4JA2A

Structural basis of a rationally rewired protein-protein interface (rr468mutant v13p, l14i, i17m and n21v)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
121
structure length
120
Chain Sequence
SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Response regulator
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
total genus 42
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ja2A00
4ML3A 4KPYA 1NXSA 2MYPA 3EJWA 4Z4IA 1AB5A 4G0OA 3SQNA 1DC7A 1GCGA 5KC9A 1PNTA 3G1WA 1JF8A 2MSKA 3NHZA 4XFKA 3TMYA 4E7PA 2FSPA 3C3KA 3I5AA 5KI6A 1Y1LA 4NV3A 1Z13A 3D02A 4WT7A 3IP9A 5KWSA 3OO1A 2QR3A 2JBAA 5C5CA 3Q41A 3QLTA 2CD7A 4B09A 3C3MA 1YMUA 1YS6A 4YR7A 1DZ3A 4YWHA 4RKQA 1RNLA 3HUTA 1I3CA 1RZRD 3N8IA 4KK4A 4HNSA 1ZGGA 1SXIA 2RDMA 4N47A 3NNNA 3CTPA 5TQ2B 2PUEA 2L19A 3MM4A 1USIA 3SY8A 3QX9A 1P6UA 2FMIA 5KQPA 4M88A 3OMWA 2JVIA 7ABPA 1ZGZA 2ID9A 3UK0A 5FWXB 1W25A 2GKGA 3FGZA 4LZLA 2E4ZA 3CNBA 3OMXA 3JVDA 4Z9BA 1DBWA 5EWJA 2OENG 2Q5CA 3N53A 1DJMA 2V0NA 3KKEA 1XWWA 3CG0A 2PUGA 2PUAA 2M98A 1T34A 3KLOA 3JPYA 3DZDA 3F6PA 3RVLA 3IP7A 4YP9A 2IOYA 1EWKA 8ABPA 1EHCA 3OM1A 2WJWA 4ETNA 1KRWA 4RWEA 5EWLA 4YS6A 3E61A 4XXHA 3HEBA 4KMRA 5B3JC 2FQXA 2HJ9A 3LUJA 3JS5A 1RXEA 1Z2DA 3OLZA 2PJUA 1UDRA 2ZAYA 2RJOA 3HJFA 5BRAA 4EYQA 2QV0A 1AB6A 3NNSA 4KV7A 2FKAA 4MR9B 2FEPA 4MR8B 3LUCA 1NXVA 1FQWA 2VUIB 4RXMA 2LUOA 4WZZA 5CNIA 1EWTA 2A9QA 1L5ZA 1LJUA 3QEMB 2LIVA 5CNMA 5DGCA 4G0PA 1YVUA 1Z16A 3K9CA 1QQBA 1JFTA 4MS4A 3KLNA 3RVNA 3IPAA 3ILYA 4XASA 1KGSA 2PE5A 2AYXA 1M2EA 3IP5A 5PNTA 1APBA 1JYEA 3T6KA 4KNYA 2PUFA 1Z25A 3HCWA 4MQEA 2H3HA 4MLCA 3CZCA 2P4UA 3CHYA 2YHBA 2MSLA 1QP0A 1YTUA 4YCSA 3LMKA 3VNAA 4L4UA 3CG4A 1R8JA 4Z9AA 1BDJA 1DP4A 5JNVA 2PAFA 3RQIA 1D1QA 1QKKA 3GBPA 3H5WA 4H3HB 2IPMA 4NCAA 1Z17A 4Z4HA 1JX6A 4RY0A 1P6QA 1JDPA 4JAVC 2QZJA 1SXGA 4KQCA 3H75A 1GLGA 4FE4A 3LUKA 3EULA 4Q6BA 1ZITA 4XAQA 3LUHA 5HQJA 1MB0A 2DRIA 2JVJA 2H0AA 4W5NA 2HQOA 5EWMA 2QW1A 3QELA 1NXTA 3EAFA 4PE5B 2PUDA 4EY3A 4HNQA 2VK2A 2JBAB 5CNJA 1D2AA 3M9WA 3KS9A 1Z26A 1Z12A 3LTEA 1GUDA 1U0SY 2GX6A 3FMVA 4S05A 3TX6A 1E6LA 3UKJA 4H60A 2VYCA 1E2BA 1C4WA 4GPAA 3HK2A 3H5VA 3Q7SA 3HSYA 2VUHB 4L85A 4MPTA 4LE0A 4LDAA 1A2OA 1DCMA 4IGAA 5EWJB 4WWHA 4RXTA 3RVKA 2HQRA 2QVGA 3MA0A 2I6FA 1ZY2A 1NXXA 2R47A 1A0OA 1NY5A 1VLZA 2P9HA 1DRJA 3LUAA 4E7OA 1MVOA 2YHAA 5T7BA 2B4AA 2A9RA 1MAVA 3Q9SA 4NQRA 3SM9A 2MYNA 1JYFA 5BQ3A 1USGA 4FE7A 4EVQA 5EWLB 4MS3A 5TQJA 4RK5A 2RGYA 1U04A 5DTEA 1TJYA 3RVQA 3HV2A 1QMPA 4ZPJA 1D5WA 3GWGA 3A0RB 1OXBB 3OLXA 2HQBA 3UUGA 4LDZA 4EGSA 3ROTA 5BRJA 6ABPA 2FN9A 5F64A 4IRXA 5IEBA 5GQSA 3BBLA 2JRLA 3C97A 1EWVA 4JA2A 1ZHHA 5TPWA 1K66A 1ZH2A 3LKVA 5IEJA 3QLUC 4KFCA 2NT3A 5KQMA 1XHFA 4MS4B 5CHYA 4W5TA 2JVKA 5CNKA 3A10A 4G0XA 1LBHA 2WY2D 1Z15A 1URPA 3MF4A 3HS3A 4WXEA 4MQEB 5GOTA 5HKOA 4MR7A 2NZUG 6CHYA 1Z2EA 5JNTA 3BRQA 2WB4A 1TMYA 2WMYA 4D6XA 2PL1A 1JDNA 2PKXA 4XLTA 4O1IA 5JNSA 2FVYA 4KREA 1P2FA 3GRCA 3LKBA 1E6KA 1JHZA 4JP1A 3ROFA 2ID7A 3GL9A 1U2QA 3CRNA 3EODA 3GYBA 4N03A 5IBQA 5DCLA 3MIZA 1JH9A 3QLVA 1ISRA 4RSMA 2FQWA 1PUXA 1M5TA 3KG2A 1ZDMA 2E4VA 5HM6A 4F8JA 4Q6WA 4D6YA 3HVRA 2PUBA 3H1FA 1Z18A 4RU1A 2WJAA 3O1IC 3O2SB 4RKRA 4YO7A 5IX8A 3RVRA 4O1HA 1FSPA 4OLBA 4LE2A 4TLLB 5TPZA 1MB3A 1ZH4A 2E4WA 1DCKA 4ZMRA 3KJXA 3EGCA 2QSJA 3OLYA 5EWMB 4Z0NA 3QELB 5IULC 3I45A 4LX8A 4TLMB 3URMA 1KMIY 1BA2A 2CWDA 2FN8A 2R4QA 3GV0A 1D4ZA 1P8AA 3I42A 4G97A 4IMJB 3VNBA 4RK4A 3OQMA 4OG2A 3L49A 3RVJA 3GBVA 2HSGA 4G0QA 3RVOA 2O20A 4RY9A 3KCNA 4YLEA 1DBPA 3FFTA 1YMVA 4N0PA 1VKRA 2QU7A 4GNRA 2QXYA 1USKA 4W5OA 4RK0A 2PL9A 3N6VA 2E4XA 3NBMA 1PEYA 3K4HA 2M1ZA 3CZ5A 1PHRA 3KHTA 4RS3A 1BDIA 1CEYA 1GCAA 3O74A 1C0EA 1YK0A 2IPAB 2OQRA 5D2CA 3O21A 3TO5A 4PICA 5C5EA 3KYIB 3L6UA 4MGEA 1YIOA 2FLWA 1FFGA 4QPJC 3H5IA 4OTZA 2PLNA 3LUFA 2PUCA 1GUBA 3M9XA 4KRFA 3O2JA 2QVCA 4QICA 1DRKA 4PYRA 3MYYA 4RXUA 1BVHA 4MS3B 3RH0A 4DN6A 3CFYA 4EYGA 1ZAYA 4DADA 2RJNA 1IIBA 2XDYA 5IC5A 1NATA 4KK3A 2KYRA 3GT7A 5TQ0A 1M5UA 4MRMA 3IP6A 1F4VA 2PMCA 3DBIA 3Q15C 2F8SA 3IDOA 3HDGA 3DGEC 1DBQA 4P98A 3NHMA 2WWVD 3SG0A 1W9HA 2L2QA 3CKMA 3G85A 4YGXB 3OQNA 3H1GA 4N41A 2GWRA 5JS2A 1A04A 1LBIA 2FEKA 3FFXA 1VRVA 1M2FA 1NXOA 5TPWB 1BAPA 1U8TA 4KQ9A 3O2QB 4S04A 4WUTA 1QP7A 4MQFA 5JNUA 5B3JA 2MYUA 1DC8A 4W5RA 1TVMA 3DGFC 4RDCA 4MS1A 3Q7RA 3O1JC 2A9PA 5IUJC 4MR7B 4Y9TA 4ZMSA 5FWYA 1JBEA 3OQOA 3NNDA 1WETA 3F73A 3C3WA 3F7NA 4OBBA 4QYMA 1MIHA 5JNWA 1SXHA 3N0RA 1JWLA 3HZHA 4F12A 2NT4A 4Z99A 1SD5A 4OATA 1YK1A 3LUDA 1ZESA 1FFWA 4EYKA 1TM2A 3E3MA 3TB6A 5ED4A 2MYTA 2GBPA 1YS7A 3HO1A 3HXMA 2NUBA 2R48A 5TPZD 1DG9A 2ZWMA 4LE1A 1JFSA 4F3TA 1KRXA 2IPNA 3QK7A 4JOQA 3SAJA 1B00A 2FTKE 1QO0A 4JASB 4WXMA 3JY6A 3T95A 3BREA 4G0MA 3S99A 1LJLA 2W42A 4NICA 3M6MD 2R25B 1U2PA 3O75A 4XARA 1PNRA 1PEAA 1JFVA 1S8NA 3H6HA 3BRSA 4FB4A 2IPLA 4KVFA 3QEKA 5HSGA 4YV7A 3H1EA 1K68A 3A3KA 3RVPA 4NCBA 1L5YA 4MAAA 2IKSA 3DLHA 3H5LA 4RV5A 1E6MA 2JCGA 4JB0A 5JS1A 5KQGA 3B2NA 1VPWA 1QPZA 1SRRA 2NZVG 3CS3A 3RVMA 4UHKA 3GA5A 3N75A 3A0UA 2FMFA 3N0WA 3N0XA 4Z4GA 3MQ4A 1ZVVA 3EQZA 4Q7EA 5TQ2A 2LPMA 1RZRA 3T8YA 3HM9A 4Z4EA 1H9CA 4MLDA 5TE9A 4RK6A 3CLKA 3EDCA 5FWXA 1OXKB 4IF4A 3EQ2A 2GI4A 3D8UA 3QX8A 3F6CA 5DLEA 5DKFA 5FBHA 4EVSA 4EVRA 2FEWB 3JVIA 3FFWA 3LOPA 4HYEA 5T3YA 3KYJB 4TMYA 4YRZA 4QYWA 4O5AA 3IPCA 2LP4Y 2JB9A 3O1HB 1NXPA 4RZSA 5TQ0B 4ZJPA 3OM0A 4MRMB 1ISSA 4JB2A 4TN5A 3JPWA 1HEYA 4Z4CA 5E3JA 1FFSA 2MSWA 5I4CA 1D1PA 3FDFA 3P9YA 4ETIA 4N0QA 2B1JA 3SNKA 1TLFA 3MMNA 4LRQA 4DQDA 5IUKC 5BR1A 2FLKA 4PEVA 3OO0A 4HNRA 5KQLA 4N76A 4ZYLA 4H3KB 1BDHA 3HUUA 4MR9A 3TD9A 3BILA 4W5QA 3OLVA 4MR8A 1QQAA 9ABPA 4EUKA 5IUNC 1JLKA 2IYNA 1LK0A 4IILA 4MYRA 4P1ZA 3RVSA 4MQFB 1CYEA 4CBVA 1RXIA 4KZKA 1JL3A 2E4UA 2CHFA 3KSMA 3QEMA 4MS1B 4Z4FA 2X7XA 4PZ0A 1NXWA 2L18A 1F51E 1J56A 1ZN2A 3LUGA 2A9OA 5FWYB 4F11A 1QP4A 3Q7TA 2FMHA 4G0YA 3QLVC 4UHJA 3T38A 2HPHA 2FW0A 2LBPA 2F8TA 3CU5A 3DLBA 1CHNA 4G86A 3W9SA 2BGGA 1ABFA 5KC8A 1EFAA 4RK1A 3KTOA 4F06A 2CHEA 2JK1A 1QNLA 3R0JA 3HDVA 3QLUA 3H5OA 4OLAA 5FBKA 4RY8A 3I09A 1NTRA 2FXIA 3ILHA 1QO0D 1EAYA 2N9UA 3OLWA 2J48A 5JNRA 2WRZA 2TMYA 1ABEA 3H6GA 2FMKA 4EYOA 2L17A 2E4YA 3H5TA 4RK7A 2AYZA 4G0ZA 4ETMA 4D74A 2FQYA 1DCFA 1XHEA 1RPJA 2IDMA 3C6QA 4IMIB 3LFTA 5ABPA 3JTEA
chains in the Genus database with same CATH superfamily
2IEYA 1N2CA 1ATIA 1SXJE 2ZWIA 3AQIA 1RYHA 2DHEA 3CH5A 2IOHA 2I4TA 3Q7PA 1DC7A 2Q9UA 3SQNA 1WMFA 1VHQA 4FIDA 4EW2A 1TTPB 3R77A 1H1LA 2C7BA 2KI5A 4AQDA 2B82A 4QGFA 4P2BA 3UMBA 3L1VA 1FMLA 2LNDA 5EXTA 1IY0A 4BKQA 1GSIA 3WQRA 4Y6LA 3N07A 3OO1A 5DN6D 2R1TB 3MSCA 3LDAA 3LPMA 4IIDA 1RWMA 4E5MA 4INZA 1P4SA 5FP0A 1YCHA 1U2ZA 1JHAA 1UC4B 4IIBA 4UZFA 1NOKA 3EHEA 1DO8A 1RYBA 4HJXA 4HNSA 1SOVA 4G1MB 3E53A 3QXCA 3S29A 5BV1A 5P8WA 5J4HA 3NNNA 1QFYA 6YASA 2PUEA 1MZPA 1YS9A 1DTWA 1USIA 1O0BA 1SVLA 2Q4DA 3PQDA 1TM3E 3QX9A 4JQCA 4M88A 3U9TA 1RFGE 3OQIB 5I7VA 4C06A 4TT8A 3LFHA 3WAKA 3KZCA 3CVYA 1R1DA 2GUGA 2OILA 1JG4A 4HKTA 5HWSA 1I3LA 3Q3JB 4MW0A 3DFZA 3STVA 2ZBFA 4LHWA 5CX1A 2AC7A 2H1IA 2QMHA 4CKZA 2V0NA 1J2UA 4RETA 1A7UA 2D0IA 4QQRA 4GMHA 1LX7A 2J5QA 2BGKA 1M2VB 2RSLA 4N5HX 1JILA 4RNCA 3OIYA 1T91A 4B47A 1VLJA 1EFTA 2ZULA 2WWXA 4HWRA 1EHCA 2OHXA 1E0AA 3AJRA 1E1CB 2DERA 4JI1B 4YS6A 4OGWA 2V45A 5TGDA 2FQXA 2HJ9A 1JDZA 3ZD6A 3TVTA 2QRLA 5BUSA 3D6TB 2HK8A 1NNUA 2AA3A 2R4TA 4A0GA 1N6KA 3WWOA 1SVOA 1NVWQ 2XXBA 3CZ4A 3QJYA 4HWKA 3R3UA 4E1AA 3EGXA 4DWVA 2GCOB 2CUNA 3PVZA 2FCAA 4XD7A 4LN1A 2X2OA 5JALA 1GPJA 1DRUA 4AMGA 1ZK2A 4QJ3A 4N65A 2BSXA 3LRTA 1ZD9A 2XV1A 4TL9A 3HFSA 3JQ7B 1WVMA 4I8XA 3CXUA 6LDHA 4EI2A 5B1SA 3OZDA 3R5KA 4YT5A 5JR3A 1LI4A 1YRBA 4IRMA 4UAVA 4MLCA 1WB9A 1ODKA 2HLDA 3CHYA 3UMCA 1XC7A 2AJ8A 3WIEA 4ENRA 2BHNA 2VC2B 4WBNF 5HNKA 3JD2A 5CK5A 1T2FA 2ZQYA 2HRBA 4JIMA 1S6YA 1U5BB 3TL2A 4M6WA 5F9MA 8LDHA 2IYOA 3KOXA 1O94C 1P4GA 2IOFK 5LQKA 2QJFA 4J0GA 3FROA 4YDQA 3ZWYA 1ENOA 3EWAA 1AV7A 1ZD4A 3KFVA 5EKSA 3X1JA 1NE2A 3ZHXA 4D9BA 2ZAGA 1DE0A 1WMDA 2FFHA 2FY8A 3NETA 2IZ6A 3O4FA 3P7MA 1X77A 3HR4A 1GLGA 2Y77A 3GXBA 4KO8A 1IXZA 4PO1A 5D3QA 4D57A 4R71A 1AA6A 2XITA 3BPSA 2ZBDA 1YXMA 2X5JO 1W2GA 3JQFC 4L74A 2GTIA 4B80A 1ZITA 2J9XB 1A69A 1R88A 4DILA 1T5TA 4WFIA 1PFUA 2R7MA 4L5BA 1OGJA 3VPGA 1ZI8A 1E7RA 1WNFA 3D6JA 1WKCA 2WG0A 3FWPA 4D4MA 1UDXA 5IVPA 2JPDA 3K1ZA 4YI5A 3EG9B 3QUAA 3ZZTA 1RACA 2B99A 5F4BA 5KJCA 2UVPB 4D3SA 5LNK6 5T3UA 4G67A 5AXDA 2WHXA 3KXKA 5DYNA 4BO9A 1EP2B 2C5EA 3TPZA 2H5JA 2YCBA 4JX8A 2O7RA 4WK4B 3EARA 4REOA 1WZIA 1SC3A 3NHFA 4BNWA 3GIWA 1TYAE 1Q5PA 4P4GA 3ZHTA 2W6OA 1NC1A 1A2OA 1DCMA 1GL7A 4ZHQF 4XWWA 3QUBA 2NWQA 1FS5A 2RH8A 4ZT2A 2IP1A 4JVNA 5EI5A 5L7WA 5ALTA 1NXXA 4W6ZA 3UY4A 4RSGA 2XOEA 3SR0A 1F5NA 5EQJB 1QHFA 3WTCA 2IYYA 2P3SA 4ZRDA 4IDNA 3UV7A 3ZDBA 3C3BA 3OHSX 3WJ7A 4X6YA 3R23A 4HUQB 2JG3A 3DEZA 5JAOA 4PFQA 3RRMA 4BMPB 4HNAA 3V2UA 2A7XA 3EXAA 3GG2A 3N76A 4YY3B 2BPOA 2YVAA 1GTSA 1XLWA 1J24A 4FT4A 2H2HA 3AHJA 1AN0A 1ZW6A 3Q5EA 1H2RS 1DV1A 2Q8NA 3HR7A 4WESB 2YWGA 3LDHA 1GFZA 2H1VA 1W581 4WKBA 2D5BA 4GBED 2EYUA 4YPOA 1PEDA 3AO0B 3U31A 4G0NA 1C9EA 4NCXA 2C4KA 3CMCO 5ALNA 1C29B 5T64A 2YDXA 2YW9A 1EUCA 2G04A 2OLEA 3N3BC 1DNPA 5I9SA 2QT9A 3FSEA 1AGRA 3A0RB 3U4HA 4FGZA 5IC4A 3UUGA 1I7PA 1G4UR 3O8QB 2AYYA 4OB7A 3BGDA 3P97A 4ENQA 5JCXA 1P7VA 2NVUB 1ZA1A 1N0UA 2D4HA 1JHDA 5FHQA 1PD1A 4A5SA 4JA2A 1B2RA 1KZHA 1M0TA 1HORA 2KS6A 3O92A 2I9PA 1BVYF 2FFRA 2P2YA 5IEJA 5B58C 4RZUA 4KJZA 5HRAA 5LA6B 5G4LA 5ADHA 5ICSA 4BV8A 2NP7A 3RRBA 4L57A 3CWQA 5D3MA 3PX7A 3TTSA 2P9CA 2I22A 2WTMA 3R24A 3DFUA 3U44B 3MW8A 4CIWA 4TZ0A 4ZVRA 2ECKA 1T2UA 3O4VA 2Q9CA 4KXFB 4M9SA 2MJLA 5LZ8A 3H19A 2I3BA 2WMYA 4J07A 3HXOA 4N3NA 2J30A 1NW6A 1JFFA 2B4QA 3D6UA 3NTQA 4P35A 4QXMA 4EM6A 5GV8A 4RA9A 5C7IO 2J4DA 4GE0A 5J58A 5EUCA 2ID7A 2HU2A 3CRNA 2OHJA 3E15A 3GARA 1WDTA 1PUXA 1XVIA 3A3OA 3QPAA 1R6TA 2C20A 5ALWA 3B51X 2WFMA 4Q6WA 4RIIA 4TV9B 5DM70 3HVRA 2A6PA 2PUBA 3TMKA 3HB7A 2XDAA 3M6UA 4L8GA 5I48A 4KR6A 4XR4A 3DHYA 4GMDA 2I8CA 1V8FA 2WSIA 5DULA 1B0ZA 2HF8A 3ADPA 3CRRA 4PPYA 4UQLA 5SZKB 5K0SA 1YDWA 3OOYA 3MMXA 4NHOA 2RGNA 1UEJA 5FL7A 4DPLA 5CYOA 4E4TA 2QTFA 3E9RA 1MOQA 3RU7A 3K30A 4DQKA 3QELB 3W5CA 3QMVA 2YXNA 1EP9A 1GKIA 1MDFA 1YE8A 1HL3A 4MPJA 4C7VA 1JG7A 4ONEA 1Q0TA 1BA2A 2JFQA 3D1JA 3R76A 1E2NA 2VHEA 1NRWA 1IJEA 2FETA 2PVCA 2P90A 3E9NA 4IXTA 2VHXA 4X64B 1H2ZA 3L49A 3O38A 1Z88A 5CFOA 4L2IA 2QK4A 1Z38A 2DPLA 2ZJ0A 1T8RA 4DLZA 1NQUA 4L7QA 1DBPA 1ZVKA 4BO5A 4BB5A 4LY9A 3BWXA 2MMCA 1WUYA 2HSDA 2D5LA 1HQYE 2BFDB 2YHSA 4IIGA 2R62A 3K16A 4Z4QA 2QX9A 3N6VA 1VE5A 3NBMA 5J9FA 4OL9A 1W36B 2M1ZA 1NZFA 4RS3A 2PKQO 4BNXA 1LW6E 1C0EA 1ZMRA 3R3HA 4HEA1 5EZSA 1E18A 4IJQA 2EZTA 3GLGA 1OAAA 3DTNA 2ZZKA 5F7XA 4G2TA 2H11A 1IK4A 4FYVA 1FP4A 4XGNA 4Y9UA 3T35A 1L3IA 1DC3A 2PXXA 1PX0A 3I37X 4D99A 1BZYA 2EJTA 1XTKA 3M9XA 3THOA 3J81k 3O0TA 1U0OC 3I58A 4B3MB 3DBOB 3NAGA 4RXUA 1RXYA 5IYZA 5JDIC 3H65A 1ZAYA 3IGFA 4EQ6A 4ZK6A 5JARA 2FWMX 3JD1A 4MKXA 4DSTA 1JLLB 5IC5A 3ISTA 4DWJA 2Y6VA 2ERYA 2Y9PB 3L4EA 3I6YA 1T13A 3BWCA 3NCHA 5A6SB 1JMKC 2I55A 3VR3D 4OAPA 3G2IA 5H3HA 3C3DA 4LZOA 5LXTB 1EFRD 4HO1X 4WK0B 3HDGA 5C8DA 3R75A 1JXOA 2BM0A 2XAAA 2VH1A 4DBLE 4F3KA 2BLNA 2C2YA 4EHHA 3ENQA 1VFPA 3UMMA 4A0HA 1QYDA 1ZGAA 1CG6A 4YRJA 1MEJA 1ZW1A 4L6IA 4U7GA 1OSNA 3WRWA 1WZNA 3FMGA 1R3UA 1Q77A 5CFZA 1LKZA 5DPMA 3TW6A 5LJLA 1PCXA 1N2EA 3X1YA 3IAHA 3Q7RA 4DSAA 3OC6A 1EI9A 4RIGA 3ZU5A 2ZG6A 1JV2B 2QQEA 5HDQA 5F2EA 2AK2A 3JXEA 3PFCA 1X3SA 2JJQA 1TW2A 3DHEA 3OPNA 4OBBA 3ELDA 4EGFA 5B6JA 1XRMA 2NO7A 3CNOA 2XRYA 3W5VA 4BLVA 1ODIA 2XBMA 2VHJA 3W7BA 5F5NA 2I6UA 1SD5A 4N3GA 1NYTA 4LJ4A 1RZ3A 2ZB7A 2ORIA 1L4MA 4IXNA 4DV0B 2A78A 3N8HA 1WKVA 2OWEA 3AOEC 5IFLA 2W48A 2CDNA 2V4ZA 1TQ4A 4H17A 3RSLA 3T7CA 3RTDA 3Q3VA 2MINA 4C78A 4CLOB 3ELUA 3ZHQA 3H4TA 3HB1A 4N8SA 1SBHA 3CF2A 1DL5A 1HYGA 1WTCA 4XWTA 3FVWA 2WBLC 3RG2A 4BOYA 2H2AA 3STYA 2CJYA 1N7JA 4XM1A 2H2DA 2BLLA 2WT4A 3OOSA 1Z6TA 1F2TA 1IEXA 2FFQA 2ZSJA 3M6MD 4RLHA 3SDBA 2CLLB 3DE1X 3ZWQA 5EP4A 3S2SA 3IKMB 3PC2A 5KAPA 1O94A 3ZGYA 2CVFA 3DH0A 4RORA 1P4HA 1M1NB 5EPEA 4PFSA 3FCCA 5U4XA 1IZ9A 5F7JA 2OFWA 3U09A 4TQUS 3I2FA 1UDCA 1IXRC 5BN3A 1PE0A 2TRSB 1DWPA 1YHYA 3L0YA 4WKPA 3SFVA 2B92A 3JQFA 4RVCA 4Q02A 3DTYA 2F9MA 4OKNA 1AVTA 4Q3DA 1NMZA 3GI1A 4RV5A 3WQBA 4E12A 4FUQA 4CM4B 5JS1A 2Y8EA 1D5CA 3VNQA 3ZGZA 3FZYA 1GYRA 2OESA 3K8QA 4PLZA 4BRZA 2W2MA 2OORA 3L0DA 3X1DA 3IMCA 5F3WB 3UKOA 2M32A 4QOGA 5GY7A 5DLQC 3C5WP 4M0FA 1T4CA 4A7PA 1L0BA 2OY0A 1XPRA 4Z4GA 4YJGB 1RZUA 3LCVB 5IF9A 1DPFA 2LPMA 2C7GA 3D7NA 2HOQA 3H3FA 4QBKA 5K8CA 4XCVA 1SCJA 1YUMA 4Q1DA 5JAZA 5KYUB 4WE3A 5KOYA 3RRFA 4EUHA 4MVYA 5CXXA 4M9CA 1T29A 2JFHA 2Q5FA 3AC0A 5DLEA 4TMVA 4BNLA 3VZSA 3VMFA 2B2NA 3C5CA 4RY2A 4JUDX 1M1UA 4YRZA 4PWYA 3MGKA 4ZVMA 5AVUA 2PPVA 2AG1A 3K3PA 4X63A 4NE7A 2BEUB 1P39A 3DDCA 3K1TA 4LOJA 1W93A 1XJQA 2WD8A 3A7EA 4HQNA 1JA0A 3KZVA 1Y1KE 2C1XA 4QXRA 3QI2A 1SQGA 4JU8A 4HCJA 4N54A 1LLDA 3GGDA 4P38A 3X1MA 4TUYF 5EJ5A 2P7IA 1JLSA 4HTFB 1SKAA 1ZR2A 8MHTA 1R0WA 4W6QA 2ZQ5A 2ZS8A 3X2SA 4J4HA 5KYNA 3V1LA 2ZWAA 3E8XA 3FJOA 1Z2OX 1Z5WA 5HEKA 1QIHA 3P2KA 3TD9A 1G8YA 3OCCA 3DBVO 3QHQA 3PHIA 2V1UA 4E88A 3LNTA 1BS2A 1CQZA 4MR8A 3V7YA 2XWBF 4R16A 9ABPA 3GLFA 2FRDA 1QP8A 4QJIA 3R3VA 4UU1A 5LNK1 2NNWB 4AVYA 1UOOA 1FS4A 3AR9A 1KYQA 2CHFA 3BJIC 2CMHA 3KEFA 4GT1A 1LGYA 2ZJFA 3BFXA 3EIEA 4NBNA 4MV7A 2NAPA 5CEFA 4W9MC 4KSBA 4QECA 5DNAA 3MZ0A 1A8QA 1YZUA 1ZN8A 2FMHA 2ROQA 3FSGA 2H51A 4M0LA 1QOZA 4CMBA 2F8TA 3PDWA 4LWZA 4I4TB 1GQRA 2MHCA 5G0VA 1XT6A 2OFOA 4W1PA 1C14A 1THTA 1GZSA 2DQZA 3BL5A 2C96A 2YCLA 3LE8A 5JH7F 1IOVA 1U3VA 3ROKA 1DDGA 4K9NA 2RFLA 3V1NA 4F9GA 1XTPA 5JMTA 1LDMA 1LBSA 3WK9A 2QLBA 4AY3A 1J0XO 2AQHA 4FHZA 1QO0D 1EAYA 2YINC 4ZCPA 1H2WA 1FQKA 3E2PA 4DANA 2AG5A 4K03A 2PSDA 3I2JA 5JZ9A 4NONA 3ZWDA 4RK7A 4CDGA 3V4RA 2C4WA 3R0XA 2W0MA 1JNYA 3CPSA 4M38A 4M1MA 3SZRA 1LPBB 4BWVA 2ONCA 2CB9A 2ZDQA 5HOEA 1O5OA 3VISA 1O9GA 3IV7A 3FBWA 1P62B 3RRJA 3TXXA 5D6NA 2PV7A 1KMNA 4CKXA 5C1BA 2RHDA 3C24A 1Q7EA 2FZGA 4PLPA 4R1UA 1GCGA 4URWR 4DJAA 2A9KA 3H9CA 3GEEA 3G1WA 3HCPA 1W88A 4GOKA 4A2PA 2FSPA 5KWVA 3ESAA 3KEMA 1PKXA 3D54D 1GWNA 3G2NA 1IJBA 1WSWA 4RGBA 1DUVG 1T5OA 2PT7A 1DAIA 3D02A 3NOVA 4XYMA 3LWBA 1QBGA 3IP9A 5I9MA 1XHLA 3VR5A 3WL7A 4GPZA 3FDZB 5ILGA 4Z6KA 1L7NA 3JQAA 5F12A 1YS6A 4CWAA 2QF7A 1SKUA 2YMPA 3OZTA 4EABA 1DZ3A 1P9OA 5C1DA 3V8QA 1JRLA 3U7HB 1ELOA 3F97A 4B3IA 3PWKA 1M10A 4NNPA 3KQHA 1H0HA 1I0ZA 4Z53A 1B0UA 1LQUA 3HFRA 1ZUHA 3DQZA 4PRZA 2G9VA 1JXQA 1KZGB 2I7VA 1AN9A 3B82A 2R84A 3OEED 3UHOA 1A2QA 2NOAA 3KAJA 4EQZA 4F45A 3OX2A 1OLUA 4KW7A 1X92A 2GKGA 1T8UA 2OQ2A 1G8HA 2J3DA 3KD2A 2NSJA 4NZ9A 4O2BF 5TX7A 5K6RA 2OENG 3EH2A 5JZOA 2VT7A 3G0DA 1AF4A 4QQNA 3UCEA 4XFJA 5A5FA 3QKSB 4N0DA 4RIHA 2VDWB 3PHLA 2CV1A 1XWWA 2D62A 2HPZA 2M1XA 2WW8A 2WYVA 3GLTA 4IZHA 3ZLTA 2PWPA 2QTHA 3QITA 3ZW9A 2OOKA 3RWOA 1RLOA 1OZ0A 3A4VA 4XSVA 3TRHA 4GQAA 2OXFA 5CA0F 4FE3A 3U5ZB 3E7FA 4GNKA 2EBUA 3GH3A 3T5PA 3GDFA 1HY3A 3KTAA 4JBHA 4Z9XA 5FPYA 2ADMA 4H4EA 1OBFO 4JUBA 2C2WA 3LBFA 4DB4A 1G8JA 4R2HA 4OHKA 1QWOA 1UUFA 3VDXA 4FFVA 1UP4A 4IDPA 4F9FA 3DCIA 1ZRSA 4OYRA 2QTCA 2ZRIA 1DAMA 4D42A 4WZZA 2E9SA 5G0SA 3C14C 5DYGA 3B9BA 1R4ZA 1FTNA 1Z16A 5KQRA 2V7PA 1P3Y1 4O8CA 1LXCA 3JYNA 5G41A 5EYPB 1L5RA 4A0SA 4HOYA 4XB2A 4Q9HA 3JAKB 4NNOA 3WHKA 1F12A 1JIXA 1WZEA 1WWKA 1CUSA 2GJAA 1UFVA 2H2GA 1YJ8A 3UWDA 1IL0A 6REQB 2O5RA 2QGNA 4KKVA 1N8KA 1TEVA 2BFBB 5E9AA 3SF8A 3COYA 4LI0A 2HWYA 3G2LA 1MJFA 4ZZ1A 1HA3A 3B6EA 2XQGA 1G5HA 3JYQA 1CT9A 4E6PA 5JWHA 1GGVA 2WSBA 4K87A 2GZ3A 1NLZA 5GZ1A 3O9MA 4U7FA 1MO4A 2HBYA 4LVNA 3IMGA 4Z49A 2XT6A 2MDTA 4NV0A 4FHEA 1UL1X 4P3KA 3SZOA 1P6QA 5CCBA 4RGQA 3NFRA 2GXQA 3MFYA 1GM5A 2Y27A 4CEHB 4RHFA 3ZDZB 3AVVA 1SC9A 4ZT5A 3KPJA 2PMEA 5FUXA 1P2UA 1MG0A 3DPIA 3E4CA 2VF5X 4LNUA 3JAMA 5HQJA 4K26A 2QBYA 4XUGB 3HPRA 3S55A 3MK31 3EPRA 2J0UB 1N2BA 2DRIA 3BRWD 3PGA1 1CJMA 1RAAA 2VNJA 1Z0IA 4HQ0A 4KLNA 5H4HA 2XIQA 3OF3A 1BC5A 2R87A 4Y1RB 2QPOA 4Y6QA 5BSTA 1FZTA 1D09A 3R3ZA 3VPCA 1M72A 4U5QA 4MP3A 4I3GA 1KVRA 1I13A 3NRBA 4AM8A 2QRPA 4OXIA 2GAOA 4ZOLB 2ZCJA 2IHZA 3K92A 5DN9A 3NONA 3FBGA 2Y1GA 3KR1A 4QWMA 1Z6AA 2Z57A 5FEMA 4QYIB 3W3AD 3R0QA 3WGHA 4PFKA 4K0KB 1U99A 1UBLS 3SJCA 3SEFA 5IS2A 1XP8A 1E3SA 1DIRA 2I87A 5C4GB 2PX4A 1L5MA 3H5VA 3P2EA 3PFIA 5AW5A 3HSYA 1WHTB 3C6ZA 2Y66A 3AONB 3VUFA 4I1PA 2PFSA 5LFAA 1QK3A 1R4MA 1OFHA 1VB5A 2I2WA 2PXCA 2WE7A 3EE6A 5BQOA 1QIEA 5NULA 1FP2A 4A03A 2IEZA 2F3RA 3KT6A 4HVLA 2DFDA 4V2UA 3KELA 4HZUB 4JC0A 2EJWA 1SELA 4JENA 2XODA 2GB4A 2AOUB 3CUEF 4E7OA 5B7GA 5T7BA 5KNBA 4EZIA 3TNYA 4Y2JA 1NUAA 1QKIA 2E6UX 3CX7A 3TTXA 1WF3A 4MYHA 3BTVA 4FYXA 2Q3LA 5CYPA 1Y4AE 2P1DA 5F23A 4QT4A 1I5RA 4X7RA 4YRNA 3LM8A 4WZBB 4EVQA 1M6VB 4OK6A 4HLUC 4LXIA 1YQGA 1ZEMA 3K9GA 3UN1A 3GEIA 2VVTA 2GLTA 3NANA 4L08A 5TMPA 4M1YA 1FXWA 1E2DA 1LF5A 1TJYA 3KQMA 4TYQA 2AOVA 4UXIA 4NS1A 2WUFA 4BEVA 1P2DA 1UP6A 2A5FA 3GWGA 4UTVA 1TLLA 3GJSA 4GYWA 1RAFA 1R0KA 3K0FB 1VKZA 1SBYA 2WP0A 4MUGA 1ZBDA 2VPWA 2ZP1A 3C8MA 1U65A 1PZEA 3T3GA 3G5MA 1A88A 5KINB 4H27A 2Q6IA 4RVOA 3VYRB 5KNDD 2D2FA 3B48A 4R8KA 1EA7A 5A2QA 4BY9E 1P4AA 3GJRA 3L3BA 2CBGA 4QLOA 3U7IA 4FNOA 1VYHA 3O8OA 5CHYA 4LVCA 5MGBA 3SHOA 3TVDA 2XKAA 2GEJA 2BC9A 2QZSA 3E48A 5LZ2A 1SHTX 5ICCA 4L9AA 4WK6A 1JHYA 2JRCA 6CHYA 2XUKA 4A36A 1N5MA 1G5FA 2G40A 2PGOA 2RAVA 1M67A 2IEBA 2DBQA 2ONJA 2OGUA 3ROZA 1GPDG 4N5IX 1SCQA 4GI3A 4O1IA 1SBZA 3RIMA 3KALA 3MBIA 4KREA 1JEQB 1QGZA 2P0YA 4YUYA 4I7EA 3QWHA 3M5CA 2ZSAA 2LTAA 4X00A 4HV4A 2ATXA 5K20A 2HT1A 1ETUA 4W5WA 4RSMA 4X85A 1ORIA 4F1JA 3QF7A 4Q7JB 4DAEA 4GKKB 2GCEA 3NHSA 1IEVA 5CYGA 1CVRA 2IXEA 3C41J 4Z8XA 4CMHA 1VIVA 2VATA 4TYPA 2J85A 2JASA 3L93A 3G5AA 4E4RA 1TYDE 4E94A 2C5GA 3FPCA 2B61A 5JFGA 4ZVNA 4AY4A 3H84A 2Y1KA 4ND7A 1ZH4A 2Z58A 3OF5A 4O6VA 2Z6AA 1A1VA 2PLAA 1QYXA 4KJXA 2QLFA 4QVIA 3EXG1 5IJ9B 1B8PA 2O2IA 2FPSA 1H69A 3K0AA 4XGKA 3BT7A 1E6WA 1IDOA 3HTXA 3OQMA 1XTVA 4J2HA 5AICA 2CBXA 1MAHA 2ZYHA 5DLDA 5UKDA 3WB2A 5KVAA 1FW6A 1P72A 1ULUA 2Q8QA 5JTUA 1U4SA 4W63A 2F00A 4IXMA 3LPLA 5DM4A 5DOVA 2XA1A 3PYLA 2B20A 4BP8A 2HSJA 3CLSC 4AN4A 4QBGB 2AV6A 4QXOA 3VYSB 5L40A 3KHTA 3KSRA 1REQA 2FZCA 1ZJZA 3DEYX 3GPDG 1AXRA 1JNXX 3DLCA 4YRQA 2BGIA 3NM6B 2CSXA 5B5SA 1XYVA 1PV2A 4TKVA 4QDZA 4CMEA 4JYAB 3AJ8A 1MX3A 3O5AA 3S1AB 1N3BA 2OFPA 1QSGA 4A5OA 4IOKA 5J23A 3VR2A 1FFGA 1K6EA 3ENZA 3B3QA 3BD8A 3G82C 3BUSA 4MUMA 3H05A 2FDRA 1BJTA 4FFLA 2P2LA 1VP3A 4J3FA 4NMLA 5THQA 5JSZA 3ZWKA 1C3VA 1C0IA 3FWKA 1VLHA 3GNQA 1XEXB 4EECA 4ZJZA 1MQSA 3O8DA 4ZQHA 4AO6A 4XSGA 4MS3B 3RH0A 1ACMA 3RKSA 4DN6A 4RYDA 1J97A 5JNLA 2NUTA 2RJNA 2O3UA 2HU8A 3OPMA 3RSZA 1WW2A 3RHZA 3KL2A 5EAIA 4U7WA 1Y6FA 1J0BA 2GLXA 1IY1A 1NFFA 1T25A 2KYRA 4HAWA 4O4LA 4AWBA 4YLYA 5JO9A 1NJ8A 3AESB 4FR5A 5DLPA 2VAVA 1M73E 1SULA 2H52A 2OCKA 2NO9A 3UJNA 4PGMA 1UZLA 5CXUA 1I9CA 4LBVA 4CG3A 4ROSA 2FEKA 3CEAA 2NZ2A 4N6OA 4L07A 5DCWA 2JLZA 2DSNA 5JTTA 4GWGA 4WUTA 5TF4A 5DHPA 1FK8A 3BGIA 1YB4A 3OUTA 5AM1A 2WIJA 1GR0A 2AD1A 2ZKIA 2YVUA 4Q7LA 4ACBA 4BGEA 3O1JC 1IMJA 2I6QA 4OLHA 4KUHA 5BSRA 5CFRA 3ETGA 2NO0A 1NVVQ 3I8SA 3SFZA 3UJCA 1L5SA 1U7WA 1TEZA 4BMXA 3JZMA 3C3WA 4OMUA 4JI3B 4DABA 4QYMA 3H9JA 1RRCA 1OPRA 2VP2A 3LPCA 4I50A 1U0EA 2G5PA 3AEKB 1W0KA 2AIRA 2B5VA 4N7MA 1XVUA 3SJ7A 4KPUA 4DE5A 4Z54A 2O8CA 3ICQB 2OXEA 3HA7A 1QDUA 2YFKA 1POXA 5EJEA 1GNPA 1DJPA 1KZ9A 3NIDB 3HWX1 1GU7A 4DXHA 4C7OA 4HP8A 4CKYA 3GLIB 1LRJA 4ILKA 5A7GA 5IN5A 3UAVA 3WYFA 1N1DA 1R6BX 3NYRA 2Z8YA 1IBRA 3BF7A 4DQUA 2QUAA 2AW3A 1GZ7A 1MEEA 3U13A 4B7CA 2B1QA 3HYTA 2XUGA 1O08A 4EG5A 2Y0PA 1Y6ZA 1FC0A 4XZ3A 5IBCA 2AMJA 3IDZA 3RABA 4F6RB 2LZ0A 1FDSA 1S8NA 4KCGA 3UA3A 4C4YA 3QEKA 4HDQB 4B9AA 4TLEA 3LBYA 1RWPA 1R18A 4AG6A 4HFRA 1UADA 4TRNA 3G2PA 2HN9A 3DLIA 4AZTA 1CIJA 3EMVA 1QZ3A 4JB0A 2DBZA 3EVEA 1KKMA 3GQBB 3ZOKA 4DCCA 5KQGA 3DBLA 2ZAOA 5DHQA 2V7QD 2DTEA 1QQ7A 3NALA 4G41A 1S01A 3U81A 4YMGA 3QVGB 1SWVA 4GE3A 4CIXA 4GG1A 3EGDB 2VCHA 5LOVF 1Y9DA 1WB6A 4Z4EA 1V43A 3I6ZA 2WTNA 1PLLA 7REQB 2O0JA 2ACWA 5J5AA 1BMTA 4BX0A 3L7CA 4HXYA 2GM3A 1HRKA 2ZWOA 2OXCA 2VPQA 2UKDA 5JJKA 2V03A 1HT3A 4N01A 1G20B 3BSWA 3F2VA 3JARB 5D00A 4AMVA 2PDAA 2O8VA 1GTVA 4D8YA 4Q7QA 2NO1A 2O7SA 4EW3A 3I1YA 1TM4E 5H3LA 5GJCA 2IE8A 5ESXA 3HVKA 2X3UA 1ILWA 5EMJA 2BYTA 3RGGA 4G0WA 2QQ0A 4A4DA 5JXWA 3P94A 4G9BA 1FL9A 3QVWA 4H7IA 4QAJA 5IN4A 2IQ5A 2VAWA 3UJHA 2AF4C 3WDSA 2IZZA 4U02A 5HF6A 1DAKA 3VAYA 1E4VA 4FW9A 4M98A 2MCFA 1II0A 4DR3B 3D3EA 4PX3A 5KQLA 2AMFA 1WY5A 1P60A 3W1WA 2P8JA 2Q9BA 4MKZA 3ZJVA 3DKIA 4J0QA 4C4TA 2UYHA 4YRDA 2EKZA 2FWPA 4GLFA 2BEWA 4G5OA 4MYRA 4YP5A 4ZCQA 3TSAA 4DFDA 3QW4B 4MQFB 1X6VA 1CCWA 2PZLA 4WOKA 1GVHA 1DEHA 1O97D 5F7OA 2X7XA 3KYCA 1COWD 1LLUA 1KP3A 2PEZA 2IYFA 2XYQA 2WWRA 1TUGA 2A9OA 2XOKA 1YCFA 1MABA 4PO8A 4UVEA 1P75A 1PT8A 5IT9A 1MHPA 4RSRA 3Q7TA 2P9GA 2VJYA 1KAQA 4ZK2A 3EPHA 2FW0A 2CDAA 1JBKA 5L3SA 4NJMA 1YBFA 4UNQA 3L8GA 4G86A 2BGGA 2XDQB 5KWIA 5EJ7A 1JSXA 1BWQA 3H2KA 3SSAA 3ZKWB 4BO2A 3L8EA 5K0ZA 5J2TF 4WD3A 1QWSA 4BVEA 2IVFA 2QEQA 2OFFA 5JRJA 1Y3IA 2BJWA 2A92A 2ZSBA 4RFVA 3PDIA 4EPVA 1UMCB 1QF6A 4QX6A 3GLRA 4HDNB 5F76A 3M6IA 2IYTA 3NORA 2V7WA 3KLMX 4JN6B 1PF7E 4QBTA 3JWPA 4F4UA 1E3WB 1Q1NA 4O4IA 4FCVA 2Z4SA 1KDYA 4AULA 3O8LA 2AYZA 3IT2A 3ZXXA 2WUEA 4JLUA 3MN1A 3R4VA 1E5TA 3Q8XB 5G53C 3G8YA 2DVMA 5P21A 1VJRA 3C6QA 1OKKA 1KOJA 1BWSA 3I92A 1VKOA 4AG5A 3TSZA 4K40A 4DSZA 3OOWA 5EJGA 1H6CA 3PA6A 4D80A 4OXKA 1U8FO 3HP1A 1IWBB 1HNXB 1OPXA 1A1SA 1UBSB 4EGQA 1TCAA 4UMVA 4ZVQA 3LOUA 5HK8A 1N6HA 2G9NA 4AY2A 2QX8A 2IP2A 3C3KA 4XJSA 1P8JA 3I5AA 1AKEA 3BKWA 5ENZA 2HJGA 3WLMA 3UV6A 4GKJB 1W4CA 4B8ZA 5DASA 3P52A 4Q1FA 1WO8A 4RFLA 3T3DA 4F0JA 3HP7A 4OJMX 4DMRA 1MRNA 1Z2AA 1RYDA 2DULA 3PGMA 5DSTA 2A3NA 1W5FA 2B0JA 4E11A 4EELA 4LF6B 1Z06A 3NUQA 4CEJB 1XJ0A 1SUEA 2C4NA 5LDGA 1L3BA 5REQA 1NL3A 5LZ4A 2KMLA 4LK2A 3RROA 3R8FA 1MP0A 4FU0A 2JVIA 3P26A 7ABPA 2ID9A 2XMCA 4I19A 1UEXC 6GPBA 4KH1A 4BXOB 2W6JD 1UMDA 3WWCA 1BMFD 5K0TA 4PXYA 5NLLA 3V7WA 3SQMA 4LF9B 2CXNA 1SUIA 3AEZA 2Q5CA 5A06A 4O2AF 2ZJZA 3K5PA 3WRYC 3DBHB 1FSFA 1J9ZA 4ISCA 4M60A 4AIRA 3UHFA 4LF7B 5KCMA 1HFEL 3IELA 4CCAA 2L82A 2PO5A 1Y3DE 4V0QA 4ARSA 3NFYA 4PZZA 3WIUA 4C6TB 1IBMB 2Q0SA 4LC0A 1DIGA 1Q12A 1TKAA 5HGXA 3V8MA 2VRBA 3BF8A 4W99A 4YP9A 4M37A 4B8YA 3QMMA 3D9QX 4MHTA 9MHTA 2F1IA 3AM3A 1OIXA 1B6RA 2AH5A 3D1VA 3QPCA 4KMRA 2M9MA 1DXHA 1Y7IA 1ZP6A 3AR6A 1ENYA 1XFAA 2DQ4A 2W71A 1PZNA 3LO8A 1I01A 4MQ4A 5C4MA 1VSUA 4TS9A 1EVYA 1KFEB 2ZRHA 3ORRA 2WSLA 4URYR 1KWGA 3QW2A 4RXMA 1WUJS 3JQBC 4ZIRB 3ADCA 1NQVA 4UUOA 3AETB 2HJWA 3IKJA 3ZV6A 1EWTA 4O4JA 3EEFA 3AW8A 1CUBA 1IWOA 1FF9A 1M1XB 4ZXPA 2G0AA 5IARA 5CB0A 2Z9DA 3H86A 3H87A 5I7UA 1VDZA 4JGGA 4CIDA 5I7HA 5K8TA 3H2HA 3C3EA 4JBXA 2EF1A 3QX7A 4ZAVA 3R8XA 4B3CA 3IUMA 1OWPA 2FOIA 3P0EA 2PE5A 1YQ9A 1DX9A 2OOSA 4NDZA 5DW3A 3V7UA 5BW5A 2DPHA 4DZTA 1GDDA 1XLTC 1SVKA 2B8WA 2H3HA 2J3QA 3FHCB 3L0IB 3WDMA 1R5OA 1Q20A 2PMFA 4PLFA 4KP7A 3TJZA 3TRKA 3DAPA 4KHZA 2QPLA 4C1BA 1QK4A 5CDHA 3IE1A 2Y76A 5SZIA 1C7JA 1G8GA 3EGIA 3FZEA 2Y1XA 4UBKA 5F3DA 3DAYA 4HT3B 2VG8A 3M1YA 4YRCA 2IEIA 4U9HS 1VRCA 1ZSNA 1GGHA 1UBOS 3C6KA 3WKAA 2ZUFA 2IBTA 2V0GA 4ZZ2A 2P4EA 3AF1A 3GGPA 5JVDF 1DCTA 2XCIA 3LZCA 3P9RA 1JMYA 1Q57A 1UKBA 3BXZA 1SXPA 1RI5A 4NZZA 1QGUB 4LDJA 1M8GA 1V0JA 3VA7A 5JU6A 3BE4A 3REFA 3DW3X 4LJYA 3WNZA 4CHGA 2EZ4A 2GXUA 2V1XA 3KTDA 2DWPA 4IGIA 4K3VA 3PTZA 4K7JA 5SY4A 1TKBA 3WLFA 4BNGA 2X9VA 3D0OA 4TWJA 1LSSA 2G8NA 1B73A 1CDZA 4GSLA 4OY3A 3T9FA 2WJPA 1Z83A 1T0HB 4HZIA 4MVXA 3SYMA 3FUVA 3U9LA 3MILA 1GU1A 1S3GA 4OM7A 4UEQA 4YRGA 3ANMA 2CK3D 2DTXA 1YR1A 4HNQA 5ESDA 2BUCA 3AGQA 1W7AA 3Q0EA 3M9WA 1IPFA 4H1TA 5JSKA 1CP3A 4I5IA 5K3SA 3U7QA 2QN8A 5A3JA 5FWAA 5C5IA 3V8PA 5K01A 1X7YA 2BWJA 2QP9X 1RWXA 1G8FA 4YROA 1NBAA 3ZIAA 2B30A 2IUFA 1HXHA 2JD0A 3FNRA 3VSDA 5ADUS 4DA4A 4TM7A 3ME5A 4G1FA 1SIBE 4O02B 3A7DA 3MCZA 2YXLA 4RTOA 2WDPA 2Z30A 3MAJA 2XXJA 5LYJF 4L85A 2H29A 1H9AA 4MWBA 1PT6A 4C2UA 1O57A 1IHPA 4TMKA 2WPNA 3A31A 4WWHA 4ITRC 5EWJB 4YQEA 5D5QA 2RB4A 1ECGA 2HQRA 4Q3BA 1RC8A 4PSVA 4Q4JB 5B4TA 1PJLA 2X9NA 4RWZA 5DNYB 4PAOA 3HU2A 2YJ3A 4BFWA 1K4KA 3LUAA 4KN9S 3DV2A 1ZJ4A 5IJ0B 3ZZNA 1AO0A 2QTTA 3AG5A 4V0LA 2WA1A 1F4LA 2DQKA 4E14A 4N39A 3GPBA 1NJFA 4RL6A 1RI3A 2X5NA 1Z4PX 4WVLA 4V38A 2EERA 5KPJA 3P32A 4YMHA 3GCWA 4PIMA 4A26A 1J2TA 2W6ZA 3H1AA 3VAZA 4FEAA 4KDCA 1Y0BA 4C4RA 5K0FA 1KY3A 4MUHA 4Y6GB 3FOZA 1TO2E 2C94A 4RTKA 2BMEA 2G6BA 3MXTA 3G2HA 1OWOA 1RWVA 1VJ1A 4LDZA 4TS1A 1OH8A 1RWKA 3C2QA 4MW5A 4R1MA 2FX2A 5HHTA 1PFWA 1FLAA 2PLRA 4IRXA 5JRZA 4Z3KA 1Z74A 5GQSA 1AUVA 3HXLA 3SEAA 3QF4B 4Y3UA 4HLQB 4HN2A 2ZJ8A 1FLDA 4B3SB 1U7UA 2HQSA 4DA9A 2XGGA 4D9EA 4DCUA 4FDVA 5JD5A 1OT5A 3MRTA 4PN3A 2C7PA 1JLRA 3EBLA 4CKCA 5KIAA 3INGA 3DQQA 3QOFA 5KTYA 1I5EA 1LBHA 3I4LA 5HIJA 4W5HA 2XKBA 1Q1EA 5GOTA 4B3RB 5DTMA 4ERNA 3RV3A 3EK2A 3UJ9A 1QR6A 1DBIA 3VR1A 3ZCUA 2C98A 1N6IA 3G02A 5L9AA 4MXDA 1UJBA 4YAWA 5AI8A 5CA1B 1U0BB 2CEKA 3T06B 4B43A 1A72A 1A9OA 4XLTA 4K9QA 2VO1A 1AHPA 2EKDA 5JNSA 3BEDA 3DEKA 3LKBA 1U98A 4MVJA 5FJJA 4JP1A 5B53A 1SKYB 3OWXA 2JF0A 5ECGC 1Q0QA 2XQJA 4EX6A 1PTKA 5CEJA 2E4VA 3LHKA 4K9MA 3P45A 4IKPA 1H3NA 3RC7A 4D3FA 3ZZ1A 2X58A 3TIXB 4W4TA 4IFBA 4RU1A 5KU7A 2V8BA 1YE5A 2YOGA 4ZPXA 5IX8A 4YCAA 3ROXA 4DDMA 4BHTA 3S27A 4ZEVA 5CCDA 2IDZA 4KQ1A 5K2MA 4OFXA 3S2YA 1OHHD 3BWYA 4NPHA 4P4NA 1XYGA 4XH9B 4X3CA 5FI1B 1SCNE 2XMSA 3FB1A 1E32A 1ULZA 3EGWA 4ARAA 1YDGA 4PZPA 2CMKA 3P27A 5FUBA 3BH0A 1TA0A 4G9EA 4XI9A 2HMTA 1GQ2A 1WPGA 5DI3A 5B37A 3K71B 4R8VA 1WZ2A 2GZDA 1GAEO 1Q50A 3OHPA 2E49A 2M6SA 2NTJA 3KEQA 4L95C 3WYCA 2CFOA 2VUTA 4B6RA 4YJ2B 5BV0A 4Z0PA 3R20A 2LE0A 4NBVA 1GLNA 3DW1X 1KYWA 3GHYA 2COUA 3EXHC 5COQA 1XKLA 4CLEA 3T7TA 2EL9A 3I4FA 2OBXA 3FVQA 4K8RB 1CWUA 1B42A 2PL9A 3HACA 4RK0A 4NZNA 1T6BY 1G7RA 3IUNA 4HEJA 4X1KB 5IC6A 1VCNA 3BMNA 3NV9A 2CXRA 2GM9A 3LY5A 4HAZA 1KKLA 1LTQA 2OQRA 1U9IA 1QQTA 2NTYC 2VWPA 4PQYA 4DLXA 4CR7A 3KVYA 4DQLA 3AUXA 4PICA 5IDWA 5CAEB 1NJ1A 1K6MA 1R5JA 1E6EA 4OI2A 3SMVA 1D0IA 3L02A 3G0OA 3MQ2A 2P77A 3BC1A 2PLNA 1PGJA 1TU0A 4D0SA 1GUBA 5IKOA 1NT4A 5ALSA 4Y6RA 1J07A 2PZAA 1ZIXA 4HVAA 5A5DA 4MLPA 2J5KA 3MYYA 3RODA 1DIBA 2Q0QA 1PQ4A 1AGXA 2I2AA 3NBZC 3E1GA 4DT1A 5FTKA 1B43A 4C4SA 2EGHA 4RD0A 3RS4A 3K94A 2Z1NA 3OCWA 3QKIA 4GR5A 4K8OA 5JO0A 2HR1A 2B4TO 5EY5B 3DOUA 2GLUA 3EUWA 1NW3A 3CJTA 1GOTA 5J1SB 1JEEA 3NR2A 4LOLA 1K75A 1VHJA 1XJCA 2P11A 3RAEC 2O8BB 2P4QA 1IZ8A 3QVXA 3ZI4A 3LBHA 2Q07A 1DBQA 2X9LA 4DSNA 3HMQA 2GAIA 3DHNA 4FZJA 4M9XA 3T5MA 5DX0A 1YGYA 1ZIDA 2IHJA 3WK6A 3EY9A 1U8XX 3CA8A 5BUZA 1NXOA 1FFEA 2EKLA 3H2ZA 4NDAA 3RYIB 4Z2YA 1UH5A 3PV0A 1RXSA 2HCJB 3Q72A 3P0FA 3RGWS 2F3UA 4DLPA 1M6WA 2A3RA 1Z45A 2A9FA 4L9RA 4E51A 3S2EA 3HSSA 2FE1A 4ID3A 3L1HA 3NBFA 3EOBI 1QF9A 5IUJC 3B3FA 1XD9A 2P4SA 4QOIA 3NNDA 1X7DA 2F67A 3FTPA 1GA6A 3SR3A 1I94B 5E0KB 1Y3CE 2RGBA 2HK9A 5DSZA 3OU7A 5JCZA 1CY8A 2VDJA 3OE1A 1XN1A 2PZFA 2QL9A 5CDUA 4J7AA 4BFTA 2W90A 5BYKA 3T0GA 4ZARA 4EVIA 2Q2QA 2PSHA 4N4AA 2EBFX 2GEBA 3CW8X 1ADCA 1E79D 5AM5A 1VL8A 3GYGA 4YMWA 4LE1A 3WK7A 4AKTA 2EP7A 4G8DA 4C21A 3ICOA 4GI5A 4F9EA 2JJ8A 3K73O 3I61A 3IUQA 1RHQA 2QI9F 3WNBA 1B00A 4YONB 5IK2D 3HDYA 1C3OB 3X43A 2FZKA 1W48A 2ZXEA 3REGA 1OXVA 1M6YA 4UAJA 5IVDA 2BI8A 2K7FA 4LYYA 4OLJA 3HDJA 4V02A 3P20A 4DUGA 2MWMA 3L04A 4Q12A 3ZK7A 3QKTA 1XXHB 4PFJA 1LDYA 3EIXA 1Q11A 2NX2A 5KWEA 4DZZA 2CWWA 2X41A 3BIWA 3CF4G 2BUBA 3N2LA 2G06A 4KQWA 4NEHB 1DQYA 3RVPA 2QVBA 3NVAA 1HLPA 5EGNA 4Q4HB 2RK6A 1S2NA 4RTSA 3TQIA 3H5LA 1XELA 3G2QA 3K1AB 3HKDA 1JR3D 2IOFA 1MVLA 2C4TA 3B9PA 3OIDA 2XE6A 1M0EA 5EIAA 4BNVA 1GQQA 4RVHA 5JBIA 1L4HA 2NZVG 3KV3O 3LY9A 1AKRA 3EF0A 3HV0A 1E7SA 4WOCA 4CZ2A 4EB6A 2OV3A 3B38A 1TQ2A 3A0UA 3EMKA 3OZCA 4N8DA 1J8YF 4JJ7A 1CPYA 3QFFA 3I04A 1H66A 1XNQB 2RD2A 1I10A 1UWCA 1U02A 4GBMA 1NQAO 2QL6A 1LPPA 1PKEA 2F9LA 3CX6A 4IF4A 4EY8A 2E87A 4AQYB 4L9SA 4B44A 3HJGA 4Q24A 3GY0A 2VJKA 5FBHA 3IAXA 2G80A 2WNHA 3JVIA 1ZUIA 1V45E 3EZ2A 2R751 3GZNB 5AW2A 4ZEWA 3T7IA 1VE1A 3OPYB 1AK9A 1XTBA 2WIBA 1Z7WA 3DDSA 3P9ZA 1O2DA 2VEOA 3A9CA 4BLWA 3KPWA 1I1QB 1KBOA 5DISB 4MV6A 3ZI7A 4R7GA 3REOA 3FCYA 4NFLA 4ESHA 3H17A 3ZTYA 5L3VA 1X7ZB 2CF5A 2O2DA 2QMUA 3DP9A 4R2MA 1XGKA 1SBIA 3LC7O 1CQWA 5A4FS 3HUUA 4QUJA 2PUWA 1KQFA 1V5WA 1ZA2A 3VJRA 3OLVA 4Q3KA 5TEWA 1Y8QA 5JYDA 3JRXA 3RVSA 1T1RA 3IEVA 3OY7A 1T36B 2HF7A 1G59A 3KSMA 1PJ4A 3TQQA 3BE6A 3PQ7A 5C52B 3VJMA 1FMTA 1ZN2A 2H7YA 4GVPA 1WA5A 1MHTA 5B2FA 3TG8A 3TKAA 2G9QA 4QGHA 4OEHA 1I4OA 1DLIA 3EPKA 3LYAA 1BJKA 2XWJI 3GLUA 1U2DA 4J75A 2A30A 1GD1O 2R6R1 4NIMA 5E6RA 4JCCA 1KC3A 4RHEA 2FJ0A 2Y1CA 4J7CA 2I4RA 1JR4A 4UOEA 5JD6A 4UW9A 2F3QA 1TK2A 1QE3A 4LXTA 1YF3A 3KOMA 4YT8A 2D00A 4HDOB 4EFNA 3I09A 3EBOA 1HRDA 4NWIA 1EFUA 3WRXC 2EFHB 1MIOB 5FUWA 2JIOA 4HSGA 4D26A 3G5UA 1RP1A 4HAYA 3ICCA 4NOKA 2Z4TA 2Z8YM 1YU6A 1HDEA 1KK2A 2AHOA 1EFDN 3RR2A 4B6QA 5ADWA 4D74A 3C43A 4IV0A 4ARIA 1RPJA 1E2FA 3ZEAA 3PX3A 4IO0A 2GERA 3NS7A 5LCXA 2X4LA 1AX9A 3WGOA 1ZXBA 4AWAA 1KEPA 3O91A 3C98A 3T7DA 3KKMA 5IF3A 3TGPA 5AKJA 1LVHA 4AN1A 3CRMA 3MJSA 1YOBA 2PZJA 3HJHA 1XUOA 1PL8A 3BRCA 1IU9A 3QBEA 4CMIA 3L84A 2X4DA 2B8EA 4IIJB 1WVGA 3SKXA 4CIVA 5IT4A 4QNMA 1FMJA 4PYIA 2H6EA 4WSOA 4CMKA 3UM9A 1FNCA 2TYSB 3GFQA 4NENA 4JLJA 5E38A 4GYYA 1UAYA 1Z75A 4G37A 1JDUA 2P2CA 4P31A 2X13A 1BHO1 1LV7A 3R8CA 1I3CA 4OQ4A 4DPMA 1GPWB 2H4FA 2J6IA 2X19A 4ZVLA 2RK4A 2QTVA 3AR5A 2VHWA 4Y2GA 5BXYA 2VJBA 5I7OA 1CRPA 2BTQB 2G5TA 2DFTA 5EPUA 3P96A 2C5HA 2K2WA 2B98A 1F9AA 4IDFA 2PVSA 3I83A 2VEDA 1AQLA 2C2GA 5ERYA 3U3OA 3OMWA 4QUHA 1DXYA 1T9CA 3LGAA 4CNBA 3MWEB 4CCWA 4YCDA 1YO6A 5KJ1A 1W25A 3Q4GA 3VZBA 1F8YA 3PUHA 5TMDA 3AEUA 1MW9X 3V1UA 2PX3A 1PRYA 2Q6KA 1SHUX 3EXHA 1S2MA 2OO7A 3HKBB 3IOYA 2YY6A 3N53A 4NV1A 4Q9JA 1RJEA 4KPEC 4DMMA 2OZLA 4N0MA 4Y7DA 1I2DA 3TGWA 2WT8A 3G2JA 3IP7A 4ND3A 1Y48E 2IYLD 2PU5A 3Q98A 2PH1A 4K5QA 4Y1GA 2ID4A 4ETNA 3TRIA 4QGBA 3RRZA 4REQB 1KDRA 1ZSVA 3SOZA 2X6RA 2AD5A 2H07A 3T5TA 1IAQA 1JKIA 2C9DA 1RXEA 1Z2DA 2PN1A 3D8BA 1JQEA 3NJRA 1UDRA 4M1QA 3RS9A 3V1TC 1VPTA 1T10A 3TPCA 5AXBA 2P2NA 3B3JA 3FF1A 3NNSA 4QYTA 2QZZA 2BCEA 2FPGB 1AGYA 1GARA 1K97A 3DL7A 5AYVA 1QUEA 1OROA 3E82A 1BJRE 3ORQA 2PKRA 3R3JA 4AKIA 3DYVA 2OGSA 3HCRA 3KYDB 2D2XA 1MXFA 2WF8A 4G0PA 1YVUA 2AFHB 3SIPA 3ZD8A 5KZMB 4WZAB 2R1VB 3GO4A 1RRPA 1WM1A 1GJRA 3DOIA 5B1DA 2PNFA 1M7GA 2BGNA 2PMKA 3OKCA 4BVAA 4CYMA 2H4YA 3NVKI 5AW0A 5FUVA 4EF5A 5K8IA 1Y9EA 2ZI5A 7ADHA 3QE9Y 4LRYA 4GZ6A 1E2PA 3NBKA 4KYVA 3UB4A 2GN6A 5DHSA 4MEBA 1Z25A 3U3MA 4IFIA 3FZNA 1PUIA 1ZUNA 3I4CA 2W2KB 1CR1A 2HBRA 4Y2RA 1Z7BA 3LCMA 1TF7A 1A9SA 3TQFA 1R8JA 2WE8A 2A0UA 2QDKA 1EX7A 4JK3A 1S4QA 2Z3VA 4QO7A 5DMXA 5AK0A 5JE8A 3HNPA 3U80A 4GPIB 3L7BA 5GAJA 3RYHB 1V7PC 1BX0A 2KPOA 3PZBA 4MLZA 1XU9A 2CDRA 2CJWA 4LSWA 3T41A 3X3HA 2TS1A 3JCZA 2HNKA 4DYVA 2VI5A 1G3UA 1PZGA 3IV9A 5DCUA 4UNRA 3IDAA 1HE5A 4NFHA 4WFKA 3MJTA 4KNWA 2JD1A 4M1OA 1ZO8A 2XWQA 4FYMA 4CMCA 1MNAA 4XRGA 4DR4B 3GEHA 4KSYA 4LCBA 3SJBA 2GEDA 1UMBA 2I9KA 2O05A 3H11A 2F55A 3QBJA 4LFBB 4CM9D 4MPRA 3LQ4A 4NZOA 4D3DA 3KYBA 2DFKB 1CRZA 3LIPA 2A1TR 3O84A 3VR4D 1UKVY 5EWMA 2RHBA 2IS6A 2J5RA 1G3RA 5EJ8A 1OQAA 2JBAB 3ESQA 5CNJA 3ELBA 4HDKA 5B64A 4C01A 2K6GA 4IZOA 2ET6A 4XUEA 4HMOA 3WG9A 3WGMA 2EQAA 4OB8A 4BX2A 5FUYA 3JQEA 4PTYA 4CI9A 2IBSA 1Y6QA 2DYKA 1WDLA 5FA5A 3WRVA 4JLPA 3DE2X 4R9NA 3WFIA 5MN5A 4XEHA 4DREA 4WN9A 3M2PA 4FTWA 1Z4OA 5DBIA 2V0CA 2VYCA 1RYNA 1U7DA 4AJ4A 2JZNA 2JI8A 3TW8A 1WOMA 3D8TA 1GKUB 2IW3A 4RPKA 1NMYA 2OBMA 3MG9A 1U9YA 1H4VB 2IXGA 2UZ3A 4LE0A 1UBFA 5F2NA 2AFRA 1X1DA 2G07A 1ORDA 1PGOA 1TDJA 4HSEA 4ZANA 1V1RA 2NADA 2V9CA 2X86A 2QDXA 3B89A 4JJIA 1EB8A 3VNRA 3QVSA 1M54A 2Q6LA 1J49A 1MQ8B 2AI2A 3BTOA 2LKDA 3FSRA 4RF3A 1DTSA 1O58A 2RC5A 3IMEA 3VGPA 4B3HA 4GRDA 5CLFA 4G1VA 2ZRDA 3NTOA 1ZQ9A 3CINA 4WZ6A 5K8JB 1XRLA 3EAGA 5T6MA 4X8MA 1SUCA 3CPEA 3G0IA 1LSJA 1P1HA 1UBNA 4WMLA 2VL7A 3SSOA 1RMTA 2QAIA 3BXEA 2WUVA 3CZRA 4GXTA 3WBKA 1A5SB 2Q62A 2RGYA 2H9AA 2VDKB 3OEHD 1Q0HA 1U04A 4H7DA 4TV8A 5EHIA 2N47A 3CRZA 2FGKA 3E1SA 4MUIA 5FFNA 3FHTA 4IUCS 5BSFA 3PTLA 1ZX1A 1W5AA 5COBA 1ZI6A 3LA6A 1U3UA 2JD2A 2R6CA 5LDHA 1KMQA 1ESDA 3CRVA 3W34A 2V3VA 2IIBA 3E2MA 4OYLA 3ROTA 5BRJA 4BNUA 2VPXA 4HDMA 3DYBA 4EA7A 4B4OA 3ZK9A 5KTTA 2DWUA 1XG5A 1UK6A 4ZT7A 1VM6A 1YMQA 2IU4A 3F3SA 4HYYA 2JLQA 1EVJA 5AOBA 4DJEC 4GOMD 4M49A 2HZBA 2O6LA 3K9QO 4NBLA 2QMOA 2J6BA 2OCBA 4W82A 4E5VA 2FSVC 2NT3A 4Q3AA 4W5TA 3BJRA 4OMFG 1J23A 1V2GA 3MTEA 1TIPA 1CR2A 1T9AA 2R8ZA 2WY2D 2I34A 4WXEA 4B7AA 2I62A 1GCOA 1DIAA 2HH9A 3BN3A 4O4HB 1NSFA 4R3NA 4BB9A 1VG9B 4F97A 3DE0X 5L3SB 5THXA 3MMZA 2KWIA 3DTVA 3IB3A 3DUWA 3PUWA 1M0SA 1UBCA 4FWBA 1WPRA 4V24A 3WVNA 3UQYS 3ZVLA 3ZVKA 2XZLA 1I7DA 1DX4A 1KYIA 2A5GA 1XXLA 3GRCA 2H5IA 3AW9A 3PI6A 4DUYB 1T2DA 1KI6B 3SN6A 1K7CA 4QJ4A 4TXHA 4QXAA 1BHSA 4UTXA 3EFEA 1GG5A 2WIAA 1PSZA 1TECE 2W8ZA 4YYEA 2GFQA 3BQ9A 3W4KA 1E5LA 5BVHA 4ZTZB 1LLCA 4Y2PA 1KE2A 4ZYYA 3MPUA 3F74A 1FNDA 3M83A 3UT6A 4RZQA 1HC7A 1CK4A 4RKYA 5KQSA 3TBHA 1EFLA 3W2IA 4NS4A 3DMTC 2C2ZA 1TAHA 2QD1A 4CUZA 4JZYA 1IATA 2ECFA 2VNSA 4S0ZA 1EIWA 3A6DA 1X7XB 2R4QA 3MLAA 5K4GA 3I42A 3S2ZA 2QIOA 2ISSD 4F4JA 3BCSA 1GRQA 1NDQA 4JVSB 1GKLA 3B3AA 4Q9KA 2RHMA 4IH9A 4POAA 2W2VA 3DNPA 4J1QA 5FDFA 1OBCA 3LQQA 1F6WA 3LQ2A 3KQYA 1RVV1 3B1JA 3EVBA 2XB6A 2Z5FA 1N92A 4PINA 2PSEA 2VRWA 1CV2A 4EKYA 2QU7A 1TRHA 2VJAA 2YXEA 5SYMA 3PT9A 2A0WA 4TTVA 2DY0A 3L8CA 1JYSA 1U8AA 1PR3A 4XIFA 2QM0A 1UQUA 2AG8A 1NKTA 3CVWA 1DU4A 3K4HA 4CF6A 4BQOA 5I45A 1XZJA 1CIPA 1R5BA 2O2XA 1RHMA 3OE7A 4IIUA 4Q15A 4U7PB 5BWCA 2WYOA 4H18A 2P1ZA 4B4UA 3T5DA 3O7WA 4GXNA 3TO5A 1HUQA 2AZXA 5DSXA 5C5EA 1SG6A 3ZQ4A 5D5PA 3C7DB 5K3BA 4R0VA 3G13A 2YIMA 4QPJC 3JW8A 2CJPA 3SZUA 3F6EX 4AJPA 1T0IA 5DYYA 1TZJA 5A4KA 1ZD1A 1U1EA 1JZTA 4U00A 1X1RA 1JPNA 4DY4A 1JAZA 4OPMA 3W90A 5KOJA 1PU2A 1OLXB 3X0DA 2P6MA 1AQYA 1CERA 1DI0A 3FCOA 1FFBA 2EARA 1RLMA 1YAHA 2BKEA 1X2BA 3ECCA 1XMSA 3A36A 4JVLA 4DS3A 4S0XA 2YWXA 3WQQA 3BWVA 3TCKA 1YDEA 2WTXA 3VTZA 3UUFA 3CLTD 1YHZA 1RJ9A 1UEIA 3JASA 4G01B 1C30B 2QIPA 2OHVA 3KWFA 3QJGA 5EQTA 4YMVA 5IAAA 4IHJB 4PO3X 1G16A 3G8CA 4CM3A 4MIEA 3HE3A 1V35A 3PJFA 3VI4B 1DXQA 4L50A 2PUVA 4MYSA 5JDCC 4C7MA 4X66B 3SG0A 2G70A 3HUEA 4YGXB 4DQXA 5KX5A 1FU7A 2ZJBA 3NP9A 4TMTA 5JEEA 1V9SA 1YD7A 3UK2A 1UZAA 2PUHA 2RG1A 4B82A 1Y3HA 1U8TA 1WXHA 1KY4A 3UG7A 4FWIB 1FMFA 1OJLA 2ORWA 1QHHA 3U3ZA 1NX9A 3L7OA 4A91A 3DG9A 1NY6A 2P9JA 3OETA 4Y2SA 4H0FA 2GCIA 3PDJA 4IQGA 4KU4A 4AMUA 4QG3A 1K5PA 3LP8A 2WM2A 2Z95A 1YASA 4A6DA 4WL0A 4JNKA 3S2UA 2HNAA 2C61A 2BFOA 2IEDA 3L1IA 4B7XA 3C1UA 1BXGA 4FLMA 4LJ9A 5JQWA 5JBQA 4YB8A 4URZR 2NT4A 1RRKA 1I0IA 1L7EA 1V47A 2P3QA 4PZAA 3V4ZA 1C8VB 5A0VA 2NZ8A 2Q46A 4ND4A 3VPDA 3HDTA 2JCVA 4P34A 3HO1A 3F4BA 1LDNA 1ZXLA 3KKOA 4QWWA 4KWCA 4NATA 2R48A 4LK3A 5INTA 4MQUA 4BPBA 1JFSA 1CNMA 4K9SA 4PS1A 3VTAA 1U7TA 1P0MA 2WWTA 3ZGVA 3SIXA 1X14A 3K35A 3A1UA 4JASB 3T95A 2I80A 3FTDA 2R85A 4PYMA 4KKXB 2O2YA 5H4GA 1RLIA 1UFKA 4KIFA 5TDHA 3DDOA 3T3HA 3KJNA 4M8LA 5EXXA 2CXOA 2BELA 2FE4A 3RJTA 3ND6A 4RLFA 3G9XA 5H68A 4Q00A 5GVSA 2QNIA 4FZ3A 1FDIA 4B3BA 4YK7A 1N5KA 1G42A 3PPVA 4PG6A 2L0XA 4RELA 4B75A 3FPFA 5JZSA 2P75A 1R6AA 4YDRA 4PV7A 1X80B 1BMDA 1YL6A 4CM8B 2CLKB 3NRJA 3EYAA 2G71A 2ZT8A 2VNHA 1Y63A 1G17A 2O7QA 4ND8B 4F04A 1YR2A 1U63A 4IX1A 4D3YA 3H2YA 3IVRA 1A8PA 4MKHA 3RVMA 3U56A 1IN8A 2QD3A 1U2GA 1WBBA 4F4HA 1U31A 5HS6A 3FE2A 2GF0A 4NK4A 2A9JA 3IXMA 3L7LA 3TNJA 4IS2A 1H9CA 2BEKA 5EKUA 1ML3A 4UE3S 4A15A 1X1CA 4YMLA 3CE6A 1BE8A 3NEPX 1B14A 3VDMA 3CH7A 2AS0A 2Q5OA 3PR1A 1QHIA 2UUAB 5DDIP 3DP7A 4J7UA 2VJDA 1SHKA 2HEGA 1JEAA 1RT9A 1SXJD 1BE0A 2QRHA 3CKLA 5HUJA 5C7LO 2PKQP 2XGSA 3AR8A 5DWVA 1EB9A 4Z0HO 4FYIA 2P0EA 2Z6VA 2D8MA 5JSFA 1C8KA 1Z6QA 1UPFA 3H18A 3PUJA 4MWZA 4E5YA 3A32A 4GMXA 5L45A 4QU8A 5KUTA 1IM2A 1EH5A 5GZ3A 1N2GA 2ZUBA 3CC8A 3PJGA 4MYCA 3VR6H 4EZBA 5LA6F 4EY4A 2H7CA 3U48A 2XUJA 4E0BA 4HNVA 2PZBA 1NVGA 5HIMA 1EX6A 4AT1A 1LK5A 1X94A 4H4DA 1F2DA 3GJ3A 4J90A 1ITZA 2PZ8A 4MR9A 3BILA 3OZGA 1W4RA 4OUDB 3KE9A 3IQZA 2V3WA 1X9GA 1KEEB 4EUKA 1KY2A 3JVEA 1MVNA 2P7HA 4KZKA 2AEFA 1JL3A 1Q3KA 1SIOA 4DIMA 4GSKA 5ALMA 4Z4FA 5B6IA 4U7TB 1E60A 3IPYA 2Q41A 5K3AA 1I7SB 2I1QA 2D1QA 5FWYB 1DKPA 2N46A 3UK7A 1WPXA 3AUFA 1YI1A 4TV9F 3ZBUA 1E7MA 4J4BA 4OGFA 4BCCA 3HUDA 1IG3A 3IQGX 3TSOA 3WGGA 2FW9A 3P9IA 4XWOA 5K05A 4FDLA 4D4LA 5LBTA 3FGNA 3NIWA 4CV3A 1Z0AA 1ULHA 5EXSA 2AI3A 3QFCA 4UM8B 3W3ZB 2IEAA 3K1YA 1EXMA 1WXDA 5SICE 3CM0A 4MGIR 1U3DA 5TV2A 1S7GA 5CH8A 1W94A 3A1DA 3Q7IA 2DMRA 4OLAA 2IYRA 4JLBA 4PHCA 3TK1A 4II7A 4CRWB 5FLKA 5G1PA 4C7JA 3V9PA 1KQPA 1AKTA 2PJRA 3OH8A 2XEDA 1TEHA 4ZI2A 5BNZA 1RRMA 1V9LA 1XMXA 1ECBA 3UBTA 1TLTA 4K0RA 1HNWB 1D4AA 2H1HA 2PG3A 3TX2A 2XOXA 1FDRA 1PK8A 1W1WA 2IYEA 3IAAA 1SVIA 2ISCA 3MINA 5DGIA 3W0LB 3LFTA 2YTZA 1W6UA 1XDGA 2CMGA 4HGOA 4PY2A 2NU8A 1NVKA 2WPDA 2QAJA 4CUKA 5DH9A 1DWUA 3FYUC 4DGQA 2NV6A 3B3GA 4WADA 4ZDWA 4Q66C 3DE6X 3O7MA 1XDBA 1ZCZA 3GUUA 5AH0A 4E5NA 3MCWA 2W00A 4LSZA 2UZ0A 1J4AA 3N1UA 4L72A 1R9NA 2JFUA 5KWSA 3AFNA 3ZE9A 3WGTA 3B6KA 1YFLA 2MSNA 3IPLA 3HXKA 4RKQA 3WGJA 2WJGA 4UKDA 3OZRA 4LXHA 4F85A 1GA4A 5EQFA 2QLLA 4J9UE 3O9ZA 5JISA 4GRAA 2OVFA 1R00A 1O95D 2L19A 3FVVA 3I04M 3V7FA 2IPOA 2HCTA 1EDOA 1OE0A 4L5YA 3ZIDA 5LD2C 3A9TA 2IYAA 3F5SA 1QTRA 2CE2X 2Y1OA 4YUWA 1ESEA 2UYQA 3EVFA 4G89A 2D0OB 4D5EA 2OM6A 5LKAA 2FU5C 3IEIA 5LXTF 2DFVA 2ORVA 3HHEA 3RTAA 3WLAA 3N2KA 2GPWA 3MAGA 2DM6A 2VKTA 1IJFA 2UVQA 4BFXA 2FN4A 2VQEB 2YRFA 2AEMA 3QM1A 1DX6A 1Y3BE 1V4NA 2GZ2A 3DZDA 1AK2A 1IAVA 3OFVA 1UC8A 3CBQA 1ZFNA 1MENA 3HM2A 3QP9A 4KO3S 4N7JA 3REQB 3NG1A 3TLYA 5AUPB 3CCCA 1JIKA 1VGQA 3HNOA 3ODGA 1ATZA 2JAQA 1SOWA 2HRRA 3HEBA 1H94A 3VHXB 4KQIA 4GF5A 1M1YE 5KB3A 1HLGA 1FSZA 1RPAA 2GN1A 2XB4A 3A3PA 4YP0A 5JCJA 1SVMA 1T8YA 4J2OA 3ZI0A 3BJEA 4PCVA 2FEPA 4IIYA 1GT6A 2E5WA 2IHVA 3IC5A 1HH4A 3O2NA 5JAMA 3T1OA 1TTHA 2YJNA 2Z6UA 1L9XA 1XJ5A 5EHXA 3AJDA 3AVUA 1Z63A 2ZRKA 2FWJA 4X8HA 3JWJA 1PL6A 3QEMB 3SS9X 3SS7X 3CNNA 3ELYA 3LY7A 2ZWPA 4O63O 2PX0A 1J5PA 2I2DA 3EDRA 4I4LA 4YUZA 2DT8A 3E84A 3RS2A 4NHEA 1G1MA 2RJ3A 1BSVA 2JFOA 1O96A 2Y4NA 2ZB8A 3LYHA 5EKDA 1D6SA 2KBFA 1DKQA 3OZBA 5HF8A 4MS4A 5JPIA 3STXA 4OHWA 4KR7A 1RIIA 3L46A 3H7AA 2MMGA 4URFA 1N6RA 1R9GA 2LXNA 3LSTA 5LZ7A 4DZRA 1W35A 3A1SA 4MQEA 4JYMA 2HBQA 1LZLA 5AVQA 2WHEA 3RHTA 1ZJYA 2QKYA 1Y7TA 5SY6A 3GZ4A 3ZJUA 1W4ZA 4GP7A 4OL0A 1HL7A 4ZO6A 1NU6A 2AMYA 2FAXA 1XYYA 3KFLA 4L5IA 3U0VA 3FR8A 2ECPA 2VAMA 3LLVA 4XLLA 2IPMA 2RKOA 4AX4A 1GRNA 2KSQA 5BN4A 3EZ7A 4WLOA 1QFSA 5DGHA 3R7WA 4RKFA 3N28A 1JDPA 3CNQS 3WHLA 1T5BA 3M6WA 5C1IA 3U4MA 4LJSA 4CTKA 1T9KA 3EJ6A 3R6WA 5KPDA 1PFQA 4TWZA 3WGQA 1NW7A 2WOJA 1GQOA 5IAGA 4PX2A 4XAQA 3M3DA 5B1YA 1BO6A 4IQ8A 5CLQA 1UKCA 2AUMA 3G6KA 2PBLA 3PUIA 3EXIA 4YAGA 2ABWA 3KP1A 3SYNA 3ZGOA 1NJGA 1ZKMA 1FYVA 1ZK4A 2ZJ5A 2ZIUB 4LZJA 4V0SA 1JTFA 2FEOA 5HBRA 4DM3A 3KQKA 3E23A 4LC9A 4X6XA 1AKNA 1KMHB 1PO7A 1TE2A 2BFEB 5KYYB 1ZNWA 4NCJA 1NJSA 5AW7A 2NP6A 1X1BA 4QFMA 4CG1A 1VECA 3QVJA 4A16A 3CB4A 5KKNB 1WJGA 4RVUA 4P3NA 2VZEA 1NMQA 1XTIA 4S05A 4FYWA 1U8EA 4FMDB 2I65A 4GPAA 5JBNA 4W9NC 3TLCA 3HNRA 2QX4A 3ZGLA 3U60B 4Y1EA 4Q9LA 4EG7A 3QPDA 1YBAA 2IGTA 1TT5A 2ZXFA 4P36A 1A9ZA 5SYAA 4B7UA 4EUFA 2QY6A 2ZSKA 3T4XA 2GT1A 3BMOB 4QZVA 2JFPA 1QAMA 1TUIA 1OTYA 1A0OA 1AA9A 2C59A 4IY1A 2HA3A 1VC2A 4KPGA 4XQCA 5IW8A 1A5AB 3DZKA 1WAMA 5AK3A 4RA6B 1H65A 4EAAA 2AKEA 4U2EA 3EY4A 1HO3A 2FN7A 1NSTA 2FKNA 5AI0A 1C8BA 2JI7A 3O8NA 4V0NA 3SC2A 1PJ2A 2JLUA 2O1XA 1SVNA 2ZK7A 1ODSA 5ALPA 3SX0A 3AIMA 4BFLA 2HFKA 3I9FA 3OA0A 5DO9A 5DTEA 4YJ3B 2DH5A 2PGLA 2WIFA 3GA7A 4LQLA 2VUSA 3HV2A 5DV9A 4Q3NA 4YXFA 4CEIA 8GPBA 3UMYA 4C0LA 1XI2A 2BTOA 1OXBB 1PJQA 2VHVA 4I4TF 4ARVA 1O0CA 4AJNA 3DEHA 3FRIA 4F21A 4BFVA 3ZN2A 1BQ3A 4R4JA 5D86A 4JODA 1TPZA 3VR3A 4C2TA 1LV8A 3FMOB 1PWHA 1QFMA 3BA6A 3ECAA 1ZUWA 2YJGA 3GEPA 4RVNA 3U5TA 3WY9A 1EFRA 1PGNA 4HNHA 4WH0A 3CF0A 3KKKA 4FXOA 5TPWA 3DYIA 3TDNA 3OTHA 4BJ1A 3QLUC 1IY8A 2GPBA 2FFJA 1V8PA 3ZXSA 4NEGA 5HR5A 4HH3C 4P81A 2QP3A 3HU3A 3GFOA 4H3VA 3CLUD 1OMOA 3HRKA 2HWWA 2ONYA 2QYTA 1G7CA 1L4YA 1XTUA 2XVXA 3ROMA 1T3GA 2PJDA 2NZUG 4CT4B 1J20A 4LRSB 1NJ5A 3U62A 1F2UB 2A84A 4JUIA 4BJ5A 4NCHA 1UM8A 3HCFA 1Y8ZA 1VL6A 2BBOA 1ZS9A 5EZYB 4XB6B 5JADA 3HA2A 2YXBA 4XLZA 1J0AA 4UCFA 3OPVA 5AI6A 1NHGA 5CEEA 4ZAFA 4GKBA 2Q2NA 3EMBA 3C6XA 3QU2A 4LUCA 1U2QA 1NPDA 4R9VA 4MRPA 3NGLA 2D7JA 1MN6A 3U4CA 1O0SA 2E4AA 3MJDA 3IALA 3RO7A 2YH2A 1O4WA 3OX4A 2OO3A 4NVRA 2G88A 2GCPA 3EUEA 3MCAA 1U7HA 2FR8C 1BMQA 4F7DA 2CNWA 4LE2A 4RF5A 1CU1A 5B1IA 2X2EA 3Q8WA 4KB5A 3JQQA 1N2SA 3DMYA 1NI4B 1SVUA 2F9FA 1TO1E 5T67A 4AYTA 4ER6A 5CB4B 3EDQA 1M5RA 3PGJA 3KKPA 1GQYA 1A9RA 2CHQA 1E89A 4IDDA 2KQUA 3W9UA 4BJHB 5BSVA 1KMIY 3DC7A 2H06A 1X8XA 2UYYA 1NJ2A 3AUSA 3QPUA 4NZPA 4UXJA 3B1FA 3CURA 5IJZA 5GONA