4MS4B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the agonist baclofen
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
408
Chain Sequence
b'PPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWECLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/agonist
total genus 148
structure length 408
sequence length 418
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms4B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms4B01
3CNBA 1T34A 3N53A 5IBQA 3BILA 1ZGGA 4RY0A 4MGEA 3RH0A 1DBWA 1NXPA 2I6FA 3OO1A 3QELA 1A0OA 4MQFB 3RVOA 4Z4FA 5CNJA 4EUKA 4FB4A 3SG0A 4W5QA 1KRWA 4S04A 5KC9A 2E4WA 3KKEA 3OLWA 3HXMA 2H3HA 2FLKA 4D6YA 4MQEA 3H5IA 3TD9A 1A2OA 3HM9A 2NZUG 1Z16A 4IF4A 4IRXA 3MQ4A 4W5NA 3QX8A 3NNDA 3E61A 4O1IA 1BVHA 4Z9BA 3FFTA 3CG0A 1MIHA 3SQNA 2WY2D 1QPZA 3FMVA 1D5WA 4B09A 4MPTA 1EWTA 1YS6A 1D1PA 4RK4A 4MLDA 4Z0NA 3HVRA 3OLVA 1USGA 5TPZD 1Z2EA 4JB2A 4Q6BA 1ZAYA 2B1JA 4GNRA 3T8YA 3OLZA 1ISSA 1DCKA 2WRZA 4P98A 4F3TA 1NXOA 1Z2DA 4KREA 4MQEB 3OLYA 3HO1A 2MYNA 3G1WA 2B4AA 3A3KA 1RZRA 1XWWA 1KRXA 3QEKA 5E3JA 1XHEA 3SM9A 4EYOA 1QP4A 2R48A 3IDOA 3LOPA 3OM0A 3RVQA 4S05A 4DADA 4MS4A 5FWYB 3I42A 1LJLA 1EWVA 3KLNA 2Q5CA 4MAAA 1J56A 2AYXA 4HYEA 3CFYA 2QW1A 1E6KA 1D2AA 4DQDA 2XDYA 4TLMB 1JFTA 1ZGZA 2P9HA 3EDCA 4PICA 3DGEC 4MS1A 5I4CA 3C3MA 1ZY2A 3FDFA 6ABPA 4KFCA 1JX6A 1EFAA 4MLCA 5DGCA 3SNKA 3KG2A 5JNTA 2R47A 1YIOA 4RK5A 3HZHA 4RKRA 5BRJA 2PUFA 4RK6A 1TLFA 3KHTA 1JLKA 1DC7A 5EWMA 4F8JA 3TO5A 4YRZA 2FEPA 4IGAA 2VYCA 1Z25A 4MS4B 2RJOA 3MA0A 2FXIA 1ZESA 1RXEA 4KQCA 4Z99A 4PE5B 2MSWA 4N41A 3SY8A 4JP1A 3C6QA 2PL1A 3KJXA 2R4QA 3H75A 3T38A 2MSKA 3O1IC 2OENG 4L85A 3N75A 2A9QA 5EWLA 1WETA 4YR7A 1DBQA 4IMJB 1MB3A 2HJ9A 1NATA 1FFWA 1JYEA 4KRFA 3EGCA 1JL3A 3H6HA 3O2QB 4Q7EA 3RVPA 5TQJA 1VPWA 4EYQA 1RXIA 2RJNA 8ABPA 2HQOA 5DCLA 1VRVA 3UK0A 3ILYA 3CU5A 5EWMB 2YHAA 3NNSA 1NY5A 1SXHA 2E4ZA 3T6KA 2ID9A 3CLKA 3GBVA 3KTOA 7ABPA 1R8JA 3KSMA 4KK3A 1ZH4A 1YMUA 1P2FA 3CKMA 5ED4A 3I09A 1P6QA 4WXMA 2PKXA 5IUKC 3EULA 2FLWA 3ILHA 4MR8A 2WB4A 3MF4A 5JNRA 4WZZA 3JPYA 1NXWA 4N0QA 1OXBB 3JPWA 5JNVA 3OO0A 4G0ZA 1DBPA 1M5TA 2L19A 1SXIA 1I3CA 2HSGA 2ID7A 3MIZA 5CNKA 1DRJA 1M2EA 5F64A 2O20A 4F11A 2CHEA 5CNMA 3MM4A 4JAVC 3FGZA 3KLOA 4WWHA 4ZJPA 2PUGA 4G0MA 5FBHA 1NXVA 3GT7A 1TJYA 4LX8A 2P4UA 1P8AA 1M2FA 3KYJB 3NBMA 4MS3B 1JHZA 5JNSA 3A0RB 3C3WA 1AB6A 1GUBA 1JH9A 1ZVVA 2PUDA 1KMIY 1Z12A 2QVGA 4F12A 3GWGA 3N6VA 4HNSA 5TQ0A 2N9UA 1E2BA 4L4UA 4MR8B 3LUJA 4PEVA 2JRLA 2ZAYA 4JA2A 1YVUA 2IYNA 3OQNA 4QYMA 3H5OA 5IC5A 5PNTA 2FEWB 1APBA 4RXMA 1NTRA 4MRMA 1Y1LA 5JNWA 4EVSA 2LP4Y 2RDMA 4UHJA 3OMXA 3O2SB 3P9YA 4N0PA 5DLEA 5TE9A 3QELB 4Z4HA 4OBBA 4RWEA 3M6MD 4RSMA 5EWJA 3CG4A 3N8IA 4XLTA 3NHMA 3RVLA 5BQ3A 5TPZA 3M9XA 5T7BA 1YS7A 4ZPJA 2LBPA 9ABPA 1SRRA 1K68A 4EYGA 2E4YA 1RPJA 4N47A 3Q7SA 4LDAA 5TQ0B 2E4VA 3F73A 2PUBA 3E3MA 4Q6WA 4ZMRA 4E7PA 4MRMB 2F8TA 3VNBA 3QLUA 5IUJC 4IMIB 1CEYA 3FFXA 3HUUA 4YGXB 3QLUC 4PYRA 3GRCA 3LUGA 3Q7TA 4G0YA 4WXEA 3QLVA 2W42A 2PLNA 4FE7A 3TB6A 1Z17A 5EWJB 2FW0A 2L2QA 3QLVC 5KQGA 1U04A 2LIVA 4RS3A 3I5AA 2IPAB 2M98A 3BRSA 4OLAA 3LKBA 2QU7A 3H5WA 3LUHA 3GBPA 3VNAA 4KNYA 1ISRA 2AYZA 4EVRA 5TPWA 4TMYA 1DCMA 4LE0A 3B2NA 4M88A 3GV0A 5FWXA 1U0SY 4NCBA 4RDCA 4ZYLA 4NICA 2F8SA 1YTUA 4RY8A 4F06A 3H5TA 4DN6A 3Q7RA 4H60A 3W9SA 2L17A 1BDHA 3CZ5A 3C97A 1VKRA 3QK7A 4Y9TA 4G0QA 4WUTA 3A10A 3EJWA 1QP7A 3EQZA 1QQAA 1L5ZA 3IPCA 1MAVA 4H3KB 4PZ0A 1BAPA 1DZ3A 5JNUA 2QZJA 4G97A 3JVDA 5CNIA 3LUFA 5IUNC 3HEBA 2HQRA 4O5AA 1LJUA 4RK0A 5CHYA 5KI6A 5KC8A 1BA2A 4MS1B 1JWLA 2FMIA 3TX6A 3CS3A 1U8TA 3K4HA 1JBEA 4JOQA 1ZDMA 2QXYA 2FQWA 2KYRA 3S99A 4EYKA 1ZH2A 3N0RA 2IKSA 2X7XA 3LTEA 4LE1A 5D2CA 3IPAA 3LUDA 4CBVA 5FWXB 4W5OA 5JS2A 2GI4A 3O21A 5KQLA 1U2QA 3HSYA 3F6PA 3L49A 1Z26A 2FEKA 4XFKA 2PE5A 4IILA 4ETMA 3LMKA 5GOTA 1E6LA 4Z4CA 1QMPA 2RGYA 2PUEA 2JVJA 3O2JA 1LK0A 4JASB 1ABFA 2TMYA 2JVIA 4RKQA 1BDIA 3IP5A 2H0AA 5C5CA 2M1ZA 1BDJA 2FQXA 2J48A 1U2PA 1LBIA 4Z4EA 2A9PA 3G85A 3GA5A 1DCFA 2GKGA 3T95A 3CHYA 4MR9A 3HDVA 4NQRA 5BR1A 5EWLB 2MYUA 2FQYA 2FMFA 2A9OA 4LDZA 1EAYA 1XHFA 2PAFA 2MSLA 4MQFA 2IOYA 3KCNA 2PMCA 3NHZA 3HCWA 4YV7A 1E6MA 1ZHHA 4O1HA 4Z4GA 1L5YA 3CZCA 3D02A 1JDNA 2IDMA 4RK1A 4TLLB 1VLZA 3RVNA 1TMYA 1DG9A 2LPMA 2DRIA 2VK2A 4KPYA 3O1HB 3GYBA 4HNQA 2FMHA 1F51E 2CWDA 3K9CA 3Q9SA 4ETIA 1C0EA 4OTZA 1YK1A 3DZDA 3I45A 2JCGA 5ABPA 4RXTA 3Q41A 3H1FA 1JYFA 2PL9A 1K66A 4ETNA 3OMWA 4YP9A 3ROFA 1M5UA 4RY9A 2IPLA 4UHKA 3HK2A 1QO0A 2E4UA 2QV0A 5HM6A 3OQOA 3DLHA 3MYYA 5KQPA 3MMNA 4RV5A 1GCAA 1FFGA 4KV7A 4QICA 1CYEA 3JVIA 1RZRD 1PNRA 5HSGA 3HS3A 3URMA 2JVKA 4W5TA 2PUAA 2BGGA 4P1ZA 3OM1A 5T3YA 4QYWA 1A04A 3H5LA 3OQMA 2V0NA 3F7NA 2FVYA 3RVSA 1DRKA 4XARA 1MVOA 3O74A 4MYRA 1DP4A 2MYPA 4LE2A 2WMYA 4KZKA 1QQBA 4HNRA 4RU1A 3RVKA 4EGSA 3OLXA 4G86A 4LZLA 5FWYA 4TN5A 1AB5A 2JBAA 1NXTA 3HDGA 5HQJA 3HV2A 2L18A 3EQ2A 4YS6A 3LUCA 4RXUA 3RVMA 5BRAA 2PJUA 3D8UA 1JFSA 3CTPA 1QNLA 3H6GA 4ZMSA 3N0XA 4Z4IA 2LUOA 1ABEA 1Z15A 3JY6A 3EAFA 1USIA 3O75A 4OATA 2FMKA 3FFWA 1NXXA 4YWHA 4XXHA 4OG2A 3NNNA 3QEMA 3RVRA 5HKOA 2JB9A 2A9RA 2VUHB 2FTKE 1PHRA 2WJWA 2JK1A 1H9CA 5GQSA 1F4VA 3QLTA 3LKVA 1ZITA 2E4XA 4OLBA 4XASA 5JS1A 3IP7A 3A0UA 2PUCA 2IPMA 4MR7A 2FKAA 3BRQA 3F6CA 1FQWA 3KYIB 4G0OA 2NUBA 5DKFA 4YCSA 6CHYA 1Z13A 3UKJA 2CD7A 2JBAB 3LUKA 3H1GA 3C3KA 3HJFA 4KVFA 1GLGA 1URPA 4EVQA 1PNTA 3KS9A 2ZWMA 4ML3A 1Z18A 3Q15C 1FFSA 1KGSA 1D1QA 3N0WA 3QX9A 2IPNA 1NXSA 4XAQA 1EHCA 5DTEA 5TQ2A 1CHNA 2R25B 2FN8A 2MYTA 1PEAA 3JS5A 3QEMB 5KQMA 2GWRA 2NT3A 3BBLA 4NV3A 3R0JA 3IP9A 1B00A 1UDRA 1USKA 3JTEA 4WT7A 3BREA 5B3JA 1OXKB 3SAJA 3GL9A 4JB0A 1MB0A 1JF8A 2WWVD 5B3JC 3UUGA 1W9HA 4LRQA 1TM2A 5TPWB 2QR3A 3HUTA 4MR7B 2VUIB 4KMRA 4Z9AA 1DC8A 3DGFC 1SXGA 1LBHA 3H1EA 3DLBA 1PUXA 5IULC 4W5RA 1IIBA 3O1JC 3LFTA 1PEYA 4QPJC 4D6XA 2GX6A 1P6UA 1SD5A 1YMVA 2CHFA 5FBKA 2HPHA 1QP0A 5KWSA 4G0PA 1FSPA 2WJAA 1EWKA 2QVCA 4RK7A 5TQ2B 2NT4A 1GCGA 1S8NA 3RVJA 3L6UA 4RZSA 4KQ9A 4EY3A 1ZN2A 5C5EA 4GPAA 3IP6A 4E7OA 1C4WA 4YO7A 2GBPA 3LUAA 3DBIA 1D4ZA 1JFVA 4H3HB 2NZVG 1JDPA 1GUDA 4N76A 3ROTA 1TVMA 3CRNA 5IX8A 2FSPA 3M9WA 1DJMA 4MS3A 3EODA 1QO0D 2HQBA 2QSJA 4NCAA 2OQRA 2YHBA 3H5VA 1HEYA 5IEJA 1RNLA 3TMYA 2FN9A 3RQIA 4D74A 4YLEA 5IEBA 1QKKA 4KK4A 4FE4A 4MR9B 1W25A 4G0XA 1YK0A 4N03A
chains in the Genus database with same CATH superfamily
1ZHFA 1JWBB 1ZGGA 2BGJA 4UU0A 3LA8A 4BN0A 4IDEA 1RI4A 2I6FA 2FPSA 4PZLA 4Q19A 4CMHA 5AK4A 2NZWA 3TCNA 1L5LA 4R51A 3ZX5A 1Y5NA 5F5LA 4GEKA 4CT5A 4X65B 5KC9A 1GM5A 2CCJA 2X9GA 5AJUA 1G42A 3T1VA 4DNFA 3MMZA 2H3HA 1NMZA 1ZMRA 1ZRSA 2HU5A 3PJEA 2VYND 1E5QA 3PPIA 2O8BA 4PBSA 1F2TB 2G71A 3TD9A 4R81A 4K5QA 3WMEA 3UWMA 3KKPA 3MQ4A 2GRJA 3TD2A 1E77A 1QUEA 2R3SA 3OT1A 5CXSA 4K1LA 1L1FA 4FYIA 4GRAA 2HK8A 2EX4A 2X77A 2CJWA 4MRSA 5J2UB 4D5GA 1N77A 2Z9DA 2XDQA 4R2IA 4UREA 1XTKA 3MK31 4MTLA 4XDGA 1SVWA 4WJZA 1E9CA 4F86A 2D06A 2X0NA 3L8FA 1MW9X 1VI6A 2H7XA 3CIOA 2EQ5A 1LLFA 4IV5A 1MZPA 4ZHQF 2AXNA 5DBEX 2SHKA 3VYWA 4QG3A 3KJHA 2XVMA 2H1WA 1Z4MA 3KWJA 4PTZA 4ZN6A 1RHUA 1SD2A 1PZEA 1LVGA 3UGKA 1GQOA 2CZGA 2OESA 1AU9A 1JG3A 2Q4TA 3PDJA 5G3YA 3TK1A 2WQ6A 1GGFA 4GOKA 3LK7A 4WV3A 5PGMA 4EG0A 3FYTA 1P7PA 3RBZA 2B4AA 4GOOD 2PV0A 1KSHA 4UHDA 1A5SB 1E58A 2R44A 3ZD9A 4B84A 4HNAA 3FNQA 3LF2A 4BNDB 1EP1B 3Q40A 4JJKA 2Q7DA 2GF0A 1R4MB 3TM5A 3EEFA 4EYOA 3OX4A 1IBCA 3IDOA 1QP4A 3EPKA 3MWDA 5AT1A 3ZH9B 3C7DB 2B3TA 5GIOE 1OLSA 2XDQB 4FX2A 1C3OA 4I1PA 1VA5A 4EHAA 1PF7E 3FWKA 1K06A 1GSHA 1VHWA 2XF2A 1IZ7A 1SULA 4MVJG 2J7PA 4Y6GB 4D1YA 4XQGA 4RTNA 1GEGA 3RIYA 5FA5A 2YV3A 3U80A 2IDZA 3SBXA 4E11A 3ZGYA 4KXNA 4EHKA 5B37A 4JR1A 1I14A 5JVDF 4PICA 1CUZA 3CSDA 1AQIA 2CUTA 3VC1A 2JKYA 4KPUB 5IKXA 2PMBA 3B9RA 5JSKA 3Q8MA 5BWOA 2CLOB 5A5EA 3PXCX 6YASA 1UXHA 1G6OA 3DDOA 4XA8A 1DJPA 3TVTA 3UJDA 5BRJA 5K99A 1CF4A 1TYZA 1H4SA 2HRRA 5FPKA 2OGTA 4L57A 3CINA 4TTJA 1U4NA 5DT2A 2FWIA 2AEJA 2WWHA 2WW8A 3WQHA 3FPAA 3MWDB 4C2AA 2P30A 2P2DA 1BKYA 4HATA 4P80A 1OLSB 2C0PA 2FZ4A 5DOVA 4E1BA 2FXIA 3I04M 1C3OB 5B6PA 1L7VC 4KQCA 4V0MA 1ZXXA 3B1FA 1I51A 1ZRNA 4DNQA 5DDIP 4PS0A 1V71A 1SUFA 1IG0A 2X2PA 2ISQA 1QIIA 2A9JA 2GPJA 2Q3LA 3O1IC 4LSZA 5EWLA 2ORVA 3UV3A 3W1EA 1F8FA 3BMNA 2ZRCA 3X1MA 4E3WA 2WLSA 4U2GA 3AY0A 3NTVA 1XB2A 5IM4A 2FEOA 3FOCA 2WKPA 1CZUA 2R751 2DSTA 2ORYA 3AUXA 3NATA 4QBIA 1OH6A 2P91A 3ILYA 1QJ4A 2X86A 4O4LF 1DTSA 4GMXA 1L5KA 1BROA 2W6CX 2XUGA 2ACVA 3KPYA 3S1LA 3T94A 4WL0A 4D8YA 1S2NA 1IY9A 3FRIA 4IQ4A 1XSEA 5ELLA 2JFZA 1ZCAA 3PHGA 3WGHA 3ZNNA 5BQFA 1QONA 3PXDA 2IS6A 4I81A 1P2FA 5FOWA 3RIEA 1GIAA 4ZJUA 2B0JA 3B3JA 3H1BA 4PAQA 3ZH2A 3GRYA 1ZR2A 3KZVA 1PTKA 4EITA 1PK8A 1XK7A 1SWWA 2V65A 4ZAGA 2EHJA 1CF9A 3H2ZA 4UULA 4IOKA 4BJ5A 1R16A 2G82A 2JD2A 2E5LB 2A58A 4MCHA 2IXGA 1QDLB 5CLJA 4AW9A 5CCBA 3K16A 3GELA 3BMNB 1KFBB 3M6LA 5M3BA 1E79D 1FMCA 1KSJA 3SVTA 3HYSA 5BN5A 1GYQA 1EHIA 1XZIA 3A6KA 4RSGA 4YPOA 2VKTA 1NVAA 5JZVA 1FNMA 2JAXA 4QSMA 1A9RA 2AW3A 1XRRA 2RGDA 3GFPA 4XWGA 3N2EA 3CR3C 4G4JA 3AUYA 4NHOA 4UD2A 5LC1A 1PD0A 2IOQA 4DR7B 1ZGBA 4BASA 1JHZA 4RMJA 1DVRA 1JH9A 2I2CA 1FLVA 4H7EA 2OKGA 3N7AA 2OCIA 3N2YA 3E2MA 4HUJA 5IJ0A 2UU9B 3QFRA 3R6TA 4R3WA 5FF9A 4PFQA 1ULHA 2GWHA 2WD8A 3E82A 3WL7A 4B33A 3ONFA 4CE6A 3BGWA 1G9XA 4R05A 2Z9BA 3QI7A 3G59A 3Q3GE 4M7WA 1YZTA 3GEIA 3GLHE 3O8OB 2PGIA 1Y1LA 4P3NA 2A9KA 4QDZA 4QXOA 3TVYA 3WHLA 4BBZA 1OB2A 2NUTA 2RDMA 4MPRA 3SOPA 4HB0A 1P4AA 3N2ZB 5AXAA 2GZSA 1L4GA 3EXG1 3NETA 1T0HB 1GL9B 2AX3A 3RYCA 1J33A 2ERYA 4XLTA 3VO9A 4GHWA 3CLHA 2A86A 4LOLA 5T7BA 4ER6A 2X15A 1BVHA 4XJSA 2IYLD 1SRRA 3PA8A 3WIEA 4DF3A 5KYKA 4HVCA 2CD9A 1MX1A 3LV8A 1N34B 2FYTA 1CPYA 3OZDA 4LXIA 1KMQA 1MPXA 1EWRA 2J7PD 4UEKA 5L3RA 5IJ0B 1SQ5A 1OLXA 3N8GA 5KVCA 2OBFA 3QKRB 2FLVA 5CBPB 2J07A 4XD7D 3BGVA 4C88A 1BW9A 5FWNA 3IB3A 4J16C 1Z7WA 1E4OA 4QOHA 4TL6A 2FN3A 3TFWA 4C0QC 4LNUA 2FH5B 5K8UA 4EA9A 3IOMA 2VQFB 3FLMA 4BNZA 2LCFA 2NUTB 4JVOA 5C1DA 3P52A 2ST1A 2GM4A 4AI6A 2REBA 4ZEOA 3GRCA 3W5AA 2VTEA 4IHAA 2ZU0C 2ZWOA 4RJTA 1EWYA 4DMLA 5DYNA 2EG9A 3RYCB 1D03A 1L8LA 1WXXA 3NHJA 1PEDA 2QMEA 3UENA 5BSWA 1MOPA 2PKWA 1HE1C 3LE8A 5EESA 3OE5A 2IPAB 4CIXA 2V45A 2I8CA 3D59A 4YRGA 3UUEA 3LPCA 3VNAA 3LBAA 2W0MA 4EVRA 4JHXA 4LBVA 4YAKA 3MS2A 2YDYA 3UMRA 1OLXB 1XLTA 4PBTA 3TPZA 1H9BA 3BTSA 3W2EA 5IYZA 4PU0A 5JU6A 4Y1RA 2JFVA 3AM3A 3U4IA 2VTVA 1BW9B 1IUPA 1JE0A 3ZCQA 3E22A 2VXCA 3W8RA 2WUVA 4LNUB 4AS2A 1WE2A 2HJSA 3TQOA 1WP4A 4F97A 4GC9A 4WFJA 1KQPA 3JTMA 1DS6A 4WUTA 4V1CA 4D43A 2HCJB 4PBRA 4PPFA 2QJOA 4W63A 2JLQA 3TQCA 5JNUA 2R9VA 5JASA 1JKXA 4R1LA 3WS7A 2IU3A 2C2XA 2JZCA 1JR3E 3E9MA 4XR9A 1G5TA 1MV5A 3DB1A 2CHVA 3T52A 5KI6A 5IABA 4A91A 3EGDA 1NP6A 1OYOA 1VSUA 4NU0A 3USCS 2FMIA 2G70A 2IZ5A 2O3QA 2W7TA 3Q98A 4KHZA 1G5HA 1X1SA 5F1OA 2A1IA 3TX6A 1VDZA 1E1RA 1U1FA 1MC4A 4V0LA 4EEZA 3C6BA 4OXIA 2QNRA 3DE1X 5IYZB 1U28A 5JPIA 4Y1RB 4TMVA 3O4GA 4BECA 1J9ZA 4QUKA 2ZIAA 1ND5A 3E22B 2C2BA 2F3SA 4EI9A 3PE4A 2WTXA 1MKYA 1LK0A 3FPJA 1SXQA 5FIUA 1BDIA 3AR3A 2H31A 3DEKA 3OJLA 4IH1A 4PIVA 4O3MA 1CIVA 4B85A 1A77A 1GNVA 4C3VA 3QJGA 3TW8A 4L72A 2H2FA 2RAFA 3MRVA 1DCFA 2M1XA 3INTA 2O07A 1ZMBA 4L75A 1ZAKA 1F0KA 4J1NA 1GKKA 2AGVA 1NJ1A 1VCNA 1LTQA 2BMWA 2Q3CA 3EGDB 4KFSA 2XW6A 1FQKA 4X20A 3Q3HA 4X44A 5DI9A 2FJUA 2D7JA 4JVMA 1WTAA 3K92A 1R5BA 2IIVA 1DC5A 3SS9X 4K9SA 1OTHA 4C04A 3HCWA 2BGNA 1FJHA 3CGWA 2BEJA 4TLLB 3KLMX 5DTRA 2ONJA 3VDMA 1XJCA 1S8OA 3ICPA 3RT1A 4FKMA 4LGMA 4F93B 1YS4A 2PKRA 3TR6A 1A27A 2CWDA 1VIVA 1MC8A 2WAMA 1QIFA 5EZYA 4ABTA 2FU5C 5AVKA 5J4KA 3DLBA 2VSQA 1SHUX 4F8YA 5TEVA 1V3VA 3TW8B 2XX3A 3BXZA 1KOFA 1JYFA 2Z5LA 1JR4A 4OHRA 4KJXA 1MX3A 1KOJA 4MMYB 1T6XA 4ALIA 4X20B 3UPTA 1NY6A 1NYRA 3BHIA 3H2KA 1V48A 3MYYA 4BQNA 3TLXA 4YT8A 2HA2A 4M8NE 5CM2Z 1UPXA 1O94A 1KNQA 5DJ5A 2YN2A 3RBVA 1J8VA 2C4WA 2VH2A 4FFPA 4KQJA 4JZYA 1JLRA 1QRAA 4RY2A 1YOBA 4WVFA 4Q9JA 1RS0A 4HDAA 1VI5A 4UD6A 1KRHA 1KFCB 1XPJA 4QVGA 2B35A 4UTVA 1QG6A 3V80A 5JNLA 1IZ8A 3CRZA 4BJ1A 1JEYA 4TXNA 3M70A 4HX9A 3OY2A 4AQYB 4IIJA 2CDNA 4DCTA 2Z04A 3LF1A 5EZYB 1Z7EA 4R5MA 4Q5IA 2A5YB 4YUWA 1KDTA 2BBSA 3T7CA 1DGQA 3OLXA 4NYJR 5F1YA 1DJQA 1AB5A 4ZEVA 3QYAA 1BX3A 1OI4A 4LVCA 3F5QA 1JQ3A 4HAYA 3OC0A 1SGWA 2XRFA 1UC9A 4IDHA 1T0PA 3RK1A 5T8KC 1N9GA 3G9ZA 3M9LA 1KDOA 4NBTA 4DLPA 3TYXA 2E1PA 3QVVA 4GBMA 4Z7JA 3T5TA 3H8JA 5KVVA 1Y7HA 3P97A 1V5WA 3I61A 3T5CA 4B4DA 2C3OA 5EKSA 3WWZA 3QEMA 3ND9A 2PVPA 2C5SA 1ZOPA 4HAWA 1MJNA 4F9GA 4ZT7A 4IIJB 4M0FA 2JAUA 1J90A 2VK8A 2HNKA 2HHLA 2MOKA 2W48A 5F2KA 2D3TA 4YRKA 3QSYA 1POWA 1E3WA 1VCHA 4MR7A 1I7LA 1N32B 3DM9B 3K20A 3VU9B 1K89A 4QOJA 3D43A 3HB4X 2I3AA 3VH2A 3ND6A 3T3MB 2IL1A 3ER6A 4JOBA 1IJBA 2B9EA 1RLJA 1XKTA 2VQ3A 1JXAA 3IAM6 4EVQA 2GPTA 1N9GB 2ZB2A 1Z8HA 5B58C 1L5WA 1EKXA 5ANRB 4WIAA 4DFDA 3LPMA 1HFWA 4B3JA 3VHRA 1N75A 3BH6A 2MYTA 2IWRA 3QEMB 1EK0A 3VYVA 4QBGB 4TXMA 4HDMB 1UC8A 1GTZA 1UM9A 1MB0A 4KMSA 2AI3A 3GLSA 4HEA6 4TROA 4JL6A 1LW7A 4XPZA 3O3MB 5ICEA 1Z2AA 4MR7B 1E3WB 1B0ZA 1Y7PA 1KTIA 1WB6A 4XX0A 4Y2HA 1EVZA 1P4HA 4BFUA 2WYIA 4C2TA 3LHFA 1TYEB 721PA 1I32A 1ANKA 3DWEX 1QH8A 4I4NA 2X9NA 2DPMA 5FBKA 1HE2A 2LWIA 3ORSA 4WDQA 3BE6A 1T15A 4XKJA 1EX1A 2QM7A 1YE5A 3D6AA 4EW6A 1ORHA 5CEEA 3MJFA 1R5NA 3LJKA 2V9CA 1JR3A 3CPHA 1EWKA 4DW8A 1QVVA 2X0FA 2I78A 1B6SA 3OC6A 5JAHA 5HJEA 4OCZA 4H1TA 4KQ9A 3JSAA 4EY3A 3NW9A 4JUAA 3S1AB 2CLSA 2V1XA 4OSPA 5EE5B 3Q87B 1PQPA 1UM9B 2HNBA 1YJBA 1UBNA 2BBWA 3M6XA 4Q39A 3IVRA 1C3VA 3AF2A 4U8GA 3KD3A 1XMIA 3SS7X 3VZBA 5CBKA 3V7WA 3PJDA 2NZVG 4I4TA 1XLWA 3DUFA 3VR0A 1MN6A 1YU6A 3KAKA 4XX0B 1SUEA 2QLLA 5ES4B 2AXEA 5BW4A 2GZ3A 2AF3C 2HCRA 2QSJA 2CZCA 2X58A 3QKSA 2CY0A 4C0HA 4QATA 2PMKA 5B64A 1E0AA 4DC9A 1E2NA 2J9GA 1QH8B 3T7SA 3TJZA 2XITA 1O94D 2FN9A 3GVXA 1NI3A 1UJMA 2GJSA 2PWAA 3NOVA 3PGVA 5IN5A 1RI3A 2D0OB 3GCGA 4EG1A 4OP2A 5DN6D 1QKKA 2GJAA 1ZMTA 1U3DA 3D2AA 3LOUA 2MR5A 1TAGA 1CJMA 4JBXA 1G1MA 4IRUB 5TQVA 1EXDA 2O3SA 3IUQA 2NV0A 4M8KA 3AVTA 1XF9A 2BP7A 2W4QA 4RGVA 1FYEA 4G5QA 5ECDA 1A7KA 2XTNA 3RKRA 3RR2A 4C7VA 4I4TB 4EFKA 4NE9A 3RT9A 3MGGA 3DUFB 4L8WB 3HKBA 4NF2A 3F46A 4D9EA 1FNBA 3T4UA 4GSKA 1PJQA 1P0PA 3OLWA 3WYFA 4N12A 1T9KA 5TT1A 4X94A 2EDCA 5DFAA 1COWA 1RPNA 3WMRA 1D3AA 1EZ4A 4WJLA 4K40A 1S89A 3ENKA 5LDGA 3QX8A 4UXJA 4LXQA 3HCCA 3IJEB 1SCJA 2H2GA 3Q0TA 4KZPA 1G6Q1 5TB5A 3F1KA 1SJ9A 1ULBA 4X00A 1W93A 5I9SA 4ZEXA 1QR2A 3PDUA 2G28A 1D5WA 3O4HA 4JB3A 4NH4A 3SX2A 1XDZA 2DH5A 3V3KA 3AEZA 3PFKA 3ZZMA 1TD9A 5C18A 5BVHA 4RV4A 3D4BA 1QCCA 2XQJA 2YINC 4XQ0A 1F0PA 4HN4B 5EL0A 1N78A 2BP7B 1ULSA 3WB9A 3IERA 2WOJA 3SIXA 4LSMA 3AX6A 5GPBA 4WACA 1M6VA 4XQCA 1KK3A 4BIMA 3HKBB 3NTOA 3NYRA 4LMPA 5JAMA 2WRZA 4D3YA 1UK7A 2SKDA 1PR1A 4JI0B 3W05A 2ZYTX 2BY4A 4J0EA 4QELA 3DL7A 3HO1A 4L8FA 5FOXA 2C00A 1YIDA 2BN4A 2RGCA 5L95A 1O03A 3IHKA 5TS3A 2PAAA 3WQRA 2XYRA 3TNLA 1O4WA 5JATA 3PSHA 2AKYA 2F64A 3FFAA 4YPVA 5BVHB 1QKIA 5CDFE 4B71A 4DNPA 4M1EA 3NH9A 3SHOA 5COQA 1JFRA 2PNJA 3CFYA 1FFCA 4I0WB 4WA7A 1M6VB 3W6NA 5G0TA 5TX7A 5CA0B 5IWAB 2R8ZA 3BF8A 1MP0A 1KYYA 5KWVA 5LD2B 3B7WA 2J85A 5DK4A 5A5GA 2DWOA 4FOOA 3I0MA 2CVPA 1UMBA 2NADA 2NG1A 2R11A 3OECA 2H7VA 4X92A 3ZW9A 4RH1A 5AJXA 4X85A 2W6MA 4AO8A 1IBSA 1TLLA 1G2OA 1P0IA 2HPVA 1ZVMA 3QGMA 4MI3A 3WDMA 4BE9A 1YIOA 1N1GA 3I28A 2I7TA 3IJRA 5DSTA 3IE1A 3GFSA 2QTNA 1X9GA 3TAUA 5A5FA 4WBSA 1UXOA 3ZI7A 1OGYA 5A5VA 1XMOB 1U8UA 2ILTA 2X6QA 4LJ4A 4LMAA 1U31A 1K9SA 2H06A 3G1TA 2PJDA 1EE9A 1Z2NX 2J6HA 4G3XA 4GI3A 4LYGA 4D4LA 3DAFA 4AQDA 1NMXA 3F5FA 4KE8A 1G8MA 4QHYA 1DIRA 1CVLA 1L5MA 1QE5A 1RWXA 1X92A 3NWPA 4KOEC 1PUIA 1G7SA 1YDHA 1ZC3A 4WK4B 3N75A 1F8UA 4EPVA 2GM3A 5LQKA 2BI7A 4QAJA 3AU9A 2IYPA 3KIPA 4XWKA 3ICQB 1JLSA 1WNTA 4GFDA 1UADA 1P91A 3QUQA 2Q28A 3FB1A 1TIBA 2P8JA 3VPFA 4CMGA 2GK4A 1YOVA 3M5WA 2O7QA 3EXFB 3OFNA 2OBLA 4U7TB 2PQMA 1LNZA 1NJGA 2C96A 1WAMA 5B7GA 3C14C 1ZZEA 4KRYA 1T0BA 3KSMA 4RQAA 1ULTA 3R7DA 2XUDA 2ZTSA 3D7LA 3Q2OA 5FFNA 4Y2TA 1VG8A 2EG5A 3CRVA 4IMPA 3PLAE 4QQFA 3EQ9A 1LWOA 1HUQA 1V6AA 1NVGA 3Q9NA 4HP8A 4FT4A 3H5AA 1C1DA 3B6MA 4TMXA 4B6QA 3ZQ4A 4YQYA 3OEEA 4EY6A 4RSRA 4GL4A 1KIFA 4MKIA 4X6XA 4YMSA 2QD1A 2XRZA 3ORRA 3U3XA 4TM7A 2ZUVA 4FFMA 3L07A 1ZGHA 3DNPA 1AKRA 2RG1A 3U2QA 3REOA 1W35A 4GBED 5EMKA 1TB4A 1U2GC 4FIDA 3ZG6A 3DWGA 4Q01A 2WILA 2IY7A 1LA2A 2VA9A 2AHRA 1MGOA 3GJ3A 1EFUA 2YJ6A 3DYVA 1WXDA 3WISA 2J0QA 3EE6A 3KJGA 1EFTA 1MG0A 4KE7A 1QTQA 4K9LA 5CIYA 4C2BA 3GDWA 3QJYA 1P19A 1OH7A 2FW9A 3VSAA 1EFRA 5HRUA 4GPZA 3F4KA 1TAHA 4RF4A 1NBOA 5CURA 4ZCIA 1Q83A 5AHWA 5EIBC 2VHWA 3K31A 1C1DB 1UJ6A 3DLTA 1X1CA 3LSTA 5AJWA 3KLPX 4EMTA 2A33A 5ALYA 5CGZA 3EVDA 1E20A 2I62A 5E7QA 3K0CA 5C4IA 1Z37A 1HFEL 4EVSA 2JAWA 3QFCA 1AOXA 3CEAA 1JEOA 3RSSA 3BH7A 3HY4A 3K8ZA 2VXBA 1NG1A 3P2OA 1X87A 3DEFA 4ZCRA 5AUPB 2VRBA 3UMCA 2JJ2A 1I3MA 4GF5A 4TWBA 2VNJA 3GJSA 3RS3A 3WRYC 5HPYB 3H9QA 4PSKA 1KJ9A 3KZMA 1YB2A 1BMDA 3JZFA 4PXSA 4B8YA 4L4SA 1R9MA 3VISA 1WKCA 3AV0B 2E55A 3WJ1A 1SVSA 2EWVA 1OIVA 3ZV7A 5H5JA 2WJ3A 3BHNA 2H65A 3JD4A 4QEKA 4ZOAA 2QRKA 3PJRA 4AKGA 3E5MA 3ON5A 4QU0A 1KO4A 2CUKA 1B0UA 2LR0A 3FYHA 2Y71A 3HLYA 4ZTBA 4IZ6A 4ZI7A 3TG8A 1R66A 2ZAMA 3L41A 4OQDA 4KGDA 4QLOA 3I76A 1MNAA 2R60A 3N0VA 4J9UE 2BCGY 2C5EA 4N7RA 1C14A 3S2ZA 4C03A 3D6HA 1SKBA 1SG6A 1UIMA 1VIDA 2C7GA 4JI1B 1VJ5A 3AP2A 1F3OA 1IU9A 3RIGA 4DE5A 1EVJA 2YQ4A 4ZDJA 3DW1X 1VRCA 2QI9C 4UNSA 4WY5A 2IXDA 1E7MA 3KQNA 1TQ4A 3BULA 1QLHA 4K28A 5IBRA 1UPBA 1ZPDA 3H8WA 4ZAXA 3QFTA 3QLVC 1EXMA 2RGWA 3C8MA 4R9SA 3TKAA 2HZ7A 2I2WA 2ZCUA 1WQ4A 2VHCA 1LB1B 5E6SA 3IPRA 1N2IA 3AUUA 1G8PA 1Z7YA 3HNRA 4JBWA 1CB0A 5EUMA 2YHUA 2KBEA 2AJ8A 3OZEA 1LSJA 4TLEA 4TMYA 3VBCA 3VKVA 1NNEA 4MGHA 2QDXA 3U3RA 1AKVA 4LVOA 1Y3IA 2VC2B 3U17A 4P3YA 2Q21A 2I54A 1XZMA 3FY4A 1OX6A 5DGDA 1YTUA 3ZEIA 1GT6A 4ZIRA 4Q7QA 4ZQHA 4DPLA 3JWJA 1ZOIA 5CDFA 4FSDA 2PPVA 4GZ3A 3R8XA 2IKQA 5D3QA 1PQYA 4QUAA 3K53A 4ZU6X 1Y5LA 2QP9X 4QARA 5HZMA 4EGJA 3N86A 1AF7A 4JC0A 1QU2A 4TSKA 4ZI5A 1E1LA 4N48A 1C7QA 1GNSA 2BC9A 1JU9A 4MYSA 2WHRA 2H0RA 3E70C 3HRIA 4JQOA 4AUKA 5B36A 1O87A 4AZSA 1ZOLA 3EDYA 3MCAA 3FSGD 4D80A 5EJMA 5A02A 5FOVA 1M8JA 3ETJA 4O8CA 1ZKMA 2HNAA 3ZHVA 1D07A 1QAOA 4OHVA 4DUGA 5L6LB 4AZWA 4LPSA 1RPTA 2CXSA 3OEED 4NS1A 4BGEA 3DZHA 3ER9A 1L1QA 2H57A 1XMXA 2PRYA 3Q8WA 2A88A 4QD3A 2F90A 4X61A 4ZIRB 1JEDA 5E6UA 1VDMA 2GAFA 3EF0A 2PUEA 4JASB 2UUCB 1ABFA 2TMYA 5JCJD 1QM5A 3FYUA 4Z54A 4GMHA 3U09A 1R8YA 1QGED 2FQXA 2W6JD 2NLOA 1BZYA 3GWZA 1DADA 2A0XA 2Y05A 1HQYE 2G9ZA 1LU9A 2ASVA 3AIIA 3GA5A 3MGKA 1JEAA 3ZE2B 1ADJA 3UKOA 1TM7E 4MW0A 1P0MA 3BFVA 2FQYA 3ZE6A 1GDTA 1JW9B 1EAYA 3I34X 2JIBA 3F8WA 4LDZA 4O4JA 2AD5A 5HG0A 3TTWA 4BP8A 1M6EX 2OCPA 2ENUA 3NAGA 3NHZA 5THKA 1L5YA 2HU2A 1NT2A 3MC1A 4Y6PA 4DDVA 3RVNA 2IF0A 4MW7A 3T3IA 1U2TA 4QOSA 4OU5A 1W73A 3GLUA 1MT0A 2FVXA 5E6UB 4C78A 4CUJA 3OEYA 4XGQA 1BE6A 4GBGA 4OIFA 1YVRA 1E2UA 3RUHA 4WXYB 5JXGA 2PA0A 3FX2A 2HJGA 3FYUB 3H84A 4R01A 5I3ZA 3NASA 4JOSA 3A37A 4QJ3A 3I45A 4JCCA 4Z0TA 4V2IA 3NRCA 1IHYA 1AK2A 3M2PA 1U8FO 3GDGA 3QVKA 4JJ7A 4Q21A 4BMYA 1E5DA 4I3GA 1GDHA 1E8MA 4QRDA 5LFAA 2WLTA 5EQFA 4G8CA 1ESCA 4BGVA 3DLIA 4RD3A 4U4AA 1QZZA 3A4MA 4FNAA 4K3UA 1PLKA 4O4JB 5M5BA 1IWBB 3MMNA 3ZD7A 1E9BA 3UWSA 1E5XA 1HDYA 2QBYA 3M6WA 2I9KA 4IZHA 4KX3A 5AP9A 1ZRMA 3SEAA 4F4CA 4YY3B 1DOZA 3CUEF 1TZKA 5BXYA 3KO8A 2LZ0A 2FPMA 1JPJA 3P19A 3AG5A 5I7OA 4JJ8A 3SR4A 4OSEA 3AF4A 4XDHA 3FVQA 3QTBA 4YFVA 1OCEA 4HUQA 5EIAA 4C08A 1R1DA 3JASA 3Q8LA 5CAEB 1I3OA 2J45A 2ZFUA 1CY8A 4LZLA 3O31A 1AA9A 4RWZA 3DKIA 5EC8A 1GCIA 2ROQA 3VR5A 3W77A 4A0HA 3HJBA 3RRNA 5JW6A 1BA3A 3H6GA 4JCOA 4AD8A 1H6AA 1KI4A 1SQ6A 3F9RA 3DL0A 5JG7A 3I0ZA 3EFOA 5C8XA 4JLSA 3NVDA 1WZ2A 2DGDA 3HB1A 3I4CA 1RPAA 1GDDA 1MAAA 2DOKA 1NXXA 4DQVA 2GDJA 5WRFA 4UAVA 2UUAB 3D8SA 4KWIA 1LX6A 5A62A 2OHVA 3KB6A 5KVQA 3AZPA 3C6YA 2II6A 1FP4B 1WLYA 5CMLA 1Q0TA 2DR2A 5LZ9A 3KAJA 4TYMA 2VUHB 2I66A 1FW8A 2LXNA 2WQZA 1WM1A 3P4YA 4P8RA 5JCZA 2BKUA 5AK3A 3VZCA 3TLGB 4EA7A 4ZDKA 1JSLA 3ZJUA 4HUQB 2FE4A 2WUEA 3I72A 2CNWA 3I2HA 3JASB 1I80A 1VL6A 3BRQA 4OEHA 3IUBA 3OSZA 1ZJYA 2R2GA 1CB7A 1J2JA 1U80A 1HKHA 1IZ0A 5I9NA 2R6JA 3ZOZA 4LK3A 1PNTA 3AVXA 1TKCA 1OD6A 4I08A 3VR3A 2HYIC 1C5KA 2PX4A 4DUGD 3Q15C 1OF1A 2JGEA 1KVSA 1N2BA 2RBKA 4QOFA 1I2BA 4D0LB 3I23A 1A9YA 3AINA 5HFNA 3W2TA 5C7YA 1NN3A 5FYQA 3HRKA 1ZD8A 1DBSA 2CJPA 2GA9A 4B6OA 3DE5X 4D9FA 3JQQA 3FWZA 3PS9A 3SZRA 4FI3F 3DXXA 3LDFA 2VDJA 2ZYGA 1JJVA 1QFMA 3B6EA 5H83A 4IDNA 2GZAA 3GZTB 1NASA 2RHWA 2YV5A 4WEQA 4B5KA 1L4HA 5C51B 4UCQA 4CFYA 3CLVA 3BIOA 2FWPA 1H8EA 5MHTA 1LD3A 3S2IA 1G8JA 2DC1A 3DMTA 1XMVA 1RWBA 1UBFA 3L7DA 4FGKA 4W7HA 3I9MA 4ZQCB 1Q84A 3FAKA 3HUEA 4AX8A 1XDSA 3K09C 1P0CA 2RBEA 5COBA 4IFIA 2V5UA 5CBPA 2ZDGA 4RQBA 4GKBA 4I46A 1Y9JA 2APJA 4FIZA 3IDQA 4IM7A 4MKGA 2CFSA 3R3HA 4G63A 1A4IA 3DWFA 1WW2A 4IJUA 1QRRA 3E84A 3GJ8A 4XEUA 5EMNA 4J29A 1B15A 1N0VC 4K9KA 4LZWA 4LWPA 1NN5A 3GJ6A 1ZO8A 3RVJA 4PRZA 2A84A 3D5EA 3DEZA 3PFCA 3T7JA 2JCYA 4HT3B 1DZIA 3QY9A 4CM5A 3JZMA 4PGAA 4I4IA 1UFKA 5GP1A 5K3BA 1Y7LA 4EG5A 5FLEX 2PZAA 3EH2A 4AB1A 4HUTA 3BMQA 4KSYA 4BWFB 5BW6B 1RYYA 3V8QA 2C5LA 3KXDA 5LOVA 3CRNA 4WASA 1TQ2A 2XECA 3MT9A 2C4MA 4C4YA 4BZWA 2WKQA 3H5VA 1K3UB 1WWKA 1WEKA 5E1BA 1HQCA 1ZJ5A 1B0PA 1VFNA 2XKJE 3OFSA 1NHWA 2N1MA 1VKNA 2ZOSA 3A9SA 1M2KA 1O2DA 2GAJA 3EWIA 4R98A 4Z9XA 2AV6A 4JQYA 1H93A 2UVPA 3DOIA 4JL8A 1Z45A 3LBYA 4KK4A 3W2FA 3EZ6A 3E3LA 2QA5A 2EZTA 5AM0A 5IW8A 1E63A 2FP4A 1C3XA 2ZKIA 5KAMA 4QYSA 2ZE8A 2V7QA 5BPHA 1TF5A 1NF9A 2CBZA 4PPGA 5F73A 1YULA 1ZA2A 3MW8A 3RC8A 1ZN8A 5NULA 2BHTA 3CVOA 3BMQB 1MQ8B 1JU3A 2Y67A 5DHTA 1N5MA 5AVJA 3S6JA 3SHWA 2C2OA 4QYTA 5F9HA 1EU1A 1B3RA 2XHZA 3B3AA 4M55A 5D8DA 5THXA 5C9ZA 5LOVB 3GDHA 4E15A 3BSYA 2R96A 1OJ7A 4JZKA 2WE7A 3G82C 2B2CA 3B38A 4RLQA 4RVUA 3F74A 1IRXA 4JWKA 4A2WA 1A2OA 3PIRA 2RB4A 5CYGA 3LPAA 3TRKA 1DKNA 3ZCVA 2FR0A 2QYOA 4CIAA 4DC1A 3C7KA 1F4LA 4XOUA 4QLAA 2UVPB 4FDTA 2LGJA 3PVZA 4O2RA 2J5XA 2W71A 3RTAA 1WVMA 2AFHE 4DY4A 4B09A 3DFZA 1JDZA 1SXJC 3RADC 2JANA 1Y37A 3BX1A 3FIUA 1T0UA 3F5SA 4R8KA 1J1ZA 2FP4B 3UYKA 4D6PA 1W29A 2C9CA 5GY7A 2VATA 3MUFA 4X24A 3DXYA 2N42A 3F5DA 4HDRA 1IB6A 1YR9A 4MRVA 1OYVA 1UPUA 3TSZA 1PWZA 3ZK7A 3I6ZA 1G63A 4V1CI 1FRFS 3ZGXA 1SUWA 4UDYX 2G40A 3BXHA 3DMRA 1Z06A 2HW8A 3AYXB 1JJFA 3QMMA 3WL8A 2VJLA 1NOKA 1BNCA 1NW8A 1LPOA 3BA6A 2O7SA 4FBLA 4MZXA 4IIUA 4QL3A 3K8YA 3P0HA 4BN5A 4ED9A 3ZHCA 1YVPA 3WKDA 3KAQA 1VTKA 2VHVA 4OB7A 1Y3BE 4LQLA 1NNI1 3AETB 3E3AA 3G1WA 3UA4A 4NQZA 5DWQA 3UG7A 1NMYA 2IU4A 2PKCA 4UZEA 5EFOA 5FULA 1YRLA 1UOEA 5LQCA 1SWVA 1CUAA 2VDWA 3LOPA 2X22A 4AKIA 3ETDA 4C43A 1EE2A 1AHNA 2BMVA 1YL7A 3STXA 4OX9Y 4BFTA 4Y9DA 2PD6A 1B73A 5KU7A 5DTJA 4GH5A 3FJ1A 4R9RA 4HDRB 3R1IA 4Z8YA 1SEPA 3KJNA 1HFKA 2GERA 5A3VA 4Q3OA 4EJ6A 3GI1A 1IXZA 3ZGOA 4X8MA 4EF4A 5JJCA 2VCYA 2ZSBA 2WJIA 1A96A 4E5PA 2G67A 4UTNA 2PLFA 4PSCA 5BUQA 4LOIA 2CVHA 2IY9A 4JBYA 5IT9A 3WWYA 3RYIA 5CM9C 1JKIA 5JNTA 1TE2A 1GUAA 3VX3A 3MXTA 2BT4A 3S7TA 4RK6A 2PUFA 1A9PA 1BS1A 4V38A 4NEQA 5EWMA 5TGZA 3QE9Y 1YT5A 4CLRA 4PC2A 2ADMA 2VDWB 4J2TA 3TO5A 2FEPA 2PGJA 1PR4A 3ABQB 4KNVA 4N40A 4UUBA 3WDLA 1CY6A 3PU6A 3OJXA 4I5GA 4I9UA 5E0KB 4UHBA 4YPFA 1T4MA 4E2YA 2QJTA 5GZ1A 4RTMA 5ALUA 3SY8A 3KKZA 3CZ4A 2A5LA 3CXRA 4ZOLF 1OV4A 2F9LA 1F1BA 2H1IA 2WJ6A 1H85A 4KXXA 4MDEA 2GXSA 2R5WA 2J33A 4LG1A 5D5QA 3R0IA 1ZH6A 5D5HA 1J2UA 2QDKA 4ZO7A 5AKKA 1NATA 1WY5A 1T2UA 4MX8A 4F3YA 1E2MA 3LSYA 3H0KA 3O2QB 4CF3A 1J1UA 3RYIB 1RXIA 3CTMA 9GPBA 2FKNA 2HQOA 3HFRA 4FFDA 4F04A 4QE3A 2YRFA 1PYDA 2QG6A 2YZ7A 1SG0A 5EWMB 1NJ8A 2OYCA 3NNSA 1NY5A 5AYVA 5AVYA 3OZSA 4BJ6A 1AUVA 2JGFA 3F90A 2NMVA 1HNZB 2XAAA 3KTOA 4JEMA 2JI9A 1NV8A 4B81A 1RLUA 3P2IA 3HEAA 2AUMA 3OLQA 4UDOA 1FOEB 2MU1A 3UO8B 2IX3A 4JC8A 3CNOA 3RTBA 3IQXA 4MHOA 5EUCA 2FLWA 3CLSD 1MJ5A 2A0YA 3DVQX 3GJ7A 2EWWA 2VF2A 2ODBA 1OXBB 1BEEA 5KHLB 1QE0A 3AEYA 4GZMA 2Q1TA 4RADA 5K01A 1AZSC 1XTRA 1ZGCA 3C3JA 5ALTA 3X1KA 3E9CA 2HSGA 1CNMA 4BV2A 4ZXFA 1NVTA 2F55A 2YJZA 4TZTA 3BCSA 3RRXA 1DC3A 1HDEA 4K7JA 1G9TA 2B8WA 4WWHA 3ZHTA 5CDYA 4KUHA 2P68A 3WA7A 4E94A 3JQCA 3QU5A 4FDUA 2VQ6A 4YDSA 5CYFA 4OM8A 1JDSA 2AN9A 1JQBA 1P8AA 2P4UA 4LX8A 2G09A 2Q2WA 1CY2A 1WSDA 1JECA 5KNDD 4QFMA 1QHYA 3PUXA 2JA1A 4MRNA 1L5HA 4EJSC 2PWZA 1B2RA 1H1DA 5TQ0A 1D7OA 1U3GA 4XM0A 4KQFA 1XZCA 2F9FA 1ZCZA 2XZTA 1AUXA 3AFGA 4R8RA 5C3UA 4JYAB 3U1TA 4H6VA 4QDKA 4CTJA 2XT9A 1IHPA 4FLEA 4TS9A 3E48A 3SVZA 4BO5A 4LHVA 2VYVA 4AVYA 2HWYA 3R7BA 1U7OA 3L6EA 3FCUB 5KOIA 1SKYB 3JWEA 3ODGA 1HF3A 1H9AA 1WKVA 1ZUNA 4HWPA 4JU8A 1K6JA 3LPDA 3EB9A 3GVIA 3QP9A 5EXXA 1QGYA 4QG7A 1R15A 3LT0A 3N8IA 3H83A 3CW2A 3RAJA 5LNK6 2V8BA 3M9XA 3FIJA 5KJ6A 5HGXA 4PHFA 1K68A 1OU4A 1F2DA 5I8ZA 3FRJA 1RBYA 5CTJA 3BL6A 3EDQA 1GZVA 1RAGA 2O8NA 3JQPA 1L5HB 5DCWA 1TF2A 1XCOA 5TQ0B 2NV2B 1H5QA 4Y7DA 4HH1A 2P5UA 1DKRA 3CUTA 2AFHA 1KDYA 2O2HA 3O94A 2XGOA 4AIIA 2PXHA 1I10A 3VNBA 4F60A 1MW8X 4P4TA 3N8NA 4R69A 4FLFA 3V9AA 4F56A 3AI2A 1H2WA 1TPYA 3UB2A 2O3RA 3R7NA 5G02A 1GGEA 1QRDA 1Z17A 2YMLA 5SYMA 1SU6A 2V97A 1U04A 2VG8A 3C5VA 2PT7A 3G9TA 4L0DA 4D82A 1F38A 3G8CA 3H4VA 3I5AA 3A6DA 1T0IA 2NXJA 2QTGA 3DTVA 3GHHA 1G60A 5HK8A 3MUOA 5K0NA 3LZ6A 1JZSA 1N92A 2JDID 2TSYB 3KQTA 2LVBA 5K5EA 3KBBA 5DI3B 4ZJZA 2QVLA 3W7VA 2PH7A 2NVBA 1QHXA 3EAGA 4A15A 5AUNB 3JSXA 1M8PA 5C7OO 1CEEA 2QX6A 1I6LA 1QBGA 1I33A 1EJ6A 2BVNA 2AFHB 2KW5A 3A2MA 4GC5A 4LMBA 1XMQB 1XA4A 3RUCA 3L5OA 3U9LA 3NB0A 5HZHA 2VAVA 4CN9A 1TJ3A 4G0QA 4NNPA 2OEPA 3A10A 1QP7A 3A1SA 4B2PA 3VKHA 2BKVA 1DT3A 1KA9H 3P94A 1QYRA 3D5QA 3PT5A 1EE1A 3D8RA 1UEJA 3TUJC 2OK7A 1S1MA 4AURA 5KSOA 2ALJA 3MEQA 2V7VA 3OE1A 4PXYA 3AVVA 4Q9HA 4NYMQ 2QWXA 1NDHA 3QVWA 2G7MC 3DFIA 4F91B 5LMUB 1QGUA 2P2SA 4IJVA 2JIMA 2C07A 5LZ4A 5CFNA 4DTIA 2W11A 1JYSA 2AG0A 1SHTX 1U7WA 2R8BA 2Q6IA 1ZQ9A 4Y2RA 2PANA 5JXHA 3CVVA 1PHPA 1PJBA 5HM8A 3ZIDA 4V3BA 3QMVA 4MMXB 1RXCA 5FBLB 4BP1A 3DO6A 4UOEA 3F71A 4AJ9A 1STOA 3NOQA 3U6BA 3IFSA 3EGXA 4MA0A 4F1WA 2LKDA 3L7IA 5LYJA 1IN8A 1BO6A 3PXBA 4ZEMA 5ITZA 4HWRA 2WSIA 2I1WA 3WGMA 4XM1A 2P9JA 2OECA 4NMXB 3HYRA 2WE8A 2IH5A 4PGMA 4FZVA 1OLUA 3ZDZB 3PC2A 2OCDA 1H2FA 2GO7A 2PMEA 5BQOA 1JTFA 3KOXA 5JFOA 2ID8A 3VVCA 3V6MA 3O2NA 3DHVA 1V4NA 4NQRA 2IE0A 1K8YB 2XOXA 3EEQA 4G65A 4TTQA 1PK7A 1YA6A 1QGUB 1FZTA 1M33A 2IIPA 2F48A 2AJCA 4KAJA 2CLKB 2MSLA 2DPXA 3O8QB 2JI4A 5TDHA 5JZ9A 2C4VA 2WU1A 5JSYA 2OB2A 4NJMA 1H42A 1E6MA 4NV1A 2WG1A 4MV0A 1CRQA 1XTBA 2RH4A 4RK1A 4KXWA 4M4SA 4MSUA 3SBOA 3FPHA 2IYQA 3EXIB 5TEWA 3EGXB 4NNOA 1TTHA 5LYJB 5HX7A 4KPYA 3O1HB 2XCOA 2XRMA 3BSWA 4A6DA 1F51E 2ATXA 4ZZ0A 1M0WA 1NAHA 1NP3A 3H1TA 4ZCLA 5ERGB 4ER0A 1OLUB 4ON9A 1S8AA 1ZOOA 3EY4A 4H7FA 3ZXYA 4EQZA 5A4FS 4IKPA 3WOVA 4I9NA 1ZM3A 3TOCA 5A3SA 3FUCA 2O8CB 2DY1A 3D0QA 4K6KA 1AX9A 1JWAB 3LHKA 3QQ5A 2DBVO 1LV7A 1GTMA 1M2VA 4MGYR 2EZ8A 4TV9F 5D3MB 4JS0A 4JL5A 1T3ZA 4ND3A 3DLHA 3EK2A 1XWIA 4Q05A 3RFTA 3VVLA 3ZE1B 2GFHA 3HFJA 4IMRA 1VMAA 1OAOA 2GFQA 3IULA 5DYIA 3DE7X 1YUMA 4UQPA 1R0BA 2VHJA 4TLCA 3ANSA 1SVIA 2LE0A 2KWIA 5BV0A 1VMIA 1IG3A 2AC4A 2QAJA 4J7CA 1OSNA 4DMHA 4BNJA 2QL7A 2HKIA 3H8SA 1DRKA 4LX0A 1JU4A 1YWGO 3RUPA 4MUFA 4NBVA 1O8CA 1W6RA 4QDJA 4F7WA 2DMRA 1N6OA 4WINA 1ISMA 1SVLA 1BE8A 4HNRA 2JGKA 4Q4DA 3NIWA 5B58T 3RVKA 1EG7A 4PO9A 2QTRA 3QI2A 2CFRA 2VOJA 3HDGA 3PXXA 4KL8S 3HXOA 1M2VB 4YCJA 5FPTA 1U0NA 2P9QA 3R5SA 2PZFA 1M6NA 1WRBA 3V3TA 1BN6A 3NORA 5A0TA 2B4TO 4HLUC 1Y1PA 1IHXA 2ZJ6A 5B4UA 5K0LA 2F00A 2D7CA 4IJMA 3AW9A 4N3CA 1XL0A 4NXNB 3AP3A 5T3UA 2G0NA 2AFIA 2H52A 3DYBA 3PKJA 4KN6A 5HFAA 1Z0ZA 2DFTA 1QFYA 2SBTA 3C2QA 4IG4A 5ESWA 3WLKX 5HOQA 1GTVA 5DHSA 5HMLA 2WJWA 1JQJC 4UUAA 4XUEA 1CQIA 2JIOA 4HFRA 5BY2A 1XXHA 1H9CA 2WWWA 3WG9A 3Q1KA 1RWOA 2EJTA 3B12A 5IXJA 4OLBA 1WSAA 3F96A 2CB0A 2QW8A 1G8AA 4AJPA 4AROA 1Z6GA 2GS9A 1H4VB 2EL9A 2XWPA 3HM2A 3MJSA 1VFPA 5IMSA 2A4KA 1YZGA 2CMGA 1WO8A 4KVFA 1ONBA 2PTHA 4F5EA 4E5KA 2CXNA 3E05A 3NBZC 1ZWKA 1KAHA 3HG7A 4Q1AA 3HWSA 4ZT6A 4CG1A 4BQIA 2IYYA 5B3AA 3K8OE 3K0BA 1KYIA 3G7UA 3PWZA 4LY9A 3ESYA 2V6FA 3OUZA 4YUYA 1TUGA 3TNFA 1NXSA 2PWBA 3RDPA 3L82B 4G1UC 4LY6A 1V9LA 2AFIB 2DUJA 4BX9A 4X7PA 5FO0A 2QG4A 2VYFA 4EF5A 1YA8A 4OGKA 4QT0A 4ZMBA 2ZI5A 1EQUA 1GPJA 3IBCA 1HT3A 1PG5A 1P75A 1XXHB 2B2XA 5KBYA 1VGVA 2C5AA 2QLNA 4FW8A 2CVOA 1HLPA 4LJ7A 4Y0VA 2HLNA 1EFDN 3VDXA 1HE3A 1N6KA 1Z0FA 2H18A 2PRZA 3IV6A 1W0KD 4LXHA 1LV8A 3AUFA 3ZCSA 2BZSA 4HPJB 1SURA 4LF9B 2QRPA 4DR6B 4DBZA 3C70A 2YWCA 2ZJ7A 2Y1GA 3MOSA 3KQHA 1R12A 2A0WA 3R2JA 5A1JA 2B5VA 5FO1A 1B43A 2GX6A 3JRNA 3LUPA 1S1CA 4I5FA 4P3KA 3UAZA 3DYIA 1J20A 1NNUA 2BAGA 2HRZA 3MCVA 3P45A 4HLDA 4IOMA 2H1FA 4JP3A 4R9VA 2HBRA 2EARA 1B6GA 4TWRA 3T4EA 4KH1A 4B73A 2OO5C 5L9AA 3LL7A 1A4UA 3X0DA 3FCYA 3OCWA 2QN9A 3KTDA 4XDZA 3PCRB 3BHMA 4RZSA 2LDXA 1VLQA 2GK6A 4X91A 1HNNA 2Z95A 2J09A 1IY1A 3GK3A 3HVJA 4B8ZA 5FKJA 1A9TA 5F21A 5FEMA 4TWZA 1JAXA 1YKFA 4KWEA 1CZKA 1YHZA 2IODA 3FOWA 1NKSA 1V7PC 3ROTA 4BX0A 2HGZA 5IZCA 1Z8FA 1PWXA 2WJ4A 3NUZA 3ZDXB 3UAOA 2JBHA 5D51S 3BE5A 3EEYA 4OFWA 2GPBA 3ZXSA 3P2EA 4HH4A 4RHEA 1HDCA 1ZUHA 2PFSA 4ISCA 4XUCA 4MQUA 1SUSA 5EVCA 5CA1B 1SZCA 2J3IA 2OC9A 4HFNA 5L3ZA 3K6RA 3KOMA 4U9IS 2AT1A 2JG3A 1PFVA 4B3FX 2H1CA 1VQ1A 2XYPA 1JEJA 1SUIA 4EY7A 1G8HA 5KKNB 2DBRA 2J3HA 3BVPA 1A69A 3B82A 5TPZD 1J8YF 5JDCA 4QBHA 3U7RA 3P9ZA 3RH0A 4WVLA 2JIDA 4NDAA 1GFIA 1VPLA 2G6BA 1KFKB 2I4LA 1ZNXA 3AFOA 3LQ4A 3QELA 3SIPA 4AMYA 3DVRX 1R8SA 4BNNA 2JGNA 3E23A 4M99A 1R5OA 4DMRA 1SCUA 1FPQA 1TZBA 2OBNA 5I7AA 5BNZA 1TW2A 2YWRA 4BVKA 2D5LA 1MA0A 5LMZA 5MFPA 4C3ZA 4ZODA 1DFIA 1RU3A 3QFHA 4KE6A 4UVEA 4OFXA 5GTDA 1UQUA 2VAWA 3ZHSA 3HM9A 3N76A 1FSFA 1Z16A 5BUCA 1P2UA 2C04A 3CF0A 1D2MA 4B7AA 3OOEA 4HNTA 1U1CA 1EXVA 3EFEA 3R6GA 5HWSA 1W36B 1C7JA 4F8EA 4WFQA 1J07A 1G7RA 4IDAA 2W37A 5CLLA 1Y8QA 3PFGA 4MWSA 2HWWA 4MQBA 4NMMA 1SVNA 2HCBA 4X60A 4TXJA 3S2SA 3L77A 5TSDA 3GEMA 2J41A 3H19A 3QBDA 4WX2B 4D7AA 1AS3A 1TK2A 3I73A 1Y7IA 5ES3A 2B21A 1FZQA 1TO6A 4Q0MA 2V3CC 5KSPA 4ZU1X 2B2NA 2ZBVA 1D2HA 4DGQA 4UXHA 5IHPA 2JAPA 2NVUA 3CRMA 4TRRA 4B43A 4Q9LA 4AS3A 1XCPA 1N3IA 3S3TA 5CB6A 2W58A 1YRAA 4R16A 4BQFA 3LZDA 1L7EA 4DQXA 2W00A 1TCBA 3AWDA 3WNQA 3SM9A 2Q0HA 3ZQJA 1VPDA 2BGIA 2R48A 4CIVA 4U7DA 2DKOA 1QLJA 5J4HA 4L8GA 4F3NA 1G7CA 4EG8A 2CLMB 3K0EA 4MPPA 3RSQA 1DEHA 3M6VA 4EHHA 4ABYA 2Q5CA 3GZNB 5I5EA 4ARUA 3EX7C 2IXBA 3I3SR 1HK7A 2AQIA 2QSZA 1V9CA 3ROZA 1UPAA 1PG0A 2GCOB 3CLRC 4RE5A 4LYEA 3R7FA 5B4VA 5CB0A 1ZOSA 2VP2A 3NP7A 4URHA 3D3NA 3TPCA 2J1LA 1C9YA 3GRUA 1CHDA 4IIHA 3IA7A 1ACJA 1I2CA 2NVUB 1IMOA 3TOXA 1D6NA 5H8WA 1A8UA 2QX4A 2WF6A 4QPDA 1ESEA 1Z4QA 1OGJA 3EMKA 3SJ7A 3W5IA 4CDNA 2YZNA 5BORA 3UT5A 3HZHA 2C1ZA 4EO7A 4WEOA 3UFBA 3IUMA 2CNDA 1G2IA 1EVIA 1T8TA 3W3AD 1F9EA 1DLJA 4S2EA 4HVLA 5HUQA 4I1VA 1Y5MA 5G0SA 3SMVA 3PPXA 1Z0JA 3HTXA 3MA0A 4CR8A 2RGAA 2XYQA 3NWJA 4M54A 2AX4A 1K3FA 2BV3A 2PL1A 1P5JA 3FTFA 3FNHA 3JQFC 5TMBA 3WKEA 1W5FA 3L06A 3N74A 2AF4C 4L85A 5DNEA 1ZK0A 2PX8A 4ND2A 1J5PA 3GDOA 5KQSA 2HJ9A 5EE3A 5A9RA 3QU4A 4D3ZA 1JYEA 4YRPA 4LI0A 4WOKA 2XDAA 1ORWA 4BCDA 4ZGWA 1SH7A 5E1OA 4EYQA 2D1SA 4RPKA 1F9AA 1B6RA 3UT5B 3NBYC 4Q47A 2XBUA 4UAJA 5ESXA 4PGGA 3TLCA 3OF3A 3LPLA 4CIYA 2HO4A 3BN3A 4OBXA 1L7PA 3TTXA 1C8LA 2BHSA 1ZNYA 4GLLA 2HMUA 3F49S 5JYDA 3I9NA 3JQ8A 2HY7A 3CKMA 3VNUA 2Q3JA 2B4KA 1QOPB 1DWOA 2GB4A 2N0SA 2EYUA 3H9EO 4V0NA 4AP9A 5JMTA 4C4XA 1GPLA 2QOEA 3WDSA 3JPYA 5H4HA 1HZZA 2RHBA 3SBEA 1XEWX 3SEFA 5DBIA 1EI9A 4V03A 2WR8A 3ENVA 1DBPA 2I80A 2VT7A 4H6WA 1ECFA 4NG5A 1T2DA 4UBKA 3H05A 3H42B 1DKQA 1XEWY 2WABA 3HPRA 2HMYB 4FZJA 2QRNA 1RXVA 2VP0A 1UKEA 2HJVA 2V98A 4JU9A 4L9AA 4QOEA 1RBMA 4QX6A 5FOQA 1A5TA 3P27A 3RS2A 5TMDA 3VX4A 1T5BA 2P3LA 3Q3CA 5LP6F 2CHEA 2AL7A 3RRFA 3TE7A 2WAOA 3CUWA 4JAVC 5DULA 1T4CB 1HPLA 4KGXA 2A92A 1S8FA 2O05A 3NAZA 1R37A 2AK3A 5D6OA 1M2WA 1H2YA 3JQ8B 5EMJA 3HZRA 2QX7A 1XQWA 3B3GA 4M22A 5GJVC 3JX9A 4DSOA 4L4UA 2Q4RA 3W9YA 2ZAYA 3BWBA 4B1FA 4C2UA 3DLAA 4I1RA 2O06A 4XWYA 1LQTA 4CTOA 1GRNA 5KB3A 3UPUA 1MNQA 1ST2A 1D2CA 3VM6A 2GBLA 1NFFA 5DLYA 5ALFA 5IG2A 2D3WA 3IQIX 1FUYB 1TEHA 1UKYA 2EGHA 2DFPA 3P9YA 4QC2A 3CCCA 4V0OA 3RIHA 5INTA 2B30A 2TYSB 4U0JA 3FKSD 1E94E 1UEXC 4CEIA 3QE4A 4HR7A 3RHSA 1M34E 1LWNA 5BQ3A 2X3FA 3OTIA 1IQ0A 2ECFA 2WIDA 2XOEA 3NYQA 3JYOA 3LTNC 4QM6A 2IXFA 2YJNA 3BJMA 1CS0A 3GZ4A 4TKUA 2IP4A 3L1HA 4W9MC 3E3NA 2VDVE 5EE1A 2Q1UA 3T7RA 3BMCA 1Q0QA 3L7KA 3Q7SA 4GE3A 1B0AA 3SWWA 4D8TA 1UEIA 2P2LA 1X6VA 3L02A 3HI4A 1NAIA 5LLSA 1ZSYA 1E7SA 1E2JA 2FX5A 3FPLA 3DHWC 4RORA 4JYZA 3SMQA 2IS2A 5LU8A 1AKTA 2JC3A 4J1TA 1MG5A 1BC5A 1P1JA 5BN1A 1XCLA 4EYEA 2G1JA 5JJIA 3VR4H 3EIOA 3OPXA 4YGXB 3FE2A 3QLUC 5DCYA 3X2FA 1RRPA 1V3QE 2ZSDA 1XK6A 1PL8A 1GSAA 2BJVA 1BFDA 3KXLA 3EZFA 2JAQA 3M3PA 1QV9A 4PFSA 1U9ZA 2NZYA 3NC0C 4TUYA 4CEIB 3PT9A 3MRXA 4KUGA 2RAUA 3WBKA 3BWCA 1PW7A 3D0OA 3P0IA 2ECKA 2JK0A 1CS0B 4FCCA 3LKBA 1U2SA 2VSFA 3VPHA 4OHOA 5JTTA 2ZSFA 5ALRA 5HDBB 1NRWA 4GX1A 4GWKA 4K46A 2G0TA 5ESDA 2NX2A 4EUEA 3OU6A 1RM5A 2VSOA 4RCVA 4LWZA 1QWOA 4YJKA 4GR5A 4KRGA 4DRXA 2EWMA 2HPZA 1TJNA 2OPBA 3N59A 3KLBA 1DDGA 1P7YA 3MTGA 4Y9TA 1JLMA 3U4GA 1G2QA 1MX5A 4H16A 5JUWA 4BUZA 2CYBA 5JJKA 3UGJA 4EARA 4JJIA 5F4BA 5CXUA 5KTKA 3JVDA 1QU3A 2J3DA 4PAWA 4YCDA 5EIOA 3DXZA 4J0KA 3MQ2A 1TT5B 3KNZA 1PTJC 4YRMA 4H6PA 1POXA 2DY0A 4MS1B 4WLUA 3FDIA 4J0HA 2UZ1A 3ASZA 4YAJA 5KDLA 3QA3E 2ZUBA 4URVR 4M2LA 2C3MA 1EEXB 5K7SA 4L6IA 2FJ0A 5ILGA 1Y5IA 1KK1A 3JVEA 4CMEC 4MGZR 5JS2A 3CNEA 2JIZD 4HLCA 4CG2A 4YAUA 5K0CA 2DH6A 4XQEA 3V97A 3CMCO 3M4YA 5FT9A 4DRXB 4F5YA 1YQXA 5K0ZA 2WFMA 2LRHA 3F5MA 4OOEA 4U7HA 2WBLC 4M49A 1RAFA 5ALXA 4RKQA 3W9BA 13PKA 3EZNA 1UCFA 4H1VA 2XGSA 1ZXBA 4D9MA 3WVNA 2IYTA 3GUVA 1C1YA 3W5SA 1FCJA 1JA0A 1J00A 3PNQA 1PSWA 1F8XA 2ZI6A 3ORFA 4RGQA 4HB2A 3T95A 1PDWA 1ZRHA 2Z5GA 4DS3A 1G2PA 3KUDA 3RIXA 4M98A 3BWDD 4BL5A 1R4ZA 1V7CA 4ACBA 2ZTUA 4K6OA 3NT4A 4HC4A 3ZJTA 4D0SA 1IY8A 2KLHA 2QD3A 1E4YA 4Q1BA 1VG0B 3D02A 3R9IA 5J58A 1M8FA 1TU3A 3ROQA 4C1BA 4AAYA 1NJ2A 1E1NA 4IHKA 4YECA 1UZMA 3PITA 1R64A 2ZSHA 3RS5A 3SC2A 3LD9A 2BFNA 5I7VA 5SZHB 5H68A 4D81A 2HV8A 2P2ZA 2E0IA 2RK4A 4A1OA 2YVUA 2OXCA 3A7DA 4J07A 5DNWA 2FPUA 1USVA 2JS7A 2JL1A 4FFNA 3OPQA 4ZYTA 5BR7A 1DIOB 1EK6A 1YBVA 2QM3A 3BTOA 1A98A 2VN8A 1O5OA 5SYAA 4KN8A 5HKKD 4XWWA 3PIDA 3Q5EA 1H8HD 2YWHA 3CH7A 5AI4A 2QTLA 2VT3A 2JLUA 2KMLA 2WDZA 1WU8A 3CRW1 1OA0A 1CE8A 1S5PA 4FMCB 2R5NA 3ZX4A 3DCYA 4QASA 1MU0A 1Q22A 1QO0A 2E4UA 3LLCA 4G2NA 1TGVA 1V95A 2CHGA 4JI7B 4TTRA 1NI4A 4A8HA 3VAZA 4B7CA 4O63O 4EZEA 1PV2A 3HB0A 4YN3A 4KV7A 3R7WB 3RQSA 3H1PA 4YAWA 4HVTA 5K8TA 3ZTWA 2F1RA 4W9RA 5FUQA 3UV7A 3ZTTA 4CJXA 3IQZA 4FYYA 1Q7BA 3SC2B 4L8YA 1A04A 4RMIA 4F7DA 1BEUB 1J5XA 1DQPA 4NFLA 1U1DA 1BS2A 4LRSB 3DMYA 4G1VA 4UNPA 3WIBA 1EK1A 2A7QA 3IVGA 1P39A 4M3NA 1T5TA 5HIAA 2O8FA 5BYKA 3LX6A 2NNLD 1DOAA 4U6QA 2R5FA 4E08A 4H35A 4FJ0A 3WLIA 3DMFA 3VR6A 4TN5A 3KDAA 4KLCA 4MHSA 1YB7A 4ZHQA 1CE8B 5T67A 2L18A 1XAGA 4YS6A 5T6BA 3N2LA 2BH9A 3BBPA 3CBGA 3R4CA 4TKLA 5FOSA 1NI4B 1PYGA 3G7SA 4ZMSA 1PE0A 5IZ4A 5KIAA 4XYMA 3WK9A 4Z4IA 2BKLA 4HQKA 5A2GA 1TA9A 3IQGX 4HGZA 2Q4DA 5B55A 1NR5A 2YIMA 5D6NA 1FDTA 4CDGA 1AQNA 4OA5A 3GN1A 2H7YA 4XXHA 1WBBA 3ZWPA 1ONPA 3BGIA 2XD9A 2VVTA 5B4TA 1WPGA 3L4KA 4C4OA 2VNHA 3OIDA 2VP9A 1BIFA 4FWBA 2BBTA 1MQ9A 4MPDA 5EUQB 4RTOA 3B51X 2VBCA 3NT5A 4MWZA 4YC7A 2ARKA 1AN9A 5KDDA 4F2DA 4UOZA 5JS1A 3CLUD 5A6SA 4YREA 1S4QA 4ZANA 1TNDA 2IPMA 6CHYA 5DKFA 4P58A 4HI0E 2BF7A 3OICA 2PFKA 5DRTA 4TRNA 4ZHQB 1G38A 4XRGA 4FD2A 1WD7A 4ARBA 3NX4A 3A4YA 4EFDA 3MRTA 4MJ7A 5BYJA 5JVDA 3AHJA 4ZJYA 3GNSA 2RK6A 4CQNA 2B7CA 1DC4A 4UDNA 4YQZA 3IVCA 3U3DA 3BGDA 2OILA 3ZIAD 5EI5A 3MRSA 2AR9A 1R2QA 1M34B 1Z28A 2PD4A 1PP4A 4OXRA 3BZBA 4YAOA 3KT8A 3SF0A 4DV5B 1GZ6A 3C48A 3NHUA 3QA9A 4UE2A 1WMSA 4WGFA 5EVJA 3KKLA 2PFGA 1UC4B 4L07A 4BBAA 2BSQA 2X14A 1W9HA 1Z4OA 2Q07A 1IMJA 1TM2A 5E0OA 5A6SB 2QR3A 1RCTE 2PO5A 2XAUA 1TTQB 3L18A 4O2LA 4OGFA 1CLUA 1XUOA 2ZXUA 1N1EA 4LOKA 1AXGA 4RS4A 3A14A 4RZ2A 3USZA 4EPRA 4MVYA 4Z1MD 2GHQA 3BAFA 1CDZA 3KOZA 1N0HA 3QXCA 5MN6A 4BYGA 2XVZA 5JVDB 2QE7A 3IBFA 1JHXA 3ZXXA 4C3OB 4C5AA 5J23A 5IARA 1P6UA 3C6MA 2ZT8A 2W2PA 5H3CA 1KXJA 1EG2A 5DBHX 2XYHA 1QB8A 5U9CA 1QP0A 3K7EA 3CV3A 4EFMA 2H9YA 1G5FA 1M8GA 4RK7A 3MCTA 2X6TA 4WNYA 3V8EA 3FUXA 3RARA 4B9EA 1EFHA 4O4LA 2DLNA 2H1OA 2PZBA 3TUZC 1V47A 2FSVC 3DAGA 3TJRA 4IEIA 4E7OA 1YNSA 5J59A 3DBOB 1XLUA 3OZUA 3H2GA 3TN7A 5DM2A 3LKDA 5JO0A 1XL1A 3KZKA 5DVZA 4KQHA 4F45A 2XEDA 3H2SA 4KIWA 1XX6A 2VAPA 4ZT2A 3RFUA 1M5RA 3DOFA 2XUIA 2ZCVA 1ZGJA 3O7WA 3QE2A 1DJMA 5IAJA 3WNVA 1QO0D 4UTZA 5HFJA 1T3GA 3KEFA 3KT3A 3NRJA 5JRDS 3E8MA 2HSDA 2D1FA 4XYLA 2HBQA 2H2WA 3AUKA 2O6LA 3C1OA 1VRWA 3ADKA 2KI5A 1T43A 4DWJA 5L6MB 2HTFA 3CKYA 3D3KA 4CQMD 2UYOA 4PWZA 2XQKA 2ZRKA 3VNVA 3GRAA 1JG2A 1O6ZA 1SXJE 2WAXA 4XGNA 1T8UA 1T34A 4LXGA 4JBLA 3BT7A 3FGNA 3I1IA 4P3XA 4EK9A 2GN8A 3C3YA 2IYVA 5FADA 5F7XA 5K0EA 4J43A 4R4JA 1I36A 1QR6A 2CGEA 4MUAA 4JDUA 1G17A 5LDHA 1GGKA 5EPOA 3I64A 4LFCB 2GEKA 3H04A 3DDNA 2RHLA 4BMVA 1KRWA 1HLFA 2DWPA 4RFLA 3O8NA 4GLFA 4HK4A 1TTPB 2JCSA 5AJHA 1HDZA 1GOTA 3A27A 3EEOA 4JFAA 2Y93A 4TMKA 3PTLA 3T5AA 2XXJA 1GR0A 3A1WA 4TTSA 5FPPA 4X84A 7AT1A 2VAMA 2NZUG 1IDN1 1N8TA 3O47A 4BUJA 4N5DA 1DUIA 2VOEA 3QWAA 4CM9A 3C4VA 4WK0B 2IFTA 1G55A 2NOAA 3D64A 3SE0A 3E8SA 4YRBA 2D6FA 2AEFA 4L7QA 3MINA 1YS6A 4JVNA 4N5HX 1GT91 4P31A 4JMLA 3TX2A 3O8BA 3OIGA 4M87A 3HVIA 1ZNWA 3KV1A 4MP6A 3ZDYB 1NF3A 4EQ6B 2I6XA 3ZE0B 3TZBA 5JR3A 2O1XA 1VZ3A 2FWAA 2O2CA 3G3EA 5CPBA 1YQ9A 2VHYA 3TLMA 5CG1A 1LRKA 2Q4EA 4W8HA 4IG9A 2WWTA 4OGLA 3T4XA 2X19A 3PI6A 4EW3A 5I47A 4ZTZB 3LO5A 5I9IA 3KE9A 4F1JA 4LJLA 4P98A 1WXWA 1NXOA 4MI1A 5CA0F 2HMTA 3G2HA 3I52A 3Q7EA 4RA6A 1K92A 1RQPA 1X38A 2EF0A 2VAXA 2R7KA 2XF8A 4BZZA 3AJRA 2QX8A 1NULA 4UVGA 3CISA 3CNQS 3DEAA 5B2EA 2X8JA 1A82A 3NKLA 3VJKA 3AW8A 1TYDE 1NQ5A 2P0AA 3OM0A 3FOBA 2IHYA 4TXHA 1II9A 5B1HA 3M4JA 4OQFA 2OV1A 3GXBA 4PLCA 3MINB 2ZIVB 5FWYB 3A04A 3FKQA 3NIGB 1H5NA 1J49A 4RDHA 5KTSA 2F43A 5K05A 1A88A 1SHLA 2QW1A 5JJ5A 3KDSE 1D2AA 2JFFA 1UJ5A 3DZFA 4HAVA 4Y6LA 5CT4A 4R0MA 1H94A 1JA9A 2BMEA 4F4IA 1BE1A 3EDCA 1WPXA 3PFBA 1B1AA 3C1TA 5JI3E 1KGDA 1ZY2A 4KFCA 3ISTA 1NVKA 4EBFA 4LGCA 3EF1A 1CJVC 4AUNA 3KG2A 1GJRA 1C4OA 3QVGA 4X66B 4R41A 2YZGA 2AEEA 5AUQA 4CFZA 2CWWA 1I4LD 1WJGA 1MBZA 4OXNA 1L4EA 3BDAA 3KHTA 2X8JB 2ZETA 4BC0A 1QC5A 3WRVA 3CJRA 3DT8A 3IKMB 3SCZA 4YCCA 2RI0A 1HDOA 2H1RA 1U99A 3MD0A 4Q7JB 4RHYA 2VYCA 4OK5A 1A4RA 2NZJA 2WPDD 2VPTA 3TOZA 2BPOA 3WGLA 5KNCA 4ZXPA 1TMKA 4R5HA 3M3DA 3ZCPA 4PE5B 4GOMD 4XFDA 5DMXA 2F43B 5IAKA 1P45A 2E4AA 1GPYA 3ACCA 3WNDA 2CMKA 2EZ9A 1LS1A 3V7FA 1L4UA 1SHKA 4P7FA 5E3IA 4FOTA 4ETWA 1CRWG 4K87A 4DMGA 2C03A 3GUUA 4NCIA 2JLBA 3A1NA 2QXTA 4QRHA 1BMFA 4EHFA 1SZJG 4RYDA 4XFJA 1AUOA 1JL3A 1L4LA 3DS8A 3NPMA 4KGZA 3DD5A 3QVGB 3FMFA 3EARA 4FBMA 4S3MA 3OZCA 4RELA 1QCDA 2FMUA 3L7CA 1Y3FE 5DCLA 1J06A 2BMFA 2ZVPX 1G16A 2YASA 4XSGA 4O4HB 4FHCA 4PNEA 1QC5B 4HNGA 4MQ6A 4UU8A 4C0KA 5A03A 2ACEA 3VZRA 5K6TA 4AN0A 1Z39A 1JG7A 1T25A 4B4WA 1QRUA 4GVPA 4P7JA 4D9HA 4EMSA 4RULA 2ZZMA 1ZH4A 4CI0B 3TJMA 1YMUA 3E0QA 3CMMA 4ZEWA 3ULKA 1US8A 3PGKA 3MAAC 4HFMA 2CMFA 3MTIA 1JHPA 1H2XA 1NWCA 2WB4A 2CBXA 2OQVA 4YQEA 2DVMA 1AE1A 2E37A 5A71A 1E0KA 1B1CA 1YI8A 5HF9A 4EAQA 2X8LA 4PANA 4AKHA 1W19A 3AWIA 2RBGA 2AH5A 2QIOA 3AKDA 1Z4IA 1N3YA 1VJCA 1VXOA 1RHRA 3V4OA 2ID7A 3P2KA 2Y1XA 4S1TA 5CNKA 5KNDH 2C78A 1MA3A 3SF8A 3UUFA 1Y1QA 1M7BA 1CYDA 3VHXA 2FGJA 3TGLA 2VRNA 4BWVA 1ZIDA 1L2TA 1CDOA 4YBZA 1KSGA 2VDNB 3SGLA 2HHAA 2FR8C 4PZZA 4M46A 5BOSA 4N5LA 3TLJA 3OCXA 2EKPA 2PX3A 3NEAA 4B9AA 1GPUA 3HDJA 1IXYA 1NXVA 3TEFA 5B53A 4J94A 4Q4LA 5EERA 3WGTA 3JD3A 4ITRC 4KDRA 4HXFB 1US8B 2WNIA 2AVDA 2EDAA 1OU0A 3GFGA 3KHUA 1W4RA 1Z2OX 3A3YA 2N9UA 2BTEA 4LJYA 1JIUA 4MYHA 1PQWA 1FLNA 3IAFA 1I24A 4JA2A 3WTCA 1YR3A 3DVLA 1VJTA 2EFDB 3BICA 3H5OA 4Q24A 4JR0A 2AA3A 3HU2A 1JIQA 2E9SA 2B4YA 2RJ3A 4MLPA 4QGGA 2CNLA 4K8OA 3OPVA 3K9FC 4DV1B 3SXUA 4BMPB 1FYDA 4WZAE 3SF8B 4ZYXA 3O2SB 3VHXB 2JJMA 1P3Y1 1UC5B 5TE9A 5AUOB 2OHHA 1J6UA 1TX4B 2Y0BA 2XMGA 2Z2JA 3EAQA 4JBIA 4R1SA 1QTNA 4R1QA 4RWEA 3UMJA 4IUDS 1UK8A 4IGKA 2JIPA 4JLBA 4N7BA 4UEOA 2RH8A 4A8JC 5D7NA 4QTZA 1M7HA 4Q1VA 3P0EA 3X44A 1P3DA 4AJLA 1XEFA 1LPPA 2P3QA 1CEQA 3RKSA 3F7OA 2AN1A 1JJ7A 1HSZA 2UZ4A 1PJ3A 3A36A 4E33A 2QD2A 2WG0A 2K2QB 3UICA 4KIUA 4QOIA 1VLMA 2FF5A 2VUTA 5K1ZA 1ZMOA 4ANFA 1NURA 1DUSA 1ENPA 1SXJB 4KSBA 1SKQA 4F4HA 4IWNA 4QJIA 3VUEA 3WHIA 3SXUB 5CB4F 1HDXA 3R09A 4NZPA 3LQQA 1FDOA 2GN1A 4DCGA 1VE7A 4IINA 4AFNA 1NZJA 2AI1A 2G1KA 1KS2A 3FWYA 2PBRA 2OP0A 2WA1A 2ZUDA 4YWJA 3OE7D 5J3JA 3N8DA 3V4VB 5MGBA 2DEUA 1G3UA 2WUWE 3B1YA 4PX5A 1K7YA 4QAQA 2DUUA 3EIEA 3DD1A 5FA6A 4CYMA 1DTWA 2FOXA 2M98A 4WFIA 3KSRA 1VG1A 4HN2A 2IDKA 1Z3CA 4NYIR 5TT0A 2YZKA 3FG9A 2VDLB 3ZJYA 1YA4A 1U3WA 3PLNA 3EUFA 5B7QA 3MHTA 2I22A 1RMTA 2ZTVA 2HDWA 4FHDA 1PUJA 1SB8A 2OD9A 1NL3A 2TS1A 2NSHA 4NTZA 3LECA 5AW5A 1NT4A