1XCLA

Guanidinoacetate methyltransferase containing s-adenosylhomocysteine and guanidine
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
PLFAPGEDCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of guanidinoacetate methyltransferase: crystal structures of guanidinoacetate methyltransferase ternary complexes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Guanidinoacetate N-methyltransferase
total genus 73
structure length 229
sequence length 229
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2004-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1xclA00
4MQ4A 3UJCA 1NW3A 2V7EA 1VBFA 3NVKI 1XCLA 4ZTBA 3HA7A 1R8XA 2XBMA 2IH4A 1R74A 3K6RA 4PCAA 10MHA 2FYTA 1EAMA 4KIGA 3DMGA 2IBSA 1Z3CA 3RIEA 2FK7A 2I62A 2PJDA 4XUDA 1KXZA 5K0NA 4PYKA 2OB2A 5EKUA 2YQZA 3DTNA 3G7UA 3HA3A 5CD1A 4GEKA 3HTXA 1WXXA 1ZHFA 2A14A 2OPBA 4ER5A 1JR4A 3FPJA 3LDUA 4V0QA 4P58A 2GH1A 4EKGA 2AZTA 3KU1A 3LCCA 2IH5A 5U4XA 2ZWVA 3BUSA 3KPJA 5DX1A 5E1DA 5C9ZA 1F3LA 3HCCA 2JHPA 5E2AA 3NWEA 5D1HA 2H11A 3LSTA 3LKDA 3P8ZA 3QV2A 3MCZA 4KIFA 3C6MA 5DTRA 1N2XA 4CKEA 1YUBA 4X41A 2JH8A 5DT2A 2AOVA 5C1IA 5DTMA 3PS9A 1FP2A 5EQJB 1R8YA 5HFJA 5FUBA 3UWPA 4CKBA 5E1OA 3DMHA 3AY0A 3OZRA 5CVUA 3G88A 4PYLA 5EHIA 5DWQA 3FTEA 4XUCA 3FTDA 5C0OE 3JWJA 1YF3A 2B3TA 3ELWA 3GXOA 5LR6A 4FS8A 3SR4A 1DUSA 2PWYA 5E1MA 1IY9A 2BZGA 3EVFA 1QAQA 3KQVA 4WXHA 3G5TA 1QZZA 3OFKA 1TPYA 2LD4A 3F4KA 3I58A 3NDIA 1U2ZA 3A25A 3NTVA 4HH4A 3BWBA 3HEMA 3SSMA 4RTOA 5DPMA 2UYCA 3LX6A 2YVLA 1NV8A 4XCXA 1X1BA 3FRIA 5MHTA 1R6AA 3HNRA 2XYRA 5FA8A 3KPUA 1JG4A 4PCLA 2YTZA 4HTFB 4OA8A 3FPHA 4X63A 5BP7A 1M6EX 4AX8A 3C6KA 2OB1A 1VP3A 5KQSA 3EVCA 4PIMA 3GCZA 1MJFA 4FR0A 4HTFA 4FP9A 5EG5A 3PVCA 3AXTA 5CVDA 1WZNA 4BLUA 2HWKA 3ER9A 4DZRA 1EJ6A 4GF5A 3FRHA 2B78A 2H00A 1X19A 1P39A 5K0JA 3BXOA 5CM2Z 4B17A 5EIFA 4MWZA 4BLVA 1NKVA 4DMGA 4RYLA 3LBYA 5E9JA 3BKWA 3O4FA 4PINA 4F85A 5LQAA 5EC8A 2ZZNA 2EJUA 3AWIA 1VE3A 1X1DA 1XDZA 2Z6QA 1BKYA 5EZQA 1SVUA 3E7PA 4UOEA 2P41A 2Z6UA 2OO3A 4HG2A 1WG8A 3P2IA 2P35A 3KQSA 3WSTA 5CCXA 3MGGA 5HOQA 4RTSA 3E05A 5CVJA 5DRTA 2OY0A 1SQGA 2PV0A 4DQ0A 3G5LA 2WA2A 3CGGA 2ZCJA 3SMQA 2EG5A 2YXEA 1NW8A 4FSXA 3C0KA 1ZG3A 4C03A 3M6VA 3R24A 3GO4A 5ICGA 3TOSA 2I6GA 4PYMA 4A6DA 3LHDA 3FZGA 4C08A 4F86A 1ZKDA 4P7GA 1V39A 3GRYA 4KDRA 4PWYA 3RW9A 5GOZA 2CL5A 1FBNA 1NE2A 2AOTB 3EGVA 2EX4A 5LQKA 2HMYB 4RVDA 1XJ5A 1L1EA 3LPMA 2IBTA 1OR8A 2CKDA 3B3FA 1G55A 1O9HA 3KHKA 4KW7A 5K01A 1G38A 2IH2A 4YUZA 2ZZKA 5CCBA 1SKMA 4WVLA 4YMHA 2ZIGA 3T7TA 3EVAA 1NV9A 1X1AA 1YB2A 1ZGAA 3UA4A 3BZBA 2O0LA 5FTWA 4QVGA 1IM8A 4G56A 3M33A 4YV2A 5LSAA 3KQYA 4Y2HA 1XDSA 3NDJA 1KIAA 1B42A 2F8LA 2V74B 2DULA 2ZBRA 4LWPA 3HCEA 5K0LA 2FRXA 4YUVA 2FHPA 4DF3A 1RJGA 4E2YA 2NP6A 4OBWA 4HGYA 1AQIA 2O05A 4HSGA 3X0DA 1QAOA 2ZULA 4KWCA 3BT7A 2N47A 3OE4A 3DXZA 2P8JA 2BR5A 3BWYA 3I64A 2G72A 3NJRA 3TKAA 5DM1A 4AZWA 3OPNA 1XTPA 2NYUA 2ONYA 4PNEA 4ER0A 2PT9A 2PY6A 2YR0A 4R8RA 2ZTHA 4R6WA 5DRYA 5FHQA 3TM4A 3FPFA 2I7CA 1HMYA 1N7IA 2NP7A 3UJ6A 5FQOA 1NT2A 5M5BA 1YZHA 3DLCA 3R6TA 3SVZA 3ID6C 3LCVB 3PX3A 1D2GA 2HNKA 3TKYA 3A27A 3DXYA 4Z2YA 5E8JA 1EG2A 1QANA 2YX1A 3UJDA 4RSRA 5E1BA 4POOA 5E2BA 3T7RA 3I9FA 4E2ZA 1FP1D 4QVKA 2IPXA 3FUVA 3FYCA 2BM9A 2XVMA 1NBHA 2AOUB 5EIWA 1AQJA 2Y1XA 3L8DA 1KYWA 3BWMA 1KYZA 3KQQA 3C3PA 1P1BA 3LKZA 4AZVA 4YMGA 1RI1A 5EGSA 3VYWA 4E32A 2PX4A 3MERA 3R0QA 3M6WA 3A26A 1NBIA 2P1DA 4QQNA 2H1RA 4QQKA 4C06A 1XCJA 2QRVA 1I4WA 1WS6A 5GWXA 4GC5A 4AZTA 3GWZA 2ZIEA 5EMLA 5GM2A 4OBXA 4PYOA 4AUKA 3DP7A 1VL5A 4YUXA 1JQ3A 2P7IA 4CTKA 3DR5A 3KR2A 3GRUA 4IV8A 2XYQA 5CVVA 2OXTA 3IYLW 5DX0A 1F38A 3PFHA 4EKIA 3IEIA 5HZMA 2AOTA 3T0IA 1ZGJA 1YFJA 4M38A 1TW2A 5F2KA 4U7TB 1FJXA 3P9KA 2ZBQA 2OKCA 1I9GA 2AN5A 2R6ZA 3MHTA 2PXAA 3D2LA 3P71T 3M70A 4PYNA 3EVEA 5K0GA 3QOWA 1WY7A 4FT4A 5CUQA 1UIRA 3G2PA 2PX5A 2VS1A 2IGTA 4YV0A 3B3JA 4BP3A 2PX8A 3FPGA 4M7RA 4PIPA 1NW5A 2HTEA 3P97A 5EKXA 3V8VA 3EEYA 3R3HA 5FADA 2ORED 3PX2A 4EMSA 2FPOA 1PJZA 2R3SA 3DOUA 5FWDA 1X1CA 4RV9A 2FK8A 2DPMA 2P7HA 1FPQA 1RI4A 4M37A 3ME5A 4PONA 5E9QA 4OQEA 3EPPA 3GGDA 3V97A 3B7PA 2O57A 4RVGA 4RTLA 2BR4A 5F2NA 5K09A 5DXAA 5LQCA 3KPYA 2GS9A 3EVDA 4L7VA 4C05A 2BH2A 4LWOA 3B3GA 2P3OA 3OU2A 4E70A 2NXEA 5GIOE 1Y8CA 1QAMA 2HV9A 3S68A 3I53A 4MTLA 5G02A 3G2QA 2IDKA 3LECA 4GC9A 2VZ9A 4GOND 5H02A 3UBTA 5CVEA 1KPHA 3VC1A 2PVCA 5K0FA 2GAFA 2K4MA 2PX2A 5HIJA 3P9IA 5FCDA 3TFWA 3KQTA 2ERCA 1Q0TA 4GUAA 3KQOA 3TLJA 3P2KA 1SUIA 5K0EA 4R6XA 4RTPA 2I9KA 4DA4A 1RI5A 1Q0SA 2C7PA 1G8AA 3EGIA 4E30A 3P9NA 3A7EA 4HGZA 4DM3A 3OE5A 3FUWA 3TR6A 2ZVJA 1TW3A 1G6Q1 3EEOA 5GINE 3VC2A 8MHTA 2ADMA 2GA9A 1VQ1A 3ELDA 4P7FA 3PB3A 3VSEA 1JTEA 4BY9E 1SUSA 3GJYA 3E8SA 2GPYA 1JG1A 3C3YA 3LDGA 3JWIA 5KS2A 3HP7A 1JQDA 4O29A 2AN3A 2B25A 3K0BA 1BHJA 2PSSA 3BGVA 1KP9A 3UJ8A 2WK1A 3LDFA 3GIWA 5FWAA 3UJBA 5K0CA 1JG2A 2NXNA 5EMMA 3TMAA 3GDHA 3MTEA 4E31A 4K6MA 3AXSA 5DXJA 1JSXA 5T64A 2XYVA 3UFBA 3FUUA 3SM3A 4PYQA 1R00A 3ERCA 1R18A 3SSOA 3PT9A 5FA5A 1NW6A 3HVIA 3KQPA 1INLA 3G89A 1AV6A 1G8SA 2QM3A 2YUIA 2AS0A 2PXXA 5DLYA 1JSZA 2BM8A 4R05A 5EMKA 2CMGA 5HEKA 2QYOA 5BW5A 5K03A 4MHTA 4RTKA 2AR0A 1M6YA 1DCTA 3MCTA 1PRYA 1AF7A 2UYQA 3AJDA 3HCAA 1BC5A 4FT2A 5BXYA 4QTUB 5KQRA 3THSA 4AZSA 3Q87B 5HIIA 3NMUF 1P91A 3UZUA 3DXXA 4BLWA 5FHRA 1JQEA 2YXLA 2ESRA 5GP1A 4RTNA 2C7OA 3ORHA 2QY6A 3SGLA 1D2CA 2PXCA 4FSDA 4ER6A 2OYRA 4C04A 3GU3A 3U81A 3GRZA 2G70A 2IIPA 4FZVA 4GOOD 1L3BA 1KPIA 2P3LA 2FCAA 5DM4A 4OA5A 2PKWA 1YFLA 1N7JA 1VLMA 3I5UA 3CKKA 4RTMA 1VPTA 2ZLBA 3G8BA 3ELYA 4GOMD 3A4TA 1SG9A 3UJ9A 4BP1A 1JTFA 3O7WA 3EMBA 4FGZA 3EVGA 2BR3A 3IV6A 4KDCA 3GRVA 2ZFUA 3EVZA 3HCDA 3TPZA 5HILA 2JHAA 4X60A 4CKCA 1EJ0A 1I1NA 1DL5A 2IDJA 3OFJA 1O54A 5EVJA 5EZSA 4LG1A 2NXCA 4Y30A 5BW4A 5E9WA 1RI3A 4ER3A 3B89A 3IHTA 4R8SA 1KPGA 4DCMA 3MAGA 1WXWA 1EQAA 5K8VA 4RTRA 3CBGA 4GQBA 3KR1A 4PGGA 3T7SA 5KYGA 3A7DA 3JWGA 2GLUA 4YUYA 3SX0A 2ZWAA 5F2OA 4YUWA 3REOA 1L3IA 4F84A 1KR5A 2JHCA 2ZSUA 2E5WA 1IXKA 4MIKA 2G8NA 5LQJA 3SSNA 4NECA 3P2EA 2Z6AA 3DULA 4RVHA 4ER7A 5DSTA 3FTFA 3CCFA 5JR3A 9MHTA 1RJDA 3LL7A 5HIKA 3OU7A 4M36A 3DUWA 3RODA 5CIYA 3PLAE 5EOVA 4EVIA 2AVDA 4E2WA 2B9EA 3OCJA 4OX9Y 2OZVA 5EEGA 1YZ3A 3FUTA 2O07A 3UJAA 4ATNA 2AN4A 4OQDA 4V0RA 4CWAA 3LCUA 4RTJA 2HR1A 1RI2A 5ICEA 5K05A 2VP3A 2O06A 3FPEA 5B1SA 4YV1A 5JUWA 2WA1A 1ORIA 4X1OA 5D1NA 5K0BA 4RWZA 1P1CA 2AOUA 4LECA 1H1DA 3M6UA 1XDUA 4JXJA 2NNWB 5LQRA 3KQMA 3OZTA 4E33A 2C7RA 2Y1WA 5GIPE 1D2HA 5EHGA 2YXDA 3KPVA 2AOWA 3BGDA 3UJ7A 3CJTA 3HVHA 3HCBA 7MHTA 5P8WA 1M0EA 3KQWA 2UYOA 2GB4A 5DX8A 4QTTB 5LQUA 2ONZA 3DMFA 3R9XB 2CMHA 2PLWA 3JWHA 4QPNA 5E8RA 1JG3A 1O9GA 3TRKA 2XVAA 2JJQA 3Q7EA 4IWNA 2ZBPA 2IP2A 1ZQ9A 3O31A 4HRAA 4PYIA 1L9KA 3KKZA 4QDJA 2P3QA 5GM1A 4DCGA 3FYDA 4RVFA 2KW5A 3G2OA 4H0NA 2B2CA 3NW9A 1QYRA 1L3CA 4RX1A 3MTIA 5IKMA 5T6BA 1XVAA 1RJEA 4RTQA 3CC8A 3BWCA 4P7JA 3EVBA 3HVJA 4U7PB 4XUEA 2ZIFA 4A6EA 1EIZA 1NW7A 2AOXA 3E23A 4HC4A 4ISCA 4C4AA 5LQNA 5KVAA 3G8AA 4QDKA 2G71A 2UZ4A 4DKJA 2VDWA 4IV0A 3LBFA 2VDUE 3KR0A 2OBFA 5DSXA 3M4XA 2C7QA 1HNNA 1KHHA 1UFKA 4E2XA 4PYJA 3HM2A 5EPEA 4GBED 3MQ2A 3HCFA 3ER8A 5DM2A 5FQNA 5DM0A 5FULA 5IH3A 2QRVB 1T43A 2AVNA 3BKXA 4GOLD 2Q41A 3OZSA 3SXJA 4C07A 3H2BA 2QE6A 5T67A 2P40A 3B5IA 3KR9A 4EK9A 4CXMA 5ICCA 3THRA 5EMJA 3EMDA 3G2MA 3LGAA 5HIMA 3NWBA 3M6XA 3PTAA 1BOOA 3OU6A 5ICFA 1XXLA 3HVKA 1VIDA 3NVMB 2ZW9A 4P7KA 3ELUA 3CVOA 1G60A 4KRGA 2PGXA 2JH9A 5EEHA 3FTCA 3HA5A 2PWPA 1UWVA 2EJTA 2VDVE 3GNLA 3GRRA 1MHTA 3MB5A 3QOXA 4EQZA 4QPPA 2ZZMA 3KPWA 2UYHA 4IKPA 2CWWA 4X61A 1ORHA 2NXJA 3DLIA 3FUXA 3ANXA 1VP9A 2EFJA 3UA3A 3EGEA 3P9CA 5DTQA 2JG3A 1RJFA 2IFTA 4PGHA 5ERGB 3CJQA 2PT6A 3CJRA 3DH0A 4CTJA 1SQFA 3BGIA 3TQSA 2PBFA 2G1PA 3PFGA 3TM5A 4KVZA
chains in the Genus database with same CATH superfamily
1HE8B 4XD7A 1XDDA 4AQYB 3G1TA 1C2YA 1WLSA 2P90A 3AHIA 1R8XA 1BMTA 4DIMA 3OHMA 1AUPA 1J2YA 1G6OA 1UDRA 2ODBA 2Q3EA 4INZA 4KIGA 2IW3A 3LZ6A 3OOSA 2B7BA 3E22B 4TMVA 4AP5A 5EHNA 1UKVY 5EKUA 3UG6A 4S2EA 1BXGB 1LVUA 3SD7A 2UVDA 2GNPA 1XMJA 3AO0B 3UPTA 1KETA 1Q7BA 3O47A 2GN6A 1UC5B 4P58A 2GH1A 4UHBA 5IJ9B 2QK4A 1TC1A 3FNQA 4QUKA 1TJ4A 1SOUA 4RHEA 2D06A 3ZBUA 1SUAA 3L4BC 3U4GA 2NAPA 2QTVB 4RLQA 3LT0A 1JXMA 3T9FA 3VU0A 4GM0A 5LOVA 5H1YA 1E2PA 4DR7B 1VSUA 2WSSA 2WWGA 3D31A 4IOKA 1PG2A 3VX4A 3WGNA 4I1OA 4AWXA 2JFBA 1HDZA 1GAJA 1T26A 4PZUA 1D5CA 2YJGA 4YAJA 1GSIA 4XR4A 3AI3A 2IUTA 3OESA 3UYKA 3STXA 3V7UA 3TRJA 4BUCA 4KPUA 1M1XB 3EIFA 2OFWA 4WA7A 4ZCQA 4E09A 5J2TB 3A1TA 4CGYA 1X8JA 4OSEA 4BV3A 1QNFA 2C8KA 1DBWA 3U7QB 3LUBA 4BB9A 3DBRB 4OJQA 2I2AA 3JWJA 1ZJ6A 3CZAA 1YU6A 2CFCA 4FS8A 4I50A 1DUSA 1JIXA 2ZSDA 3ICOA 2QPTA 4MV5A 1U3WA 1QAQA 5B7NA 4KNVA 3U0BA 2PCJA 3OHSX 4J2TA 4MYHA 1RZRD 1SWWA 2ZYIA 1SAYA 3U61B 4N6OA 5J2TF 3HJGA 2BJVA 1NUSA 3N2YA 3OPVA 5CT9A 1RPJA 4AB1A 3LX6A 3SYLA 2HI0A 1CJCA 3GEDA 4CM9D 4U2EA 3ZX4A 4IGKA 4KGDA 4YO7A 721PA 1XZEA 5KYNA 4DA9A 2X0EA 5ALTA 1ZM2A 3IR7A 4WOPA 3MWDA 4CIXA 4Q4AB 4IKOA 3OPYB 4BOYA 4ETIA 3C8MA 1IUNA 1AB5A 1ZYUA 4KQGA 1NVXQ 2Q6IA 3CF4G 1KDYA 4B8YA 1WZNA 4JXZA 4L9SA 1L1FA 2XXAB 1HX7A 2Y77A 2NGRA 3DMRA 5IEBA 1TO1E 1VB5A 1P39A 4HAWA 4CLRA 2VJAA 1B1CA 1K4KA 4B45A 4XI9A 3PSHA 4ZC1A 2YMQA 2Z4RA 3J81A 3KEFA 4XQ9A 3W8EA 2HRDA 3AHGA 4C88A 4JLWA 2WTMA 2Z6QA 1ECCA 3GUYA 4HDKA 1IEQA 4HQKA 4II3A 2CDAA 1TU0A 1V5EA 4HQOA 2I7TA 2NUTA 2IHNA 2XB9A 5HOEA 1K7XB 1FU4A 1PJLA 3U3MA 3M4JA 1EZ4A 4OQXA 5ELLA 1XL1A 2AK3A 1NVVQ 2QLTA 3P2YA 4FFMA 4RPLA 1IULA 4FJ2A 4JKIA 4CG3A 3T1QA 2PUTA 3G59A 1PNQA 2PUDA 2AE1A 3AF6A 1P7PA 4GKKB 2PMBA 1Y81A 2DAPA 2X0IA 4PYMA 1LJ8A 2HHCA 1PWYE 1M1NA 4D3DA 1K3UB 2HL6A 1Y9JA 3ORRA 4G0YA 2PUAA 1YRYE 1QO9A 3B8EA 4JKYA 1NR1A 3AF3A 3QG5A 2FMIA 1IBMB 3BH7A 3GRCA 2GJKA 3RRYA 5IJ0B 4V0NA 4PN7A 4G5XA 1DU4A 2NZXA 2W8BA 1G55A 4PPGA 1I13A 5EMHA 5KVCA 2JD1A 1B41A 3R9WA 1G1MA 1NUUA 2PX0A 3R2JA 4I4CA 4BMCA 4EPXA 1L4GA 4ZU6X 2AQ8A 2H2GA 4M7OA 2ZSJA 1DIRA 1G64A 1U0LA 2NV0A 3UA4A 2QGFA 4NU6A 5DU2A 1GEEA 4Q47A 4V0OA 3FOZA 1ZNQO 4H35A 3WK6A 1HTBA 3ILXA 1KEUA 4PG7A 1QQ5A 3L02A 1RMQA 4ND6A 2AWNA 4ZQEA 4BO4A 5KNBD 4MS4B 5K0LA 1CS4C 2A5GA 2XTAA 3TVDA 1ESZA 4F3NA 4JVMA 5KDDA 4N54A 3EFOA 3WKEA 4W9NC 8AT1A 2NP6A 4Z53A 3WBJA 3WQQA 4KWCA 5F1YA 2V5UA 3SX2A 1DEXA 3I64A 1E1RA 1R6BX 2G72A 1EXMA 4QOEA 4HLUC 4TKUA 4ZXFA 3TKAA 1GPYA 3N7TA 4OMCA 4Y1RB 3AW8A 3PNYA 4F2PA 1A8UA 2Z5FA 3F1KA 3KJZA 4M76B 1MZVA 2HQRA 2B92A 2OFFA 2I65A 1ECGA 1PLJA 3HR4A 1Z0JA 1SVWA 1VHQA 3F5DA 2BFFB 3R6TA 2IPMA 4HO1X 4TL9A 3EYAA 4DMMA 2OORC 3DC2A 3F46A 3WRYA 4N3NA 1SZCA 4DVGA 1EG2A 5E9AA 4POOA 3AOEA 4AS3A 4CI9A 4U63A 4PQYA 2IT1A 1S2IA 2X7HA 4WLVA 2AYZA 4F3KA 5LUAA 4LJYA 4J3FA 1GLGA 1KYWA 3HN2A 2J0SA 4P32A 1AHHA 2GVZC 2ZIVB 1EDOA 4CFSA 1ZI9A 3LZCA 1RI1A 4A0HA 3OZCA 3M6WA 4IGAA 2BELA 3B1ZA 1LH0A 2V4MA 1R5BA 2V98A 2G06A 2A1UA 2HTFA 3PI6A 3BIJA 4HZUB 1ODCA 2C4KA 4DANA 1NY6A 4GP7A 3EPHA 2LCQA 1MTOA 1SXJC 3I9MA 1JIKA 4P4LA 3B1XA 4KUEA 4B3BA 2OXFA 1VLHA 3FWKA 1G3MA 4K6CA 4LOIA 1YIOA 1Z0IA 1F38A 1XXHB 3IYLW 4OREX 1NXTA 4EHNA 1PJCA 3BD7A 3OQBA 2QDXA 3FPAA 5BVGB 3OPMA 3LP5A 3DNPA 2DXIA 2VF5X 2FSGA 1DAKA 3DE2X 4OFXA 4BNFA 5LYJB 1OLSB 3HGTA 3SHFA 1TVKA 1YRBA 2R2GA 4JR0A 2GPAA 4D9FA 1KTVA 2X5OA 3IQEA 4HGRA 3V1YA 4LXYA 2P2NA 2PYZA 3B9PA 4KJXA 2CNWA 2A5LA 3TTVA 2C0CA 3FPGA 5TR9A 5AVVA 1PUIA 1WCWA 4B2IA 4DLTA 4RKFA 4Q4JB 4CLEA 3H0KA 2BFCA 3STUA 4I1PA 3WK8A 1RZVA 4DV7B 5HBGA 1KGSA 3FNBA 1I2DA 4JQYA 1E1RD 4M1KA 4RW0A 3VPSA 3FOFC 4UARA 3OFND 2YHUA 2IITA 3HGQA 5BSEA 4RVGA 3UUFA 4W1QA 4QICA 2NSHA 1KVRA 2TMGA 4E5VA 4TN1A 5FLKA 7MDHA 3S0JA 4NAVA 3F8WA 3FIJA 3Q85A 4R7TA 3OCZA 2A9JA 5ALMA 3ROTA 1RAEA 1PZMA 3EC1A 2YJZA 4JI7B 4E70A 1ICIA 4REQA 3R0JA 4PO9A 1KSHA 1X3LA 3JQAD 3QUCA 3ENVA 4N9WA 4P4UA 4Z9FA 5BVHA 4WESA 1L1RA 4UUBA 3NGXA 5J2UB 2WKWA 3OZ7A 3L49A 4DWWA 4GOND 3UF0A 4Q3LA 1L5HB 3GQBA 1RKVA 1AQ6A 4IMPA 1X74A 1M1NB 2H7VA 4PO3X 5HIJA 3OZGA 2BIFA 4ARZA 1H8EA 5AM4A 3SLRA 2W8ZA 1GXSA 4LNAA 1KY2A 2X8JB 2IQ5A 2FFRA 1ATIA 4A6XA 1Z26A 4JC5A 3HZRA 3V55A 3UNXA 1LPOA 2BP7A 4DA4A 3INGA 1A9ZA 3IV7A 1G8AA 4AN4A 3E61A 4J9VA 3F4BA 3A4VA 2J87A 4DRYA 3OM0A 3LHSA 3BVPA 4PRLA 1Y80A 1NP6A 1Y9EA 3BM5A 3OQ6A 4Q01A 2IYSA 1GGKA 3GJYA 5IC4A 1N3YA 2OAQ1 2GPYA 1JG1A 4AP9A 5FFFA 1N6OA 1PYGA 2PQMA 3E22A 4IX9A 3M4NA 4Q9HA 4BCDA 5CB8A 3M1IA 4FNAA 4NMWA 4Q4HB 2KB0A 4BWFB 1Z25A 3I1FA 2O3JA 1HSOA 1S2GA 1J1IA 4IS2A 1FP6A 3NONA 2C99A 4HLQB 4MQEB 4N7RA 5LZ7A 4ZVPA 3RK1A 2EZ9A 2AWOA 3GEHA 5FP0A 1B8OA 2L42A 1GUBA 5IFLA 5KOHA 4S05A 1ADFA 2OBYA 2XCIA 3BIFA 3R20A 1D04A 4U2BA 3L8CA 4AMBA 1M6WA 2P79A 2CMGA 1WTAA 3VI4B 4BX2A 4RTKA 1RP1A 3ND5A 2AEJA 3KFXA 2J3HA 4C7OA 1G41A 3ZDEA 3G5UA 2IS4A 1BC5A 1EHCA 1HRDA 1X7YB 4LBZA 4PQRA 1O96B 4UTZA 1KIMA 1NDUA 3H2ZA 4HJXA 5EIAA 3ZHBA 4ENTA 2PPVA 3A28A 4HUQA 3LP6A 4NHOA 2RH5A 4RHXA 5HMMA 4EDFA 9ABPA 4CIYA 2WY2D 2NYAA 7ABPA 1M3SA 3G2NA 1KORA 4R2LA 2QVZX 1G3UA 3VDXA 2OYRA 1FF9A 2UZ0A 2HYDA 4FDLA 3UAXA 3ZLVA 4CQJA 4C76A 1KPIA 3STWA 2XWPA 2JJMA 1CD5A 2PKWA 3M9WA 4MULA 4FFVA 1SBCA 1FVFA 5DYYA 1CIPA 5HKBA 3KDPA 2F3QA 2GD1O 3LWZA 5AK4A 3KVYA 5TS2A 3STYA 2HU5A 3U4DA 1AVTA 2IIVA 2X6QA 4LVOA 4XEUA 3U1VA 4F3RA 3FI9A 3L7MA 2J3JA 3DM9B 4XM2A 3H87A 4UFPA 2YV2A 3N75A 4OQYA 1EE1A 2ODTX 5KJ6A 3U44A 4R83A 3RREA 4JQCA 5G4LA 5KHLB 4UBOA 4D5EA 4O33A 1LBIA 5HGXA 3UAYA 5ALIA 4YPVA 2E49A 1ZM4A 3IVAA 1P80A 3M34A 3OY2A 4MQEA 3EJWA 2I76A 1UKBA 2CUTA 2P67A 1FYFA 4E2FA 3GUUA 1EZ1A 3Q7QA 5JBIA 4BUZA 1Y5IA 4EVSA 3NRBA 3SPXA 3GEGA 4TTRA 3EXFA 4YMWA 1CRPA 1P45A 2DH5A 3AYXB 2OV1A 5LP6C 4DLVA 1P9LA 1P7VA 4PXYA 4MWCA 2D2EA 2Q21A 4BPRA 4Q5IA 2XMRA 3G2HA 4XX0B 2NU8A 3ZYCA 5HKKA 3FPLA 4URZR 5G4KA 1ENPA 4H7PA 2J7KA 3DV2A 3LYHA 3TQQA 5A5VA 3PEWA 4PPFA 5K3BA 4RF2A 4NECA 2BONA 1C7EA 3D6TB 3FHJA 2ZM6B 1J49A 1TYZA 2WAMA 2WQ6A 3R3UA 1AUXA 1KK0A 3BTOA 3T15A 3WK4A 4CKWA 1YZGA 1FLVA 2B9EA 2WHXA 1FZQA 3H04A 3QHPA 4P35A 3UWMA 1Y34E 5BR8B 3RHSA 2QW0X 1PF7E 4URFA 5MFPA 4IQFA 1AGYA 3FPEA 1QO0D 1AO3A 4FGUA 3VJLA 3BQ9A 3I23A 4BXOA 2C83A 3IR6A 2H9YA 5LA6B 2D4HA 3MPUA 1XP8A 3ZWCA 3B51X 2DX7A 3WAKA 1U2TA 1FNBA 1PFVA 4EJMA 1S6YA 3TLXA 2VPZA 5BVHB 5SY9A 4E33A 4J4TA 3QKUA 4BRUA 1G59A 3SBXA 3OETA 4F1KA 2M2IA 1WETA 3V2GA 4A1FA 2K7FA 4IMJB 1V8ZA 4ARCA 2CDBA 2X23A 2I34A 3QW4B 4P86A 5FTJA 4XDYA 2F7SA 5DX8A 1P74A 1UC9A 1LQ2A 2JLCA 1WBJB 3SXPA 3R9XB 1QVZA 5JSYA 4EFNA 2GASA 2C8LA 3WRXC 4BVHA 1JG3A 3QBVA 3A4IA 4MQ6A 3L4BA 2VP9A 1K7SN 4F3TA 3K8QA 3NH6A 3JQ8A 1CR2A 4JVNA 4QDJA 3KKZA 4GKBA 1WZCA 4RVFA 2Y6VA 4AYTA 4WD3A 2B2CA 4R8MA 3AUAA 1L4EA 4I4TA 4IO1A 4WVFA 4XGIA 1ZVVA 3TB4A 1I6WA 5EIBC 1FSPA 1NN3A 1JH8A 2QVBA 3WYNA 5KTPA 1PN3A 1APBA 4LE2A 5LDDC 2G0NA 1XKTA 5LQNA 4JELA 4BAZA 2WZDA 3MS7A 3G9TA 3K4PA 5BVGA 3RRNA 2HA7A 1T36B 4XRRA 3S2SA 1O6ZA 3G0GA 1O8BA 3PCTA 3QPWA 4KXLA 4U7WA 1PFWA 4J1QA 5JQWA 2C7QA 5JNSA 1F9EA 2YWHA 2Z2IA 3H3FA 1XZJA 3MQ2A 3HCFA 3LHFA 5HSGA 2EWVA 4GOLD 1NULA 1I4LD 1S7CA 1W0KD 3T7KA 5BMVA 3GMTA 4JB8A 5IDVA 4GXQA 5IU6A 4WUTA 1G63A 1HT3A 5SZKB 1IHPA 4BMZA 1ISJA 1W0CA 1KARA 5E3JA 3UK6A 3WV4A 3IAEA 3V48A 4EUKA 1PW5A 2NU6A 4Y3UA 1C4XA 3CE9A 3SHWA 1U0FA 2IZ6A 4MW9A 4RA9B 2CBZA 4BGDA 3OUUA 2JIZA 3RTDA 4KZPA 4IM7A 2AKAB 1P3Y1 4GVLA 1AQYA 3ECAA 1S9HA 2BGTA 1U1CA 1C30B 4LYEA 5I3CA 4GZ5A 2RI1A 3E1KA 1J70A 2EJTA 3F5MA 4FCTA 4PAWA 3U26A 1POXA 2VHVA 3ECCA 3DQQA 3SS8A 2K87A 3EZ7A 3NIDB 4S0ZA 4H3HB 1B8VA 2VHXA 2OV8A 4BZZA 1USUA 2KLHA 1YGPA 2GEVA 2OG1A 1YDEA 3ZEAA 1X1RA 2ZROA 2H6EA 1R4NB 1QRAA 3DE3X 2P2SA 4V0SA 4XPIB 2APJA 2JS7A 2W6NA 4ON9A 3SQDA 4RWEA 3DGFC 3PF9A 4GLOA 3MJEA 4HMOA 3NV7A 5IUKC 1G42A 3JY6A 5BY2A 4G1MB 5G1OA 4C0WA 4X44A 5HF5A 4FZRA 2DFKB 3SOZA 3VJRA 1EM6A 1V3TA 1T6YA 2ZK7A 3MMSA 1L8XA 3KUKA 4B75A 5MF6A 1KVQA 5JXHA 4ZTBA 4WY5A 3S7ZA 1N9GA 1NP7A 3THWA 2RC5A 4QUBA 2DY1A 4F45A 4OHFA 4IDCA 2AC4A 5K0NA 1PVOA 2OB2A 3BICA 2QP4A 3IP9A 3OY7A 1ZHFA 2MCFA 1UDAA 2EEZA 4PLHA 3ZHSA 4V0QA 4MKGA 1ZRHA 2PZ8A 1JYEA 5JE8A 5U4XA 2ZWVA 3KPJA 4KNWA 1GTMA 4E1BA 2KPOA 1BE1A 5T4FA 1MU0A 1CUIA 2W98A 1T5LA 5EXSA 4DC1A 4YXWD 5GPBA 1XZDA 1AHIA 5IJAA 1X86B 4R3UC 1QDLB 1H4SA 3LNCA 1EGAA 1FFAA 1Z12A 1NNSA 3TIXB 4G24A 1OI2A 3PS9A 4O1HA 4OGWA 1FP2A 4LPSA 2CVHA 2VJKA 3ZBPA 4YRBA 2ABWA 3QOYA 5IDQA 3F6RA 1RSZA 1PV2A 3UWPA 4LDZA 4YQZA 1P29A 1UQRA 3UT5A 1U9ZA 1VM6A 4NZNA 1PSZA 2QUBA 2CHFA 4MUKA 2P30A 4XUCA 5TXGA 3GEPA 4PWZA 3ZEIA 5CURA 4BN5A 3CNNA 3DZHA 1OHHD 3B7WA 1Z0FA 4JB0A 4OQNA 4D92A 4WOCA 1XRNA 1L7MA 1ZKMA 5HUQA 1XF1A 2W2KB 5JDIC 5BSMA 3F2IA 1QZZA 4YCDA 4BE7B 4GOXA 2GXQA 2HRBA 4CETA 2PUGA 4A8HA 1QQTA 2FP4A 1BAPA 1XQ9A 1BEEA 3PXDA 4FDAA 2VC2B 4YROA 3RVLA 3D6HA 3CIOA 2B21A 1E1NA 5FUMA 1R6UA 1EM8A 3FRIA 3U4IA 3HNRA 4QHSA 5A5DA 2XYRA 1FMCA 1IOZA 5FA8A 3ILHA 2DWCA 1FOEB 2JF0A 4NZYA 4RS4A 3FPHA 3D5QA 5BSRA 3RJ5A 3ZGNA 3SYNA 5LXTF 3IIIA 3ETLA 3BMCA 3GCZA 1DKRA 3HBNA 1OTHA 3WGUA 3TK1A 4AZ0A 5F7XA 5IG2A 3MW8A 1PK9A 1D2RA 1PZFA 1I2ZA 5JI2E 2VCEA 3UOAB 2RGNA 1U8YA 2RGEA 3BHJA 4AURA 1U0OC 4AUEA 2GERA 2CNBA 4BQRA 5E95A 1MENA 3IEPA 3LD9A 1VZ2A 2VHTA 3HYTA 1NQVA 1Y1KE 1BFKA 1R64A 3NHFA 3I01M 1YS2X 3P2IA 1ZH0A 2F6RA 1VDZA 4HLNA 1TO6A 5EJ8A 3CH4B 3WSVA 5FYDA 1K8ZB 1NFQA 2RHJA 2W22A 2BGIA 5AVJA 1E94E 4Z86A 5CFLA 3G5LA 1FX0B 4Q7MB 2UZIR 4X66B 5G1PA 5HFAA 1CERA 4ARAA 1Q1NA 2V9CA 1GAQA 1K98A 2NZVG 4Y2TA 3U16A 3J80A 2GFIA 3FOEC 3GZJA 1ZG3A 4QLAA 1U0EA 1T4CA 2AEEA 2C5LA 1X7WB 2J5RA 3N8NA 4H7EA 3CPEA 2HSEA 2RK4A 3PPVA 5BPFA 2XUZA 3CKYA 1NONA 3ECSA 4HGPA 1N2GA 3RLIA 3PGVA 5KU7A 2J3DA 4L07A 3K0FA 3FE2A 3SJZA 1HOTA 4UCQA 4IGFA 3ST7A 4BO1A 1YZUA 2JLQA 1EBFA 2IBTA 5CXUA 4F5WA 3JQ7A 1RRGA 3GLHE 1R6DA 2AFIB 2IW1A 2PFKA 3ILYA 4TRJA 1E5LA 5DVZA 1PSDA 4YUZA 3Q8MA 2BCJQ 1CJKC 1QHEA 4WVLA 5DSZA 3TSWA 3W7AA 4E13A 1QBKC 4M0DA 1N5JA 2F4VB 1UT5A 4G36A 3PA6A 5FTWA 4UNQA 2WJ6A 2H2IA 1ADYA 1WPXA 4YI5A 4G4GA 4B9EA 2GWHA 4QYIA 3A14A 4EKEA 3NDJA 3IVGA 5B55A 2V74B 4HUQB 3VYTB 3QE3A 2LE0A 4KQCA 2GN2A 3BL5A 3S99A 4ZP1A 1NX6A 1GNPA 2GSDA 3KB1A 3UB3A 5ALXA 1V3QE 4NPAA 5ARDA 2PJUA 4CMEA 3RYCA 4LFCB 3FMVA 6PFKA 4AZWA 5ALZA 1XEAA 2NYUA 3TSZA 2Q2WA 2R8ZA 5DRYA 3JTEA 4JLUA 5K51A 1GU0A 2ATXA 2IY9A 5AW5A 3GGCA 4ZO4A 1YRHA 1ZVKA 4PW0A 4ZAYA 3OQJA 2FN8A 5JJCA 4W5QA 3EISA 2V58A 3BTUA 3IEXA 3QZUA 4QSMA 1RLUA 5AJUA 3LCMA 3MTBA 8ATCA 1R8QA 3QSGA 1G20A 2XBLA 1T9HA 4LDQA 5AJTA 4JI0B 4EG1A 1V48A 1R4AA 3L7BA 3OQMA 1UH5A 1T35A 2F9FA 4DUGD 3HCWA 5C7YA 3ND7A 4G0WA 1VIVA 5CFOA 5K99A 3O4HA 5JXGA 1ULZA 4GMGA 2GN9A 1QUEA 2CHEA 4XCQA 5CB4F 1XRLA 3QNWA 4FCCA 4J2OA 5C46F 3LOQA 1YWGO 2IEBA 2JA1A 1GGNA 1JLSA 1PAUA 3TX2A 2ZJ1A 3V32A 4KLNA 4ZJUA 4ZHQB 2G82A 2FWMX 5ALLA 4ZAXA 2QRVA 1Z4PX 2XOEA 4J75A 2R1VA 4TWIA 1JMVA 2PH1A 3FWPA 3E0QA 3T3OA 3LNTA 1KY5A 4B43A 1VYTA 5F52A 3OX4A 2YHIA 2P7IA 3L4EA 1VFPA 4RSGA 4CTKA 1O08A 3GRUA 2ID7A 2UUPA 2W2XA 2A59A 5CYPA 4EKIA 1RXSA 3E48A 2FPGB 1ICEA 4YRIA 1YZLA 3H42B 2ZE6A 2GTPA 2JPDA 1TTPB 4UHJA 4Z99A 3O2NA 1QYDA 3VTAA 3QKSB 2QSUA 2OKCA 3WIUA 4X20A 5ULLA 3HDQA 2ZT6A 1QE5A 2XECA 2X0RA 2E89A 3L2OB 4LZPA 1T3ZA 3GB9A 5U1PA 4G26A 2VSYA 4GZ3A 2Y92A 3TLGA 2EEPA 2X0JA 1YQUA 4HWSA 2H0AA 2QG4A 5AXAA 4W5OA 3C3MA 1EP2B 1IAQA 1QO7A 2OENG 2JJ1D 2OAEA 4M7RA 1FMTA 1MNQA 1DDIA 4GAEA 1ANKA 1DQPA 4O4HA 4ETMA 2JD2A 1E4EB 2C7BA 2B6NA 3KU4A 1EIWA 4W7HA 2ORED 4J76A 3HKEA 3R3YA 3TZLA 3W5BA 1ZGGA 4KO3S 3HDHA 3AP1A 4OQFA 1YL7A 2A9VA 2WWXA 4B46A 3TRHA 4LV5B 5F2NA 2GUWA 2WTUA 1C81A 1SUBA 3FYSA 5M3BA 4W5NA 1QRUA 1XFDA 4FUQA 4KMOA 1V5FA 1YK1A 1P5JA 1W1IA 3SCZA 4E22A 2WJHA 3NX4A 1TQHA 3KO8A 1R16A 1DJOA 4BO2A 4D9JA 4HF7A 4UVGA 3HC7A 5JRZA 4LAFA 4BBJA 1QH9A 5BSTA 2ZRBA 3M8KA 1Z13A 4CNBA 5C53B 5DYTA 2VZ9A 4Q0MA 2BMJA 2PVCA 4LSZA 3U7HB 3DHYA 3B1YA 4M86A 1M54A 1V2HE 3S5JA 2HT1A 3JTMA 3VSDA 5AKJA 2H4XA 4HGQA 1YA6A 1WQ1R 5C1DA 1NP3A 4TL6A 1WVMA 3DMNA 1GZ5A 2XUKA 1DV1A 2P1RA 3B52X 5K0EA 2BISA 1Q3TA 1FFEA 1E1LA 5DYNA 1U98A 2B1IA 5AMXA 3E81A 1ZUD1 2ECFA 1XD9A 3BXFA 1GR1A 5C5IA 1IQ0A 3KJGA 5EZYA 4HAXA 3U3DA 2KJQA 1JXOA 2J32A 2N0SA 2WM9B 5E7JA 3TTSA 3ZDDA 1MEEA 4HB2A 4JITA 2OPHA 2L17A 4YCLA 2YFYA 1VSBA 2BGKA 5EYPB 2EERA 1IZ0A 3T99A 1F2VA 3Q0TA 4K8OA 1HETA 1U1GA 1MX9A 3ETJA 2Y99A 3PNMA 4G67A 2V4ZA 5IYZF 4C7OB 4WTOA 4BVLA 4C6RA 4DRXA 4YV0A 1XROA 1BHJA 1X0VA 1YQGA 4CCSA 1X9IA 1SHTX 4NNJA 4F21A 4P3XA 1JG2A 3OO0A 3IEMA 1QPBA 2OCIA 1V25A 3BIWA 4RF4A 3RIHA 2O1WA 3CEPB 2BDEA 4MEAA 3QVOA 4CE6A 2A9QA 1A2KC 5T64A 3UFBA 1T3LA 1E2IA 2R5FA 1V45E 3AVOA 3PXXA 4M49A 3OBBA 3HSKA 5CYOA 1AB6A 3T38A 3VR2A 3RAFC 2Z43A 3HP4A 3KAKA 3Q3IA 2JKYA 5FAXA 2XMPA 3OFSA 2UUBB 2XLBA 4PIVA 1HDCA 4BX8A 1FDIA 2HEGA 1E66A 1O77A 4M8SA 2DFPA 3OIVA 3RD5A 1KDOA 3CRZA 3MCTA 1GP2A 2FW0A 5FBLB 1SKYB 3HS3A 3QEBZ 1E1KA 3PJFA 2BFDA 2VSQA 3C1AA 3TXAA 1LRKA 4PBSA 2UVQA 4OKNA 4CI0B 3LYUA 2C4VA 2IGBA 2AW5A 5BT9A 3IR5A 5FHRA 1VMKA 4JBLA 3HR7A 1FRQA 4NZ9A 1ZVQA 2ATEA 2E4YA 4ND3A 4WEQA 4R1TA 1C4WA 4Y2YA 2PXCA 3NHBA 5LLDA 4OX9B 4QDZA 4ZK2A 3GU3A 1ZRNA 3WKCA 3QE4A 4DV2B 3B6ZA 5D51S 4B35A 2H5LA 2ZRNA 2K2QB 2VHEA 1ZK3A 5FUQA 1Q91A 1YCHA 3DAGA 2Z2ZA 4BJ1A 1XTRA 3A9TA 4IR7A 1I36A 4AW9A 2RBKA 3P94A 4N4AA 2DHRA 1ZD1A 1JHXA 2G9RA 1FLNA 2IZ0A 4FGZA 1MCZA 3N8DA 1BN6A 1BXKA 1KYQA 3EVGA 4JL8A 4G9EA 4IJ6A 3HCDA 1A8HA 1NJSA 2IPAB 1AKWA 1F8GA 3ZU5A 4FWTA 2ZAOA 5ITWA 4CT5A 1EJ0A 4GL4A 4TTTS 5EVJA 4R8KA 3KDAA 3S44A 3QXGA 4DT1A 5KTMA 5LVAA 5T8KA 4RXUA 1K4MA 4RH3A 4PHCA 2VKTA 3T1HB 1T0PA 3CUTA 3EZXA 3OZDA 2CL0X 1OBHA 5T8KC 3ZWOA 2JGDA 1T2CA 3GWGA 3UMVA 1UZNA 2W58A 1KMNA 3K1AA 1M7HA 1KP2A 2AEMA 4F84A 4Z3KA 4HMQA 4YLYA 5IDXA 3OKAA 4LF7B 5DGHA 4B8ZA 2YVUA 1VJDA 1X7HA 1RYMA 1UINA 2HV8A 2XR1A 4LNHA 4C7KA 3P2EA 3ZHYA 4CYMA 3OKPA 4ZN6A 1P1KA 2Z6AA 1EHIA 5CM8B 3ZWWA 2ZI9A 3EZ2A 5EESA 3E2IA 4ER7A 2EKZA 3OZWA 4B6SA 1MEOA 1Q1EA 2ERXA 2W71A 3KXKA 3PWSA 4N0PA 2R4UA 2AVDA 1DC3A 2H1SA 4LKRA 2PZLA 2NTNA 3AETA 4OJTA 5EJMA 3FUTA 3CUYA 4BC1A 4F6RB 1HDIA 2RGRA 1Z3IX 3L7CA 1FTQA 2QAJA 1EP3B 3OLZA 3HCOA 3OQIA 1ZICA 2YZKA 1ORIA 3B6EA 3JPWA 2VT6A 3W1EA 3T5AA 2OGWA 2YY5A 1J20A 4TV9A 4WI1A 2J6BA 2NVWA 1KS9A 1SXJB 1L4HA 1DO0A 4ONEA 4NJEA 4EPYA 1AQNA 2CVZA 5LQRA 3OZTA 1NURA 1UK6A 1D2HA 2H92A 1XJCA 4ZEOA 5CFRA 3WGIA 1NASA 4ZOLF 2YXDA 1FTYA 2VRCA 3BGDA 3HKCB 3N2EA 4OB6A 5EIBD 4L1KA 1OZAA 3TAUA 3W7VA 1PEYA 3NWJA 2XNSA 3MRTA 2E4AA 1T3SA 3AIKA 1KFBB 3QQPA 3RB8A 2VAVA 4QNMA 1LK0A 4NJMA 3K5HA 5L7YA 4CM7A 2C42A 1XEWY 1PQWA 2HMTA 1J0XO 2J4CA 1W7AA 4BDTA 4W9RA 5KAPA 3JVEA 1ZY2A 2QE7A 2JJQA 2Z3WA 1QM5A 3KEOA 3PIDA 5HJ2A 1O2DA 2IP2A 3V4VB 2VSXA 2P3QA 4GX1A 3R5KA 5GM1A 1E2GA 2QRNA 3UWKA 1JRLA 3IQDB 4PX2A 4UTOA 5KKCA 3JQQA 1XVAA 4DXDA 4RTQA 5JCJD 5JFOA 3RT1A 5FAKA 4ISCA 4PO1A 1B74A 4HC4A 4WLNA 1CP3A 1SIBE 1HUQA 1ODIA 2QM0A 2R44A 5DMXA 4BP8A 4EB8A 3TQCA 4OHPA 5I48A 3E9ZA 1GUDA 1J42A 1OKKA 4ZVLA 1VE7A 3N2GA 2OMKA 4GW3A 4O8CA 2HIMA 3ND9A 1Z29A 1L5GB 4EDHA 5T57A 3ZXYA 4PZYA 4GBED 3CLUD 3MGCA 4EGJA 5EKDA 1OFUA 4GH5A 4GLLA 4XB6B 3LK6A 3AV3A 3SZOA 4R1MA 3G23A 3SXJA 4CT0A 3VDNB 1TQDA 5KNCA 1NVKA 1KEWA 5EKTA 3HKBA 4KQMA 3ESZA 4EG8A 1D09A 3IAM6 2HNBA 3SHTA 1ZU4A 2ID4A 2OXCA 2Q2QA 1LDNA 1VL0A 4JZYA 2ZTMA 2PMKA 4URVR 1ZJWA 3SNKA 1R7RA 1PIWA 1IN7A 1UXOA 3BB4A 4FBLA 2O8BB 1L4KA 1ULHA 3KJQA 2VHUA 2W48A 1K3TA 1Q77A 3G3EA 3DEZA 2XODA 2DTEA 2HBRA 3DVRX 3GRRA 1ZUIA 3I83A 3K94A 3H97A 1MHPA 3IVCA 2F9LA 1P0IA 4UXIA 4CFYA 4CM6A 4G0VA 3M83A 2VWGA 1BCSB 1ETUA 1QX3A 4LDPA 1PZNA 3C8UA 3G2LA 3ZHTA 5DBOA 3S27A 3FUXA 4G5HA 3K16A 1ZGCA 1RKQA 3C7CB 2C5SA 3PQFA 4ZCLA 3WNCA 2VF7A 1AMOA 1THTA 3P9CA 1EFRA 2OESA 2P91A 5BSVA 2MIIA 2F17A 3AU9A 3HDGA 3UK2A 1XN4A 2YWCA 1EVQA 1M7GA 1PS9A 3A4NA 2PS0A 2Z2KA 4X1IA 5KJEA 5BYJA 2FPLA 3U7JA 3PE4A 2QBYB 1C3VA 1K88A 1P2TA 3JATA 4EBFA 3NTRA 2JIRA 1ZM9A 2XMGA 3SIPA 2KSQA 4F3CA 4YGYA 3U4QB 4LJSA 1E3DA 1SHJA 3O92A 3V9PA 4YRTA 1O97D 3WB1A 4EHLA 2I99A 4MQ4A 1LJLA 3ZJUA 2NTVA 1IJBA 1Q7EA 2DHEA 1DS6A 1ZC3A 3RIMA 5A2QA 2ZR7A 1RHMA 4RQUA 1HNZB 1Y3BE 2PU5A 1PK8A 5EWJB 2DCUA 1S7GA 2EFGA 1DQRA 2YV1A 1AKMA 2ZYGA 3DWEX 1KEPA 3JVIA 3ZH9B 1TZJA 2WU3A 2W9XA 4G85A 3HHPA 4P0TA 5SZJA 3TTTA 821PA 1XCOA 1Y48E 2W6PA 4FMBB 4QWMA 1V1MB 2SNIE 5ITZA 5JH7B 3LCCA 1QB7A 3T9CA 1WABA 2FW7A 1HE4A 1JALA 1U1DA 4HEJA 3R74A 3WK9A 5B6JA 2QIPA 3SAJA 1ESNA 4MI1A 4E7PA 3UB4A 3NWEA 3GLGE 3WLMA 1BXZA 2NQTA 4WN9A 1NDHA 1C9EA 1K66A 2NSYA 2ZIZA 5IAGA 4CIBA 3E9CA 2I78A 3I92A 3DBHA 2AL7A 3ASVA 4LYJA 2Q1SA 2H7YA 4PQEA 3ZOKA 4P3KA 4A0GA 2NZWA 5L3VA 4MAFA 2ZT7A 3SP1A 2R1TB 5C7IO 2YYYA 2YVQA 1L4BA 2RCYA 1XMPA 1I7PA 1X8XA 2D5BA 4J7UA 5DHAA 2JFGA 2NTEA 3TIGA 1DAIA 1OFUX 2FPIA 1BS2A 2HPHA 1BYIA 3EK2A 4GQAA 5H3LA 5FUBA 1A7AA 3ZNOA 4LF5B 3KLBA 2OBMA 5G4KB 2XGOA 5AM0A 2HA3A 5JJLA 2NU8B 2IX3A 5EHIA 2CXUA 2W4IA 5JY6A 2HBQA 3FTDA 1PQYA 4OIFA 1YMVA 2YS6A 4L16A 1Q12A 2BGJA 3BMOA 2P78A 2YZMA 3GBVA 1JE0A 3P0IA 3DVQX 2NO6A 2CCJA 4R41A 2VK2A 4JT4A 5JQGB 3NEPX 3PPXA 4KE6A 3BILA 3KHUA 4PEVA 1Z4MA 3DEYX 1U2ZA 1W9MA 3C4VA 4OU4A 3VA7A 2V6MA 5HTKA 1K0UA 3MQ4A 3OP1A 4H1VA 2QE7D 4YALA 1NRJB 4FD2A 2CKMA 1WPQA 1HEUA 1N5OX 2JIDA 2F3TA 1X1BA 3I04M 4PLVA 5A9TA 1R6AA 2BKXA 2G1UA 3V1MA 4OQZA 3PHLA 3AHJA 2HN9A 3T06B 4I1RA 3RARA 4OK6A 1KE2A 3CM0A 1S02A 3L46A 2ENWA 1QORA 3ZWNA 2BGWA 4Q03A 3UY4A 3OBIA 2PH7A 3AXTA 3EZNA 3VZRA 4DZRA 4JR1A 4J03A 3AB7A 1G98A 2P6PA 1U90A 2YMMA 3LZDA 1PEDA 1WRBA 1Y8QB 1YJ5A 2B8EA 3QELA 1X9HA 4HWRA 3R7DA 1WQ4A 3OG9A 3RT9A 3WR5A 4DMGA 1J8YF 1ZIXA 4QOIA 4DOMA 4RLFA 6Q21A 2MMCA 1C8BA 2RAFA 1K3FA 3QU4A 1U7ZA 3AEKA 2P1ZA 3DSRA 2Z6UA 5AKLA 1JFFB 4Z0TA 5AI4A 1LZKA 3PNLA 4ZO8A 3W6PA 1SCAA 3TLAA 3W5HA 2P2DA 6YASA 2W2LA 3AEZA 1XTSA 5A3QA 5JHGB 3OM8A 4F8JA 3FGZA 4WZAE 1A9OA 1ZNYA 2YXEA 3ENQA 1LXCA 4W5HA 4YT2A 1TT7A 2UZ1B 3DOCA 4L6CA 3X3HA 4Q18A 2Q1UA 4PHHA 3MUFA 3VR5H 4F86A 4F96A 5FXMA 2B98A 1DWPA 2H4HA 3QXCA 1J8VA 3SKXA 1TYDE 4MWGA 3X1WA 3ZHCA 2R4QA 1YULA 4XIYA 2XIQA 3U37A 3HQ4O 1NQOA 4F11A 1VCMA 4HDSA 3SWWA 2Y1CA 1SWVA 1UUFA 3EEQA 3JQRA 4X1YA 1TCAA 3WGKA 5K01A 1Z34A 1QYXA 4CM8B 4JHLA 2IYEA 5JRDS 3ONWA 1JDSA 3LWBA 3WGMA 5JQGA 3IKTA 2OV6A 3NJ8A 1L0BA 3WLSA 1EFCA 3IE2A 3G8DA 3IAAA 2X42A 4KH1A 3ZC3A 3RU2A 4XYBA 4RA9A 3WKDA 2XNDA 4GO1A 4UMEA 2NU6B 2DYKA 3QMVA 3LFHA 4QU0A 4YS6A 2P2GA 5B64A 2JFUA 3JARB 4XIFA 3K70D 2E5FA 4YO8A 1UR5A 3RIGA 4ENUA 1DWQA 2O05A 4D6XA 4P08A 3M7IA 1T8RA 3OE4A 1RAGA 1L5OA 3CMMA 2XKBA 4IWYA 3BCUA 3TJMA 1MB4A 1WDTA 5ALDA 2WVJA 3V7NA 1F51E 3WMFA 2A67A 4IRMA 4YT5A 4B85A 4CDGA 4Z51A 5KNCH 1L5HA 5CU7A 5G1NA 1H0KA 1QVAA 2X15A 4LN1A 4X7BA 3AR7A 2W6JA 4FB4A 3TO5A 1NY5A 1DRUA 2VKQA 2JZCA 2XAAA 3GAZA 5DGXA 4B82A 5K6AA 3DEFA 4N48A 2OD2A 2ECPA 2WTNA 2H4JA 3M1LA 5HE8A 5I9MA 1IZYA 4AU1A 4XWWA 2XXJA 1DI0A 1ZXLA 4FX5A 1D5WA 3V2UA 5ITZB 3B2NA 4L0DA 1O57A 3DNMA 4GI1A 2QZJA 1F6DA 4N47A 2WWFA 2D4AA 4YY3B 1NF2A 4AJ4A 3T7RA 1WKCA 3I9FA 3VVCA 2ZUTA 3KQKA 1QS0A 3BSFA 1N6KA 3IJRA 1XCBA 2GHTA 2N42A 2JAHA 3FDJA 4J7AA 4AO7A 4O08A 2HDHA 3OOJA 3V8RA 3UM9A 5IBRA 2ZBDA 1ORDA 4LZJA 1TKBA 1UM9A 2QRKA 3CB2A 3SZLA 3K6SA 1ZH4A 2FPPA 2IE0A 3B12A 1JAHA 2FDRA 4MS1A 4QBHA 5TT0A 4B4WA 1NBIA 4EEKA 4QQNA 4JXKA 4QTXA 2PPLA 4LDAA 4U6SA 3I3SR 5HK8A 1XCJA 2ECKA 4MUYA 4R51A 3THXB 3EZ9A 4R8VA 2B37A 4UQLA 5JEDA 2H07A 1FNCA 1BG6A 3I0NA 4FM9A 3ZGLA 1VL5A 5IM4A 1JQ3A 5IPFA 4DBLC 2QD3A 3FOCA 1CRQA 1NPYA 1OBCA 1JR3A 5JXJA 2QJRA 4MW6A 1OLUA 1XZKA 4MPJA 3JVUA 4OUDA 5EE9A 3WWEA 3GRFA 1ZGJA 1JFSA 5B58C 2QSYA 2X9NA 1DRVA 3NDBB 1IH8A 2VF4X 4ESOA 1I0LA 2D7DA 1PD1A 1VA4A 2DQZA 3QIVA 3ZE9A 2JVIA 2X5KO 3OLCX 3EFBA 1CUGA 4X0EA 3KQUA 4PSDA 1AZLA 2XHEA 3EOZA 4XXHA 3AJEA 5F64A 5IUJC 2VS1A 4J0HA 1P19A 1W1UA 1Y4UA 2AUTA 2GK3A 3D7KA 3MJFA 4V03A 3UV7A 2R6CA 2QTZA 1E7SA 2WFAA 3VRHA 1CRWG 1CUXA 2C3PA 2X8BA 3HKBB 1A1SA 2WD7B 4BVKA 3IDQA 4ZWNA 5FWDA 4OXKA 2CE2X 2GO7A 4RV9A 1L5FA 3N0TA 4NCHA 5EFOA 3D7LA 3I6IA 1H1LA 4MW1A 4E7OA 4EUSA 1SKQA 3NKVA 2AN1A 4QAJA 4QLOA 4UJ3A 1CQIB 1I80A 1PUXA 3QU2A 3R5FA 3MA0A 4KUGA 4IDPA 4DEVA 3SR0A 4EQ6A 2GS9A 3HBFA 4TWBA 5C8ZA 1CR0A 1QFMA 3CZ4A 2NXEA 4WCFB 4D96A 4J0KA 3FW1A 5JYBA 4FNMA 3REQA 3IB6A 4K6FA 1BIFA 2TECE 3MJTA 2O8NA 3PVSA 1BE0A 1ZJ4A 3K0CC 2IDKA 4MAAA 5D3ZA 3ZS8A 3TRDA 1EPUA 2PL3A 2XW6A 2H1LA 1VHDA 3AFIA 3UWDA 3CRRA 4IDGA 3FJYA 2GEUA 4LYDA 4K9SA 4ZIRA 2GO1A 2PX2A 1AO0A 1DFHA 4IOJA 3PNSA 2OGZA 5CFZA 2GILA 4OHMA 3ZTTA 4X6YA 4QM6A 4K6KA 3THXA 4QU8A 2QY9A 4W5RA 1KKMA 3STHA 1Z5WA 4C4RA 2EP8A 2H9IA 2RJ3A 4ZMSA 3LAWA 3ZV5A 3L5OA 2WQZA 2JIOA 5BR7A 3NNSA 3FUWA 4N76A 2JIBA 1GPNA 1QG6A 4CM4B 5GINE 3D6UA 4PSVA 5IBPA 4ZYVA 1KDVA 3AFHA 3JZMA 4RZ2A 3I42A 5BSUA 4F6LA 3AG6A 3F5SA 5ILQA 3FVRA 2PVPA 3U7EB 1LLDA 4QBGB 4B8WA 3C45A 3G2IA 3OECA 4S1VA 4TGLA 1YQWA 3KFLA 5SZHB 3UC5A 1QIGA 2TSYB 4LRUA 4ZYWA 4EX7A 3GGOA 2V7QA 3WB9A 1E7YA 1SOAA 1XR3A 1KQ3A 2PHZA 3GT7A 3H4MA 1C4KA 3TMAA 3UAOA 5IM5A 3TLKA 3L7KA 3MTEA 3BMCB 3HXPA 4N0DA 1IIRA 4JI5B 1TCVA 2CF6A 2PQ6A 4PVCA 3HUUA 1EVJA 5IULC 5JWHA 3PT9A 1JDNA 4Y0VA 6NULA 4RGVA 3PFWO 1G8SA 3Q3EA 3H5WA 2JLXA 3EGDA 1AK2A 4MHTA 1XTKA 2AXPA 3KAQA 1AHPA 5K03A 3C6YA 4NXMB 2V6IA 4BNDA 4TYWA 5A1TA 1J00A 4M9ZA 4WH0A 3RCBA 1KXJA 2HXSA 3GFVA 3OMWA 4FSHA 4HWPA 4MO9A 3W6UA 5KQRA 4B79A 1LW7A 5HIIA 6AT1A 3S1LA 3PQDA 3OZUA 4LJLA 3C3AA 3LA6A 4NWIA 5AFSA 1RT9A 3JAWA 3HYNA 3RGWS 4W63A 4KUHA 1CQPA 3N74A 1RYFA 2C04A 4FZVA 1PTJC 3O4RA 3E03A 4K28A 3X1MA 2VWHA 3DD5A 4CLOB 1EFKA 4UTPA 3JQAA 5KVSA 2YCLA 4Y9SA 1J99A 1N7JA 1OB2A 5B37A 2FN3A 2OOKA 1AKVA 3L6UA 2O8CB 2ZLBA 2O8FB 1HMPA 2YDYA 1V5IA 1W88A 1M1YE 3NHLA 2B8JA 2JGFA 4HY3A 1SG9A 3P9QA 2Q1XA 4DM7A 1G2QA 2B5WA 4U7HA 4P3NA 4GPTA 5JDCC 1MZPA 1L7XA 1G0NA 2VWPA 5TGDA 3N53A 2WYHA 1M1YB 2GD6A 2R00C 4Q3CA 3TPZA 4KI0A 5CT5A 3THYA 2JHAA 3KETA 3N76A 1I1NA 1KQPA 1IN5A 1WXFA 3VNRA 1DJPA 1RLMA 4UU0A 5AD1A 2R00A 1VE9A 4N5IX 4AKGA 3P0RA 5KU1A 3AWDA 3AP3A 3ORYA 1TM3E 3BIXA 3E3AA 1Q83A 3O73A 3Q0EA 4Z7NB 3RC1A 2IA5A 1UWCA 5EI5A 3QHAA 5A3SA 1GQFA 5ER6A 5LZ2A 1E99A 1XPRA 3NOQA 2VDWB 1MABA 4R16A 5ALFA 3BHIA 1WSBA 3GJZA 1B16A 2BSQA 3DUFB 3UEOA 5T5QA 1MW8X 3FCSB 3G17A 3I9KA 2JK0A 1O96A 3JQBA 3PGXA 2XB8A 4R1PA 5LFAA 1K6IA 4G01B 2Z57A 3HB7A 1VG9B 4XD7D 3DULA 4DV4B 3QPVA 4HZIA 1NRIA 2GPJA 2QTWB 2V96A 1G3QA 3A06A 4AY3A 4C4TA 1T8WA 1QKJA 2AZDA 1PJ4A 1LGYA 2Q0XA 2AZXA 5EE1A 2O1SA 4FMCF 5J1TB 4EVIA 4FYYA 2OZVA 5CH5A 1YZ3A 3EVTA 1TYCA 3I52A 2Q5OA 3MSXA 2G4CA 4S1PA 3F6SA 3UJAA 5B3LA 2GSWA 1JG6A 1RI2A 5DISB 3TQTA 2AC7A 4YV1A 2PSDA 1EX7A 2QLJA 4KO8A 2C84A 3AOGA 3IPYA 4N1AA 1FPMA 3W78A 1GRCA 3H6KA 3MWFA 4ILEA 4L8LA 3ZIAD 5DXFA 5BORA 5IJ9A 1KF0A 1Z2CA 4XM0A 1XX6A 3MK31 1N5MA 1W5EA 4JJ8A 5THXA 4ZHQF 4JYBA 5F73A 1E61A 3WRYC 2QTNA 2CLLB 2NU7B 2X1MA 1QHYA 2OAGA 3TNFA 2JFNA 1XG5A 3E9EA 1X2BA 1GN8A 4R81A 4ZI7B 4S1TA 3QK7A 3KLPX 1XA0A 3RUCA 5AKEA 4A0QA 1LK5A 4MSUA 1XMSA 3QLVC 4X91A 3KYCB 3EXHB 1TA4A 4XFDA 2VJMA 5CVTA 1G21E 3C7AA 1FXWF 1ZQ9A 2FR0A 4LDNA 1O95A 4DMLA 4RV5A 2VTVA 3G2OA 3COWA 1E0JA 3TW6A 2RJOA 4KFCA 1OY1A 3BWCA 1RZRA 4AL4A 4YIKA 2AIRA 5HP4A 3N05A 3QJGA 5ECDA 4HPJB 3EH2A 3HV0A 1Y1LA 2KM1A 1WY5A 4ZARA 2JH3A 2Y0PA 4IVRA 3REGA 4YCCA 1KSFX 1Q20A 3MILA 5DSXA 4EENA 5BW8A 3VO2A 1OBVA 1XSEA 4E2XA 4UEOA 3WK5A 1CW2B 3RHFA 3BWVA 3FCAA 2BJWA 2HA2A 3KWMA 1II9A 3A3PA 1PT6A 2PFSA 3ACDA 3OZSA 4ALMA 1E20A 3NKLA 3P5SA 3UGQA 1F3OA 1H2ZA 2ZYDA 3DZFA 1XQ1A 3GD5A 1PW7A 1Y89A 3C97A 3MWDB 3NUGA 5FR1A 3PWKA 4NEGA 1XELA 3BORA 4YQEA 4CV1A 3ESRA 2XRFA 1T9DA 5HUHA 1R4MB 3G2MA 3L0SA 5IVHA 5JC8A 5K3SA 5FWXB 3PTAA 3DOFA 3N2ZB 4NBSA 3ICWA 4NXNB 3ET5A 4RESA 1JGTA 4O4HF 1P62B 1VIDA 3OSZA 3ZWKA 4XLTA 3LW8A 1AA9A 1C2TA 1FVOA 1PVVA 2H2DA 1KSJA 1PGPA 2O3QA 2QV0A 3BF8A 4KRGA 2MDTA 4GR9A 4M0KA 4QECA 1TVKB 4KQ1A 5HCUA 2HH9A 4JGGA 3ZU3A 4YUAA 2RHWA 3P4YA 4MV3A 2COEA 1K97A 4RPCA 1OFIA 3DBRA 2X1LA 4G09A 3UFXB 2D0PB 4IKPA 3Q5DA 3AVQA 1OGYA 1BA2A 1LTHR 2Q6TA 4HHEA 2EFJA 4C29A 1A4IA 1IHYA 1ZIDA 3S1AA 3OCVA 3H2KA 3LLMA 4L95C 4MW0A 1GYQA 1N2CE 1SD5A 1PNTA 2WKRA 5IP5A 3FKSD 4GPBA 1DC4A 2W83A 5ALEA 2CYAA 3VBCA 2VVTA 2BW0A 1G9TA 4L22A 2BZSA 1JZSA 3LOUA 1GUZA 1B3BA 5JLJA 5C31A 1TOAA 5K1ZA 3UANA 3MWLA 2QRUA 4FEYA 4B3RB 3I0MA 1P4JA 1R0BA 4DPLA 3FLEA 1BROA 4HDNB 1Z15A 3I1JA 3DFUA 4N8EA 3UMJA 3H5TA 4F12A 2I91A 5AVKA 3LQYA 4XWYA 3WRWA 3OWXA 3AB3A 1ZUWA 1OYVA 2NV6A 4IUYA 1KY4A 4LVUA 1P75A 3AL2A 3KKPA 5K45A 1H2YA 3EXG2 4M8LA 4X3CA 2YY7A 5NLLA 2F8MA 3WFJA 4C7JA 3KTDA 2XCRB 3A31A 4TTVA 4CUZA 2YMPA 4M1MA 4TLDA 1T5SA 1B0ZA 3QV2A 1F7VA 2ZJ4A 3E2MA 4KITB 2JATA 2XF8A 5EE3A 4KAJA 3ETCA 4N9QA 3ZZ0A 3VZDA 1ZL0A 4BNXA 4CCWA 1N2HA 4U5QA 2ZAYA 1CVLA 2WC1A 2OLJA 3DTVD 3I6BA 4TV8A 4IQGA 2DWQA 2BSAA 3CINA 3AC0A 4JOBA 3ZGYA 2XQJA 1DTEA 2RHOA 4GBMA 1S5PA 1L4NA 1XZQA 3RC9A 3DMHA 4LOHA 1E79D 1U3VA 1YT5A 1YE8A 3NATA 4UDNA 2XB4A 2AR7A 5E6SB 1OH6A 3VC7A 2AN9A 3T1VA 1Y6FA 1JDTA 3T4UA 1W85A 1SU8A 1YF3A 4Q9LA 2Y71A 3AOEC 5KJFA 1VPDA 2MSLA 2QXTA 2W6JD 1I30A 3ZW8A 4MS3A 3EWNA 5A9RA 4FOLA 1KVSA 5JQGF 1Q92A 2WAYA 1DTSA 2W90A 2IBMA 3KXLA 3HSYA 1KEVA 2IPOA 2MMGA 2Q3MA 4XR9A 3W9YA 4A8TA 3PE3A 4AMZA 1W49A 3N8GA 4IYRA 4ERNA 4MUAA 2WUGA 3TCKA 4G0PA 2OB1A 4JASB 4C4XA 1VCHA 2PL1A 1MH9A 3DVLA 1U0RA 4P4GA 4E6PA 3USCS 1QZTA 2SKCA 3EXAA 3FUCA 3HG7A 5CVDA 1WCIB 4GZ6A 3TSYA 3TTUA 2FPRA 1QOQB 4TSFA 1F06A 2B78A 5KJ1A 2XYHA 1LNSA 1NGSA 2XMDA 1P7YA 2MINB 2LKDA 4KVFA 4U0JA 4DEYA 1MAUA 3L05A 5D3QA 2NX2A 2YWDA 1N1EA 2O3UA 4GVPA 2WJ4A 4L5YA 4J94A 2R8RA 3NBMA 5EIHA 7REQA 2CBXA 1QWOA 3MMPA 1ZONA 4ZGGA 1SVUA 3EDMA 1HE2A 3ZYZA 5E4TA 4K9QA 1GLNA 2Z8YM 3WGVA 2P35A 1DVRA 1AX9A 4WASA 4LJRA 4FWIB 3AG5A 5LMNB 2L19A 4C0LA 3V4PB 2EBWA 3FNGA 3D0OA 4HDMB 4PG8A 4EB0A 1CLUA 1DIGA 4N8DA 3AFMA 1CULC 1TZKA 2ZBGA 3PUHA 4JJIA 4JVLA 4N3AA 1I4OA 2WG2A 5ICGA 1FJGB 3LHDA 4BBAA 2JLRA 4IY1A 1KJNA 2X3FA 1WP9A 2KBEA 4XVQA 1V39A 1QOPB 4LTDA 1DSSG 4B3XA 1CR4A 2CMFA 4BV8A 4EY7A 5HKOA 4B71A 5JSFA 5EUMA 1NE2A 1GY8A 2AOTB 4EG4A 2YN2A 4LHSA 4C0SA 3H2YA 2QZPA 3RTCA 3R9XA 2HU7A 1AGNA 4JJ6A 4P33A 5E2IA 1UOOA 2BVNA 2V7TA 1RPNA 3SEAA 3ZCXA 2WPDD 1O3YA 3EXEB 4LRSB 2I6XA 2R25B 4UM5A 4FOTA 3VVLA 3NT5A 1KOFA 2I3GA 3H9BA 3NJ4A 3T52A 3W2EA 3ZJ5A 1DP4A 3E9RA 5DYIA 3AL0C 1T8PA 1IM8A 3AFGA 4G56A 3UUWA 1UPUA 3H2GA 3M6LA 1FRZA 3ROMA 3U7QA 1JFTA 2CB0A 3BAFA 3IMKA 1DQZA 2OE2A 3HCEA 2OHGA 4TXJA 4YUVA 5TQVA 4DMKA 5JAHA 2F3SA 3Q8KA 1KO5A 4US1R 2G04A 1L7EA 3RI3A 1VFNA 3ZG6A 3UO8B 3JD1A 3PLRA 3UW1A 3R6DA 2N47A 1GQQA 1X80A 1M9NA 2GKSA 3IUMA 2YFHA 4G8BA 4O1MA 1XZ8A 5EXDA 4YCAA 1FS6A 5C7LO 3RADC 3COZA 1Z82A 3HZOA 4HNTA 1CQJA 3PXUA 3ASYA 1CUJA 2O7SA 3B20A 1GCAA 1BCSA 3WZLA 5H68A 3TM4A 2IZZA 4KDFA 1HMYA 3BXGA 3W3AD 1R9GA 3IE0A 2YY6A 3UJ6A 1NT2A 2F3PA 2IEYA 3BQMB 3FCXA 3ID6C 4MV9A 4XX0A 1TTQB 3DDOA 1JXQA 5C3UA 3TKYA 3TPCA 3OTIA 1JWAB 5B4VA 2BKAA 2F2TA 3T9AA 4MP8A 1QANA 5BURA 5E1BA 4FZ5A 3GZNA 4ECEA 4WADA 3VMFA 4JSRA 4CIDA 3HKDA 2RHBA 1ONSA 3FYCA 2BM9A 2YOGA 3F1LA 2AOUB 1JEYB 2C9MA 5DHPA 2EKBA 4IMIB 1GU7A 1VGRA 2QA5A 4DYDA 5EJ6A 3ESQA 3DEJA 4TV9F 2PZBA 3EC2A 1L8AA 4WDRA 3EXIB 2GARA 3I34X 5LCXA 2ORWA 4NYMQ 5I7EA 5J4KA 1BNCA 4FCWA 2IV7A 3PIIA 4KN5A 3LFUA 1CQXA 2BTEA 3CYFA 4YK7A 3JASA 4BO6A 3VPXA 2FX3A 4PHFA 5HE9A 5AO9A 3TZHA 1S1CA 2HDOA 4XPIA 1W87A 5B6IA 4UQPA 4WK4B 2CUKA 1UJ2A 2D1RA 3O82A 3RANA 3VTZA 3CU5A 1PBTA 2VO1A 2ZG6A 3MHPA 3PUKA 2BHRA 2JFPA 3VR0A 4IV8A 5AW3A 2HNAA 3ZXUB 2OYSA 4QBIA 4HAIA 3IALA 3KIPA 4ZCSA 4G0MA 3P7MA 3ZX5A 2FG5A 3PHGA 3NNDA 2AJBA 4LOAA 3NCTA 1FYWA 1Y3HA 3EHEA 3PDWA 1XYYA 4EO9A 1RWQA 2W42A 3AV0B 3FLAA 4WE3A 3QPCA 4DV1B 4D0GA 4UUPA 5KQGA 4FZJA 1TTTA 3AL3A 1EP1B 3U3XA 2PX8A 3C70A 3A1FA 2WDZA 4F2GA 4ZIRB 4KSBA 5DBEX 3C4JA 1ZCZA 4WSOA 1G5IA 3R3HA 5KTNA 3CZ9A 3DZKA 1S8NA 2IHZA 3HLTA 2Y93A 3R7WA 4NJOA 3GA0A 1IBSA 4RDXA 2QMQA 5BOVA 2WKQA 4MRAA 4G2NA 3K09A 3GUVA 2E85A 1EE2A 4C4ZA 4EA9A 5K3EA 2GNAA 2O57A 4OQMA 2ODQA 2FRDA 1L7VC 3T5DA 4PZZA 2V5VA 5DHRA 4C05A 1CX9B 3V4OA 3K1YA 3PHIA 4UHFA 3ANLA 3C5EA 1IG3A 5L3SB 2YWEA 5AW6A 1E92A 5A7HA 3DS8A 1SO8A 3H18A 1LI7A 2FPUA 3ZCTA 5BQ5A 3JYNA 5KSWB 4BE4A 4D82A 3OT1A 4JWKA 3AY3A 3HABA 3WHPA 3UWOA 1LW6E 3ZXIA 4F2WA 2WV7A 1R0CA 1NLYA 4CLDA 3EQ9A 1IQPA 3WBBA 1PU2A 2E9SA 1WE2A 2XQGA 3IT3A 3JQFC 3SLGA 1I4DD 1WMEA 3DEIA 5BOSA 1MVOA 2G67A 2V0GA 4S1WA 3THYB 1FNDA 1OTYA 3HUTA 4RKYA 1QYVA 2A1IA 3P9NA 4Q9DA 2PGLA 3DW1X 3FF1A 3NOOA 3HV2A 4HMPA 2PRYA 1BDMA 4O4JA 2QQFA 1B15A 3EDCA 3MWKA 1O6CA 3FSEA 5BN4B 1ID1A 1T1EA 4G5FA 1OX4B 1SEVA 1MG0A 3ET4A 1V8OA 1DRWA 3K5WA 4DFDA 4LZWA 2GCIA 4OO3A 3PKIA 4PGFA 3RUHA 1VHJA 4ACAA 1ORRA 3DCJA 2I22A 1YKGA 3DHWC 5DM60 1SD1A 5KS2A 3DFIA 4XCVA 1JLKA 3HP7A 2BHTA 4BNDB 4KR0A 4JT2A 1UBCA 1K8XB 3X2SA 3LDFA 5COBA 5B5SA 1US8A 3G79A 3Q41A 3WQBA 6REQB 1N5RA 4RMGA 4DARA 1OXKB 2GDZA 3VHRA 2G08A 4JJ7A 4V0KA 1KJZA 4L27A 3K9GA 4EF4A 3HI6A 3SM3A 1I6LA 1N1GA 3TRFA 1R00A 5BWMA 3M4ZA 3R3XA 1Y5MA 4UM9D 5KTTA 2FJ0A 4YMVA 3A04A 3KQPA 1INLA 5DE3A 2CW5A 2BFBB 1M33A 2C97A 2C5BA 1ADBA 2A4MA 2YUIA 5FL7D 1JSZA 1ODLA 1BE8A 2IX9A 3IOYA 1DC7A 1ELOA 4HTAA 4LMRA 4V24A 3A4YA 4XB1A 1M6YA 5DNCA 2E1RA 1PRYA 5LIPA 3JW8A 1PNOA 1ZIYA 3NBQA 3ZK9A 2G4VA 4EZIA 2N75A 2YWBA 3Q87B 3UAZA 4H31A 4BLWA 4EJSA 5DLQC 2ZOSA 1RYDA 5A05A 1PWXA 1SB8A 3HYCA 1Z6TA 4P0QB 4TPKA 2NOAA 1A76A 2XT9A 1CJUC 1Z6QA 3DG9A 4FSDA 4G89A 4Z8XA 3TJRA 1JS1X 1KJ9A 5HVNA 1XAHA 3R5XA 4UXJA 3DVAB 3UXEA 4AFNA 1ZCAA 3U4QA 5ADHA 2RHDA 3NH9A 2A5JA 1VLMA 4EI2A 5DIZA 4ILKA 1XQVA 4IXTA 2PQ2A 4LQ4A 3LYLA 4O0MA 4US0R 2FQ1A 1J0DA 1QDEA 2Q50A 4QBFA 2IXFA 4DR5B 1XU7A 2VDRB 3UJ9A 4EEXA 3BK7A 1U81A 4IIXA 4A6PA 3V2HA 3EXHA 5BW6B 5JXIA 4UCFA 3WL5A 3QFTA 1RWWA 1T9CA 2OP1A 1E3LA 4H7KA 3ACBA 5K4GA 2VJCA 5IYZA 2ID8A 1NG1A 2H1OA 3TOCA 1A7KA 5F23A 2X40A 3B89A 4BC0A 1JEEA 1C29B 1GPDG 1SIWA 1FX0A 2I4MA 2NPOA 1DV2A 3AHEA 3GMDA 4FYPA 3CBGA 4RD0A 1ENOA 3ZR4B 4CQMA 3BEDA 4XGNA 4BP9A 3WDLA 5CA1A 1TJNA 4BLQA 4AY4A 2ADFA 3RS4A 1KK2A 2RFLA 2RHMA 4R2MA 3LKVA 3PK0A 4KYIB 4IHAA 4N5HX 3T5CA 1Q11A 1IXKA 2UXBB 2E48A 2ZJFA 3N7AA 4JUBA 1RJ9B 3AM1A 1VLZA 3K96A 3L7LA 2CXNA 3HJBA 3DUWA 4GMDA 2G8LA 3C7DB 3RYCB 1SQ6A 1IN4A 1NJ1A 3SQMA 4BNVA 1QTRA 2O2YA 3KSBC 1DO8A 4V0RA 1QIJA 4OQDA 2ZETA 4I6GA 5FBKA 1L4UA 3R4VA 1LSJA 3L01A 5KYKA 3C8HA 3ANMA 3VJMA 1V47A 4QU5A 1G5HA 1US8B 5JZOA 3F6PA 4JBYA 2Y6UA 3CNBA 1BU5A 3M6UA 4UAGA 3IAUA 4DQXA 4Q9AA 3JAMA 8ADHA 2PK3A 4G8DA 1IQUA 4AQ7A 3DR3A 4X1KB 4OAPA 2H3EA 4WZBA 5J23A 3HCBA 1H2XA 4PRYA 3BE5A 1ISPA 1KI9A 2FEKA 4LX0A 4BZPA 4QGSA 4Z4CA 1LDEA 2P5YA 3SJUA 1FXWA 2NO4A 3P1JA 1JNYA 3PR3A 5AJVB 3FKJA 5D8DA 2G3YA 1T8SA 3T6KA 3RVDA 3WFZA 4TKZA 4RJKA 2PLWA 4RD1A 5C81A 3QWFA 1VXRA 2IHBA 4TXLA 3RYIB 1FNMA 2HCBA 2XVAA 4MEJA 1IHDA 4IWNA 4G9GA 3ENZA 3H7IA 2R9VA 5DFAA 3HN6A 4DLBA 1QK3A 4KG7A 4LZZA 3LLUA 3EVBA 1YKFA 5PGMA 5ANRB 4TQ9A 1OU0A 2W70A 3J81k 1Z6ZA 4QDKA 3WLJA 5LNK1 1HA3A 2UZ4A 1GADO 2VH2A 3SQLA 2JVKA 2PG3A 3A2NA 3H9UA 2WSIA 5C32A 2MSDB 2YC4C 1T0IA 4ZPXA 2H7CA 1U7UA 4XSVA 2GPWA 1W4ZA 1Q0ZA 2WSLA 1ENYA 2P2LA 1XXHE 5EL0A 3FY4A 3NPMA 2X13A 4LEIA 4BWGA 5A4AA 1LDYA 2QRVB 5IW8A 1ILEA 1PWZA 5IHPA 1YCFA 1ETHA 1RAHA 2B2XA 2H65A 4MR9A 3W5SA 4J7CA 2G4LA 5L9AA 3NB0A 5IDYA 3OZXA 4QASA 5DO9A 1RYYA 2JD0A 4AZ0B 3EMDA 2NU9A 2ZAIA 1QMGA 3OC6A 3O8QA 1WCV1 1EUCA 5FI1B 3WLHA 1GL3A 2JBAA 1SVKA 3P2MA 2DPXA 1H6BA 1JQ5A 2JAPA 2RGNC 4Z0NA 3ZH2A 3S2ZA 1KZHA 4XJTA 1PE0A 4QOHA 4IMRA 1J7JA 3ETEA 3FETA 2Q4BA 1KL7A 1P2DA 2C2GA 4IQ8A 4NV3A 2VDVE 4ZYUA 2WJIA 3FB4A 2VXOA 3NIBA 3I3OA 4FR2A 1CEEA 2IP4A 1COWD 1JHQA 2QTBA 4O5OA 3V7WA 3NNNA 1PV1A 4FBMA 1YAJA 4LMBA 2QT1A 4I7EA 4MHSA 1B6RA 1WUJS 1VP9A 2FUNB 4QAQA 3I6QA 1HEIA 2E3JA 3TPFA 5BO5A 4B7XA 1VJ1A 2JG3A 5GVSA 5L4LA 2WRZA 1TUBB 3USZA 3OI7A 1X70A 4YDRA 4DJFC 3EW9A 3JASB 3R09A 3OJXA 1FVXA 4KR2A 5IAOA 3CXRA 3R9IA 3PNVA 4DY6A 1XPUA 2G5PA 5JJIA 1EVKA 1CY8A 1UC8A 3EDQA 3BFXA 3SMVA 2QJWA 2RCNA 3AHFA 3B48A 2CXOA 1E4YA 2TRSB 3AU8A 1JV2B 1NVAA 3IUYA 5GADl 1DC8A 1C1HA 4UPVA 4MR8B 3RE1A 1S8FA 2BV3A 3K6RA 5AKGA 5F51A 1Z18A 4E5UA 1VBNA 5ALJA 1CETA 1ZGBA 2OZEA 3P26A 4ZYTA 3DDNA 3PJEA 2PJDA 1YD7A 1YBAA 4YRQA 2O2HA 3W9SA 5JU6A 5TPZD 1NOIA 3RLFA 1Z7EA 1R6TA 4ER5A 1LU9A 3SZRA 3EYWA 4U3JB 5C37A 3B5EA 4NMHA 2E37A 3VOBA 2GEJA 5E6SA 1EWQA 4R7GA 4OI1A 2VL7A 1Q0RA 1E1CB 2HDNB 4LQCA 1QGAA 5D5PA 2VZ8A 4OSOA 4BNMA 3MCZA 3L8MA 1SCNE 3PBKA 1ZK0A 3CE6A 3I4LA 3NANA 2VSOA 1ORWA 2P0EA 2HA6A 3KYBA 5LQMA 1R3DA 1JU9A 5HFNA 5LU9A 5FF9A 3GVIA 4YJFA 1DG3A 3N3BC 4JC0A 1QGUB 2G76A 3VR3D 1HTTA 3JRXA 4IL5A 5HFJA 4CKBA 1RRMA 3H19A 4KN6A 3DUFA 2QUIA 1VRVA 1YU9A 5DWQA 1P9NA 4AYXA 3T7IA 1J2TA 2O2DA 5EE5B 1UMCB 3CEMA 1AM4D 4WBNB 1UBKS 2L82A 1IOWA 1IY9A 4D97A 1OT5A 1B76A 1C0PA 4KWEA 1NJ6A 1P1FA 4RUKA 3T54A 2MSEB 1YONA 3AY6A 1DC6A 1GA4A 5TEWA 1UKCA 1Y5NA 2W2MA 3AGPA 5AH0A 2G1PA 2DLCX 1ITZA 4F5EA 1IK6A 1QBGA 4XCXA 4ARZB 1Z5PA 1CUWA 1E0DA 1R88A 1CB0A 1PJ3A 1WMAA 2R751 3C3CA 4TYQA 1YB1A 3TZQA 4C43A 2GX6A 2RKBA 3KDSE 1EUDA 4PCLA 4QE3A 4X63A 2OKGA 5DBGA 5CJJA 1E9AA 3DV0B 5KQSA 2X14A 3BTSA 1N9ZA 3L7OA 4DLKA 1N8NA 1Z75A 4HTFA 2B1GA 3R7LA 4B5KA 1DT5A 1BEUB 3ZDZB 3ZGZA 3H2JA 2HWKA 4DQVA 4KO2S 1D2EA 3PNOA 3OHPA 1U02A 4HN4B 1QE3A 4OKSA 4ZO6A 2H00A 2Y1GA 1SOVA 3KTAB 4C7MA 4E21A 1OPXA 4EW1A 1XVUA 5HYVA 1OE0A 3AR9A 5LJLA 3G68A 2OG2A 4RYLA 2J09A 3NPAA 4IEFB 1AOXA 4G1CA 1UBMS 2NXWA 4EELA 4MRMB 4Q7QA 5KIAA 2CXPA 4OB7A 3RRJA 5HF6