4MS4B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the agonist baclofen
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
418
structure length
408
Chain Sequence
PPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWECLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/agonist
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 148
structure length 408
sequence length 418
ec nomenclature
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms4B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ms4B01
5IBQA 1C4WA 3O1HB 4G0XA 2R25B 3QX9A 4KZKA 5DCLA 3F73A 4WUTA 3TB6A 3HCWA 1Z12A 2L18A 3Q7TA 4QYMA 1XWWA 4MLCA 1NXWA 3ROTA 3LFTA 4MR7B 2MSWA 5JS2A 3MYYA 4KV7A 4WXEA 3O74A 1NTRA 1P6QA 3CFYA 1NY5A 3OMXA 4H3HB 1BA2A 2PE5A 3RVQA 1E6LA 3UK0A 3KS9A 4M88A 1SD5A 5IC5A 2WB4A 4MS1A 3FFXA 3BRSA 1QO0D 4PICA 3MIZA 1BDHA 3F7NA 1KRWA 3UUGA 5CNIA 1JBEA 3KKEA 4QICA 3DLBA 5TPZA 2LP4Y 2ZAYA 1K68A 2PUFA 1DRKA 1DZ3A 3K4HA 4G0ZA 2B4AA 5ABPA 2PMCA 3OLXA 3FGZA 4PEVA 2RJOA 3HVRA 3DZDA 3OLYA 3RVJA 3CU5A 4Z4CA 2XDYA 5ED4A 4RXTA 3T38A 3NNNA 1USGA 3CZ5A 3M9WA 4RU1A 1Z16A 3H5LA 2QSJA 4MR8B 4MS1B 1JDPA 3CNBA 3OLZA 4D6YA 3EDCA 3NBMA 1K66A 4JP1A 1QQBA 2TMYA 5HKOA 1NXPA 2PUGA 3MMNA 2FMKA 3EGCA 4N03A 1USKA 4O1HA 3KCNA 1DBWA 3QELA 2JBAA 3MM4A 4RY8A 1ZN2A 4XFKA 3RVRA 3BRQA 1YK0A 2NZVG 5JNTA 2GBPA 4ZYLA 3E61A 4NCAA 1DG9A 2FMHA 5JNVA 4OTZA 2NZUG 3NNSA 4Z0NA 2ID7A 4G97A 5KQPA 1L5YA 1HEYA 3FMVA 3H5TA 1JHZA 3EULA 3C3WA 1CHNA 4NICA 3A0RB 1A2OA 2FEWB 3LUFA 4EGSA 2LIVA 5FWYA 1I3CA 3CS3A 2Q5CA 3TD9A 3ILYA 1AB6A 2PL1A 3JPYA 3JTEA 3CG0A 4MR9B 1SXHA 4YRZA 5KWSA 3OQOA 1LBHA 5I4CA 1VLZA 4WXMA 1QO0A 2H0AA 1Z2EA 2A9OA 4EYOA 2QW1A 1MVOA 3KYJB 5B3JC 2WRZA 1QQAA 3N0RA 3O21A 1RXEA 3FDFA 1EHCA 2MYUA 3GBPA 3URMA 2PUCA 3QLUC 3F6CA 2LPMA 1PNTA 2JCGA 2WJAA 1Z18A 2IDMA 3GYBA 4YV7A 5BQ3A 2OENG 5IUKC 2GI4A 4PYRA 4ZPJA 4EYQA 4W5TA 5FWXA 4RWEA 1KGSA 1TM2A 1JFVA 5EWLA 2VYCA 2WY2D 1JYEA 3DGFC 3GL9A 2PAFA 3B2NA 1Z15A 3RVSA 1NXOA 2PUEA 3MA0A 4KK3A 5KQMA 3EAFA 4EVRA 4KK4A 1MIHA 1VKRA 3CTPA 1PEAA 2WWVD 2A9RA 3OM1A 2W42A 1YS7A 4GNRA 3Q7SA 5FWXB 1JH9A 3K9CA 2CHEA 2E4ZA 3C6QA 4MRMB 3RH0A 1YVUA 5CNJA 2FMFA 1JYFA 1APBA 4OLBA 1UDRA 1YK1A 2IPLA 2RGYA 4OLAA 4P1ZA 5IUJC 1P2FA 1RNLA 1GCAA 1Z26A 1M5TA 4UHKA 3SAJA 2FTKE 1SXGA 4MR7A 3GBVA 4RK6A 3KYIB 3C3MA 3CRNA 3DBIA 1EWTA 2PL9A 2QR3A 1D1QA 1U2PA 1XHEA 3H6GA 5D2CA 3CKMA 3H75A 2MYNA 2J48A 3A0UA 3G1WA 3JPWA 3LUJA 5CNMA 4W5OA 2PJUA 4Z9AA 6ABPA 3T6KA 3E3MA 4RXUA 4KQCA 5T3YA 4G86A 3GA5A 5F64A 1SRRA 1RZRD 2E4WA 4G0PA 3BREA 3OLWA 4H60A 1LBIA 4N0QA 3I09A 4MAAA 2IPMA 4JB2A 3QEKA 4FE4A 2FMIA 1YIOA 4MR8A 3O2JA 4W5QA 1XHFA 4DADA 1RXIA 2JRLA 3N0XA 5E3JA 1AB5A 4HNRA 1VRVA 2R4QA 1ZH4A 3HEBA 3QK7A 3ROFA 2RDMA 4Z4EA 3LUHA 5KC8A 1M2FA 4IRXA 4RK1A 2JB9A 4YP9A 3JS5A 5BR1A 3QX8A 4Q6WA 4XLTA 1QMPA 4LE2A 1LJUA 1EAYA 4Q6BA 1GUDA 3H1EA 2OQRA 1OXKB 3S99A 2M98A 2PUDA 2FN8A 3H5WA 1U0SY 2O20A 3GT7A 3M9XA 4G0YA 3RVOA 1H9CA 1ZHHA 2AYZA 2CHFA 2L2QA 4ZJPA 2A9PA 2QZJA 2IOYA 8ABPA 2P9HA 3G85A 4L85A 3VNBA 1F4VA 4KQ9A 1URPA 5DTEA 4RXMA 3H5OA 1U04A 5KQLA 3LUKA 1GCGA 3RVNA 3TO5A 2MSKA 4RKRA 2YHBA 3GWGA 2LUOA 4MR9A 4RSMA 4WZZA 1P8AA 3RVLA 1JF8A 4G0QA 3HDVA 2MSLA 1JFTA 3LKBA 1DCMA 5BRJA 1DCFA 4YGXB 3OQNA 2B1JA 2M1ZA 3HJFA 1QP4A 3IPAA 1TJYA 1DRJA 2DRIA 1RPJA 3CHYA 4KVFA 2PLNA 3JY6A 1R8JA 1FFSA 2FLWA 1RZRA 3LUAA 4HNSA 4MS4B 1DBQA 5EWMB 1BDJA 5IEJA 1L5ZA 3QEMB 3F6PA 4YWHA 3L6UA 4D74A 2HSGA 4F06A 3EJWA 4JAVC 3GV0A 4F8JA 1BDIA 4H3KB 5PNTA 1DC8A 1S8NA 2FKAA 2FVYA 3IDOA 3VNAA 1YS6A 4B09A 4TMYA 4D6XA 1PNRA 1D1PA 2QVGA 2FLKA 4OATA 1Z2DA 2NT3A 4OG2A 3D02A 3H5VA 3QLVA 3H6HA 2X7XA 2QU7A 4Z9BA 1A04A 5IULC 9ABPA 3LUDA 1TLFA 3HSYA 1DCKA 5JS1A 4F11A 2QV0A 5DLEA 4IMIB 4W5NA 3I42A 3KHTA 3OMWA 3W9SA 4MRMA 2V0NA 5CHYA 1E6MA 4Z4FA 1KRXA 4MGEA 4LZLA 5KQGA 3N53A 1FSPA 3LKVA 4KPYA 3LUGA 4E7PA 2JVKA 3H1GA 2FQWA 5GOTA 4RK0A 1E6KA 1TVMA 4OBBA 1USIA 4PE5B 1PEYA 3SNKA 4RS3A 1VPWA 2CWDA 3RVKA 1BVHA 3C3KA 1EWKA 4DN6A 4QPJC 3EQ2A 3Q7RA 4PZ0A 2RJNA 4S04A 2FEPA 4JASB 4EYGA 2GX6A 4TN5A 1Z17A 1LK0A 2JVIA 5JNUA 3L49A 4WWHA 3IPCA 3Q41A 4L4UA 4MQFA 5FBKA 4YO7A 1A0OA 1GLGA 4MYRA 1M2EA 4P98A 5TQ2A 2E4VA 4RY9A 3OO0A 1U8TA 3OLVA 5JNSA 1W25A 1D5WA 1BAPA 4QYWA 1EFAA 3O1JC 1D2AA 2GKGA 1ZDMA 3JVIA 5TQ0B 4ETMA 1NXSA 3D8UA 4F3TA 3LOPA 4MQFB 4GPAA 3TX6A 1QKKA 3O2QB 2ID9A 5TQ2B 3DLHA 1C0EA 1B00A 3H5IA 1LJLA 4RV5A 1U2QA 5BRAA 3IP5A 2BGGA 3LTEA 3SM9A 1QPZA 4ML3A 1NXXA 5HSGA 3P9YA 3LMKA 5TPWB 4Z4IA 3HS3A 3UKJA 1Y1LA 1Z25A 4ZMRA 4RK7A 4KREA 2E4XA 3A3KA 3KSMA 3RVMA 1JDNA 2LBPA 1PHRA 1DP4A 3SQNA 2QXYA 4LRQA 5TQJA 2IPAB 4RZSA 3KLOA 4EYKA 4UHJA 2IYNA 3IP6A 3SY8A 2JK1A 3H1FA 4FB4A 5EWJB 2PKXA 3I5AA 3OO1A 1FFGA 1E2BA 3HUTA 2HQBA 5KC9A 4S05A 2MYPA 1FQWA 4N0PA 2F8TA 4YLEA 3FFWA 2E4UA 6CHYA 1ZGZA 3BILA 1YMVA 1IIBA 4MS3A 3T95A 5TE9A 3HK2A 2KYRA 4NCBA 4ETNA 3KG2A 4NQRA 3O75A 1DC7A 1ABFA 1TMYA 4KMRA 1MB0A 3I45A 1ISRA 4ETIA 2FEKA 5C5CA 1ZESA 2PUAA 2GWRA 3OM0A 5DKFA 4MS4A 1DJMA 5EWMA 4LDZA 7ABPA 1T34A 2WMYA 3Q9SA 2FXIA 4JOQA 3Q15C 2JVJA 3QEMA 2NT4A 4Z99A 1P6UA 2FQXA 1MAVA 2IKSA 1ZVVA 5IEBA 1PUXA 2NUBA 2FN9A 4MS3B 2E4YA 4DQDA 1ZH2A 1Z13A 3DGEC 2A9QA 3NNDA 1M5UA 4F12A 2VK2A 3N8IA 4MLDA 4O1IA 1JL3A 4NV3A 1JX6A 3ILHA 4IF4A 2HPHA 1ABEA 3NHMA 3OQMA 2H3HA 4XASA 5B3JA 1NATA 1ZY2A 4RKQA 3HXMA 4IILA 4EY3A 4YR7A 2YHAA 3EODA 4G0OA 4RK5A 2ZWMA 3QLUA 3JVDA 4Z4GA 3IP7A 3BBLA 2PUBA 4RY0A 1EWVA 3HZHA 3M6MD 4IMJB 5JNWA 3QELB 1JWLA 2HQRA 2JBAB 2IPNA 3A10A 4IGAA 5T7BA 3T8YA 1F51E 2L17A 4MPTA 2F8SA 3N0WA 1ZAYA 3HV2A 1NXTA 2VUHB 4G0MA 1OXBB 1W9HA 2QVCA 4O5AA 5FBHA 3SG0A 3FFTA 3HUUA 4CBVA 4LDAA 4TLLB 1QNLA 3R0JA 4N47A 4EVQA 1QP0A 2VUIB 4Y9TA 3EQZA 5JNRA 4XARA 2L19A 2HQOA 3KLNA 3KTOA 1NXVA 4KNYA 2I6FA 2HJ9A 3N75A 4RDCA 1GUBA 2N9UA 5FWYB 2P4UA 2R48A 2FSPA 4HNQA 4HYEA 3TMYA 4FE7A 5HM6A 3QLVC 3GRCA 1ZITA 1MB3A 4WT7A 1JLKA 5IX8A 1CYEA 4W5RA 3N6VA 4Q7EA 1D4ZA 4Z4HA 5GQSA 5TQ0A 5KI6A 4KRFA 2FW0A 3NHZA 3C97A 4LE1A 1ISSA 3HDGA 4MQEA 5TPZD 4YCSA 4XAQA 3CZCA 3MQ4A 4TLMB 5CNKA 1WETA 4XXHA 3RQIA 4KFCA 4LE0A 2WJWA 5HQJA 1FFWA 5TPWA 1ZGGA 3CG4A 4RK4A 5EWLB 4JA2A 2R47A 2CD7A 4N76A 3CLKA 5IUNC 2MYTA 3O1IC 4JB0A 5C5EA 3QLTA 2FQYA 3LUCA 4MQEB 1J56A 4LX8A 5DGCA 1YMUA 4YS6A 4E7OA 1SXIA 3HO1A 1QP7A 4ZMSA 3MF4A 3IP9A 3RVPA 5EWJA 1DBPA 1YTUA 1CEYA 3KJXA 1JFSA 3HM9A 4EVSA 3O2SB 1KMIY 4EUKA 2AYXA 4N41A
chains in the Genus database with same CATH superfamily
1UMBB 3EXIA 1C4WA 2GF9A 3P94A 5AI4A 2PZAA 1LLFA 1JE1A 4QDTA 4DY4A 1IBLB 3IC5A 4O63O 5C3UA 3K92A 4EF6A 4WK6A 2ZRGA 5DDIP 5KWVA 1WV0A 4MLCA 1A9XB 3BGVA 2MSWA 1KVQA 1EGVB 4WXEA 1AK9A 3CFYA 1T6YA 2INGX 5GONA 1C9JA 2ETVA 3TLKA 8ADHA 3GGOA 5I7EA 5IS2A 4YT5A 1UM8A 1CY7A 4WECA 2BM9A 2ENWA 1Z6GA 1IWPB 2P27A 1W0JA 2OECA 3ZDYB 2YWHA 2YW2A 4J0JA 2G07A 1R0ZA 4PZLA 3DNPA 4BLPA 4FZ5A 5CBPB 1CQWA 2XW6A 3IBFA 4XQ0A 1RRGA 1FYWA 2HGSA 3TE7A 1W1WA 2PMCA 3HB9A 1L4NA 1VDZA 3O94A 3PQ6A 5TSDA 2FR1A 3T9CA 4WHMA 3OLYA 3TLJA 1E2HA 4XD7A 4M2LA 1PGNA 1OR8A 3MAGA 3SX2A 2G1PA 5I9TA 3BF7A 3S70A 3UTDA 3AERB 1A3CA 4RNCA 2FPGB 3CNBA 1QC5A 4XOIA 2IOHA 3EGDA 2A30A 1DQNA 2VDWB 2KM1A 4W63A 2VYVD 1JJBA 3G89A 1C80A 2RC5A 3GNTA 5BQ5A 9GPBA 1ECBA 3B9QA 1DI0A 3A4TA 4CL2A 1SXJA 1A2QA 4YRDA 4M6WA 3W9YA 3MM4A 1TU0A 2GTPA 1EHIA 1HTBA 4JITA 1OBFO 2HUPA 1YR8A 2PS0A 1JLLB 1PS9A 1FLVA 3VTKA 4D80A 4DJAA 2V4UA 2RHMA 3PNYA 4ZOLA 1AHIA 2WFLA 3D31A 2PD4A 1GV1A 1V37A 1NBIA 1X94A 5IVDA 4OM7A 4RJJA 1JEYB 5ELLA 2QF7A 2DHCA 1BXGB 2RIPA 4BFXA 1FJXA 2GCGA 3NNSA 1AQNA 4AI6A 3KKMA 2R6HA 3PDIB 2ADMA 4JJ7A 3BK2A 1PG2A 3ONDA 4XCXA 5FFFA 3TYXA 2VNHA 1BXRA 3W5IA 1BQEA 3KVVA 3KPWA 3SHOA 3T5GA 4BZPA 1OAAA 4WEQA 3R75A 3BGIA 3JASA 4X20A 1E89A 3K4PA 3Q3IA 2BIFA 4AP6A 2O5EA 2A86A 2JPDA 1R9GA 4X92A 2PL1A 4WCFC 5DV9A 3E3OA 3G13A 3WMRA 1V1MA 1C9DB 1NMQA 3LT4A 4DQ0A 3ULKA 5I4CA 3O8RA 4UTNA 2PS1A 1V3VA 3FBTA 3O38A 1J0CA 5BQXA 5C7YA 5HTOA 2PMFA 2WRZA 3T3MB 1B42A 1A7AA 1FL9A 2B99A 2BFEB 2C83A 4B2IA 5AW4A 3GLIB 1CHDA 1QU3A 3VKHA 1SU8A 1E5VA 3H4MA 3NIFB 4M0PA 1HG0A 4UTZA 4BBZA 4EELA 5KEIA 1VHTA 1TU4A 3DFZA 3WLJA 4PN3A 1QV6A 2O3TA 4MICA 5LYYA 1D2NA 1TZMA 3HN2A 3VH2A 1QOZA 4YV7A 5IJWA 3JQ6A 4R7TA 4W5TA 4LYAA 2JI8A 2YC2C 4ZQIA 1FFEA 1PK9A 1EGAA 2IZ5A 3HYLA 3IDFA 1GQSA 4L2IB 2PAFA 3WIVA 2GCNA 4EVRA 1X7WA 4WXYB 4F3RA 3ANMA 1XDSA 2D00A 1E62A 1S2IA 2RHHA 2BEVA 3O26A 3ON5A 4RVSA 4RVFA 3BHNA 5SICE 1GQRA 1WV1A 1QFYA 4CMAA 4E46A 3GJ7A 4A1FA 3E48A 3G8YA 2YWEA 4XVRA 1R0SA 3DOIA 3I9MA 3L7DA 2JFQA 1F6DA 2ZRMA 4JI1B 5ADWA 2ORIA 3HP7A 1L7RA 4LWOA 5C53B 4NC9A 4PSVA 4AULA 1A2KC 3AJRA 2I67A 1SJ9A 2V97A 1ZGAA 1SKBA 1T6NA 3GJ0A 3RS9A 1M5TA 1BVUA 2ZQ5A 1BVYF 4JBYA 3EY9A 1XA0A 4RH3A 2PUTA 3RHFA 2JA1A 3KT0A 1EDEA 5EC8A 5HGJA 4CUKA 3ME5A 2QR3A 2ZIZA 3NHPA 5HFNA 1KEZA 3O82A 4OA5A 4J9UE 3ZWWA 3DH0A 3HCCA 4EENA 3RREA 1AOXA 1UKVY 2HWKA 4RTKA 4N9QA 2F9LA 3LK6A 4KKXB 2GEUA 4TSFD 2J7KA 4DS3A 4KMOA 3OJCA 5IM4F 1IAVA 1RHJA 3NVDA 4Q24A 4QFDA 2C99A 5H16A 1D2CA 4C3VA 2J0VA 1T2CA 1TCAA 2DJIA 2DFPA 5IN5A 3RS4A 2IH2A 4DLUA 2ZRIA 1G0NA 2GZAA 1FQKA 4IXWA 2IL1A 4XDHA 4KR6A 4XGKA 4ZZ1A 3G1UA 1JSZA 1Z56C 1TAGA 2FRDC 4R83A 4TVOA 5F9MA 3W90A 2V5AA 1C3OA 4Q34A 4MVCA 3QIVA 1V7CA 1L3CA 2G06A 3A9VA 2XWBF 4FDUA 4UMFA 4JJEA 1IN6A 2P65A 3H11B 2F3PA 3H97A 2DKNA 3A11A 4TQUS 5D5PA 3U4AA 4W9NA 1RXIA 1X1BA 1WTAA 4I4TB 3NBUA 1ZK0A 1QCYA 4J6EA 5F4ZA 3B78A 1O87A 2ZJ4A 3VAZA 4F5EA 5GJBA 4JI5B 5FNVB 2VH1A 5IABA 1ENOA 1EUZA 2ISCA 4DLZA 1K97A 5CPBA 2FW1A 4CMBA 1ZD2P 3FMOB 1NDHA 5K0EA 2FF5A 2NN3C 2W5UA 3H1EA 5CFQA 5LLTA 2LIPA 2WIFA 2M98A 1VE7A 2OFXA 4F91B 3LBYA 1F0NA 2PBZA 2AA3A 1NLZA 3VZSA 4B32A 3AX6A 1ZHHA 4MRVA 3LXRA 3OFKA 1W52X 2QZJA 2XNHA 1AKNA 5AJYA 2IOYA 1II8B 4KQ9A 4IIUA 2F64A 1J8VA 2Y3IA 1CS0A 4E3ZA 4F3KA 4XM0A 2HCFA 1UXKA 2G1AA 1Z5WA 2PHZA 2YXPX 1OBVA 1CUBA 1ZOSA 5LB4A 3RVLA 3QXGA 1NBWB 3DJYA 3GXOA 2REQB 4JT4A 2IPXA 3E5RA 2WTUA 1SXPA 2J46A 4J7UA 1Q0RA 1VJCA 2ZVDA 4TZTA 4CMKA 2Q3CA 4D9MA 4JOBA 2V74B 2BBSA 1MPTA 1SULA 1XRMA 3FPHA 2ZZMA 3WYAA 3D0QA 2HWYA 3JQDA 3BBPA 3D3NA 1WKCA 4IXNA 3GEBA 1WSBA 3IUBA 4UOZA 5E6RA 3IQIX 3WDMA 4UTPA 1PR1A 3C1AA 4TRJA 4JLMA 3UGJA 2BHNA 2BN4A 2A58A 2HSGA 2DY0A 2FZGA 1IJEA 1ODCA 2GPYA 3H8WA 5PNTA 1WP4A 1DVRA 1ZBQA 5BXQC 1R0BA 4BWYA 1QVZA 5KWJA 1AUVA 4TMYA 1P5RA 3H17A 2J67A 5KYWB 4MQBA 4ITRC 2P6RA 2COEA 1M34B 5T6BA 3FUCA 1U0TA 2UYHA 4HSEA 5FV4A 1M8JA 2DB3A 4U4AA 2CFTA 4ZRDA 1XXHB 2IZOA 2HA3A 2XBLA 1JQEA 5GP1A 2G7ZA 1KK0A 2AFHA 3AI1A 1QHHA 4W5NA 3HNRA 2BEUB 3QOFA 3A4MA 5EXXA 3RFXA 4X8HA 2Y0PA 5ALTA 4RKWA 5T3UA 1Y3IA 1OXXK 4M0FA 1VE3A 1QHFA 1HQCA 1DTEA 3LKVA 4WIAA 4FUTA 4ZVPA 2OHFA 2YWGA 4U2FA 3RNOA 4C03A 2Y8EA 3FG9A 5AK5A 1I14A 4HN9A 1XZCA 3TW8A 3H1GA 2P2CA 1U8UA 2H57A 3C6MA 3D8TA 2JARA 1CCWA 1SD1A 1SVIA 3MGKA 4P36A 5HF5A 1NV8A 1PEYA 1VPWA 5F73A 2VJMB 1U1IA 1JJAA 3B7GA 5KDDA 2C7BA 1XP8A 3H65A 2WSLA 1R2QA 4TS4A 3CW8X 3PEWA 3VM6A 1UWKA 2VWPA 5SV2A 4FD2A 4AFNA 3MHPA 3QI7A 3UG7A 1J2EA 1LVUA 2V7GA 2Z1MA 2V96A 2LXNA 1M1YA 2C2YA 3SJBA 3BJRA 1YDWA 2EDAA 5HCIA 5JYBA 2WHEA 5BW5A 4QVIA 3Q3GE 4JCOA 5E1MA 2RGGA 2WU8A 4OJQA 1AE1A 4OMDA 2QRQA 1Q1GA 3HYCA 3OO0A 3AVUA 1U8TA 4CM8A 1NQOA 2FPOA 4PZAA 3A3YA 4CF6A 2NV6A 4NYIQ 4QUIA 4MHTA 4XYGA 4O2BA 4MW9A 3EEBA 1O6FA 4JBGA 3PNVA 3DLIA 3CJQA 4HEJA 2CVPA 1KO8A 3Q0EA 2O1WA 4V0SA 2IUSA 2JEZA 3DMYA 3LHSA 3LOPA 5G4KA 3RG2A 2N42A 4QRIA 5A5DA 5BN1A 4MAFA 3VAYA 2HGZA 3RC1A 1LQUA 4JI0B 3MTQA 4JKYA 3QE9Y 4DXDA 1IB6A 2H5IA 3OE4A 1VLVA 3JAWA 1PJ3A 1P0QA 1GL9B 5EINA 3RIHA 3FTPA 1IRIA 1NNSA 1DOHA 2HC9A 2HO5A 1C0PA 2HBZA 3CW9A 4GHWA 4P4NA 4COKA 4CQMB 1QRSA 1OLSB 4LY0A 5JSHA 4IG9A 1F60A 1EH5A 1CUFA 3BE8A 1Y1LA 2HMVA 5DYYA 5LBTA 3PLAE 3G0GA 2VRCD 1P73A 3TPZA 3W5VA 4RM3A 1S1CA 4CM6A 2GETA 3FR7A 1PHRA 4EMUA 4PYKA 5AKJA 5TQJA 1EFUA 1SCQA 4C0WA 1NG1A 2VG8A 4K6OA 5LZ7A 4BZZA 2IYNA 3IP6A 1KIFA 4OQPA 1IXKA 4X90A 1LLQA 4EI2A 2FSFA 2DBRA 5FLXA 2WFZA 3OTQA 4URZR 3KVOA 2CN1A 3BUSA 5CTAA 3WGIA 3SE0A 4UEJA 3EXIB 4YP5A 1ZGZA 5EIFA 1USUA 2X5JO 3WQSB 1AV6A 2QN3A 2A0XA 3U31A 2RGXA 4WVFA 2W6OA 4Y2XA 5TX7A 2WV7A 2KYRA 5G0UA 3SNHA 2J9RA 2LDXA 5ECWA 2QKYA 5CH5A 1TMYA 2E5LB 2D0IA 1UT5A 2RHCA 1N5KA 1NVUQ 3B6EA 2HSEA 1SQ6A 5CGZA 4AWXA 2H06A 1PV2A 5C51B 3KC2A 3LM8A 2EQ5A 1YB5A 4QULA 2FXIA 4U63A 4UTXA 3SFTA 3E5MA 3UV6A 4CT0A 3BIWA 1O0CA 1XQWA 3A2KA 1DEOA 3DTYA 3L0PA 2DR2A 2PX0A 1P5ZB 2O52A 1TPYA 4DQDA 4PSDA 3P2JA 4RQAA 1TA0A 3R9KA 4X91A 4BNFA 3EZNA 1BA3A 4F4FA 1CZRA 1Q15A 2H9YA 2ODEA 3ABZA 4ZZIA 2AR0A 1MG0A 1N2EA 3IJRA 4G09A 4NBTA 3PQCA 3U7FB 3RBZA 4KHZA 1U9CA 1W87A 4M1QA 4O4HA 4QOGA 4YV2A 2B35A 3UAXA 4QTYA 1RHKA 1N1EA 1GR0A 4W7HA 3QE4A 4O25A 2MINA 2Z8ZA 2H7XA 3UV7A 4D3YA 1JEJA 1QC5B 3IAHA 3EGDB 4IDPA 1ORIA 1YMQA 5IAKA 3PNMA 3AHIA 3ENQA 2YWCA 3D4OA 4WKNA 3N1UA 1A9TA 2XKJE 3DEYX 1WDKA 2EF1A 4IMJB 2V7VA 3M6MD 4HI0E 2Q5EA 2YVKA 4M6WB 4MGYR 5GJVC 3UW1A 1MGPA 4J0KA 1OH8A 1JHVA 4G1UC 1HGXA 5LIRA 4YCBA 1T8SA 2PGLA 4RF3A 4WUVA 1L5SA 4ZOLB 4J8PA 1G291 3VDQA 4XPZA 4G0MA 4RVGA 1FVOA 2X0EA 1OQAA 1E60A 2YNMA 3TVYA 4F1WA 5JTUA 1ESZA 2AK2A 3VPFA 3WB2A 4UEQA 3S1AB 2QEQA 3B1FA 5CG1A 1QO9A 4OU5A 4EVQA 5F9FA 4B2PA 4KBYA 3OSZA 4GOKA 1BXRB 1CIPA 2Y1LA 4WPGA 3W2FA 3DXYA 5C0OE 5DASA 4ZO7A 4BNTA 2ZWOA 3KLNA 4D82A 2GNOA 3LGSA 1G5QA 2CMKA 2BFAA 2G9UA 3B1ZA 2ZIGA 3BHJA 2X7JA 4NPCA 4W6ZA 1XTJA 1WDTA 2NVOA 3TDNA 3FNRA 1MB3A 4TGLA 1JLKA 3E84A 3ZJ5A 4EGJA 1ADCA 1L5FA 1U3GA 1V1MB 2GRUA 2R4TA 3ZHTA 121PA 3FUVA 3HWRA 4Q7EA 1QH0A 4KEAA 1WXDA 1CUAA 1XRRA 2JJ1A 1O7JA 1HY3A 5GQSA 3UATA 1K7EB 5BYAA 2CNBA 2O3SA 4N3NA 1AN0A 1L8OA 1REQB 2ATIA 2GOYA 2VUSA 2A1UA 2ZFUA 2PZLA 5D6NA 5ICSA 3SSMA 1TCVA 3G9UA 3QITA 3KTDA 5B7QA 3T1HB 4M54A 1N4AA 1ETUA 1YCHA 2R60A 4ZAFA 1T2NA 3LX8A 4N5LA 3KJQA 3K0SA 3JYNA 2VHZA 4XH9B 3MTIA 4YQYA 5JR3A 4RVNA 2QZZA 1ZLYA 2AH5A 2XE7A 3ES9A 3TIXB 4DM4A 1XG5A 4N6OA 2A4KA 4G23A 2C7PA 2EKBA 3WGKA 5A7GA 2CD7A 1FP4A 1XELA 3DPSA 2IQ5A 3TLYA 5K2OA 1DIBA 4JB0A 2GHQA 2LCQA 1UXOA 1Z7EA 2VRBA 1BW9A 3D8RA 1O58A 3I05A 2C07A 3PRYA 5BW6B 1O1YA 1AQIA 1NU6A 1X7WB 2ACWA 1FOEB 2BEVB 3E2MA 3E7XA 2PMDA 1KU0A 3NKLA 3NC4A 4TLDA 5FPHA 3TZQA 3UAWA 4BKRA 4E7OA 3HO1A 4I8DA 4NCNA 4X61A 2B61A 5JOQA 1WM1A 5I01A 5ER9A 1C1YA 1JHRA 4Y9UA 1IOLA 4GD3Q 1KMQA 4NS4A 3A6JA 3JQBC 3R7AA 1ZM3A 1WDWB 2P30A 2B7CA 2NAFA 4D8VA 1GNVA 3DBRA 5I7FA 3PHHA 3H5RA 1KETA 4OH1A 4IHKA 2QW0X 2P7IA 4B3HA 2WWYA 3HGTA 3N2NA 2WSMA 2Q9CA 2H85A 3IAS6 4L6CA 2NO4A 4O2AA 4AJPA 4DUZB 5JI2E 3ROTA 4DDMA 1T25A 1P0MA 1MAHA 1KSJA 4TXHA 2V5UA 3VR4H 3UK2A 4X3PA 1ZW1A 2B4RO 4C78A 3AINA 5FUXA 1GSHA 5A62A 1BWRA 4BMCA 3LBAA 4YXFA 4Z7QB 2RBGA 2QAJA 5FAKA 4OLBA 2HLPA 4D26A 1FRFS 1W75A 4EA6A 5D3MA 1L5QA 4GPTA 3KSBC 3GHYA 2QENA 4HWTA 3K0FA 2Y67A 1AK1A 3HBJA 1HLGA 521PA 1JJFA 1DAOA 2FN4A 2XRZA 1IK4A 2F1HA 2XKAA 4UHEA 3UUFA 4DUGA 3KR9A 5JALA 1K68A 2PUFA 1YJXA 1TF2A 1DZ3A 2OMKA 5FFNA 4YTEA 3P2KA 1E79A 4BO4A 4HQOA 3DZDA 3G0DA 1YO6A 2D8MA 3LBFA 5ERYA 4B75A 2CL5A 5TJHA 1C3OB 1XTIA 5ITWA 5DTMA 1KI7A 2NWQA 1PJ4A 4DQXA 5ELMA 4G41A 3WP1B 3HMKA 4WNCA 1L5HA 5CIYA 4AZ0B 1BD4A 1QLHA 3DXZA 1LWNA 2I66A 1RWPA 3RYFA 2YW9A 1KFEB 4MWSA 3N2LA 4PIVA 3MMNA 3VR5D 4C07A 3I5YA 1GL6A 3HABA 3EH2A 2IGBA 2H0RA 1RFGE 2NADA 1NJ2A 4KGZA 2J7PA 1EA5A 3PQ4A 4GXNA 5YASA 3SSAA 3FPFA 4BFVA 4WOJA 5CH8A 3U4DA 1K63A 1D8TA 1OKKD 1RBMA 2CFCA 3ESBA 4I5FA 3ZIDA 5JI3E 4ZYLA 4D97A 2ADFA 2D74A 4QHSA 3U7QA 3ZOKA 5TS3A 1KE2A 2HTEA 2PWZA 1ZNWA 3PIDA 4UNQA 4Z1MD 1QHYA 3R23A 3ZW9A 2UXCB 2PXHA 4H7KA 1RTTA 4G97A 1XVLA 2GN4A 5EHGA 3KT8A 4WN3A 2BI7A 2V8OA 1QF6A 1GTL1 1KA9H 1ZKMA 5H4GA 1OU0A 3F71A 5T8KA 1GQOA 1SEVA 1SCDA 3P8ZA 1CS0B 1MJHA 1JEOA 2Q5JA 2Z8XA 3MRTA 1XZ8A 1HT0A 2FH5B 1K08A 2LIVA 2QOEA 4QEDA 2ZRLA 3TLGA 1TQ8A 4BXOA 3EH1A 4MUMA 4I6EA 1U8FO 2I62A 2XJ4A 3PFFA 2P4SA 2YRFA 1Z63A 1PL7A 1E4EA 3JVUA 3PC2A 4PC2A 1GPLA 1JT2A 2OCPA 3CRZA 5DNUA 5B3JC 1Q1EA 5CM2Z 1XCJA 3ICQB 3KPYA 1XZGA 4HFNA 3V4RA 1RJGA 1KP9A 1Z38A 1JALA 3R6DA 4B5LA 2QBYB 2VCYA 3FPSA 3QQ5A 4UD6A 2WD9A 1U7XA 3F5QA 5E6RB 1J2UA 3N3AC 1JIQA 1Y6JA 2OENG 3AY0A 3C1UA 4NWIA 3DDNA 4ZPJA 5IUKC 3K2BA 4TVKA 1LY1A 1P61B 3U3MA 3UHOA 3TCKA 3VR4A 3IXMA 1ZL0A 5FPKA 2P2DA 5CLQA 1KOGA 3M49A 3AUTA 1FA9A 3L8ZA 4NHOA 5HRUA 1ISPA 3SZRA 4E5YA 2BYTA 3AF3A 3UG6A 4CETA 3KR1A 3ESYA 1DHRA 3CTPA 2QGNA 2OYCA 3SF8A 1N3LA 3AJ9A 2DEUA 1VE1A 1G3MA 3L4KA 1JQJC 5LQNA 3C3PA 2QQFA 1RQPA 5E4TA 2GBLA 3H9QA 1HQDA 1LI7A 1QHHB 2XHZA 1CY6A 4PTLA 3FPGA 5FL7D 4DABA 1FQOA 4ECEA 4JL5A 3Q3VA 3CLTC 2C4NA 3RRJA 2Q6OA 4JA0A 1B8NA 3PPIA 1EA7A 2WSYB 3EVNA 4KXUA 2AZMA 2WHYA 1M34E 3HZZA 3F9IA 3BFJA 4G5QA 2OVBA 4GYKA 4WINA 3WRXA 3F5FA 2HSJA 3TW8B 1XXHE 3LY9A 3UMVA 3A36A 1KGDA 4RD4A 5F76A 1HX7A 2BGMA 5K5EA 1FVXA 4WOBA 1I8TA 4WMLA 3LVRE 4QG7A 3O4JA 4YUVA 2UYOA 1XQVA 3PNPA 5FUQA 2Q21A 4FOLA 4F6CA 4AS3A 4X8MA 3PC3A 1NHGA 3GJ8A 4LY3A 5D2CA 3GRVA 2KBEA 2UZAA 4KRXA 3RU2A 1BG6A 1GRRA 1U1GA 1M1YB 1WUTA 5GV7A 1VMIA 1TAHA 8OHMA 3GFPA 4YRJA 1FDVA 1Y5MA 1SRRA 2IE0A 5TF4A 5KQRA 2F17A 3P4YA 1Q0HA 2BHRA 4ICIA 1XHLA 3TWOA 1IUNA 3G0OA 4CM8B 3MXTA 3DDOA 1RMTA 2IHJA 2ZXEA 4O2BB 3RI3A 5DCYA 2IPMA 2PX5A 3S8MA 3SSNA 1KS2A 4TV9A 4UUPA 4KDRA 3STXA 2BKAA 4CTNA 3IE0A 3JATB 3WL3A 2JJYA 2YIMA 4IDEA 4NLLA 4ZXFA 5A02A 1RQ2A 1AZSC 2QYTA 3V7NA 4RD2A 4ZRNA 3OJEA 4DUYB 4Z4EA 4JI8B 3I61A 1FXSA 4BLVA 1K8QA 4B3GA 4Z7OB 4DPKA 2AFIA 3JAWB 1SCIA 4U3JB 5COQA 4Q6WA 4QOIA 1QMPA 2XI4A 2XA2A 1OVMA 3PTAA 2E18A 1VI2A 2QP3A 4PIMA 5DNCA 3IUJA 4KU4A 1L7PA 2R62A 3D4IA 2NTVA 3ROPA 2ZBVA 3K53A 4B45A 2JATA 3ZOZA 1N5RA 2FPMA 3HCDA 2R87A 2HWXA 1LV7A 3O7WA 3QFCA 4NCHA 3VDNB 2NO0A 1A8QA 2P9HA 4Q82A 4FYWA 2WB2A 2CF6A 2E21A 1GGNA 1NX9A 2Q3EA 3CZ4A 2A33A 2QN9A 3PA8A 4NIMA 1KYWA 2R1VA 1ZHOA 2P9FA 2V4MA 5LQCA 1TEXA 3GGSA 2HIAA 4KWCA 4DVGA 1FSFA 3ETNA 2W6JD 3L1JA 1V71A 3JWIA 4RSMA 2OGWA 1KJNA 1KY3A 3MT0A 2I3AA 3R1IA 1ARZA 3GARA 3HDVA 3HH8A 1R27A 2GHIA 1C81A 2GEVA 3Q1LA 4INPA 2LE0A 4KDEA 4B6JA 1ZXBA 5AKIA 1WKBA 2XIQA 5JY1A 1B1AA 2M1ZA 2BT4A 1JT9A 3W1EA 3ILVA 3G3EA 2IEDA 2W6CX 4B7CA 4PZZA 2VH2A 1TYDE 3HCFA 3G9QA 1PGPA 1HYEA 3IVRA 2NU9A 2TECE 2FLWA 4I4LA 1OSNA 1G9TA 1KSGA 1JR3E 3VU0A 2FCRA 1N2IA 2Q99A 4AWAA 2Z6VA 3KU4A 5IEJA 2BGUA 5NLLA 3KOWA 1SXJC 2IHUA 2J5XA 2VCHA 2L42A 3CIFA 3M8KA 1Y8QB 4C7KA 2NXNA 3IAUA 4PQYA 1ZGJA 3KXPA 1E3SA 1TYEB 3FNHA 5C35A 3L7NA 2C8JA 2CYAA 1VDMA 2I9KA 4OATA 4YRLA 4IIXA 2BGKA 3QFSA 4ZWNA 2PG3A 4MW7A 3RSLA 2B8JA 1C8LA 1JQLB 1ZD9A 4HPWA 4AO6A 1L7BA 2WU1A 4O4HB 1GRVA 3PC8A 4RGBA 2FW6A 1PI3A 3O9VA 4C2TA 1B4DA 1X1QA 3GZ4A 2RGAA 3N2IA 1XVTA 1U81A 1GL7A 4ODIA 4BLRA 2MINB 4EL5A 4HWGA 3DUWA 5LA6A 3PUVA 2BMEA 1Y8RA 1H85A 1NUQA 4RFSA 5HGXA 4BGVA 3BCRA 1LXCA 1O89A 5DEOA 1XWFA 5FFMA 3EWAA 2HADA 3VR6D 3JQ8A 4YREA 4GXRA 3T3GA 1W9MA 1PR9A 3FUUA 1COWA 2F9FA 5LDDC 4HGNA 1T4CB 3NT5A 2JIRA 4RIIA 4AJ1A 1J39A 2NYRA 1Q0QA 3LCMA 2CDBA 3PD7A 3ZY3A 2HPVA 3AL0C 5BR4A 1Z17A 2DWPA 4ZOEA 4ARUA 3JYOA 1XTVA 4GMFA 1SXJE 1R4NA 4XEUA 4MQFA 1Z0UA 2Y1CA 2FZ5A 4PINA 2ORED 4KN5A 1U3UA 3GRRA 2Q6KA 4QTUB 3VSEA 4XRGA 3F0TA 4XQGA 4IHJF 2WJIA 4KGVA 2VDJA 4AYXA 4P84A 1DKPA 4M0EA 1MBZA 1R6AA 1ZEJA 2RC6A 4IXDA 3PXGA 3WMGA 5IXJA 2QRMA 2XMDA 1RBQA 4BAUA 2EL7A 3A7EA 5HXAA 2WIDA 1NR7A 2HFJA 1QIDA 1N6NA 1IM5A 3D8UA 4JH0A 2JHFA 1NVMB 1HEIA 1WU8A 4BNIA 2Y71A 1A1SA 4QXRA 3LIPA 3OEEA 4Z7NB 3A6GA 3ZQ4A 2EJVA 1P7ZA 2QN2A 5A7HA 5IFLA 1T2AA 1QORA 3B52X 2PIDA 3CVJA 3W8FA 5BR7A 2ZR0A 4M22A 4D8WA 3HO6A 3OF5A 4PS0A 3UHJA 3CLRD 3CUVA 1JI0A 2C9MA 2Q41A 4KPGA 1FP4B 4MVJI 4PG6A 3FSGA 1MCZA 1HL3A 2Z43A 3PFIA 2JZNA 1BW9B 2PYIA 2CUTA 3O3CA 5CP8A 1ECLA 4JVMA 5BOVA 1PQ4A 2LBPA 2VXYA 3WO1A 1FTGA 1A8UA 1KARA 2OCKA 5H82A 2WNHA 3GFBA 3MMXA 3DMTA 3INTA 3QVOA 3DYBA 3MGAA 2C5SA 3BOSA 3HYRA 1UQTA 3U7IA 2V6GA 1M1NA 3WYGA 5COBA 1TZ2A 3DBRB 3NH9A 2WZQA 4HY3A 3TI9A 3ILSA 4F2PA 1IBCA 2ZJ1A 3R0ZA 5CT4A 2DTEA 1CR1A 3BILA 3EWIA 5JFTA 3UMBA 3TZBA 4NCJA 4DNXA 5CEEA 3HK2A 1QIMA 4URFA 3KG2A 1RMQA 3D64A 1Z6YA 4MI1A 3NFRA 4W1SA 2P9TA 1NVTA 2ATEA 4LVCA 2GO1A 4W9NC 1T5SA 4R01A 5L3VA 5LSAA 4HFMA 1EFVA 3QHPA 1WHSA 4MKXA 4XDYA 3Q7IA 5DKFA 1RWQA 3DE4X 4JLWA 1YTLA 4Z3OA 3EPJA 3Q9SA 1TF7A 1XIVA 4JOQA 1YI8A 2AUNA 3MGGA 3Q15C 4F72A 4XSVA 3CUSA 3DEIA 3UW3A 4EW2A 1MKYA 1NVFA 3U3ZA 3IPYA 1TD1A 4BDSA 3PFWO 4BNLA 3T5TA 4CMEA 3D0KA 2IH4A 2CUKA 2YX1A 1AVTA 2JFFA 3C70A 3KUDA 2RHRA 3N6XA 4DV0B 3CNEA 2VK2A 4MPJA 4IIJA 1XKXA 1PW5A 3QVWA 3H16A 4LDPA 1JX6A 1T5TA 3KUXA 3ILHA 3LYUA 2GBFA 4GMGA 4XB2A 1NSTA 1RLIA 3DFKA 4B9EA 4ZQFA 3NMUF 1TO2E 1NW7A 2FJ0A 4P81A 16PKA 1ULTA 4KYVA 5ALJA 2ZIUB 4B71A 5A0VA 1RAGA 4X84A 3ZCPA 3GDOA 3WC4A 1AUXA 2ZOSA 3N0VA 3MWYW 2C04A 3PHIA 1E9BA 1SEPA 3LV8A 1H0SA 1YQUA 4PNZA 3RARA 2O9JA 4XEHA 4OOEA 5K0ZA 2XE6A 1T9HA 4H31A 1EWVA 4I1IA 5AW1A 2Z6QA 2HQRA 1T0PA 4I1RA 3V4OA 1BROA 5T7BA 2Z5FA 2UZ0A 2VDUE 3ISTA 5CB0A 2B20A 4MPTA 3X1ZA 1NF3A 1S9HA 1QDLB 4IJWA 4AW9A 2VAWA 1RACA 3AHEA 3PNLA 5IRCD 3JU3A 4J3FA 3UCEA 4F97A 3OLCX 5ARCA 2HREA 5T4HA 2D2IA 4YEDA 2QIPA 2G8LA 3WG9A 2OORA 4MRSA 5F5NA 3WZMA 4EW1A 1G7RA 3AR8A 5IJ0A 5DP1A 3NKFA 3H3XA 3KOOA 4BPBA 4XGQA 2ZUBA 4I8XA 4RDCA 5D1HA 4P3OA 2NU8A 3LLVA 4R7ZA 4M49A 4DMKA 2JW5A 3UUEA 3ZCXA 1GFSA 1EX9A 4EYSA 1VHWA 1E4EB 1G8JA 2ZBFA 5HMLA 1S8OA 5ALMA 1YQXA 1YCFA 1JXOA 1PVVA 3UZUA 5IT0A 1C5KA 1UFQA 2BVNA 1XNGA 1G2QA 1YRAA 2VZEA 2HOQA 3HDGA 3OLQA 4LJ8A 2J3MA 4Q02A 4V0LA 3TNDA 3ED5A 3IESA 3H83A 3E3NA 4O3MA 3CX3A 1BEUB 2WU3A 1KYZA 5B1HA 1JDZA 4L15A 3HL4A 4ZU6X 1CR6A 4O02B 1VCNA 4R5MA 4BQOA 1PL6A 2RHTA 2XCSB 4OIMA 1M2JA 3K2QA 3BTSA 5L6MB 1Y5RA 2AVNA 2I6GA 2Z2XA 4HDOB 1QFXA 1OMOA 1QYIA 2EGHA 3OCJA 5J40A 4C22A 1YAHA 1EXMA 1JWBB 1UDBA 4MDFA 2QWXA 1CE8A 4IRUB 3SF8B 1IM2A 2RG7A 4BNMA 4CM9A 2F4VB 4E2FA 4WOPA 5FJIA 3RVPA 4L75A 5JBQA 4PBSA 4DSOA 3AK4A 3K05A 2Z04A 4ZEOA 2Q9BA 3REQB 4YAKA 1YTUA 1J8QA 1KEUA 1J33A 2FPPA 5BUSA 3N9IA 1GG5A 2BZ0A 1HLDA 5K8TA 4JZKA 3L9WA 5L3QA 1UBRS 3O1HB 3E9MA 4WFJA 1TUGA 3D81A 2ZBQA 1TQHA 3MERA 3Q7TA 3DZFA 4YT2A 2PJZA 1X6VA 3K3PA 1V9LA 1YF3A 2FV8A 4GMHA 5B1YA 2AFHE 3F96A 4KBGA 4QVGA 4D5EA 3ZQ6A 3UNXA 2ST1A 3CXRA 2VPIA 1VHDA 1Y3BE 3OJOA 4YJ3A 4B6RA 3QVJA 2PE5A 1N77A 3RTCA 1EP9A 4JD5A 3ZVKA 4FYKA 4WLOA 2N1BA 3EW9A 3THRA 1IN7A 3ND5A 4ZGWA 3TMKA 4DV7B 4C4PA 1FLDA 1NUHA 2YCBA 4AJJA 4LZAA 4LZJA 4Q4JA 3DOUA 1G8SA 5TPZA 3IJPA 1DRKA 1ORWA 2QX8A 1BEZA 1ICEA 3RANA 4I19A 1DBRA 4PYIA 4GC5A 5KCZA 4NOJA 2GCEA 4YBRA 4YRRA 3UM9A 5I3ZA 4OYRA 3WLQA 4EPVA 5IDXA 3T38A 4UMDA 5TDHA 4D79A 1USGA 2F3SA 1UAGA 5I47A 3PFGA 3RDPA 3WKBA 3HA3A 4D6YA 1M1YE 4FWTA 1UIMA 1QH9A 1UK7A 3FWHA 4R1UA 2PR7A 1AXGA 3QVLA 3EQ9A 1F0PA 2PJRA 4TPKA 5F35A 3ASVA 1A4UA 2WPDD 1AQ6A 1Y4SA 3ITKA 1B0PA 1KH3A 2JGJA 3PC4A 3PWZA 4LC0A 5AHRA 5L3RA 2OBNA 4O4LA 1TI7A 1ZAKA 3VPSA 4BPRA 4TZ0A 4ZAZA 2AFIB 4NK4A 1NUUA 3EEIA 3IKLA 1K6EA 2WTXA 4MEJA 2B37A 3OCUA 2PR2A 4DZZA 2Z58A 3COYA 1H9AA 1NP6A 2GBPA 2WYOA 4NG5A 3BVPA 1LU9A 4NU8X 5B12A 3T9AA 2DUJA 1DG9A 3O8QA 1IU9A 1XRSB 4TTPA 1R4AA 3EGXB 1YUNA 4R2MA 4GG1A 1L5YA 1TJPB 2F8LA 3BXOA 3E05A 1GO2A 1HEYA 4FDLA 5LFAA 2FFAA 1BFUA 4YJKA 1DRUA 3OC0A 3H0EA 3C3WA 4F96A 3K9HA 5JD4A 5GVRA 5KTTA 5EKTA 2R1VB 3RC7A 2FEWB 3QKWA 3V2GA 4L0CA 2ZRJA 4U2DA 3TD9A 3W06A 3HL0A 4TYNA 3K70D 1AB6A 4BX3A 1CF2O 1RXUA 2BPOA 2I78A 3BE5A 3G7NA 3IUEA 1E2EA 2RGNA 1D2HA 5GZ6A 2H2FA 1QO0A 3GGDA 5B53A 5IDWA 2YUIA 4KDFA 2V54A 3LCJA 1W7AA 3ZU2A 1G4UR 4Q1VA 3TN7A 4PONA 4OUDA 1EE2A 1TQ2A 3FB4A 4CPDA 3DLPX 2J6IA 1GHTA 2XF2A 1H6CA 4LF6B 1ULUA 4XYMA 4N48A 2NU9B 2EZTA 3ZXUB 4MJ7A 4AMZA 2PUCA 2CMHA 2FG7C 4WXRA 5C7LO 3KU1A 1HBJA 2C3MA 5ALLA 4H0NA 2FSIA 2VK4A 3V80A 2I4RA 1YONA 3WK7A 5JU6A 5LNK6 2GT1A 1POWA 1GSOA 4IOMA 3RWOA 1XYVA 2NO9A 4QSHA 5IARA 5AW0A 3LQRA 1TO1E 2ZSKA 4P7GA 5F9HA 2VYFA 2HK9A 1TVEA 1U3TA 3WLHA 5I7VA 5JEDA 4IIHA 4RL6A 3IBGA 4L27A 3BXFA 4KPFC 3RVSA 3CF4A 5CDSA 2PUEA 1Z2OX 3G8DA 2YY7A 4Y1GA 3COWA 4G26A 3RRNA 3SHTA 2YNMC 4CM4B 4EKIA 3AV3A 3LRPA 1PEAA 1EFKA 2W58A 3CTMA 3WNQA 3ROGA 4B6PA 3O5AA 4IQGA 3W5CA 4WAUA 5EKUA 3GF4A 1WW3A 3IH5A 3UXEA 1X0XA 5AK3A 1AUOA 1CY1A 1PFKA 3H9BA 2K4MA 2EEZA 5D7NA 1LD3A 5DXAA 2FMFA 3AR4A 3ONNA 3TINA 3HXQA 3W6OA 4G5FA 1Y8RB 1GAQA 4S0XA 2FWJA 2XUKA 2IPLA 2E87A 1BDBA 1UZNA 2PH5A 3GFFA 3ISVA 4RFSB 3WLNA 2D62A 2Q3DA 1JU9A 3OMLA 3MTAA 2GYWA 1KPIA 2Y6VA 5MF6A 5AQ1A 4N01A 2WIGA 4MR7A 1I2MA 1KJ8A 1NC3A 2X58A 4ZQGA 4JLBA 3UK6A 4PX2A 3BWMA 4DN6A 4DPMA 5BORA 3E7FA 4E1BA 1DT3A 4WA8A 2ZWPA 1H9BA 1E4OA 1Q92A 2IIBA 3UBTA 1BQ3A 1IH8A 2QVBA 3RGGA 5ECDA 2B83A 1DOAA 5AKGA 3A0UA 5BYJA 3HACA 3CF2A 3DEKA 1R9JA 4GMDA 2APJA 3KZOA 1R4NB 2NYUA 2FOXA 3I72A 1UJCA 4HDSA 2WWIA 4JLAA 2O2SA 4RMGA 5E2IA 4H4CA 3VVBA 4CTKA 2WIJA 4FFDA 1UWCA 4YLGA 2ZTVA 2CZGA 2H59A 1FMJA 1OFUA 5EZYA 4BLTA 2XEXA 2WFAA 4G0PA 1VXOA 2JLVA 3RV4A 1SQ0A 1YGPA 3AFNA 6PFKA 9ATCA 1DIAA 3CMCO 4MAAA 2JLUA 1XAGA 4JT9A 5LBUA 4CEHA 4FN5A 3ZVRA 4J0QA 2A6PA 4N12A 5JRDS 3Q9LA 2HCBA 2JFWA 2HJHA 1LW7A 1NURA 2OO5A 2X4DA 3BAFA 1JZQA 4HNRA 4YP0A 5DBIA 2X6TA 3EFEA 3U7RA 4I4IA 2Z2ZA 2WTMA 1ZUHA 1ZS9A 3IO5A 3TR0A 1BYUA 2HO4A 3WGHA 2R6ZA 2I2BA 5H1YA 2HHAA 2BC9A 1MA3A 4AX4A 3STHA 1MXHA 3FPCA 4ME6A 4BIMA 4XX1A 2P8JA 2QM3A 1NZJA 4IJVA 3O91A 1KEPA 4CDGA 2OCAA 4L4SA 2BV3A 3I9LA 2AYZA 2X41A 2IUFA 1XJ0A 2BUBA 1I4LD 2RGBA 2OKCA 2VYQA 3L6DA 3OQIA 4TTSA 5CW2A 5G0SA 3ZEAA 4I0WB 4G56A 4F4IA 2IYWA 3D8BA 3KUKA 5DTEA 2G76A 3AOGA 4DMRA 4EPRA 1G42A 1LF0A 3NS7A 1VKOA 5LKRA 1WUJS 2RE8A 5AFSA 1A8SA 5FOWA 2I87A 1SBNE 1M1NB 1EG7A 2R6R1 3NPAA 5DHAA 3BWCA 3GWGA 1JGTA 2LUOA 3TOCA 5FPTA 3K9FC 3MLBA 1Y7PA 4KAJA 3R8FA 3LKBA 5BN3B 4FZVA 2E0IA 2WJJA 5CT5A 2XXJA 1HYQA 1D6NA 1C8VB 3C8ZA 4NCXA 3UH1A 3IPAA 4ITUA 1MN6A 1F8UA 4D0LB 1YZKA 1S5PA 4XIFA 3LKDA 4AQYB 2ODAA 3ESDA 4DLRA 2YN2A 2YWBA 3FCAA 3LUAA 1EFVB 1Z4NA 2F1OA 2P4HX 1Z2CA 5E9AA 2V9ZA 1U0NA 2EKQA 2WJ4A 3INRA 3QG1A 4G3XA 1WBJB 2R2AA 4NMHA 3ZE1B 4WDRA 4TMKA 1ZCBA 5EERA 3CYFA 5KJ6A 3D0OA 3IDSA 4JGGA 2VLIA 3CO5A 3PX3A 3SSOA 4AF6A 4E12A 3NHYA 1QVAA 1BX3A 2V7WA 3BA6A 3AKDA 4KYUA 2GF2A 1KZ6A 4KAFA 1ZH6A 2PXAA 4OQNA 4ZC1A 2X6QA 1TM4E 2OEPA 2R6DA 3BD7A 3LX6A 4OREX 1QCCA 1J1UA 3ANNA 1O77A 4ZAVA 4TN1A 5IWAB 1JA0A 4BASA 5JDCA 1XAIA 1D6SA 3BIJA 1U7WA 1X80B 4LXIA 3QPBA 1PUJA 1FUKA 2OQ2A 3KHTA 5E1OA 5T8KC 3TBHA 4ZZ0A 5CHYA 2B30A 5L3SB 3PSAA 2ZM5A 1W581 4M89A 4MNTA 3WB1A 4KXFB 1VP9A 1QQ6A 5TS2A 1N2CA 1H23A 4RIFA 4HQRA 2Z4RA 4OLJA 5JAUA 5GJWC 1W49A 3FTNA 1DO2A 3DWGA 5TJ9A 1SWVA 3SYKA 2JGFA 4X8OA 5IYZF 4UD2A 4YP6A 4ZI3A 1N7GA 3GCGA 5EIXA 5JPDA 1UZMA 1IMJA 3DXFA 3FOCA 5HNKA 4U6SA 1G3QA 2BEWA 3VGJA 5E6UA 4Q7LA 3WMEA 1IUPA 2ZUCA 3VOSA 4RTSA 1HDRA 3P27A 1E3TA 4EYGA 1Z6XA 2Q9AA 4BQEA 2XZTA 3S8EA 2WK1A 3B70A 1QYXA 5FPPA 1XQ9A 4QM7A 1LBSA 1N2ZA 2GGSA 4C7BA 5FBKA 4FYMA 4IUYA 4LYFA 1G7CA 5IJ0B 1HNXB 4QDJA 4ZT3A 3W5UA 1OC2A 3P2IA 2I6SA 1QGAA 3FPBA 1BS1A 4PZDA 2HRQA 4QUAA 2NU8B 1JPJA 3SN6A 2XZLA 4L0QA 3HQ4O 4OSEA 4LYEA 4Z4QA 3HY6A 1V6SA 4BO9A 3Q3EA 1J21A 1G3IA 2NU7B 4C7OA 1ML4A 1IN5A 2PZJA 1G5RA 2FWNA 1DAEA 3WLAA 2GBLC 1L7DA 3GPBA 4IJQA 4MV3A 3C74A 4YQEA 3KZKA 1KEWA 3M4JA 3SQWA 2JFOA 1DKUA 3R3SA 4H7DA 5E4FA 1C0EA 3C7AA 3ZU5A 3DZGA 1LBQA 3PDHA 4DGSA 2J9XB 3HJAA 1XYYA 4BJ5A 1ESEA 4EA8A 5DCWA 3U0VA 3WRXC 1JDBC 4LHSA 5BWLA 3QE2A 1V8ZA 1K7FB 3MCAA 2AG6A 2ERCA 4CLRB 1G60A 2C4UA 3LMKA 3HBLA 3RVBA 4B4UA 5DZSA 1ECGA 3NO4A 3UENA 2AQIA 2PVPA 1ZMRA 4OGGA 5TT1A 2QRUA 3PHJA 4ZMRA 1PYDA 3TUJC 3Q11A 4LYJA 3KSMA 1MQAA 2VBGA 2VR1A 1L5NA 1JI3A 4FFBB 5AM0A 1P0FA 3BZWA 4L4ZA 3FNGA 3TL3A 5I4BA 1B2LA 1CE8B 1EUCA 4LRQA 3ACCA 1N1DA 3MJEA 4DEYA 2PQ6A 2ZS8A 3VBCA 2BJHA 4AVYA 2OYSA 2PNJA 5C46F 3K6SB 5EUMA 3I5AA 4P58A 3CB2A 2P9GA 3GCWA 1CFZA 1K3TA 1VCIA 2FPPB 2IK8A 2PWPA 4QARA 3MJRA 4KLCA 3TTTA 4CDRA 4J7XA 1FQWA 1Z08A 4GLBA 1WUIS 4X1KB 3FFWA 4ONEA 1XCGB 5LUAA 3WWYA 4XJXA 2GZ1A 4AKIA 4D4LA 2OXEA 2O4UX 5KTYA 5CFOA 1Z7WA 2J9YB 3K6RA 4Z2YA 4ETNA 2AMVA 1T0BA 1X14A 4FW9A 3DLAA 1SN7A 1Z4IA 3B2EA 2H4JA 3HXLA 4B2YA 4ZDKA 5DMHA 2H2WA 1N5OX 4YJ3B 4V1CA 1XA3A 1DJMA 1UPTA 5EWMA 2CXSA 1V16A 1YQWA 2G17A 1DEAA 2O3QA 3CURA 1TK9A 3G2JA 4FONA 3M4XA 4JBIA 4WFIA 5L7WA 3M4NA 1D6JA 2P9CA 4MS3B 1F8YA 2E4YA 1QHEA 1HURA 2W6ID 1ZH2A 3D4BA 2P11A 4Q4JB 5CCBA 3RAFC 3BMOB 5DCUA 1OROA 2BWJA 4MGIR 2DSTA 5IASA 2ZZNA 8GPBA 4YQZA 3SICE 4LJ9A 2RGWA 3QYFA 2OAEA 4HTAA 3TRKA 2ZI9A 5FNZA 4CUZA 4EH1A 1QRDA 3OE7A 3C98A 1OLOA 4PLTA 3IAS1 4BAGA 4BNHA 5K0NA 3HXMA 1WXHA 4PGMA 3R5XA 1H65A 5H3LA 5IBRA 2JD2A 3JVDA 1UAAA 3IEPA 4OGFA 3U3DA 4Z4GA 3IP7A 1HORA 3TR6A 3WYBA 1IY2A 4O4LB 4KLAA 4RFVA 3ESRA 2O7VA 1NPDA 2ZW9A 4WSOA 1GNSA 2L17A 3WYFA 3QIAA 3R4VA 1MW9X 3OKAA 4ACBA 3KTAA 1T1EA 3ZWNA 3LHIA 3AM3A 3E81A 3RPEA 1JPUA 3HKEA 3MUFA 4E07A 1FTQA 2WT8A 3JAKA 1E8MA 4JJZA 4WZBB 4X64B 5BWCA 4UAGA 5CCXA 4BECA 1YHZA 1EJBA 1RRCA 2AFIE 3RO7A 1SUWA 3P9XA 3N8GA 3T3IA 4ZJZA 2GPWA 2ZDGA 2PLWA 4IKPA 2IBTA 2W11A 5JECA 4FILA 1ZK1A 4KN6A 1W5BA 2ZTLA 4MKRA 2JFHA 3B6ZA 3QVGA 1YJAA 3G2KA 3KLBA 4QASA 1RTKA 3M1IA 5JXHA 5IT5A 2NSHA 1Z5OA 4Q03A 4QPCA 3ZJYA 4DARA 3IQWA 3MGBA 3PC8C 4Z4HA 3ZGXA 4O8ZA 3Q8LA 4OUDB 2HK8A 3ANYB 3PE3A 4HTFA 4YJDA 1YRQA 4MUYA 3VHQA 5HWSA 2YOHA 3IAEA 1RZUA 4MQEA 5AHXA 2W2MA 1C41A 2PL5A 5B7PA 4OHPA 1Z6TA 1MX5A 1ZXXA 3ADCA 3ONFA 4KR3A 1TM7E 3I3SR 3L5KA 1HYGA 1GZ3A 3OQHA 1ZL2A 3C2QA 2ZBRA 1AXEA 3HJGA 5AW8A 4BN5A 2I4MA 1VJ5A 4C4XA 4UQPA 6REQA 1ZGGA 3ODGA 4XIYA 5JCJA 2R47A 2WJVA 4OXKA 3D8HA 1FNNA 3KOMA 4C7VA 1PWYE 5E3IA 4D4KA 4WLFA 1J22A 1JV2B 3T41A 5ICFA 4BO8A 4YRSA 4YP1A 1AO0A 1AZWA 4NDZA 1RCFA 1CEXA 3BERA 1QTRA 3NAMA 4HAIA 4K3UA 1XNJA 3B5EA 1YMUA 4NMWA 3JQQA 1QLWA 3PKJA 4QXQA 3A1CA 1OXUA 3KYBA 3AI3A 3DVRX 1UEIA 2QL5A 3SHQA 4PLPA 1WBBA 2HNAA 3FYUA 3OZSA 4TMVA 4EKDA 1XFDA 4MVJP 4X6YA 5F77A 3Q2KA 4M83A 1T8PA 5KJCA 3AVVA 4F3YA 1KMIY 2AJBA 5IBQA 3W3ZB 2WYWA 4U2EA 4ZVKA 4IM7A 1XR3A 1U0OC 3TB6A 2OK7A 2WABA 1KBQA 3OA0A 2P2LA 2WE8A 3SJZA 1FUUA 4KSYA 2COKA 4MR7B 2BE7A 3FFAA 3MYYA 4ZDJA 3O74A 2JZOA 4BNVA 2SNIE 4ZMBA 4UHCA 4RZUA 3N8NA 3DKRA 3FDJA 2XEDA 2ZJ7A 3WZLA 1QG2A 2OG2A 1WD7A 3PQ5A 4XWOA 2PO5A 1P29A 3LGXA 1YKFA 1R16A 2X13A 3TK1A 4J76A 1GNRA 5A9RA 3KB2A 3HGQA 4HDSB 5JAPA 2QD2A 1SBYA 3HO8A 1GAWA 1YQEA 5DWVA 1G5TA 1M6VA 1G7SA 3FETA 5EZYB 4EM6A 4CM3A 2RJOA 5JTTA 2X0JA 2QGFA 2O48X 1OTHA 1LJ8A 3H0CA 4QNMA 4XYEA 4IOLA 3T94A 2DCUA 4C1BA 5KOIA 2IX3A 1K92A 1YL6A 3IUSA 4GLJA 3WKDA 1VJRA 3DMTC 4CEHB 1CQZA 4YIHA 1GNTA 4G5RA 4N54A 1T8UA 2Q2OA 5B7GA 5JAZA 2I3BA 4II7A 1BX0A 2AN9A 3L46A 3PVSA 2H4YA 2W2VA 1QRUA 4YYZA 2VDVE 1EMDA 1BE8A 2FEXA 4RY8A 4QECA 3VPDA 2CGEA 4POOA 3X1MA 3GGJA 3PLNA 5K0GA 3C7KA 4MVXA 3VKVA 4K1LA 2BSXA 1X13A 2PGJA 3EA0A 3L6RA 4WL0A 1OZGA 1TGYA 1H1TA 3UO8B 4K9MA 3V2HA 1VYHA 3ID6C 1S01A 3OEHA 3T7CA 1W46A 4WLUA 4N0DA 4OTZA 4A8HA 1GTSA 2XB8A 2E2WA 5J23A 4HH4A 4XLZA 3TEMA 3GRYA 3OQIB 4Z49A 3QHAA 5FEUA 3A1NA 1A7UA 4WRRA 4LFBB 3CPEA 1AGXA 2D5AA 4KG7A 4CMEC 4YAEA 2QJFA 1DARA 4XR9A 5F5XA 3ZX5A 1RP7A 3IQEA 3Q3HA 3JQAA 3LHKA 1XYGA 4NBRA 4RMNA 3OQOA 4BFTA 3ZV6A 3PPYA 1R5BA 1DIOB 2P78A 3OOHA 1E1CA 2QW1A 3ADBA 2NZYA 2W4MA 4OMCA 1H0KA 4CTOA 2YC4C 3IHWA 4E2ZA 1C7JA 3T1TA 2FSHA 4FFOA 2GCIA 3UJAA 2JLQA 4BMYA 1GTVA 3MD9A 2RJ3A 2AJCA 1ZZEA 1UXGA 1GTJ1 3UTCA 5KYTA 1RI2A 3DBOB 3HDHA 3AJ8A 1DJLA 4OB8A 4JLPA 5CD9A 3CX4A 4B46A 1RRFA 1JG1A 2WHQA 2BFMA 4HFRA 5M5BA 4I66A 1IONA 4EJ6A 2X0DA 1RT9A 2DPGA 4MVJG 2XRFA 3P0HA 4DWJA 3O84A 3UMMA 1R8SA 1BEEA 1M2OA 5IT4A 1UINA 3C4QA 3T7RA 5DWQA 3RWBA 2QTMA 2OD2A 2YVQA 2R8OA 3OZEA 4LVUA 1NPTO 3Q7SA 4R41A 2OCLA 5HEKA 4D99A 4CKWA 4MW6A 2VJKA 1G6Q1 2A5YB 2OORC 3CKYA 3NHAA 3C6QA 1XRPA 2C2XA 2ZJAA 3F8WA 1A4IA 2D3TA 3CCBA 2XA1A 4Z9YA 4QFCA 5FIUA 2IYPA 4EHBA 4G65A 4X1IA 3DUFA 2PSHA 1UDRA 1WVGA 3AM4A 2ZU0C 1KVTA 4CODB 1N2CB 5JQGF 3ETDA 3BL8A 3LRXA 5CYPA 2XOKD 5A4MS 4HAZA 2F7SA 5HM8A 3OPYI 4I5DA 3HCAA 1KZGB 3K0KA 1VMKA 3EISA 4JLJA 4RK6A 3AETA 2C2GA 4DLLA 1WXQA 2BEWB 4TV8B 3AUYA 4LDNA 3EZYA 1I7LA 4FZRA 4UTVA 1JR6A 3ANXA 3JRXA 1G5HA 2EU8A 2O4CA 3PL5A 5EQFA 3FNFA 2J48A 4KTTE 1BWQA 1VSVA 3I83A 2CD9A 5AVVA 2ORWA 6ABPA 4M9CA 3T6KA 5ALGA 2BBTA 3AHHA 4MINA 5T3YA 4FX2A 3TFWA 1F12A 1KO7A 4HXEB 1TZKA 5F2OA 3ER8A 2I2DA 3A3OA 5LQUA 2DKOA 3L04A 3UBMA 2W6NA 2BKVA 2YVUA 3QWBA 2IIPA 5LU9A 2QQEA 5AMXA 5FA6A 3I58A 2UUOA 3L02A 3FGNA 1JEAA 2CVZA 4U7HA 1FC0A 5CB4B 2MCFA 3O2JA 1XMPA 4OU4A 4MROA 1T6XA 1JZSA 2DSNA 3JALA 4M0KA 3J81A 1E5LA 3JZMA 1WCIB 3WYCA 1UF9A 1MU0A 2W2NA 2DPXA 3L6CA 4JC4A 4ZV9A 1CG6A 2ECPA 4LRXA 1BMTA 2YN0A 3DM5A 1T9GR 1Y37A 3H5NA 3OZRA 4P5PA 5TR9A 4ZHQA 3RLFA 3SKVA 1KEKA 3IA2A 1LJUA 2R3SA 3SMQA 3SZLA 1SXQA 2AJDA 2PKCA 3BA1A 5F2EA 4QDUA 3SDSA 1H2EA 1I9CA 2BUAA 5WRFA 4ZEMA 3D7NA 4YJ2A 4NENB 1UPCA 5TNXA 1NASA 5AVUA 1NYQA 3RVOA 4OFBA 1YC2A 3MBIA 2HYDA 4ZGBA 1S2NA 5FOSA 5AD1A 3KAQA 2AC2A 4UCWA 1US8A 3AYZB 5C1IA 3KETA 5BV2P 1XA4A 4FLFA 1DINA 4AAYA 4D9GA 1TFRA 3TCNA 1Z9BA 5D5QA 5FLYA 1BE1A 2XWPA 1J8FA 5CA0A 5L7TA 5A0FA 4ZVMA 1Z0KA 2BF4A 3H2HA 4RC9A 4Y2RA 1DCFA 3IMGA 2F1KA 3DE6X 4YGXB 2ZBGA 4ESHA 4R8KA 5JY6A 3IV9A 3IE1A 1W8DA 2DETA 3P71T 5HTKA 2Q50A 3LT0A 1T9AA 2V4ZA 1RFLA 3BIOA 1Q77A 4HX9A 4DLNA 5FTNA 1H4TA 2GO7A 4HQLA 4L5CA 3LT1A 3T3OA 2ERXA 3FHJA 3HCOA 4LJ6A 3GLKA 5EWMB 3ZD9A 4WQMA 4PQEA 3OPYB 1XN1A 3IAXA 4Q12A 1AS2A 1IZZA 5F5LA 5DTIA 2G6TA 2V7TA 3QVUA 4J1TA 3HXTA 4UDOA 4AIIA 4DCCA 3L1VA 5CFZA 4L5IA 4Q9KA 1EFRA 3DKIA 4PHGA 1JR4A 3G82C 2FLKA 4RHCA 1NIJA 4CQLA 2MOKA 4OG2A 3ESZA 3EF3A 1Z8NA 5A3JA 3P9NA 5A4AA 3HRIA 2F3RA 1IB0A 4UPVA 1GLNA 4EW6A 5E6SB 2X1HA 4XQ9A 5DYGA 5C8YF 1KXZA 4G1VA 3QEOA 3RHTA 3TECE 3OZ7A 2Q7OE 1T24A 3KOXA 4LRWA 2OR3A 4PAQA 1C7QA 4ZT7A 2ZWIA 4I6JA 1NU8A 2MIIA 4JIGA 1ATZA 2QR2A 1RXVA 6GPBA 4REMA 5EE5B 1B0UA 1F14A 4P53A 2VTBA 3QBJA 3AF2A 3DZBA 3U1VA 5SY4A 2RGNC 1SBQA 5KDOA 2QTLA 1NN3A 4RWZA 1NF8A 2FY8A 1OWPA 4PCUA 2II6A 5KOJB 4OJNA 5CT8A 4P93A 3LBNA 1F8XA 2G9NA 1JQ5A 1L7OA 2BTQB 4PAOA 3KTAB 1U7HA 4MMZB 1Z5ZA 1G5IA 3TOVA 2P4QA 2RJNA 1WZCA 3HKEB 4MRPA 4NYJR 3SJUA 2ZYDA 4D9EA 3QUSA 3JAKB 4BB0A 4YAWA 3OY7A 4ZK2A 2ZGVA 5ENDA 4P4SA 3IPCA 3KL2A 1QGOA 4B8WA 1KY5A 1F9EA 1U98A 4H7EA 5JD5A 2WP8J 4JFRA 4LF9B 3CX8A 3MCTA 2IP4A 1M2EA 1G1MA 1HE2A 1LA2A 4TS3A 1TJ4A 3WY9A 2QSZA 3FTCA 5BQOA 4A03A 1UM9A 3DDHA 5H5JA 1N2JA 4N6GA 4S35A 1AM4D 4FOPA 4ZO8A 3V1KA 1UKCA 1HLFA 4KLZA 3QVGB 5EIHA 1EFAA 3ZWDA 5HJ5A 1KYVA 5M34A 2F43A 4ETWA 1QZ3A 2O6LA 1ZDMA 2R97A 1L2TA 1NC1A 4NXMB 4UU8A 2JKVA 3I28A 4Q9HA 4HTFB 4PCLA 1W85A 3P9ZA 4Q93A 3TX6A 3UJ3X 5DNAA 3MJ4A 3H05A 1I6KA 3HU2A 4N3BA 1MQ8B 3ZU3A 4GOXA 1DO8A 4BEBA 3QENA 5KWEA 1E64A 1J20A 1E2GA 1Q1NA 1X8JA 2AK3A 2AOUA 2BKUA 3CT4A 3IVGA 3OU2A 4FFWA 1Y6ZA 3K5HA 2JAUA 2PTHA 3Q12A 1NJGA 5B36A 8ATCA 4E1VA 1KZYC 2XUAA 4XKJA 5F4BA 3GLIE 1A98A 1EHYA 5IMSA 1DCTA 2H1IA 3C7DB 2HRRA 1TT5A 3HB0A 4RKEA 2GPSA 2PD3A 3RF6A 5JMWA 2IS2A 4MH0R 2JJ8A 1WP9A 3RSZA 1XDGA 4HO1X 3L8CA 4H1VA 4EYKA 2IYVA 1VZ2A 3FYUB 4NCIA 1NNLA 3H8JA 2Y4NA 3EVEA 3PGXA 3MWEB 5G4LA 4H7JA 3ZW7A 3MQ2A 3SVZA 2V1UA 4U7WA 4QDKA 3FCCA 1RYZA 3AVPA 1QAMA 4LNUB 4N0PA 2BFNA 3ZJUA 3GMDA 3Q0TA 1JFRA 3VHRA 2IEAA 4FMCF 1W5AA 5LYJF 1XJ5A 1YJ8A 2Z5LA 3SC4A 1YFKA 5TE9A 2KE5A 3TXXA 3KEMA 2C2MA 3GJSA 1AN9A 1TMGE 1ZCZA 2EX1A 3ELBA 2GLUA 1FP7A 1N2OA 1NONA 2DE0X 3JWJA 3NM4A 1N7JA 4Q4DA 5JG7A 4RTNA 2OO5C 2HA4A 1DEHA 1QGYA 4ZI7F 1DFGA 1WMDA 3VZDA 3OD1A 3AHJA 3QEMA 1BKDR 4K05A 1H5QA 2WOJA 3VO8A 1J7JA 1ZIYA 3RSQA 5I5EA 1F8GA 2X3UA 5ALYA 4M9RA 5C8DA 4M76B 2P9BA 2HBQA 5LJIA 5LXTA 4OXRA 2FSGA 3D6HA 4KP7A 3E9ZA 4BQIA 1G2OA 4BZWA 1EI9A 1HWYA 3BN3A 1M6VB 1JEDA 4MKZA 1HNZB 2C8VA 4G1MB 3OUZA 3FBWA 1RAHA 3PHGA 4RD6A 2J45A 4EX7A 4PR3A 1B23P 3G8AA 1DQYA 5GONF 3IB6A 5IMBA 4KXNA 5I7UA 1YS2X 1OTXA 2BGIA 4BMDA 3OF2A 3AEQA 5KHOC 1J0AA 3R74A 4ZEWA 2QG9A 4HS4A 2WLSA 3GA0A 1EFTA 1W2GA 1Y3DE 1Z73A 4U7TB 2XTAA 3UHPA 3PYXA 4D9NA 3HV0A 4X7PA 4HYTA 2XCQA 1IULA 4KLNA 4LKRA 4BZXA 4BVHA 3D4LA 1AMOA 3R20A 3ENNA 4LPSA 3RLIA 4CEIB 4L3OA 4U00A 3LLUA 4AG6A 5JNWA 3E9YA 1M67A 4TS9A 2GAIA 3RSCA 2P6UA 4HN2A 4YMTA 1KOFA 1AT1A 1E3JA 3FTEA 2NPOA 4XZ3A 1MJNA 3EDMA 3HVIA 1P2VA 3GYGA 1SNYA 2SKEA 3JD4A 3G8CA 3HUUA 4CBVA 1WUYA 2B4QA 5BSTA 1J99A 5AVRA 1E1DA 3EE6A 1CJUC 3LDFA 1X19A 3IMEA 4MEBA 2O1XA 4NEGA 4ZVTA 2I29A 1TJ5A 4GPZA 2WAYA 3UPUA 1XBTA 4BGDA 3BMQA 4HOYA 1WNFA 4JMPA 4QKQA 3HLKA 2UUPA 5IZ4A 3LPMA 4J0CA 4RQBA 4GM4A 3GRPA 4HDCA 3HJRA 3WS7A 4EG7A 5E7IA 4L78A 3JQAB 2DTXA 4QLAA 3GGGA 1UAYA 4EY8A 4ZOLF 1BS2A 5CPFA 5DBFA 1H66A 1DKOA 1KYTA 2XAAA 1O6BA 4DPLA 5LR6A 1I5EA 1SHJA 5IC6A 1E1CB 2I4IA 4IQ4A 5KI6A 4C01A 5JDCC 1GAXA 2FVXA 1FX0A 2D5CA 1CVRA 2GESA 3F3MA 3PZRA 4HNAA 3WWPA 4P3PA 4K03A 4F9GA 3IL2A 4IFTA 3QOWA 1UBGA 2OE2A 1PS0A 1M8GA 1V5GA 2NZJA 2O2YA 1CERA 5BURA 5HUJA 5KMGB 1KORA 2X5OA 3O31A 3L2OB 3BWDD 5HQJA 1T0IA 2ZRFA 2KI5A 4P5EA 3MWKA 5IKOA 3AU8A 1YACA 3DCYA 3G2OA 4UASA 1RCUA 4A0GA 4LNHA 2H3EA 3IOCA 3WK9A 2J4DA 4D9KA 3K2IA 3L41A 5THQA 3SP1A 3N2EA 4CV1A 4NJMA 4ZTBA 3D43A 3A2LA 2P35A 3EASA 2VRWA 3QFHA 2QTCA 2IEZA 1XT6A 2OO3A 3H7AA 5A4FS 4UW9A 3BWVA 1AGYA 4CKWB 4DHEA 5KU7A 1KAMA 3W4KA 1W2HA 2ZVJA 3OSUA 3DKKA 5EE9A 1MORA 1NN1A 1OZAA 3C0KA 1I1HA 2A0KA 2VDPB 4J1QA 2WW8A 3WBBA 1IVNA 1ID1A 3LQYA 2JD0A 3MCVA 4X1IB 3MTDA 2PGAA 3PUXA 5TRTA 2QRLA 4L07A 1PSDA 2ZU6A 3BK1A 1QRAA 3NHKA 4BNZA 2HCTA 3HCWA 4JLNA 1X74A 5BSWA 4QXPA 4UU7A 2CLDX 2ZYAA 3R3VA 5P8WA 3IV6A 3T34A 1DAGA 4D25A 4ZCQA 1A8PA 2G63A 1DRVA 3FKJA 3I1IA 1P6QA 2GEJA 3AETB 3KSRA 4I3FA 4BKPA 2AR7A 3ZG6A 1UXJA 1CRWG 4R2JA 4HNGA 4QNNA 3B20A 4ZT5A 2ZTSA 1RKXA 2YV5A 3HN7A 3M3DA 1N2CE 3BT7A 3HP1A 1RLUA 4J6FA 2OM2A 3BRSA 4DSNA 1U0EA 2JGKA 1BDHA 4WK0B 4F38A 3OJWA 3OM8A 2VP9A 3O9MA 3NX4A 4YMHA 4AJ4A 4TYWA 4RHUA 3LC2O 2PXXA 4TXJA 3R76A 4RE5A 2OGUA 3TFQA 4EHKA 2QLLA 1NP7A 3E9NA 3I39X 3MWDA 1L5OA 4KWIA 4IIBA 3BFKA 1KMHA 3S40A 3SLRA 2RKWA 3PQ3A 3QFFA 5INTA 3U81A 1SG0A 2V7XA 3C3YA 3OX4A 3ND7A 1JDPA 1BIFA 4D45A 4LOIA 2JCYA 2PMBA 4TL7A 2PPVA 3UT0A 4UCXA 3IUNA 2C4HA 4GR5A 2FWPA 2PGDA 4YECA 2UVQA 3OQVA 5DTQA 4L95C 4BX2A 5LQMA 2JBAA 1RKUA 3EAQA 3L8DA 4HC4A 4Q4HA 4OI0A 2QRGA 1FDTA 1VPEA 5MN4A 3BCHA 1GYPA 5E9WA 1M8KA 2NZVG 2VOJA 2WQ7A 3LZCA 1TM1E 3HWWA 4Q21A 4YJ2B 3W4JA 2PZFA 4L4RA 1MT0A 1W6RA 2G7MC 3G79A 4MUXA 1OA0A 3VI3B 4EHAA 4YUXA 8AT1A 4MGKR 3DA8A 4BX9A 2BM8A 5JFGA 3VR2D 1DRWA 2JFZA 2IITA 2D0PB 2G0TA 1US8B 3H5TA 3BWYA 4Y6OA 3UWSA 1J90A 1RE0A 2QM7A 3KCQA 4NICA 2Q28A 4L0MA 5BVHA 1H4VB 2CBZA 1E1RD 3LUFA 2QPOA 2HPAA 2EFYA 2V7QA 4PHHA 1Y42X 1KVUA 3CH5A 3CG0A 3VTZA 3SCZA 1ONPA 1PNOA 2ZYVX 4DCUA 1XQ6A 2Z4TA 4WXMA 1XC7A 1J5EB 4PS1A 2Z6UA 2H0AA 3BH0A 2P4EA 2ZAOA 1H2WA 1GQQA 4AL4A 5I7HA 1E9AA 4QNRA 2A14A 4E5MA 3S68A 2DHEA 1EHCA 3DMHA 3PE4A 2V1XA 2HCJB 4FBLA 1SC1A 3VNRA 1PNTA 1R8YA 2IDMA 3BJMA 1HE5A 3QU9A 3MBKA 3P4XA 2NQ8A 2GI4A 4P8RA 5ALZA 3VFDA 1D0IA 1MX9A 4IVQA 1P1RA 4OX9Y 4W9RA 2P6PA 2B2NA 3CWZA 4K6GA 2C78A 3WLFA 2CMGA 1B3RA 1MVLA 2OBBA 2W6IA 1TQDA 1SUCA 1KXJA 1VIMA 2WEKA 3DGFC 3ZHRA 1EK0A 2XDWA 1FLNA 4YRAA 5BXYA 5KQMA 3MT7A 1EFPB 4J2OA 3VUFA 3PUWA 4CQLB 5FT9A 3ELWA 2J6HA 3JWPA 1SELA 2M1XA 4OP3A 3T9FA 2QY9A 4JQCA 3IALA 3DEZA 4B9AA 1AS0A 5D7BA 1HKHA 2FX2A 4XYLA 3QPUA 1DFHA 1SZPA 3DT6A 3PR3A 1QU2A 2XVXA 2ISSD 2WA1A 4GBMA 4YRNA 4R9VA 2J3DA 1Z36A 3HC7A 5IKPA 1YVUA 3LKZA 4H27A 4ZK6A 2J3KA 4M4SA 4P92A 2AEMA 4L5YA 4OKIA 2VTBB 3WV5A 4INZA 2C5GA 3AEUA 4D0NA 4B3DA 3OQPA 2CLIB 3W8EA 5TEVA 3ZCSA 3HWSA 1WSDA 3ZLTA 1P2FA 4CI9A 3UGQA 1HE1C 2YH2A 1BYIA 2FTKE 2OP1A 2R6CA 4PBRA 1F2TA 1MF7A 3HGMA 1BGWA 1U8CB 1XZMA 1XL1A 1W5TA 3MPOA 2PKWA 3ZZMA 2I7VA 3FNEA 2CNKA 2GK7A 3LH5A 1OHHD 1UBHS 4K8OA 1PZXA 1UK9A 3GEPA 4IKOA 1EIZA 3ZBUA 4MKGA 3GJQA 4P4SB 1HH4A 3LXXA 2V0GA 4KO8A 1Z34A 2UYQA 2B4KA 1VGRA 1H3EA 1E9FA 3VO2A 2MHCA 1CR4A 5HKKD 4QXOA 4Q1FA 3ZY4A 1UM9B 3GK3A 4CKCA 1RZRD 4MUIA 4CU2A 3ORQA 1VL8A 1Q2XA 3PHCA 4O2LA 3BRWA 1WDMA 2DBQA 3GCDA 4N8EA 5FTWA 1C3LA 1WXXA 3ZGNA 2F43B 3NATA 4PRKA 1G8YA 1AQUA 1TECE 4R51A 2ZSJA 3B82A 3FYUC 4YRMA 1W85B 4E31A 2F3QA 2F9MA 2Y77A 4YAUA 4D4HA 2H5JA 1FB5A 2O8BB 2WD7A 4A2WA 1E8NA 2AOUB 1U1FA 2R1ZA 3SEAA 4JROA 3B5IA 3IJ5A 3OIYA 2NTJA 2WTBA 3TRIA 4U2KA 2GERA 5FD8A 4NDAA 1OXKB 4JKOA 4FXPA 2HXGA 1M7HA 2IVZA 1G21A 1RAIA 3L7BA 1PFWA 3D6AA 3H5WA 4L72A 5EJ5A 1TT5B 3PBKA 2ZSFA 4TOIA 2L2QA 4OH7A 1UMKA 3NIGB 5EE0A 1UJNA 1NRWA 5FYDA 4I4NA 1PTJA 4Q18A 5B1IA 5K0SA 4BCDA 2GM4A 3IEIA 4P3NA 1V9SA 2ZANA 4R9UC 2OXRA 5EXTA 2AMFA 3D8SA 3DZCA 5ESRA 4REQA 1Y8ZA 4EB3A 3U0BA 2NZWA 2IOFK 2RI1A 1LSSA 3H4VA 5HKLA 1ZMOA 5I45A 1ZD4A 1N5LA 1DKNA 5JYCA 5FA8A 4KJZA 1LDMA 1OGYA 5DNEA 1TUEA 3SYNA 4CR6A 2JI4A 5AWFC 5AVYA 3HYTA 3EY4A 1Q16A 5CA1A 1W4AA 2Y27A 1H8HD 3OQNA 4LBYA 4LSWA 1LPSA 4L8GA 1KU6A 5LBIA 1GGHA 2XVYA 2B4TO 2VIIA 3RIMA 2QJOA 3II6X 5CJ2A 4CLHA 1FYEA 2E5WA 2GFQA 3HEMA 3DQZA 1B8PA 3UMGA 1YR7A 4H15A 2CCKA 4D4GA 3B7WA 3SZGA 1Z28A 1RM5A 3QEMB 2D1RA 3MTJA 4CM7A 5JASA 4KE9A 1RS0A 1VSUA 4F06A 3E7DA 2ZPTX 3GV0A 1BDIA 5I9IA 2VPWA 4ZYYA 2CNLA 3IDOA 1KDYA 5CVEA 5A04A 3Q10A 3QVKA 5CFLA 1P45A 1XZJA 4JODA 2HSWA 1Q1BA 3D02A 3S7ZA 1MPXA 4CMCA 5LVAA 3OF3A 5FKJA 1P4SA 3LUDA 1F3LA 1ULHA 2C4VA 2BCEA 4URUR 4NBNA 3ZDFA 1FXWA 2EKPA 1NBMD 3NTRA 4K9SA 4KGXA 3U3RA 2BFPA