1ZI8A

Crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVASKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTGSSGYVASAAALANERTLDFLVPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi8A00
2BJHA 1E5TA 2XDWA 3AZOA 3STWA 2HU5A 2JF0A 3WK8A 2WIJA 2J4FA 4DTCA 5F4ZA 1A88A 3ED1A 4ZWNA 1QIDA 3DL4A 4AB1A 3G9TA 1A7UA 4KE7A 1JFRA 1CUSA 2GBCA 2AJLI 1CUFA 4BDSA 3V48A 5HFAA 2WU3A 4Y7DA 4AZ0A 5FXMA 5ALPA 3WWPA 4EZIA 1XRNA 2DHCA 3DYVA 3C5VA 2HL6A 3DKKA 4X6UA 1E8MA 4FFVA 1CR6A 2V96A 3EQ9A 4FWBA 4H7JA 2C0QA 2J4CA 4OU5A 5LZ4A 5D3ZA 1UOOA 4UHEA 3HABA 4Q34A 1YAJA 2XMBA 1N1MA 4KRYA 5AI6A 3YASA 1DX4A 1Y37A 3M3DA 1TRHA 3CXUA 1FFCA 1Q83A 5T4FA 3TEJA 5FOQA 1P0IA 5HK8A 1J1IA 2JBWA 1NX9A 3A70A 4YX9A 4X91A 3MUOA 2FUKA 4QEKA 2PKYX 1EDEA 3IVMA 1VA4A 1QIHA 2XQGA 3I2GA 2ECFA 3PDCA 2ROQA 1XRQA 2Y2UA 4UBNA 1ZD2P 3M83A 5CH5A 2PSDA 1LPNA 5A7HA 3UMJA 5EGNA 3I2HA 3IUNA 4WCVA 2VA9A 3WMRA 5BV7A 2NW6A 4MYSA 2QUBA 1U2EA 5KBYA 3ILSA 4DMCA 3V1LA 1K6EA 1XQYA 1Q84A 2VJCA 1TIBA 5LKRA 3H2HA 4K5QA 2HADA 1CUYA 3PE6A 3JW8A 4WFKA 5ALZA 2OLEA 4AQDA 5HF8A 4U2GA 3C5WP 4OPMA 3EBLA 1F8UA 1XRPA 4IH1A 1GXSA 5DNWA 1GKLA 5ALTA 3QBJA 5HKAA 2O2GA 4UBLA 3UUEA 3E1GA 4BZZA 4BATA 2XMCA 3DLTA 2BGNA 4QDOA 3DCNA 4X6YA 5D6OA 2ZJ6A 2H7CA 1MX5A 2YXPX 2PL5A 5IVDA 5ALXA 3H2KA 2CKMA 3HSSA 1AZWA 4GXNA 2WFLA 3WJ2A 4D9JA 5J3JA 3DEAA 2RONA 2I3ZA 5AK4A 1BU8A 5KWIA 1Q0RA 1RP1A 1ODTC 2QMQA 1ZIXA 4BCDA 4KE6A 3VVLA 2GYVA 4WY8A 2HA0A 1TCCA 5ALDA 4W9RA 4FLEA 3WA6A 2PVSA 5FRDA 1WPXA 3FNBA 3DOIA 1UK9A 4H7DA 2O2HA 2WJ6A 4U2FA 4AZ3A 5LZ5A 3PICA 1CUEA 1X70A 4A23A 5IH7A 1EB8A 4DLNA 4G8BA 4G8DA 4BVKA 4PSCA 1SCIA 4N5HX 1IZ8A 1GPNA 2ZJ7A 1CEXA 1DQYA 2XUDA 2WIDA 1XRRA 5CXUA 4QLAA 4N8SA 5ALIA 3IUQA 4UFOA 2HA2A 2R11A 2XQFA 4CIAA 4BBZA 5JAPA 3IA2A 2QR5A 4BAGA 2PU5A 5AKKA 1VOTA 5T4HA 1CUVA 4FTWA 1R4ZA 1CUUA 3OC0A 2VF2A 3WZLA 1K4YA 2V97A 3KWJA 4X6XA 2ACEA 1MX1A 3FLEA 5HF5A 5AH0A 5JALA 5AKYA 3WK5A 1ETHA 2EDAA 2JGFA 1CUJA 2XLCA 4INZA 3OTQA 2GYWA 2GBFA 3WWCA 2VJAA 5A6VA 4OD0A 1FJ2A 1AC5A 4HTAA 3I2JA 3HZOA 1UFOA 4CG1A 3AJAA 3EIOA 2HA4A 1N5RA 3RM3A 3D2CA 4TGLA 5HF6A 4FMPA 4C89A 3RLIA 2Z5GA 1G4HA 4OCZA 1W1IA 5LIPA 1QJ4A 3AINA 1LGYA 5CH3A 5EHQA 4C87A 4BC0A 3G7NA 2PUJA 4U2EA 2BFNA 2FJ0A 3C6ZA 4QWWA 4Q3OA 3QMMA 3OPMA 4HXGA 1RYYA 2QT9A 1ZJ4A 1WM1A 1VA5A 1YB7A 3W05A 4H7FA 4EY6A 1EINA 1YS1X 3V1KA 3BJMA 2G63A 4J0GA 1H23A 4F60A 4F5ZA 2C5GA 1UWCA 1W76A 5SYNA 1MAHA 5JZBA 4CCYA 1HLGA 1BN6A 4QDUA 4ZV9A 1W52X 1XZAA 2WSLA 3H1BA 3JWEA 4DYHA 3JYHA 3FWHA 4CIBA 3G0IA 4BAZA 3NUZA 3DNMA 5DNVA 5JD6A 1JJFA 4C4XA 2I03A 3O4GA 5E4YA 4U2BA 4AXBA 5LP1A 1QE3A 1ACJA 1R88A 1WB5A 2VJBA 1DWOA 1XQWA 1BRTA 4KRXA 2B9VA 3Q8WA 4ARAA 1C4XA 3ICWA 5DJ5A 2OCGA 4P9NA 1YA8A 3H17A 4BE9A 4QDTA 5AM4A 4UHCA 5ALWA 3ZLTA 1ZIYA 4RE5A 2WHRA 3VDXA 1TCBA 1NU8A 2CJPA 2PPLA 3FSGD 5EHZA 5EHXA 2QKYA 4Q1VA 3QPAA 4W1PA 5AOAA 3ANTA 3FLBA 4GBGA 2PUHA 2GYUA 3I2KA 5A71A 1EH5A 4MEAA 1ZGBA 5ALFA 5DYWA 1EB9A 2VSQA 3DKRA 1E3QA 1HL7A 1XZDA 2QJRA 3FSGA 1IUNA 1CUXA 1XZBA 1XKTA 4CG3A 4XVCA 4OSEA 2JGJA 3LP5A 5EI5A 1QO7A 1XZJA 3F97A 2WG0A 3WJ1A 3S2ZA 3I6ZA 3U0VA 1DU4A 3HJUA 1W4LA 2PSJA 2V98A 1ZICA 3H18A 1CFJA 5K3AA 3H0CA 1EHYA 2WTNA 2HA7A 3I2IA 1CUBA 3WKDA 3AILA 1HKHA 3DD5A 1CUHA 1H22A 4EUSA 1Y7HA 1DWPA 3MUNA 3GBSA 3GELA 5KWJA 4N5IX 4CG2A 3QVMA 3FCYA 4Q82A 3H1AA 1XRMA 3HC7A 4FOLA 3KOOA 4BVLA 4QA9A 1QIMA 2B4KA 3AZPA 3L1IA 1XQVA 5AI9A 5JADA 1IUOA 5LKAA 5A62A 4X97A 4KE9A 3AIOA 1LPSA 4C6HA 3DS8A 5AICA 5AHXA 4EY8A 5A7FA 4E11A 2XUGA 5AOBA 5ESRA 3L1HA 3M81A 7YASA 1S8OA 2ZSIA 3PUIA 3CCBA 5HF9A 3SWWA 4J03A 4BYMA 1HDEA 3C8DA 2PBLA 4J0KA 4XX1A 4Q3LA 5FPPA 4EY4A 5ALVA 4BTLA 1H2XA 2IITA 5AKEA 3GROA 4PNZA 4AX4A 4H7IA 3R3UA 4UBIA 4WDQA 2DQZA 4Y2TA 3STXA 5T4BA 2H7XA 4UBKA 2H7YA 4BTVA 3F67A 1ZD4A 3DDUA 5BOVA 1DX6A 3KWFA 5D7BA 4XWGA 5AM0A 5EFZA 5AK3A 1VJ5A 3DJYA 1O6FA 1UKCA 1JMYA 3D4LA 1CUIA 3AZQA 1MPXA 1VZ2A 2QUAA 2QS9A 2BCEA 1YS2X 4MWSA 4C01A 2BAGA 4ITVA 4X90A 1XRLA 1OILA 2RI6A 5CURA 1JJBA 1P0PA 4M0MA 4ZI5A 1SCKA 1JMKC 2W22A 4E46A 3R3WA 1YASA 4B82A 4W1QA 1QGED 2J3DA 2Z8ZA 2XUJA 1MTZA 4FNMA 1UK8A 2PSHA 1U4NA 3C70A 1YB6A 1W6RA 1VE7A 3BL8A 3STTA 2XLBA 5E4JA 1K8QA 3LLCA 5A7GA 1MO2A 4H18A 4B83A 1QIIA 3E3AA 1FFBA 3ZWQA 5K5EA 1BCSA 5LLSA 2UZ0A 4GW3A 5JYCA 4MQMA 1L7QA 1J06A 1H2ZA 4JYPA 1F0PA 3K2IA 1HPLA 2WG1A 1CRLA 2XMGA 2JGMA 4Y2QA 5ALGA 3I28A 1R3DA 1U65A 5I9IA 3G9XA 4Y2SA 4Z49A 1BROA 5LZ9A 4UHDA 2Y2VA 3KDAA 4G4JA 2OCKA 2WHPB 4AMZA 1BN7A 3G9ZA 4E14A 2CZQA 2WFZA 4NS4A 1XZFA 1QFMA 1E8NA 2WFMA 1BEZA 2HHAA 1TK3A 2PSEA 2BGRA 1ZI9A 1DT5A 4DNPA 3WWOA 5CXXA 2WUEA 1XZLA 4W1RA 2XMSA 1UOPA 2WUGA 3WK6A 3QMVA 1K5PA 4K6HA 5LZ2A 2RHTA 5JD4A 4FBMA 3E4DA 1CUGA 1XFDA 1MAAA 2V9ZA 3EF3A 1QLWA 4DNFA 3O4IA 4UBJA 2RHWA 3D2AA 2Y1KA 1DINA 3BIWA 2Y6UA 1KU0A 1J07A 5AKLA 5K3FA 5AM3A 4JUIA 4DGQA 4HZGA 1FSSA 5C8XA 1WHTA 4AO8A 4B85A 3WYNA 2Z3WA 2G5PA 1HQDA 5JASA 5HZGA 2EEPA 1QIJA 2BUCA 3WZMA 3IUJA 1VKHA 3OM8A 1UK7A 1GPLA 1LBSA 1ZJ5A 1P0QA 3WKBA 2WTMA 5LZ7A 2RGUA 4EY7A 2OQIA 3R40A 1E89A 3G02A 1QIEA 3NGMA 4I3FA 1QIFA 1M33A 1EVEA 3WL6A 4F0JA 1WHSA 2VAVA 4OYYA 4N8DA 5ALUA 1HBJA 4IH4A 5KREA 1ZGCA 4UHFA 3W9BA 3E0XA 4J0IA 4WJLA 2PSFA 2HU8A 5ALQA 1MNQA 1AUOA 3WK4A 1YSCA 4BZWA 3FYUA 1XZGA 2DFPA 3WKAA 5JZ9A 3GUUA 5K3DA 4H35A 3EQ7A 4NZZA 1BS9A 3DYIA 3G9UA 4UPDA 3RK4A 3V1NA 3VISA 3QH4A 4JEIA 3RARA 4J7AA 3QMWA 4FFWA 3B12A 1PV1A 1X2BA 2XUPA 3ZI7A 1G5FA 4QE3A 4DSZA 3UUFA 4KYVA 2CUTA 1TQHA 3H2GA 4Y2JA 1PJAA 5AIBA 3EQ8A 3C8HA 2DQYA 1L7RA 5DYTA 2VT6A 2OG1A 4HS9A 3BF7A 4HVTA 1QZ3A 2WUDA 3GFFA 4KACA 2HA5A 5HQ3A 1N5MA 1Y7IA 2LIPA 4G5XA 5AJHA 4UHHA 2ZVDA 1W75A 2ES4A 1WCYA 5K3EA 2ZYIA 1EK2A 4J0HA 1SC9A 1EI9A 4MEBA 1UT6A 4QDXA 3BDVA 2GBIA 3QYJA 4X94A 4KAJA 1WPRA 4KE8A 4F21A 3HYSA 4CCWA 5ALJA 1OXMA 1CUZA 3HRHA 5DWDA 4BE4A 5HKBA 4B80A 3H19A 1H2WA 5AKIA 2W6CX 4DM7A 2PX6A 4FNGA 4KEAA 1X2EA 3VJLA 1AMNA 3CN9A 5JANA 2RIPA 2D5LA 5DTJA 4J3JA 1VZ3A 5DLPA 1CUWA 3R0VA 3SC2A 4J0CA 1ODSA 4OUKX 5YASA 4UHBA 1XKLA 1J2EA 4IO0A 2HIHA 3FYTA 4KR0A 3O4HA 2WFLB 2QVBA 3VJMA 5E4TA 4DMKA 4BC1A 4L9AA 3ANSA 3A2MA 5AP9A 4X7BA 2HDWA 4L3WA 4YPVA 2VEOA 2JGLA 3WL8A 4IHAA 4X92A 1ZD3A 3I1IA 2Q0XA 1TKRA 1XLUA 4DSAA 1CQZA 3T52A 4AN1A 4UUQA 2BUAA 3WK9A 3MVEA 4U2CA 5SYMA 5JARA 4NVRA 2HA3A 3WA7A 4LHEA 1UZAA 1OCEA 1YA4A 1E8DA 3STUA 4JNCA 2P8SA 3FBWA 1QIKA 5ALNA 2XB6A 4OB6A 3STVA 3L1JA 2HFKA 4J0JA 3HLKA 2J3QA 1T2NA 4PSDA 2C5FA 2HU7A 2XUQA 2B61A 3D0KA 1THGA 2XMQA 1ACLA 4X95A 4EY5A 3ESAA 3WIOA 1GQRA 5E2IA 3O4JA 4BVJA 4RE6A 3ICVA 3QPCA 2DSNA 1XZHA 1P0MA 2ACKA 4MQLA 4QWMA 3X3HA 2PU7A 3DL7A 3R3XA 1GKKA 3A6ZA 5FP0A 3TJMA 1PFQA 1GT6A 3KD2A 2OCIA 5ALRA 4LYEA 5C7YA 1G66A 1MJ5A 5BWBA 5AI0A 2WQZA 1GQSA 1H2YA 2VJDA 3IB3A 3W9UA 2QXTA 2WIKA 1B41A 1UKBA 2WIGA 1CLEA 5AM1A 1I6WA 4UFNA 5ALHA 5FV4A 2VAXA 4GHWA 4PV7A 1D07A 3TRDA 3B5EA 1CUDA 4C88A 1CQWA 5HQ3B 1L7AA 3HI4A 2VATA 5D3KA 2QRUA 4GDMA 1GZ7A 2AJCA 3W04A 3HXKA 3R3VA 5IVHA 4KAAA 4HRXA 1RWQA 2C58A 2WUFA 4EA6A 4HXFB 1BEEA 3AIMA 1FFAA 3MGAA 3WI7A 3ZLUA 4LKOA 4FBLA 5JIBA 2CBGA 3CN7A 3FLAA 2XUOA 5JAHA 2XQKA 2XT0A 1ZD5A 4I4CA 3DOHA 3KSRA 1AQLA 3I1YA 3D2BA 4KAFA 4A5SA 2OQVA 2YYSA 5ALSA 4BP9A 4HXEB 1CUCA 3STYA 4WY5A 4U2DA 4CCYB 3KXPA 3BIXA 3D5EA 4UBOA 3IBTA 4B84A 1B6GA 2GZRA 4G4GA 5EIEA 4BCCA 5FUMA 4Y9SA 1SFRA 2WLSA 2C4HA 2ZYSA 2WG2A 5IKXA 4ZXFA 3C87A 4H7HA 3HACA 1QOZA 1WOMA 4O08A 1FFEA 2AJDA 4DMFA 5CT9A 3F98A 1EXWA 3FCXA 2QTBA 2FJPA 2K2QB 2QJWA 2R8BA 4ZRDA 4RGYA 1BE0A 4X71A 5C81A 2AXEA 3SX4A 2AJBA 2VTVA 1R9MA 1QO9A 3H2IA 2WJ3A 3V1MA 5AKJA 3O9VA 5AI5A 1XZMA 4G8CA 3D7RA 2XMZA 3G8YA 1WB6A 4IH9A 3IURA 2JIDA 4GECA 5CH8A 3NWOA 1QTRA 5ALLA 5CTAA 3IDAA 3TGLA 4P93A 3N2ZB 1EK1A 5IVKA 2HFJA 1O6GA 4PF1A 4IQ4A 2ORYA 4OB8A 4Y2PA 1CUAA 1Q0ZA 4I19A 4B0PA 1IVYA 2O7RA 1LLFA 4NMWA 4AN0A 1R9NA 2JGKA 4RNCA 3PF9A 2CEKA 2JGEA 2I3DA 3W06A 2XUKA 4B9AA 2HRQA 2BKLA 4J0DA 3T4UA 4OYLA 4Y2VA 3H2JA 1CV2A 2H1IA 4FHZA 1LZKA 1XZCA 1SOMA 1ORVA 1A8QA 2X8BA 4M0FA 2WIFA 3V9AA 4GI1A 3BWXA 4PO3X 1AURA 4H77A 4P08A 1EX9A 2E3JA 1K63A 5CT4A 4TVKA 2EDCA 4C4ZA 5AM2A 1MNAA 3G0GA 3N0TA 2JEZA 1XQXA 3DQZA 3FVTA 4OB7A 1ODCA 3LIPA 1USWA 4N8EA 4MXDA 5ALEA 3O0DA 3Q0TA 3RKSA 3C43A 4XIIA 3ESCA 1VLQA 4JH0A 4KJXA 3U1TA 4HAIA 1XZIA 1IUPA 4DNQA 3IIIA 5AKXA 3R3YA 2DR0A 2VT7A 1NU6A 3R41A 1YAHA 1CIJA 5CT8A 2D0DA 5EIAA 4BCBA 1MN6A 2OGSA 2XMDA 3BE8A 1DT3A 4DIUA 5JATA 4G4IA 3QM1A 5AKHA 3VXKA 3IUMA 2IX9A 2AJ8A 4K6KA 4X00A 4Y2RA 3O9MA 3A2LA 1ISPA 4H0CA 4B6GA 1YR2A 2BUBA 1MT3A 3IULA 5AKGA 2IIVA 3WKEA 5LYYA 2I78A 1SCQA 2QZPA 5T4EA 1LPBB 2X76A 1CVLA 1IMJA 1A8UA 3VVMA 4B0OA 4BDTA 5A2GA 5CBKA 3OG9A 2OXEA 4W1SA 4WFIA 2WILA 2H9YA 4PSUA 3PFBA 2WHQA 2Z3ZA 2OPHA 5FPQA 1LZLA 2DHEA 1E66A 4L72A 2ZJFA 1Z68A 1VXRA 5IVIA 2XUFA 1VE6A 4C4YA 5ALMA 2DCMA 3BDIA 3PI6A 1JU3A 1YCDA 4YASA 5FKJA 4G1FA 4S0XA 3LCRA 2C7BA 2WKWA 4QZVA 1LPMA 1LPOA 3A2NA 4QDZA 2G5TA 4LXGA 3G0DA 3B3QA 1JI3A 1LPPA 6YASA 2JEYA 3M82A 2ZYHA 4H7EA 1EVQA 2XUIA 5ALKA 2O7VA 4BP8A 4MYDA 1F6WA 3ZV7A 5BWCA 1ORWA 2ZSHA 3WLAA 3F8SA 2XQIA 4EHBA 4RPCA 4BAUA 1U8EA 5CMLA 3K6KA 3S8YA 1R1DA 2FX5A 4B7ZA 2B20A 2XE4A 5EIHA 2OAGA 1ZOIA 3QPDA 2OGTA 3BF8A 4GEGA 3BJRA 5FLKA 3W2TA 2XUAA 3OOSA 5AK5A 1QONA 5DYYA 2GBGA 2GZSA 3NOXA 1XZEA 1JJIA 4Y2UA 4H7KA 1N8SA 4LXHA 4E15A 1LNSA 2YH2A 5C8ZA 2DHDA 3I6MA 5I7UA 1ZI8A 3ESDA 3FAKA 3H04A 5JAOA 4L0CA 3O95A 3WIBA 4ETWA 1FFDA 1A8SA 3P2MA 5C8VA 4X3CA 4BRZA 4BB0A 3C45A 4BRSA 3D59A 4WDRA 3WKCA 3K9BA 1JKMA 1JT2A 4B81A 5ALOA 5I8PA 1DTEA 4P92A 4LIPD 2XQJA 4DMHA 5K3CA 3PF8A 5JD5A 2HM7A 1JU4A 3SK0A 5H3HA 4FLFA 3WWDA 5AI8A 5HK9A 4M0EA 4AO7A 1C7JA 4PQEA 3G0BA 2ZYRA 1C7IA 3FOBA 4FLMA 4MWTA 4PW0A 3WL7A 4G9GA 4X93A 1AKNA 3PFCA 2XMRA 1QIGA 4A16A 5JZSA 4TPKA 1DWQA 4GWLA 1VXOA 1EA5A 2JGIA 3AUKA 4GLBA 2QXUA 2WM2A 5K3FB 1XZKA 2PM8A 3ESBA 5FDFA 1AGYA 5AI4A 3VKFA 2O2IA 4EB0A 2RAUA 5HFNA 2OAEA 4ARBA 4EBBA 2ONCA 3WQHA 1MU0A 1R50A 4AO6A 4W63A 5CRIA 3CCCA 4LYDA 3FYUC 3LIIA 5ALYA 1ZI6A 1TCAA 1QFSA 3F9CA 1BCRA 5AOCA 4Q3KA 4CI9A 3AIKA 4HRYA 2QOEA 1LBTA 3I2FA 5ISMA 1KEZA 2VQ6A 4ZV7A 1F0NA 1XLVA 3C6YA 3OURA 1CPYA 1EDBA 2HRRA 1EDDA 5CT5A 4FKBA 1T4MA 1IZ7A 1DQZA 5AKZA 3AFIA 5DNUA 5LZ8A 2HA6A 4WFJA 3QITA 1G42A 3FYUB 3GA7A 5AIAA 4UFPA 4V2IA 2CB9A 2G4LA 5CT6A 2C0PA 4ZGBA 1KU6A 2QM0A 2Z8XA 2CMFA 4MJ3A 4AMYA 1GGVA 3WK7A 3ZLVA 4LXIA 1UKAA 4ZREA 5K3BA 4Q05A 4XJVA 1GPKA 1LPAB 4OU4A 4B9EA 2XUHA 4QNNA 5EHNA 4G9EA 4Y2XA 4FDMA 2OGZA 4ROTA 5DTIA 2WHPA 3WWEA 1MX9A 5HCUA 4X85A 3QZUA 1XROA 5CW2A 4K2AA 3G0CA 3D3NA 4JYMA 1XLWA 3LS2A 1TAHA 1UXOA 2WU4A 4CFSA 1WB4A 3I6YA 2XI4A 3ZPXA 3C6XA 3WL5A 5AK6A 3PUHA 4Y2YA 2OCLA 1THTA 3WYDA 3BXPA 3FVRA 5JAUA 1UOQA 4K6GA 4UBMA 4QLOA 2Y6VA 2WJ4A 1QTIA 2YASA 3F96A 1UK6A 3VJKA 2X5XA 3GZJA 3HEAA 5AO9A 5AM5A 1AX9A 3C6BA 4YK7A 3R3ZA 4DNOA
chains in the Genus database with same CATH superfamily
2VVTA 3NVMB 3K96A 2HNAA 3NX4A 4UUPA 2NVUB 3WGKA 4REQA 1LSSA 3AESB 2BBOA 3KBOA 3SHFA 2C1EA 3WMFA 1QH1A 2OBBA 3A3KA 3EUWA 5CIQA 3WK8A 1CDEA 1OLXA 4OAPA 4URYR 3HXMA 2CFIA 1J5EB 1MOQA 3L7IA 4E7PA 1H1LB 2XTAA 3S2YA 3UAXA 4A27A 3IEXA 4V39A 1MVNA 2ZBRA 1PKXA 4YRCA 4AB1A 1WCIB 3K53A 4OBWA 2WJJA 4DHEA 2QI9C 5C8YA 3WJ7A 1E6CA 1JGTA 1QC5B 2I76A 2FP4B 3LDHA 1J23A 1JFRA 5JSZA 1N3YA 2GBCA 4QYIA 2HJHA 3HDTA 3R2JA 5FH9A 2IYSA 1JHRA 4HTFB 4MAFA 1GVHA 2AHRA 1DLJA 1QPZA 4ZVRA 4FPXA 4UTZA 1LEHA 1RZUA 1U8AA 2CLSA 2DFTA 1V2HE 3QU7A 4O4LF 4Y7DA 4EMTA 3UHFA 4ND1A 1H2HA 1MB3A 3GUZA 3OCXA 5JSQA 3GR6A 3M1AA 5KAMA 3NHRA 3OZRA 1ZN7A 4MKIA 3WWPA 4B4OA 5JI3E 3DYVA 4GM0A 4OHVA 4AS1A 2GZDA 1QSGA 3BM5A 1QU3A 3HBJA 2FMHA 4PG5A 3TOZA 3TM5A 4Q47A 4YDSA 3F74A 3PK0A 2R84A 1J42A 1KI3A 4FYHA 1CX9B 4NJEB 1EYZA 4TMVA 5FOVA 1XSEA 1S9DA 2P67A 2CY0A 4AU1A 1P7VA 4B5LA 4H7JA 3IT3A 2JJ1D 1D09A 4IIDA 1PNQA 5A04A 2J4CA 3FM9A 4GKVA 4MO9A 1DTWB 1FRQA 1LK5A 3CM0A 1TPYA 4Y6QA 1KYVA 3ZY3A 3ETLA 5LJLA 4Q1AA 1RR6A 2OHHA 4FZ5A 3LCUA 3HABA 1GGHA 3FGPA 4YS6A 2IYOA 4GYJA 2A7XA 1YVUA 1SHJA 5IHPA 4BQPA 4RA9A 5K0CA 4HGOA 1FA9A 1NULA 1OTHA 1L5LA 1ZW1A 4DLYA 5C32A 5BT9A 5FLXA 1NVVR 4TOIA 1BXKA 3BKXA 1J5XA 1WXIA 2H11A 4Y6GB 2PGNA 2WQ6A 2UXBB 4JSTA 4BVEA 2CXRA 3AOGA 4WXMA 3PQ5A 4HWKA 1QLJA 1ECBA 4OMFG 2XUZA 4KMMA 2JJ1A 4CKCB 3DBLA 3OA0A 2OBFA 1E0JA 2ZR9A 2IYFA 3NJ8A 5FOQA 1TLFA 3SXUA 1NRWA 1Z0DA 4YC7A 5ICGA 1E2UA 2ZIZA 2O4CA 4MVJI 4TTJA 3HPQA 3KXIA 2P77A 1C9YA 4OI1A 4YUZA 2J3IA 3NPMA 2LVBA 3JARB 1Y34E 4TL6A 1C30B 1VA4A 4MCHA 2XQGA 5CFPA 3LGSA 1BH6A 2C9YA 1UC9A 4B2PA 1GL7A 4BKQA 3ZCQA 1EESA 3U44B 3O7WA 2BZ1A 2JAWA 4MUKA 4R9NA 4DR5B 2C95A 4UBNA 1ZD2P 5DB4A 5CH5A 4ZEWA 3DB1A 4W9MC 3MS7A 4XR4A 1J90A 3EIEA 4K9OA 2W2OA 1CB7A 3KJIA 3O1HB 3OLXA 3BS4A 2PUVA 1MC5A 1KZ1A 2XNCA 1WW2A 5EGNA 5IBRA 1X1CA 2A88A 2XWBF 1UMDA 2PWPA 2YZGA 1PTJC 1WUIS 2G67A 2W6JD 5K1ZA 5BV7A 1C7RA 2GASA 1OXUA 3BHIA 4WXYB 4FHFA 1Z37A 4MYSA 5JCOA 1YTUA 2P5SA 5M29A 5DLQC 2Y0PA 1GTJ1 1TU3A 4XRGA 1MH1A 4DR3B 4YROA 3O4FA 4AG6A 1NFFA 4X8MA 3BSSA 4B3XA 1XTSA 3W7VA 4PPFA 1ULBA 2VPZA 3IQIX 4RGVA 3UYKA 4CKBB 1QG2A 3BB1A 3V1LA 1XQYA 2ZTUA 3CR7A 2WPNA 2WJHA 3IVRA 4IQ0A 1KE1A 3SMQA 2C5LA 4KWTA 2VJCA 1QF6A 4NXMB 1ZINA 1UR5A 2WMYA 2J3EA 4MB2A 5DCWA 2YWRA 4BFYA 4K6FA 3FHTA 2FW0A 2IJGX 1QLHA 2G7ZA 4K5QA 4WVFA 1YIAA 1PUXA 3BIJA 4JBXA 4OQ4A 3CNHA 4EKGA 2W6JA 2E37A 5DWVA 1RQRA 5JXJA 2BCGY 1V3TA 3QFTA 4BLQA 2SKEA 1XDUA 2RGXA 4Z0NA 3ZXXA 1A9YA 1G60A 4WBNA 4X1YB 3TLJA 3SS7X 4F97A 1LI4A 1RBYA 2OLEA 5HIKA 1JDBC 2WF6A 4GLOA 1Z2NX 4LDNA 4LYJA 4O4IB 4H16A 3TPFA 1TM7E 2WYOA 1C8VB 1JPNA 2H8GA 4NV3A 5I9TA 5J5VA 1RXVA 4B3JA 2RHDA 4XA8A 4EECA 3LNTA 4JJKA 4JASB 4C4PA 4MGKR 4CF6A 2JI9A 4DVGA 4IH1A 5KYYA 1G18A 3HJTA 3TCKA 2KHZA 4KVZA 2AFHA 4MDYA 2V7TA 3VRHA 3ZTTA 5LMZA 3CX3A 2FPRA 2Z09A 3L7MA 1QKIA 1W4ZA 3ABOB 3NUQA 3OEHD 5TS2A 3ZHXA 2P3QA 4EFDA 2FE1A 4PZUA 2RC6A 1A1VA 1SIBE 4JGBA 1XMIA 4TT3D 1I7NA 4J1TA 4YAKA 2VLIA 4ZGWA 2ETXA 2O2GA 4JEHA 3M6LA 4ZVOA 1USVA 4RK6A 3Q11A 2X77A 1D0SA 4AI6A 1NUSA 2GDJA 3KQVA 3QUBA 2ZJ3A 3L6UA 4BATA 5BNTA 1KQFA 1P75A 4IL5A 1N2BA 1NUAA 3GW8A 1UH5A 2VDVE 3I9MA 3RNOA 5FBHA 1H93A 1YL6A 2XWSA 1IOLA 3MTBA 1FNMA 2X7HA 1XCGB 5IRCD 3BMCA 2VYCA 2QU7A 3GV0A 1MX5A 2AN4A 4KDCA 2PL5A 4R8LA 2CMDA 5IVDA 2Z4RA 1RWMA 1I3MA 3S5UA 1ZUD1 1UKEA 2WRZA 5COAA 3DTTA 3K1ZA 3KZNA 1P0FA 2NTNA 3IP1A 3O3CA 3I5MA 3PRKE 2Y1OA 3HRKA 4BFXA 4A15A 3FRIA 1U0RA 3EIXA 4C5BA 4I66A 2DLCX 2FN8A 2IIBA 3GD7A 2FRVA 4TT3A 4I4LA 1XCOA 2OBMA 4NNPA 4PSAA 2WFLA 5TEWA 3TQTA 1B93A 4D9JA 1K8ZB 1P6QA 2ENUA 3HGMA 2QIOA 4I50A 4IS2A 4LMPA 3DEAA 1FQWA 5J3JA 4JKYA 3JR3A 2XSZD 3GRVA 2IYZA 2I3ZA 4DUPA 3BMOA 1OLSA 3SC3A 3V2UA 5TY0A 1GGNA 1Y5RA 5LQSA 1JUDA 3UEOA 3I9JA 1JDSA 3BC1A 1TMKA 3CMCO 4PGMA 2M6KA 1ZIXA 4BCDA 2ZWOA 1ZPDA 4KE6A 3VVLA 5CVTA 1X7XA 4OXYA 2HA0A 2QD2A 3WIVA 4MOWA 2RAPA 4P54A 3U9TA 4Z4GA 1DKPA 3OSUA 4PQRA 5CB6A 1DAGA 1G3MA 2JFZA 2C8LA 4B44A 1G6HA 3ZQ6A 1T5DX 3QTTA 3W5AA 1J2RA 2HNBA 2XCUA 3O3OB 5JXWA 4X60A 3FNBA 1Z6ZA 4J3FA 2XSZA 4XE5A 1LI5A 3DFUA 3CRZA 3FCSB 3SJZA 3D64A 1WY7A 4PFQA 4F93B 2NUBA 1ZC3A 2O2HA 1ZC4A 4BBJA 1AN0A 3BCSA 1KP9A 3EQ2A 3HCFA 5KOJA 5FNVA 2IOQA 2RK3A 2OTCA 1FVOA 3PICA 3GLRA 2CMGA 4GYKA 1HYHA 1Y8AA 2E0IA 2VQSA 5FA6A 3U4AA 3ZU5A 5IFKA 5IH7A 2YWHA 3V8MA 3F6EX 1EB8A 1LVUA 4DLNA 4OX9Y 3UUWA 1CJMA 4UNNA 3VPBA 1Z6AA 5E1BA 4ZMRA 3F9IA 3S55A 1F51E 3ZIDA 2QBYB 2QD1A 3ZH2A 4EENA 4N5HX 5KHAA 4Y1FA 2FEMA 3DWIA 4FGLA 3E7DA 1U2ZA 4AUEA 4DA4A 2ZJ7A 4LE2A 2BGTA 4YT5A 1CEXA 1Q7GA 1WXXA 2YMLA 2WIDA 4UU1A 4YHBA 1AXRA 1XRRA 5CXUA 4M1YA 4QLAA 4RY8A 1DADA 4LV5B 4U63A 4MW2A 3LPAA 2P9GA 1K7XB 5ALIA 4V1CB 1AKEA 2DTEA 2ZRKA 3SNKA 5E3HA 2DR2A 3AJ8A 1Q74A 5F23A 5C3UA 4NONA 1HFWA 2XQFA 1C7FA 4W6QA 5IAGA 2JI6A 4DABA 1OB5A 4EI8A 5JAPA 5JZMA 5KJCA 3Q6NA 2ZT6A 1K4KA 3IA2A 3M5CA 2IF2A 3IUSA 1EE1A 2PU5A 3DR5A 3PVZA 2V5UA 1EK6A 3C3EA 4QUDA 4WGFA 5JTUA 2M1ZA 1XQ1A 4DCSA 1ZJWA 2A9QA 5JNUA 1KMIY 4LRWA 4OYRA 2HK6A 1I4DD 5FI3A 1CUUA 5JAMA 3OC0A 3CURA 2BHNA 4OI4A 1SZJG 1R4MA 5ITVA 4KHPB 4AMGA 4F6RA 2V97A 3ZJ4A 5F35A 2WT4A 4CBVA 2ZPTX 3I34X 4X6XA 5C53B 4UMVA 5JCOC 5J2TF 5IXJA 5DPMA 2J0EA 1B23P 3MEQA 521PA 4EG0A 3CUVA 1CYDA 3CRRA 1TTQB 3ZNPA 3T7AA 3JD4A 3WNVA 2P4HX 4D56A 3PIRA 4AUMA 1P77A 4NBTA 5BSKA 1JE1A 2JJQA 2O07A 3D8UA 1NQAO 2FMFA 4QHYA 1M67A 3VO2A 2XLCA 3RVJA 4QICA 3OZBA 1B43A 2PT5A 4F3NA 1ADFA 1O97D 4PZLA 3CLRD 3V7YA 1GG9A 3RVNA 2FLVA 5KYXA 3R8FA 2GBFA 4HQLA 3BMNB 3TINA 2H5JA 3C1TA 3N75A 2YS7A 5JROA 4HN4B 1ENOA 3HM9A 5A6VA 1P73A 3AR3A 3WB2A 1FJ2A 2FR0A 4HTAA 3I2JA 3HZOA 1UFOA 2B4QA 3FDXA 5CNIA 3GZ4A 4J7XA 1T9GS 3K7EA 2EX1A 5AJVB 4C9BA 2PRYA 3EEOA 2AOUA 4KPYA 1W96A 4K9LA 4KVFA 1EBFA 3GEPA 4XQEA 5A3QA 4U0JA 4HGPA 3L18A 3VC7A 5M34A 1X7WA 5HF6A 1PT9A 4GIBA 1FTSA 3T4PA 4XOIA 4C89A 1J9ZA 2REXB 3RLIA 1XI2A 2AMFA 4WX2B 2E55A 3C7CB 4TMXA 3HJCA 3A4LA 5LCXA 3HUDA 2G82A 1CRWG 5HUHA 2WOJA 4OX9B 5K51A 1Z6YA 3NR2A 1B76A 1BA3A 4OQNA 3F6BX 3K8OE 4MIEA 3GAFA 2ZAGA 4C5CA 1JEQA 5L3RA 1K86A 4CMJA 3DC2A 4L7VA 4RJIA 5CH3A 5EHQA 2JIBA 1E3IA 2ZWAA 3GBVA 1Q44A 2DFLA 1RPAA 2G88A 3LDFA 2WD7B 4GPTA 3HO8A 5DHSA 5IDWA 1E1KA 4P3NA 2XHZA 5TQ0A 1IQRA 3KQLA 3ZY6A 1PQ4A 3TKAA 3BJIC 4NX2A 2Z6VA 1EDZA 1QOPB 1R6DA 2DYKA 3VBEA 1JMVA 1R7RA 4FSDA 3L8FA 5DXJA 5BQ3A 5FF9A 4RDXA 2H3EA 3JPWA 5AVXA 1S2LA 4U2EA 1ADJA 4IQGA 4BGVA 2E5WA 3WO1A 4M7RA 3C6ZA 2XZDA 2Z9DA 2PO5A 4QWWA 2PUTA 3OPMA 2SKCA 1K1EA 5C4IA 5JS6A 2QWXA 1DBPA 1NJFA 3CSDA 4G5FA 4CDGA 1DARA 2RGNC 3ENQA 3KJEA 3ZY2A 2W4MA 1COWD 1Z28A 1HH4A 2F48A 2QQ0A 1Q1BA 1SIUA 3CW9A 4XLZA 1L5WA 1YQTA 4ZO6A 3SQXA 1WM1A 2ZCUA 3LDAA 4DMRA 1QMPA 3D3JA 5EHGA 4HVLA 1CR0A 1XPRA 1P39A 1GL3A 1O1YA 3IIKA 4X24A 3W05A 3EK2A 1B0ZA 1UBCA 4P0TA 5AVKA 4EW1A 2R0QC 1OH5A 2H08A 3OKFA 3WLTA 3BJMA 4MUIA 3KSUA 1RJEA 1C3XA 1VSVA 3TSWA 1M2EA 2VUTA 5DIZA 1H23A 2XQVA 2ZQZA 4F60A 2ZG6A 3HKEA 1IZZA 5BWLA 4RD3A 2O0KA 3ZWDA 3A6PC 2BHTA 3BTUA 3KJGA 2ZRIA 1IBCA 3VYSB 2GO1A 3NYWA 4EJSA 3D6AA 3AP1A 3LKZA 1H5UA 3MMSA 1BN6A 4YV1A 1UIMA 2BEUB 4YO8A 5CYPA 1T13A 1COWA 1SCAA 1U7DA 1IYZA 2WSLA 4ZV9A 4DOMA 2I87A 1QGDA 3BWYA 3OZ7A 1BSVA 3LXXA 4XVHA 3I1JA 4JMLA 2WIBA 4D4JA 2JAXA 4Z0PA 2V5VA 3TKYA 3FWHA 4YVFA 3G0IA 3H8WA 5DNVA 5JD6A 5AMXA 2F1IA 1ML3A 4KWHA 5HJ5A 4EF5A 4X8HA 1LXCA 4WZAA 3PDJA 1IONA 1ZK1A 1N2CA 2EIHA 1VMKA 4GZLA 2FPOA 1M54A 3A6JA 1W88A 1JG6A 2VK1A 3FJOA 3G8AA 3KKNA 4RIHA 1QE3A 1G3UA 2PG3A 4YP9A 3UAYA 8ABPA 3DLAA 5DRTA 4ZC8A 3Q8MA 1XQWA 4R41A 2NPIA 2OA0A 1Z29A 3ANYB 3CVXA 1V45E 1NI4B 3QUQA 4W8OA 5FB3A 2GCGA 5BNFA 2P6NA 2WJVA 2ZS9A 3H9GA 4PZ0A 1WA5A 3E35A 3O2NA 4RF2A 4JT4A 2IA5A 1C4XA 4UAUA 1IDN1 4KYIB 4YJ2F 4F71A 1LCIA 4QPDA 1X1AA 4BO0A 5BSHA 1TJYA 2H17A 2OCGA 1X14A 2R65A 1C0PA 1EWTA 3MWGA 4G41A 5SZJA 3EEQA 5AM4A 1KI6A 5EIFA 5ALWA 5JR3A 3COVA 2HYIC 3C4VA 4RENA 1M1NB 2X42A 3D1JA 4M0KA 5KYUB 1LFAA 3BFKA 2VPIA 1A0OA 1R6BX 1WUHS 1ZIYA 2AG5A 2PZEA 5I7EA 1TA4A 2RAVA 2WWWA 4FJ2A 2Y05A 3P0IA 1Z5VA 4MZDA 1WQ3A 1NU8A 1QG6A 1S6YA 3FSGD 1GGFA 3DOEA 4W7IA 2QKYA 5EHXA 3UWPA 4Q1VA 3TVTA 1UPUA 1Z4IA 4DILA 3A27A 4A91A 2W37A 4GBGA 2PUHA 3MSXA 3BXZA 4CGYA 4ZIRA 4UDNA 3B36A 1CE8A 3OE4A 5E0KB 3ZK7A 5C18A 5HRCA 2VNIA 4M9ZA 4N0MA 2J6HA 1F14A 2WNIA 3FVQA 3HB7A 4OF4A 5TPWB 4WLEA 5H3LA 5BR7A 5IMSA 3RRJA 3OQVA 4OP2A 4AP5A 4WNYA 2K2WA 4BFTA 5AVZA 3UBTA 1W59A 5KYWA 4GI3A 1KMQA 2A57A 3A3NA 3WICA 2E7ZA 3WGMA 1KR2A 2OD2A 1AN9A 2JFOA 2PLFA 3JCZA 3DE7X 3MIZA 4OXKA 1XZDA 2QJRA 4YRQA 2YVQA 3TQFA 1T35A 3FSGA 5FO1A 1XJ0A 1YMVA 1C1DB 3D4IA 3GGCA 1R10A 3GLUA 3NIGB 1XG5A 4ZVUA 4EHLA 5IU6A 1DELA 2XTJA 2YX1A 3H11A 4ERXA 4R1SA 3C1UA 1QPGA 1CB0A 1M5RA 2RK6A 1N3IA 2BRUA 2CUZA 4J2OA 3WLFA 2VUUA 2Q49A 1XKTA 3Q4GA 4KVGA 4CG3A 4XVCA 3QG5A 2AL7A 2JGJA 2QW8A 3KQQA 4OSEA 2P2ZA 3LP5A 4UCXA 1L5NA 5LOVF 5HG0A 5EI5A 2JLAA 2Z56A 2HK9A 3I72A 1EZ1A 1U7WA 4HADA 5DGIA 1L4EA 1VJ0A 3ROKA 4FMCB 1LNQA 1Y4UA 3WADA 3IP3A 3DPIA 2QLFA 4JUAA 1K2VN 1ULZA 4RX1A 3KSZO 3VH3A 4KB5A 4TQ9A 3U56A 1MW9X 2SCUA 3FI0A 4EI2A 4MDFA 4EGCB 3A1CA 2LCFA 1E9AA 1GLGA 4MK4A 4QBIA 4ZOQI 3GJ5A 2IKQA 5EYPB 1PT5A 2ZE5A 3HJUA 5BY2A 4XEHA 2C2OA 4NCKA 2R5NA 3DDCA 4MICA 5CA1B 4WOKA 1ZICA 1U6KA 3H18A 4XI9A 2WKSA 2ZI5A 3AR8A 3OE1A 4UQOA 5K3AA 3EODA 3ROEA 3QEAZ 3H0CA 1E2JA 1P4HA 1VDMA 4IXWA 1BS2A 2PVPA 3PNQA 4NDNE 4ARUA 4F4JA 3ZCUA 2G9VA 3FGZA 3KTAB 4JLSA 3Q3CA 1J4AA 2P5UA 3EXEA 3T9EA 2H1WA 3NM5A 4RL6A 3UK0A 1JFTA 2MDTA 2AX3A 1U0GA 2ZVQX 4HWSA 4OUDB 4JVSB 1QAMA 3ZYZA 1L4HA 2JLBA 5CJPA 1E79D 4DPMA 3W5CA 1WETA 5A0TA 4OAOA 2GBPA 2IHUA 1WKVA 1T1EA 2V7XA 2D5BA 4YTEA 1FXUA 4YH1A 5IW8A 3BTVA 4RA6A 1BXGB 1N4AA 3C2QA 3DZKA 3WLJA 2R44A 1HORA 3PC8C 4ZJPA 4E08A 4CG2A 4RKEA 2X8WA 1E1CB 2PMDA 5ADHA 3AC0A 1M83A 3MQ4A 1LF0A 2VUIB 3V7UA 4HYQA 1WUJS 2QTAA 1KY5A 5EJMA 3HYRA 1J0DA 5KYKA 1YFLA 2AFIB 1NTOA 3C3CA 3UOAB 3AZPA 4F46A 2ZJZA 4J9UE 2B92A 5EINA 4E13A 5HDQA 1XQVA 4UQLA 1PL8A 3T15A 5ILGA 3RRZA 1G1MA 3ED5A 3JS5A 4M76B 3T1YB 3PR3A 4H08A 5DHUA 1SBCA 3BGVA 5LKAA 1E79A 2BELA 4X1IA 1T26A 5IN5A 3RTEA 1ECFA 3SY8A 3W3ZB 3SIXA 1SBIA 4HEJA 4FILA 2EWWA 3ZKWA 3EN0A 4IIJA 3UV6A 3ZNQA 3OU6A 2NADA 4RANA 4JBGA 4C6HA 5K20A 1P2GA 1DUSA 5IKMA 1Q0LA 1S89A 2G25A 4LFAB 3MJFA 2XWJI 2CL7X 2FQYA 2HQSA 5A7FA 4WXPA 2C57A 2AYXA 3L7NA 4GVPA 4E11A 2XBMA 5B1YA 2H2DA 5ESRA 1WXFA 1PS9A 3AMVA 3L1HA 1ISRA 1YULA 2VRWA 4WNAB 5CVVA 5CB0A 4C7XA 3OO1A 5B37A 4YR7A 1SGWA 3HCRA 1ZMTA 2IODA 3LBHA 3PUIA 4PEVA 4DJEC 3PHJA 4R69A 3VPXA 4NFYA 3Q5GA 2QEQA 3A9UA 4IZIA 4XLTA 5GJVC 2QNBA 3DAYA 4DCVA 3SWWA 5C80A 2C2WA 2G8LA 2RHMA 2IP4A 4FDLA 3RU2A 3SIWA 3UJ8A 1ZCAA 1U0HC 5G53C 1XWWA 4J0KA 3MOGA 4TV8F 5ENZA 4O2BF 2FCRA 1I1OA 3ORHA 1KFEB 4YCMA 3PUYA 2R6AA 5KOHA 3L07A 1GOTA 4L4UA 3QUTA 2TECE 2X8AA 3HCPA 1GA1A 2VSNA 4PCUA 3GROA 1JHYA 3E15A 1PQWA 2VF5X 2UXDB 2HIMA 3N07A 4U6SA 4TXJA 5C4GB 2FSHA 2ZBDA 1E5DA 3FNFA 2FMXA 3ECSA 1T3SA 3KQTA 5HTKA 4IOKA 1G6OA 1X74A 3BERA 5T4BA 5H3CA 2H7YA 3MJHA 3OTWA 4M0LA 3SOZA 3WKDA 1X1EA 3F3MA 4YMTA 4PGHA 1L5FA 3OO0A 2Y68A 1ULUA 1DX6A 1IG0A 5BV1A 3LXMA 2EZ8A 1IJKA 3M4NA 1B0AA 1X0XA 3BZWA 3AOEA 4Y6PA 3ZDZB 2XA1A 4Q1BA 1SG9A 5AK3A 1VJ5A 1UKCA 5CW1A 4ZO4A 1FLNA 4EOGA 3WIDA 2I55A 3GG9A 3V8PA 5JZVA 16PKA 1RBMA 1CHNA 1JMYA 3W6ZA 4GL2A 4Y7CA 1CUIA 1DKRA 1N25A 2ZT7A 3K8QA 1S4QA 1VZ2A 2QUAA 2WSIA 2ATXA 2QS9A 3GJXC 6ABPA 2BCEA 1JQAA 1A2QA 4FFPA 2JS7A 1RKVA 2O52A 5B3JA 2WU8A 3NONA 4IIFA 3H2BA 2H2GA 4MWSA 1C3JA 1CBUA 1RYFA 2WSSD 4LZLA 2H1CA 2HI0A 2MR5A 3QFHA 4RETA 5LU8A 1V8PA 4Q3NA 3U9LA 4BMXA 3IPCA 4CF3A 3LZDA 2Q5CA 4HWOA 4A0SA 1ITZA 2RI6A 1RM3A 4OJKA 1JJBA 5KTRA 1DPGA 1HLPA 3F3SA 4M0MA 4OLHA 1N34B 1WBJB 2Z1MA 1Q14A 1IG3A 3K5IA 3KK0A 4BU0A 1JMKC 1K2WA 2W22A 3EXFA 1E4EA 4LX0A 1YASA 1PEYA 4JU8A 4N7JA 1SC1A 2AR0A 4EM6A 2AC7A 2R8ZA 2VPWA 3RSFA 1QGED 2I4RA 5B7GA 4XAQA 2J3DA 5ERXA 1QVWA 3FX2A 3VR0A 1KPGA 4PZZA 3FBTA 1EG2A 4M8IA 4Q7JB 1N7JA 3GT4A 1G5RA 4JN6B 4U2KA 1ECLA 2UZ1A 1L7NA 1VL6A 1X9HA 1XK7A 3D6NB 4BNFA 2FFBA 2WSSA 3QNWA 2IOHA 3FWZA 3Q6MA 1XDZA 4N6NA 4W5OA 3P2KA 5FFFA 1D2EA 1X19A 5JBNA 1ZJZA 1TYDE 3UAZA 2FUCA 3O8QB 2O1WA 5A9SB 3KS9A 2PA3A 3OZAA 1YB4A 4BEJA 2P2GA 3STTA 2ATCA 3UW3A 4BVHA 3TLZA 3H5VA 5I5EA 3IELA 1S1CA 4X63A 1SUBA 2CLLB 4C2AA 1U02A 1E0SA 1V39A 1QQBA 2CHFA 1O0SA 2PX8A 3W79A 5JQGF 1DIOB 3JY6A 4B83A 5DKFA 4LF8B 1OX4B 3BCRA 3E3AA 2M2IA 4IBOA 4RH0A 2G70A 3CV3A 3UWMA 2ZE6A 5CYOA 1J9GA 3GFGA 5LLSA 2VZ8A 3D6VA 5GONB 4DA7A 4H6XA 4MI3A 5JLAA 1MHTA 2VK8A 1KMNA 3GQBB 3PJEA 4GW3A 2R97A 1WXQA 2BT4A 3KKOA 4Q6BA 5H0IA 5EJFA 4B3DA 4LF4B 3EMKA 2D8AA 3HL4A 3QKSB 4ACAA 1L7QA 4MQMA 1J06A 4BJ6A 5JYCA 3OFND 4JYPA 2I6GA 2RK4A 1JG7A 1UMBB 2J6CA 2FN4A 2QYTA 4CEJA 5BOSA 5GVSA 2GPAA 1SU7A 5K0GA 2WG1A 4H59A 1PGOA 3O26A 4JJ6A 2HAEA 1FX1A 5E1MA 5A0FA 5AW0A 2FGKA 4NCIA 2HBQA 5DCYA 2XA9A 4GF5A 1DO2A 3KBBA 1D0IA 3GEDA 4GBED 1WJGA 1V47A 1B00A 2F67A 2ZK7A 3P4XA 4G1VA 4KXYA 2ZDQA 5FA5A 2YC4C 3EXIA 3FPCA 3RRMA 5I51A 2ZJ8A 3WC4A 2PXAA 2QORA 1B6SA 4W5RA 4DG9A 1DNPA 2B1JA 2R68A 4M9XA 3U48A 1K7YA 3CPHA 2QGZA 2OP1A 2FSIA 4IIVA 5TDHA 1FUUA 3VR1A 1E60A 2HBZA 1GITA 4AP9A 1IOZA 4G4JA 2PJDA 2OCKA 3OFNA 4L02A 3L0CA 4NE2A 4G5QA 4LOLA 4U9IS 1SRRA 1V4NA 2FUG1 4KBGA 3GRKA 2QTVB 4GVXA 2VTBA 4JELA 2AEMA 3NP9A 1X39A 1X7HA 1PRYA 3FPGA 4LV6A 4DEVA 3O73A 1QZXA 4N5DA 4YRNA 5JO9A 3JXEA 2PSEA 1RMQA 5G4KB 3QXGA 5IXYA 4Y18A 1T15A 4DEYA 3DZBA 2BGRA 4R9VA 4OGLA 2AW5A 1J39A 1NBME 3A6KA 2RB4A 3EEFA 4YP6A 1HDIA 2BP7B 3PXBA 1YUMA 3CLSC 10MHA 5J4YA 1F2UA 1BE1A 3E9YA 4PCVA 2CLDX 2EBWA 2BFCB 1D0VA 3HG7A 2WUEA 1DP4A 3I09A 3KZXA 5FAXA 4DCMA 1KJJA 2WUGA 3F1KA 3VC2A 1DKMA 2VT2A 3TAXA 4PONA 1GCIA 3ENKA 1YVRA 3EPLA 1OF1A 3PGKA 5DVZA 1YWGO 1Z7WA 2V3VA 3E4DA 4EPVA 3EF1A 1IK6A 1CUGA 4REMA 4NOKA 2V8OA 1ZOOA 5CDTA 9LDBA 4K88A 4F9EA 3WV5A 4XVRA 1LW6E 2XGMA 1Z62A 1FB5A 2GJSA 1AVTA 4FK8A 4K0RA 2AMYA 1NYTA 4JCCA 4JX8A 3B5IA 4UM7A 2VTEA 4DSTA 3GX1A 3JYPA 3PQ6A 4WCFB 3VU1A 4UUNA 1E1YA 1DINA 3OESA 3BIWA 3MOSA 3RFTA 3K6SA 1GUAA 2AEFA 3UW1A 4B3GA 1U3WA 3K2QA 3U3KA 4CWAA 1W25A 5K3FA 3E2IA 4HNUA 3B2NA 3K9WA 4JUIA 3SYTA 1J1ZA 3EVNA 1QP4A 3T7KA 2K7ZA 3AM1A 4XIGS 5IJ9B 2G0TA 3DBHB 1IB6A 3ISTA 5C8XA 5CB4F 5EMMA 3FPSA 1NVMB 2WK1A 1E99A 2NXJA 2XE6A 4R54A 3WY9A 2X9QA 4F3TA 3UA3A 4QRHA 4D9NA 4RZ3A 1TD9A 1KSJA 3L7KA 1N9ZA 2IYUA 2HXGA 3OLVA 1PE0A 4QJBA 2BUCA 1MAVA 5I9MA 3LY8A 3VVBA 5IASA 1T1GA 3A36A 3OM8A 2BEVB 5DXFA 1UK7A 3IIMA 5IMBA 4QREA 3RFUA 4ZI2A 1EFRD 3A14A 3FPHA 4GZMA 4HFJA 3UJPA 5K0ZA 5SZHB 2PWYA 3HDVA 1PSDA 1ZJ5A 3FRJA 4PVDA 3UICA 1JQDA 4IIXA 4KLZA 3QA3E 4MB6A 5LZ7A 3OQNA 2ZB4A 5KU1A 1DDOA 4BO7A 3J81k 5MHTA 2OQIA 3FIUA 3R40A 4M46A 4ZO7A 2HT1A 4KLCA 1DG1G 3U7RA 2JAPA 2ATEA 4ZVVA 3TVYA 3D4BA 3S2SA 2YYAA 5L4NA 4XCVA 1P3JA 4FCVA 3ETGA 3UWKA 3HKCB 2IPXA 1TEXA 3LOQA 1KAGA 1TXGA 1T5SA 2LR0A 1P2DA 5GGXA 3WL6A 3JQPA 3EOBI 3F6RA 1N1GA 2PX2A 4N8DA 5DP1A 4D26A 4L4ZA 4IH4A 1T6NA 3E6AA 1ZGCA 4CDNA 5TXGA 4RJTA 5KYTA 3SEFA 1EFRA 1MIOB 4UHFA 2XD4A 1DAMA 4TWJA 1PS8A 1FYXA 4J0IA 4S2UA 4CZ2A 2G40A 2C83A 1ABFA 2QVZX 4ND8A 4KQHA 3TZEA 1FJXA 3QEMB 4QASA 2GFHA 4EL5A 2GB4A 2D54A 1GQ2A 1YDHA 2GUGA 3B1FA 3CKKA 3AVOA 4QXPA 4DPLA 5IF3A 1XRSB 4Z86A 3UAOA 4MVYA 1UFKA 3FYUA 4HFMA 2OVBA 4Z3KA 4ZZ1A 3IV9A 4KIGA 1YS9A 4X45A 4Z99A 2PNJA 1BKYA 1UBGA 1V48A 4ZCTA 3W4KA 5BVGB 4MV0A 4P7FA 1JPJA 4I4TA 3SZLA 4JNKA 2HCRA 2YY7A 3NIBA 3SLRA 1JKFA 2O3SA 2DQ4A 2B7CA 4IKOA 2LNDA 2MSEB 3P94A 1NVFA 4L6IA 4MAMA 5EZ6B 4YRJA 2FSSA 2HDHA 1GDHA 4UPDA 2NU8B 3MBKA 4AS2A 4ER6A 2E5LB 3V1NA 1BX3A 2NZWA 1JG4A 2QTRA 3IDQA 8ATCA 1SNYA 2CXNA 1LJLA 4E1AA 3E53A 1AK1A 4IXMA 3M9LA 1JEAA 2BTQB 2HSJA 1WP9A 5NULA 1F1JA 1KBOA 2P79A 4JP5A 4AJ9A 1MVOA 2QHXA 3QMWA 2CUKA 1J00A 4BL5A 5BPFA 1AZLA 4MGZR 1TO6A 3N7AA 2JAQA 2Y0EA 1F6DA 2XUPA 4COOA 1BU5A 2FZCA 4DDVA 1C3EA 2D06A 2C3OA 1PL0A 3LWNA 4KYUA 1U5BA 1UMCA 2P4SA 2QIPA 1Y1QA 4ZCSA 1E7WA 3ZDFA 4BV3A 4DV5B 1LSJA 3AHCA 4RZIA 1B74A 2V0NA 3IVXA 2HQRA 2HMUA 3EMDA 2A6PA 4EGJA 2OK8A 2VZEA 4KITB 3H2GA 2NG1A 4Y2JA 2J09A 3EQ8A 3L7JA 1BO6A 5LLDA 5F2KA 1JR3E 3KNZA 3I5UA 2QL9A 2G09A 2A78A 1HZZA 3N2NA 4TV9A 4V0MA 3X2SA 4C0XA 1SUPA 3H42B 2B6NA 4OM7A 2YYZA 4M0UA 2VT6A 3EPKA 1LQTA 5B7PA 4J29A 5FBQB 4C22A 2XDYA 2ZPAA 5F77A 4HVTA 1PJ2A 1QZ3A 1OAKA 3NKLA 1P7ZA 4JVLA 2BGUA 5DH9A 1OWPA 3URMA 1R66A 2HMWA 3GFFA 1QZZA 1V5IA 4UJ5A 1D7OA 1BQ4A 1POXA 4G23A 2WI8A 3PUWA 3NM4A 2Q8NA 3GLIA 3RV3A 3ZZMA 4DARA 5JVDB 3TXYA 4D0SA 3DFKA 4L95C 1B73A 5AJHA 4OLBA 2II6A 3RT1A 4EO7A 2YJZA 4UHHA 2JH3A 4B3BA 3P2OA 2F64A 2ZVDA 2ES4A 2PMBA 4G0OA 4N3CA 2OFFA 1WCYA 5PNTA 3O74A 1EK2A 4B1FA 3TECE 3OQOA 1G5HA 3OPNA 1SC9A 4J0HA 4MB0A 5EVCA 2GWHA 4H9GA 3ZBQA 4PYJA 2BEKA 5H4HA 2D59A 3AUTA 5IT9A 1S2DA 3IQFA 3H0KA 3LFTA 3E3OA 2IYPA 1PKEA 3O2SB 4QDXA 2PANA 3BDVA 4UUOA 5CITA 3MWKA 3ZCPA 2GBIA 3MAJA 1N5IA 3UKOA 3CISA 4EG7A 1GP2A 1V4BA 2CZCA 1PJTA 3IJ5A 2G0AA 1D8AA 3FR7A 3HJNA 1P44A 5EJIA 1U0OC 2AUTA 2PZLA 2LCQA 5DO9A 3VR5H 3G1WA 3COSA 1UKZA 4Q9DA 1ZK0A 3IVGA 2FVYA 4QARA 2NUPA 3SM3A 1OXMA 1P81A 2E4AA 1CUZA 1IXKA 4HD8A 2QVYX 1T4CA 1YZ3A 3NHKA 4A2PA 2X5JO 4BE4A 5KJFA 4D0RA 1ZGGA 1T3ZA 1UC5B 1V7CA 5AKIA 1BA2A 2QJFA 3JAKB 2PX0A 4N5LA 3GLHB 4K03A 3MCVA 4BKUA 1Y3DE 3UJNA 2CNLA 5IM5A 5D8DA 3CRMA 2PX6A 2FK7A 2BR3A 2ZSAA 3AL3A 3B6EA 1XDDA 4IYJA 2QYHA 1A97A 2PZFA 1V9CA 3H9UA 1NMZA 3PC6A 4G65A 1DQSA 3VJLA 1NNUA 2C4NA 2J5XA 3CN9A 3FFWA 3IAM6 4AURA 4C03A 1QPBA 4BMDA 3ZHZA 3Q7PA 2G76A 3G1TA 4E21A 5B6JA 3CRQA 3I0MA 4J3JA 2IPMA 5BYAA 1DRUA 5A5GA 4LS3A 2NU7A 4GM1A 1Z5UA 4G1EB 2JB9A 1CUWA 2GM5A 3R0VA 5I7WA 5ED4A 2DE0X 3RC7A 2Z2JA 1AKVA 3KC2A 4J0CA 4YP0A 5YASA 3JQFC 1E6KA 2FRDC 2LWIA 1SEVA 3DOCA 3HV2A 3KHTA 4G4SP 4L50A 1SUWA 4WERA 3AEQA 3TNYA 4BNDA 1OJ7A 4LAFA 3B70A 4B6RA 2XXAB 4F96A 4UREA 5IP5A 2HIHA 4EFLA 5D01A 4DANA 1OYYA 5CPFA 2IUYA 5KMGA 1T9HA 2AFHE 3M5WA 4FP9A 4KR0A 5EKXA 3WLRA 4HJRA 1M6EX 5JECA 4YRAA 2ZPUA 2VHTA 3K32A 3QKIA 4F56A 3GO4A 4KODA 7ADHA 4LDQA 3K73O 1MABA 5EWMB 1M8PA 1ZJYA 1XR3A 3R6LA 1BD3A 4YRDA 5JH7F 1U3VA 3JWJA 1XX6A 1J2TA 1KVTA 1QBGA 2BM9A 2QR2A 1N2GA 4P33A 5K4GA 3TZKA 1XMPA 3K94A 4ZQCB 3A2MA 2CV0A 1JILA 3FTCA 3RC9A 4F38A 2C84A 1SOUA 4XOUA 3HP4A 4OK6A 4BFVA 3QU2A 5EUMA 1DGQA 3IXMA 5FJJA 4B75A 2YXNA 1IVSA 2D1QA 1QGUA 3O3MB 4MUAA 4JI8B 2W8ZA 4EI9A 4EEXA 3TWOA 4FWIB 3ZCXA 2VEOA 3IOCA 4RQUA 3L6EA 3OBIA 1CZHA 4DQXA 1KDVA 5ER9A 5CPBA 1CU1A 3DAFA 1C2YA 4JL6A 3KXDA 1RE0A 3LUCA 4TTVA 4UVEA 2JCXA 1YJBA 2NTVA 3P52A 5BSVA 3SE0A 1O6CA 1Z25A 1NMQA 2EF0A 2O3UA 4G07A 4TZTA 1TKRA 5H1YA 3SMVA 2IHKA 5JS7A 2WDPA 2EG9A 1GLNA 4WT7A 1CS0A 3PDWA 5AVWA 2AZ4A 2NOAA 3CZMA 2QUHA 2NZ2A 4XEUA 2L19A 1AK2A 2BUAA 3KLNA 2CCGA 3MVEA 4U2CA 3DV0B 5DM2A 4RLSA 1KO1A 1U04A 2PKCA 5LP6C 5KZMB 1OIXA 3EFBA 1QK5A 2QMYA 1PFUA 3D7LA 3DVRX 3B5JA 2XHEA 4RSRA 4DV0B 3K5PA 1OCEA 4HZUA 1II9A 1N5JA 4JNCA 4IEFB 3GJ8A 1TM1E 3FBWA 1QIKA 2V7GA 2YCLA 2G1UA 5ALNA 3ITKA 1WKCA 1W8IA 3STVA 3GDOA 3L1JA 4M0CA 4AJJA 2BM1A 5EJGA 2WM3A 5K0NA 1Z2AA 3HLKA 3DBVO 2H2AA 1W9MA 2J3QA 4MV5A 4JB2A 2X0FA 1T2NA 2XUQA 5EVJA 3ZHBA 3MWDA 4LUCA 2JAUA 3IS3A 5FL3A 2NSYA 1R0YA 4MARA 5BSGA 3NBQA 1VI6A 1EXNA 3ND8A 4I9GA 1GR0A 2IYRA 4XSHA 1ECPA 2ZJBA 1LUAA 3Q3VA 4X95A 5L51A 4MYTA 1GQRA 1ZNWA 3FH0A 4KXVA 2R4QA 3U39A 2IC5A 2ONZA 1GPMA 1PX2A 4BVJA 4RE6A 2IEBA 2I4MA 1ZDMA 1SBTA 3OX3A 3QPCA 5KTNA 5T6BA 3VNSA 3CIOA 2IRWA 2VBFA 3F7NA 4QWMA 3MWJA 3FDJA 4XFKA 3L8MA 3LF1A 4KUEA 1OLUB 1GGMA 4M1TA 1TAQA 4PFSA 2Q4EA 4YI5A 4B7CA 2ZSKA 1OXTA 2JIZD 4MSUA 1F38A 1GT6A 1IHOA 1WD5A 4HNGA 4KQKA 1OY1A 1UKVY 4ZOLF 3VDNB 4FFBA 3H5TA 2WVHA 1UXJA 3JQ7A 2HWKA 1Z17A 2CXQA 3JQ9A 3TLKA 5ALRA 1IHDA 1B3BA 2FZKA 2K5UA 2CXTA 2BFWA 1MA0A 3EAQA 4GZ6A 5KSWB 3JD3A 5AI0A 5I9SA 5TMBA 1HTBA 1T91A 1SQ0A 1XHLA 1YBAA 2P69A 5EWLB 3WGOA 2A9KA 4G2NA 2E9SA 2AXQA 3E8MA 4U7PB 4LKRA 4YBZA 3TW8B 1K68A 1QE0A 4YAEA 3W2FA 4Z8XA 3W9UA 2C03A 4JB0A 3TSOA 3UAVA 3PFFA 4L57A 4QQ8A 1RDFA 2QD3A 4F92B 2WKQA 4MQ6A 3K8ZA 3TSAA 1GVNB 4J9VA 3H0EA 3DF9A 2EBUA 3VHLB 4BUJA 2JIZA 3KOYA 2FMKA 5EXTA 3ZWPA 1FX0A 3ZI4A 3OJ0A 3LT0A 2YDYA 5ALHA 5FV4A 8MHTA 3AX6A 1PFGA 2IU6A 3AR6A 3REOA 5LMCA 2O05A 5AW1A 1NZDA 1D07A 2G5GX 3O8CA 5ITSA 1FJGB 3C6MA 5EN4A 2C07A 2XBLA 3P9CA 4X61A 4XM1A 2IELA 4XUDA 3TUIC 5IT5A 4W5NA 3Q6IA 2R4UA 3TVDA 3SHQA 4C88A 2PR2A 1U9CA 1AS2A 1KS2A 1CQWA 1KY2A 1S8AA 2XGOA 5HQ3B 5ANRB 4LQ4A 2VATA 4GKAA 3CH6A 1FQKA 4GDMA 1EBUA 1SCBA 1Y1KE 3PTAA 1C4KA 2FWRA 2XOKD 2N9UA 4ZCPA 4KAAA 1QHIA 1DXYA 1PGNA 1PV2A 1RPTA 1YQGA 3FCUB 4TM7A 4C4OA 3H5RA 1X1BA 4TTIA 3SBXA 4UOQA 2IL1A 2OILA 3LHSA 1PL7A 2IE0A 3V8VA 4NULA 1BMDA 1YD7A 1RLTA 2DQKA 2AG6A 4EA6A 3E2PA 4M88A 3JQEA 1O89A 1BEEA 1OW3B 3NS7A 3SJBA 5TT1A 4LCBA 3OZSA 1CQJB 4ERNA 5IC5A 3GP5A 4CV2A 3MGAA 3WI7A 1RQGA 3OOYA 1PZGA 4LKOA 1US8B 4TSKA 2DZDA 2QGFA 3NU1A 4O0MA 1CJBA 1U9IC 1ZIDA 5ERGB 5EP2A 5JIBA 3R20A 1KK2A 2R62A 4BZPA 5KOIA 2DPXA 5GAJA 2GPYA 2KBEA 1HR0B 4LZNA 2XUOA 3TIFA 1EWQA 1AG9A 1HTWA 2XOKA 2RE8A 2QAGB 3TD9A 5ELXA 3DE4X 4G2TA 3VC3A 3T3PB 1X7DA 2B7BA 4PWZA 3HP7A 3SZGA 2N46A 4OXXA 1DV2A 3TFOA 5G0VA 4WK2B 3DOHA 4DLXA 1JLRA 3FJ1A 3KZVA 4BMNA 4XVUA 1YDFA 1LSUA 3D2BA 1T36A 2QNRA 4IV8A 4E5UA 1C9NA 5BWOA 3DFIA 1L7PA 1P5ZB 1B14A 4U02A 4Q39A 2C7QA 2EJUA 3WLQA 2JPDA 4KGZA 5DE3A 5CX4A 3CNOA 1LS1A 2OUKA 3HR7A 3PNBA 1W1WA 2UZ4A 2CFOA 4IDQA 2X0NA 1A5ZA 3B3JA 1FBNA 4Y9UA 1U1CA 5AUPB 2BW0A 4B84A 1TE2A 1RC8A 2IEAA 3UJAA 1KJZA 4Z7OB 4P81A 1ORDA 3GNLA 5MN4A 5EIEA 4EO9A 3DSRA 1B7GO 1V6CA 3AF4A 5AQEA 4PPGA 2C2ZA 2OB1A 4IDPA 4BWVA 5MF6A 3V5NA 3ZX4A 1GL9B 3MGBA 4CJXA 3ZDEA 1VL2A 2QTWB 2WWVD 3U7FB 2XIQA 2O2EA 3QXJA 4JCOA 4O4HB 1QOZA 2GD0A 4O08A 1FFEA 2GF0A 3KCNA 1ISJA 2PL3A 1ABEA 1YZQA 5DGDA 1RKXA 2CCKA 3VYRB 1WD7A 5FTKA 3THXB 3GVPA 2YWGA 5DLYA 2WJGA 3NV9A 3C97A 1SM4A 1UDXA 4RHUA 5CD9A 3ZHVA 1E69A 3OJOA 1HE3A 4JOBA 4RZQA 1U8YA 2OZLA 4C0KA 5FBZA 1N32B 4US1R 5DCUA 3IHTA 4EVQA 1E9VA 4XYLA 4EFMA 2R8BA 2R86A 2XRYA 4B5KA 4TS4A 2A58A 4DCGA 1WVGA 5L7TA 1O8CA 1BE0A 5I5GA 3UAWA 3U7QA 4A82A 2XVYA 4DAEA 3SJCA 1Y3AA 2H4ZA 3K72B 3WS7A 1P4AA 5THQA 1T2FA 2AR7A 4TVSA 2NU6B 2BZ0A 1D1PA 1QYWA 2IZ6A 4HO1X 1R9MA 4UUMA 3OPVA 1QG4A 4BIIA 1KDRA 3H2IA 3V1MA 5AKJA 4JBLA 4YJFA 1MP0A 1M2VA 1VLLA 1FYWA 3BICA 5AI5A 4MCIA 1XZMA 3IQDB 5H7XA 1E62A 1QH8B 3E1SA 1KFKB 5BN5B 2PZBA 1NQUA 4R4JA 2N47A 1HDOA 1N2CE 4WVLA 1WP4A 1Z8DA 3G8YA 4ZQHA 3GJ3A 1WB6A 3OX2A 4IH9A 4X1KB 1I13A 1S3SA 2RGWA 2Z9CA 3IURA 4AKHA 1OV6A 1RJ9B 4MVJD 4P8RA 1T5LA 3V6LA 2Q2NA 4ESVA 1KSFX 2V58A 4KPEC 2ZUVA 1V71A 3IESA 2P2DA 1ZU5A 5ALLA 5ISMA 3BFVA 2DFVA 5IZCC 2QG4A 1I30A 3PJRA 2VT3A 3S7TA 3N53A 5F1KA 1JALA 1Z9BA 2R6DA 5HFJA 5JNSA 5BSTA 5IVKA 2HFJA 2HU2A 1KC1A 1V7ZA 3WG9A 2F3SA 1QCZA 2UAGA 1EFPB 4PF1A 2ZAYA 1GA6A 3F49S 3LOUA 3I9OA 3M9WA 4OB8A 5AXBA 3UMVA 3EVCA 1CUAA 1Q0ZA 2VRBA 1I2MA 2D7CA 4XZ3A 621PA 5JWHA 3IP8A 1DEXA 3N2KA 3EWAA 1IVYA 2O7RA 2PRJA 4RPLA 1EFVA 4NMWA 5ESDA 2IY9A 3G2JA 1RYBA 4RADA 3WRXC 2JGKA 2F3QA 2NTYC 2PLWA 2ZW9A 3FPAA 3FUCA 2O8CB 4YJHA 3NCHA 2VP2A 1HE1C 1X0VA 4EJSC 3WSVA 1FOEB 1L8AA 3GF4A 3DCIA 3LWZA 2XUKA 5KINB 3HS3A 1Y3CE 1ACMA 5CDHA 4B9AA 2BKLA 2G77B 3QOXA 4QRIA 5CP8A 3T4UA 3GCXA 3VNQA 4KR2A 5E6RA 5DNAA 2O19A 3ANLA 1YRWA 4JITA 1CV2A 1SC4A 3NZEA 3VPGA 1KQOA 1OYWA 5DLDA 1LZKA 3R9WA 1XZCA 4EI7A 2BFBB 1CLUA 1SOMA 4BPRA 5KHLB 1E0KA 1NPTO 2UYQA 2BFOA 1WMEA 4ZQFA 4ZYYA 1D5WA 5IJ0B 3JAMA 3U6BA 1H6CA 4FU0A 5J47A 1G7SA 1FTYA 1MOSA 2CHUA 3Q1LA 4M0FA 4YWHA 2ZUEA 3L0PA 3IBSA 4EB3A 3QI2A 2AMLA 4UE6A 1XEAA 3ETNA 4F6LA 3NBKA 4FYXA 4QTXA 3BWXA 4S12A 5EZQA 3JX9A 2OAP1 4P08A 2GAIA 3AFMA 2QT0A 5A3VA 1TO2E 3G9QA 2J32A 2E3JA 2X0EA 3TK1A 5BN1A 1K63A 3TIGA 1QHEA 2R7KA 1RZ3A 2HJSA 4LVOA 4ZU1X 3OT1A 3QP9A 5B53A 4NAHA 4UNIA 3VR6D 4P35A 5KHOC 1C3OB 3ZIUA 1I4OA 4ZZ3A 1Y63A 3FB1A 1Y42X 4NIMA 1XQXA 3SHVA 3LUAA 2VPPA 1PV4A 1J1UA 3KPVA 4OB7A 4FC7A 1L5OA 1SH7A 3KSAC 1E2GA 1FFGA 1HOTA 1YR8A 3G7UA 1BQEA 1QANA 2NMVA 2R66A 1CTQA 4L4YA 4U6NA 4EIWA 1Y9JA 4I9NA 5DULA 3QHQA 2CFSA 3DZHA 1JEYA 2M6SA 2RD2A 1I5EA 1PAUA 1G17A 1M10A 3Q12A 2QR3A 5C8YF 4QQNA 4ZVKA 4AKGA 5A4AA 1P2SA 3AJEA 4IDEA 4U9UA 4Y1GA 4QUKA 5FT9A 3VR6A 2PUWA 3EXG2 1K7FB 1U90A 1HE4A 3FHOA 1B3RA 4HAIA 1SA0B 3NLLA 5HDBB 1C9JA 1P4GA 2CWWA 1I3LA 3DLHA 1F20A 4G36A 3KB2A 3M3PA 4LTNA 2E49A 1MDFA 2C4UA 4N9WA 2EFYA 4GSKA 4N48A 2Q2VA 4CF4A 4BQFA 4Y6OA 4NFSA 1YAHA 1A9OA 2MSLA 2JGNA 2ZIWB 3MXOA 3KUDA 4HDRB 2CL5A 5CT8A 5JE8A 2O20A 3GLGA 1V3QE 1A2KC 4TM8A 4LFCB 1GZSA 4G0QA 2XMDA 3ZYCA 2GAOA 3EG9A 3TB4A 4CTKA 3DD1A 3G5UA 5BW8A 3ZQJA 4P82A 5TV2A 4RAQA 3I9KA 4HQNA 2IX9A 4KIFA 4DCPA 3ASYA 1RPJA 2ZTSA 2FY8A 2PMEA 2JLZA 3V2HA 4CXMA 2HHJA 1NVUQ 2PLAA 5C1BA 2C4MA 4MIYA 1ISPA 4KXMA 2J8ZA 1UEXC 4H0CA 3DXZA 4HDAA 4JA2A 3RVLA 4EX6A 1E2KA 1XTJA 1MT3A 3IAAA 1RT9A 5BSWA 4EHKA 3TZBA 3UF0A 2WV7A 2VSFA 4IHKA 1SCQA 1Y8RB 2ZBVA 1RP7A 1QUFA 3KU1A 4M89A 4J75A 3CVVA 2Q41A 5EPOA 4IW3B 3KAJA 2VEDA 1UBMS 4HSGA 5GY7A 4O2AA 3SBEA 3MTIA 3V2GA 5A9RA 4MDEA 1BGVA 3KT6A 3NH6A 4QDJA 1JNYA 4BNUA 3B2EA 4FHDA 4AJ1A 1A8UA 2QJTA 1TD1A 2V03A 5F2EA 5I7OA 4AF8A 2GRJA 2X2EA 4UC0A 3GZNB 4MRMB 4Q4DA 2PUCA 1Z56C 2AKYA 2O48X 1PJBA 3SSOA 3PLRA 1G19A 4N12A 3PFBA 4NICA 2Z3ZA 4HH3C 1UJ6A 2NSDA 3JQAB 4NAUA 4E4YA 1YK1A 3ETDA 1EKXA 4RTMA 2VTDA 2J3LA 2DM6A 2ETVA 5FPQA 2BZSA 3NTVA 1LZLA 3I83A 4CKYA 2PZAA 2W6MA 5DISB 1R6TA 5D84A 2ZJFA 4B4DA 1Z68A 3SEQA 3FNQA 2AC4A 4UNPA 3OHPA 3W1EA 1M6VB 1V5FA 2R751 3WQBA 4CU2A 5JV5A 1TMGE 4BRUA 1AV6A 1YBVA 3ILYA 2TS1A 1PQYA 2A14A 5IDVA 1D4ZA 3W9SA 4OJTA 5LVAA 1XMXA 3IOMA 1U3CA 5DN9A 3D5TA 5KTKA 4UUAA 4EYGA 4JL5A 3RS3A 1B0UA 2I8CA 4FYIA 1WG8A 4BUCA 1M7GA 5ENVA 4PX2A 1FU8A 5C34B 2NUTA 5ARDA 1QR6A 2R1VB 1G8YA 4CKEB 5FA8A 5L95A 2MU1A 4TZ6A 1EGQA 2I4TA 2ZRAA 4C4AA 1PSZA 2WKWA 4IF6A 4AJHA 1LPMA 1LPOA 3ZEIA 4QDZA 3IJEB 3TOVA 3MWYW 1SQ6A 2QN3A 1ND6A 1F2TB 1VLZA 1WOYA 1NY6A 3H8VA 4I1PA 1GHTA 1Q19A 2QQGA 3IUPA 2AS0A 2VDMB 1DEKA 2Y0CA 3B7PA 4G0YA 1M34B 6YASA 3LKDA 1FP1D 2FPKA 2ODPA 4H7EA 3WVNA 3GRAA 4LYYA 1Q0UA 4LFBB 4O1MA 3H1FA 4MRNA 3ITNA 5EESA 1E98A 3NWEA 5JU6A 1NUHA 2R7LA 5HUQA 1QORA 4HJXA 1AKUA 3TO5A 2J0QA 4C0AC 1EFCA 3DMNA 3UJ6A 2JIQA 3ADOA 5G0WA 4CDRA 2PGOA 3AI1A 2N42A 2ZSHA 3WLAA 1Y8QB 1YQDA 5GV7A 4RIGA 3E3NA 3PL5A 3K2EA 2R2AA 1BE8A 2G6TA 1I6LA 1L5MA 2BEJA 3E2MA 3I0ZA 4RPCA 2JI7A 3BUSA 4GICA 2VYQA 3BE4A 2A0FA 1K89A 4R2XA 2PYIA 2HWUA 3MT8A 3TSCA 1ZM4A 4DZTA 2J9GA 3S8YA 1XZPA 5EE5B 4E5NA 1VYTA 3EF0A 2B20A 1ZXLA 3GU3A 1IHXA 2XEXA 3A6EA 3BF8A 3WAJA 5L6LB 3GP8A 3VPAA 5BORA 2PMWB 5FLKA 3UPUA 4GRDA 4YWJA 1YR7A 1QONA 3ZVRA 4EB8A 4YUAA 5A4DA 5HW0A 1T9AA 1H05A 1Q0SA 2PZGA 5J2TB 1TA9A 2B6HA 4BJ1A 2ZJ4A 1UQTA 4QOFA 3AETB 3MJVA 1JDZA 1NP3A 2FAXA 3NOXA 1LBEA 4TN5A 4Y6RA 1JJIA 4Y2UA 4R0MA 3IEMA 4JKOA 5GV8A 2WOOA 4ZO9A 3TQIA 3LUBA 3EHEA 4C6SA 1FY2A 4H7KA 1I32A 1VL1A 2CJYA 2DH5A 3A9TA 3KV1A 4RTNA 3W7BA 3AJ9A 2OEPA 3I6MA 4J3NA 1COZA 4A8JA 1NC3A 1OE0A 1ZI8A 5C8ZA 4Q4CA 2W93A 1UP4A 2CUNA 3RAFC 2BLLA 3ESDA 1N9KA 1Q16A 5JBQA 3Q3IA 1T3GA 3OAAD 3AESA 4LYHA 4LY0A 4BVAA 4CLRB 5KVVA 3ZCRA 2N1MA 4YXWA 4P80A 1T5OA 4DLKA 2IPLA 4LBWA 1M8FA 1M2OB 5FWYA 1FFDA 5C8VA 1VSTA 3TFQA 2QRLA 5KWSA 4RTJA 1IXYA 3OP1A 4I6EA 2B2CA 3PI7A 4X3CA 4AP6A 4NXNB 1Z33A 1U2TA 1VKOA 3WRWA 4BB0A 1WCIA 4LGVA 4NE7A 2HX1A 1JJ7A 1W5BA 3CZ4A 4RABA 5KDDA 1P1BA 1X7YB 3DL2A 1I4WA 3BX1A 3OQBA 4JC8A 3UFXA 2OXRA 4YUXA 1JKMA 1YJ8A 4C2TA 4PBRA 4PHGA 4IOLA 1X1SA 5KNBD 3ZIAD 1JJAA 5JFOA 2BGKA 1FVXA 4RWZA 3V8NA 5K2OA 2FR8A 3LLUA 4KH0A 2QDKA 2FETA 1VSQA 2X41A 4I50F 4LX8A 3QFCA 3UV7A 1TVKA 3KZOA 3AI7A 4OQMA 2GRUA 1H4QA 4LYFA 3OAAA 4HNRA 5JD5A 2HM7A 1EUDB 2FSVC 2JKVA 4AXXA 1RTKA 2GAFA 4K9MA 1E5LA 3BD8A 1N0IA 2Y99A 4QELA 1NNSA 1DIGA 2C2GA 4MVCA 4B3RB 4I1VA 4CQMA 2JFYA 4PTYA 5G4LA 1P2FA 3DVQX 4M0EA 3Q72A 3U31A 4QU5A 3UPTA 2TSYB 5C5CA 2HO5A 4TXNA 3CX8A 3G0BA 4JC5A 3S8EA 1M2HA 1C7IA 3OFKA 2Z9BA 5ECWA 5KNBA 2ZRDA 3NAZA 2PFKA 3NHZA 3RBXA 3ZIAA 4Y1EA 5DHPA 4FLMA 2BKEA 1P9LA 2CJFA 2LIVA 1GM5A 1GUDA 1SY7A 2Z83A 4MWTA 3PE4A 4AJKA 3TSZA 1KK3A 1M3SA 4X93A 3SD7A 6REQA 1FEZA 3WHPA 3W4JA 1PI3A 2ZM6B 1V5GA 3RYHA 3ZU4A 5KVSA 4F8JA 2ATIA 2A0XA 1YRQA 1BOOA 1QHHB 2VRCA 4TKVA 1TM5E 4G37A 2I1WA 1O0BA 4CEHA 3HVJA 2BGWA 3HEBA 2H1VA 4PC2A 1I7LA 1Z12A 2AN1A 3II6X 3LLMA 5I7SA 4HQ6A 3FVVA 2Z58A 1OD6A 3CTMA 4AUKA 3ZDXB 3R7NA 2OBXA 3FROA 2PM8A 3CB4A 3RDPA 4HQ0A 4ALMA 1W48A 5CU7A 4CCSA 5C46F 4O4LA 2BLNA 2GARA 5EUBA 2O2IA 1OZFA 3WDLA 2VCYA 1Z2CA 3OH8A 3A32A 4EQ6B 2QVGA 1NM5C 1YR9A 2RAUA 4IPTA 1Y7LA 3GYBA 4K6CA 1GZ6A 3JARA 3QLEA 2TMKA 5FI1B 5HFNA 4EMBA 5JTTA 5KPDA 4B3SB 2F6RA 5CEJA 3C7DB 3K0BA 4L0QA 3RJMA 3KKLA 4OFZA 4HYEA 1VCOA 4GMFA 2GHQA 5EKUA 2BTOA 2JFBA 4GPEA 4YJDA 1E9RA 3CCCA 3HYTA 5CRIA 3OIUA 1DTSA 1DCMA 1V1MB 2IW3A 4HEQA 5AUQA 4L08A 1I3OA 1PSWA 3JR7A 3TW0A 2ZRGA 4FI3F 5ALYA 1ZI6A 3MBIA 3UH0A 1SELA 5JRZA 2EKQA 1NW3A 4QAQA 3OOJA 3B6JA 4PLHA 3ISJA 2GJKA 1L5RA 2XTZA 4FDTA 4JOCA 3TTWA 2AE1A 4ZEVA 1BCRA 3I4FA 5EMJA 4DC1A 1T8SA 4LC0A 1SPBS 3SZMA 2QJOA 3AFGA 4AJ4A 2E82A 4LY9A 5I7VA 3C7AA 2XVXA 5JT1A 1WHSB 1K5DA 4Z7JA 1E1MA 3B9RA 3GFTA 1SXJB 1Z0KA 1Z7GA 2QN9A 2VBGA 3N58A 3N7TA 4LXYA 1MENA 4OV6B 2NT3A 4ZV7A 1GWNA 4FMDB 1ST3A 3TR0A 1Z26A 2HTEA 4KGXA 5BMVB 1NONA 3P1JA 5FBLB 2AN5A 1VLHA 1MH9A 3DC7A 3LO5A 1A76A 2ORED 3ONNA 1QK4A 1V1RB 4FKBA 4WADA 5CT5A 3B89A 1T4MA 1KZ4A 1IZ7A 1XEWY 1DQZA 3LYUA 4HUJA 2ZSJA 1P4JA 3IBYA 3PDIB 3VYVA 5JRDS 5JSFA 3L4BA 1ODKA 4KIJA 1KEKA 3HK2A 1Z7YA 2VQEB 1W8DA 3AUYA 3TIVA 4ZOCA 2CVOA 2WF9A 4OQPA 4YT4A 4Z1OA 1Z5PA 1P0CA 3GJZA 3N6RA 4KO4S 4DR2B 2NQ8A 1F1BA 3RYTC 3EASA 2C0PA 1HMPA 2XF8A 4R8KA 2QT1A 2DUMA 1L5QA 4ZGBA 1K7EB 5FWNA 4L6AA 4G0NA 4X1YA 4IILA 4LRXA 4HX2A 3WRYA 3I04M 4I5IA 4NCXA 4Z4EA 3HJRA 4QM6A 5E6UA 4O4IA 4I1SA 1TFRA 4ZYLA 1ID8A 4YMUA 3ADBA 3BEOA 5F2OA 1S2OA 1TM4E 4J8PA 1LKZA 1NE7A 4FR5A 3K4QA 4QG3A 1O97C 1Z18A 3V7NA 3AF2A 4QIHA 1LPAB 3KYJB 3JVDA