5DXFA 4DY4A 4HY3A 5EHQA 1SHZA 3ZS9A 4JV5B 3GFQA 2I3ZA 1I3CA 3LBFA 4JI6B 2FDXA 3KJEA 3LMKA 2QRZA 1B1AA 2NNLD 4PZDA 5A06A 3IPXA 4XIYA 4ALMA 1EFVB 3KDAA 1OAOC 3OSZA 4IO1A 1M5RA 2C0QA 4FS3A 2VDKB 4MUMA 5LMUB 3PUYA 5IBQA 1Y7IA 3SR4A 1E1RD 2B9VA 3DV0B 2CBXA 2DQSA 2LIPA 3CRMA 5J5VA 4DV4B 3KT0A 2BWJA 3NHJA 1DIOB 1GQOA 3LDFA 1MA0A 1KK2A 4S1WA 2Q5HA 4OLAA 3LKZA 5CB8A 1Z68A 2CW5A 4U0KA 2V5VA 4X20A 1NT4A 5DOZA 1WCYA 2BEVB 1FE8A 3FMFA 4M60A 4BVFA 3KQHA 4C5BA 3RTEA 3ONNA 4L8VA 3K2BA 4HNRA 4F72A 2BTOA 4B3IA 4F06A 4KYIB 5FBKA 4ENTA 3QNMA 1FS6A 5MGBA 3OOJA 3I72A 4HAIA 4QODA 1G41A 5BSUA 1EAMA 2FEAA 1ORDA 1DTWA 5A62A 1WBJB 2H7CA 4EUKA 1EWYA 4MTCA 1JWBB 1Q11A 1ZQ9A 4BB6A 2GXUA 3AM1A 1A2QA 2AWOA 3LP5A 1BCRA 3MWKA 4OHUA 4UJ5A 3EZ7A 5C5IA 5KIAA 1P3DA 3UAWA 1A9TA 1XPJA 1A5ZA 3UFBA 3K30A 1ZGAA 4LOLA 3W2GA 1Y1QA 3IEXA 4LYDA 1GHTA 3OJLA 5ITZA 1N8NA 8GPBA 2JFNA 4H59A 1WUYA 2IT1A 1MF7A 2ZUWA 4H17A 4Q3OA 3RHFA 4ZDIA 3DOOA 1YS2X 5H3HA 3RVPA 3T1VA 3A1NA 5JEEA 1JLHA 2FRVA 3EARA 1ENOA 2FSHA 4B3DA 1RWPA 2GBLC 4D4GA 3SNKA 1Y63A 5CIQA 1ISSA 1CZRA 5D87A 1MEJA 5E9QA 4OHFA 1ZL0A 1QFZA 2LRHA 2MT9A 1HE3A 2PEYA 1GZDA 1NL3A 3OFVA 3AIMA 4K8OA 1Z6XA 5SYNA 1QR6A 5B57C 2ORVA 2V4MA 4HL6A 4NNOA 1RJDA 2DFNA 5CT6A 5E0KB 3R74A 5CVTA 1NIPA 3OICA 5A4DA 3Q41A 4EUEA 2PMDA 4C01A 1Z2NX 2WBLC 3ZLVA 4XQEA 3RSFA 1JUDA 3RVQA 1PR1A 1U7XA 1XU9A 2Y93A 3CN9A 2UUBB 3MTGA 3IIMA 2EDCA 5LQDA 3N7AA 3LT1A 5CBPB 2OILA 1SCIA 2H51A 1TCCA 1UMCA 2QW1A 3EVFA 2P4HX 2VJKA 3NONA 4DVJA 2Z5FA 1UP6A 1HEYA 3O8NA 4YMIA 3INGA 5DM1A 2LKCA 1SD2A 2DPYA 3JQCA 3C6BA 1JGTA 3ELDA 1E0DA 3MJVA 4NEHB 3REGA 1DBIA 3VO9A 1NW5A 4N47A 5KTMA 1EX7A 3R3WA 4IG9A 4L6AA 1PWXA 3GNSA 4D8YA 4BY9E 5CR9A 5K4HA 5GONB 4AJNA 2JI9A 5HZMA 4MIEA 1U8EA 1G7TA 1ZJYA 3LI2A 3R5SA 2JIZD 4MXDA 4RKFA 1ZR2A 3REQA 2BKVA 3FRHA 3Q5GA 3BB3A 3JAWB 4NYMR 4HWOA 2YW9A 5IBRA 1M67A 1CDOA 3CRZA 3ER6A 1PJAA 1UINA 1G5TA 3DEHA 3H04A 1KPIA 1PL7A 4NWIA 1ESCA 1WPGA 5E4FA 5JZ9A 3GZ4A 3PFCA 1MR3F 4RD2A 5DLPA 2XZTA 3BPSA 4CM6A 3HLYA 3DMYA 4X8LA 2F3RA 4HPWA 4E1BA 3ICPA 5IJ0A 1JWLA 4HDNB 2Z8XA 1M34B 2CB9A 1RHRA 3C3KA 2A35A 4AO7A 1L7PA 2RCYA 3A6LA 1L5HB 3PE3A 4WKCA 4PF1A 3K9QO 4AZTA 4PQEA 3HXOA 3LK7A 1DAHA 3LO8A 4XJTA 1Y82A 4B71A 1RI5A 1SELA 3PPXA 2HMUA 1IONA 3UPDA 3TTYA 3QLJA 4H3VA 1S8AA 5A4FS 4L0MA 4ND2A 3IKTA 1V11A 3KFLA 4MB2A 2FJPA 1ZHHA 3VVLA 1O6ZA 3D6AA 3PHGA 3WA7A 1B8NA 1IEWA 5LQMA 1SZJG 2ZZNA 5J2TB 1FFAA 1DFHA 2DYKA 2PD4A 1IWOA 2XNSA 2W83A 3NTOA 1GGKA 1B26A 4O4LF 3AF3A 4F2DA 3CVXA 5BV0A 1XB2A 3V2UA 2OPHA 1MJ5A 5E2AA 1NW9B 1PJQA 2WAAA 4EG1A 2GNAA 4DC9A 2F2TA 1ZH2A 3H75A 3O93A 2NO5A 3DNMA 4DLBA 1ECFA 4J3JA 4BX8A 4JLKA 2X6RA 4B9EA 3VDRA 4TSKA 4JNKA 3Q72A 4UQPA 1ZJ5A 2OXTA 5ICGA 1TK3A 3RK0A 3LVFO 3I76A 3CF6R 2IPAB 1Z36A 2GETA 4RL6A 3T3OA 2XEXA 1OI4A 2ZOSA 3HACA 4A5OA 2H2DA 1TJ4A 3AF4A 1X80B 4ZMRA 2QB5A 1LI4A 1GZ5A 2Q7DA 2O05A 1XQXA 4IGFA 5A5DA 1RAHA 1U6KA 2XX3A 5TMBA 5CFRA 3D3QA 4JT8A 1W34A 5EUBA 1DWPA 3N2GB 5BWNA 1OWPA 2DPLA 1JKJA 2P9GA 3MB5A 3VISA 2PVPA 4BBAA 3AP2A 1HGXA 2VIIA 1ID8A 1VCNA 2I29A 3OJFA 1VL2A 4A8HA 3BXPA 2Q49A 1YRBA 2HLDD 4PANA 4KE9A 1DFIA 4FI3C 5E0OA 1BMQA 5EJMA 4IJQA 5FAXA 4BVEA 2GFQA 4RHCA 4QDZA 4EUFA 1ESMA 1NN5A 4N3NA 2QL7A 3KYCA 3QY9A 4OSOA 3LL7A 1G18A 4GH5A 1I9GA 1TQDA 3TMAA 1XDSA 3FDZB 4OMCA 5L51A 1C30A 4HRYA 4ZALA 1ODTC 1WB5A 3H5IA 1T0UA 2ID7A 1IJKA 3KDSE 4WINA 2G77B 5BUCA 5ALLA 3U5TA 2H1VA 3A0UA 1HDYA 1P33A 1L5MA 1MX3A 1ZRHA 2GJ4A 1VCMA 3BXGA 4ITUA 4X3OA 5JSHA 1EX6A 5DHUA 2XQIA 2YVKA 3I9FA 4A0SA 1Q83A 4ONEA 3M7IA 4TWZA 3X1JA 1A2KC 2WMOB 3PDIA 1O5OA 3I6MA 3MXTA 2WPNA 2JF0A 1KKLA 4XCVA 2L0XA 1HYHA 3W7BA 3ZXSA 1F8GA 1PT8A 5EINA 2H06A 1RI3A 1PJSA 5MN6A 2W6ID 3B53X 2ZS7A 1J0AA 1DQNA 4REMA 4OXKA 4RCYA 1MV8A 5DM4A 2BMDA 2WP0A 1RXIA 3DZ8A 1YAJA 3VHXB 3GGDA 3B20A 2PD6A 3TXYA 1UJBA 3ZU5A 2XRMA 1ZK3A 1FXUA 5C1PA 4I99A 3M3PA 2NNWB 2F67A 1I7PA 3PC7A 4NP6A 1C4XA 2RH4A 3WRYC 2H17A 2QGZA 3KVVA 2GAIA 2IEBA 1K75A 2CLIB 4E5MA 2JCSA 1MGOA 3OSUA 2VNKA 1U0JA 1IBSA 3FVVA 3P9ZA 4NZPA 4C4SA 2FV8A 1DAMA 3SAJA 1U90A 3ZCQA 3G3EA 3P8ZA 4DPKA 4Y9RA 1GUFA 4MVJM 1CEEA 3CJQA 2ZRJA 1DC3A 4XUCA 4JP2A 2WC1A 1JE0A 1GAJA 3OG9A 4BNTA 4IJ5A 3ZNNA 2BHTA 1C3OB 4MVWA 4L4RA 4BN4A 1BRMA 3JQEA 5JJKA 5HF6A 4JYMA 1QHYA 5ENZA 2XSZA 2AOXA 4CF3A 4WEOA 1E9AA 2BFMA 2NOAA 2Y27A 3LOQA 1RYDA 1JL3A 1GQSA 2UZ1B 4HN2A 1OXUA 1JTVA 2DUJA 3KEFA 3E22B 4GEGA 3I42A 3VSAA 2GO7A 3PDWA 1XX6A 4H6VA 2A9QA 2X13A 3BWEA 3RHTA 3HJAA 3IEMA 4AKIA 3GJZA 5SY9A 3RUIA 1X94A 3WLRA 3L4JA 2V7QD 3M1LA 1B0UA 2D8MA 3NP9A 4C4YA 1P5RA 4COOA 5IUKC 2F43A 3NM4A 4EJMA 1KJ9A 5D51S 4RKRA 4LMAA 3ZE7A 3HY6A 4EL5A 3VR2A 2J4CA 1ZD8A 2G08A 4KH1A 5BSMA 3KETA 3CX3A 4H3HB 3KEOA 3B1JA 2P2ZA 3ANXA 2VDOB 2B83A 2WIGA 1VMDA 2HWUA 4GGMX 2O8FA 1GTJ1 4EG5A 1NBMA 1WCIA 3I9LA 1OXSC 4ZU3A 1NUHA 1YI1A 3JQAB 1TAHA 2CYCA 1GCUA 1D5WA 2WTEA 3TIFA 3UM9A 1UUFA 4NZNA 2TMDA 5D01A 4BJ3A 3NBQA 2EFYA 4KQIA 5ADVA 3EG5A 5EE3A 4C4TA 2J3EA 2CFIA 3DQQA 3JWIA 2EP7A 4R1NA 4WBSA 4HDMB 2IA5A 2ZBGA 5EIAA 5IM4F 3HL0A 1Q77A 3MHPA 4OK6A 1IEVA 1U9CA 5KYVA 3W8EA 3VR2D 2PN1A 4EPXA 2DZDA 1MEEA 1O97D 1FSGA 1M34E 2J7KA 3U9LA 4PHFA 1NW4A 1ZXBA 1BU5A 1N7HA 3HY4A 1JDUA 4LOKA 1WW8A 4EGAA 1PSDA 2W0MA 5GJVC 1PN3A 1ESNA 1H1TA 3BHIA 2ATXA 3N07A 3N0VA 3OTWA 3TS1A 2QEQA 1JEYA 4DW8A 5HMLA 3Q6NA 1QRUA 2G9NA 3QLVC 1P2SA 3OZWA 4PLVA 4RZHA 4RZQA 4DUYB 3TOSA 3RG2A 1V8BA 3NOQA 1QFMA 3I34X 3RYHA 4OAOA 1T1EA 1ZXXA 1NR7A 4QIHA 4E1AA 1U7PA 1G21A 2GVDC 4WLOA 4DNPA 4YIHA 4G41A 3N2IA 2ZITA 1SVMA 2CSXA 1RQ2A 1CQXA 1C1XA 3HYSA 4X85A 2BC9A 4YDQA 2XQVA 4WNYA 2WYWA 3C8UA 1J33A 1UFQA 2HBZA 2WZBA 1XCBA 3GDOA 3GRCA 1PQWA 4OV6B 2O2ZA 1V2HE 1WB6A 2OFXA 1QLHA 4IY1A 2QD2A 2QPLA 3NOOA 4FJ2A 5ESWA 3OQNA 4LHXA 1WPQA 5HDBB 2AFIB 2CFRA 2X3FA 4IZOA 3L7YA 1OLUB 3A2LA 3BIWA 4Y6OA 4NYJR 1I8TA 2GM5A 3GROA 2FCAA 3IIJA 4ZDKA 4I8DA 3UXEA 2OHIA 2WJVA 2FUEA 5KNBD 2A33A 3BWYA 3H2KA 4ZEMA 4EJ0A 2R1ZA 5F2NA 3L5KA 1GTZA 2ZUUA 4RYDA 4TMKA 3U7GA 4YUWA 1O77A 2H52A 2V74B 4NE2A 4UUOA 1ODCA 3ICVA 5CPFA 4YIKA 2BYTA 5IDQA 3NHSA 1DT3A 1NYQA 2O4UX 3QG5A 3H3FA 4K0RA 4M0DA 3BFKA 4GMKA 4R1UA 4ZCTA 1ZIPA 4XDGA 3LCRA 4ZEOA 3KSZO 2BFAA 3D7NA 1K7CA 1L9KA 3KQTA 1OH7A 2IHJA 4CG2A 5AW1A 2D0PB 3ZN2A 5I9IA 3DCJA 1GNSA 3GLQA 4QG3A 5JVDA 3GPDG 3T9AA 2PO7A 1N2EA 4PQYA 2ZBDA 1FXWA 2JATA 1TB4A 1RXYA 1WA5A 3BTOA 1VHQA 3D2LA 4OGLA 1QYRA 4URFA 5DZSA 4EF4A 2Q5FA 3DHYA 4YREA 2OTCA 1VJTA 5EXDA 1U8CB 4I5DA 1JG7A 1AHHA 4FOOA 1GG5A 1P8JA 4LYGA 4A26A 1PS9A 5IC6A 2XKBA 1WV0A 5JH7F 3X1WA 5LUBA 1E99A 2BDTA 1KOGA 4X20B 4YRAA 3E9QA 1Z7YA 4B6JA 2W2OA 4M0EA 2ERCA 3K0CA 2C3OA 1KHTA 1Z4LA 1WLSA 2H29A 3O38A 1VMAA 4RESA 4YN3A 5BOSA 5I7VA 1AGXA 1MRSA 2G76A 2Y66A 5ITSA 2FFJA 3L7JA 3A9TA 4EYOA 4G0VA 4YT5A 2JI8A 1K0FA 3WRVA 4DN6A 1E6LA 1GSOA 2CNWA 2DBYA 3DW1X 1PUJA 2VPXA 3DCYA 3DZKA 3DOIA 2P35A 1DTWB 2YXNA 3EJ6A 2E3JA 3FPHA 2ZYVX 3IVMA 1SRQA 1HTTA 3NGMA 3RIMA 4RTJA 1Q19A 2OLKA 2WILA 3L6DA 1Z12A 4PCAA 3UOGA 1UWVA 1DOHA 3A14A 1Q7GA 2HWYA 4HT3B 4OHXA 3HMQA 3QELB 1X1DA 4UE3S 3BYZA 5ALWA 4DMMA 4CFSA 2I6XA 3RC2A 4D0GA 3SCZA 2FX2A 1KEWA 4P0PB 2B1GA 4ZVVA 2FNAA 2YUIA 2ECOA 3IVCA 1U8YA 2DGDA 3LFHA 3WLOA 3A36A 2R60A 2QWXA 3BUSA 3GP8A 1G4HA 2DBRA 4HH4A 5KYXA 1E1YA 3BD9A 4F2HA 3C2QA 2H54A 1WX1A 1GDHA 1RYNA 3H0KA 1BXZA 3CEHA 3REOA 5M34A 1M1UA 1NA5A 1YOVB 2CWWA 5T41A 4A2WA 4W63A 3L7NA 4RQTA 1BOFA 4ZCSA 2FPMA 4INZA 5HPYB 1HQDA 2C4NA 2QZ4A 3GD5A 4KG7A 1FF9A 5JZSA 1N2JA 2O0LA 4ER3A 3BB4A 3K0BA 3OJCA 1Q12A 3JX9A 4HZUA 1HDZA 3IQHX 2QLJA 1X92A 4QPPA 4UDXX 4EAAA 8AT1A 4I7EA 4BNZA 1URPA 2ZB8A 3G6WA 2OXIA 1QO0D 4FDMA 4MQ6A 2R8EA 4NCXA 2VTKA 1K7YA 3PCRB 4NENB 1CPYA 3C45A 4QVGA 1QG0A 4CODB 4YUYA 4DA7A 1UMCB 4MVJF 1JEDA 5LQSA 3RTBA 2CMKA 2RK4A 8ADHA 2W70A 2VP2A 2AE2A 5AUQA 4KWIA 3U09A 1UBCA 4E1VA 5TSDA 4QYWA 2C29D 1AKQA 1XTTA 3B6JA 3H8JA 1T3SA 3N0TA 1USWA 1CX9B 3H1AA 4EVSA 4D98A 1B1CA 2VDLB 3LSYA 1B0AA 4NFHA 1R8SA 4JOSA 1VYUA 4MGEA 2O8DA 2C5AA 2HU5A 4JI3B 1DHRA 2BFEA 4NAVA 1IM5A 1QK4A 3NETA 3KLOA 3RRZA 1WXQA 4X1IA 2PT6A 2GGSA 3KJHA 3REQB 4HNVA 3G2MA 3CVUA 1TK2A 3NBMA 1HDIA 1EQUA 1CUJA 5BRAA 2HIAA 3TLCA 1L5SA 1IBCA 3O2JA 1KAEA 4GP9A 3TKAA 2I8CA 3K9GA 5D85A 2FVXA 2GVZC 1D0VA 1R74A 3NB0A 4JLAA 5IJ0B 3QGMA 1AS0A 1ODKA 1SD5A 2XE7A 1V95A 3UJCA 3NV7A 3L6OO 2X0EA 3GR6A 4OLJA 1Z0UA 5KSPA 3VFDA 5IBPA 2PHZA 1KMCA 4ICIA 2I34A 2XVYA 5FR1A 2YC2C 3RNOA 3U7IA 2AEJA 5EYPA 4CMCA 3A6EA 4X90A 3OE7D 2C5HA 3IDAA 3OWXA 4R2KA 5GJCA 3WLLA 1V11B 3X0DA 1J06A 2ZWIA 2QMHA 1WUTA 4V1CB 1PFWA 3AHGA 3PVSA 4NJOA 4D3DA 2R6R1 5BOVA 4TPKA 4Q7KA 2ZI4A 3T5MA 4AKSA 2D0IA 3GQBA 3QF4B 4XM2A 4ZA2A 1DIAA 4AJ2A 5K20A 4C43A 2AFIE 4RD6A 5BMVB 3C24A 1ZJWA 2QUBA 1JAIA 2E37A 2P78A 4WXHA 4G97A 1I6LA 4MVJP 1QGZA 2OKCA 2QTHA 2VJBA 3KQVA 4R51A 1YGYA 4D99A 4G9BA 1IEXA 3L41A 4L51A 4DV2B 1S2DA 1DL5A 3HBFA 3F0TA 5IDVA 4NBWA 4TKZA 4RVCA 1U1CA 4AS3A 3DV2A 3OZVA 4O25A 3ICCA 2X5JO 4WZ6A 1E61A 1YBAA 5GAJA 3ZUPA 2W8BA 2WIAA 3OO0A 4AKGA 4OHWA 1TVMA 3VJKA 3EZFA 5IKXA 3TZEA 1P6UA 3WYNA 3KK0A 4G84A 3AONB 2WPDD 4N5IX 1YJXA 4ACAA 1BXKA 3FYCA 2QK4A 2GF2A 4X41A 4P22A 1V35A 3EVCA 3AIKA 1JKJB 3DAPA 3E2MA 3HPQA 3IEIA 5CFOA 4N41A 3VR1A 3KC2A 3N75A 1VMKA 4FOTA 3DCNA 4JU8A 1MQ9A 1NBIA 1FSPA 4IM7A 1U6JA 1G9XA 1SCKA 3A7EA 3JQ9A 3FDIA 3D02A 4ZKEA 3V2IA 4ALNA 5JSFA 3EUFA 3KT8A 3T7AA 3OPQA 1MVNA 2POCA 4BO8A 5IVPA 4CR7A 3ZQ6A 4ARSA 4Q16A 4X1KA 4H60A 4C2UA 1GPLA 3Q11A 3T15A 3GXBA 2OOKA 3KYCB 3RYIA 3GJQA 2VPPA 2CDAA 2QAJA 5JO0A 1CQJA 1Z4NA 2CXNA 4G0WA 4BEJA 3EIHA 4LQCA 4KSBA 1C30B 3HUUA 2BISA 4HGRA 4UNIA 3STHA 4F3YA 1CVLA 2GQ0A 4WRRA 2BHRA 4OOFA 3KKLA 2G9RA 5JXWA 3GGPA 4H9GA 2FSSA 3R8XA 2ARKA 3SDSA 1OHHA 1SZPA 1RI4A 1IDN1 2JC3A 3A1FA 1OWLA 3CUVA 3K5PA 3K8ZA 5E3JA 3NUZA 3WQQA 2VAXA 1QQ6A 1XMSA 3ND6A 3PDIB 2E1RA 1DOAA 2EGGA 2P5SA 4LV6A 1D1QA 1JIQA 1H9AA 1QUFA 4IDBA 5B3AA 1KQNA 2OYCA 5E9JA 4BHTA 4C6TA 2F1RA 4BX9A 3QY0A 4MW2A 2BZ1A 2ZTLA 2JD1A 2I4IA 4N5LA 3E1SA 3Q87B 4FFNA 1WNFA 3AEZA 3L8MA 4GFDA 4ZODA 1G3RA 1ZIOA 1JKFA 4QDXA 4Z0PA 5B55A 2XCTB 2R7LA 2IZZA 1FUUA 1MX5A 1HRDA 2HRCA 3B6KA 1Y98A 4Z4HA 2YDXA 1AV6A 4H0NA 2O6HA 1Z13A 4QTZA 5CA1A 2BKEA 1UDXA 2OYSA 1GL6A 3R6DA 1QGOA 5EPUA 1C8KA 4I1RA 4LJKA 1JDBB 2YWEA 1VJGA 3I5MA 4ZAXA 4GOOD 4GBGA 3TRKA 1Z2PX 3ZVLA 3C8HA 3PRJA 1NZJA 1X14A 4HX9A 4OQNA 4EQ6B 2G0TA 4BIIA 5DTMA 1CUYA 3IUPA 2C99A 5D5PA 1KVUA 2F8MA 4LDQA 4ED9A 4LFCB 5GOTA 1CU1A 3GPCA 5JAPA 5DMXA 4R1TA 1RRVA 4BBZA 3VPCA 4ZT2A 1O94D 3EHEA 3LAWA 1YL5A 1BWPA 3KELA 3S2YA 3QA3E 1R4AA 4LAFA 4UM7A 2I2DA 4K1XA 3ZX4A 3K09C 4OXXA 4I6JA 1T6XA 4Q34A 3WGJA 2BVNA 3GEDA 2PS3A 2Q2OA 1BDHA 4ITRC 1DC5A 2ZE8A 1UPCA 1XYYA 3BGIA 4OVKA 3IP9A 4H7PA 4HDAA 2NTYC 3FTEA 3FHTA 4C0HA 2WG1A 2W11A 1C80A 5HNKA 1DKOA 4DR5B 1U7OA 2WF5A 2O48X 1D0IA 1ZITA 3EQ8A 4E2FA 1JHMA 2B3TA 2JIMA 2BEJA 2F43B 2QD3A 1S01A 4EFKA 5IHPA 1CEQA 4F9GA 4KHZA 2P30A 1RPAA 3CNLA 2HBRA 5ALRA 1E6KA 4Z0NA 2ZSKA 2OORC 4BRSA 2HUPA 2QRKA 4J16C 2VZ8A 3Q6IA 3DOHA 5F5NA 4V1CI 4MW9A 1E2KA 1WCIB 3WA6A 1Y5RA 1FZQA 4E4TA 2FGJA 2OD7A 2Z08A 2VRCD 2X22A 5AI8A 1E5TA 2P5UA 4EYKA 3QVOA 1LV8A 3K1TA 1L5NA 4GGPA 2IF2A 5C7YA 2WYHA 4M1QA 3PUKA 2NYVA 4RM2A 4A2PA 3C48A 5BYJA 1JS1X 1SCNE 4MUBA 1JWAB 2I3BA 4UOEA 1P2BA 2IYOA 2X8JB 3QW4B 4G0NA 2G70A 3C3PA 3RR2A 4DRYA 5FORA 3ZHRA 4C7XA 2Y1WA 1EK0A 1K8YB 1QTIA 1NU6A 1XLVA 1Q1EA 4FP9A 1E4EA 1R0SA 2MR5A 2QORA 5JRDS 3PQ4A 1XPUA 5E6UA 4F11A 1E7WA 1H6CA 2O0KA 3UAVA 5KX5F 1ND5A 4C4ZA 4JBNA 4L9SA 1YZHA 5CM9C 4CIVA 1ZNWA 4QNMA 4QJBA 1OXBB 4DT1A 3ROTA 3VZDA 1BRTA 4EMSA 1KEEA 3P0JA 1M2VA 3RYHB 2AC2A 4ZXFA 3W6UA 4BWFB 1G21B 3JYLA 2YW2A 4FDUA 1ZRSA 2JI6A 2C4MA 3OFSA 3MEQA 3S27A 4MYHA 4RIHA 4CBVA 1R0CA 4FB5A 3T7DA 3KB8A 5EKXA 2AX3A 1RIIA 4EZIA 2GZHA 1B00A 2QD4A 4CMIA 1UPAA 1LKZA 4F46A 4BV9A 4RK5A 1BXRA 1QAQA 4DMGA 4GSYA 3RUFA 1JVNA 5BR7A 1LX6A 3OEEA 5EHIA 1P6XA 4Q15A 4JLUA 4MW1A 3I1IA 4ECAA 1DUVG 1T5DX 2HF8A 5A9TA 3QMMA 1Q5PA 2Q3LA 2Z1MA 1DJMA 1Z4JA 4ZK2A 2JGKA 4P4NA 3GH3A 3N8DA 1NVDA 5REQB 1TA4A 1S3SA 2V6MA 4FONA 2JFXA 2ZKLA 2ZGVA 4CIBA 1UKVY 1X1CA 2HHAA 1QH8A 2Z1NA 4F8JA 3FNRA 3ZHSA 3GAAA 1MTZA 1IBLB 2QY9A 3IFSA 4X66B 3OETA 1SG0A 5GWXA 4C7MA 2D2VA 4L5YA 3KPJA 3TE7A 1TF2A 2WZCA 1DKNA 1W36B 1QONA 2QXUA 4NCJA 4J7AA 2X3YA 3ANYB 4Y9TA 1NKTA 5FKJA 4FYHA 3HI6A 4NK5A 5JVDB 1NJ2A 2VDWA 3E2IA 4EB8A 4DYVA 4INPA 1KMNA 3OBBA 4LE1A 4MRVA 1MG0A 4IJ6A 3WO1A 2Z56A 5CJJA 1PQ4A 3HCWA 2HA4A 3D6TB 1L7DA 2IZ5A 4U9IS 5AVJA 2HMAA 3T3EA 1YVPA 2J33A 1TYAE 4R9NA 4D9EA 3ORHA 1QDEA 5I9NA 2UKDA 2Y0PA 1Y4UA 3QBDA 4YO7A 3UENA 2CFOA 3AJ9A 2XGOA 1SXJD 3LSTA 1A2OA 3GAZA 3PQ2A 4LOAA 4N03A 4G2TA 4PPNA 3ZU4A 4DZTA 1AMUA 5IVHA 3C7CB 2ON6A 3DAOA 4CV1A 3UATA 3GFOA 4Y18A 2I99A 1GAWA 2FPUA 3Q10A 5KC8A 2PE5A 5BOSB 2G4LA 4MQBA 3ZY5A 4DLWA 3BD8A 4JQYA 1KZHA 5I47A 3NT5A 2ANBA 1CUEA 1EFCA 1ATIA 2XB4A 3DAYA 2BI8A 3DLIA 3PPIA 1FLDA 4P3XA 4YUZA 5L4SA 1SB8A 1Z4OA 3TO5A 1FRNA 4NNJA 2HMVA 2QQ5A 5JBQA 2QVCA 4LBZA 4QPCA 4YRMA 5AUPB 4WHMA 4RDXA 2JFBA 3PFGA 3UKDA 3P52A 3TDNA 1U5CA 1VGVA 1YS7A 3IT3A 1AKUA 2BHLA 2YWGA 4L0QA 4FMCB 4L5AA 5DGCA 5DSTA 2JFYA 4TTVA 4P33A 4QUIA 2JH8A 3NFRA 4XD2A 4R7GA 4B3FX 3AF6A 3D7RA 2BF4A 3AESA 1Q0RA 3BRWA 1P17A 3FVTA 4JC8A 5EG5A 4B74A 2YWXA 5K0EA 4XEUA 2ZR9A 3ANMA 1KDYA 1XBTA 3CQ9A 3IJEB 5FL3A 1CY2A 1E2HA 1PCXA 2CF6A 4U7JA 3KSAC 5JXGA 4XSGA 3OQIB 2DWPA 5KYXB 3GZJA 4KQ9A 3LDUA 3KTFA 3B9PA 2MU1A 3CVWA 3FWYA 2R8ZA 1R50A 5EQDA 3GOQA 3RSOA 4BMSA 5DYWA 3G23A 3QXJA 1N1GA 2QPOA 2CDNA 2WQ6A 1GXSB 1N4AA 3C6QA 3QPWA 2AYYA 3K9FC 1ITZA 3KZXA 4F5WA 3IRVA 1PJ2A 4M55A 4W99A 5TS2A 2FPIA 2ZJ4A 1MD9A 1Z8NA 2GYWA 1XTZA 3P2YA 2XYVA 4TM8A 4R8MA 3U40A 1I0IA 4HZUB 4QDJA 2R1VB 3WIOA 2J5BA 5AHRA 1ZK2A 4CKZA 2PL5A 1GA1A 1PW7A 2IQIA 2YQ4A 3L0BA 3LPLA 1QWOA 4D0RA 4RF2A 4EPVA 5T6MA 4PLZA 4G5HA 1OZHA 2O2GA 2UVPA 1CY0A 1I5EA 3GNQA 3TPFA 4EUSA 2P6MA 4BQQA 4FHDA 5K6AC 4HNUA 2OCIA 4EHIA 4OLFA 1G8MA 3A7DA 3PKIA 4GMDA 1DAIA 5EWLA 2J4DA 1NBME 4GE3A 3T7SA 2PRKA 1R6AA 2G7MC 4CTKA 5KEIA 4FM9A 1NBEA 4GI5A 2HH9A 3JZAA 1O8CA 2HTEA 2B8NA 2RARA 3I9V1 2GPJA 3K53A 4PRZA 3CNOA 1EMDA 3FIJA 5ALJA 3V32A 3AOEA 4LGVA 1WB9A 4R5HA 1OVGA 3AETA 2BFEB 2C96A 4ID9A 4JJKA 4KUGA 4PYJA 4C04A 1F7VA 2XXAA 4X1IB 3GB9A 1LLUA 1GUBA 4LGCA 1KARA 4M37A 3ORFA 2JCGA 4KODA 1VPWA 4AT1A 2WOJA 5K05A 4MS3B 1FZTA 2XCOA 2YFYA 3ZOKA 2BFNA 4MKIA 3T9BA 4EX6A 4HLUA 5KKCA 2R6AA 3I32A 1PV4A 1K4YA 2JJ2A 2QS9A 4G65A 2M9MA 4G0ZA 2JLZA 4LUCA 2M1ZA 2QJFA 4D3FA 4R2IA 1C8VB 5DN9A 1A4IA 3IP1A 2AVNA 1HX7A 2ACWA 4LMRA 4EA8A 1QIEA 1T8WA 1PKXA 3R7DA 3JWPA 5CM8B 3V7FA 2JGEA 1Y6JA 2XPCA 3ET4A 5EYPB 1G21E 1RPZA 1NX6A 3JAKA 3L8DA 5IDXA 2QU8A 3UYLA 3RI3A 2WMYA 3NNDA 1TO2E 2R6JA 2WVGA 3UHPA 4RPCA 1P73A 5KQMA 4J90A 4I9NA 2WD8A 4V3BA 5ALZA 3GQBB 1Z34A 3RRMA 4Q47A 1TGVA 3C5WP 3K6RA 4XLLA 3CSUA 1AMNA 4C76A 1RLMA 4JKIA 2HF2A 1GTG1 5EHGA 1Z0AA 1QF9A 4HQRA 3TR6A 1S8NA 3P9CA 3SYNA 3KOWA 1JECA 4BV2A 5HWSA 1K4MA 4E12A 1TCUA 4EGCB 1KFEB 4MKXA 1GLVA 4RJ2A 3V5NA 4TN5A 3T9EA 4DDMA 3FLMA 7REQA 1PR4A 3LPNA 4KQFA 1D4AA 3TQCA 1LTKA 1T2FA 4CMGA 1OI3A 1ESDA 4ZOLA 4NVRA 1HBJA 3RVJA 2XAUA 3UUWA 5I01A 1C4OA 1PBNA 3X1KA 1Y6GA 2VSXA 3DAFA 3V7NA 3K2EA 5DM0A 1T5HX 3FRIA 4EKIA 1R0RE 4C5AA 3KXPA 3SWWA 2JBAB 3BGDA 1PSWA 1P7VA 5CLIA 1EGQA 3AZOA 4PLCA 4O29A 4D9HA 4N0PA 3WGVA 4LE2A 1PYDA 4Q39A 1C7RA 3LVQE 4XGIA 2JIRA 2HUNA 1A5AB 1CUFA 3CR8A 4RK1A 2WFLA 4F60A 2B8JA 4DCVA 5I51A 5JQGA 5JCXA 4X1KB 2NYAA 4U0JA 2PZBA 4OX9Y 1R1DA 1KORA 1Z2CA 4PFQA 3PGA1 4JVOA 1CQJB 1N6KA 1XRQA 3B3AA 2XHEA 3O74A 4HCJA 4QXMA 4KR7A 1P4SA 2PYDA 5EIHA 2ZETA 2RGEA 3QTLA 3CCFA 2XADA 2B2CA 3JY6A 4O4JA 2W00A 4KYVA 4GPZA 1EP1B 3ZNQA 4ZYLA 3QWAA 4G2NA 3IE2A 4JK3A 5FFNA 4LF7B 4YRLA 2P9HA 2QV7A 3USCS 2IUEA 3A70A 3OOYA 1GSAA 4RORA 3V3KA 4IWNA 1GDDA 1TIKA 2TS1A 4AG3A 3OMXA 4QTYA 3GLSA 4JX9A 3QIVA 5K0GA 3NKFA 2QM7A 2VYVA 5T4BA 1GN9A 5JATA 3RBVA 1P1HA 1QQAA 4HAUA 3D7SA 1FA9A 1M8GA 2DUWA 1ZFNA 1TVCA 3G5LA 4X61A 2C8LA 3C39A 4FZVA 5LYYA 3NHYA 3ML1A 4KHPB 3R5TA 1K3FA 1NXSA 2A5LA 3HVHA 3ZWNA 4C4PA 2WM3A 3AUJB 4P53A 1RC8A 1F2VA 1L7BA 3A6FA 2QMUA 5DE3A 2GWHA 4PSDA 2OKGA 1NDUA 3NHBA 5EGNA 1OTHA 1IHUA 2X5NA 4DILA 5CA1F 1BW9A 4RZIA 5H81A 1PDWA 5GVRA 1U3CA 2VJDA 2R47A 3FNHA 4JIMA 2D8AA 3W5IA 5K0FA 1HL3A 3R6GA 3RF7A 5KTKA 1UC9A 3HVUA 3MTEA 2C42A 1XPRA 1VLHA 2G4VA 4EZBA 3ORSA 3OKPA 5K3FA 4ESOA 4C6RA 1E8NA 3A4VA 3DONA 3DLAA 1ZLYA 1WZNA 2IKSA 3ZQKA 2J0VA 3EUWA 3MA0A 5JNWA 4POAA 5DSZA 6ABPA 3M70A 1UEXC 4A92A 3O2NA 3V1KA 2AZXA 5ERGB 3E05A 3IAS6 3OFNA 1S96A 1BN7A 1QYDA 1V3TA 4FK8A 1Y33E 3DE5X 2WHXA 3PQ7A 4H1TA 2R6DA 4N5HX 1CR2A 1Y6RA 3Q5EA 1TD1A 3QYAA 3LXRA 1BQ4A 4CJXA 1RZ3A 4PX3A 3Q40A 3MAGA 1U2DC 4U3JA 1IOWA 5EVCA 5LZ5A 3U3RA 1RZUA 2ZJ6A 3BGOS 1N3LA 1QGUA 2ZCVA 1IUNA 3B6MA 2AK3A 1DHTA 1SZDA 3BC1A 4R98A 1YZKA 4RQAA 1IZ9A 2ZIGA 1VYVA 2X8AA 3G2OA 1GQQA 2NM0A 3OQVA 4ZVSA 1XZAA 3LW8A 2DU8A 4YV2A 1OREA 5ER9A 5F2KA 3TLZA 4TXLA 4H6WA 1NVBA 2FOIA 2QMOA 3MAJA 2PM8A 3MIIA 1P1KA 3JSAA 4IDOA 3OFND 4MCAA 4YJFB 1AUQA 5CBKA 3AJRA 4TN1A 2C1EA 2NXEA 4GXQA 3U3KA 4A7PA 4M4SA 3O4VA 3H7AA 2ID8A 1KH1A 1JSCA 1ZGJA 2EJBA 2FSGA 3GXOA 3NAQA 2HU7A 1ZI9A 1Z08A 3TSWA 1KJJA 2B7BA 1TZKA 1AKRA 1KO1A 1Y9JA 1BN6A 1N3IA 1T3ZA 2FPGA 4MLCA 3TRIA 3D3NA 3PIRA 4HWTA 4KVGA 1GTVA 4JC0A 4CCSA 2IYPA 2QE7A 1OPXA 4U63A 4B6SA 2UZIR 3W8RA 4BPBA 3M9WA 2WYVA 2QM3A 1XV5A 1X6VA 5IHXA 2QRMA 4Z9XA 2WKWA 5JIBA 1EWTA 4WZBB 2Q07A 3OIYA 1E4EB 1WVMA 2E9SA 3TJRA 3NIFB 2CJXA 4JJ8A 4TLEA 2Y77A 1P9OA 3PXEA 4MYUA 4YRQA 3RC7A 4EA6A 2Q5QA 5BQXA 4L7QA 2B5OA 2PTGA 3R0IA 4DT1B 1KEEB 4JKOA 2AG6A 1NMZA 3LKBA 4TQGA 1M2VB 1CQIB 1E0AA 1PJ8A 2JGNA 1C7JA 2O52A 2AW3A 1KI3A 2C2YA 1OB2A 3UJBA 4I4CA 3FYUA 4MP8A 3K9BA 2VH5R 2BCEA 5KDDA 2DCUA 2QW8A 3OT1A 4Z1OA 5BQPA 2XCSB 1D2MA 1PWHA 1ZI6A 2AJDA 1YCGA 2DTEA 3FUUA 3K73O 3B85A 4GVPA 3PL5A 4FQ5A 3TKYA 1JI0A 4PY2A 3I9MA 4CMIB 2WB2A 1EUZA 3LUBA 2HC9A 5GQSA 5MFPA 2CLHB 1BXRB 1F0KA 4DS3A 2SHKA 4MP6A 4OU5A 3TYXA 3DDSA 4BAGA 1DADA 4WASA 3LDGA 1MT3A 3WWYA 4OAQA 5JZVA 4ZYUA 4BLUA 1EFRA 2H5EA 2IW3A 3MWEA 4N12A 3SC6A 1DGQA 4MAAA 2QZSA 1D0SA 2DULA 4AECA 4BGEA 2Z09A 3ZDCA 2HJGA 3KOUA 2BJVA 1QOQB 2WWRA 4IOJA 1S9DA 1QH8B 3MUFA 2BI4A 4KQGA 2J6IA 2OE2A 3GX1A 3WZMA 4EFNA 1SB9A 3SIPA 4E14A 3TRJA 1SXJB 4O0MA 4R31A 1TGYA 2PX2A 1E2QA 3UMBA 4YAWA 1K6MA 4H1VA 4LECA 2OCYC 1RM0A 2C58A 4H08A 4B45A 1UM8A 2WT4A 3QX8A 3KL4A 4MWCA 5U9CA 3I6BA 3BXOA 3KOZA 5ABPA 3R9IA 2ZATA 2AHOA 2VDWB 3PXUA 1EFRD 1YS4A 2Q8QA 3TOXA 1JQBA 4RJTA 2JEYA 1CS0A 4K9SA 4Q9AA 2PRSA 4QRHA 3E15A 5HUQA 2HQ1A 1QHHA 4JFAA 2Y9MB 4N6OA 4MI3A 4XR4A 3S44A 4MPPA 4BB5A 2HBYA 3K1AA 2ZWPA 3QSYA 3N74A 3UHJA 3KZ1E 5FYDA 2F6RA 1MAVA 2W9XA 3IAM6 1XD9A 4S1PA 4QRIA 4L15A 5F7ZA 3E7XA 4HDRB 4X60A 3WJ2A 2QRLA 4YGXB 5FOTA 5AVSA 3IQXA 4IL5A 3EXIB 4ASUA 4ENRA 1FX0B 1PR9A 3KIPA 5HKOA 2OM2A 4PHTA 1SURA 3TL6A 2PBRA 3T0FA 1AZSC 4AF7A 5AVUA 3UT5A 5LA6A 2J7PA 1GZSA 1Y81A 3STUA 3EH1A 1F51E 2CVPA 2PEZA 4DLKA 4MUAA 4JH0A 1ULUA 2H1HA 3UJNA 1EGHA 2X0FA 4Q4AB 2GCIA 3GNLA 4G63A 1LDMA 2FUG6 3ELWA 3DCIA 3KYIB 4ZO6A 3ZWQA 2QVZX 4PZEA 3WKCA 2WDZA 2RI1A 4FYIA 4KWCA 1P5ZB 2RGUA 5BR8B 1WMAA 2ZIEA 4RF3A 4GGOA 1QE0A 5DWVA 2CMHA 1XZ8A 2CCGA 2L82A 3U44A 4B3GA 4GXRA 3IR7A 1NLFA 4ASUD 5F52A 3O47A 1ZGHA 1Q6ZA 1AKVA 5LMNB 4QFBA 1UOEA 5KTSA 3HC7A 4KUHA 2BM0A 1TE2A 3K2IA 3AEYA 2VYNA 4KLNA 1XCMA 2OC9A 3EW7A 2F1OA 5CFPA 1IXSB 3W78A 2FZGA 4JLBA 1BZYA 1XLTA 1VGRA 3MJSA 4E3WA 1U9JA 3F8TA 4CI9A 5EEHA 3TNLA 2DFPA 4AG6A 2Q62A 1ZK1A 3VQTA 4A6EA 3R7AA 3U37A 1Y0BA 1UOOA 1MFPA 2OGZA 1E64A 3LF1A 2FPIB 1TW2A 3AM4A 3GFBA 2V9CA 4MWOA 1IOLA 2CLDX 1ZHFA 3ZTYA 4L3VA 5IAJA 5FAKA 2XUFA 5AW5A 4MUFA 4R7TA 3WZ2A 4C4RA 4OL0A 1YJ5A 5KSZA 5CEFA 3ZZ1A 5K0BA 1X70A 3KG2A 1T9CA 2XDWA 4JYPA 4KE6A 4WT7A 3KSMA 3VDQA 1VL8A 3GH1A 1FFSA 1M1ZA 1P6QA 4UM5A 5FF9A 1AGNA 2IYZA 2CK3D 3DUFA 2FZ5A 3B3GA 2BGLA 2VZLA 4MO9A 1W2HA 5C1BA 2Q1SA 4IWXA 2AN4A 3I73A 3O94A 3SBXA 4EG6A 4EG8A 3F6PA 4F4HA 1QYXA 1T1SA 3K9NA 4RS4A 5EWLB 2VTBA 1FK8A 2BN4A 5DFAA 4JQSA 4KFSA 2XTZA 3X1DA 1DAGA 1GQRA 1IY9A 5DSXA 4BNNA 1YVEI 5EJ6A 1EEXB 2HA7A 4G4SO 4LF8B 3G5UA 1W25A 1XMJA 3AFIA 4I5GA 4TROA 2QTZA 1Z4KA 1NGSA 1V48A 2VUIB 4BQEA 1LK0A 1W85B 2BR4A 3RVMA 2NV0A 2RMKA 5IVIA 5TT1A 2OZLA 5FUWA 1E7SA 2VNIA 3NTRA 1G5RA 4O2AF 1U0TA 4M0CA 5AJUA 5C1IA 1OGIA 2C07A 2B99A 2Q2QA 1UEJA 3VYRB 2B69A 2ADOA 2C59A 2I4NA 3O8QA 4LBWA 1XD8A 5CFQA 3LC2O 1QM5A 1DX4A 3EEIA 5C34B 5C5CA 4QUBA 1A9PA 3DKVA 5BV2P 2VQEB 2Z9CA 3NAGA 4GOND 4YQZA 3HKDB 3IUNA 4YAIA 4BLTA 4HGQA 3QVGB 3M83A 2GR9A 1K98A 4YAJA 4KDRA 1O87A 1VSUA 2XUHA 2HPVA 2JEOA 3OHSX 4UVEA 4D26A 3GOHA 2C3MA 4QOEA 1MOQA 3HSYA 3KJIA 4Z0HO 1N8KA 1UM9A 3WGQA 1I0LA 2P3LA 3JAKB 1E1QA 1H4VB 1V3QE 2ZQ5A 3BFPA 4G37A 4YJKA 3T38A 3U7QA 4Q1EA 4IIBA 3NVKI 3ZZTA 3G2JA 1JT9A