1XCLA

Guanidinoacetate methyltransferase containing s-adenosylhomocysteine and guanidine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
PLFAPGEDCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanidinoacetate N-methyltransferase
publication title Catalytic mechanism of guanidinoacetate methyltransferase: crystal structures of guanidinoacetate methyltransferase ternary complexes.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 73
structure length 229
sequence length 229
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2004-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xclA00
3JWGA 4FS8A 4RSRA 2ZWVA 1WZNA 3EVZA 3HA3A 3OU7A 1R00A 3THRA 2IPXA 2PVCA 2ESRA 2G8NA 3BKXA 4PONA 3HCFA 1WS6A 1BC5A 2C7QA 1R8YA 2IDKA 3AJDA 3IEIA 5DX8A 1RI1A 3KR0A 3B3GA 4C03A 3SR4A 2FCAA 5EZQA 3C3PA 3O4FA 4CKEA 1VP3A 1YFLA 3SM3A 3PT9A 4PYNA 1N2XA 3VSEA 4AX8A 4PYKA 3HCBA 3VYWA 5HOQA 2CMHA 3M6XA 5HIJA 4HRAA 1VP9A 3KR9A 2GS9A 4ZTBA 2OXTA 4F86A 5LQKA 3NDIA 2OKCA 3TM4A 4QPPA 3B89A 4R6XA 2QM3A 3KQPA 2XVAA 1JTFA 5LR6A 4GQBA 3G2PA 4RVGA 5DTMA 5C1IA 3TPZA 3D2LA 3BXOA 3MAGA 3BWBA 3E23A 3R0QA 2IP2A 3B7PA 1QAMA 4XUCA 2HWKA 1X19A 1Z3CA 2OB1A 3A4TA 3G2MA 4HTFB 3LL7A 5CCXA 1VL5A 1JG3A 3LKDA 4MTLA 2YXEA 3FUWA 5CD1A 3IYLW 3REOA 4DF3A 2NYUA 3MQ2A 5LQAA 4KIFA 3R6TA 2AN4A 5GIOE 2IH4A 3R9XB 2QYOA 1L1EA 5EEGA 3GRYA 5LQRA 1EJ0A 5DSXA 1L9KA 4QDJA 5LQCA 4YV2A 2EJUA 3KR1A 3SSOA 5HZMA 5ICCA 5C9ZA 3HCAA 3HCEA 3G5TA 3GU3A 2HV9A 4GEKA 2QY6A 2P3OA 2YQZA 3G2OA 2ZW9A 3EMDA 4KRGA 5EMLA 2PGXA 3TKAA 4LECA 4C05A 2I9KA 2JH9A 2YUIA 5D1HA 3HEMA 2AS0A 3T0IA 4C4AA 5LQUA 1NW3A 2Y1XA 4GBED 3UJCA 5ERGB 5CCBA 5EG5A 5EMKA 3BWYA 1ORIA 2BM9A 4MIKA 3TQSA 2QRVA 3B5IA 4NECA 5F2OA 3GO4A 2O0LA 3AWIA 1PJZA 1EAMA 2K4MA 2LD4A 3FPHA 4IKPA 4E2WA 1KPIA 3DTNA 4XCXA 5EHGA 5GP1A 3AXTA 4B17A 3SXJA 2EJTA 4BLUA 3G2QA 5CVUA 1WXXA 4MWZA 1KXZA 3A25A 3LDGA 4PYOA 3R24A 2O07A 5DM2A 1P39A 3QOXA 5E9QA 2Z6UA 3LBYA 5CVEA 1IXKA 1QAOA 2O06A 4DCGA 5CVVA 2PXCA 3CGGA 3KQYA 1AQJA 5E8JA 3GRUA 4RTPA 3HVIA 4EKIA 8MHTA 3RODA 4UOEA 2ZBRA 2Z6QA 2F8LA 4PGHA 4HGYA 4E33A 5EOVA 3CKKA 4RTJA 5T64A 3FTFA 2PX4A 2AOUB 3SMQA 1F3LA 4E2YA 5EHIA 1XDUA 1HMYA 3Q87B 4FT4A 3ME5A 3HTXA 3DMGA 1G8AA 3KKZA 5DWQA 5K0LA 5F2KA 1ZHFA 3CVOA 4GOND 1JSZA 4R05A 5DRYA 5EPEA 5ICFA 3TOSA 1R18A 5DRTA 2IH2A 2AN3A 3ID6C 2ZTHA 2IDJA 2ZIGA 1I4WA 5T6BA 1NBHA 1SVUA 3R3HA 4HH4A 4OBWA 5FQOA 3X0DA 7MHTA 2YX1A 1WY7A 5EIWA 3T7RA 2UYCA 1RJEA 5EGSA 4ER7A 1SKMA 2H00A 1T43A 1JG2A 3PS9A 4E31A 4EVIA 3PTAA 1YF3A 5E2AA 3OCJA 5EKXA 5M5BA 3NVKI 1XXLA 2JHAA 1R74A 2NP7A 3E8SA 3BGVA 4E2ZA 3GDHA 3TMAA 5DSTA 5H02A 1BHJA 4CTKA 2ORED 3EEYA 5DX0A 4FSDA 2ONYA 3NW9A 1NW8A 2B78A 2AOTB 2GAFA 4GC9A 4IWNA 2R3SA 4PYQA 1O54A 2XYVA 2PX8A 3UJDA 4ER5A 3T7TA 3EVBA 3P97A 4ATNA 2YR0A 3JWHA 3UBTA 4YUYA 3VC2A 5K05A 1KP9A 2FYTA 3ELDA 3DLIA 4RX1A 4QPNA 1DL5A 4YV0A 4RTNA 3FUUA 3FRIA 2WK1A 4GUAA 4RTOA 1FBNA 4F85A 3MHTA 4ER0A 1U2ZA 2GA9A 4LWPA 3V97A 4BP3A 5E8RA 3E05A 2PBFA 5FULA 3FTCA 4U7TB 5K0JA 4BY9E 3P2KA 4CXMA 1F38A 4Z2YA 3UJAA 4FR0A 5GOZA 4AZVA 1IY9A 3P8ZA 4AUKA 3BT7A 2YXDA 1DCTA 3F4KA 3LBFA 2B9EA 3FTDA 3G7UA 1ZGAA 2JJQA 1L3IA 3HP7A 3IHTA 3MTEA 3TFWA 2EG5A 4FT2A 5FQNA 4PCAA 2IBTA 4IV0A 2PT9A 2BM8A 5E1DA 5E9WA 10MHA 1WXWA 1YFJA 2FK7A 4RVHA 2C7OA 5FHRA 1L3CA 1XVAA 2OO3A 2PWYA 5K0NA 4V0QA 2GB4A 2YTZA 3EVAA 3BUSA 3KQOA 5HIMA 1H1DA 4FGZA 1I1NA 1I9GA 1X1DA 1EQAA 3GRRA 4JXJA 3AY0A 4RVDA 4A6DA 2AN5A 4C06A 4RTMA 2PWPA 3KPUA 2VS1A 3ORHA 1YB2A 3SX0A 2P1DA 4Y2HA 3ELYA 4GOLD 3KQSA 5K01A 1KYZA 5BXYA 2GH1A 3TM5A 2FRXA 4M38A 4OQDA 2IBSA 5EEHA 1JG1A 3EVDA 2PT6A 3EGVA 3MB5A 1JQDA 3AXSA 1UFKA 2ADMA 5KS2A 1FP2A 4PWYA 3B3FA 4YUWA 4MQ4A 2OBFA 3UA4A 4CWAA 1N7IA 3MCZA 9MHTA 3CJTA 5LQJA 3RIEA 1JSXA 1G60A 1BOOA 3PB3A 4R6WA 3PX2A 4RTRA 3DULA 2ZZMA 1RI3A 4EKGA 2P40A 2PJDA 3MERA 4PIPA 5E1OA 2ZSUA 4ER3A 3M70A 5EMMA 5F2NA 3FUXA 3H2BA 5K0EA 3OZSA 1KYWA 3LGAA 2H1RA 5CUQA 4U7PB 1G55A 4FZVA 5K0FA 1SQFA 3K6RA 4PCLA 4OA5A 4OA8A 5BP7A 2AVDA 3LSTA 2PV0A 3P2EA 3DXZA 2VZ9A 4RTLA 3FYDA 1RJGA 1SG9A 1ZG3A 3SVZA 4DCMA 1QANA 4PYJA 1XDZA 1KHHA 3DH0A 3SGLA 1FPQA 3G88A 1NW6A 1KR5A 1QZZA 2ZIFA 3PFGA 2P8JA 3DOUA 4KDCA 4PYMA 5CVJA 4AZTA 1VPTA 3G89A 4DMGA 2C7RA 2QE6A 1V39A 3EPPA 2HTEA 2UYQA 3G5LA 4E70A 3HCCA 1FJXA 2ZLBA 4PIMA 3BGDA 3QV2A 3DR5A 3DMFA 5CM2Z 4X1OA 5EC8A 1WG8A 2NP6A 4CKCA 2P41A 2O05A 2AOWA 4R8SA 5K0BA 1P1BA 2YXLA 3P2IA 3CJRA 4RV9A 5DLYA 4DA4A 3M6WA 1YUBA 5T67A 3ELUA 3EVGA 4KW7A 4M36A 2FHPA 4O29A 2DPMA 1O9HA 4E32A 3M6VA 4OQEA 1EJ6A 5FCDA 2Z6AA 3FPJA 2FK8A 3NWEA 2JHPA 2QRVB 1RJFA 4KVZA 3GCZA 1Q0TA 4QQNA 4RTKA 2HR1A 1G6Q1 2ERCA 1RI2A 4AZWA 2HMYB 5P8WA 2EFJA 2Y1WA 2ZVJA 3NWBA 4ISCA 5BW4A 1NV9A 2AOVA 2GLUA 3HA5A 2V74B 2BR3A 3TKYA 2PSSA 3TR6A 3WSTA 3TLJA 5K03A 2OYRA 3EGIA 3FUVA 1UWVA 1VLMA 2P35A 3C3YA 2AOTA 3C6KA 3HCDA 5DM1A 3SSMA 5DX1A 1Y8CA 2NXEA 2ZZNA 1VE3A 2AVNA 3L8DA 2BR5A 3LDUA 3KPWA 1O9GA 4HC4A 3LECA 4BP1A 3QOWA 5KQSA 5MHTA 1N7JA 3GNLA 3P71T 2VDUE 1IM8A 3DP7A 3FPFA 2NXCA 3DMHA 2P7HA 5DT2A 5JUWA 3DUWA 4QQKA 1VIDA 2XYQA 1JR4A 4PYLA 4X41A 3I9FA 5G02A 2BH2A 3GJYA 4DQ0A 3GGDA 4KDRA 5HFJA 4A6EA 3TRKA 3PX3A 2ZBPA 3NTVA 3UJ7A 4POOA 3LCUA 1RI5A 4HGZA 4RVFA 1UIRA 2A14A 3UJ6A 3KPJA 4PYIA 4Y30A 2PXAA 5BW5A 2PXXA 1KPGA 1TW2A 3P9CA 3UWPA 2PKWA 5ICGA 2JH8A 3DLCA 5KVAA 1KIAA 1XJ5A 5FADA 2HNKA 2NNWB 3NDJA 3T7SA 2P7IA 5DXAA 1X1CA 3CCFA 1EIZA 5GINE 4P7JA 4CTJA 1TW3A 3KQVA 3M6UA 3OE5A 5FHQA 2V7EA 1M0EA 2FPOA 2PLWA 1JQ3A 4M37A 4DM3A 4PNEA 4X61A 5E1BA 4C07A 1D2CA 4HTFA 1VQ1A 3A26A 3BGIA 3FPEA 3M33A 4QTUB 3RW9A 5CIYA 2CKDA 2OPBA 2XVMA 3KQQA 3LCVB 3CBGA 4ER6A 5E1MA 3G8BA 1JG4A 5DM4A 3I53A 5IKMA 3LHDA 2ZULA 3EVCA 3NJRA 3CC8A 3OZRA 5DPMA 4BLWA 2N47A 4E30A 3NMUF 3GXOA 2PY6A 3KPYA 5DTQA 5GM2A 3I58A 3UJBA 5HIKA 1X1AA 3OU6A 4GOMD 2P3LA 5FA8A 3UJ8A 4QDKA 2CL5A 2E5WA 4E2XA 3KQWA 4GF5A 2NXJA 3OFJA 4RTSA 1OR8A 5EVJA 3GWZA 3PFHA 4PGGA 4YUZA 2ZCJA 2OZVA 4YUXA 3GRVA 2B2CA 3IV6A 3JWJA 3KHKA 4RWZA 1FP1D 5IH3A 2B3TA 1HNNA 2ZFUA 3HNRA 3KQTA 1M6EX 3ER9A 1BKYA 1NT2A 5ICEA 3ELWA 3C0KA 1KPHA 3I5UA 4F84A 2IH5A 2H11A 2VP3A 3BWMA 4HG2A 1EG2A 1XCJA 1ZQ9A 2AR0A 4FSXA 3SSNA 2C7PA 2WA2A 4HSGA 3UA3A 3EMBA 5DM0A 1JTEA 3A7DA 5FWDA 4C08A 2GPYA 5DXJA 5D1NA 1AQIA 1VBFA 3KPVA 1NBIA 2G72A 4X63A 4YMHA 3JWIA 1XCLA 1P91A 3O7WA 3C6MA 5C0OE 1X1BA 4DKJA 3S68A 2CMGA 4C04A 5GM1A 3U81A 2JHCA 1M6YA 5U4XA 1RI4A 1JQEA 1L3BA 1MJFA 2XYRA 2ZZKA 3HVHA 1R8XA 4LWOA 2VDVE 4WVLA 1NE2A 2YVLA 3DXYA 3MGGA 3EVEA 5E2BA 5EQJB 3FTEA 1XTPA 5K09A 2AOUA 1B42A 5B1SA 3GIWA 3LPMA 3FRHA 2Q41A 2G71A 3GRZA 3K0BA 3EEOA 3BKWA 1NKVA 3ERCA 3FYCA 4L7VA 1SQGA 3E7PA 3KR2A 3UJ9A 5CVDA 4MHTA 2XBMA 3MTIA 4X60A 4YV1A 2G70A 3BWCA 3G8AA 5K8VA 4QTTB 1ZGJA 5FWAA 1NW7A 2ZIEA 1NV8A 3UZUA 4KWCA 2IIPA 2NXNA 3HVKA 1AV6A 3ANXA 4LG1A 5HIIA 3VC1A 2G1PA 5K0GA 4V0RA 2EX4A 5HEKA 1QYRA 2ZBQA 2UZ4A 2B25A 3OZTA 4GC5A 3PLAE 1Q0SA 3LX6A 1INLA 3KQMA 5LSAA 5FUBA 4K6MA 2PX5A 3DXXA 2UYOA 3EVFA 4DZRA 2O57A 1G8SA 2WA1A 2DULA 2ZWAA 1RJDA 4BLVA 1D2HA 2JG3A 2IGTA 3HM2A 4YUVA 1DUSA 3THSA 3UFBA 1R6AA 5KQRA 4P7FA 4P7KA 5K0CA 4P58A 3P9NA 3V8VA 1YZHA 3HVJA 3KU1A 2R6ZA 4CKBA 4QVGA 4OX9Y 2AZTA 1ORHA 2I7CA 3OE4A 1D2GA 4EMSA 1TPYA 2ONZA 1QAQA 4PINA 4R8RA 1AF7A 3BZBA 2I62A 3LKZA 3I64A 4M7RA 5KYGA 4H0NA 1MHTA 4G56A 4OBXA 3LDFA 2BR4A 2BZGA 4QVKA 1P1CA 4P7GA 5LQNA 3ER8A 2IFTA 4FP9A 3MCTA 3A27A 4YMGA 1YZ3A 5GIPE 2VDWA 3OFKA 2UYHA 1SUSA 4RTQA 5JR3A 3P9KA 3FUTA 1SUIA 3FPGA 5FA5A 4EK9A 1PRYA 2P3QA 2CWWA 2OB2A 3CJQA 3OPNA 4KIGA 4GOOD 3A7EA 2PX2A 4XUDA 4EQZA 3EGEA 3LCCA 2OY0A 3FZGA 5E9JA 1ZKDA 3OU2A 5EZSA 2I6GA 3M4XA 3HA7A 3NVMB 5GWXA 1XDSA 1G38A 4RYLA 3PVCA 5EIFA 4XUEA 5HILA 1NW5A 2AOXA 4AZSA 2KW5A 5DTRA 3Q7EA 3O31A 3P9IA 5FTWA 4IV8A 5EKUA 5EMJA 4WXHA 3B3JA
chains in the Genus database with same CATH superfamily
5D01A 2ZWVA 1L6IA 1M2VA 1OBCA 3B1FA 3I1JA 1BQ3A 1PX0A 3GA7A 1LDBA 3THRA 2PVCA 3BKXA 1ZLXA 4PONA 3DEHA 4JGBA 4PLWA 1A9TA 2FVYA 2NPIA 1IY1A 3NEPX 5L4NA 3HNOA 1HTWA 3J7AC 5K3FA 1NMXA 4PLTA 4HDOB 2GQ0A 2INGX 1YFLA 4PYNA 5L3QA 1X7XA 2JCYA 4ETWA 1Y3CE 2PANA 5G1NA 4LQ4A 4E08A 1W0KD 3L18A 3QWFA 4FOTA 5JQGA 1S8AA 3KR9A 4WEQA 2B9VA 4Q47A 2OXFA 5EUMA 2HRQA 1IM2A 3PP8A 3EXHB 4X7MA 4OBBA 4EX6A 3G2PA 2ZAOA 4H6XA 4L57A 4ARSA 4C0WA 4LJ6A 4ZYWA 4BVFA 1RWXA 3RTBA 3DE4X 5GJCA 4Q1AA 3D2BA 1AKNA 5A1TA 1YZNA 1ZBQA 1QAMA 3RHSA 5ALIA 2FPPA 1PJ4A 1D4ZA 2P4HX 4KIUA 2VP2A 5CTAA 2G5CA 3LYLA 3LPCA 4B74A 4GVLA 3REOA 4QFDA 5HBRA 4CV0A 1P1KA 3ILHA 2G0AA 3HU3A 5LQAA 4BKRA 3EIUA 3JQQA 2YJZA 4MINA 4HWSA 5LQRA 3CZ4A 5I3CA 4E0BA 3JD2A 4TSRA 1THTA 3C7AA 4OLJA 1F8FA 4XM2A 3ORYA 1N6IA 1E1QA 5HE8A 3S4YA 4CCYB 1KI6A 4U8HA 3PCTA 3EZ2A 5HKOA 1KO8A 1L8AA 4GKJB 4A10A 4RDCA 1E4OA 4J3JA 2D7DA 2I8CA 3AUUA 1U0FA 1XCMA 3RPEA 3NR2A 4A92A 3G82C 3IAXA 1NRWA 3A31A 1TCVA 621PA 2BC9A 1RRFA 4QT0A 4XFKA 1V7QA 1Z8FA 2VFAA 1UBKS 2R6CA 2VDQB 3DXFA 2WFAA 3C24A 5IBRA 4PAWA 3ZWCA 1WXEA 3OLCX 2EP7A 3TQSA 4KQMA 3AETA 4LEIA 2ODAA 4JS0A 2O7RA 4BNHA 7REQB 1CUBA 5F23A 1RYDA 2AXQA 4CMEC 1MIHA 5HE9A 2G28A 2FSFA 5DGIA 1WXXA 1OI7A 1B14A 3W90A 4C5CA 2P4EA 3JYLA 3O03A 1J0CA 1CUGA 2C4NA 1R0WA 1VGQA 2F9LA 3AFNA 1QAOA 3AM5A 3TSAA 2PSFA 3TPFA 5E8JA 2ZJ3A 3W6ZA 2XWSA 1I3CA 3JVDA 5IZCC 1FX0A 2RFLA 1YZUA 2WMNB 1Z83A 2ZJOA 3D6AA 2F8LA 2HF8A 1M8FA 3SKXA 3DOEA 4F2GA 2Z8XA 1GNSA 2HPZA 3AJAA 2Z1NA 5JAPA 3MAAC 3VOSA 2PX4A 3SMQA 4D2IA 4NH0A 3U37A 3C1UA 5FI1B 1PJ8A 3ZJ5A 2CVHA 3IA2A 1ZM7A 2B8TA 5EHNA 4YO7A 4CM9A 5K0LA 3BGWA 4CLHA 4UC0A 2JGDA 4N0EA 4MICA 3PUKA 1EWKA 1ZUWA 5DV9A 4C0KA 2AV6A 4Q4DA 3TVYA 1HYQA 1KXJA 2CYCA 4JP3A 4LWQA 1T2FA 2OHFA 1UP7A 3OUZA 5GZ3A 4ZYLA 2IEBA 3EDCA 3L6UA 3VR2D 3O2NA 5FTNA 4D0NA 1SURA 1IZ7A 3KRTA 4DQDA 5EGSA 2UUAB 1G5FA 2AE1A 2AF4C 3ZEAA 1MQ9A 4LMBA 5EFOA 5KKCA 3T15A 5LXTA 4MIEA 3A1WA 1D6SA 3AHJA 3RC1A 1RJ9B 3RSGA 2CJFA 4DXDA 1XXLA 1QOQB 5FH9A 2OLEA 3GQBA 2Q5CA 1N5RA 1I2AA 1G7RA 1XTUA 4PZ9A 1E8DA 4HV4A 1XJCA 4XVCA 3NEJA 4FEAA 3JQDA 2BD0A 5LM3A 4IJVA 1J99A 3MOSA 2LKDA 1UEXC 4NHOA 4QEKA 3F9IA 4BN4A 5PNTA 2H9YA 1UWKA 4R1OA 2CXRA 2VF8A 5ALRA 4C0BA 2PX8A 4KMOA 2FG6C 3T7TA 5MFPA 1EHCA 4CLOA 1YOVA 2BF4A 3L82B 1SKAA 2ZBUA 2JI7A 1KP9A 3WLIA 3CUYA 3ELDA 1OXUA 3HBNA 4H7PA 5K0TA 2G80A 2F8TA 2X5NA 1DU4A 3WAGA 4HXFB 4EPVA 3N0VA 4PZYA 5IYZF 5IAAA 2DECA 4LNAA 2CV2A 5KYNA 5JVDB 2B7CA 4BP3A 1GFIA 2A9FA 3DAOA 3H3FA 2WVGA 3ZKAA 3C85A 3R0XA 3UCXA 1M66A 2RJ3A 1G4HA 5FWYB 1SD1A 4KMMA 1QIIA 2ZB7A 4WOCA 3X1XA 2GZAA 2PGIA 3BJIC 3PSAA 2ZAGA 2GGSA 4E07A 2CMKA 3U3JA 1SBHA 2J85A 1J25A 4S0XA 4E6EA 3I9KA 2W42A 2WG2A 3DEYX 4ZVKA 1XQYA 3GP3A 1SR8A 4L0QA 2AFIA 4RJ2A 1AKVA 1FJHA 2YASA 3T54A 1T0PA 1WWKA 2FZLA 1GZUA 2DCUA 1HYEA 2IVZA 2YQ4A 4QOFA 1JHZA 5K0NA 1C3XA 3L92A 5FOSA 1KWKA 3ZCSA 5KYWB 1B00A 1FS4A 1HPLA 2WJVA 2J8ZA 3WIEA 4IDQA 5I9LA 2I4TA 2VS1A 3NOQA 2F59A 1YB2A 2Q3CA 2NTYC 3KFXA 2AQIA 4K6CA 3RU2A 1R5NA 2HK8A 3CWCA 2BLLA 2YIDA 4XKJA 1RIIA 1I51A 2LW7A 1TOAA 1QYWA 2PKEA 4ZT7A 5FO1A 5T4EA 5K3FB 1D2MA 4G24A 4L72A 1SXJC 4MKRA 4CM3A 1Z4MA 3R6GA 1A0OA 5C80A 1Q1AA 1UZUA 2CL0X 2IEIA 5K3OA 5L3QB 5CG1A 3GZTB 4Z4GA 1V6AA 4UQLA 1E1RA 2OBFA 3P9ZA 4AQDA 3KT0A 5LQJA 2CF5A 3O91A 3V42A 2RB5A 4E5UA 5C4IA 2DF8A 4V0KA 3PLRA 4YQEA 1CY4A 1SC6A 2HHCA 3AY7A 3E0QA 5E1OA 3QOYA 3DE2X 2ECFA 1KRWA 3IT0A 5FUYA 3HLYA 1MH1A 1XTRA 1QK5A 2VAXA 2W58A 2HXSA 1DIGA 2WYUA 4H1HA 1G9TA 1YE8A 3DNFA 3FZEA 1P62B 4B3XA 3ZQ4A 2FPPB 1YI1A 4IDHA 1HE2A 4C1NA 3KV1A 1Q6YA 3JVUA 5J4HA 2XHEA 4ZVSA 5AI4A 5ALZA 2P69A 3FBTA 3LSYA 1VLJA 4H3VA 4P4UA 3C3DA 5G0UA 2PFGA 2AFIE 2VPQA 1CB7A 3DYIA 3PZBA 4I2VA 3F96A 4PAMA 1L7EA 4KDCA 4TT3D 1Q57A 3MTJA 4Q39A 2I0FA 2C7RA 1JHMA 1C4XA 1JIUA 4BWFB 4LX8A 1V95A 4U4AA 4S24A 1FNDA 1V0JA 1UFOA 3QKUA 1HURA 3TSCA 1BXGA 1L5RA 1T6YA 1X14A 2QORA 1WZ2A 3WLTA 3ZQ6A 3MOIA 3O3MB 3WS7A 1ODFA 2K7FA 1N92A 2F7SA 4JBLA 5KYKA 2W70A 4DGSA 4ZMSA 4FUTA 3ELUA 2CDNA 3VA7A 3ZX5A 1Y82A 2W6JD 1XU7A 1N3IA 2JFWA 4DY4A 2GPJA 2JLAA 3WGVA 1Z2AA 3EEIA 5SYAA 3ND6A 4G0UA 1V3VA 5I48A 5AJYA 1NG1A 3R41A 3IUJA 3AETB 4DM4A 2UXCB 3NALA 3WNZA 4L7QA 3DO8A 4LV8B 1YU9A 4F3YA 1RM3A 2IY8A 2AI1A 5A03A 3T41A 1RRPA 1NV9A 1WXDA 1RHQA 4OAQA 4G01B 3SICE 2V74B 4R8VA 2ZB2A 1YASA 3IP1A 1ORWA 3EGIA 3NHZA 4IKOA 3T3EA 3SY8A 2Q50A 3HCPA 4F4JA 2ORYA 2PA3A 4J1QA 2AOTA 2PX6A 2GD2A 4Q6WA 3BDVA 5LN1A 2DHCA 2H5LA 4Q3AA 3RVKA 2Q46A 3KOXA 1XD9A 1D4AA 1FX0B 4OAPA 3WL7A 5LZ4A 2BFNA 6YASA 1MP0A 1ZL2A 1VPEA 3H9BA 4FILA 1OGYA 4RPCA 1PQYA 1U8XX 1EFAA 2FUG6 2X0DA 4C0QC 1CS4C 2PA0A 5D00A 1KOLA 4JIGA 4MRSA 4M22A 3D3WA 1SBQA 4FDAA 4ZDWA 1JR4A 1MEOA 2JGDB 5DBEX 1YVEI 4AJ4A 5AM3A 2I87A 3AFOA 2O52A 3OHSX 3TRKA 4IQGA 4Z8YA 2PL3A 1G16A 3CR8A 4FONA 1EFVB 4XYMA 2O19A 4IIUA 1DRWA 1ZGZA 4JYBA 4G1EB 3UJ6A 1LUAA 3M9WA 1UANA 1KJZA 3CNHA 3ICOA 3LM8A 4WLOA 3Q3HA 2PVSA 4MUYA 3BH7A 2ASVA 4KRYA 1UQUA 5EINA 3DWEX 4M0CA 4KO1S 5A7HA 2E55A 4ECAA 5LXTB 1SOUA 2W90A 3GA0A 1EDBA 3QKRA 4Z0HO 4XQCA 6PFKA 2OP0A 4BX8A 5HPYB 4ESHA 4U2FA 4ZRDA 1QOZA 4KJZA 3A2KA 1NYRA 2DR3A 5JJIA 1IBSA 3PEEA 4K9DA 1BG6A 4PS0A 1JQ3A 5I7WA 1V5GA 3PDCA 2RGWA 1K4MA 3RW9A 1LS6A 3M33A 4ETMA 4LTNA 5IXYA 4X95A 1YOVB 3IIJA 1M1UA 1E5XA 2QL7A 5IF3A 3L0OA 3FFBA 1HLGA 2EFHB 2VJPA 4D8UA 5EE9A 3TIFA 3MLAA 2D13A 3A2NA 5B3KA 3SIPA 3AW8A 4LVUA 4ND1A 2OV2A 1KNXA 1QGED 2QTRA 1ZNZA 5JFGA 2PUVA 3PI6A 1X1EA 3D6FA 3UJ8A 3S70A 4A82A 1B43A 2GTHA 2QMYA 2A2ZA 3F1LA 4QECA 4CL2A 3KYIB 1DZ3A 2EJWA 1KKLA 4IHAA 3VDQA 4E3WA 1F7VA 1W76A 4NENA 2X6TA 5SY9A 4FHDA 1IEWA 5C1PA 5JPDA 1I7SB 4PHCA 1E4VA 3BMXA 4JA2A 3IV6A 2B3TA 3D5TA 4L74A 4UCQA 3WB2A 1EVIA 4HCJA 4PV7A 2J67A 1NT2A 3ZNPA 3S1SA 3MOGA 4HVTA 3TVTA 5CNJA 2AFIB 4NDNE 3CX3A 3ZHOA 1JJ7A 1KAEA 5FV7A 2YKGA 3PIIA 3IUSA 1ZN7A 1W5BA 1ZDMA 2QVZX 4FGJA 3GPLA 4XPZA 4XOIA 4JBIA 4B48A 2V7BA 3DDZX 4HJRA 4YMHA 1IRXA 1XCLA 2VJOA 3JXEA 3QUTA 3S99A 1PYDA 2HBZA 1X1BA 3NOOA 1UBHS 2H1OA 3V80A 4C04A 3IC5A 2BFFA 2QT1A 1Y3FE 5EJAA 3JVVA 4US2R 4DCCA 1BS2A 1L7NA 3UAZA 3VJRA 1SRQA 4QUGA 4EPWA 1JEYB 1G64A 2KX7A 4NQZA 4Q9LA 1WB4A 1U2RA 1VBMA 4KGVA 3NBQA 1P2SA 3IE1A 3MLBA 2I3BA 4KP7A 4EJSC 3I42A 1ZGCA 2QTMA 5LMZA 3UXYA 5F98A 1FFAA 1I5RA 4MAAA 1J06A 2IHBA 4E5VA 5EXTA 4MVJP 1W0KA 2JVJA 3BWCA 4L5IA 1ZCFA 2F55A 2VUSA 2F2TA 1VRVA 3C7DB 1NW7A 3PPIA 3X2FA 1FLVA 3D4IA 1F4LA 4G5XA 4IGEA 3ES9A 4M9RA 5JAIA 2HBQA 3U5ZB 4QPDA 2PLNA 3RJMA 3DC2A 3ANXA 4ZYVA 1WDWB 1BXRA 4L50A 1QHYA 1C3LA 4JQOA 1DG3A 2WTUA 4FXPA 1YFZA 3T5AA 4Z3DA 5C9ZA 3EC1A 1WZEA 3LS2A 1P9LA 2D5AA 1VPLA 4D74A 4QBIA 3G1WA 1TD1A 1N0IA 3NNNA 4OEHA 1VC2A 1L5VA 2CD9A 3L6OO 1PCXA 3RHTA 2R7MA 4RUKA 1JHOA 4YUVA 2HCJB 5AMXA 5HF6A 3D7RA 3AGQA 2IZZA 4MSUA 2ZUDA 5GONF 1BXGB 3OQJA 4TN5A 3X1YA 3D8HA 3U4GA 4G0VA 1K6IA 2HFJA 3QVVA 4B3BA 1ISJA 3ZCUA 2FQ1A 1U9YA 3H8SA 4EG6A 3AG5A 2J32A 3O84A 1I3MA 2WKWA 4I46A 1XGKA 3UM9A 3LGXA 1T2NA 2DWQA 3BG5A 4ZRNA 4M1WA 5ENZA 3T5MA 1SXQA 1CUDA 5FWXA 1MR3F 2KYRA 3QLVA 3PL1A 5DNAA 2P67A 3IR6A 2V1UA 5KDLA 3P9KA 1W35A 4P92A 3Q85A 1GPJA 2EL9A 2JLCA 4M98A 4EM6A 1YL6A 1RWNA 4LXHA 4G86A 1J9EA 2BW0A 1ZZGA 4IMRA 1OXKB 3PG5A 3C87A 4E5DA 2R8BA 1UDAA 2ZJ5A 5DGCA 5E9JA 4IFBA 2VZEA 2PKCA 1XDSA 2J45A 3SFVA 4AF8A 5JNLA 4X5OA 4IS3A 4WD3A 1MX1A 3DONA 5A4DA 4M54A 2C9MA 1OX4B 4G23A 2GEFA 4WIAA 4PGAA 3P5SA 3SP1A 4U7WA 4M1TA 3Q6IA 4TKVA 2MU1A 2ZYGA 3RLFA 3SZGA 3LLCA 3VHXA 2JFPA 2A58A 2OBXA 3HUTA 4KUHA 4P4GA 1NW4A 5ITZA 1A7UA 3D3WB 2XIQA 2C20A 3E1GA 2FN9A 3LKVA 3A11A 4ARCA 5E3IA 1E59A 2JLSA 1CRPA 4LBYA 3WP0A 5BUSA 5JARA 1PNQA 1IPEA 3N7AA 1NAHA 2VNAA 3D5QA 1N2XA 1KH2A 2QQ5A 2O2EA 2FW1A 2W2NA 3R0IA 3PQEA 2RH5A 4WASA 5CDUA 3B8EA 4BXOB 1XX6A 2CVFA 1NA5A 2J4FA 2QS9A 2GS9A 2VDLB 2ZRLA 1MNAA 5G4LA 4H1TA 1EP1B 4QPPA 3VR2A 1IULA 4GVPA 1AZWA 3QKRB 3UEOA 4PLGA 5L7TA 3OX4A 5AW5A 3I0NA 3E23A 5ICSA 3ZJYA 1NFQA 3PPWA 1AK2A 1LSUA 2IP2A 4IDEA 4GX5A 5ARBA 2IVFA 4IJ5A 1QB8A 5CFPA 2X15A 3TD9A 4XUCA 3OQ1A 2HWKA 1NF3A 2XWPA 3MS2A 4H27A 4LCBA 5DFAA 4WBNB 5C1DA 3SQMA 1GNRA 2NSDA 1BGVA 1X1TA 2RIRA 4UD2A 3EAFA 1DTSA 1NN3A 2Y1DA 5DCWA 4BKQA 2WP0A 5AO9A 1T3HA 5HGJA 4IRUB 4P33A 4EI7A 1IVNA 5GMOA 2QT0A 3VNUA 4W5NA 3A9TA 1LJLA 3ECSA 1EJ0A 3T34A 2CE7A 3BH6A 5FOUA 1E8MA 3ED5A 4R16A 3PDWA 4M8LA 4ZZ1A 2YCBA 5KJ1A 3S5UA 2XMDA 4UU7A 3C5CA 3G0BA 3I83A 4W7SA 5ICCA 2C3YA 3PXGA 4D96A 1C3EA 3OTWA 1H05A 4G4JA 1L4LA 3SAJA 4NENB 4RELA 5KU1A 3D8SA 1TM3E 3BFVA 1EGHA 2ONCA 3LKBA 3KKKA 4GP9A 4C7JA 5I9NA 1MO5A 1L4GA 5J4YA 3HBAA 3HI6A 3RABA 3B9QA 3IVRA 1J9ZA 5JDCC 3DMPA 2BHSA 4YEDA 2DPLA 3OF3A 1VDZA 4LXQA 1QX4A 5KYXA 5FBWB 1ZVMA 2N0SA 1Q0RA 2VRNA 1KDTA 4Y6GB 2JBWA 2H1VA 2PZEA 3FX2A 5LZ2A 1W34A 3IMGA 4WT7A 4GM1A 4ANFA 2FUNB 5EIXA 2QHXA 5CA0A 3EXIA 1NDQA 2ORIA 3EIOA 3KOZA 5TRTA 4M8IA 4LYFA 1C7RA 3MFQA 5CVEA 1F9EA 3H65A 2AXPA 5TARA 3ZWDA 4B3JA 2O2ZA 2BFFB 2GCGA 5H1YA 3FSEA 1F6DA 1ZK2A 2YWXA 2JGEA 4GMKA 3ZHVA 4X6YA 4CVNA 4COOA 3O7MA 1WXFA 2DM6A 3MC1A 4UOEA 4EGFA 5ESDA 2QGNA 4IH1A 1CUFA 1HR0B 2K6GA 2HOQA 1FW8A 2RAPA 2YZ2A 3WLMA 4E2YA 3VVCA 1NOJA 2DTEA 1GZSA 3OOSA 5BRNA 1HLDA 1R7RA 1BU8A 2VBFA 3DFMA 3KKZA 1BD3A 4LCJA 3W8FA 3U7QA 2F64A 1QG4A 2WWGA 1Z5ZA 5EPEA 4HP8A 3UNXA 5CAEA 3KJQA 2G0TA 4E21A 4PC1A 3ORQA 1CR0A 1U65A 1DIRA 4BCCA 1U3FA 2A1TR 4UHBA 3LUBA 1Y8RB 1TFUA 2C2KA 2CLKB 2H31A 3AIMA 2FWPA 5KVCA 1Y6ZA 5AVRA 2B99A 2HNBA 2B8EA 4D4IA 1SKUA 4UTNA 4W6ZA 2H16A 4IQFA 2HRDA 2Q3LA 1EKXA 1HG1A 3WYDA 3K9LA 1HDEA 2QG4A 3IMCA 3F3MA 1SU7A 3PWSA 3SS7X 1EVJA 4HS4A 4B80A 4NZ9A 1F0NA 2PKQP 1CR6A 2I3AA 3COVA 1RS0A 2J3IA 4KQEA 2XXAA 3D7KA 3ZW7A 2HKIA 4TT3A 3OZFA 3VHRA 1NJ6A 3NM4A 1OZAA 1S2NA 3NJ4A 4BZQA 4WCDA 4ZAXA 4WESB 4ATNA 2QL5A 1L2TA 3G68A 3H6HA 3RQIA 4Z4CA 3UJNA 3EF1A 4UE6A 5CDGA 3GUYA 4YDHB 2YDYA 5AI6A 2Z2JA 5AM1A 3I4CA 3QW4B 4OB7A 2XRFA 4OH7A 3JASA 3MMPA 4I66A 5HFAA 4GLFA 2IPOA 2H9IA 1B26A 2R5WA 3F2VA 1FBNA 4HS9A 4OOEA 5FTLA 2GA9A 3JTMA 3CKLA 4QARA 4PPYA 5KWVA 4XPIA 1KEWA 1DB3A 1EFRD 5T57A 1L1QA 2W6JA 2D1YA 2VTVA 4LQCA 4RD4A 3CINA 3CVUA 2C99A 1U0TA 3DO6A 2ZK7A 1RBMA 5THKA 2YXDA 3E7XA 1N2HA 1Z82A 4X24A 1SEVA 1QE0A 3DDCA 1FRQA 1ZC4A 3FJYA 2FUKA 1PR2A 2BM8A 2DH6A 3PK0A 2B8JA 5E1DA 1NTRA 1WXWA 1XAIA 1E3SA 2I34A 3I8SA 3IKMB 1UK6A 1BVRA 1RPNA 1UFQA 3DZJA 3JPWA 3G9QA 3ZXUB 3T35A 5FIUA 1AUXA 4AWBA 1F2UA 3E9RA 2EF1A 2YTZA 1DV1A 3EVAA 3GD7A 3SEZA 3H19A 2KM1A 3KQOA 1H1DA 1DDIA 1I9GA 1X1DA 3CIOA 4OQ4A 5ALXA 4BQNA 4TKVB 1SBZA 2EWMA 4FFDA 4JMPA 3VHXB 2NSLA 1M8GA 2J5BA 1Z2CA 2W2MA 1U04A 3NORA 4GZLA 1H2YA 3V7UA 5I9TA 1K9SA 3PTLA 1PR1A 1HDXA 2CJXA 2X2PA 5KIAA 4IIBA 3W34A 3JQBC 1L9XA 3PWZA 3X3HA 1U1FA 2H2DA 3AXSA 3QFCA 3NANA 1L4YA 4W1QA 1E1CB 1BCRA 2Z0MA 2DHQA 2RHJA 1FP2A 5AVQA 4XTRA 3PEVA 1FP7A 4IGIA 1N7IA 5DBFA 1Q7CA 3INTA 1WVIA 1XVTA 4PG7A 3RI3A 3RIEA 3WYGA 3ZTTA 3DBRA 1J49A 2A1TS 3IE2A 2HCBA 1VM6A 5GV8A 2PJDA 1SA0B 5F2NA 1ESCA 1RXWA 3RJTA 5F52A 3NAGA 1EUZA 4D3FA 1RLTA 1TJPB 5JHHB 3ZCPA 3D3JA 5C34B 2F3TA 3WZ2A 3HFJA 1NQTA 1EXMA 3ABOB 1FXSA 3AY3A 3KLMX 2YXBA 3L77A 4GI7A 3CE6A 2QTLA 1KMIY 3QLUA 2LP4Y 4A7PA 4CV3A 2AUTA 2YINC 4HN2A 3WAKA 4X64B 1JXOA 2RGAA 4TLMB 4LRUA 4D9IA 5L3SA 3LC2O 1L7RA 3Q3GE 4TVBA 3T6KA 1WL8A 3EFHA 3KQLA 4LDJA 4FYMA 4JL5A 5LKAA 4AIRA 3LUCA 5BN4A 5JS7A 3G5LA 1PL6A 3TQQA 9MHTA 1WD7A 2HSDA 1IY0A 3Q2OA 3D0KA 3I37X 2YVQA 1MX3A 4M0KA 4DIEA 1ZOPA 1MO6A 3HJBA 5D5QA 2C9ZA 1B73A 1LBHA 2XDQA 4FI3F 4PRKA 3N07A 5E9QA 3WJAA 2IEGA 2Z30A 4DA4A 2HX1A 4PSUA 4KV9A 4XZ3A 5K6AC 4O29A 2Y1CA 1XD2A 3UWKA 1TMGE 2DPMA 1KH1A 3FKJA 3FMFA 3KZKA 4WQMA 3KKPA 5ERYA 3GP8A 4KKXB 3IPYA 2FK8A 4CIWA 4UHKA 2H52A 2BP7A 1RYMA 2D3WA 2FZKA 1N3BA 1IHUA 1JXMA 5KSZA 4JYCA 3T5TA 4B9AA 1B6SA 1L7QA 1SHJA 4Z0NA 5CA0B 3QWAA 2G7MC 1F6WA 3EXIB 2HMWA 4KQKA 3OX1A 3OJFA 4YDSA 1R6BX 5KTKA 2K87A 4HXYA 1VLMA 2BJVA 2R8XA 3RSSA 1OT5A 2ZETA 4JSRA 2YBDA 4RPLA 2Y92A 4Q15A 1VRCA 5HQ3A 1IZYA 2A0YA 3ZCTA 3QEBZ 4QYSA 1AG9A 2QOEA 2CHUA 4N5LA 1HL7A 3IA7A 5FORA 3KPWA 1ZUHA 3NBFA 4ZAFA 1TZ2A 1MBZA 2VDUE 3UGKA 1P6UA 3K09C 3C3KA 3A1SA 2L18A 3DMHA 4UARA 2XUJA 5DT2A 4P0QB 3NH6A 1A7KA 1PV2A 1T8YA 4FCVA 4G0YA 1BAPA 1SRRA 1ZI6A 3NYRA 3OH8A 1NLFA 4NEGA 1HO3A 3RSHA 4EAQA 5B6PA 5JSZB 2REQA 5KWEA 3U7QB 3HADA 1BJTA 4O59O 2X9LA 3OKCA 5CAEB 1EK5A 4B4VA 4ZICA 4UATA 1VSQA 3SF8B 1RJWA 1BEUB 5ES4B 1O7JA 3IUMA 4QUEA 1M2JA 1Y6QA 3TAHA 4W1PA 1DEOA 3A04A 3TINA 4IOJA 3L8CA 4RVFA 1J6UA 2YWEA 3D0QA 3HN2A 3EZFA 2QIOA 3BGOS 3ZOZA 5JEDA 4BNKA 4IH9A 3VFDA 4Y0VA 3MCAA 4ARVA 1ZOOA 3IMEA 1KY5A 3MW8A 4HK4A 4P31A 1JYFA 1P9RA 1U0RA 2BEKA 2HNKA 1ZX1A 1Z28A 2C95A 4NCNA 1OX6A 5D3ZA 1YSCA 1CE8B 2OCPA 2OV6A 2ZEJA 4QBGB 3R8FA 4I1YA 4PO9A 3H7AA 3IAUA 1DDGA 3C3AA 5KCMA 2CXUA 3L06A 2H2WA 4GZ5A 3FPEA 4ZANA 3CE9A 4IJKA 5A3RA 5IUJC 3EIQA 1W44A 4P8RA 4CCAA 3A6JA 2BFPA 3U6KA 2XVMA 2CZQA 1SZPA 4X0EA 3KYDB 4L3VA 1F0KA 4EJMA 2ZULA 5DPMA 1TK3A 1W52X 3JASB 3UT6A 4EJ2A 1UP6A 4TLLB 2O2SA 2ZWMA 4YO8A 3QU7A 3DZBA 4JGIA 2D5CA 4RETA 3MS7A 4LVNA 5DSZA 4K5QA 1GJRA 4BV9A 1Y5LA 3P26A 4PXSA 2OV8A 3F73A 1FUKA 4K2HA 4RA9A 2AKAB 5SZIA 3GJ7A 4P5DA 3GZJA 5ILOA 5BW4A 1JEYA 1CJKC 2ETXA 3GPCA 4HAIA 4D81A 5HNKA 4L9WA 3K3PA 4BFVA 4ETIA 1O96A 4CF4A 2ZFUA 3HZRA 3MG9A 4J07A 3QX9A 2IUEA 2X0NA 2X8WA 1U0HC 4B46A 3UKDA 4GBJA 1R4AA 1GGFA 2X8AA 4HQRA 4L22A 2FUCA 4NPAA 3TLCA 4F3CA 3LX4A 1JHQA 2P8SA 2WD9A 4G36A 3AEXA 3DOOA 3HJHA 3KBBA 2UZIR 3O75A 4DLUA 5DI9A 2WD7A 1TMOA 3OX3A 5K3DA 4BKPA 1F2UB 3WBFA 1GG2A 3SDBA 2B94A 3M8KA 1X80B 1SHLA 2DQZA 2IF0A 1OVGA 4WOPA 4ZHQF 1W0CA 1WV1A 5TMEA 4ND4A 4OU4A 5HHTA 4PZAA 3EASA 1Y0BA 4O5OA 1NT4A 3UMGA 1JG6A 1PDVA 1K3UB 2ATIA 4QXAA 1MRNA 1U2QA 4BECA 5IN5A 2GJKA 4AP6A 4DKXA 2VPWA 1I6MA 4LWOA 4XIJA 5A04A 5CGQB 3GLIB 3RFCA 2ZTUA 3M4JA 1WU8A 5EJMA 2QK4A 2AOUA 2IW1A 3IUNA 5L4LA 1GZ7A 1FIUA 1S1CA 1M2GA 2IYZA 3ERCA 5AK5A 3QQPA 4R5HA 4MJ3A 3RNLA 3SDSA 5ESRA 3KWLA 2Q4TA 1U2GC 2FKAA 3PENA 3QKTA 4O02B 3MXOA 2W43A 1P0FA 4U9IS 3RSQA 1HZZA 2MYUA 5CFNA 4QDUA 3V8RA 1ZGJA 3VJKA 3VHQA 4EAAA 1MNQA 2RG7A 2XVZA 2V96A 2ZS9A 2ZVDA 3ANMA 3Q9NA 4IIDA 3LNCA 4LMAA 2IIPA 1MFZA 5H3LA 1XCBA 2C3MA 5IABA 4HLCA 2G1PA 3NXSA 4V0RA 3R8XA 3OZTA 1CRQA 3DFFA 2HGZA 1FVXA 4WNAA 4QOJA 3EYAA 4JLPA 2Y0EA 3UJPA 3F6YA 3GNTA 5JTTA 5KNBH 4KC0A 4MZXA 4MS4A 4EHFA 5L3SB 3L9WA 3U40A 1XTIA 2AQHA 3HJAA 4G9EA 4BE4A 1OUMA 1R1DA 1VZ2A 2GFQA 4W8OA 1RJDA 3D3KA 5B55A 2GKOA 2V7VA 1V26A 3HU1A 4UHJA 5BN4B 4UTVA 1BRTA 3L7MA 1WBDA 1GTZA 4MV4A 4IVQA 4U7FA 1II0A 5H82A 3SJUA 3THSA 1B1AA 3X1MA 3Q0IA 4B3CA 5FUWA 5DW0A 3HVJA 1BMTA 3PNMA 4RIGA 2XDQB 4BX2A 4CTOA 3LOUA 3NATA 3ITEA 3CNBA 2RGNC 4RMNA 4JFAA 2G5TA 4DNOA 3IH5A 4BGEA 1DINA 3G7SA 1EFTA 1HM5A 2JBHA 4ND5A 5B3LA 2E6UX 1OASA 2FSVA 4HWTA 5TF0A 5K99A 1GFWA 4OBXA 3ZLJA 5TQVA 2NZUG 3BFJA 4GM0A 1D4OA 2IZ0A 3CUKA 3LQQA 1OV4A 3I6BA 2VAVA 4HWKA 5TC4A 5HIAA 3QE3A 1H23A 1V8OA 2IKQA 1M75A 1LI7A 4UE3S 4XD7D 3G13A 4RS4A 4LF8B 3L41A 1V25A 4UOQA 1GADO 3HDYA 2OB2A 4MZDA 4V0SA 4MPRA 4H6WA 2NQ8A 3UT5A 3W0LB 1GGEA 5I7RA 4WBSA 1EGMB 3NVMB 4LRWA 1G38A 4BNVA 5HQ3B 3VSDA 5BN5A 2V4MA 4U02A 2PAAA 1LLUA 1MOSA 4IOKA 2JCVA 5C8XA 1LI4A 2PWAA 1R12A 2HWXA 3LY9A 3OIVA 3OQVA 4HMQA 1KOJA 4X71A 1H69A 2X0RA 1UL1X 3R9WA 4K86A 4JI7B 2PTGA 5SZHB 1XZAA 4QQRA 1GR0A 2QF7A 3H0CA 2HYDA 2VT6A 2X2OA 3OMXA 4FFBA 1WS6A 4EMUA 3IEIA 3N0XA 4N5NA 1MG0A 4YMUA 1UADA 2HDOA 3E53A 3H9GA 1XPUA 3FFXA 3NC1C 4QTXA 1C30B 3COZA 1VMEA 1VP3A 4OGFA 4MRAA 3SM3A 3O5AA 3TR5A 4D9JA 1ABFA 2E2WA 1WR8A 2GCOA 3UYLA 4CCWA 1RXIA 2CYBA 3TZCA 5M34A 1FA9A 1GQSA 3WLSA 2QM3A 1B0UA 4AJJA 3CZ5A 2HWUA 2L42A 4GQBA 3HJFA 2V6JA 1KVUA 2EKLA 1H5NA 2QMOA 4KWIA 1UBLS 4HX2A 1G8PA 1PG5A 3T61A 3TNFA 3PHJA 4TQGA 3R0QA 4RU1A 5D86A 3EQ9A 2Y0BA 3NTUA 4L5CA 3ZR4B 2ECKA 1BO6A 4HDSA 2FDCA 3KHUA 2QRMA 2F62A 2AMYA 1Z5WA 4JLKA 3R9IA 4Y9TA 2OV4A 3DWIA 3HBJA 3ZV3A 4L9AA 1KEKA 1R10A 4MW1A 4PC2A 4LBZA 1ECGA 2FEOA 3IV9A 4B8WA 4EKEA 4ZTZB 1B41A 1VG0B 1XIVA 4GS5A 4LYJA 2HI0A 3HPQA 1NFFA 2VQ3A 2BMJA 3QMVA 2G7ZA 4I1UA 1FDUA 4HVLA 2YJGA 4QYMA 1YRAA 3BWXA 3KQUA 1W29A 2A9OA 4D98A 4M0PA 3JCZA 1I2DA 3PJEA 3QVXA 5AKHA 3RS8A 4A8JC 3HB7A 3NNDA 3PQCA 4GMDA 3U19A 4B43A 2Z4TA 1HE3A 4JEUA 1S8FA 1MUUA 3IAS6 4KNVA 3CRW1 4RA9B 3W5UA 3N6RA 1EFRA 3FBGA 4FX2A 3JQ9C 1O96B 3FJOA 2OO5C 4RV4A 2QTTA 1N0VC 4UUQA 4TRMA 1IUKA 5EMKA 1MN6A 1MW9X 4ARUA 1JHXA 3UOAB 1KEEB 1SVIA 3RT7A 1DRVA 3JZDA 4YONB 2G5PA 2GAIA 1HDOA 3JAWA 4R40A 4KPEC 1W4AA 2WD7B 3I9V1 3PUYA 2PT7A 1KPIA 3DTNA 4MGIR 4BV8A 5AW0A 4QYWA 3DWFA 5LZ5A 1DV2A 3FWKA 5CH8A 4B5KA 4DLSA 2Q4DA 1V16A 2J07A 4F2PA 1JQLB 2R86A 1PKEA 3E15A 1ZO8A 3KYJB 4WK6A 1DJOA 2WAYA 3F74A 3ZHCA 1M1XB 4HZUB 5C5IA 1UXIA 1IXKA 1QS0B 3OQ6A 2BI4A 3I39X 1H2ZA 2FSGA 2K7ZA 3NC4A 1R0XA 4RTPA 1N9ZA 5CH5A 1SIOA 3AR2A 1ACLA 2VCHA 5K8LA 4PGHA 3OY2A 3LBIA 1KYTA 2AOUB 2PHZA 5EERA 4HLDA 4OGGA 4R71A 1VE5A 3Q87B 3H97A 3B51X 4FT4A 3KZOA 4JLOA 1QM5A 4FI3C 1UH5A 4X1IA 3H86A 1T0BA 1PT6A 3U3KA 4WX2B 1NUQA 4EARA 3I52A 2FPIA 4Q16A 2QMUA 4R05A 3Q2KA 4TKMA 5JLAA 1R18A 3W06A 2HRRA 2RGUA 4XM0A 3ZHTA 4M6WB 4C2BA 2Z9BA 1NBHA 2B0CA 4OB8A 1AX9A 4NPHA 4R1TA 2WZBA 4B76A 2OORC 2M32A 4CT0A 1YHYA 2LXNA 2XUGA 3BWDD 3T7RA 4B3DA 3AR4A 1WETA 1JAHA 4HUQA 4TS9A 2OAGA 3Q40A 4S2UA 1YF3A 1TT5A 1GKKA 4P5EA 5KKNB 1Z0SA 1CQJB 1MC8A 4X9XA 4WNAB 221PA 3U3OA 4DJTA 1CETA 1KZHA 5U4QA 4MS4B 1B8NA 4N4AA 3HYRA 1NSFA 4X7BA 2PZAA 1OCEA 2BGRA 4N9WA 1VSVA 2GAFA 1VKZA 4K40A 1M0WA 2XD4A 4IFEA 2ZRHA 1SVOA 2G1UA 4O0MA 3G0HA 3E4DA 4J3FA 3E27A 4A6XA 2QZPA 1E5DA 3IALA 3VC2A 2QJTA 2M2IA 2RCYA 2QW1A 1UZNA 3U60B 4U2CA 1YBHA 2C4MA 4C7OA 3D6HA 3WYNA 5MN4A 3C8UA 4BU0A 5ALMA 4OUKX 4LWPA 4TS4A 2IXTA 5E8RA 5F7ZA 1AH2A 2I2BA 3O8BA 1RYYA 1XWWA 4CUJA 2J4CA 3L07A 2QMQA 1AB5A 1MKYA 2BPOA 1EFDN 1A8IA 3P45A 2NVBA 3I6ZA 2W6NA 3ABSB 1CDZA 2HJVA 1LQ2A 3REQA 2V4ZA 2C4TA 1OWOA 1Y1PA 3G7UA 3OFSA 1SUFA 4UQOA 3E3LA 2PQ2A 5JISA 3H3JA 4UZSA 4KFRA 4CL0A 4LJ4A 2AD5A 1B15A 2BELA 4DANA 3UT5B 1JHDA 1LV8A 4PSDA 1DWQA 4RK4A 5E9WA 3PPYA 5ALWA 3TL6A 1P5HA 4Q7KA 4ZDJA 5B12A 1L5HA 4M99A 2PMDA 5IBPA 3JD3A 1EB8A 3SIXA 2BKXA 5BN5B 5LKRA 4UUPA 4NYJQ 1NZDA 1FDRA 2QWXA 4OL0A 2FN3A 4G5FA 5LYJA 3ZU5A 4CG2A 4X8HA 4OYRA 1JKFA 3DZHA 2B92A 1U2PA 1K86A 1EQAA 4LRYA 4QJ3A 3TI9A 1VCHA 4QXPA 4H1UA 3ZHZA 4BMDA 5BVHA 4WY2A 2Z43A 4PLCA 1XBTA 2JI6A 2YMMA 3A2LA 1JHYA 4G41A 3PC6A 4HQFA 3G9ZA 4XQ9A 1W59A 3WK9A 5BXYA 2YNMC 2I7VA 4FFBB 4BWYA 2W37A 1CXZA 1GOTA 3AUFA 2C2YA 4F93B 5MGNA 1K0UA 3OWXA 3MB5A 1WHTA 1MOPA 2H8GA 1B16A 3GB9A 1SOVA 3S0JA 2WHPB 5HK9A 3QZUA 4IF6A 4Q1VA 3WR5A 4N3GA 2GCOB 3RSZA 2GLTA 5BRAA 3QX8A 3IBFA 2OOSA 2PIAA 1UXJA 5ITVA 5JZSA 3DG9A 5C5CA 2ZI6A 3CJTA 4K6KA 4MB6A 4Y0AA 3JD1A 3R7LA 2Z2XA 1I4OA 3PR2B 1CUCA 2QRQA 1NR7A 1G5PA 3DUFA 4WZBA 1E89A 2EZ4A 4FNAA 4YLGA 4B35A 2HN9A 4EKGA 4G4SP 1YQGA 2CFCA 4P3NA 5EMMA 2AKYA 1PIWA 3H4VA 4ME6A 1ESEA 2HK9A 3SC3A 1IIBA 4JQZA 4INAA 2XUDA 2I66A 3KLNA 1L5OA 3E22A 3FCAA 4PCLA 3HCNA 2D00A 2EFEB 5HCUA 3QSYA 3OQOA 2AVDA 1E77A 3ROPA 4AN1A 4PYJA 4BFUA 1T8WA 3IX7A 2VKQA 3L9XA 3NU1A 1LQUA 1XDZA 3OJEA 1ZFNA 3WL6A 1GG8A 2X8JA 2ZRPA 1XZQA 2ZXUA 4JGGA 1UKEA 1YR7A 3O1JC 1FCJA 1Y5MA 4JVOA 1QO9A 5DW3A 1SKYE 1T9DA 2UYQA 2IV2X 5F3RA 4YRMA 4PFQA 1FJXA 1KQOA 3HSSA 2IJGX 2ZLBA 2C8VA 1BEZA 2Y1LA 3ROEA 3K9NA 5EC8A 1LZLA 1UZMA 3N2IA 3T1VA 1EXDA 3ADDA 3EQZA 2E5LB 1JH8A 4S2EA 2O05A 2WB4A 3OX2A 4CV1A 2GBLC 3A4MA 3EYWA 1ZUD1 3N05A 2BBTA 3SJCA 3I6MA 3TEMA 3MJHA 2D1RA 1Z2NX 3S55A 1R16A 3EXAA 3JQ6A 4GSKA 4B8ZA 3NDBB 4C0SA 1EFKA 1QHHA 4GP7A 4PHGA 2PSEA 4QICA 3SZLA 1O5TA 1IG0A 3R2JA 3FGPA 1RJFA 1ZRHA 2JIBA 1DO0A 2A9VA 5CH3A 1QUEA 3JAWB 4IIVA 3TWOA 3U0VA 2CV1A 3ZUGA 4ZYZA 1A69A 3JZMA 1ZOSA 3DV0A 1VHQA 5TQ0A 1U1EA 4WZBE 1JFRA 2GPSA 5B3JC 3GLHE 1V16B 1V9LA 1ECLA 1PVVA 1G3MA 1W49A 2BR3A 3BXXA 4RKQA 5IDYA 4CKZA 1GY8A 1E3MA 1Q15A 1ZRMA 4BNFA 1V2HE 3HHPA 1IOZA 1A9YA 3OWHA 3RHZA 3ZUPA 4RYDA 3I5MA 2AVNA 3U2QA 1IY8A 4F8YA 1PT8A 5LB2A 2VI5A 3BK7A 3IERA 1EB9A 1O57A 1A82A 4REQB 3RS3A 5LFAA 4MJLA 2IPNA 4COKA 3P71T 5HTOA 1S1MA 5EP1A 4EFLA 1G3RA 1IXYA 4P82A 4K87A 1LRJA 1I8TA 4DSOA 4KXXA 4A4DA 1YWGO 2I9PA 2IWRA 4OMFG 1VB5A 2WJPA 1N6NA 2OBLA 4I99A 1NI5A 3ETJA 2FPIB 2VLBA 4I4TF 3I01M 4IIHA 4LISA 3G8DA 1KZ7B 3S29A 2L2QA 1E6UA 3NTVA 3USZA 3SYKA 1PR6A 1O9BA 3OOWA 4O4IA 1CR4A 1RBYA 2OV1A 2VJQA 3PC3A 4J2HA 3IGFA 1P18A 1N9GA 3EXHC 5KSPA 4XDGA 3OUTA 3BVPA 2WOOA 3NCHA 1OFTA 1ZI8A 1W46A 3TBFA 3P9CA 5F1OA 1JW9B 1TT5B 1SUEA 2AZMA 3K2IA 4W4TA 3I6YA 4DR1B 2C58A 3GBPA 3OI7A 4MR9A 4M0EA 1N78A 1OY1A 5EWMB 5DXAA 3C3MA 4YT4A 4ZHSA 4URHA 1C3JA 1OLSA 2V98A 2P9BA 2QM0A 3KQVA 1PFWA 3LE8A 3Q8XB 4I36A 4QQFA 5FHQA 3GLSA 4AO8A 1TDJA 8AT1A 3Q98A 5UKDA 3AUJB 1EH5A 5BOSA 2DC1A 3WTCA 2A5LA 3IAAA 1CBUA 3OZ7A 5I7OA 1P5FA 1N5LA 4IBOA 3QPBA 4C7BA 1VL2A 2OLJA 2JRCA 3AOEC 3RANA 5LU9A 2AEEA 2WE7A 4C7OB 4C22A 4OI0A 3LLMA 1X1AA 4TYMA 2OCAA 1D3AA 4LMPA 2OK7A 4XIYA 3WY9A 4AY4A 3TTVA 2J33A 4QRHA 5ARDA 2MSNA 2CK3D 3KOWA 3GPDG 2NXJA 2Z5GA 1K8RA 1RPAA 3QVWA 1FFHA 2CVQA 5JJLA 3AT1A 1XKQA 4GMFA 2ZCJA 1WDLA 3PFHA 4JJZA 4MMYB 4DR5B 2FA9A 2ID8A 1RMTA 3HEBA 1J2YA 1QZUA 3L8HA 2VF4X 5IH3A 3ZD7A 3QPUA 1U3TA 1OMOA 1Y5NA 1SU6A 3IBCA 4MS1B 1Q2XA 3K0AB 4XD7A 1GTVA 1I6LA 1UAAA 4QHSA 4DR6B 1E3JA 1L5HB 2QG9A 3C1OA 1NOKA 3SSNA 4GX2A 2RGCA 1BCSA 2PPLA 3IOYA 1QLWA 4P5PA 1TI7A 3D4PA 4QFBA 4UTOA 5LYJB 1E5LA 4D6YA 1Q12A 2R11A 5TSDA 5LMUB 4P84A 1FDIA 3TLGA 2Y0PA 3BDIA 4YT2A 5JATA 4Q7JB 1SKQA 1YRLA 4OVKA 1QTNA 4Q1FA 2VO1A 2ID4A 2COKA 1KEZA 1UOOA 1T2DA 3GRAA 3G2LA 3LUHA 3GT3A 4LXTA 1AGYA 1VYHA 3WGYA 4GWGA 5KX5A 5F5XA 2B36A 1D8TA 3BCUA 3QVOA 3BJMA 3P4YA 2ZZKA 1HSZA 4IGFA 1R5JA 1IUPA 2VDVE 1BA2A 1F3OA 3L7AA 5FPSA 5A4FS 3QFRA 2C5EA 1UK8A 2J3KA 4IMIB 1J2TA 4I55B 4U63A 2ZUTA 3RG2A 4QGSA 1Q1BA 3GIWA 4DA9A 3DT9A 1H4TA 2R751 4FGWA 4RH1A 5FI0B 5F73A 5FO0A 3UJ9A 2BTOA 1C4WA 1H0HA 3BC1A 2XNJA 1T4CB 3BBLA 4W1RA 3UPTA 3A32A 3EQ2A 3DUFB 2I99A 1WO8A 2VP0A 4WZBB 5EPUA 4CN9A 5I7SA 4NLLA 4NR0A 4CT4B 1CEQA 3UXMA 4EBBA 4QGHA 3ZJVA 3GX1A 3E22B 5FUVA 1OWNA 2A9QA 4UZFA 1S2OA 2PSDA 3WLAA 1T4GA 3ORFA 4O1HA 1TM1E 4P81A 3BZUA 2MOKA 3DDHA 3DQZA 2GBCA 2W9XA 3VC1A 2H1HA 2ZBQA 2C31A 3R5FA 3WFIA 4M21A 3VMFA 1J20A 1HSOA 1T1JA 1K8XB 3PITA 1CQWA 2NUTB 1LJ8A 1OXSC 2Q0HA 2I54A 1NMQA 2X8JB 2XWQA 4K6MA 4M0UA 2PH3A 1XPJA 3M1AA 4Z54A 5EQTA 2C9OA 3PD0A 4EO9A 3PFIA 5EP3A 4ZYXA 2VHJA 4I8XA 1FDTA 3SZRA 4GP6A 4MI9A 2F4VB 4U0JA 3VPAA 3LBAA 1ZCBA 2O59A 1UODA 2VJYA 3CRVA 4L6CA 4P58A 5TDHA 3STXA 2KHZA 5KSYA 4N7MA 4RZHA 4ZQBA 3WZLA 1FFSA 1QLHA 1D2GA 2X5XA 2ONZA 4OHYA 4L2IB 1YV9A 4BKMA 3I64A 4MUFA 3LCRA 3MCWA 5DK6A 4DV4B 1SWVA 3B2EA 4G56A 3ER8A 3QBDA 4WOJA 2GZ3A 3N0TA 3ZWOA 1BXKA 3OIWA 4MGHA 4TWIA 5PGMA 5TVKA 2COUA 2VDWA 4ZPJA 3VGPA 2QMHA 4BTVA 4G3XA 1XPOA 3FPGA 1E6WA 3DPUA 4XW2A 1TA9A 3UK6A 3H1PA 4TV9A 4WBNF 4DARA 5CW2A 3LT5A 3FCYA 4EQZA 1NGSA 1HE8B 5KTTA 3DTYA 2BGTA 3BREA 4J0HA 4F1KA 2Y6VA 4GXNA 4JT2A 4BFSA 3J81k 5GWXA 1QQAA 5J1SB 3GJ6A 1NVFA 2WU3A 4XUEA 1CULC 5KNCD 3ABQB 1A71A 3CLTC 1KMMA 2KW5A 1Z35A 4M7WA 4MRVA 3VDRA 3E0XA 3ELBA 5I45A 5LU8A 4TV8A 1QONA 4Y1RA 4DCVA 4RJTA 3IIKA 4B2YA 4ZKEA 2H1LA 2FMKA 2XJ4A 3VPDA 4FJ1A 4CQMB 1PZHA 1M6HA 3HA3A 2X0FA 1EP2B 1JIJA 1G5IA 1Z9BA 4NS4A 1S7GA 1DAIA 4O5AA 2R48A 5FOWA 2C7QA 3DD1A 1EI9A 1W87A 2Q3FA 4H9GA 1RKBA 1YB5A 3AUXA 1JAXA 1NQXA 5EZQA 1P17A 1XI2A 1SIBE 3I09A 3RVOA 4O4IB 1O5IA 2WZCA 3F4LA 1N9GB 4DFDA 4U7DA 4TRNA 2DR2A 4R0MA 1IPHA 5DN6D 3PF8A 4HLNA 3CVYA 1WE2A 4EENA 1D2NA 5IDVA 1JTFA 2NNLD 5IKXA 3U48A 1FZQA 1O1YA 5FD8A 2WICA 2BSQA 4AF7A 1BDBA 3FGOA 3H5RA 1H4SA 3BXOA 1X1RA 3EPRA 4MR9B 3PXCX 3IKJA 4ZTUB 1FFEA 4BNMA 1H5UA 1QKJA 3H5AA 3MJFA 2LNDA 1FQOA 3B7PA 1OLSB 2ACVA 1X2BA 2B2NA 3PZRA 2JIOA 2V65A 3AZOA 2M6SA 2W2OA 3CBQA 5CDFA 1BDIA 5F9FA 4J0JA 3WYAA 1EXWA 4BQOA 1I0LA 4JJKA 1NI3A 5HZKA 1P1IA 2IYQA 5ALPA 2GF0A 1V5EA 4KIFA 4CU5A 1XQWA 5KSOA 1GCGA 2QNBA 2VOEA 2AJTA 1L4BA 2Q5JA 2Y9MB 4L6IA 4M1MA 3ZPXA 2HD4A 4DA7A 3WNVA 5HZMA 1KZGB 1S2LA 1VG8A 4JI4B 1A8HA 2XUHA 3N3AC 4J49A 1EA5A 2QZJA 3LMKA 1AHIA 2Q2NA 4M1QA 2IHTA 3DTTA 1MLDA 4JQCA 4OXIA 3ZKWA 3IS3A 5K8CA 1RWBA 2VUUA 4LW8A 1T1RA 1ULTA 3I72A 4B82A 5COBA 3JVIA 3KJZA 2G76A 2LIPA 2W6CX 1I80A 1XQVA 2FX3A 3SSAA 3LVRE 2IS6A 2HO4A 1CZKA 2B20A 2H92A 1PGOA 4S0ZA 3I3OA 4JLSA 3DMTC 5CXQA 3WGGA 3GELA 4MIKA 1VIAA 1Z0UA 2JDID 4PC7A 3QVTA 4ZT5A 2VH5R 1M2FA 2VRBA 3L6CA 3L8FA 3NBYC 4NECA 1DQSA 2GUGA 3I2JA 1BCSB 1WIWA 2IXFA 3IPAA 5GP1A 4Q00A 5EHGA 4BGDA 3AXTA 3ZVMA 3AM3A 2AG1A 3OIDA 4GYWA 4K8OA 4CYMA 2Y6UA 5EE3A 1ZU4A 3A0UA 1FP6A 3O8RA 1E3QA 1CF2O 3Q15C 1MZVA 4PHFA 3TLGB 3KOMA 3SZ3A 4PYOA 3WK8A 3ZWYA 3LPAA 1VHTA 5DM2A 5JXHA 3HLTA 2P5SA 4PSAA 1AC5A 1YVUA 3II6X 1T36A 4TLDA 1WXGA 1MAWA 4DCGA 3KT3A 1V41E 1SO8A 2IE8A 2WPDD 4WLFA 5CDFE 1Q95A 4M0FA 5KX5B 3LP8A 3GRUA 3WWCA 2IHVA 2WM8A 3QEAZ 4LFCB 1M34A 1ENOA 1FSGA 2PRKA 2QX4A 3H1BA 2Z6QA 4MR7A 1Y4DE 4HGYA 4KG7A 3Q1LA 2H5EA 5T64A 1E96A 1O6ZA 1XTSA 3W5BA 3IHKA 2EBHX 3GFFA 4BAGA 4AJ9A 2CFTA 1Q0UA 1V8PA 4I5IA 1V4BA 2P2YA 1TQ2A 3ME5A 3H8VA 3REGA 4RKEA 1Q5PA 1ZHFA 4PM4A 2ZIUB 1JSZA 5DWVA 5JD3A 4AMGA 4K46A 4ZCTA 1H6CA 2FF5A 4GKVA 1R0RE 3N70A 1LDMA 1TM7E 3NS7A 3X0DA 2EF0A 3E3OA 3GT0A 5JH7A 3ZDDA 4RFLA 3DOHA 4DMFA 3N59A 4K3VA 1ZM3A 5LP6A 1ITZA 1JNXX 1WAMA 1T43A 1XLTC 2PV7A 4YRRA 4OV6B 4A2CA 4EVIA 4LJLA 4WXPA 2G25A 5IJ9A 4OUDA 3NGXA 5E7QA 1BHQ1 3IHLA 3UAGA 2OLKA 1RC1A 2ZQZA 3KUUA 4JKIA 3VO2A 4PZ0A 1HT0A 2QD5A 4KXNA 3NKFA 1UBTS 3QY0A 1FTSA 1T5HX 4MARA 4Z49A 4MJXA 3SQLA 1C7QA 3B12A 3DMNA 1O54A 3MT7A 4FHFA 3CSUA 5B4TA 2YRWA 3H9UA 2IYRA 4E6PA 3W6OA 2MR6A 1EZ1A 3P0IA 1T5BA 1HH4A 1H3FA 1RWVA 2EDCA 1XZMA 5CXSA 5HA5A 1I1QB 1M34E 2IOFK 2JPDA 1PW5A 1SXJD 3ZIDA 1GYQA 4RPIA 3FETA 4Q7QA 1U2ZA 1OWLA 1XA0A 2N1BA 3KYBA 3ZQUA 1V6CA 1EWTA 1O95C 2IYTA 2PBFA 2PYIA 3G9UA 1YE5A 1RP1A 1PLJA 2KI5A 5TGTA 1YCGA 3L2OB 4BC1A 3IOEA 5EAIA 4BLPA 2VDWB 1U9IC 2CV0A 3BT7A 3O74A 3UC9A 1N36B 1P8JA 2BBWA 4HRXA 4IOMA 4W9RA 8ADHA 4MPJA 2VHXA 3IHTA 4GH5A 5HMMA 1YTUA 4C7VA 1CQXA 3C2QA 3FNHA 3OIYA 4MWOA 1Y9JA 2NU6A 4PAQA 5CM8B 5TB5A 4DDVA 4Y2JA 5CFLA 2G6BA 1M10A 3CR3C 1ULUA 3TTWA 5KC9A 3DHEA 1E6LA 3IOMA 4WZAA 1BX0A 2E37A 2JAQA 4H7EA 4ESEA 1D0IA 1L3CA 3CNQS 4M83A 3S2ZA 4JASB 4S1TA 4V0QA 4AYWA 2EARA 4FZRA 4Z1MD 4AI6A 3BUSA 4JOSA 1E18A 2I80A 4KLCA 5HIMA 4TV8B 4A6DA 4Y1RB 3IB6A 4DCPA 4ZJYA 2RGBA 2ACKA 1TCAA 1ENPA 5DCLA 2GH1A 1HWYA 4NK5A 1G0OA 5KYVA 2BJHA 3QBEA 2ZBDA 3M6AA 1N5MA 4OJQA 4ZJPA 2AQKA 4K9KA 3EGVA 1NPDA 3TTYA 3Q7RA 2FE1A 3ZV7A 3NHUA 3DQQA 3U17A 4JLUA 1JE0A 1C8KA 3OT1A 2DBRA 2PKXA 3KD3A 1WTCA 3ZY6A 5B58C 2VPYA 2PE5A 3QU9A 4Z4QA 1O3YA 2HLNA 3LGSA 1JSXA 4WFKA 4XIIA 1YDEA 2B4KA 3LPLA 2QT9A 4PE5B 3RSLA 2ZRIA 3D6VA 1O6BA 1WHSA 1XV5A 4XQGA 2Q7DA 3MERA 4KXLA 1NDUA 2YHUA 2V0NA 2Z58A 3ZGNA 4YCNA 1E3DA 3PWTA 3UT0A 4RLFA 2WJHA 3V8MA 1KVSA 4LDAA 3QXGA 2ZYIA 1WUTA 5K0FA 1VMDA 1K88A 2XMZA 3E8XA 4KFTA 2X76A 3TEFA 2PAFA 3L7JA 3DXZA 1SCNE 2DFNA 2HMTA 4U6SA 3UW1A 4LQLA 3I0MA 3V7FA 3WIVA 5KYUB 5LIPA 2QUZA 3N74A 3SGLA 3S8MA 1QH8A 3T94A 4WZAE 4P4SA 1MZPA 2FZGA 1QBGA 1TCCA 2ZRJA 3DKVA 1W2WB 5CVJA 2IWHA 4AZTA 1ECJA 3B1YA 4IWYA 4YWJA 2HTEA 5C8YB 5K6TA 4N47A 4MDHA 4D3ZA 3NRCA 4BWGA 4GMHA 2O5EA 1XKLA 1AKUA 4WXMA 5CTJA 4R3UC 1XZFA 3B1XA 4TTQA 4GEGA 5FBQB 2Z2KA 5EWLA 2ZUSA 3P2IA 2QN8A 5DLYA 3BTOA 5CDTA 1EUYA 2CK3A 2V3CC 4FGKA 1BMFD 4C7MA 2B1GA 2WYVA 2QM8A 3KELA 4EB8A 4F21A 3ZGYA 1YZYA 2ERYA 1ZW1A 1EX7A 1GGNA 3O92A 1SVLA 4UCXA 1MX9A 1ZPDA 2E82A 1S2GA 2BCEA 3OE7A 4PEVA 4ZREA 1FMFA 3U7HB 4TROA 3BMOA 2NU8A 1SB9A 3DT6A 4W8HA 3CPHA 3GCXA 3JQRA 2IV3A 1A9SA 3FI0A 3VR6H 3WMXA 4N49A 4A5OA 3KLPX 2HH9A 5JSKA 2OYRA 3AHFA 4L0MA 3QPWA 2MMGA 1C0LA 1T8PA 4FNMA 1NKSA 2B69A 3KSUA 2W22A 1ISFA 4I9GA 1WQ1R 3KALA 3OHPA 5K4AA 1TUGA 4N0DA 5I5GA 2BR5A 1DKQA 1KTVA 1ADFA 2PCJA 2ZRAA 3P2OA 1FU8A 1N0WA 4MR7B 2ZYVX 2CLIB 1MC5A 3H5LA 5JBNA 1QQTA 4OXQA 4PU0A 2IEZA 3STHA 5JUWA 4O4JA 4C6TA 1XRNA 3S2GA 4QIHA 2C78A 1GPKA 1VG9B 2ZATA 4B7XA 4PYLA 5G02A 3TL2A 1JBQA 1I0ZA 2C97A 1GAJA 4QXQA 1W36B 1ZU5A 4DQ0A 4KDRA 1Y7IA 2ERXA 3TEJA 3VR0A 2I1VB 3AKZA 4V0MA 4G9BA 3WKBA 5F3WB 5HF8A 1CJVC 5JH7B 1RDFA 1GRNA 1KZ6A 4PYIA 2ABWA 3RWOA 3AUKA 4E13A 1TMKA 2FOIA 1Z4NA 3JRWA 3KDPA 4NBUA 4NG5A 2SCUA 5IJ9B 4MV8A 4Q9DA 4XWOA 9LDBA 4MDYA 3EXFA 4OUDB 3W9UA 5JALA 5KVAA 2YFKA 3MILA 3LV8A 2LV8A 3W5CA 5I8ZA 2XAUA 3GLGE 4F60A 5LJIA 1W9MA 1NX6A 2JL1A 1QQ7A 3BE5A 5A4JA 3ETHA 3LW8A 3ZNOA 3U6BA 4JX8A 3A26A 3BGIA 1KKMA 4S1NA 3AVVA 3DEZA 1SG0A 1IBLB 2Q27A 1EGQA 4FS3A 3LVBA 3KBOA 4FFMA 2V58A 5AVTA 1JG7A 1O97C 4M0LA 1VIYA 5M7EA 3EN0A 5WRFA 3G8BA 4TWRA 4I6JA 4G8BA 3OZVA 2PRYA 1XZCA 2BSAA 3E9QA 4IICA 4XX0A 3ZY3A 1XCOA 3SYRA 1TK9A 2NZYA 1QTIA 4JIMA 2EYUA 1Z6PA 1XVUA 3MWJA 2MSCB 2WJAA 1GRRA 4TUYA 1JJAA 1PGNA 3DLBA 4BJHB 1BNCA 4MMXB 4OJMX 3PEWA 3DF9A 3I9NA 5DLPA 2OCXA 3TPCA 2Z57A 4RZ3A 4JKYA 3LHKA 1YOBA 2F1HA 2YVKA 1BMDA 3PVSA 3TBHA 3OQMA 1KGSA 1RFLA 4N6OA 2ON6A 4N5HX 3CISA 3KAJA 4HN9A 4OMDA 4AJEA 2UUBB 4X44A 4L4ZA 2GX6A 1V8FA 2NU6B 2C2BA 1G9XA 1BKYA 2G04A 4V0ME 3VAYA 4C3UA 5C4GB 4C0XA 3VTZA 2HA7A 3QXCA 1BRMA 1SU4A 1Y1LA 1WJGA 1Q44A 4X84A 4CI0B 4DLVA 2IH5A 1I33A 5L45A 3VKHA 2PSJA 1ZJ6A 4S1PA 1X6VA 3L6BA 4US1R 4Y18A 4XDHA 2AC2A 5FWDA 4I2NA 4OYLA 1P4AA 2FPMA 1RAEA 1ZMOA 5AOAA 2HEIA 1I0IA 5KNCA 2FZCA 1UBNA 2VUHB 3O7WA 5C7IO 3M34A 3C6MA 4KH0A 5DBIA 2ZIVB 3OF5A 3QMMA 3QENA 5EJIA 4YJ3A 3S68A 3NHJA 1JQEA 2C0QA 3GDOA 2AC4A 1UJ6A 1V1MA 4FOSA 1A9QA 1ZAKA 1PGQA 1I14A 4PAOA 4Z86A 3RHFA 4AMUA 4CM4A 4AJ1A 1QBKC 2C42A 1A8QA 3C3WA 1GRCA 3R0VA 3V4SA 4DR2B 2Z9CA 2NV2B 3A1FA 1YK1A 4B3HA 2OYCA 5BNWA 1GLVA 2G71A 1J70A 3HU2A 1SAYA 3KT8A 5IFLA 1W88B 4XWYA 2REBA 2BKVA 2GLXA 3A6ZA 3L0SA 2IYAA 2XITA 4U9UA 4AUMA 1RXSA 2YJ5A 1R8QA 3FWHA 3G59A 1L4HA 1JA1A 1S5PA 2IZ6A 2QLNA 3G8AA 3K4QA 2OZLB 1C9KA 3DMRA 1GDDA 3DAHA 4IG9A 4R1PA 5DN6A 1WSBA 1XA3A 4BN5A 4D3SA 1ZK0A 2W8BB 4CMIB 1N6LA 3OSUA 1JAIA 1TO2E 4YLEA 3RJ5A 2FPWA 3WHLA 4CMEA 2Q3JA 1DC7A 3KUDA 4B0OA 3S5JA 1JLLA 5DIZA 2WWHA 3I0ZA 2BFDB 5EKSA 4DJFC 3CVXA 1T9HA 5M3BA 5IT4A 2KB0A 3AV3A 3DBLA 5H5JA 1QH8B 4DE5A 1C3VA 3DXXA 1E9BA 4OM7A 3GGGA 4P4SB 5K20A 4AULA 2ODNA 1PTJC 2F3UA 2WJ4A 3PDIA 3QA3E 4OXKA 3JRNA 4JV5B 2DULA 4GYJA 4YLYA 4F4DA 2AK3A 4ZOLA 1G7SA 3JR3A 5IZCA 1BFDA 2JGNA 4JROA 2QLJA 3N2NA 1RTKA 1DUSA 1T4DA 1X7YA 1C8LA 3KAQA 3TIIA 3ZXIA 4BWVA 3PQ4A 4DDHA 3NC0C 4JJ8A 1AKTA 4KE8A 4MUJA 1IG3A 1QPBA 4IQ0A 2VBCA 2B5WA 4UNSA 5KKAA 1J0DA 3PHLA 5EWLB 5JZVA 2JNWA 5IK2D 4I8IA 2O8BA 1EP9A 4DSAA 4DMKA 2Q45A 5G1OA 2PBRA 2ZPAA 5FKJA 4IJ6A 4BTLA 2AFHA 4MI6A 1X7GA 1JDUA 4RPKA 4F4UA 1FMLA 3BIXA 2XUZA 4KXQA 3A3PA 3W4KA 4BNUA 3IT1A 4FN4A 3VTKA 1E4YA 1VL6A 1H42A 2QROA 4PN3A 4FDMA 1SNYA 1QR6A 2NO1A 1U0OC 1DAMA 2WU1A 3WQSB 1T4MA 3BMOB 2HJSA 5JLJA 4FW8A 4LFAB 1EX9A 5CT6A 1WOMA 2JDIA 2P4QA 4IINA 4AO7A 5T4HA 3RTDA 5H9WA 2EKQA 3LFHA 4H4EA 4E5MA 4KVFA 3B6KA 5HR5A 4AN0A 2PX2A 1MV5A 1E1NA 1R9NA 2UZ1A 4HADA 4OJKA 5LA6A 2VDNB 2XMCA 3QRWA 4D43A 2P6UA 5BNZA 5BR8B 2CEAA 4HFMA 3E4CA 5DGTA 4RHTA 3MD0A 2AOXA 4O8ZA 1RCUA 4KBYA 3AL2A 2VYQA 3QU2A 3SZUA 4ENWA 1XHFA 3FVWA 1UFRA 2WPDA 3AI7A 4PG4A 4Q4LA 5CLHA 3BIWA 3SR0A 3UKOA 1RM0A 5AKYA 3WQHA 5K0SA 3JWGA 1JFFA 2OHJA 4O4JB 4C6TB 2XBUA 2XCTB 1P0QA 2OSVA 4G63A 1W4RA 3D6TB 4HQ6A 4AM8A 3QNMA 1AQ6A 4Q34A 3VPBA 3A6PC 3KR0A 1B3BA 1RE1A 2PZMA 3WJ1A 3EUWA 1TMYA 3KB1A 3QUQA 1C2YA 1G21A 4L0DA 4O33A 1WULS 5JSFA 1DQPA 1Q2UA 2ZVPX 4AX8A 4PYKA 4YAKA 3VYWA 5JD4A 5J2UF 1JYSA 1QU3A 2NV6A 4M2LA 4PX3A 1HEUA 1RPJA 1MGPA 3TZ6A 1ZICA 3CRZA 4KYVA 5AK3A 2AFHE 2VT7A 1N75A 2OE2A 1Z6XA 1GG5A 2SCUB 4R6XA 3TM4A 1SC9A 6NULA 2PUEA 5F51A 3SLKA 5REQA 2NTNA 3EXFB 3GNQA 1DE0A 1CR1A 4TL8A 1RQ7A 5IKPA 1U6KA 3HZHA 1TIBA 2WLSA 5H80A 4NXMB 2J87A 3A1NA 3JX9A 4MQ5A 3WGQA 5EIHA 1U8AA 5LZ8A 2QR3A 5DASA 4S05A 4W5RA 1L8LA 3EXEA 4BLSA 4MI3A 1KJWA 3FSJX 5KNDH 1HE4A 1P80A 3LX5A 4ZPXA 4YV7A 4B8YA 1PR9A 2ZDQA 2WKSA 3RU7A 2IH4A 3AR8A 1AZTA 3MJDA 3E2IA 3R6TA 3GFTA 4RGVA 5BUQA 4IX1A 1L1EA 3SXUB 4YDRA 4XX0B 1OFUX 2QRHA 1LPBB 3NM5A 4BJ5A 3FTPA 1C9YA 2HSJA 3BFPA 3K30A 1UBGA 4FMDF 5J63A 3E6AA 4TS3A 3B82A 3RREA 3H9QA 1P74A 4RNCA 4EKYA 1SVKA 4EFNA 2ZSAA 1SXJA 2CXPA 1N7HA 3A1TA 2XAAA 3RBZA 4PYRA 4D8XA 3TUJC 1GA4A 2ZW9A 1TM2A 3EMDA 4GLBA 4KRGA 4ZVQA 4F91B 3RFTA 1LDNA 3FZQA 3K0CC 2GWRA 3SDZA 5IXSA 1EFPB 4GBED 3GG9A 1C7JA 3IPLA 1NU6A 2Y1EA 4L8FA 4MUNA 3VR4H 1NJ8A 4YCSA 4YX9A 3SHOA 4CKYA 3H4IA 1PWEA 5C3UA 5TS3A 1P7CA 1H85A 4KLZA 1QRDA 4D9HA 2NUBA 3BMQA 4U2GA 1ENZA 2G9RA 1L4EA 3BERA 5LP1A 3RBVA 3MIIA 5JROA 3CF0A 5KWSA 1C7IA 2OA0A 1H2FA 1L6RA 2GKGA 3C4QA 4ERXA 3MA0A 4EHHA 3DPSA 5KU7A 1ID8A 2EV9A 4Z1MA 5JV5A 4TZ6A 5K3SA 4YJ3B 5AVUA 3EZNA 4HQ0A 2PUWA 2VZ0A 3JW8A 2RC5A 2ZOSA 1U7TA 2AXEA 3AUYA 3KB8A 3ND7A 3ITKA 3TW8B 3RROA 1V1MB 2IP1A 1ZITA 1N8NA 3DDUA 5JCPA 1M7HA 4H35A 1XEWX 3TFQA 4M1KA 5E7IA 1F3LA 2BM0A 3WVNA 1SVWA 3DB1A 1TM5E 1JKJA 4KN9S 5BSMA 4QGBA 2HMVA 3ZWBA 2DFTA 4G0WA 4CEJA 3SJBA 1Q14A 2ZTVA 5IDXA 3PVZA 1W75A 2GI4A 4ZC8A 1SXJE 5HRAA 3S2EA 1MJNA 3VPCA 2O14A 2NACA 2ZITA 1E3WA 5T6BA 3ZNNA 3JSXA 1XMVA 3E9NA 4X1KA 1JQKA 3P2JA 1TEVA 3AJEA 1P6XA 3QVJA 1IPFA 4ER7A 2EZ9A 3FDZA 1UDWA 4OXXA 4CMJA 1QNLA 4ND2A 1JLLB 1UPBA 4QKQA 4DV0B 4NARA 4Q4CA 1W4LA 2D7JA 3GEHA 3FIJA 5GOTA 1C9EA 2QTGA 2HIAA 1F1BA 1FMJA 3NVKI 2ZE5A 4IHJF 1PDWA 4NU5A 5JCZA 3U7GA 4JUBA 3TMAA 3P0HA 3WDLA 1KZYC 5A6SB