1XCLA

Guanidinoacetate methyltransferase containing s-adenosylhomocysteine and guanidine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
b'PLFAPGEDCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanidinoacetate N-methyltransferase
publication title Catalytic mechanism of guanidinoacetate methyltransferase: crystal structures of guanidinoacetate methyltransferase ternary complexes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 73
structure length 229
sequence length 229
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2004-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xclA00
2ZBRA 1RI5A 1TW3A 1DUSA 3NDJA 4OBWA 2NP7A 4HGYA 2O57A 3TKAA 2P40A 5FCDA 2JG3A 2H11A 3KR0A 4PONA 2P8JA 3TQSA 5DX1A 5EEHA 4M38A 1ZGAA 4FSDA 2KW5A 3A27A 3IYLW 5P8WA 4F86A 4ZTBA 1NW7A 7MHTA 1KYWA 3FRHA 2NXCA 3EMDA 3P2IA 2ZCJA 5DM2A 3C6MA 2ZBQA 1QAMA 1KP9A 2YXLA 5E2BA 1NW8A 2AOUA 4LECA 3DXYA 5HEKA 2AR0A 3FTDA 3REOA 3FYCA 2AS0A 2ZIEA 1XDZA 3HP7A 4GOOD 5F2OA 5FTWA 4RTNA 2JHAA 1RJGA 2LD4A 2GH1A 3BUSA 1YFLA 4LG1A 2XBMA 4M36A 4PCLA 1R6AA 1KPHA 1G8AA 1WXXA 2GS9A 3MTEA 3KPVA 3VC2A 3ELDA 2ERCA 3CKKA 4E2ZA 2ZZMA 2P3LA 4CTJA 3PT9A 4QTTB 2GB4A 2OXTA 4P7FA 1H1DA 2PT9A 3FZGA 3P9NA 4RTPA 1QYRA 3V8VA 3ID6C 5EIWA 5HOQA 2R6ZA 2BM9A 3LKZA 2QRVA 2PKWA 3LBFA 3PB3A 1YF3A 2O0LA 4IV8A 5EGSA 5F2NA 3R9XB 3EVAA 2AOWA 3LDFA 4RWZA 2UYHA 4DA4A 3FPEA 3KQMA 3UJCA 1AF7A 1I4WA 3KR9A 3K0BA 3TM5A 2BR5A 5EZQA 5JR3A 4CTKA 3G2QA 5FHQA 3DP7A 3KQSA 3EGIA 3BKWA 3LCCA 3TPZA 4EK9A 3SSNA 2AN3A 3B3JA 5CVUA 5HFJA 2AOUB 5IH3A 4YMGA 4GF5A 2PT6A 2IP2A 5FULA 4PCAA 3FUWA 5U4XA 1VBFA 1JG4A 2YUIA 3B5IA 4U7TB 3U81A 3BXOA 3I9FA 5DX0A 4C06A 3GWZA 1M0EA 1EIZA 3G2OA 3I5UA 5DM0A 5KS2A 5FWDA 5BP7A 4RTOA 4X1OA 3CCFA 1YFJA 1O54A 2BH2A 3CBGA 1QANA 3QOXA 5LR6A 4POOA 1P1CA 5EIFA 2CWWA 4QPNA 5MHTA 5GOZA 2HTEA 3E8SA 1I1NA 3MQ2A 1JQDA 1EQAA 2AOXA 3EPPA 4R8RA 2AOTA 2AZTA 2ZTHA 3CJTA 1XXLA 2QRVB 1HMYA 1P91A 2CKDA 4KIFA 1Z3CA 2WA2A 1RI4A 3KQVA 5CVEA 4L7VA 3AXSA 3CGGA 3GIWA 5K0GA 2HR1A 1P39A 1UWVA 5C1IA 5DWQA 4XUEA 4Y2HA 3TRKA 3EGEA 5DXJA 2JH9A 4DF3A 1R74A 1L3IA 3EVGA 3EVBA 2EG5A 2A14A 3UJ9A 3UBTA 3EVEA 1WXWA 1AQJA 3KQPA 3E23A 2ZFUA 3RODA 5JUWA 3NJRA 3R6TA 1XCJA 3HCAA 4HC4A 4QPPA 4P7KA 4X63A 3BZBA 1RI3A 3M70A 3GDHA 4HH4A 5GWXA 5K0JA 3HCBA 3G7UA 5LQJA 1TW2A 2PXCA 2ZLBA 5E9JA 3NW9A 3OU7A 4CKCA 3OZRA 1L1EA 3LSTA 4PIPA 4EQZA 4CXMA 4PINA 2AOVA 5HILA 1SUIA 3DMGA 3ER9A 4C07A 4RX1A 4CKBA 2H00A 2YVLA 3HA3A 5BXYA 2PWYA 3E05A 5HIIA 2Z6AA 2GPYA 3HA7A 3QV2A 4HRAA 5EC8A 2PWPA 2I7CA 5FA8A 2AOTB 3C6KA 2EJUA 3EVCA 5DSXA 2Q41A 3NDIA 3QOWA 5EKUA 2C7RA 4BLVA 4AX8A 5HIKA 2YR0A 3I64A 4RTKA 2XYVA 3KPUA 5EOVA 4AZTA 4DCMA 5KQRA 3TR6A 5FHRA 4RTRA 3BGVA 5DM1A 5K05A 1FP2A 4X61A 1R8YA 1JG3A 3FRIA 5K01A 1INLA 3SMQA 3FTEA 1O9HA 3HEMA 2ESRA 3LGAA 2JH8A 2GA9A 2JJQA 1NV8A 1IM8A 1O9GA 3D2LA 1G6Q1 3GGDA 3GRZA 4RVGA 1L3CA 5EHGA 2G1PA 2V74B 2WK1A 4FT4A 5HIJA 5CUQA 4M7RA 4JXJA 4FR0A 2P3QA 1D2GA 3R3HA 4MWZA 5GM2A 3UFBA 4E30A 1VQ1A 3VC1A 2DPMA 4XUDA 4G56A 3HCDA 2HV9A 4MHTA 3OE4A 4AZWA 1MHTA 4E2YA 4E32A 3EGVA 2G72A 3T7RA 3FUTA 4OQEA 2HNKA 5EMJA 4EVIA 3THRA 3TLJA 4H0NA 2GAFA 1XJ5A 3AXTA 3H2BA 5CD1A 4FT2A 4DKJA 1ORIA 2IIPA 2PV0A 2ZWVA 4AZVA 8MHTA 2QE6A 3O31A 4QVGA 3EEOA 3ELYA 2VS1A 3HVHA 5EEGA 3TFWA 3NWEA 1YB2A 3Q7EA 4MIKA 5HZMA 3G8BA 4C04A 4LWOA 3CC8A 1YZHA 1KR5A 1SUSA 1B42A 1NBHA 3BWCA 4ISCA 2QY6A 5DLYA 5GP1A 2O06A 1WG8A 3MCZA 4P58A 2HMYB 2NNWB 3OZSA 3B89A 4E31A 1YUBA 2FCAA 3PS9A 2NYUA 3FYDA 5F2KA 2XYQA 3HTXA 1Q0SA 3BWMA 3PFHA 4DCGA 1FPQA 3SGLA 4PYLA 1DL5A 3M33A 4FZVA 3LKDA 1WY7A 2OB1A 5E9WA 3P9IA 4PYNA 3OZTA 1Y8CA 2GLUA 2HWKA 3AJDA 3ELUA 2EX4A 2YXDA 3O4FA 1UIRA 1XDSA 4QVKA 1VPTA 1M6YA 3LDGA 3TMAA 4B17A 3PLAE 1XVAA 2OO3A 4AZSA 1JG2A 3UJ6A 1X1CA 1IXKA 3SSMA 1ZHFA 3HVJA 3F4KA 1ZKDA 4C03A 3LL7A 2OB2A 3EEYA 3ER8A 1F38A 1NV9A 1JQ3A 1KXZA 1F3LA 4HG2A 3LHDA 5ERGB 3HCFA 2UYCA 2VDWA 5HIMA 4RTLA 1EJ6A 2B78A 2FK7A 2PXXA 1PJZA 2E5WA 3MTIA 5M5BA 4C4AA 4ATNA 3PFGA 4A6DA 4YV1A 2ZWAA 5ICEA 5LQCA 5DTQA 3FPHA 4PYKA 3M6VA 5BW4A 2IH5A 2Y1WA 4C05A 5K0FA 3OPNA 2OYRA 1N7IA 1V39A 3FUXA 2Y1XA 3FUVA 3G8AA 3M6WA 4V0QA 1Q0TA 3GU3A 4PIMA 3NTVA 4Z2YA 2CMHA 3DXZA 4DMGA 1EG2A 3KQWA 2VDUE 3FPGA 3KQQA 3MERA 3GRRA 2IBTA 2BM8A 4M37A 5LQKA 1KIAA 2PXAA 2BZGA 3JWHA 1VL5A 1NW3A 1HNNA 2FK8A 1R8XA 1UFKA 3E7PA 2XYRA 1SQFA 4YV2A 5K0BA 3LECA 5G02A 4BLUA 3CJRA 1D2HA 4QDKA 4F85A 2V7EA 2YQZA 3G5TA 3C3PA 3P2EA 4ER6A 3Q87B 3DXXA 3SR4A 1AV6A 2H1RA 3G2PA 2WA1A 1I9GA 4ER3A 5BW5A 3OCJA 4PGGA 1G60A 3EMBA 4FP9A 5E1BA 2P41A 1NT2A 4YUYA 4P7GA 2PX5A 4BP3A 3HNRA 3WSTA 3TOSA 2AN5A 2FHPA 3BWBA 4YUXA 3KPYA 3BKXA 4XCXA 4OA8A 4GOLD 5GINE 3OFKA 1NBIA 3T0IA 4E2WA 3P9KA 1ZG3A 3JWGA 5FUBA 2FRXA 2FYTA 4Y30A 1X1BA 5E8RA 2I62A 3P8ZA 2IBSA 3B3FA 3M6UA 3JWIA 5EG5A 3DLCA 3P2KA 4PWYA 5EPEA 1QAOA 1M6EX 3DUWA 3MCTA 2C7PA 1JTEA 5LQAA 3LDUA 3PVCA 3KKZA 5CM2Z 1VIDA 4EMSA 4PYJA 1JTFA 3JWJA 1BKYA 4U7PB 5EMLA 3UA3A 1RJFA 2PBFA 1VLMA 2AVNA 2BR4A 1NW5A 2OPBA 4GBED 2B25A 3GJYA 2F8LA 4GEKA 5D1HA 3A25A 4QTUB 5DRTA 5FQNA 3GNLA 3NMUF 3KPWA 3RIEA 4GOMD 1KHHA 2UZ4A 3G5LA 5K0EA 4GUAA 5K0CA 2ZULA 4KRGA 4PYOA 2G71A 2C7OA 3KR1A 5DX8A 4RVDA 1T43A 1VE3A 3LCUA 3HVKA 4OBXA 4WVLA 4KVZA 3IHTA 1NE2A 5CIYA 4RV9A 3DMFA 4CKEA 2B9EA 2OZVA 3NWBA 5FADA 5IKMA 2K4MA 4HGZA 3V97A 1JQEA 5K0NA 5EVJA 2JHPA 4GC9A 1G38A 2CL5A 4RVFA 5FA5A 3KQTA 3OFJA 3BT7A 1XTPA 2VP3A 3OE5A 3HA5A 3SXJA 1DCTA 1SQGA 3M6XA 4PGHA 3UJDA 2G8NA 1FJXA 5DSTA 5EQJB 1MJFA 3EVZA 2PJDA 2NXEA 1PRYA 4P7JA 3UJAA 2FPOA 2PGXA 2PLWA 2PX4A 3DMHA 3EVFA 4HTFA 4XUCA 2ZVJA 3B7PA 2ZW9A 1X19A 3FUUA 4KW7A 10MHA 3UZUA 1G8SA 4KIGA 3P9CA 5CVJA 3PX3A 1JG1A 4IV0A 2QYOA 5GIOE 3L8DA 5ICGA 3KPJA 4QDJA 4ER5A 2CMGA 2C7QA 4R8SA 9MHTA 4WXHA 3K6RA 5GIPE 3A7EA 1YZ3A 5D1NA 5K8VA 4YUZA 5KYGA 1U2ZA 5K09A 5E1MA 5LSAA 3BWYA 1L9KA 5C9ZA 2IH4A 2XVMA 3GO4A 3NVMB 2VDVE 4FGZA 3THSA 2ADMA 1KYZA 3OU2A 2P3OA 4PNEA 4OQDA 3SX0A 2NP6A 3EVDA 2ONZA 2YXEA 4IWNA 3A26A 2IPXA 3GCZA 4O29A 2PY6A 2PVCA 2YTZA 3NVKI 5EHIA 1RJEA 2P1DA 1QAQA 3MGGA 5E2AA 4BLWA 3MHTA 3KQYA 5KQSA 3M4XA 4C08A 3FTFA 5DPMA 3HVIA 3UA4A 1N2XA 1SKMA 3GRYA 3G2MA 4FS8A 3X0DA 1R18A 3LCVB 4MTLA 4HTFB 3R24A 5E1DA 3KHKA 3OU6A 1NKVA 2B3TA 5T67A 4KWCA 2PX8A 1P1BA 2PX2A 3DH0A 3MAGA 3HCEA 3IV6A 2P7HA 1EAMA 2NXJA 2BR3A 2QM3A 5ICFA 1RJDA 5CVVA 4YUWA 3VSEA 4K6MA 1BOOA 3UJ8A 5H02A 2VZ9A 3AWIA 1SG9A 3HM2A 3R0QA 4QQNA 3RW9A 2AVDA 2EFJA 1OR8A 2NXNA 3P71T 3PX2A 3TM4A 3FTCA 3LBYA 5FQOA 3A7DA 2XVAA 3B3GA 3ELWA 4NECA 2P35A 5FWAA 3BGIA 5K0LA 3T7SA 5E8JA 1WS6A 3AY0A 3SVZA 1X1AA 4LWPA 5E1OA 1ORHA 4ER0A 4E33A 4RVHA 2G70A 2OKCA 2R3SA 1RI1A 2I9KA 4RYLA 5EMMA 1ZQ9A 1KPIA 5GM1A 1IY9A 3G88A 5B1SA 4DM3A 4EKGA 2ZBPA 2AN4A 3KQOA 5CVDA 3A4TA 3DR5A 4KDRA 2B2CA 1NW6A 5K03A 2N47A 4HSGA 3S68A 2ZIGA 4OA5A 4RTSA 4OX9Y 1WZNA 2OBFA 3UJBA 4GOND 3DOUA 3KR2A 5C0OE 1BC5A 3TKYA 1XCLA 3UJ7A 2YX1A 4GQBA 3BGDA 2IDKA 2DULA 1JSXA 3CJQA 4PYMA 2ONYA 4R05A 5DTMA 5LQNA 1FBNA 1L3BA 3MB5A 4A6EA 1AQIA 5CCXA 3FPFA 3LX6A 4IKPA 4PYIA 4F84A 3O7WA 1R00A 3LPMA 5E9QA 2O05A 1SVUA 5KVAA 2IH2A 5T6BA 1EJ0A 1G55A 3VYWA 3HCCA 3I53A 1VP9A 2ZZNA 4YUVA 5LQUA 3GRVA 1KPGA 3IEIA 3CVOA 3ERCA 4YV0A 4RTJA 4CWAA 3ME5A 1X1DA 4MQ4A 2PSSA 2I6GA 4V0RA 2IDJA 2UYQA 4GC5A 4UOEA 4E2XA 5EMKA 3GXOA 4DQ0A 5DRYA 1ZGJA 2P7IA 2ZSUA 4KDCA 3KU1A 1JR4A 2ZIFA 5DTRA 4AUKA 4ER7A 1QZZA 4RTMA 3PTAA 2O07A 4DZRA 2IGTA 5LQRA 4QQKA 1FP1D 3UWPA 4X60A 4PYQA 4RSRA 5EZSA 4EKIA 1RI2A 1XDUA 2EJTA 5CCBA 3FPJA 1JSZA 3I58A 1TPYA 3SSOA 3C0KA 3SM3A 2ORED 2IFTA 4X41A 4YMHA 2OY0A 5T64A 3DLIA 1D2CA 4R6XA 5DXAA 5DT2A 1BHJA 4R6WA 3T7TA 3DTNA 4RTQA 4BP1A 1VP3A 3ANXA 3DULA 4FSXA 5EKXA 2Z6QA 3C3YA 2JHCA 3P97A 4E70A 1N7JA 3GRUA 2ZZKA 5DM4A 2Z6UA 3G89A 5ICCA 3ORHA 4BY9E 2UYOA
chains in the Genus database with same CATH superfamily
1SC6A 3QPCA 2AUTA 3ITEA 2CVHA 2QD5A 2P40A 3OZWA 4GLLA 4BTLA 1GVHA 4RIEA 2H11A 1Q0ZA 3GEMA 3ZIAD 1VGVA 5KAPA 3OWOA 4TZ6A 4K40A 2YJ6A 4Y0AA 3SZLA 9GPBA 1PVDA 1ONNA 4NCKA 3RCBA 5LD2C 3QTTA 2OK8A 3WICA 1LNZA 3FRHA 3MWEA 1DQNA 2HBYA 4ARIA 1GGFA 2F1JA 1VE5A 3K0KA 2C31A 4HN2A 1NFRA 4OIMA 4RY9A 4DAEA 1RXVA 2DETA 2AOUA 4MQBA 2Z56A 5EVCA 5I47A 1Z22A 1IDN1 1WMEA 1IK4A 1HK7A 3FTDA 2AFHA 3L0DA 4JLMA 4C9BA 1KEKA 2QP4A 3GH3A 3KSUA 4L8YA 3I01A 3RS9A 4YRQA 3DKIA 4DPKA 1FFCA 1X0VA 1YXMA 3URMA 3GLGA 1W88A 3R6LA 4UJ5A 5FPQA 5CGQB 5JYCA 1QIHA 2XNDD 1FYWA 2I34A 3IR7A 2Q9UA 2ERCA 3CKKA 2GCPA 1TK2A 2P3LA 3PT9A 4CTJA 4E5NA 4I1UA 1V5IA 1KO4A 2QTHA 5B30A 3RTEA 4KYTA 4EP1A 4X66B 1K7XB 1AMUA 1XVTA 2FPRA 3LLVA 5EGSA 1QE5A 2P79A 2WJ3A 4LMRA 3DFKA 3B7WA 4B9EA 1QHSA 4Q19A 3UJCA 4EB8A 2QDXA 2JK0A 4DV4B 3OHSX 2ZIZA 1BYIA 3BFKA 2JFXA 4MPRA 2MMGA 3THOA 1J2UA 3KOYA 3EQ9A 4CG2A 3T38A 3MD0A 2HN9A 2AJCA 2BN4A 2P8SA 2WE8A 4N6NA 5HFJA 3RREA 5IH3A 3WRWA 4MQFA 1SBCA 2J48A 1JG4A 5B2EA 3W5HA 1B0ZA 1M10A 2QRMA 3BXOA 3F4LA 2B0JA 4Q4AB 2EF1A 1U65A 2DX7A 3IEKA 1JJ7A 2WKWA 3TW8B 1NM5A 4L50A 1VI5A 2PS1A 4LF5B 1WPGA 1KO1A 3CCFA 4OXKA 4FHZA 1KMHB 3C3BA 4OYYA 1UZUA 3GRKA 2JGMA 3EXEA 2PZMA 3A1VA 7ABPA 5IZCA 3H9GA 1IHPA 2KYRA 3CHYA 3UMCA 1M7GA 3ZIDA 2QS9A 2WE7A 3JPWA 2ZT7A 3RYHA 5A6SA 1Z3CA 1TD1A 3LPAA 5JBQA 1NVUQ 1P33A 1ILEA 3BXFA 1Z6YA 4M55A 4KAJA 3AF6A 1XWFA 1ZIYA 3CGGA 3WK6A 1LV8A 2C84A 2M98A 3AVPA 1P39A 3CO0S 4NV3A 3WGGA 4WLFA 5H81A 3PWTA 1DJNA 3NKFA 5DYIA 4A73A 3DDCA 1AOXA 2JH9A 1NG1A 3O8LA 3NHKA 4HAYA 1W35A 3SFVA 4D9KA 4F91B 4ILKA 4IOJA 4UM5A 4H6XA 3KZXA 4F7DA 2CJWA 2H31A 4F5DA 4NICA 3WO1A 4P7KA 1UT8A 2VJAA 1AD2A 5JNRA 3S27A 1G291 5EUBA 3HCBA 3GLIB 3KG2A 4YB8A 2V0GA 2PXCA 4EJMA 1C3XA 3TGWA 2EBFX 2GDZA 3FA2A 5H4HA 1II8B 1AK1A 2ZB3A 5DWDA 5HA5A 3EZFA 1XMSA 5BOSA 5ECYA 4KFUA 1O6GA 1BVYF 1J00A 3RKUA 2A86A 1DAOA 2PWYA 1EUCB 2PL9A 2ZSJA 3JPYA 5HZGA 5F2EA 1JE1A 5ED4A 1Q0QA 3D6VA 4NC9A 3VA7A 4MUIA 2FE4A 3EVCA 2HA3A 5AKJA 5FA8A 1ESNA 1WO8A 1SU6A 1JXQA 3NBFA 1EHIA 3V4FA 1WZCA 3DZDA 3HZRA 1OXXK 2C9YA 2ZUSA 5EOVA 4Z54A 1QHGA 2JCVA 4KR9A 1VIVA 1L5QA 1I6MA 1PK8A 5DHSA 2W70A 4OP3A 1JG3A 4PNZA 5A62A 1JA0A 4CM8B 3HEMA 1YBMA 1Z0UA 2JH8A 1OBVA 3GJ6A 4JYMA 4OXRA 4RZHA 5FP0A 1AGYA 3MUFA 4RJKA 2PNFA 2WNSA 3T7CA 1N2OA 1NVVR 1G20E 1SHTX 2ZOSA 4P7BA 5DK6A 4Q4LA 3U40A 3WLQA 1NXTA 1OTHA 1WXGA 4GPD1 4YCBA 3ZWQA 5KNDD 3ESQA 1PEYA 4C7VA 4TV8B 2CUNA 1N0UA 3CKMA 3LUAA 2IXFA 1SD2A 3QJGA 2VHCA 4FYPA 2XKAA 3QY9A 4RF5A 5BRJA 1AKQA 3EIEA 4JVOA 4NMHA 4RZQA 2A9KA 1PKEA 3UPUA 4RDHA 2G7MC 4KMOA 4ZVPA 4TVSA 2FR8C 3BMNA 3E5NA 4H7DA 1NLYA 3THYA 4MS3A 4P5EA 2PV0A 1XPJA 3BS4A 3LYUA 3AERB 4K05A 2QE6A 1Z06A 2WFMA 4QVGA 4TT3A 4WKCA 3BE8A 1JEDA 4MJLA 1TTPB 1FQWA 1XTSA 3TLGA 4Z4EA 1NMSA 4L07A 3NWEA 1JQJC 5TPZA 3WXMA 3Q7EA 3KS9A 4HBGA 3G8BA 1O6FA 1LY1A 4Z6KA 1AHIA 1P2SA 4OY3A 5D7BA 5IAJA 4Y2SA 1E4EA 4IVNA 3EW7A 2P2DA 4DYDA 3DYBA 2VHWA 4KHPB 1YUBA 4O3FA 4R1OA 1U28A 2Q2NA 2ZRBA 1XK6A 3PD0A 5LQMA 3DBRB 1THMA 3K70C 5ESRA 3L7YA 5FBZA 1NMEA 5K8UA 4ODIA 1A5TA 3ZBTA 4D1YA 3NWPA 4X20B 1VHJA 3CF6R 4ARAA 3BZWA 4BE9A 2HW8A 1XDSA 1PD1A 2B8NA 3OEYA 4HQKA 1KWKA 1Q12A 4L8FA 4XWKA 1L4FA 5FUYA 2CE2X 1JG2A 2RH9B 2V1XA 1X1CA 3UJ6A 4C21A 3CLUC 1AV7A 1GADO 4GXTA 4XEUA 4P4NA 2R84A 1XEAA 2OQVA 1W8DA 1UINA 4BE4A 221PA 3T1NA 2IUTA 4ZZ1A 2HSJA 4P4SB 1VPLA 1RP1A 3FWHA 1YR3A 4MWTA 2B98A 3B20A 4ZZIA 1F3LA 3VX4A 3DBLA 2H8GA 1L5MA 1QDEA 2WWGA 4FFVA 3UBMA 4CDRA 1LLUA 4UVEA 3L8HA 3UMSA 2FETA 2F00A 4H27A 4ATNA 3OF5A 4DBVO 3EQ2A 2AZMA 2UZ1B 1IPEA 5IARA 3SC4A 4YFYA 2I3DA 2JZCA 4OM7A 3W9BA 3FUVA 3KSMA 4KGVA 2BEJA 2J0EA 1WXQA 3GU3A 4NESA 4Z2YA 5AVWA 1O94D 2CMHA 1V8FA 2BELA 1PWHA 4W4TA 4YQYA 4BZZA 1CY6A 5FNVA 4XCQA 2QV0A 1T4MA 1X1RA 2OWDA 2BM8A 4UVGA 3ZV6A 1JZQA 1KAQA 3N58A 4OYLA 4N6OA 3V7FA 5AK0A 2HQRA 2QK4A 2ZBUA 3ZWPA 4JV5B 3JZMA 5GJCA 4IXDA 5DP1A 4Q3EA 3CS3A 1QV6A 5J43A 1WUJS 4MR9B 2J08A 4OOFA 2PYZA 4HWRA 5DVZA 1LLFA 2UZ3A 2ZYRA 2QN3A 3PGMA 3MF4A 2O8BA 1P0QA 1K8ZB 2XVYA 3VR5H 3V4RA 2I4OA 2IIBA 4JL5A 4H7HA 4EJSB 4FSHA 2IITA 4PHCA 1OLXB 1UWLA 1OU4A 3WGTA 3U4QA 1ZDMA 5KTSA 4BNTA 3MT8A 1OZGA 3Q7RA 3SJCA 5CCDA 4B80A 1GPUA 1VLQA 2DHRA 2EJWA 4KO8A 4KOEC 4P3YA 2XE8A 4HRYA 2O8EB 3AR9A 3P9KA 1ZG3A 1ISIA 4JWKA 2GWHA 2FRXA 1ORDA 4LZZA 1BWQA 3C14C 4PE5B 3AUFA 4REOA 3VJMA 1XP8A 5E0OA 2P2SA 4G5GA 1Z8NA 3JR7A 2R7AA 5E4YA 4BDTA 1NN5A 3Q3CA 2XY4A 2A5DA 3OJLA 1DRUA 2WT8A 3ZOKA 3ACCA 3L7JA 2AZDA 2YDXA 3O9MA 3T4UA 1SB8A 2AMJA 3PDJA 5A05A 1EM6A 2ZYDA 1YDHA 1MQSA 1QVZA 1K7YA 2GYYA 3VR2A 1WDKA 5CFQA 2QRQA 1SCQA 1NDQA 2OCPA 2OYSA 4I2NA 2C2KA 1SHKA 3EXFA 4ARBA 1FNDA 4CQMD 4D92A 2VTBA 1NL3A 2XZPA 4MHOA 1IQRA 5IKXA 5FQNA 4UDOA 4K2AA 1RDFA 1IXRC 1U3UA 3EGXB 4ND3A 4WBNA 1N2EA 2X9LA 2UUOA 3H1EA 3R9KA 3SPXA 5I7WA 4NJEB 4LTMA 3FHJA 3RRXA 3E70C 5ALXA 4EYGA 3H1BA 1ZGHA 2XAAA 3LX8A 3MJDA 4GPBA 1SOWA 1PL6A 1WMSA 1HM5A 2A7XA 2HREA 2X4LA 3GC6A 3DZFA 4V0LA 4XM2A 4D96A 4J4BA 3VTFA 2JI8A 4RD6A 3WKBA 3BCUA 2Q46A 2X3YA 1T9HA 1ZKMA 1A9SA 5TT1A 4XR9A 4EH1A 1J23A 1GLNA 1HY3A 2ANBA 2D4AA 2RGDA 3BCSA 3L9WA 3OE5A 2P6RA 5AVTA 3RROA 1ZEMA 4QGGA 4RGBA 3UJDA 4BX8A 4EPXA 4UNRA 4MP3A 4RK7A 2GCIA 2CXQA 4KG7A 4YN3A 4AJNA 4B8ZA 2Q45A 4PSCA 3O83A 1GDDA 2PX4A 2YV4A 3IL2A 4PQEA 4CLOB 2JVKA 4LOLA 5JISA 1RAIA 3N2KB 1OCEA 2EKPA 1I94B 4JQCA 1N1MA 1AKWA 2ODQA 4IGKA 3UZUA 4CCSA 2YXPX 2E4VA 1CFJA 2RGNA 1GAQA 2HLDA 2YZ2A 4N5LA 4D3XA 3CEHA 1NLMA 4WW0A 2X5XA 3T41A 3VPXA 2PMBA 4B3CA 3BL6A 4D42A 4PBSA 3MIIA 3WSWA 4MUNA 1LCIA 5HDBB 1E3WA 5DE3A 2DKNA 4IDOA 3WMEA 2IU3A 3F7OA 2Y77A 2D7JA 4G5SA 2WF6A 1OX4B 1SULA 4KTTE 5AD1A 1MV5A 4MVJM 5C1OA 4K9OA 1F0YA 1XD8A 3AC0A 3DPIA 1B43A 1TB4A 3V9PA 2JGKA 1GZUA 1W2WB 2EFCB 3MYRA 1XQYA 4JYBA 1F2UB 2JB9A 1SVOA 5DTEA 1TZBA 3H1TA 2PQ6A 2W8ZA 2H2FA 2WKSA 2IPOA 2KX7A 2WQZA 1ZU4A 1YD7A 121PA 2OD2A 1CEQA 2P69A 2QD1A 3LVQE 5FBQB 2BOVA 4FS8A 5GGXA 2IS1A 4CLEA 1PHPA 1CZRA 2V54A 4HWTA 4IDBA 3ZU5A 1Y6GA 3OZBA 4TWIA 1UJMA 1L5KA 3DOEA 4EW1A 3AW9A 4LGYA 4C7BA 4P3OA 3GCDA 1NOJA 1XALA 3OFNA 3PR2B 4Q12A 3HUDA 3HCEA 2NXWA 4BRWA 1M6VB 1XU7A 4BLRA 2VDOB 4AK9A 3AK4A 1AO3A 5JTUA 4K03A 3AY6A 4PZAA 5CVVA 2OP0A 5CDUA 3HUTA 4D9EA 4GWLA 4ND6A 2RGYA 5EUCA 5A3SA 3AWIA 3KNZA 1NMYA 4CT4B 2AL7A 3B9RA 3ZG6A 1FU4A 1QK4A 1PNOA 1OWPA 1XROA 6LDHA 3A7DA 3ABIA 2A9OA 2J9XB 8ATCA 4JGIA 5ITZA 1FLVA 2GEJA 5E8JA 4M6WB 5TR9A 2P2CA 3T34A 4FKZA 2BGWA 1DHRA 1TU4A 2B4YA 3KUUA 4K81B 3KHSA 1ZUIA 1ZQ9A 4EVQA 1P6XA 2D1RA 4NRDA 5EHNA 1VJ5A 3CLRC 3GVHA 3KEFA 1JQ5A 4K9DA 4TQAA 1WHSB 5G3ZA 4RZUA 1SCUA 2GM5A 3BB1A 4KQXA 4YDHB 2GHIA 3DTVB 3IMGA 2AF3C 4XFDA 4B6GA 4BFSA 5C0OE 2I6TA 4HCJA 2YINC 2D1SA 2EYQA 3T4EA 2JK1A 5JW6A 1NYQA 3DAPA 2IDKA 4IFIA 2JDID 4R1TA 4JI5B 1L7MA 4HBZA 1ATZA 1DKLA 3VZDA 2DKFA 4JIGA 4L22A 1WIWA 1CY1A 3ROQA 1IAQA 2WZDA 4B6SA 4RU1A 4GEGA 2W6IA 1NXOA 1KC3A 1Y5RA 5LQUA 1FYEA 1NC1A 5FWYB 3UVEA 3M6FA 1AH2A 1FSPA 1Z12A 2V3CC 3KV1A 1F6DA 5LUAA 2YJTD 3GMDA 1TLLA 1MX3A 3V1NA 4HB0A 2PBRA 2HF7A 5JSUA 1H4QA 2VPPA 3MJRA 3OEWA 1GTMA 3PC3A 1N8SA 2W98A 1OAOC 4RTMA 4AUKA 5H9VA 2VJOA 2JFOA 2PL1A 1MC1A 2PUHA 2X76A 4PR0A 4UHFA 3UJNA 1RU3A 2B5OA 2XA9A 2FLKA 1U8UA 3MJSA 1XHLA 1UQUA 1EX7A 4RSRA 5FYQA 3PXGA 4RNCA 3FTPA 3RR2A 1CNMA 1JV2B 2KS6A 2G9NA 3RRFA 2PKQP 1RRFA 4BLTA 4ZIRA 4UXJA 5T64A 3RBVA 1K5GA 4J0IA 4EEXA 4FBMA 2A9JA 1SC4A 2PGJA 3B1WA 4R6WA 4F4HA 1XCGB 2R86A 3IAS6 4D57A 1HQKA 1N7JA 1WVGA 3D7KA 5F21A 2ZJ3A 5DM4A 1K86A 3CEPB 4C6TB 3VJRA 4DG5A 4MDHA 1YTLA 1GGNA 1FU7A 1V26A 3H0EA 3H1AA 3C39A 4HDNA 1P1HA 1QG0A 4QTXA 1GLGA 1DBVO 4COKA 2O57A 3LUPA 2HQ1A 4O4HB 4AO6A 2D6FA 2CD7A 2ZE8A 4KL8S 5FOTA 1X7GA 1IQPA 1MAUA 2Q21A 4HOYA 5B4UA 1R0WA 2QTWB 1X6VA 4PY2A 4F86A 2R1TB 1GYQA 2ZAGA 4Z0HO 5AH0A 3OMXA 1M1XB 3R7AA 3FCXA 3T7DA 3VR4D 3WHIA 5BN5B 3ZDDA 2BW0A 1M1YB 4N4AA 4QJIA 5DZSA 3RBXA 3T9FA 5ITVA 5M04A 4R69A 3U1BA 5DM2A 3RVNA 1Z7WA 3KBBA 4RW0A 2ILTA 2GOYA 2XRMA 2H9IA 3FJOA 4RADA 5AI9A 4XYMA 1XEWX 3DE3X 1DC7A 1VGRA 2X2EA 3FVTA 1RKVA 1L4YA 3F74A 3R0VA 1JN0A 2GJSA 2VNIA 3KKMA 4GOOD 4RZ2A 1TK9A 4DLBA 4JY7A 1TAUA 1E4VA 1VJ1A 2VT2A 4J0EA 1W4BA 4RDXA 1NP6A 2ACWA 2BFCA 1MH1A 2AN9A 4G8DA 4QDZA 3TUJC 5IM4A 3A1SA 2R6CA 2D0OB 3FPLA 3PHJA 4IY1A 4EY6A 1EFPA 1A77A 1Q16A 3DP9A 5D3MB 4URVR 4CIWA 4AKSA 1DB3A 2RSLA 1KDRA 3TDMA 4RACA 4HK4A 4DSNA 4AF7A 1E58A 3H9BA 4TVKA 4HEA6 1HBJA 4DWOA 2FEPA 2O0KA 2PKWA 1ORTA 1C7ZA 3QPBA 4FLFA 3UEOA 3U44A 3DHEA 1JHOA 4TV8F 5G4LA 2CBXA 2PJRA 1OSNA 1JMKC 1RPNA 1XJWA 1KAOA 4DBLE 1XU4A 5CRIA 2VZEA 1VSBA 4JC5A 3GHYA 1AVTA 1UDCA 4E12A 3IJPA 1LQUA 4IIFA 1H8HD 5D8DA 5EYPA 3PHCA 4DLAA 1LF0A 2XUAA 5THXA 3A6GA 4NKRA 1JIJA 1JDUA 1MEEA 1J07A 2AOUB 2J5KA 3HB7A 4KN9S 2R47A 3ZC3A 4YMGA 4MDFA 1KDOA 1PV2A 2I4NA 2AFHB 3FUWA 3IURA 3MS4A 4G67A 1O97C 2W8BA 2R79A 4MR8B 4ND1A 1O9BA 3X2FA 4E3ZA 2FPLA 4IFTA 4R3NA 3GLGB 1W88B 2YWXA 1DZIA 3KOUA 4JR1A 3I5UA 3KEMA 5SZHB 3W8DA 4A0QA 2VYVA 4KJZA 2WB2A 3C15C 3BFXA 4O02B 1AQLA 2LNDA 1HGXA 4JBXA 5EXPA 1LQ2A 4XEHA 3ZY2A 4DZZA 5MF6A 1NNLA 2WHEA 4JI4B 4N47A 1SR8A 3D6TB 3GBSA 5F1YA 2I6XA 4R0MA 2FMUA 4YWJA 4R8RA 4DJJA 2ZJ1A 1GU7A 3D81A 2YL2A 2CKDA 4JJEA 3LOPA 1MJNA 2KPOA 5G40A 3B9QA 4MVWA 2C2OA 4IHAA 4M0LA 1CUYA 1XTTA 5CVEA 1V5GA 3UK7A 5HJ2A 4B85A 1JLLA 1A8IA 3AIMA 4L7VA 1KI4A 3ZDYB 1TCBA 4S12A 1XJQA 4I9GA 2PNJA 4E3WA 1MO3A 2EARA 1ZFNA 2CVQA 3AP3A 5C1IA 4KXLA 3VNBA 3QG5A 4K9PA 4R81A 1QRSA 2G1AA 2Y4OA 4JT2A 3PSHA 3ODPA 2VSOA 3GJTA 1YQTA 4AYXA 4JUBA 3Q2KA 1C8BA 1J2EA 1WXWA 4AMBA 4DQKA 3Q0EA 3RODA 1XCJA 5LZ9A 3HNOA 3LT0A 4MZDA 1FLDA 2QUJA 2IH4A 4CM4B 3OCXA 4OGFA 1FXSA 2PUGA 1NX6A 1E59A 1G2OA 1GUFA 4OBBA 3F5FA 1J33A 3PQDA 3EJWA 3LSTA 3X1JA 4AMYA 4DYHA 2I8CA 4XQGA 3DMGA 1JPJA 3L7KA 4B3XA 1AMOA 1ODSA 3TI9A 3EXEB 3AHIA 3G0DA 1IZ0A 1RCFA 5D2CA 4X65B 1H2YA 3MT7A 1QOZA 4HN9A 5A6SB 2SKDA 3QWBA 3RYHB 4X84A 4FE4A 3KYDA 2CXUA 4JJIA 4NBTA 3BIWA 1RWMA 1KEUA 3DMRA 3FKSA 4Y1FA 3FSEA 5IDQA 4XAQA 1M8JA 4KVGA 2RHJA 2C94A 2J5BA 2GN8A 3C5HA 3OZGA 1ZGGA 5DHFA 5NLLA 5JWOA 1QP7A 5K0SA 2IELA 4G5XA 2ESRA 1LBEA 4Q1DA 4DEYA 1IM8A 3A8TA 5A04A 5EHGA 5HKOA 3KL2A 4XFKA 4UHDA 3V1MA 3AJRA 5KO2A 1VCHA 1RHQA 1Z17A 1E8NA 1YBHA 4AJHA 5FO0A 3ZW7A 2WF8A 3GGCA 4IRUB 1C7IA 1YJ8A 1EVYA 3R3HA 3MWYW 3ZZTA 3DWFA 2EKLA 1DXQA 2W48A 5AVQA 4G56A 2OLJA 2C2MA 1W5EA 4LC1A 5T5QA 1GUYA 2C58A 2E82A 2GK6A 3OTQA 3EF1A 3THRA 3UAGA 5G1NA 2GNOA 1ZN8A 2IBMA 3GLKA 4QA9A 3ZD9A 1JT9A 1YCFA 1T5TA 1AQYA 1TXGA 3BB3A 5EIHA 1OB5A 2DQYA 1WCXA 5HZMA 4M0PA 3QPWA 3KUCA 3LY7A 5J2TA 1YZHA 1SQSA 4ZVUA 3WL3A 2PE5A 5EPOA 4MUXA 4TRMA 1SUDA 4OQMA 4ON9A 4YJDA 2CSXA 4NMXB 4P58A 1K97A 1WCIB 3AX6A 5F73A 2C2GA 1QKJA 2E4XA 4M8LA 3U62A 3STVA 2IV7A 5JI3E 1RNLA 1JAYA 4OKNA 3PXUA 3HSKA 3UW3A 3SGLA 4XSHA 1DOAA 1Z4LA 4WEQA 4FZVA 2AW5A 1W48A 3ETDA 5CFZA 5GVSA 3KVRA 1NI3A 3E3NA 4H7FA 5KNDH 3U16A 3LXXA 5DHTA 1V9CA 1VL6A 3I6YA 3DE5X 4R9RA 4US1R 3QBDA 4PZ9A 4B17A 3FCEA 2J5RA 1YQXA 4J16A 4I2VA 2G5GX 1E60A 1LBTA 2NPOA 1BGVA 1IXKA 3EYAA 3SIXA 4C0AC 5IUJC 3BMNB 1ZKDA 4TKVB 1KVQA 2DLCX 4MS3B 1D7OA 3O21A 2XF2A 1KBQA 3OF3A 3T7AA 5EHXA 4NOJA 1Y8ZA 4RLFA 5PNTA 2P78A 1CRQA 1O58A 2CVPA 3FCUB 4BNXA 4WK6A 4MWDA 1QUEA 2VHTA 1EJ6A 2VF4X 2Z58A 5KIAA 2JAOA 2B36A 2A1IA 2CFTA 3G8CA 3INRA 3MGCA 4ARSA 1E4EB 2IHVA 1YS1X 3R75A 3IPAA 3AETA 1ZD3A 1PDVA 4CR6A 3DDNA 4G0UA 1J1ZA 4DLWA 2WDZA 3I1YA 3UF0A 4Q3DA 1ITZA 3FNEA 3ZJ5A 1B8VA 4H6PA 1B6GA 5AVSA 1WKCA 1JPNA 3NOXA 1EWYA 2QAIA 2SBTA 2Z98A 3B48A 3I23A 4FMBB 5CA1A 2FRDC 3HFSA 3MERA 4KBGA 3OE7A 2YV5A 4L9SA 1I2DA 3KVVA 4B0PA 2G63A 3BQMB 4KYUA 4YV2A 5JBNA 3DF7A 5BW8A 3SQLA 3FCYA 5E7JA 3U56A 1N6LA 4BLUA 3TOXA 2O2DA 3RVRA 1KI7A 1VJGA 5BMVB 1XZQA 5CYGA 3GQBB 3E3OA 3P2EA 4MMZB 1TUGA 1VMDA 2DBRA 1KORA 4GPEA 3G1WA 4D46A 3G0IA 4XB1A 2YW2A 2OFFA 3EXG1 3ORFA 1IMJA 4R9NA 4Q9LA 1XQVA 3DWIA 4YYEA 5MGNA 1GCIA 3VPHA 1XMQB 3DHYA 3H7AA 1Y34E 3FMFA 2W2PA 4ICIA 1YGYA 5I9TA 4JI3B 2ET6A 4P7GA 4PC3A 1JDTA 3LDAA 3PYLA 4X6LA 2Z04A 3GLUA 2KI5A 3VSBA 1ECFA 1M2JA 3K72B 3UH1A 3AV3A 3R5SA 1WW8A 3A1EA 5DYTA 3ZTWA 2AFRA 3VMMA 4WJLA 3SAJA 4PFQA 3JTEA 4AZ3A 4NZ9A 1P18A 2CNWA 3N8GA 4M1ZA 5DISB 1WDMA 3OG9A 4YY3B 1H1TA 3JWIA 1KYVA 4BIIA 4G63A 1Y9ZA 2W2OA 1CUZA 1LFAA 1RM0A 1Z38A 2GN2A 2PUBA 4WESA 3D4IA 5FNVB 5KYUA 1M5UA 1F14A 2E0IA 4UARA 1RLJA 4LVOA 1UJ2A 1QFJA 1WETA 1BW9A 3CLSC 1I4DD 4I46A 5IMBA 4Q9IA 3NT4A 2GEBA 2ZB4A 3KXPA 3TZQA 3K1AB 4B3SB 2ZRHA 3QQ5A 2FSGA 1NW5A 4MLCA 4MKIA 1Y9AA 3QWIA 3V4LA 2LBPA 5JXGA 1JDNA 4GEKA 1JWAB 3W9SA 1ZJ4A 3RRNA 3R4CA 1HMPA 1OBCA 1GT6A 2P1ZA 4XIYA 4ZK2A 3WC4A 5U9CA 2UZ4A 7ADHA 3CQ9A 2N75A 4IVQA 4O2BA 4OL9A 1IEWA 4G8CA 1Z6ZA 4KRGA 4PYOA 1YQDA 1QMPA 3N3BC 1J7KA 1EEHA 1U0OC 1H85A 2PGOA 2X9GA 3M3PA 4BWVA 1NE2A 2HCFA 3R44A 1EZ1A 1UC5B 3JYPA 4MRMB 1JVSA 5TJHA 5CVTA 2RHMA 3OOWA 4R9SA 1O0SA 2RBGA 5KU1A 2FR1A 4ARUA 4IMIB 1V5WA 1G20A 2CCKA 4J8PA 1GZDA 4UU7A 5LVAA 1EQ2A 1MEOA 2GFHA 3AO0B 5FA5A 4PO9A 3TW0A 1RS0A 1XTPA 3KWMA 1GZ3A 3WKAA 1OH6A 3L6BA 3NNNA 1E5XA 2GD0A 1I2BA 4G01B 2R4TA 1QX4A 4YFVA 3WGIA 3E84A 2QPLA 2PJDA 3VSDA 1QSGA 1K7FB 2QP3A 5TT0A 1QNLA 1UK9A 2PGXA 4TXLA 1MB0A 4YASA 4L0MA 2ZI3A 5A7HA 5E0KB 1FXWF 3K0FA 3EXFB 4GP7A 1H3EA 4TTJA 1CJSA 4IV0A 3RF6A 4M9UA 3UCXA 1ZJZA 2ZUCA 4XVQA 3UHJA 4WBNB 5IN4A 4HO1X 2VNAA 1IBRA 1X7YA 3QHAA 4BQOA 4ZCIA 4YAEA 1VYVA 5I6DA 3E22A 5ALZA 1ZOPA 2H59A 3DPUA 3GO4A 2Q3JA 1GGEA 1DIHA 4ZTUB 2CYAA 1ZM3A 3A4MA 1YVPA 4AWAA 3SDBA 4I1VA 4EI9A 1F1BA 1O5IA 2FPGA 4LPSA 2IPXA 2NQTA 5AW0A 1I0LA 3I2KA 3MYYA 1Y3CE 4OK3A 3VBCA 2VJDA 5A4FS 1IOZA 4MV1A 4ZZ0A 3KFLA 1GXSA 4H0FA 1GRCA 4TQGA 2I2DA 4FD2A 3KRTA 1RXEA 2JBWA 4FHDA 3UPTA 4CZ2A 2NTYC 1C50A 4O4HF 5AMXA 5C1BA 1XLVA 2ID8A 1I01A 5TQVA 4G25A 7MDHA 5K8TA 3QLUC 3SF0A 4UVDA 4Z4QA 3HKEB 4N3CA 4WKBA 4AF8A 1ANKA 4KCGA 1P17A 3IO5A 5B1EA 1CQJA 1NJFA 2NXJA 4DMKA 1IBLB 2HBQA 2NU9A 2DYKA 3D3QA 4QNNA 4Z9FA 1K6MA 1RJDA 1E1RA 1IUPA 2BBSA 4Q5IA 5G2OA 1NR5A 1XWIA 3VSEA 3GUCA 1V37A 1BOOA 1JPUA 1QIKA 1UXHA 2P1RA 2VT7A 2WMNB 3TBFA 3V55A 3DJYA 1BQ3A 4BS9A 3PE3A 5FTKA 3P71T 1N6KA 3DNPA 1RCTE 3LUJA 1XQ9A 1EX6A 4I0WB 3VU1A 3HUEA 2CDRA 4NECA 4B8WA 3Q5EA 4LJ5A 4R2IA 5D5PA 3T8YA 4AY4A 1X1AA 3RS2A 3O90A 1BROA 3I2GA 5IXJA 2YN2A 2CNDA 1W0KD 4MGEA 1N3YA 3IKLA 4POAA 4RC9A 1KPIA 4DSOA 3G88A 4PLCA 2DT8A 3BE5A 4UCXA 3UPDA 3ICEA 5KSPA 3CLVA 4D25A 4IO1A 1OH8A 3GBPA 4IM7A 1GKLA 7GPBA 4ML3A 3LWNA 4IS3A 5AVUA 1CW2B 2F1OA 2N47A 1ZONA 5H83A 3FI0A 2JARA 3LCJA 1O57A 1OFVA 4PRYA 2BL4A 5CNIA 1T1RA 4OA5A 5JAIA 2WU1A 3AONB 4NHEA 5AM4A 2QRPA 4FFMA 3PGXA 2DCMA 3O1HB 1KY5A 1WOYA 2YX1A 2JAWA 2WHPA 3DOOA 5LQSA 4FHEA 1U3FA 4RA6B 4Z3KA 2EYUA 1G4AE 3DUFA 4ZCSA 3WLMA 2QTTA 3A4YA 2OG2A 4I4CA 4K3VA 4LJ9A 2P2YA 3SN6A 3UAXA 3A1TA 3HB1A 5EXDA 1PD0A 2VP9A 1S2IA 3IEIA 3QVLA 2HU5A 2LR0A 4U2DA 2QN8A 3QJ5A 1T0PA 5ITZB 3ME5A 3GJ5A 1SUCA 1JEOA 2QL5A 3A31A 3QK7A 4FMCB 3NIGB 4MPPA 3AF3A 4XSVA 5BNFA 3UWMA 3COYA 4K6HA 2VZLA 4QULA 4AJ9A 1S3IA 2OPHA 1IN8A 3AY3A 3C3JA 4JFRA 4HWKA 3MT0A 1XU9A 1ZGJA 5JVDF 2RKWA 1PR4A 4ZVSA 2PFKA 1OMOA 4NQRA 4LW8A 4CV2A 2JGNA 1DP4A 1VJDA 2YFYA 3K70D 2HCBA 2Q4EA 1EGHA 3PWKA 5CCBA 2CLLB 5CXQA 5NULA 3SSOA 3JAKA 1SCUB 2OKGA 1EFCA 4HYEA 2DQSA 3UM9A 3W79A 3CIFA 2JI7A 1GQRA 1HPLA 1E1YA 1Y8AA 2CHUA 2RAUA 3F6EX 3PUIA 1CE8A 4JBHA 1YC5A 3VPSA 1AUPA 2R8OA 3Q10A 3VKVA 3UWOA 3I1JA 4RTQA 2J5XA 3JVDA 4PZ0A 1VP3A 4FSXA 3LH5A 2HDOA 3LC2O 5TF4A 5TQJA 4ZGGA 1L7QA 3H1GA 3VZBA 4BWFB 5C8XA 1UCFA 2Z8YA 3CLUD 1JFLA 2A5JA 4FDVA 3KE8A 1T0IA 3G89A 5FORA 1AS2A 1H9AA 3ORHA 2I2FA 1SUEA 3IAM6 3K20A 1TIBA 3SLGA 5C2JB 1CUBA 5EXEA 3HDHA 3ZY6A 4RS3A 3FUCA 3IDAA 3TD9A 1G5IA 2ZJAA 4NULA 1E94E 2ZRKA 3H9CA 1BCSA 4PN7A 3TX2A 3I52A 1O89A 4G1UC 1NW7A 2O3QA 4MRAA 1SHJA 4N82A 3WGMA 3O1LA 4XDZA 2GO1A 1U2DA 5E3IA 5HWSA 5JFOA 1VPVA 1RHJA 3MB8A 1VPDA 1FMJA 1UJNA 1FRQA 1XVIA 5E2BA 1SCIA 1Y0BA 2H52A 3JVEA 2AHRA 2IYSA 3LP8A 1SG6A 2NZUG 2ZYUX 5AI5A 3K71B 1U4SA 2VTDA 3PJDA 2GH1A 1Z7GA 2H9YA 5BNWA 1U0LA 3SEAA 3L6DA 2WYHA 1ZUHA 2H85A 3KB8A 1WPRA 3ZCVA 2VDLB 4P98A 1G3UA 4UUMA 3DZJA 4AY5A 5IU6A 3WYCA 4BAGA 5LQDA 2C2WA 3QLTA 3HU2A 4BBPA 2OFWA 3IAAA 4HDNB 4HDAA 1E2QA 4EHLA 5F2NA 3RK1A 1R10A 2W11A 2AX4A 2Y66A 2ZJ2A 3TLYA 3CVWA 2P9QA 2UUCB 1XZHA 3IGFA 3ZWCA 2NZ8A 5FUWA 3UT6A 1ISRA 2P6UA 5HTKA 5AW6A 1BWSA 2ZWPA 1HYGA 3THYB 5FHQA 2OGWA 3KQSA 5LC1A 1E3QA 1S0UA 2DLNA 1R8JA 4ENTA 2EIHA 2R6FA 2BJWA 4B4VA 3UK1A 2W4MA 4FTWA 2BFEA 2M2IA 2QXYA 5JZSA 4HPJB 1QE3A 4G5OA 5F78A 3I62A 5EXTA 4OXNA 2I1QA 2WD8A 1WX1A 5A5DA 2HFJA 2HOQA 1G98A 4KITB 2G4CA 2ZT5A 1Z2NX 4NG5A 5KBYA 1S8AA 4YMLA 4IUYA 3W8FA 3ZY5A 4M89A 5CFPA 3JATA 1EFPB 5FEMA 3C3CA 3UMMA 2L69A 1JQBA 2YHAA 3CURA 3GCGA 2HJHA 3NC4A 4QAJA 3OEHA 5K3CA 4POOA 4KR7A 2IOQA 5LQCA 3G2JA 2RG1A 4HF7A 3EDYA 3PXCX 4ZYXA 5GMOA 2REQA 3D4PA 5AXAA 2NG1A 4L8WB 4G0VA 3U44B 5JFTA 3EG9A 3DPSA 2IE8A 3VZSA 4C4RA 3O8CA 3I5XA 1VPWA 2ETVA 1HXHA 2H51A 4A8PA 2IS6A 1KGDA 5G3YA 4OJNA 5B3JC 4PLFA 3PHLA 2D8MA 5DN6D 1AKVA 1L3IA 3PENA 1E2BA 3CCBA 1RBQA 4JAVC 4W5RA 1M1ZA 2O2EA 4A0HA 5AKXA 4W99A 4DMFA 4M1YA 1H2AS 2XCUA 3DBHA 5HR5A 4ESVA 4B44A 3OH8A 2Y05A 3T5DA 2W8BB 4DQXA 3G7UA 1NW4A 5JAMA 3EXAA 1R6XA 4E11A 2A0FA 1CJVC 1N3IA 3FIUA 1QO0D 3L79A 5F3DA 2PO5A 3K05A 3KXLA 5M3BA 3K09A 8GPBA 1ABFA 1QWOA 3CNLA 3EASA 5EJFA 1V48A 1JUDA 1X9GA 1M54A 4MA4A 5F7OA 1O3YA 3UKDA 4F4CA 2BEUA 4MVYA 2R5FA 5AUOB 1KYXA 1F0KA 1ZJJA 2XCLA 2G1KA 1PJAA 1DELA 1YO6A 1M6HA 3BAFA 2RH5A 3LC1O 4MA5A 4Q9HA 1E99A 1V35A 4AX8A 3IAFA 3DFZA 1TVMA 2X15A 2EL7A 1JLLB 3LD9A 1GTG1 3CUVA 4YCDA 2XLCA 1MBZA 5BMVF 2GN9A 5BSKA 3FB4A 1RYEA 4YRPA 2ZM5A 4MUYA 3OUZA 1EAYA 3BJRA 1YQ9A 1QRTA 2POQX 5AJXA 1Q17A 2H4WA 3KTFA 4FNOA 1X1EA 4IGIA 1ZK1A 1AGXA 3OMLA 1JJIA 3F49S 4D0NA 1SM4A 3WB9A 2OECA 4J0GA 1RW4A 4S1VA 1CNFA 2CFSA 3A3KA 3NHUA 1CRLA 4B47A 3KAQA 4Q6WA 1NIPA 4YUAA 1WP9A 4NZNA 1T2AA 3ND5A 3TVDA 3FMIA 4JZYA 5JZVA 5G1OA 2FP4A 5JCXA 3U6KA 2VHVA 1HOTA 5EMJA 1QR6A 1UPFA 4XFJA 3UAVA 5L3QB 5HKAA 4ZGWA 1L6IA 4QGHA 3G68A 2PRKA 3MTDA 2C5LA 4ALLA 1FBTA 3PJRA 1CT9A 4PG4A 5FNVF 1G6HA 1PFVA 5EZYA 1TVKA 3ESCA 3QA3E 4K5QA 1ZH4A 4HNGA 1A04A 3KYDB 4DCTA 3NHZA 1TADA 4RGYA 1NSFA 4ZZ3A 3E9NA 5SICE 2XDYA 2D5CA 4H35A 4JR0A 1UMBA 3PA8A 2HU2A 1YBAA 5TQ2A 3IKTA 3AKDA 3FPBA 3MM4A 4B46A 3PHHA 4QO7A 3PFHA 3U60B 2JGEA 1ISMA 3I9LA 3JR3A 2BM0A 3L8YA 2GEKA 3FZQA 1I4OA 1KQNA 4LRYA 2DBZA 4EBFA 1MVOA 3CLRD 2IYWA 1FUKA 3T3NA 3DDZX 1Y8CA 3SZMA 2EX4A 3BWDD 3K35A 3D1JA 2E85A 5I8WA 3OQJA 5JFGA 3L0SA 4IIUA 1XA4A 3I45A 4C5AA 4JK3A 3KSBC 2B99A 3MOSA 3KCNA 3DBOB 4FCTA 3G2KA 4XD7A 3SSMA 2IXEA 1N0VC 1ZHFA 2C3MA 3RHZA 2F3RA 2CY0A 2X0DA 3L7IA 4KXQA 4IIGA 1PR9A 5B4TA 5KVCA 3ZVRA 3RI3A 5HOQA 2WIAA 3QBVA 4MULA 4WADA 5C32A 2NTEA 4AJIA 1JQ3A 3G9XA 4JBGA 1S2OA 3C8MA 5ERGB 3MAAC 4KV7A 1SH7A 1G0NA 4R8KA 4XQ9A 3FFTA 3H9QA 2BT4A 2ZI4A 2IW1A 2ZJBA 2B4AA 1JKXA 3C6ZA 3IDOA 3K94A 4FZJA 4MPDA 4XWAA 1I32A 1W25A 3Q7SA 5IX8A 4JYCA 1WMFA 2N42A 1R3DA 4UPDA 3U7IA 4ZVNA 3ON5A 1J22A 2AEEA 3GARA 1WXEA 2XUKA 3EULA 3OAAD 2ROQA 5J23A 2J0QA 2VPWA 4QSHA 1UPCA 1OGYA 3WFZA 4WBNF 1G5FA 2C8VA 1II9A 4WFJA 1YDMA 4HPWA 4G86A 1T6ZA 2A9PA 1Q11A 1T8WA 2FUG6 2QUKA 2BGNA 3KQQA 4HNAA 4LCBA 2XRYA 1G3RA 1T3TA 2I3BA 2OV1A 3FYSA 4L5YA 4WNYA 3DAYA 4DIOA 1GZ5A 1IB0A 4L0CA 1V25A 1NNEA 2QUZA 2QQ0A 3MXOA 4IUCS 1W5AA 2FCRA 2XYRA 1THTA 1N0HA 4JYPA 2PZ8A 3A9CA 3C97A 3T7IA 2V5VA 4U63A 2YWFA 3S2EA 1JYEA 4HL6A 1YJAA 2V7EA 4QUBA 4ER6A 3GVCA 4M1MA 3SR4A 4UTVA 2O2JA 1GVNB 3DTYA 1LV7A 1ONBA 2VBIA 2WU3A 3C45A 3TE6A 4H60A 4EA9A 4MCHA 3AHGA 4J0FA 2QSUA 3ZHCA 3UWKA 4YUYA 4EUHA 3R1IA 1E0DA 2QNRA 1A7KA 2V0NA 4OJYA 4Y1RA 4B3HA 2AN5A 1Z0SA 4YUXA 1CS0A 1QE0A 1KXJA 5C5DA 2RHRA 5B55A 3R3WA 4JVSB 3AETB 4KQEA 4QGAA 1WMAA 2V4MA 3RJ9A 3HDJA 2O9JA 1WA5A 1SZPA 2K87A 4KTVE 3HYRA 2B7CA 1Y1SA 4QDTA 5AKZA 1U11A 4UXIA 4D4GA 3D4OA 4MQUA 1IUKA 4HWPA 2OVFA 4IG9A 3HG7A 1ILWA 2YWEA 4BJ6A 4X62B 1XPRA 1KOGA 4U7PB 1FTQA 3RYCA 1DJLA 4O2LA 3HN7A 5GPBA 2IU4A 4QOSA 3TD6A 2WTUA 2Y1CA 2PBFA 2WWRA 2ZJZA 3ZIAA 5B3KA 3JQ9A 3PUZA 5AW4A 2Y6VA 1PZGA 1X8KA 3HU5A 4TMFA 5COBA 1Y7IA 5D1HA 2QYSA 5E4JA 5F4BA 3NMUF 2QMOA 2OCGA 2ZE7A 3TZEA 1I36A 2Q62A 2HMAA 4IV5A 5CLLA 5DGDA 1AN0A 4MAFA 9ATCA 5K0EA 3Q3HA 1NVTA 5E38A 4BZXA 4URXR 5FI3A 1PLKA 2A1TS 4OBXA 4XM1A 4RL6A 1CZLA 1FZTA 3PPIA 2HL6A 4H4EA 3GAFA 4FR5A 3L46A 1MW8X 2HRDA 1V1RA 4JZKA 1H23A 2G0TA 4EG3A 3GT7A 3HGTA 5K0NA 4UD2A 1U98A 1G38A 4AZ3B 3SFTA 3PR1A 3O7MA 4AYTA 4MXDA 1V45E 2VP3A 3ESDA 3NV7A 3BPSA 2XNDA 1GSAA 4Q9KA 4EO4A 3DVRX 2O5VA 2Q2OA 1VKJA 4GKJB 3P9XA 1E1QD 2DRIA 4ZOBA 2G8NA 3UWDA 4R1PA 4IIJA 2PX6A 3WLNA 4WESB 4E15A 1LBIA 4MVJA 2FNAA 5CHYA 5F4ZA 1PRYA 3GFPA 4GPZA 4EB6A 5KYUB 1IWBB 1FTNA 1RR6A 1SKQA 4HP8A 5F1PA 1EDZA 1UMCB 3G0OA 1P8AA 3MINA 2J3DA 1TIPA 4TV9A 2VZ0A 1A2BA 1DG9A 4FMCF 1J2JA 1DIGA 1O97D 1R9NA 1YIAA 2GK4A 4IUBS 4X3CA 5FOWA 5BPFA 4KIGA 4DV3B 1JSCA 4MROA 4Q37A 4K6OA 1M8KA 1IJKA 2HJGA 3FB1A 4WHMA 2FWMX 3KCQA 4MB0A 2FG5A 4Z51A 2V7QD 1BGXT 4O2BB 3CNEA 3EXHC 4Y7DA 1GNTA 1H66A 1F3OA 2VA8A 1BD4A 3AQ4A 2Q0SA 4XJVA 2JIZD 4PC6A 2VDJA 1SK9A 3PEYA 1ICIA 1V9SA 1GG5A 3TL3A 3GDWA 3HK2A 4XJTA 3EGCA 3I2YX 3M9WA 2Q1YA 4DPMA 4NQZA 1WXDA 1NLUA 4RETA 3F90A 5ENVA 1V47A 4M8NE 1JHDA 3HCWA 3KKPA 3HL0A 2REXB 4L85A 2VP6A 4P8RA 4ZVRA 3TFOA 1AKMA 1ZGBA 4B6PA 1A2KC 2CD9A 1JW9B 2GR9A 4BVHA 3KELA 1ZRNA 1SXJD 1N1EA 3RVMA 1E61A 1YS6A 2FUCA 2KMLA 1WCYA 1GCAA 2FMKA 1QU3A 4YRJA 1T5LA 2H4XA 1BCRA 1ECPA 3HRKA 3K0FB 5AHWA 1QZ3A 3TIXB 3VJLA 4D0GA 3FM9A 5CEEA 5IG2A 2HPZA 2P7HA 3BJEA 1FTGA 3QKWA 3EWNA 4G1BA 4MLPA 3PUXA 1R0RE 4M2LA 4ZKEA 4EEZA 2WMYA 3EEQA 2DC1A 4IJWA 1X7YB 4RXMA 5H02A 4YP6A 3E22B 1Q74A 3DE0X 3TRIA 3EPRA 2Q3CA 4FEAA 1T91A 5H80A 1TUEA 2BBOA 4TTRA 3ZR4B 4D56A 4X8HA 5HKKD 1R6UA 3CNOA 1EXNA 1O5OA 3TH5A 4MVJG 4C7MA 1QQ6A 2FPGB 1WY5A 2R3SA 3CR3C 5L7YA 1R6TA 3B13B 3B78A 4OJMX 5AKKA 4Z8YA 3S2UA 1W49A 3UT5A 4EKGA 2ZS7A 1Q77A 4NU5A 3WX0A 1JEQA 1JI3A 4LSGA 4CEIA 5CNJA 2VDWB 1H6CA 1IB6A 5KWIA 1R37A 2XNCA 3FI9A 4ZN6A 4FFBA 3JZFA 2JBHA 1U0HC 4J4TA 3SYKA 5T4EA 4US2R 3A06A 2OV4A 2UDPA 3B85A 1CQJB 3PE4A 4RVUA 2NU9B 2DP4E 2JJ1D 5SZIA 4F9GA 5CCXA 4IKPA 3AHJA 5ITSA 1D1QA 4PX5A 3UO8B 3W1WA 3W2HA 1RYYA 1P2VA 1OXMA 2R85A 5B7NA 5KQMA 4HAUA 3PKJA 4YT4A 3UGJA 4B3TB 4PC2A 3WTCA 4YA6A 4LBVA 4BO5A 3WJ1A 2WUFA 2R44A 4YV0A 1B3BA 3G0BA 4ZALA 4CPDA 4U9IS 3R74A 3SBXA 5KNDA 2Q5IA 1ZISA 5LWQA 1EFAA 1BHSA 4TTQA 2EBWA 4II7A 4H1VA 5KU7A 3GXOA 3G5UA 2AC7A 5IM4F 1LRLA 1UBOS 3IT0A 4LYFA 4LWQA 5AW5A 2WU4A 3QI2A 5J4LA 4Q3LA 3CWZA 2E4YA 4NTZA 3GEEA 4I9FA 1RXCA 2WWXA 4N0QA 1THZA 2I87A 2IGTA 3NNSA 5LQRA 4YRFA 2BGJA 4YAGA 1ZCJA 1CBUA 3BFJA 1TPYA 4L6IA 3MQ4A 5EJ5A 4V0SA 3ZVNA 3C0KA 3BZUA 3BD6A 1NUQA 5IUKC 2JKZA 3OWHA 4RD0A 2OY0A 4OQNA 1WV0A 1A9RA 1T9GR 4DR5B 1DTSA 2TECE 1BHJA 1QGED 2XGJA 5CR9A 1CJCA 4J90A 2BTQA 3VU9B 1XZBA 3GEGA 1SQ5A 1YB7A 2BI7A 3UMFA 2WYVA 4U4AA 1A8SA 3DUFB 2NTNA 3GRUA 1R6BX 3N6RA 3T1TA 4L16A 1D6SA 3W6PA 1H2FA 3O0TA 2UYOA 5KTRA 4KUEA 2ZBRA 3ZXUB 1NQOA 1IN1A 1TMGE 4KODA 4OFXA 1DEXA 2MSLA 1D8TA 4AJLA 4BLSA 3TKAA 5JV5A 2PKCA 2Y93A 1X70A 4PONA 2XQIA 3VV3A 3G6WA 2PSHA 1A4IA 3HCRA 4PSAA 5DMXA 1W94A 3A27A 4LRXA 2ZM6B 1FJGB 4PNPA 3AM4A 1DO2A 4MKFA 1Z5GA 3K5IA 3E3AA 4NBVA 1MG5A 4RD4A 5SY6A 4AROA 4DM7A 1R5NA 2FF7A 4RKQA 4OMCA 4BEBA 1H5NA 2VT3A 1XAIA 4B6EA 3RK4A 5KOHA 3T9CA 4LECA 3H0CA 3MUNA 4D6XA 2BMAA 5DV9A 2ON6A 3OT5A 4F4FA 3WQHA 3JAKB 1MA0A 2A84A 4L78A 3RSOA 3UMJA 4DIDA 4UBNA 4OX9B 3BUSA 1U1IA 1Z15A 4P3NA 1CE8B 1Y6RA 3FDZB 4WKNA 3WRYA 5LMNB 1LVUA 2GS9A 3MELA 3ZH9B 1E3IA 3S7ZA 1KAEA 3K2QA 3KWFA 3Q9NA 1QPZA 1V7CA 3ELDA 1L4LA 2BFPA 1VDMA 3LYAA 1A82A 3T6KA 3N70A 4J03A 1T5HX 3VHXB 1O94A 1K68A 3GUVA 1VRCA 4OAOA 4E2FA 2H2HA 5KC8A 4P31A 4IDHA 1QYDA 1QOPB 3LDFA 3LRTA 3NT2A 3PEEA 2JFPA 4ENQA 2AE1A 2Q5EA 2X8LA 2QN2A 1BCSB 3K0BA 2Q4DA 1TU0A 1MVLA 1RRPA 4BO1A 1EFVA 1WXIA 3WZLA 2HYDA 3G2QA 4DR7B 3GCWA 3KKLA 5ALWA 4DR1B 2VPYA 2FQYA 2FSIA 4WOBA 2ADFA 2JFWA 2I1WA 3OP1A 4LKOA 5FULA 2BIFA 3IBGA 3FTQA 2NVBA 3Q7IA 1PZXA 4A03A 5LNK1 2A9VA 3IOEA 5DASA 1Z13A 2CGEA 1EWTA 2Q6IA 1N2GA 1UKEA 1VL8A 4RQTA 4ZAGA 1KMIY 3CLSD 1E69A 1M2VA 4QWWA 1EIZA 1I33A 2DHDA 2RC6A 3ICPA 4HY3A 5IC5A 4GHWA 3RUCA 3N2NA 4NX2A 1LKZA 4EHKA 1CUHA 4RTOA 1YJ5A 2VSFA 2XWSA 3D3WA 1BH6A 1CP3A 1JMYA 1TM5E 2HXGA 1QVAA 4D9BA 4JUDX 1P75A 1Y4UA 5DU2A 1YKGA 3VNAA 2HTEA 2Q4OA 3E8SA 3ABRB 1YSCA 2BSXA 1BRMA 3ETLA 3MQ2A 1LZLA 4IYRA 2JCXA 3SXPA 3QXJA 3LK7A 1M7BA 1J20A 2GAAA 2ZS8A 3KVYA 1ZW1A 5LN1A 1JTVA 2UVPA 2GRUA 3U39A 1Z36A 1T25A 1H69A 2W6PA 2H2GA 1NQTA 3A32A 3MS2A 4I9UA 4RWEA 3KKQA 3ZNNA 1CX9B 2IDMA 1QKIA 1FNSA 1NNSA 2X2FA 4WOPA 4CU5A 5JT1A 1FL9A 4CQMA 4XSGA 1G8YA 1YS7A 2BHNA 3HWSA 5TJ9A 1NZDA 3QX3A 3SJUA 3UJ9A 4DLTA 5HQ3A 4REQA 1ZI8A 2BFEB 2W7TA 4MRSA 4EHNA 2ZWIA 3R6TA 3UXEA 3IT2A 4QPPA 1R0KA 2O3UA 3QVGA 5J2TF 4CKBB 3Q3IA 3CZRA 1E1CA 3GDHA 4HH4A 2VNSA 1RQXA 4KI0A 4PGAA 3VDRA 5DHPA 5A4AA 3U4QB 3KQUA 3JQDA 4RMNA 2AD1A 3T7EA 4S0XA 1BMFD 3FJ1A 4RH0A 4TYNA 3H5AA 5ES3A 3KSZO 4RX1A 3USCS 4DREA 1GNVA 1QG4A 2AMVA 2VCYA 2VNKA 2Y9PB 3OICA 4Y1EA 3L1HA 4MP8A 1QP4A 4CEHA 3UMRA 4ZV7A 2GPYA 1WU8A 2IVFA 1PGNA 2O7RA 4CM9D 3VKWA 1W36B 4KQFA 3FZYA 2REQB 4A23A 1GGHA 2Q3HA 5C81A 2VSXA 3R6DA 1XZGA 3EG9B 1WB6A 1XN1A 3I64A 3JX9A 3KLOA 4FFOA 4NCHA 3WWPA 2XXAA 1EWRA 1ZBDA 2IOYA 5C7OO 3F9IA 1QGYA 1UC9A 4CCWA 1TMKA 1UF9A 3EIQA 4MMXB 1ZD4A 2G80A 3RSZA 3AVWA 5J63A 3VTAA 2JJQA 4WZAE 1QHNA 3I3SR 3D2LA 3VH2A 2IX9A 2OMKA 1L3CA 1R64A 5HE8A 2CXXA 4E1BA 4F8JA 1B4DA 4FT4A 1XSEA 4H0CA 4CM5A 4ZKDA 3T5PA 1L1FA 1R9MA 2EGHA 3DBHB 2P90A 4WECA 2W00A 5GM2A 1DIRA 1YZLA 2ST1A 1VRWA 3DR3A 1N6HA 4ROTA 1EFUA 1HLGA 3GDFA 3ORSA 5EHQA 2ZYIA 1E8MA 1KK0A 4H0NA 4LQ4A 1E2JA 4JNCA 2D5LA 3A1FA 4CG3A 1T3LA 2IIPA 5JPDA 1QIIA 1MFZA 2O3SA 1ZESA 2B1JA 1Q5PA 2BEUB 1O96A 4QWMA 5CA1F 2D3TA 1WQ1R 1EP2B 3IEXA 3OLCX 2DWUA 3ASYA 2X4IA 4IKOA 4FGSA 4L6CA 3GMTA 5DLPA 1W19A 2YWDA 2ZSDA 4M60A 3FWNA 4R16A 2QMZA 1LSSA 4JMLA 1KY4A 1IUOA 4UCFA 1PJTA 1DG1G 3H99A 5HJ7A 2FAXA 5F2KA 1KHTA 3A9UA 3WIBA 2FDRA 1AE1A 1A9XA 4PLPA 1QRUA 2ZI6A 4YCSA 1KDPA 4CODB 2QQFA 3RAJA 4BGVA 1A8PA 2OB1A 2FPWA 1OFIA 4EJFA 1SOUA 3MNFA 1U8AA 2ZI9A 2YFQA 2YXDA 2PSEA 1S1MA 3TMAA 4G5FA 3FFAA 2WWIA 1GZ6A 1TM7E 3F67A 4DPLA 1QFZA 1PT6A 3RQSA 2H1VA 1EDEA 2FP4B 2H48A 1UPBA 1CXZA 1PDOA 1KFJB 1YR7A 1ADBA 2FFRA 2RHOA 4WZ6A 1E1KA 2BKAA 1OYVA 4OD0A 2ALJA 1KE2A 1M0SA 2VUTA 3M1AA 5CU7A 4ZJPA 3WA7A 1F38A 2BBWA 1E32A 1PFWA 1J5PA 1NE7A 3M5WA 4K3UA 4P81A 2ZIXA 1I51A 4DR2B 3EISA 3EX7C 1ZVVA 2UYCA 4QUAA 4P38A 1RYHA 1TVKB 4DJFC 4YAKA 2KQUA 5LIRA 3NR2A 3TQTA 1Y1LA 3L0CA 4CT5A 1XKXA 3GJSA 1XTBA 1UBJS 1S2MA 3QIAA 5IAAA 5C53B 4CIBA 1UXIA 4FPXA 1OBHA 3ZWKA 2RHCA 3M2TA 3ELBA 2JDIA 1JHRA 1JSLA 1Y80A 5F52A 4DIEA 4EPWA 4U6NA 1KR2A 2NQ2C 4O2BF 1EK5A 2VDUE 1DWUA 3LBAA 4QTZA 4UUPA 2IBTA 4B3MB 4XR4A 4NOMA 1XTRA 3LE8A 3KO8A 4BATA 1K6XA 3SQNA 4BUCA 1TM1E 4MO2A 1E6KA 4Q4CA 3KXIA 2PZFA 1VIMA 4B76A 4UATA 4QDKA 5TMDA 2C9BA 5K5EA 4TLEA 3QBTA 2CXHA 1FU8A 3D0OA 5A71A 3TDNA 5BT8A 2NZYA 5CLQA 2RHBA 2PKQO 3IQZA 2WWHA 4DA7A 4KJXA 3OCJA 4HGNA 2PL5A 1KI3A 1NT2A 2P41A 4C1BA 5T7BA 3F9RA 3F3MA 3EGOA 1GOTA 1TF5A 4HZGA 2YWJA 5EJEA 3TAUA 4URWR 1UANA 5AVXA 2MTBA 2V03A 5GINE 1NBIA 2AG8A 3MWFA 4ZAZA 4CM6A 3EPJA 3L4JA 1RWWA 4ZOQI 5M29A 3AWDA 2E48A 3OIWA 1W4RA 4B1FA 621PA 4RANA 5JS8A 3VSCA 4U5XA 2GVZC 3TQIA 4DN6A 2EG9A 4N5DA 5EPEA 1BDHA 3ASVA 2PGDA 1C41A 1O08A 3E03A 1P5HA 3H2GA 2FMHA 2X8AA 4HQFA 4HNAB 2FMXA 1HDOA 1X2BA 1K7EB 3NHMA 4FONA 2D7DA 2PAAA 3UA3A 1E98A 3PC6A 1U8XX 3KB6A 4BXOB 5AKLA 4R1NA 2O8CA 1CNEA 1NF2A 3JYNA 2DSTA 1VLMA 4NFLA 2BR4A 4NS4A 2PSDA 2D0IA 1RZUA 3H84A 1D2NA 2P2LA 3LXRA 3QTBA 4WSOA 5KVQA 3KOWA 3VR4A 3BSSA 4URFA 3RSGA 3FOWA 4UVIA 4Q1CA 2J9ZB 1YIOA 1R4AA 4CCAA 4WY5A 5AVOA 3U37A 4BBJA 2W5UA 3BH7A 5BSFA 1J5EB 4LGVA 4Y1RB 2J3HA 5FDFA 2O5CA 1NUPA 1NP3A 4OP1A 5EP4A 1CS0B 1CSEE 2ZE5A 3D8UA 3KJQA 4WK2B 5CT8A 4Q02A 3V97A 2G09A 4Z3DA 2D2EA 1NVEA 2WV9A 2ZCVA 2FUEA 4X1IA 3SXUA 3DYIA 2F4NA 4ZU1X 3WV5A 3ADPA 4OOEA 4Q24A 4ZCRA 3U9SA 5ARDA 5BSHA 1BE0A 1K5HA 5T8KC 3TAHA 3NVAA 2I0FA 3BXHA 8AT1A 1MJFA 4L3OA 2SHKA 2ZSEA 3LNCA 3C2QA 3MXTA 1RLTA 4KYVA 3UJAA 4HTFA 4IBOA 1IRIA 3ZV4A 3OVMA 3RYCB 1QVWA 2ZW9A 1XBTA 4X97A 2FFQA 2OMEA 2DHCA 3PYXA 3QFHA 1FFYA 2CBZA 4UKDA 3E1SA 4JNKA 1D1PA 1YZVA 2A5FA 4A8HA 4UAUA 3ESAA 1IZ7A 1S2DA 1MC4A 2R87A 4MUJA 2JIMA 1H8HA 2VJCA 1CRZA 1VTKA 2COUA 2EW8A 5KSYA 5E1MA 8OHMA 1L4GA 2ATIA 1KBOA 2QRHA 2XVMA 3AZQA 4Q66C 3N2IA 3CH7A 4RSMA 2MU1A 4M8IA 3RHSA 1DC4A 2P3OA 4ZIRB 3ZI7A 1D09A 1ONSA 1V1RB 3STWA 1A9OA 1XHFA 2BKVA 1X9HA 2C82A 2IT1A 2R60A 1U8TA 4IWNA 2H9AA 1QCCA 2YXEA 2JATA 4ENSA 5J2UA 1KIMA 3DHNA 1SKYE 4BLPA 1HV8A 1QNFA 3EIWA 5KC9A 3BHNA 5LL6P 3M4XA 1DKMA 2HIMA 2CYBA 3SWWA 3LW8A 4LXIA 4PAOA 2ZB2A 1JS1X 4EB6B 4XVUA 3F6RA 4RCYA 1J1IA 4BUZA 1J6UA 4HB3A 3ZH2A 1DGQA 2H3EA 3WOVA 1AZWA 3MINB 1K4YA 3QFSA 5BR4A 3FZEA 5I9BA 3CX4A 3JQFA 1S2LA 5AOBA 3LP5A 2VSNA 3FHLA 2BR3A 3ZWVA 4BX3A 1XEXA 3PZBA 3DA8A 5CM9C 4G1CA 3FF4A 3ENKA 4YJFB 2VZ9A 2X0KA 3HM2A 5LCXA 2E89A 3AKZA 3P0EA 4S1TA 4MB2A 4UHHA 3RUDA 2FSVC 4BU0A 1EB9A 4E7OA 1SUAA 5B6JA 4N7RA 4HZUB 1M0WA 5CB8A 3ZGLA 5DHAA 1PJCA 2XA2A 3I5AA 1IJBA 5CP8A 5EWMA 4EJ2A 1EUQA 1COWD 3H4TA 1A9ZA 3P9QA 5CW2A 4MV0A 2G70A 1DX6A 4IZIA 4ENRA 1CDEA 1J2RA 2OXFA 1MU0A 1YOVA 5CT4A 1TC2A 1WULS 2OILA 1V6CA 3L40A 4QQ8A 5LZ4A 2AIRA 4ZAFA 2PCLA 4U2KA 3SNKA 1TKCA 5D3QA 4WAUA 5JD4A 3DTVD 2V9CA 1L5SA 1P73A 2ZIGA 4RPLA 4X8OA 5DXFA 3WYGA 1A9TA 1XMVA 2J30A 1VA4A 2JHFA 3DOJA 4FCWA 4KQKA 4MK4A 5BQ3A 1BCRB 1XZKA 1QTQA 4GQBA 2PGNA 2EKQA 1Y89A 3GP5A 5DTMA 4LDZA 1YVRA 4C30A 3SYMA 1JQKA 1NQWA 4PYIA 1G19A 3OKFA 1BX1A 4LYEA 4E1VA 2BGGA 3PQ5A 4BAUA 3KSRA 2QROA 2OUKA 4A2QA 3AVYA 2IEIA 3DYVA 4HEJA 3JQBA 3KIPA 3GRAA 1EGMB 4CWAA 3BDVA 4DRZA 1TJYA 4QUJA 5FO1A 4JP2A 3MTQA 5CLFA 1YRAA 2UYQA 4GC5A 4N3GA 4ZMRA 5BUQA 1UK7A 1RXWA 5IHPA 1ZM9A 2DTEA 1DARA 1KFCB 3T9BA 3CIOA 2VQDA 1A50B 4XTRA 1JXOA 3I04A 3TZHA 2ZIFA 1J9EA 1QFXA 2ZITA 5DTRA 4M46A 4YJHA 4F9EA 4EL5A 4X0EA 2YQ5A 1LRJA 1LW7A 1JEQB 3GJ0A 3PLNA 1X1SA 5AKHA 2E9SA 4ZVQA 1KY3A 4CEIB 4O3MA 4QEDA 1UJ5A 3P2MA 5K0CA 5ILOA 4M9XA 1JB1A 4GM0A 3AINA 2M32A 4HYYA 1FSFA 2RCYA 4GXNA 3UMGA 2B4KA 3IOCA 4GFDA 4JMPA 1FDWA 2V6MA 2IWHA 2VF7A 3QM1A 5JXWA 2A0KA 2F1KA 5K20A 1FMLA 4NBRA 4BP1A 2A6PA 2BF7A 2JLBA 3AFOA 3ANXA 4C3OB 2FQ1A 2V4ZA 4P86A 5JVDA 2D2VA 3LOQA 5BNZA 2Q3MA 3LHSA 4LTNA 3QSGA 3CY6A 2XUOA 4O6VA 1JG7A 5KMGA 4QBFA 3AKEA 1SFRA 2J3IA 1YMUA 4X92A 1FP6A 3ZUGA 4KP7A 3TTSA 5L51A 1C9EA 5EEHA 4DCVA 2WD9A 2ZGVA 4R2XA 4K28A 4FQ7A 4BHTA 2J3EA 3PQ8A 3TNJA 4DIFA 4BGIA 4GLFA 1YVDA 1I1HA 2E4UA 1NUAA 4KNVA 2Y27A 4FGJA 1Z5UA 3NHAA 4FXPA 5ILQA 1L5NA 4W6QA 1KP9A 2JFNA 2PG3A 3ICOA 3TLMA 4J2TA 1XYGA 3IP9A 2OXRA 1M34E 1RRCA 3WQBA 3W7AA 3ZI0A 4YR9A 3C8UA 2ZIEA 4F38A 2XCRB 1N3BA 5F2OA 1QCYA 4EZEA 4JB2A 4ZYYA 2VNHA 4N0EA 1XD2A 1OAKA 2ZJ6A 3NUZA 5B7QA 1K7SN 1NYTA 2AB0A 1U0RA 4JLAA 4YALA 4QNMA 1I5RA 1WSWA 4NZOA 4F45A 4IRMA 1VG0B 4MSUA 4E5VA 2Y1DA 1H1DA 3B52X 2VHQA 1JU4A 3CSUA 4RE6A 3RHTA 1H2ZA 4XA8A 5FX2A 1XRQA 4L57A 3CB4A 4DG9A 2VFAA 1DVRA 1LA2A 3SHFA 3EXIA 1VCMA 2ES4A 2VJQA 3AGQA 1PT8A 4KMRA 5T41A 4BV3A 2FEMA 2G1JA 4KGDA 2HPVA 2FN4A 2JLRA 4TRRA 2GRAA 2QM8A 1E62A 2Q3EA 3RABA 2JZOA 3QEMA 1DRWA 2IYRA 4TLDA 1JHPA 1U2PA 1K3TA 2FQQA 2XNSA 1E3MA 3B3JA 3M5CA 1Y5MA 2BMVA 1BDJA 4LXXA 2XF8A 2ZJ7A 4PTZA 4Q7EA 1UP6A 3M82A 2JAHA 4S2UA 2AXPA 2QT1A 2XPCA 5K4HA 1WNTA 3O38A 4Q9AA 5B5SA 1SXHA 1Z7BA 3SHWA 4YCLA 5EKDA 2W22A 2CMFA 4ONEA 1Y3DE 2GK7A 2XADA 1JHYA 2ZTUA 3DSRA 4C06A 4D97A 3GJQA 4Z9XA 3L0BA 4I1SA 2QLNA 1L5RA 5BP7A 1J8YF 4X44A 2DUJA 1MO6A 1Y7PA 2PRJA 4W8GA 3ZW8A 5KJCA 4KFCA 3R3UA 2BUAA 2NX2A 4YJGA 5EGNA 1TMOA 4J91A 2R0QC 3NHWA 2DF8A 4E4TA 4ZI3A 3JD3A 4UAVA 1KEEA 1EQAA 3EPHA 2ZTHA 1K92A 2NAPA 2JLQA 2CVOA 2WA2A 5K51A 4L5JA 3VZCA 1LSOA 4N5HX 2W2KA 3FVWA 2H0RA 3UG7A 5HUHA 3AVTA 1ACLA 2Q1XA 4N0MA 1W87A 4D5GA 4QG3A 5K0GA 3QLJA 1EFVB 3NBZC 3L49A 4CIXA 4NCBA 3WL4A 4YRMA 4CMHA 1FP4A 1D1TA 1DEKA 4JBLA 3EVGA 2QLJA 1ZJ5A 3EVBA 4EY5A 3GFRA 3KQPA 1M8FA 2JI9A 3IAS1 1ESCA 3PRJA 4G5RA 3RJTA 3NJRA 1Q50A 3MFQA 4GYYA 3IDZA 4FC7A 4M9SA 4RLHA 4MW9A 4ZHQA 2DLDA 2WJGA 2ZLBA 4J7CA 1Q1BA 1GPKA 1M2VB 1OY1A 2PSFA 4OHFA 3KZOA 1P4GA 3WKDA 8MHTA 2VBCA 1KOFA 1SUIA 3G2IA 3ER9A 4LYYA 1WW2A 3QU5A 4G3XA 1USKA 2C3OA 2H00A 4WNCA 2QE7D 1V71A 3HXPA 3TF5A 1J42A 3HY3A 3V4OA 3YASA 1NPYA 2IHYA 3SDSA 3CRMA 2P5SA 3ETHA 4WXPA 5AHXA 3K96A 4M7WA 4FYHA 1GA6A 1I24A 3VYRB 1ZSVA 2JCBA 3EMKA 2DFTA 2ZYAA 2UVPB 1DOZA 4IFBA 1P7YA 3MK31 2FMTA 1UBHS 1U04A 4MUMA 4EB3A 1I80A 5DNEA 3CF4A 1E7RA 2YNMC 4YRIA 1FP2A 2A33A 3H2YA 5BQFA 1R8YA 4WD3A 2PX0A 3H8SA 1INLA 4C4PA 3ZTYA 5E6SB 4CQMB 3TIFA 2XZLA 2JCYA 1BEZA 2P30A 4MEBA 4ZVLA 3HBJA 4REQB 3TJRA 2V96A 1PYGA 1T5DX 2P68A 4H7IA 1UFRA 1VI2A 3DMTC 4HHEA 1YE5A 2GBCA 3R23A 2WM9B 4E30A 3QVGB 5KPDA 5AKIA 1BJRE 1TLFA 3P27A 3UUFA 1CERA 2RKBA 2EJVA 4HEA1 1NXQA 3STUA 2OCKA 2XGOA 4M1WA 4B5LA 4KWTA 5K3AA 4NOLA 1ODFA 1B6TA 3IX7A 5FBRB 3T7RA 5IF3A 3RUPA 5GTDA 1Z6PA 1VJ0A 4Q05A 3SG0A 2OT3B 5CD1A 3N2EA 4FT2A 5ALOA 2H5IA 2RAFA 2ZREA 2XWQA 2I3GA 3JQCA 5B53A 3V2GA 3EIHA 5CDHA 3OLQA 1B7GO 3ELYA 2D06A 5IJXA 4CEHB 2JLCA 2GPSA 2QVBA 1Q1ZA 4E22A 4I3FA 5CYFA 3B6IA 4LMBA 4BO3A 4CG0A 5LP6C 1B42A 4XGQA 5FV4A 3PVSA 1AK9A 4LDAA 1SVSA 3QWAA 1HNXB