1ZI8A

Crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
233
structure length
233
Chain Sequence
MLTEGISIQSYDGHTFGALVGSPAKAPAPVIVIAQDIFGVNAFMRETVSWLVDQGYAAVCPDLYARQAPGTALDPQDERQREQAYKLWQAFDMEAGVGDLEAAIRYARHQPYSNGKVGLVGYSLGGALAFLVASKGYVDRAVGYYGVGLEKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANPLLQVHWYEEAGHSFARTGSSGYVASAAALANERTLDFLVPLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxymethylenebutenolidase
publication title Following directed evolution with crystallography: structural changes observed in changing the substrate specificity of dienelactone hydrolase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 82
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.45: Carboxymethylenebutenolidase.
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01738 DLH Dienelactone hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zi8A00
2HDWA 3G9UA 3ZV7A 1E89A 1IMJA 3GZJA 4WFJA 3R3YA 1BEZA 4K5QA 4Q82A 3JWEA 2W6CX 5ALXA 3V1NA 5LIPA 4OUKX 3QH4A 3GFFA 4G8CA 4Y2YA 2ACKA 4FFVA 1YB6A 3OTQA 3HEAA 5AKZA 3C87A 2WKWA 2QT9A 1H2XA 3E0XA 1YS1X 1QFMA 4X85A 3M3DA 4BVKA 3KXPA 4DMFA 3WZLA 3T4UA 1M33A 4X6UA 5FRDA 3DOIA 1EINA 1QJ4A 2WLSA 2JGMA 5JAHA 1MJ5A 2HA7A 4WY8A 4N8EA 4J0GA 1E8DA 2PSDA 3R40A 1BE0A 1XQWA 1RWQA 5E2IA 1BN6A 2G4LA 1LBSA 3C5WP 2VJDA 5AH0A 5EI5A 2VF2A 1XZMA 2FJPA 5IVKA 2QXTA 2WHPB 2R11A 2WU4A 3ED1A 5HF6A 4AXBA 1O6GA 2OGZA 5KWJA 5FLKA 3WKAA 4Y2PA 5LZ4A 5AKXA 1S8OA 2JGIA 4LYDA 1DX4A 2XT0A 1BCRA 1GPLA 1UK6A 3DLTA 4Y2SA 1IUNA 1UOOA 3I2HA 3WK6A 4QNNA 1N5MA 2ONCA 3NOXA 1E8MA 2XUJA 4G4GA 4J7AA 4NS4A 1ODSA 2ZSIA 5AOCA 5JIBA 3DCNA 5ALYA 2C0PA 1TQHA 1B41A 3O0DA 1P0PA 2XMDA 2XQKA 4DTCA 3FBWA 4FNGA 5AKGA 3PUHA 4LXGA 1KU0A 5JALA 3WJ2A 4E15A 1RYYA 4ZREA 2WTMA 4LHEA 1XFDA 3I6YA 4BP8A 3H2IA 2X8BA 1K8QA 3KD2A 2PKYX 4XWGA 1CR6A 3JYHA 1JU4A 1JMYA 2EEPA 1GZ7A 4KACA 2C7BA 3FYTA 1ODTC 2Z3WA 2J3QA 5AKHA 1GPNA 3VKFA 3JW8A 4BZWA 3ZLVA 3BF7A 2XMGA 2D5LA 2WTNA 1ISPA 4NVRA 3DOHA 1P0MA 1XZEA 5AI4A 3QITA 5AKEA 1OCEA 2XMCA 3CN7A 3O4JA 3RK4A 2WILA 2WIJA 5E4YA 3QYJA 2WFZA 4JUIA 2GBCA 1XRLA 2XUHA 1JI3A 5IVIA 1MPXA 2RIPA 4I3FA 5ALTA 3WIOA 2B9VA 1MO2A 5JAOA 3R3UA 3C6XA 3UUFA 3G9ZA 3KOOA 4BC0A 3BJRA 2Y1KA 3IDAA 3I1YA 3E4DA 1UZAA 3ICWA 1QIMA 4XVCA 4UBOA 5CRIA 1YR2A 1N1MA 3FVRA 3IULA 3OG9A 5D6OA 4EHBA 1NU6A 1G4HA 3LCRA 4MQMA 1LLFA 5AI5A 3EIOA 3EQ9A 3WK4A 1H22A 5DYYA 5C7YA 1R50A 1DTEA 2BFNA 4AO8A 2OGSA 4ZV7A 3CCBA 2BCEA 1FFAA 2QR5A 4RGYA 1ODCA 3AFIA 1DT5A 3F67A 3H1BA 3HI4A 4F0JA 4YASA 2H7CA 1JT2A 4ITVA 4X94A 5AI9A 2ZVDA 1AZWA 1A8UA 5BWBA 4OYYA 2XE4A 1SCKA 3FSGA 4MWTA 1GQRA 2XUIA 1XZBA 4DNOA 1U4NA 4GW3A 2RHTA 4C89A 4PSUA 5EIAA 1EX9A 4BE9A 5AKKA 3DNMA 4HVTA 5LZ7A 2JGKA 2QVBA 4D9JA 1ZD5A 2Z8XA 5K3FA 5JAPA 3H2JA 3WWDA 1VZ2A 1DWQA 4BBZA 3LP5A 3DD5A 1MAHA 1YCDA 1AQLA 4M0EA 4OPMA 2WUGA 5IVDA 5EHQA 2PSHA 3H2KA 1FFDA 1XZCA 2VSQA 4UHHA 2QS9A 2JGLA 2XB6A 3EF3A 2ES4A 4WJLA 2Z8ZA 3F98A 2XMBA 2OAEA 2HIHA 2XQIA 2VA9A 4EBBA 5AKIA 3IIIA 4UBIA 4WDRA 1WB5A 2ZYHA 4AN0A 3WK7A 5AM0A 1EHYA 2PU5A 2LIPA 3D0KA 1YAHA 1LGYA 4X97A 2HFJA 2VATA 3FWHA 4EY4A 2Q0XA 3NGMA 3O9VA 2HFKA 3M82A 1R4ZA 4J0IA 4MQLA 1WHSA 5AJHA 5AKJA 5AM5A 1QONA 4BATA 5AIBA 2XUGA 5A7FA 4GI1A 1ZI9A 4V2IA 4QDZA 4ZV9A 2AJBA 3R3XA 2QJRA 1GKKA 1XROA 1Y7HA 2QTBA 2QUAA 3I2JA 4J0CA 1R1DA 5ALZA 4H7EA 4X71A 1MX5A 1QIJA 4FTWA 3IA2A 2PSJA 1HPLA 3AZQA 4JYPA 2OPHA 3DJYA 3R3WA 3D2AA 3RM3A 5C8VA 4UHCA 1CV2A 4ETWA 3PI6A 5ALMA 4H0CA 5LZ5A 2OCKA 4ARAA 3STXA 4F21A 3F97A 4G1FA 3WK5A 5ALDA 4OB7A 4Q3OA 4HTAA 4CI9A 3PICA 5AI8A 1XRNA 2WIFA 2BGNA 4BAUA 3WYNA 3G9XA 1QZ3A 1UWCA 2WUEA 4X90A 5DJ5A 1XLVA 4CG1A 4OYLA 2PUJA 3D2BA 3OC0A 5D3KA 1EB9A 3TRDA 1EVQA 1SC9A 4DNPA 1DWOA 4FLFA 1Z68A 5AK4A 1T2NA 3G8YA 1R9NA 3X3HA 5EIEA 5CURA 2QZPA 4IH4A 5AM1A 4W9RA 3W04A 2DQYA 3K2IA 4PW0A 4EA6A 1EXWA 5ALHA 3I6ZA 2OGTA 1J07A 1OILA 4CIAA 2JF0A 1Q0ZA 3ESCA 3D7RA 4B85A 2GYUA 5AM2A 3DL4A 2G5TA 5HFAA 5HQ3A 4Y7DA 4XIIA 1CUAA 1HKHA 2RONA 3QPAA 3FCXA 3IBTA 3B12A 1VA5A 4NMWA 2AJDA 4J0DA 3A6ZA 2VT6A 3ILSA 5C8ZA 1AUOA 2XMQA 5LYYA 4PSCA 4OCZA 4AO7A 3B3QA 2DCMA 3STYA 3WWOA 1X2BA 4OD0A 4H18A 3DL7A 2PPLA 3C5VA 2X5XA 1THTA 3F9CA 4J03A 2Y2UA 3KWJA 3I2GA 2PL5A 4OU5A 4UFOA 1TAHA 4FDMA 2H7XA 5IH7A 4O08A 1FSSA 2ECFA 3MVEA 1AGYA 1WPXA 2OAGA 1ZJ5A 3ESAA 3WKEA 3O4HA 3WLAA 5DNWA 4QWMA 4C87A 2O7VA 2J4FA 2PU7A 5K3CA 1QOZA 5CMLA 5EFZA 3MUOA 1W52X 5KBYA 2C5FA 3D3NA 2PUHA 2HL6A 3E3AA 5AHXA 2C4HA 4CCYA 4Q34A 4U2CA 1QIFA 4QDOA 2VJBA 1MTZA 1GPKA 1EDBA 1LPNA 1QO9A 2HA5A 2DQZA 2GYWA 3DDUA 5F4ZA 1WCYA 1CRLA 3ICVA 3ZWQA 1QE3A 3V1MA 2YXPX 4U2GA 1H2WA 1G66A 4B83A 4IHAA 2G63A 3SWWA 4BYMA 2QUBA 4UBJA 2HA4A 1ZD4A 4H7DA 4B9EA 2WG0A 4H7IA 1SOMA 5K3BA 5EIHA 3OURA 5KWIA 1DX6A 2ZJFA 5JD6A 4X7BA 2PVSA 4CCWA 1CUYA 2O2HA 2XUQA 1JKMA 5K3FB 4H7FA 3I28A 1AC5A 5DYTA 5SYMA 3ANTA 3VJLA 4N5IX 5EHXA 4UHEA 4B6GA 5HCUA 2XMRA 2DFPA 1CEXA 3TEJA 4UBNA 3UMJA 5I7UA 2Y6VA 1ORWA 5T4FA 4UPDA 4ZGBA 1QIKA 4QLOA 5AOAA 1LPOA 3VXKA 3L1HA 5DNUA 4GEGA 4YK7A 5LP1A 4HS9A 1IVYA 4G4IA 1UK9A 2I3DA 1HLGA 4BCCA 5AOBA 1QGED 1MN6A 3G0IA 3H17A 1UOPA 2GYVA 4Q3KA 5H3HA 3V48A 5JAUA 2BUAA 4C4XA 1X2EA 1CQWA 4CIBA 2BGRA 1G5FA 1O6FA 1VXOA 1U2EA 1JMKC 1LPPA 3AZOA 3PFBA 4WCVA 4KJXA 4X95A 4OB6A 4G8DA 5HF5A 5JD5A 1CUXA 4FFWA 2BKLA 5BOVA 5ALIA 5ISMA 4FBLA 1XZKA 2I78A 2RGUA 5HF9A 4K6HA 2QXUA 1UKCA 3FNBA 3H04A 3FLBA 5FXMA 5JD4A 2CB9A 2PX6A 1ZOIA 2WUFA 1WM1A 4PF1A 1DQYA 4MEBA 3MGAA 1CUVA 2WU3A 3NUZA 3LLCA 4MJ3A 4FLMA 4QE3A 4RPCA 3ESDA 1LPBB 2JEYA 2HRRA 3M83A 1USWA 1W76A 1F0PA 1G42A 1W1IA 2RHWA 2VEOA 3IUJA 2GZSA 4BB0A 4GECA 3S2ZA 4OB8A 5HZGA 5I8PA 5FKJA 1CUUA 3C8DA 5JADA 5ALGA 1DT3A 1YSCA 2V9ZA 1GT6A 1IZ8A 1A88A 3QZUA 4WDQA 3VDXA 4Y2JA 2VJCA 1GKLA 1RP1A 4K6KA 2OXEA 1XQVA 4OSEA 3I6MA 2J4CA 1I6WA 4K6GA 4DMHA 2NW6A 1LPSA 2VQ6A 1VOTA 5CXXA 1XZFA 1BN7A 1L7RA 4ARBA 4L3WA 1CUBA 2W22A 4UHFA 3ZI7A 5HFNA 1DU4A 1ZD2P 5FV4A 3WA7A 3FYUA 4W1RA 1P0IA 5A7GA 5K3EA 1DWPA 2PSEA 1QTRA 5AO9A 1ACJA 2XUDA 2AJ8A 2ZJ6A 4A23A 1ZGBA 5AM3A 1AKNA 4TVKA 3DKRA 4ZRDA 1BCSA 5CXUA 5ALSA 2RI6A 4QWWA 1Y37A 2XUKA 4PV7A 3WKCA 2WFLB 1SCIA 3U1TA 3STTA 1A8QA 4Y2QA 3YASA 1R9MA 2HU7A 4YPVA 4DYHA 1KU6A 2H7YA 3DQZA 1OXMA 4EY8A 2AJLI 2VT7A 4E11A 1VLQA 3WIBA 4U2DA 5ALVA 1QIGA 2XLCA 1H2YA 3BDVA 5IVHA 2ZYRA 4BDTA 5T4BA 2HA6A 3AINA 5FDFA 3C8HA 4B0OA 5EHZA 1VXRA 3L1IA 3LS2A 3CCCA 4B0PA 2WIKA 2AJCA 1PV1A 1TIBA 2GBGA 4HAIA 5AK3A 4J0JA 2WHQA 4ZWNA 1HL7A 2HA0A 4B82A 4P08A 3ZLUA 4X91A 4BCDA 4ROTA 3IURA 3BWXA 5KREA 1MX9A 1ZICA 4X93A 3SC2A 5CH3A 5SYNA 2WHPA 1VZ3A 4Y2RA 1LZLA 2GZRA 3RKSA 4P93A 1JJFA 1ZIXA 2WIDA 4GHWA 4CFSA 1K5PA 1DQZA 3G02A 2EDCA 3PUIA 4BC1A 3A70A 2XUPA 1CUGA 4U2EA 2DHDA 4JYMA 4ZI5A 1TCBA 2FUKA 3WYDA 1U8EA 4KYVA 1PJAA 4B9AA 4QDUA 5LLSA 3CN9A 4N8DA 3G0BA 2WJ4A 2Y2VA 1CLEA 4U2FA 2B4KA 1ETHA 3WJ1A 1UK8A 4C88A 2WUDA 4ZXFA 3A2NA 3IB3A 3ESBA 5BWCA 3BJMA 5ALLA 1CUDA 1XZIA 4AN1A 3VVMA 5A2GA 2PBLA 2FX5A 4L9AA 1F0NA 3QMVA 3H1AA 2QRUA 1VE7A 3AIOA 5ALEA 3HACA 4KE8A 5D3ZA 3G9TA 1XLWA 2DSNA 4RE6A 3G0GA 1N5RA 3C6YA 3HZOA 3OOSA 4BVJA 1CUEA 4HRYA 3LIPA 1U65A 3D59A 3EQ7A 4W1QA 3WWPA 4J0KA 3W2TA 4FOLA 4Q3LA 3Q0TA 3WWCA 4GXNA 4RE5A 3STVA 3PF9A 1WB4A 4X6YA 3RLIA 2V98A 1QLWA 3WL5A 3C45A 4AMZA 1XRPA 2JBWA 3HC7A 4JNCA 1XZAA 4OU4A 5DWDA 2BUBA 4K2AA 1P0QA 4WFKA 2OCLA 2YASA 3BF8A 4AZ0A 5CT4A 4N8SA 5ALUA 1NX9A 1JJIA 1AMNA 5J3JA 3QMWA 3WA6A 1DINA 4FNMA 3N2ZB 3HLKA 4EY5A 1CUZA 1XQYA 3AIKA 1YS2X 1K6EA 2XUAA 2ZYSA 3FYUC 3O9MA 1XRMA 4EY6A 4G9GA 1ZI6A 1ACLA 2CEKA 2XQGA 1MU0A 4IO0A 5FOQA 4DNQA 2ORYA 2XQFA 5HKBA 5CT9A 2IITA 3R3VA 5A71A 3FLAA 2HADA 4PSDA 2E3JA 1XZGA 4GLBA 1BROA 3SX4A 1ORVA 3ZLTA 2CKMA 3QVMA 4LXIA 2QMQA 1MAAA 3V9AA 4QDTA 5EHNA 4MEAA 4Y2UA 1H2ZA 4BVLA 3G0CA 4FHZA 3O95A 4C4ZA 3FAKA 4UFNA 3WL6A 1MT3A 1R88A 1F6WA 3VJMA 2WJ3A 2XI4A 5BV7A 3IVMA 4BDSA 3I2IA 4H7HA 3QMMA 1FJ2A 2B61A 1Q84A 4AB1A 2HA3A 1WPRA 4WFIA 4EZIA 4U2BA 1MNQA 3GBSA 1F8UA 5LZ2A 1W75A 3WL7A 2OCIA 1SFRA 3GROA 4G8BA 5HK8A 4KRYA 1WOMA 5DTJA 4QLAA 2X76A 4BTVA 3R3ZA 2IIVA 5ALNA 4LYEA 4DSAA 4FKBA 5JZBA 4KR0A 3WZMA 1IUOA 4I4CA 1UT6A 1XZDA 1K63A 5JANA 4IH1A 4G4JA 2VTVA 4AO6A 5LZ8A 1R3DA 3HRHA 4QEKA 2GBFA 4BE4A 3AILA 1THGA 3SK0A 1XLUA 3M81A 3V1LA 3CXUA 1UK7A 1KEZA 2WJ6A 1T4MA 3O4GA 2R8BA 2CUTA 4LKOA 4BZZA 1QIDA 3BE8A 5LZ9A 1IUPA 1TKRA 5JYCA 1LPMA 1JJBA 1NU8A 5AKYA 3C6ZA 3VISA 5CTAA 3IUQA 4J0HA 1Q0RA 3GUUA 4KEAA 4DSZA 4B81A 4QZVA 2V96A 3HABA 2ZSHA 3FVTA 5LKRA 3S8YA 2ROQA 2O7RA 5ALJA 1GGVA 4KE6A 1FFCA 5I9IA 3AZPA 4QA9A 4MYDA 5FPQA 1CPYA 5D7BA 4B80A 4XX1A 4H7KA 1XKTA 4S0XA 3PFCA 1A7UA 3FOBA 4C6HA 2OQIA 3BDIA 4Z49A 4GWLA 1ZD3A 4L72A 5DYWA 4BTLA 5FP0A 2I3ZA 1BRTA 4W63A 4X6XA 3H2HA 3AJAA 2HA2A 3HXKA 2CBGA 5AK6A 3EBLA 4F60A 3DKKA 1QIEA 4TGLA 2QOEA 3D5EA 4EY7A 1YAJA 3GA7A 5T4EA 2QM0A 1GXSA 3H18A 2VJAA 2ACEA 4HXFB 3WL8A 3D4LA 4FWBA 2C0QA 5DLPA 3Q8WA 1XZHA 1QFSA 1YB7A 3LIIA 4Q05A 4DM7A 1MNAA 1XZJA 3DYIA 3WMRA 4MXDA 1CUSA 1TCCA 3AUKA 5A6VA 2XUOA 5E4TA 5ALFA 3OPMA 4FLEA 2BJHA 1CUJA 1MX1A 2XDWA 1J2EA 1YASA 3ANSA 2JEZA 4X00A 2V97A 5DTIA 1J1IA 4BRZA 5ALPA 1N8SA 4UBLA 1IZ7A 1TCAA 3OM8A 3PDCA 3STUA 4Q1VA 5AKLA 3QM1A 3GELA 4UHBA 4CG2A 4G5XA 1E8NA 3BL8A 1Y7IA 4AX4A 3BIWA 1W4LA 1E3QA 3C70A 5ALKA 3T52A 2ZJ7A 1SCQA 4UBKA 2HHAA 2GBIA 3I2FA 5CH5A 3H19A 3FLEA 3E1GA 4PO3X 5YASA 4Y9SA 5LKAA 2CMFA 3I1IA 2H1IA 3WQHA 1CQZA 2XMSA 2HU8A 4EB0A 4BAZA 4E46A 1UKBA 4W1PA 1EI9A 4JH0A 1CVLA 1C7IA 2I03A 5CBKA 3MUNA 5AICA 4LXHA 2Y6UA 4TPKA 4HZGA 1VKHA 1CUIA 1FFEA 1J06A 3HSSA 3W9BA 4INZA 3IUNA 4M0MA 4C01A 5HQ3B 2WHRA 5T4HA 5ESRA 2G5PA 1BEEA 3K6KA 3K9BA 3U0VA 4X3CA 1XRQA 3WI7A 4C4YA 4DIUA 1WHTA 1C7JA 5AI6A 1HDEA 3L1JA 3WWEA 2HU5A 1B6GA 4LIPD 1CUHA 2UZ0A 4J3JA 2WG2A 2JGFA 1JFRA 2YYSA 1GQSA 2JGEA 1H23A 4Y2XA 4WY5A 4NZZA 2PSFA 2HRQA 3BIXA 1HBJA 4UFPA 3H0CA 4H7JA 4BAGA 3KSRA 1ZIYA 1Q83A 2XMZA 4AMYA 4UHDA 1LBTA 1TRHA 5ALQA 4HXGA 1UXOA 1EH5A 2WM2A 3VJKA 3R0VA 2EDAA 4KRXA 2BUCA 7YASA 4BRSA 2XLBA 5K3DA 1L7QA 4KAJA 1WB6A 2O2GA 1K4YA 1EDEA 1LZKA 4AQDA 5JASA 4UUQA 2OCGA 3W05A 5CT6A 1EK2A 4H35A 4B84A 2FJ0A 4Y2VA 1YA4A 1XQXA 4HRXA 4N5HX 1QTIA 4CCYB 5HF8A 5FUMA 4DGQA 5JARA 1CUFA 3C43A 4DNFA 4L0CA 3WK8A 4MYSA 1BS9A 3TGLA 2WQZA 4P9NA 1XRRA 3H2GA 4IH9A 2QJWA 2BAGA 4JEIA 2ZYIA 1L7AA 5C8XA 4BCBA 6YASA 2B20A 1CUWA 3EQ8A 3PE6A 4RNCA 1EVEA 3B5EA 2C58A 4GDMA 1E66A 1QIIA 3HJUA 5E4JA 3WK9A 4AZ3A 3FSGD 5FPPA 1HQDA 3WKDA 1XKLA 1AURA 1VA4A 4HXEB 3STWA 4E14A 3AIMA 4P92A 1A8SA 3I2KA 1W6RA 2QKYA 3DEAA 4X92A 1QO7A 2WSLA 4A5SA 5AIAA 2O2IA 4DMCA 3BXPA 3QBJA 4FMPA 5JZ9A 4I19A 2VAVA 3G7NA 5K5EA 5JATA 2Z5GA 4DLNA 4IQ4A 3DS8A 3QPDA 3DYVA 4W1SA 3NWOA 1X70A 2XUFA 4CG3A 3A2LA 3QPCA 5EGNA 1TK3A 2WFMA 2P8SA 3TJMA 2DHCA 3R41A 1ZJ4A 2CJPA 4DMKA 4M0FA 4A16A 5CT8A 1VJ5A 4EUSA 4QDXA 3V1KA 2OQVA 5IKXA 2WG1A 3FCYA 5ALWA 2J3DA 2YH2A 2XQJA 1EK1A 1PFQA 1EA5A 3D2CA 3N0TA 3RARA 5CH8A 4B7ZA 2IX9A 4UBMA 5A62A 1CUCA 1QIHA 2D0DA 1BU8A 3F96A 1CFJA 5AK5A 4H77A 4KE7A 3A2MA 3VVLA 1FFBA 3O4IA 2AXEA 2DHEA 1YA8A 3PF8A 3F8SA 5A7HA 1LPAB 2VAXA 1C4XA 3KWFA 4PNZA 1UOQA 3C6BA 3W9UA 1UKAA 4F5ZA 1CIJA 2WIGA 2DR0A 5AM4A 1AX9A 1UFOA 4YX9A 1VE6A 2OLEA 5C81A 1LNSA 1ZGCA 5CW2A 1ZI8A 3WKBA 5HK9A 4PQEA 4Y2TA 2C5GA 5ALOA 1EDDA 4XJVA 3UUEA 3W06A 2OG1A 4GBGA 4MWSA 2PM8A 3KDAA 5HKAA 1XZLA 4KE9A 1D07A 4G9EA 5DNVA 1EB8A 3HYSA 2WFLA 1JU3A 3P2MA 3G0DA 5CT5A 2K2QB 2H9YA 4KAFA 4KAAA 5K3AA 2JIDA 2RAUA 4BP9A 5ALRA 2Z3ZA 5AP9A 3IUMA 2HM7A 1E5TA 4FBMA 2JGJA 5JZSA 2CZQA 3FYUB 5AI0A 3ZPXA
chains in the Genus database with same CATH superfamily
4DMRA 4XJXA 2QQ0A 4Q1EA 2B30A 4ZVUA 1GPAA 2DX7A 2V4UA 2XYHA 3CW2A 2W4QA 3OUUA 3RB8A 3ZV7A 5LQAA 1O9GA 1E89A 1M6VB 1ML4A 5EWJA 1L5WA 1Z4QA 3B48A 3T4PA 4BIIA 4B2LA 1BOFA 1FFYA 4LWQA 2JA1A 1WDLA 4PRZA 4KNYA 1ST3A 1C0KA 3COVA 2GJ4A 2OUKA 3NASA 4R6XA 2QG4A 3O4FA 1F2UA 4ZQIA 4CQMA 3R3YA 5ADWA 1BRMA 1MIOA 1LK5A 4QU8A 5AJUA 5EXSA 2PUCA 2N46A 1IK4A 1YULA 4MZDA 2QTMA 1DKQA 2X3FA 3NONA 2CKDA 1T4CA 4DCJA 2QE7A 3KEMA 4QT0A 1ZVMA 4V02A 2P5UA 2ZS9A 4Q82A 3OWOA 3PEYA 4LRWA 2W6CX 1QVWA 4UOQA 5ALXA 4B3DA 4CM9D 4FYKA 2XVZA 2G04A 2XKAA 3B82A 3LA8A 3OIYA 3GHHA 3V4RA 5KYWA 3QH4A 3QSYA 2WVGA 3GFFA 5HRCA 1XC7A 3DFZA 1WRBA 4FE7A 4MIKA 1U8ZA 4I1PA 4J1TA 3S5UA 3CNQS 2P27A 5KSPA 1U02A 5BVHA 5JWOA 2N75A 1FBNA 3LV8A 2YL2A 4WCFB 3OTQA 5DHAA 4GKJB 1PJLA 2ZU0C 4JAVC 2HO5A 3G1TA 3HEAA 1OX4A 1A5AB 5AKZA 1U5AA 2WKWA 5L3QA 2Y71A 1PG5A 2ZUCA 1FMJA 3PR1A 4PCLA 1H2XA 1ZRHA 4CMCA 3C74A 1DO8A 3GRPA 1JE0A 4C0SA 1V6SA 2V4ZA 3HN2A 1P9WA 2YWGA 4OP3A 4X85A 4B6QA 4BO8A 4OJNA 2CXPA 5EP4A 3KD3A 3AF2A 4YGXB 3DT9A 4PX5A 2HK8A 2YKGA 2NMVA 1E60A 1TUBB 1UZLA 3WLIA 1NLYA 5FRDA 3SS8A 1Q74A 1QRRA 4M1ZA 1U3TA 1M34E 3JQ7B 1XU4A 2ZW9A 1T9CA 4N7JA 1EINA 1X19A 2B6HA 3HJBA 5E6SA 4C0JA 1YE8A 3QU5A 1L7MA 4N8EA 4QGGA 1GUZA 2QV0A 4J0GA 2NQTA 4BNWA 1A1VA 2QAIA 3IKVA 3KYIB 1PRYA 1XN1A 1CETA 3VH4A 1Q16A 3R40A 3CJRA 1V47A 2C4NA 5DLEA 1BE0A 2J85A 3E1SA 5DTEA 1MBZA 4U63A 2GTIA 1XDSA 1NXSA 1XQWA 3Q3VA 5B58C 5IBRA 2A1TR 1RWQA 2LDXA 3DKVA 2N9UA 4Q00A 1WBDA 1Y9EA 3N0WA 5DYNA 3G5UA 3VR6D 5AH0A 4IHKA 4A8TA 3HVKA 1K7CA 2AEEA 5EI5A 3HDGA 4QBKA 2DULA 4F4JA 1JA9A 3D8HA 2RBGA 1ZG3A 2J87A 2R11A 3HGMA 3K2BA 1H05A 1MB0A 3OVMA 1EP3B 3QLVC 3ME5A 3QXHA 2QQEA 4B74A 5AHKA 1HORA 1O1YA 1SXJD 1N0HA 4MIEA 1NTRA 4AXBA 4DNXA 4DXAA 5LP6F 3V4VB 3ESZA 4DLPA 3GNQA 3MBOA 4RAOA 5D2CA 4AC9A 3Q2OA 3GN2A 3JCZA 2PUWA 3M1YA 4UW9A 3KALA 4WOBA 3PQ3A 1PI3A 4JC4A 4BP3A 3ZDZB 4EQZA 5LZ4A 1YA6A 3N53A 2ASEA 2QVGA 4EUKA 2XT0A 4BUJA 2B1IA 2EJCA 4QBFA 5LQRA 5LMUB 1LUAA 1SURA 1J5EB 1A7JA 1RE1A 2DSTA 3Q3CA 3DLTA 4M86A 3PRJA 4PAGA 4PPQA 1KEKA 2GZHA 1SH7A 2A7XA 3IKMB 1QK5A 4GI5A 4WI1A 2A1UB 4DC0A 2H1LA 2OCYC 1KO8A 1CDZA 3K2EA 5MN5A 4KNVA 3RG2A 4Z51A 5KB3A 3I2HA 4NCXA 1MZVA 2IF0A 3WK6A 4DY6A 1H8HA 2Z2KA 5T5QA 3IBFA 4RZ2A 3V8QA 3KE8A 4JDUA 1CJTC 2W4IA 2ONCA 3EC1A 1PJ8A 1MC1A 1VSVA 3PT9A 1PE0A 2QRVB 3OFKA 1POXA 1E8MA 3DDHA 1JBKA 1ETUA 1PGPA 2WR8A 4MRNA 4BNYA 4C4RA 4RACA 1BXGA 1V3VA 3EASA 2R97A 3FR7A 4KP7A 4JQZA 4Q4AB 5BN1A 3CEJA 1L7VC 2WM8A 5AOCA 2VYNA 3R09A 1E7SA 5IYZA 1E3IA 2NN3C 1TQHA 2H52A 2L69A 3I9MA 4D3SA 3DE1X 3PLAE 1W5EA 4F45A 2ZUEA 2H8GA 2JIPA 3FBWA 4FNGA 4BYGA 3PUHA 4P4SA 4YYZA 4RADA 1ECFA 1KU0A 2NLOA 2BWJA 3M6VA 4R69A 3OLVA 3WJ2A 4V1CA 1XFDA 2ZSKA 4UMVA 2QRZA 2UYOA 5ELMA 3A8TA 1CR1A 4NMMA 2ODWA 3I4CA 4BP8A 2X8BA 1YBMA 4Z1MA 4D25A 5HSGA 2C5HA 4GR4A 3KKEA 1GL3A 2IEIA 3NI2A 4ZTUB 1P45A 3KD2A 3KJGA 4CFYA 1UR5A 3K8ZA 4ZVRA 1KS2A 1C9MA 3OJXA 1G38A 1R5OA 4YJDA 2XRFA 3QOXA 4OOFA 4L6CA 5CIWA 2V5AA 1DEHA 1T1IA 1CR6A 3JYHA 3KKKA 3PUWA 2J3HA 4KLNA 4BBJA 5LR6A 4C22A 1HXHA 4Y2HA 1X77A 4LVUA 3B52X 2NUPB 3BRWD 1E2HA 2BMVA 3VUEA 2QN1A 4MGKR 4RZQA 4DCGA 2ZJZA 4Y18A 3PUVA 1Y89A 1N3YA 1LLUA 2C3UA 3E5RA 1CIVA 4KXLA 5CFRA 4GC9A 1VCMA 1NPDA 3EODA 3PNSA 3LUAA 3TG8A 4BZWA 2WRZA 1YJBA 4GXQA 5JY1A 2O14A 2WTNA 2WE7A 1Z37A 3DXXA 5K4HA 2PA0A 1ISPA 1RXCA 3LW7A 4NVRA 4O4JB 3PA8A 3X1ZA 5AI4A 1BMFD 1WD7A 2QPLA 2XMCA 3EDRA 4LWOA 4B4UA 1PJ4A 3I76A 2WF6A 2WIJA 2G9RA 5E4YA 4JUIA 3BB3A 4GGOA 1TK9A 1Z5ZA 4HGQA 4I1SA 2GBCA 3PD0A 1TA0A 4OATA 4ZD6A 1JI3A 1HE1C 1XVVA 1K7XB 2XSZD 1D2AA 1NMXA 1XQ6A 3LT5A 3H5AA 2J0UB 3GPDG 2ZRLA 3BEDA 3L1UA 1NOJA 3ZXUB 3DDWA 2A9VA 2QTZA 4QJ4A 3ZZ0A 2GVDC 1OE0A 3BMQA 1MO2A 2Q1YA 3KELA 4Y1GA 3RYTC 3R3UA 4F5WA 5BRAA 4XWKA 3GJ0A 3KOOA 1EBUA 1V5GA 5DZSA 1DWUA 4RVOA 2I2FA 4DZRA 1GGHA 1XQ9A 1Z2AA 3QBEA 1MV8A 1GCAA 3I1YA 2WEKA 3QVJA 4YJHB 5I51A 1OB5A 2I9PA 4LY0A 3ZVNA 4GYKA 4HQFA 4QQFA 3WAKA 1KI3A 3EJ6A 3ICWA 1KVSA 4JR1A 3CRQA 3TD6A 4FOPA 3L07A 4AJ9A 1IOVA 2YHAA 3K1AB 1NT4A 2BEVA 5E95A 1N1MA 3A1WA 3HCBA 1Q17A 3LUKA 5DW0A 5E6RA 5FNVF 3RSOA 3FVRA 3OG9A 2RFLA 3JXEA 2PLFA 4YI5A 4F2WA 4MQMA 2WP8J 4PS0A 1LWNA 4QICA 2EU8A 3P97A 5M34A 1X7YA 4WN9A 3VZBA 2XWPA 3OP1A 4RQAA 1N25A 2CLCX 3EIOA 3JTEA 1IU9A 3T5DA 5EQDA 5AMXA 4OF4A 3OEHD 5DYYA 1H66A 4N49A 2HPAA 3ZXXA 5C7YA 1R50A 3PGXA 1SIBE 4R40A 5SYNA 3RVJA 3TW4A 3CKLA 2ZIAA 1N2IA 3ZEIA 4AO8A 3DHWC 5HGJA 2XV1A 2C9OA 4JP2A 1XK7A 2AKEA 5EWLB 4M99A 1SXJC 2BCEA 3PE3A 1C80A 1OI2A 4MYHA 4NE2A 4ZXPA 4W5NA 4B1FA 1M8KA 1NYQA 2OCXA 4KBYA 4JGBA 4C30A 4BE7B 3AFIA 4EJSA 3P7MA 3RT7A 1E94E 1K98A 3OIFA 3NOOA 2XZPA 3OOHA 4ZOCA 4EJ0A 1UKVY 4IDPA 5J2UF 1ZVVA 2F55A 3UATA 1VL5A 4QUDA 5KWVA 3H1BA 1YZUA 5LQKA 1JFLA 3AI1A 2H7CA 4RZUA 4BEWA 4RNDB 1NSTA 1JPUA 4TKUA 5T7BA 5AI9A 3SSOA 2EZ9A 2PQ0A 1N33B 3GZNB 4P6VF 2BM9A 3AM4A 1XA3A 1E7YA 2YZ7A 3AP1A 4BNMA 4D9HA 5LJLA 1VBMA 2P3QA 2QMYA 3JQ8A 4GXRA 3H0KA 4N0EA 1R8QA 3W6PA 1ZISA 1M1XB 721PA 4P3XA 3EAGA 3F6CA 4MVJF 1H0HA 1LDMA 3LQKA 3F8TA 2GKSA 4J91A 2PZ8A 3D6UA 4HRVA 2OXFA 5K05A 3CTPA 1JH8A 3LVFO 3MW8A 5L6MB 2XUIA 4HRAA 4DNOA 2ZWPA 3R7DA 4TLDA 2XE6A 1GNPA 3ZY4A 1SG9A 2FHSA 1Z2PX 1PU2A 2P5SA 4FSDA 2AB0A 4RD3A 3TRJA 3TVTA 2DLDA 3KSDO 1DIGA 1RT9A 1A2KC 3C15C 3I4LA 2GESA 2ZI7A 5T64A 4C89A 3G5MA 4JVOA 1XRSB 2NADA 5CPBA 2BKEA 4EATA 5IBCA 1DXHA 5EIAA 1DCKA 1R8JA 1SHLA 4JCCA 1KZ6A 4CODB 4WOPA 4DG8A 1GQOA 3ZE1B 3ZVRA 4HVTA 5B6IA 3FKQA 5I7AA 5F51A 4N47A 1D3AA 2OD2A 2ODTX 4ZVLA 4PS1A 1ZYUA 1EK5A 1FRZA 1PTJC 2QVBA 2VFAA 2EOAA 2VK4A 1UJ6A 2WD8A 4HGNA 4Q39A 4RKYA 5KJEA 3BXXA 5BV2P 3GVPA 2IWHA 5L8VA 1HEIA 2Q8PA 4Z86A 4GM0A 3D4IA 2IA5A 3FNRA 4KK3A 1H3FA 1KJZA 1VZ2A 4K6OA 2VDRB 5ARCA 4KYUA 3H42B 1DWQA 1TD9A 3M6FA 3OA2A 4BBZA 4E51A 4QUKA 5MDHA 4TSKA 3DD5A 1KGDA 4IXNA 4TTVA 1GV0A 4WBXC 1VPVA 5KHOC 1JF8A 1YCDA 2OKCA 2LWIA 5H16A 1SBYA 1ISGA 4A8JB 3B1VA 4ACBA 5IVDA 5C80A 1QQTA 5AHWA 4ZVNA 1VLJA 5JQGB 3RUFA 5EHQA 2CUNA 2EARA 1XXHB 5DHSA 1FFDA 3T1HB 1XZCA 3B3JA 2H5EA 1Y98A 2MYNA 3UJ3X 3UPUA 5J2UA 3VZDA 2JGLA 2PS3A 4FONA 4CF5A 5BV0A 2HMVA 2XB6A 3EF3A 2ES4A 2W0MA 2VQFB 2WMYA 4LRUA 4QECA 2E55A 3WQQA 2E4ZA 2V4MA 3F98A 3ZE6A 3THYA 1NHGA 2Q2OA 1HTWA 4XQ9A 1VKZA 2PV0A 5LU9A 1Z2CA 2GI4A 1V37A 4LNHA 2HIHA 2I2DA 2XEDA 2VA9A 1G8PA 1KBZA 2XQIA 3NUQA 2AEJA 1SIOA 3C5CA 2JRCA 3HWRA 3PHBE 3GD5A 4YH1A 2OO5A 5AKIA 4G07A 3T7CA 1BXKA 4JLUA 4UBIA 3X1DA 5EJ6A 5KYNA 1WB5A 3WK7A 5JFOA 2O5EA 1KYQA 2YWXA 5AM0A 1VIDA 4BUZA 3SJZA 1IJEA 1YAHA 4V24A 5ADUS 1QRTA 1LB1B 3GLQA 4JX8A 4LJ9A 1LGYA 3GGDA 5KOHB 2XTNA 4WK2B 3ZD6A 1J25A 4TWIA 4X97A 5A9SA 3VPXA 2W5UA 3SZUA 4BWFB 4C2TA 2VATA 4CLHA 3AR3A 4DLZA 2O2ZA 1OD6A 4CBVA 3C8ZA 4YDQA 2J3EA 1SOUA 2CSXA 3S2EA 2VLBA 3S8EA 3P9IA 4U0KA 2Q0XA 2C5BA 3P20A 2VOEA 2C04A 4KIUA 2BEUB 3DXYA 5FUQA 2I2AA 3RAJA 3UW3A 5DCUA 1WHSA 5IDYA 1I30A 2PGOA 4KPEC 3HBFA 3USES 3NKLA 4FMBB 4HJXA 1I0IA 4YDHB 4HLDA 2XUGA 2Z1NA 3DTTA 5A7FA 3AHIA 1MIHA 3GPBA 4GI1A 2GCNA 2IXEA 1ZI9A 4V2IA 3PJGA 7MHTA 1UZUA 2PHZA 2VP0A 3F2VA 2AJBA 3JALA 3HXTA 1NUTA 5B1HA 3TIVA 4BWYA 1V8BA 3AUFA 4D79A 1GKKA 5IXJA 4J43A 5JH7B 1Y7HA 3PX2A 5BWOA 3Q8KA 2OENG 3E6AA 2C8KA 1KXJA 2QN8A 1ZD8A 4EIWA 1DNPA 1TTHA 4G85A 1ZZEA 5FX2A 3AY0A 5IF9A 1F1JA 5BURA 3NB0A 3RSFA 3ENVA 5K99A 1OT3A 3HY3A 3HXMA 4MP8A 5DI9A 3T9FA 1ZK0A 3MCWA 3BSFA 3PPWA 4ZCPA 5AQ1A 1G9XA 1O5IA 3JD0A 1W34A 3FPEA 2OPHA 3ZPXA 3FGPA 3R3WA 4EPWA 3NYIA 2Z5FA 2FMKA 4MGZR 2VN8A 4YAEA 4OSOA 4EP1A 3CEAA 3GLHA 1ULBA 4P35A 3L7BA 4U3JB 1PZGA 5DPMA 3PI6A 3RFTA 5LZ5A 3RKRA 5I7WA 4ARAA 3VAAA 3STXA 5TJHA 4YR9A 3H97A 1PWZA 4Q16A 3F1KA 3F97A 2I7XA 1DIBA 1Q0HA 1AN9A 3L8EA 4NPAA 4E21A 5FWNA 2R6JA 1QPGA 1US8B 4I50F 3NNSA 5I7EA 1N1EA 5KX5B 3AVWA 3LX6A 3BCHA 2WIFA 1H6CA 4ZQHA 3I3SR 3AI2A 2OLKA 4AKEA 1W96A 4P7KA 2XRZA 2Z08A 2HD4A 1T43A 2FDXA 2Y0DA 1Y1KE 1QZ3A 3EVNA 4DCVA 3IUBA 2B1RA 3K0KA 1ZM9A 1E4OA 1E0AA 3NC0C 1P7ZA 1XLVA 2DFTA 3A6KA 5G1PA 2EGUA 2NSYA 2F62A 5TXGA 2JLQA 3VHXA 5JPDA 1JMVA 1M83A 2I1QA 2ZRMA 3QFHA 4MLZA 4WGGA 3NHMA 4JYZA 3TNLA 1TVKA 4Q5IA 4WUVA 4S04A 2XCIA 2AOUB 2OZEA 4U5QA 3CB4A 3M4YA 4O2BF 4D46A 5KSWB 2NYAA 2PLNA 1ZY2A 3HDJA 1Z0DA 4OI4A 3NYQA 1RPNA 1HLDA 1WUTA 5HKLA 2JIZD 3NU1A 1SUDA 1WCIA 4TZTA 5LOVF 1YKGA 1CJSA 3IXMA 3LDUA 2XOKD 4FLFA 2EGHA 1K2WA 4M7WA 5AK4A 1T2NA 2IT1A 3CT6A 5EYPB 3TSAA 3VC1A 3AL0C 3GCGA 1M3SA 4KRGA 4BNZA 3FJOA 2I4OA 5C37A 2HCRA 1TIPA 1Z8FA 5FFNA 2XCQA 3ZW9A 1M5RA 3FIUA 5AVRA 5FL7D 4CDNA 1T5HX 4GOOD 1WUHS 1V8DA 1CQJB 2IUTA 4OY3A 1QZZA 3W04A 4AP6A 3T15A 2JCBA 4RANA 3K2IA 4MVJM 3GLIE 2YOFA 3MJSA 3F3YA 3AI3A 1DUVG 3KPVA 1QCCA 3ICEA 3B1JA 2R1TA 1VCHA 2ZVQX 4E1BA 4KQEA 2QJOA 4XR9A 2PX5A 3JQFA 3OHPA 4R5MA 3VH2A 2E89A 1J9EA 3R6LA 4MGIR 3HUEA 4DE5A 2OFOA 2JF0A 1YZ3A 3E7FA 3RFFA 4WASA 3ESCA 3KQVA 4BKUA 1PJBA 1T8YA 4C29A 4B85A 1SCNE 3HY4A 3DOFA 3TLGB 2QT1A 2V65A 3LVBA 4R6WA 3PEUA 3TNFA 2D2XA 3AUYA 4Y6LA 1IXKA 1EE9A 1E2PA 1QV7A 2VUTA 4KLCA 3B7PA 1U3GA 2PZMA 4PFKA 3OFVA 4R8MA 5D7NA 3EPLA 1RCUA 2I5PO 2ZPTX 3EZ9A 3ANXA 4Q21A 4B4VA 5HRAA 4UASA 3F78A 3P0EA 4I50A 5LA6B 1CVRA 4ALNA 1GFIA 4XIIA 1W19A 4DV0B 1G9SA 4CKCA 1RR6A 4AF8A 1SCBA 3HCAA 3MWLA 2XNSA 1QU3A 1B0ZA 3MF4A 1AGRA 4ZC1A 1GG5A 3IBTA 3VSAA 1Q50A 4ZT7A 5EOVA 2JDID 3LNCA 3DQPA 3TAUA 2IUFA 5C53B 4LYAA 4ARZB 2P6MA 1HKUA 2AJDA 3EG5A 3KB2A 5FBVB 4JXKA 1ZN9A 4J0DA 1NNSA 1CRQA 1UFRA 4JNKA 1CCWA 2VT6A 5KQRA 4YJGB 1IZ9A 1CY6A 1GNSA 5BPFA 1LX7A 4PSCA 1WOYA 4OCZA 3EPKA 1WXDA 4NJEA 3T3EA 4GFDA 4AO7A 4AF7A 3OHMA 2F3QA 2JD0A 3AY6A 3B3QA 4O2BA 1OI7A 4RDIA 2GXAA 1ADFA 3ZE8A 2I1VB 2HXYA 1XEXA 2IS6A 1NUQA 2C3YA 3CLSC 4DRXA 4F96A 1W73A 2P4HX 2ZWAA 3BGSA 3VTFA 3IT2A 3F9CA 4HLUC 2Q7DA 4UPEA 1CWUA 4J03A 4OQFA 5KNLA 4HGPA 4KFRA 4RF5A 1GAEO 4F2DA 1X7XA 4B6FA 5G3ZA 3QG1A 3TSCA 4QRHA 1TZ2A 4UOEA 2Q6IA 4L3VA 3MMPA 3M9LA 2J67A 1KP3A 1OBCA 4OP1A 4UFOA 1AGNA 1TUGA 2DVMA 1N9GB 5E38A 2BRUC 3IOYA 4LC1A 3RRYA 3GGSA 3ZUGA 1TAHA 1BGVA 4EH1A 1EAMA 2AE2A 1OX5A 3KOUA 4B6PA 2C9ZA 4DCPA 3QRWA 3NBXX 1UP7A 4XGQA 1IN6A 3BWCA 3IAM1 3SFZA 4MVXA 4AT1A 4FDTA 4GSLA 4UMFA 1FSSA 4URHA 5IH7A 1L5LA 5JNTA 2NU6B 3GRVA 3IJ5A 3MVEA 1AQYA 1FMFA 1GTSA 2X40A 2V6BA 3A3PA 3AMVA 5I4BA 3QLJA 3VBEA 3W2GA 2I4MA 4AUMA 1V1MB 3UTDA 1R15A 5E8RA 3AU8A 1IC6A 1USKA 4Q93A 1A9OA 2EFEB 4PFJA 1L2TA 1UC9A 4QYWA 121PA 2XWBF 3CX3A 4QWMA 2I2XB 2NUTA 1ICIA 5I48A 2O7VA 2J4FA 2RHHA 3K5WA 3H1PA 2NZWA 3E1KA 3IQXA 4KI0A 4KQMA 3QBTA 4U1RA 2RCYA 1ZW6A 4D9FA 4BQIA 1LKZA 6Q21A 2O8EA 3PITA 3DP7A 5EFZA 5HE9A 2NP6A 2JZNA 3MUOA 3KT3A 4REQB 5CFLA 4C14A 5KBYA 3N2IA 2IOYA 2ACWA 3WNVA 1DELA 2M9MA 1NMSA 2P8JA 2QRHA 1TTPB 3E3AA 5AHXA 1OLSB 2C4HA 2H2GA 3QHAA 4IXMA 1X9GA 2PD4A 1GZ3A 4P7JA 4CCYA 3T3OA 2OV4A 3DF9A 3UGJA 4YDSA 3I04M 4EKNB 1E1RD 3N7UA 2GHRA 3UKOA 4YPFA 4OLAA 1LFAA 2GKGA 2XJ9A 1M8JA 2X2PA 1KDYA 5IZ4A 3LH5A 3FDZA 1NUAA 2VH5R 3DDUA 2BE9A 2Z9DA 3PEFA 1KSGA 2CV2A 4XQGA 1U0TA 3BORA 2OA0A 4BKRA 5DM2A 4ZAFA 1GRQA 3KWLA 1P2FA 2ZRGA 4YREA 5L3SA 1W35A 3IP8A 4HXYA 3QE9Y 2VQEB 2F59A 4MW6A 1W0KD 1WW8A 1B0PA 1GUAA 4B83A 3GAFA 3SLKA 5C5DA 1UFVA 3PTZA 2VHEA 1Q7GA 1EM6A 5F78A 1ZUIA 1WO8A 2HA4A 2HPVA 5GONF 3T3GA 3OCYA 2O9JA 1WP4A 3PX7A 4F6CA 5K8IA 1GV1A 4IQ0A 4LV5B 2AG0A 2RGWA 1IWBB 1V9LA 3PGA1 2DBZA 1L8XA 3I45A 4II2A 4D4MA 3ZQKA 3QHPA 5K3BA 4ZDKA 3MRSA 3C3CA 2CXTA 2BFAA 3OURA 2H0QA 3LUHA 1DX6A 1PJZA 2ZJFA 4PCUA 3EMDA 5AJWA 5H02A 3CIFA 1G8JA 1CUYA 2XUQA 1CQXA 4ITRC 1I4WA 2VYFA 3II6X 4IZ6A 4EA8A 4XEHA 2Q9BA 3GFVA 5FO1A 1JFFA 1I3MA 2AG8A 4PBRA 4CI9A 1AC5A 1YQQA 2P9QA 4OGWA 5DYTA 3T94A 3VR2A 1HT0A 5D3QA 5A3VA 4YRJA 3N6RA 3BIFA 4N5IX 5EIBD 2BMEA 1KI6B 4A27A 5EHXA 2LP4Y 1RIIA 2D59A 2HZ7A 2R25B 2WV7A 3H11B 4YMHA 1M2VA 5HCUA 5K4AA 3WBKA 1JEOA 5SZJA 4JQCA 4GU5A 1U5BB 2XBLA 1CERA 5DXAA 3HU3A 2R9VA 4V0NA 4PVCA 1ONBA 1EVJA 1WX1A 5LMCA 4NCKA 4JU8A 3OJFA 1GFZA 1NAIA 4B3IA 2NU9A 3UMJA 3B9PA 3UA3A 1QIKA 1WUYA 2QMZA 1LPOA 3H5LA 4QLOA 3K1JA 1Z15A 3PJEA 3VXKA 4FEEA 4P5DA 2EZ8A 4YK7A 1DOAA 3MGGA 4ALLA 4CQJA 1E2IA 3NH6A 1RADA 1GCUA 5CDTA 1ZUD1 2EJTA 2I4LA 3BSYA 4EW6A 1I7DA 2HRCA 4R1MA 1UK9A 3K15A 4HI0E 1EVYA 4QVKA 1E1CA 3RBXA 1TEHA 4BMVA 1GEGA 4WBNB 1AG9A 4D8WA 1QGED 2HWXA 2I33A 1JQBA 4EABA 3DKIA 4M0DA 3VYSB 4P7FA 2QG6A 3BKXA 4RIFA 2CD9A 1UOPA 3U6BA 1QZXA 1PBNA 4LHYA 4D3ZA 2GYVA 4S12A 4I9HA 4B3RB 3RSCA 3V48A 1AS2A 2PXHA 1JEQA 1MLDA 3FSEA 3QFFA 4DDKA 3Q8MA 4C4XA 1V7PC 1CQWA 3C4QA 3MWEB 5E9QA 3BREA 4G0NA 5BW8A 4CIBA 5KKCA 1UBGA 5G0UA 1ECJA 3D8TA 3TOXA 2OP0A 4D8VA 5DHPA 1YFZA 2Y3IA 1WDTA 3Q3GE 5D1HA 5LJIA 1L8LA 1ISFA 1U2EA 4TKVB 5SYAA 4EY3A 3B70A 3PFBA 4FX2A 5KTNA 4DR4B 2DHRA 5EL0A 1WCWA 2ONKA 1U8CB 3GEDA 1CUXA 1VGRA 3B6KA 5M7EA 2C2HA 5IN5A 4AIRA 3QYPA 4CR6A 2JJ8A 4Q3DA 3H05A 2C2YA 4M9CA 3AFGA 1E3WB 1H94A 1ZHFA 2PRZA 3JQRA 2OFWA 4J49A 4RULA 3TS1A 1T9AA 1V4VA 2GF0A 3K2QA 4TRRA 4DSTA 5K0BA 1E3DA 2O07A 1G0OA 2FZVA 3JVEA 5BT8A 3JAMA 3DDZX 1KVTA 2M6LA 1YDMA 4V1CI 1QHIA 2AFHB 3M5WA 2A6PA 3LM8A 3RFUA 3LT2A 3VU9A 3FSJX 4MZXA 2DBQA 2XUZA 5DDIP 4BWGA 1JHXA 1FRFS 3OEWA 3HZZA 4ZT4A 5THQA 4BVFA 1Z74A 3IBSA 1VGQA 3FLBA 1CXZA 3IBYA 1J2TA 1VE3A 3NALA 4ZARA 4HUQA 1QR6A 2O1XA 4FK8A 4WXRA 5AJTA 4IKOA 2G5CA 3V8NA 5JD4A 5G4KA 1H6DA 3RAEC 5C2JB 1QYXA 2WUFA 2B21A 2RMKA 3CSDA 2TMDA 1RJGA 1QG6A 4PF1A 4RK6A 4WNCA 3IEPA 2XTAA 5TF4A 3B9RA 3FBGA 4FSHA 1JIQA 1WF6A 3MGAA 5KCMA 4D4LA 1N6KA 4DB4A 1KP2A 1P1IA 4WZ6A 4FFLA 1KE1A 3FGNA 3FTCA 2R00A 1ZNWA 4NPCA 3V9PA 1Y0BA 2I8CA 4QE3A 4RPCA 4BX2A 1GSIA 4LOIA 5P8WA 5MF6A 2QF7A 5GM2A 3A0UA 2FQWA 3EEBA 4BFTA 4BBAA 4RTPA 1N34B 4Z9AA 1ZUWA 5FA8A 3FCAA 3FOFC 5H3LA 1USWA 4ZV4A 4URUR 1RQPA 1PAUA 1G42A 4WN3A 4XCXA 1E2QA 1FQKA 4WLOA 1SY7A 3LCJA 5J2TB 5AVWA 3OZEA 1GITA 1YGPA 2COUA 3GDGA 3H5VA 4RCZA 1MW8X 5IT0A 2GJSA 4DPMA 3MJ4A 3W5BA 1WUIS 5C34B 2ZS7A 3C5EA 2VWPA 4F91B 1GGEA 4HGYA 5L7WA 1QU2A 2GEJA 4O2LA 2L42A 3ORYA 1I36A 2CVQA 4ZYUA 2OSBA 1MEJA 1YJCA 4NS1A 4PONA 1TLFA 4JI6B 4NBVA 2O06A 3SZ3A 1LXCA 5JADA 4R5HA 1A4RA 4P54A 5G41A 2DKFA 3UMGA 5JEDA 1Z6GA 1P8AA 1L4YA 2PT7A 5KJ6A 2OYRA 1KQGA 4ZALA 4FYJA 4WDQA 5BQFA 2J08A 3H1GA 1E7WA 3B8EA 2HJWA 2Z04A 4YAIA 4QM7A 1V45E 1RP1A 1QH0A 5FJJA 4UNQA 4PANA 2F00A 4K6GA 2YXDA 4MKIA 1DO0A 2JFBA 1RE0A 3VPSA 3WSVA 4Z4GA 1W47A 2PT6A 5LM3A 3HN7A 3ZUPA 1Z8DA 2H16A 3OZDA 5K20A 2HYIC 1GADO 3R7BA 1DAGA 3ER8A 3OZRA 1L7RA 2IXFA 3S68A 3DTVB 4QYTA 2ID8A 1FBTA 2PO5A 2PA3A 4GSKA 2ZIVB 1QNFA 3CZ5A 3FB1A 1VMIA 3EIXA 3U17A 4IICA 3ASZA 2ZI5A 1V26A 2BFFB 4Z3OA 3WA7A 2DRIA 4R9UC 3VX4A 3DHYA 1LC3A 2OECA 4W1RA 1P0IA 3CUKA 1GU0A 2XVAA 1CTQA 5HBGA 1DWPA 3G2PA 3ND7A 5AW3A 3EIQA 2ODAA 5BOSB 4HB0A 5TPWA 2BMJA 1UAGA 2W2LD 3SY8A 4LWPA 4E3WA 2I67A 1ACJA 2AV6A 4AJ1A 1T3HA 4LNUA 2HT1A 3FDXA 2QW0X 4G8JA 5BO5A 1KJWA 3SS7X 2Y0BA 2CFSA 4BKMA 1MX3A 5HOQA 3CLTD 4QFDA 2HNKA 4YCDA 3E7DA 1IUKA 2Y1OA 2CL7X 5AM3A 1KC1A 2FR1A 1KYYA 4TVKA 5BUSA 4WJZA 3ZKAA 4QGAA 5KTYA 2XZOA 1GDTA 3WLSA 3B78A 2V8BA 5ALSA 4AY6A 4JEMA 2G5GX 2RI6A 4ETMA 3E82A 3AOEC 1FIUA 2Q9UA 5KYYB 4GZMA 2Z0MA 4KPFC 1J5XA 1Y9ZA 3SSNA 1SRRA 2HU2A 3MD0A 4BN0A 1XNJA 2O2YA 1DAPA 1SVMA 2AN5A 4LN1A 4RL4A 5ERYA 5T3YA 4DGSA 4DV3B 2BF7A 3RUCA 2WFLB 4C7JA 2JLCA 3AO0B 1P3Y1 4ENUA 1DRVA 3U1TA 3DBRB 2Q2VA 1EVIA 1L4UA 1ESZA 1I5EA 1REQB 2PH5A 2XWQA 1R9MA 2ZIUB 4Y2QA 2VDLB 1DBQA 4UPVA 3WBFA 4F1KA 3STHA 3VR6H 2H1SA 4YPVA 3KLBA 4HGZA 4IRUB 4LFBB 1KTVA 1LEHA 2GZMA 4MV6A 4RPHA 2EF1A 4LHXA 4LE1A 3W77A 3NWEA 1LRKA 3U3KA 2HLPA 1HFEL 2IHBA 2KS6A 2YY7A 3GY0A 1RRKA 4OAOA 4YVFA 2DB3A 5H70A 1R6TA 3CTMA 5K2MA 1LNZA 4RHEA 1Z62A 3VU8A 1I3CA 3UK2A 4E11A 2FWJA 3RU7A 1VLQA 4E31A 4I4NA 3I5XA 1ID1A 4MHSA 3WIBA 5BNWA 3OKAA 4AQYB 5FADA 4OX9B 2J3MA 1ZIOA 2EWVA 3BTOA 4LZPA 4XYMA 1H2YA 1ODKA 4WLUA 5A4AA 5IVHA 1H2FA 3U81A 1VYVA 1XJQA 1J49A 2I55A 4JYBA 5JT1A 4AY2A 3QKRA 5EWJB 1Z39A 3ABIA 5T4BA 4DJ5X 3AINA 5JSZA 1C3EA 4L5AA 5ARBA 2ZUBA 4QPDA 1F5NA 1Z06A 1OPRA 3C1OA 3EX7C 4EO4A 3RU3A 4B0OA 1VXRA 3QLUC 3EFHA 3ANYB 4CQMB 1F2UB 3NC1C 2GERA 4OIFA 2AJCA 1PV1A 1VG9B 2FF7A 1MIOB 2ID4A 1ZMTA 2NXNA 3I5UA 4HAUA 1KWKA 4EVSA 2GCIA 3PCRB 4JP5A 4QOFA 4XGIA 4IGKA 5G1NA 4I3HA 3TZHA 1G1MA 1GU1A 2PTGA 2JAWA 3CLRD 4OQQA 5A4DA 2C9CA 4RJLA 1HZZC 3FPSA 1UFQA 1R16A 1MR3F 3PFIA 1UMBA 1T4CB 3T5GA 3B20A 3UJ6A 4Z4IA 2JFVA 3SKYA 1SKUA 3IURA 3U7QA 3MTQA 3MS2A 1ONOA 4BNDA 2P9HA 5CVDA 1NBAA 3SC2A 3CZCA 5KYWB 2PH7A 2HSEA 1B26A 3A3KA 3IT1A 2YYYA 4FJ0A 1YQWA 4RJ2A 3U2QA 4NOMA 3W1VA 4BMOB 5BVHB 2QROA 4W5JA 1AVTA 4LTDA 4PZZA 4P93A 1M34A 1YVEI 2C92A 4GHWA 2QMEA 3GN1A 1L8QA 3HDHA 5DO9A 2GS9A 3GMTA 4RAQA 1K5PA 4ZYLA 2YICA 1DQZA 2UZ3A 2I87A 3OD1A 4QAQA 3IESA 2D6FA 4IIGA 1GGMA 2R8EA 5FBWB 3RTBA 5C5CA 5JDIA 4BC1A 3QEBZ 2X15A 4JN6B 1N77A 1NUSA 1X1QA 2QGZA 2VNKA 3FMIA 3WDKA 2XUPA 2WJGA 1HETA 1C7FA 2FUKA 3UXEA 1Y3CE 1V43A 3WYDA 1EFPB 3GJXC 1JNYA 4ZAXA 4HS4A 1JLKA 4EVQA 6AT1A 4H08A 2B25A 3TQFA 4ML3A 3ETHA 2MYTA 1PJAA 1QAMA 2FYTA 4Z0NA 2GA9A 3P2IA 1V8FA 2F3RA 3EXAA 4B9AA 1XAIA 5K2OA 2JW5A 3FETA 2HCTA 3HB7A 4AG6A 5FUXA 4FJ2A 4QDUA 3VMFA 3E61A 1YB1A 2RGAA 4M1OA 3UGTA 3A6DA 4AUKA 4IX9A 3AFHA 4N8DA 5E6SB 2H2HA 2GVNA 1CLEA 3D1JA 3B7GA 1XMSA 5CW1A 4YUXA 4TYMA 2A5JA 1TQ2A 1TU0A 1UK8A 2E21A 2QIPA 3JX9A 2H2FA 1B76A 1XA4A 2DUWA 2FW6A 2VIIA 4URFA 1GN8A 3H6HA 3LF2A 3TLCA 4UVHA 4FEGA 2WLTA 4BP1A 1EWVA 2ZDQA 2F8LA 4O3FA 1Y8RA 4HLCA 3WHPA 3ZLJA 4QHTA 4Z4QA 3IB3A 4UCFA 2BZGA 2B6NA 3ESBA 1RLMA 2REQA 4GMKA 2HZBA 1GA1A 3L40A 1D6NA 3ESQA 3F6BX 5ALLA 2V0CA 4CDMA 5JC8A 5JCJA 4M60A 1XZIA 3U3RA 4F4FA 3BX1A 1PJSA 2Q5IA 4OBBA 4Q48A 4MW2A 3VZSA 1DAOA 1P4HA 5ECGC 2JLUA 4HPJB 3GIWA 3UN1A 1NQWA 1NVMB 9ATCA 1FYXA 2PBLA 4GVLA 3Q72A 1K0FA 3QXJA 4HGOA 4LYYA 3C7TA 2WAXA 2G25A 3VYWA 2PNFA 3RS4A 5K45A 3D6NB 3CLTC 2Z6QA 1F2VA 3FWNA 5IABA 5KC9A 1K8RA 1UP6A 4XQ0A 1UPTA 4HEQA 5LUAA 3R6TA 1ZU4A 1QH1A 3T7SA 5KNDD 4R2LA 1V8OA 4KE8A 3KJEA 4U6SA 4D92A 3ZHRA 5EJ8A 4NBTA 1FDTA 2XYPA 3MIIA 2E7ZA 2ZATA 1WUJS 3G9TA 4UVEA 2FOIA 5HIIA 3ZV6A 1KZ7B 2VOJA 2V6JA 4DLVA 4NEGA 2XBUA 3WGHA 3HCRA 3BFPA 3ND9A 3QKTA 2OHHA 5H0IA 3TECE 3C6YA 3ZZMA 3KZNA 5I45A 1FNMA 1UP4A 4Y0NA 4C0XA 3ZEAA 3ZGOA 3DVQX 4HFMA 1ZJWA 2SHKA 2JCXA 4HQ0A 1FPMA 3LDAA 4ZGWA 3EQ7A 2IYAA 2RE8A 2JIRA 2WWYA 3WWPA 1FFXA 2PO7A 5KINB 2ZREA 1BXGB 2ZFUA 2AKYA 3G3EA 4OKSA 5A5EA 3HBNA 2G0NA 4BMZA 3IPCA 1RBMA 5BSTA 4AJ2A 4MGYR 4Q3LA 5KVVA 4R68A 1SU7A 4BFZA 2E6KA 3G59A 5EPUA 4QOHA 3MGKA 3HDVA 4KXYA 2R8ZA 3UT0A 2P67A 2OFPA 4RXUA 8ATCA 3STVA 2HHJA 2HK9A 4FZJA 3HCDA 2W00A 4HNAA 1F06A 1ZK1A 1HDIA 3IXLA 4LSZA 4P4SB 4X6YA 4B31A 4ZMBA 2YN0A 3CISA 1BU5A 2AFVA 4JODA 4V1CB 4OI1A 3TTSA 3TCKA 3HVJA 2YJGA 3WL5A 5C4MA 1SU8A 5JS8A 3ECSA 2V7XA 2H5LA 1XRPA 2OOSA 3LC1O 5FEUA 1FU8A 4JNCA 1DGQA 4KWTA 1QCDA 4OU4A 1OTYA 3L77A 2XDYA 3A58B 2DY1A 4K2AA 2W2TA 2QXYA 1A9YA 1D8AA 1P0QA 2XAUA 1UQRA 3PFHA 1L7OA 3BF8A 5SY9A 4MULA 3KP1A 1CSEE 1SWVA 3F0TA 3C3PA 3PWKA 5A2QA 4Z53A 4B45A 1V3QE 4KDFA 5JISA 2VDMB 4F6RA 1E1DA 4LY3A 2PBZA 3FOCA 4K9LA 3DAFA 3WA6A 3GCZA 1DINA 3S1SA 1NNEA 2AZ4A 2Q1WA 2Q4DA 3EXEA 2H9AA 2BHLA 4XA8A 2GB4A 3HLKA 4EY5A 3IBCA 4DCTA 3KR1A 2UV8A 2JAOA 3NKVA 1CEQA 4LJ5A 1RJFA 4LHZA 1OGYA 5EG5A 4UTVA 1E0KA 4Z8YA 2XUAA 2OTCA 3TGPA 4HH3C 4LRYA 3O9MA 4NU5A 4LDNA 3BCUA 4JQSA 3PVSA 3ZHSA 1NY5A 2NZUG 1CY4A 1MT0A 3DXFA 3ELUA 3F47A 3GT3A 4NG4A 4TQUS 1Y6QA 4BV2A 4IMPA 4EPXA 2LGJA 1ACLA 2CEKA 3MB5A 2XQGA 4PG5A 1RLJA 1UADA 2FPWA 2JFZA 2PH1A 2VP3A 3BGIA 1O4VA 4ZVVA 5FOQA 4JGIA 5BMVF 5H4HA 4MRVA 4G5HA 3EDCA 2RGBA 2GN2A 1SPBS 2GPTA 1NDUA 4C3UA 1BXRA 1YZFA 5A71A 3FLAA 5EP2A 1JBQA 1WZUA 3BXEA 3FD8A 3IUYA 3OPXA 4IZIA 2E3JA 4J9VA 4JUAA 4JJEA 1KEUA 3K20A 4G89A 4PG6A 1YR6A 4D6YA 5JI2E 3CQ9A 4PGGA 2DQSA 5TLSA 4NH4A 4RIHA 5WRFA 4WZBE 4NV3A 3TJRA 1KAMA 2C2BA 2AX4A 1P73A 1JTVA 4LXIA 4EDFA 4B35A 4OHPA 4QRDA 2GN8A 3HVIA 5J4HA 1PNOA 4HQLA 3FMGA 2ZE7A 4HADA 3JYLA 4R7ZA 2N42A 4Y2UA 3AJRA 3PQDA 3HH8A 5JSFA 2H0AA 1PJCA 1LF5A 3EH2A 3H2BA 1H2ZA 3JQQA 4MWDA 1K06A 2A92A 2DUJA 2FQYA 3DPIA 1EMDA 3E18A 3RRJA 3H5OA 3O95A 3GUHA 2QLLA 1Q7EA 3NIWA 1ZD9A 4G0XA 2GK3A 4UFNA 4YCLA 4DV6B 1V1JA 5EXDA 2BEVB 4W9NA 3UIEA 2GOYA 2JH3A 4KW7A 5BV7A 3W8NA 1N7JA 3IFSA 3EGXA 3NHSA 3WQRA 4A73A 2YTZA 3RRXA 2Q5FA 1T0HB 1VL1A 1RC0A 1SHTX 2B61A 1X7YB 5FORA 4WN9B 3WMGA 4AB1A 1AQ6A 2WDPA 2ZUWA 3I3OA 3MG9A 3MJTA 5KHLB 4KWEA 2A3NA 2ZJAA 2EX1A 4WFIA 5IEBA 3UB4A 4IRXA 3KZXA 1NDHA 2XNDA 3FCCA 2R6FA 2AR7A 2AK3A 3QOWA 4IWYA 5CFPA 3T1NA 1BNCA 3VR1A 1SMKA 3EVCA 3WXBA 1MC8A 5LZ2A 5COAA 3BTSA 2Z09A 4EUEA 2VHZA 1L3BA 4KGXA 1T8RA 4PCVA 2VHJA 3B6EA 1C8LA 3V4ZA 4EJSB 3GROA 4GKBA 2UXBB 1B6TA 1WOMA 2ZZNA 5LSAA 1ZMOA 2UUBB 1AA9A 2XOEA 3FFTA 2D8AA 4YYEA 1E6UA 5L40A 1W5SA 3G85A 3M3PA 1YDGA 2V1UA 4M54A 4TKUB 1WXWA 3JQ9A 3IR6A 2XKBA 4U7WA 1GTL1 2YZMA 4Q66C 1KYWA 4I9NA 4DA0A 1MOZA 2IIVA 1E2BA 2BBSA 1I4EB 3AI7A 3KQOA 4K9SA 4L5IA 3WR5A 3TMAA 3M5CA 1JQJC 3RIEA 4GUDA 4QOSA 4BJ6A 3CEPB 3JQ8B 6LDHA 3JAWB 5HTKA 5EEGA 3DTVD 1JSLA 5BMVA 2UKDA 1V4BA 1XTZA 3RJTA 1PL6A 3DP9A 4PXAA 3PNVA 1ZNYA 1LDYA 4YRTA 1SPXA 2VWQA 3X2FA 1VPEA 2ZXFA 3O1HB 5FTMA 1IBRA 1OLOA 3R24A 3RBZA 3VKVA 3AVVA 1XZDA 2I9KA 2AG1A 1ZMBA 3TEMA 3ZCVA 1IPFA 1M9NA 2C2MA 1Y5RA 1E77A 2VRBA 3DZDA 3SR0A 3DAYA 4CR8A 1NJ1A 1UJNA 2GHTA 3RC9A 4L15A 1OXBB 5REQA 5JAZA 1Q91A 1K5DA 1OAOA 1JSZA 4MGHA 1A9ZA 5GWXA 2JHPA 2EFGA 1Z2DA 3WMWA 4RF2A 5BPHA 1J39A 1R3DA 2Z58A 3NEAA 4MDYA 4LNAA 4FIZA 3BKWA 3U4IA 3KJXA 1ENPA 1T6NA 3W78A 4PZ9A 4MSUA 2GBFA 5CVVA 4ED9A 4KFSA 2VJLA 3PC6A 3ZX4A 1QE5A 4KO8A 3HDQA 3SK0A 3ZHUA 4MUFA 4M83A 3TZEA 4AZWA 1C0LA 2W8BA 4IJMA 1UK7A 2X6TA 1YBFA 3M1IA 1FXWF 1KEZA 2KI5A 2NO4A 4KV7A 2ZB2A 5FNVB 4CT0A 2UUCB 4R98A 1G8GA 1O96A 4LXUA 3UBMA 2X4LA 1QLJA 4RZSA 4AWBA 4BEJA 2NTVA 1PD0A 2OAP1 3Q2IA 5G53C 9LDTA 1KOJA 2ARKA 4P4GA 4EHNA 1G291 5JYCA 1JJBA 4LBYA 1QOPB 3BRSA 4IOMA 4EW1A 2NUAA 4ZRMA 1AF7A 2W2XA 1GNVA 1OYYA 2DOKA 4FDUA 4NBRA 1JA0A 1QMGA 4KDRA 4RYDA 1Q0RA 2BHRA 4U00A 3LZCA 4D74A 4DYVA 3N87A 3PXAA 7AT1A 3DCIA 2V6GA 4DSZA 1INLA 4ZEXA 2PYDA 2QI9F 3JZDA 2X1HA 3HABA 1A2QA 5A4KA 2CNKA 2XIJA 5HCIA 3FUCA 4HH0A 1TM1E 1JIXA 1BE6A 1N1DA 1Z4PX 1TMKA 4DQ0A 5TT0A 1FFCA 2YOHA 4KXMA 4TV9F 1V9CA 2FEOA 3AZPA 1D5CA 1C7RA 4QA9A 5J2UB 2H06A 4OBEA 2DFVA 5FPQA 2O1WA 5D7BA 2NO5A 1R0XA 1HG1A 3D7NA 4IHQA 2AMJA 4EHFA 2I66A 1Q7TA 2Z6VA 2CDRA 4WXPA 4BO4A 1YZYA 2JAXA 4Z4FA 1AKVA 1LRLA 1XYGA 2XCSB 4S0XA 3THYB 1W4ZA 4RCVA 4RC9A 2H51A 3R23A 3FOBA 3VTKA 4C6HA 3UJCA 4Z49A 2B94A 2CNNA 2XXBA 2Y92A 2L0XA 3PLRA 4HMPA 4LOKA 1LBHA 5F1YA 5FHQA 4DJAA 3D02A 2QMUA 3VVBA 1PTKA 1V48A 2DPGA 3AVUA 4KODA 4MINA 1BRTA 1U11A 4C20A 4KJZA 2E5WA 4RBNA 1F8YA 1ATIA 1BEUB 1G7TA 2KYRA 4R0VA 2VQDA 4QHYA 1E1KA 1TFRA 2ZUVA 1T3ZA 3EXG2 2HA2A 1L3CA 1QZUA 2W2PA 4L4ZA 4CXMA 3EBLA 4F60A 4H2DA 1BYUA 2ZR9A 2AOWA 2HF7A 2QGFA 4DA9A 4BZXA 4S1OA 1OVGA 4V2UA 4LZZA 2QE7D 2QOEA 4S1PA 1L5HB 3IMKA 2DEUA 3D5EA 2A4MA 3BMCA 4XFKA 4ZI7A 1WHSB 1KYTA 4HY3A 5TS3A 2XYQA 1BVUA 3SHTA 5CB4F 5JROA 3SQWA 1YV9A 2A0XA 4CM5A 5AXCA 5T4EA 1O54A 4I5IA 1ZLXA 1GXSA 4GBED 4HL6A 2FUG6 2LRHA 3H83A 2ACEA 2ZBFA 1G6KA 3QPWA 3TAHA 2O7SA 3JALB 1I24A 3TNYA 5A5FA 2ISSD 1H2RS 3L7DA 3IEKA 3PE4A 2WT8A 4LJLA 3FOEC 4ZHQF 1XZHA 3ISTA 4XIJA 1HFWA 3I58A 1I3NA 3SBEA 1P72A 4LBZA 3ZIAA 1MNAA 1XZJA 3Q6NA 4G2TA 1GY8A 1VJGA 4CMIA 1G6OA 2FCRA 2IZ5A 2RHMA 4L08A 4YRQA 3OMLA 1Y1RA 4KQGA 4NECA 4DN6A 4PG7A 3UUGA 4D98A 3QBDA 4OHBA 4KPGA 4NFSA 4XWWA 4FE3A 2RI0A 1KNXA 4KVGA 4NWIA 2WM9B 3OCCA 4DPLA 2DKOA 2AKAB 1CUJA 1MX1A 2N3ZA 3P2YA 4U2KA 1VCNA 4DUGD 1BWSA 3KG2A 4OI2A 2P4QA 3EZLA 1E2JA 4TZ0A 4NE7A 4A15A 3D6FA 1MRZA 1GA4A 3PD1A 1OGIA 2V5UA 2V97A 4TV9A 5DLYA 221PA 3Q3EA 1KFCB 3ENNA 3QLEA 5DTIA 3VGPA 5I7VA 2JCVA 4BRZA 2FUNB 3Q5DA 2HH9A 4I1OA 5ALPA 4EGCB 3RWBA 3RC7A 2APJA 4QYSA 1ZJ6A 4OA5A 3LRTA 5CUQA 3RTDA 5MFPA 1TCAA 5L95A 3ZBUA 4FSXA 2POCA 1U1EA 3MT9A 3PDCA 4G86A 1CBUA 2ZSDA 1L7XA 4JI3B 4XDZA 1RWPA 3ZYZA 2HCBA 1PO7A 4NJMA 1GTJ1 5I8ZA 2QQGA 3K6RA 4CG2A 1YCGA 2AI3A 3NDRA 3V8RA 4AX4A 2B83A 2P6PA 3M2TA 3VHXB 3VDNB 1E3QA 3THWA 1DS6A 5ALKA 1TVKB 2AIRA 1I01A 3EVFA 1Y7TA 1JDZA 1VLHA 3P9XA 3QEOA 3TR5A 2DZDA 1PWYE 5CM8B 1VLZA 4W8HA 1W87A 5BSUA 2O2EA 4UBKA 3RJ5A 3NTRA 1OV4A 4TVSA 3HB0A 3GLIA 2KQUA 5FBQB 2HHAA 1R0LA 5KIAA 2E9SA 1E0JA 1KFEB 1W1UA 2W43A 1HTBA 3V55A 4PAQA 3CVWA 1QYWA 1CY2A 1R8XA 2XZDA 5G2OA 1K7EB 1WCIB 4JXZA 1LBIA 1Q2XA 2IGBA 2ZT5A 1CE8A 3C1TA 1NG1A 2WV9A 2P11A 4I4LA 3U3MA 2O5RA 2YFKA 1Z5VA 1CY7A 4YGYA 2VKQA 1RVDA 1Z36A 5HJEA 2A5YB 4WD3A 1WMDA 2YOGA 3ZQ4A 2EQAA 1BIFA 3WQHA 1CQZA 2OZLA 4HCJA 4J1QA 4ZHQA 1L5GB 2XMSA 4XD7A 2P5YA 2YYZA 1DO2A 2J0VA 3HJTA 3OF3A 1H8HD 5F73A 1G3UA 1HSZA 1QRAA 1SEVA 4YI3A 2D3WA 5DRYA 4EB0A 5CDFE 3HXPA 3V7NA 4E46A 3B1YA 5HGXA 4XDYA 3BB4A 2ZJYA 3DGFC 1SUFA 2R1TB 3EMBA 4FC7A 1GZ5A 1F5SA 3DOOA 3NC4A 4IGAA 4L9SA 5TQJA 3SSAA 2QN9A 3GJQA 2I03A 3CRNA 1G5RA 2VYND 1T5LA 3MUNA 1E3TA 3Q11A 5AICA 4LF5B 2WHXA 4TPKA 3LZ6A 4HZGA 3RUHA 1FDUA 3FZGA 5EZ5A 4DIMA 4IIVA 4LQCA 1GP2A 2WWXA 4TUYA 1T10A 2CCGA 1OTXA 3E4CA 4QQ8A 2G40A 4HNUA 2IOQA 4OQEA 3B2EA 5K0GA 4DMLA 1Q20A 1QSGA 1G8KA 2HWWA 1XZQA 2J9ZB 2L19A 4M0MA 2ZWMA 4C01A 4I50B 2WHRA 4D0RA 4CM6A 3G88A 4AFNA 3MJVA 2G5PA 4CKCB 3PTLA 3H86A 2UYQA 4BXOA 2GDJA 4ND8A 3U0VA 4Z1MD 2H57A 3OTIA 4X3CA 2RGXA 1XRQA 3QVVA 1H6BA 3QVSA 3SZRA 5K03A 2BR4A 3KJZA 4DIUA 2DUMA 5AI6A 3H8VA 3S27A 3ZCQA 4E5KA 3X1MA 1Y1QA 3EYAA 3E9YA 3EGWA 4N54A 4XWYA 1PBTA 1Z0SA 1U8TA 2ZRCA 1M5UA 4NJEB 3EIWA 1B6GA 4DLYA 1CUHA 1SZCA 4HZIA 4O2BB 3AB7A 4X8HA 2JVIA 2WG2A 1RWNA 1DKUA 4P34A 3GJRA 5BY2A 1XEXB 4IRMA 3W6ZA 1Z45A 5FA6A 2CDAA 3CZRA 4X3PA 3LUGA 4DRXB 2GPWA 3R0QA 5C7LO 2PEZA 2YZGA 3W79A 1D5WA 4Y2XA 4PGAA 1U3WA 2VTDA 2PSFA 3AHCA 3I01M 4WY5A 1LS6A 1FTNA 4YAGA 3O2SB 1TM5E 5F33A 1X7XB 4M0LA 4ZEWA 3SP1A 4OVKA 4H7JA 3BE5A 4RVHA 4BFSA 3LCVB 5D01A 1Z17A 4B6EA 2WZBA 2WJVA 5HIKA 1D1PA 1PQ4A 4HNGA 1K3UB 1VKNA 1OYVA 2P2DA 1A27A 1N7IA 2YHBA 1RI5A 2C98A 1LBTA 3GPIA 4J1TC 1T9DA 3N39C 4UHDA 3SYLA 4C2AA 4O3MA 1N4DA 2E87A 1PNRA 2PUDA 3ITNA 2VHXA 3I83A 5TMDA 3I6BA 4CU5A 4D6XA 1EH5A 4UM5A 1PVOA 1QHXA 2JAPA 5IM5A 5DYIA 2GTHA 2JK0A 2ERCA 5CA0A 1XK6A 1TD1A 2WOOA 3MLAA 2BBWA 1GO2A 4FN4A 4XB2A 4BOYA 2F1KA 1JIVA 3IH5A 1FDSA 4ISBA 4U2BA 3UAWA 3NT4A 1GWNA 4FHCA 2SECE 4JP1A 4RHTA 4KX3A 4ZVSA 4LG1A 7YASA 2POQX 4R9RA 1U7ZA 3WGQA 3LT1A 3UT5A 2XLBA 2YMLA 3UWDA 4BRSA 1NJ5A 3DR3A 3EN0A 5K3DA 4G1BA 4I46A 1PNQA 2NUTB 3LPNA 3RADC 3SMVA 5CHYA 4KVFA 1F14A 2EKZA 1ZM3A 4JI4B 2DXIA 4B71A 3M9XA 4X1KA 3OJWA 4RVDA 3DAHA 3OIUA 1BVRA 4QVGA 2OCGA 1M75A 2HJSA 1U81A 2ZRBA 5KU1A 1YK0A 1XNGA 5CT6A 1EK2A 4M38A 3T7RA 4D9MA 5BWNA 3GLTA 1M1YE 3FRHA 2WNHA 5BR8B 3GHYA 1YA4A 3WQSB 4D7AA 3WADA 4HRXA 3QY0A 3KE9A 1X0XA 1G21B 1QTIA 2RAFA 5DSZA 1ORHA 3GCDA 4WMLA 4MCHA 4RPGA 4CCYB 4EGQA 5KJ1A 1FSGA 2DJ5A 2PGIA 3GVIA 3N2LA 4TL6A 4HMOA 3ZK9A 2LCIA 1LTKA 4D8TA 1A69A 1WU7A 1B4DA 1R0WA 1UZNA 1P2UA 2VJNA 1DKPA 3AOGA 3FUVA 4OTZA 4DGQA 4AYXA 3KSBC 2OXTA 1CUFA 3LP8A 2FPKA 3FDZB 4RVFA 4O5OA 1YK1A 5EC8A 3ZBPA 4MS3A 3C43A 5KSYA 5EE9A 1I4LD 4LYFA 4UU8A 5DSTA 1YB2A 1HYGA 1SCUA 1SUAA 4U6NA 4JLDA 5FA5A 2UZ1B 5L3SB 2AZTA 3H5RA 5CVJA 4P9NA 2QQFA 1T0JB 3AGPA 4GQBA 1TM4E 4W7HA 3IILA 3GZTB 3N3AC 3U1VA 5E6UA 2R1VA 1NMYA 2JFXA 2P79A 5BXQC 1U7XA 3HU5A 3HU1A 1JR6A 1APBA 3OF5A 4HDCA 4MI3A 4YJ2F 3ETJA 4L02A 1U99A 4ZCSA 2C96A 1QBKC 1T1SA 3EVGA 5HE8A 4F9GA 3P96A 3C7CB 6YASA 2B20A 3ILYA 4E94A 1UM9B 3FB4A 2IW3A 3QEMA 5SY4A 1S9HA 3KVVA 2BR3A 2O0LA 3IQFA 2LKCA 2UXCB 1CF4A 5AVZA 2PKQO 1RJEA 2C58A 3UWMA 5J4YA 1E66A 1QIIA 1E2FA 3PJFA 1R6DA 4ALIA 2I29A 3CX7A 2I0FA 3P9RA 3G0HA 1W6UA 3WK9A 5IKPA 3N2KA 4AZ3A 1WZ2A 5FPPA 2H85A 3P19A 2C83A 1Z63A 2FPRA 2PLRA 3KKPA 4DMMA 3EF0A 4TKMA 3R5XA 1VA4A 1S96A 3KSZO 4Y6QA 4AW9A 4DUZB 2Q4RA 4L5JA 3C6QA 5ICEA 3AKYA 4A2PA 1M8FA 4RA6B 3OBBA 4AROA 4DAOA 1W6RA 2QKYA 1VYHA 3P9PA 4QYMA 2PX2A 1PV2A 2QU8A 3ET5A 3DDCA 1H2AS 3P9YA 4IFEA 1R3UA 2O2IA 4R01A 4OK3A 2ZWOA 3QLVA 3FR8A 3RYCA 1ZFNA 4FMPA 4GMFA 3BUSA 4I19A 2F6RA 2VAVA 4UMEA 5JZ9A 1IEWA 3BN3A 1KC3A 3TW6A 3HFJA 2JGDA 3M89A 3ZNNA 1G18A 1P2DA 1QF7A 3C7KA 3GJ6A 3PGVA 2NU9B 2AC7A 2FP4B 4G9BA 4UM8B 1J22A 1YT5A 3OIDA 4IP0A 4D42A 2H00A 4F3YA 4A26A 5BNIA 1XALA 1E1NA 4IINA 1T13A 5F9FA 4KQJA 2X8AA 4MUGA 4ZCLA 1EFTA 2WMDA 5A4IS 3W8DA 1XD2A 2I2CA 3L6CA 3B3FA 4O2AF 4JDPA 3U13A 2H1RA 2YQZA 4AWAA 1Z35A 4QJIA 4RY0A 1WXXA 3DYVA 4B3CA 9MHTA 3W6NA 1OIXA 4J1NA 3NEYA 1IY1A 1HRDA 1KE2A 2QL6A 3PXDA 3EEFA 3GP5A 4Q0MA 1I0LA 5J5CA 1RVV1 3RCBA 4RHFA 4CG3A 4D4GA 3ESXA 2FZGA 1AKUA 1RBYA 2GBLC 1TK3A 4MUIA 3SX0A 3DV0A 1WQ3A 2DP4E 3SYMA 2VYCA 4AKHA 3E22A 4JI7B 2WFMA 3D6JA 3CPSA 1JEQB 1SIUA 4G26A 4YCCA 4EFLA 5B55A 5C8YF 2CJPA 4GUAA 1XU7A 2ZOSA 4P3OA 4GBJA 2CMKA 3VNBA 5IC4A 1PL7A 2C9DA 2QW8A 1TA4A 2RH4A 1Q12A 3VPBA 1MHTA 3WLMA 5FWAA 1AOXA 1QF6A 1NFFA 5EXEA 4E32A 2A0FA 3AL2A 5GONB 5EJMA 1VIYA 2JANA 1ZZGA 2XGGA 1MG0A 2H1HA 4ZDJA 2FK8A 2JA2A 1N8KA 5LQNA 4N7MA 3FCYA 3Q6IA 1P6QA 1TTQB 4BZQA 2I7DA 3EXG1 1O2DA 4OKIA 2D5AA 1EK1A 1PFQA 1EA5A 1U0FA 1TZBA 2G76A 3EFEA 5CH8A 4PLVA 4XLTA 5A62A 4WZZA 2VUSA 5C7IO 3PC8A 3IVGA 1BU8A 3B5IA 4QXMA 4R4JA 4XARA 1YGYA 1ZNXA 2PQ2A 2W2QA 3OESA 4HQ6A 1IOLA 4JJKA 4KYIB 1N6PA 4L4RA 4CN9A 1YB4A 1ESCA 1RYEA 2A9QA 2BP7B 2GA8A 3VU9B 4H77A 4TQGA 1I10A 2D00A 3DOCA 3R44A 5DP2A 3W5DA 3NPMA 3A2MA 3EZGA 1FTWA 4PINA 3TN7A 4BS9A 4HUQB 5DGXA 1HFJA 1OFIA 3H9CA 4ZT5A 4A8HA 4GX0A 4RIIA 5G4KB 4KL8S 4GL4A 5TR9A 1K6JA 3SSMA 3O8BA 1CLUA 4YJKA 1C4XA 2GXQA 3RREA 3GEPA 3T0GA 2C2ZA 4UREA 4D99A 5JNRA 3AKZA 1SHKA 3K0EA 1AJEA 5F35A 2QD2A 4FGZA 4W4TA 3N7AA 5PNTA 3T3MB 3UJPA 2PZEA 1A3CA 1SRQA 3W9UA 2BKAA 4TYQA 2JZOA 3SHWA 2OHFA 2XYVA 3V4LA 1N5LA 1MV5A 2DR0A 2WIGA 2X9GA 3PQ8A 1AX9A 1PSZA 5AM4A 5L3ZA 2E4WA 4P4NA 1Z4KA 1OA1A 2YJ6A 2CLIB 4KO1S 4I9FA 2Y68A 5ADVA 3L7LA 3H9QA 1VBNA 3S2IA 4FT2A 4P3KA 4OFZA 3B6IA 3KOXA 2UYCA 2DTEA 1GZ4A 4YRLA 4EAAA 2BZ0A 1LNSA 1J21A 1ZGCA 1Z7EA 1F2DA 1FMLA