4JA2A

Structural basis of a rationally rewired protein-protein interface (rr468mutant v13p, l14i, i17m and n21v)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
121
structure length
120
Chain Sequence
b'SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
molecule tags Signaling protein
source organism Thermotoga maritima
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
total genus 42
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ja2A00
3QLUC 3BREA 4ZMRA 1XHFA 4KQCA 3LUAA 1BA2A 1DBQA 2WMYA 4JB0A 3C3MA 3JTEA 4ZYLA 2P4UA 1FFGA 2P9HA 5IULC 4MQEB 5JNSA 3OQMA 4XARA 2FQXA 2BGGA 5DKFA 3OO0A 4CBVA 4W5NA 1EHCA 2FQWA 1A04A 2PKXA 3HM9A 2E4YA 2NZUG 3JS5A 3HDVA 2E4XA 3OLZA 5BRJA 4JB2A 1VKRA 1F4VA 4MPTA 3CRNA 3S99A 4F3TA 2FEKA 1K66A 1GLGA 1SXIA 2HPHA 1QMPA 3CLKA 1YMUA 2V0NA 1LJUA 1USGA 3H5LA 4TLMB 5EWMB 2FEPA 3CZ5A 5HM6A 1OXBB 1JFSA 2ID7A 3IP9A 1RPJA 2YHBA 3MM4A 1MVOA 3DZDA 2PUDA 2PAFA 4WZZA 3QLVA 3CS3A 3L6UA 8ABPA 5JS2A 4KPYA 1Z25A 3EAFA 3HEBA 1P6UA 5EWLA 2GI4A 4EYQA 1YMVA 3A0UA 2QVCA 3EODA 1IIBA 3O1HB 3LUCA 4PE5B 1MB0A 1ZGGA 1RZRD 1LBIA 1Z16A 4S04A 3H5TA 1NXSA 4KNYA 4DQDA 2QW1A 3IPAA 3M6MD 4L4UA 4KK3A 4TLLB 4Z4HA 3RVPA 2VUIB 3C6QA 2HSGA 4EGSA 2E4WA 3JVIA 2FN8A 4YV7A 7ABPA 3O2JA 2FTKE 1U04A 4NQRA 4RSMA 3TD9A 1NXVA 1ZHHA 2R4QA 1D2AA 4YO7A 2W42A 1ZH4A 1Z12A 5GOTA 3FFTA 3BRQA 1YS6A 2JK1A 4MR7A 4DN6A 2LUOA 2CD7A 2H3HA 3HO1A 3F73A 5KQGA 2WB4A 2IPNA 5FWYB 1DCFA 1RXEA 4PYRA 1APBA 2QZJA 5IUNC 2IDMA 3MQ4A 2JVKA 2O20A 2A9QA 3QLTA 3BRSA 1JF8A 3FDFA 4IMIB 1HEYA 4TMYA 4RK1A 4WXEA 5CNKA 3QELA 1ZESA 3N0WA 4F12A 3Q15C 1MB3A 3EGCA 3LTEA 4ETNA 1L5YA 1ISSA 2A9RA 3LUJA 4QICA 1ZGZA 3BBLA 2OENG 3KS9A 3IDOA 4EVRA 2E4VA 4RXUA 3KYJB 3HZHA 9ABPA 1P8AA 4D6XA 1Z15A 1LJLA 3SY8A 5C5CA 5KC8A 2JVIA 4UHJA 2JVJA 4LE2A 1YS7A 1JYFA 3EULA 5TQ0A 3VNBA 1A2OA 3NBMA 3O1IC 3SM9A 2IKSA 3DGEC 2PL9A 3RVSA 5BQ3A 1TMYA 1ZN2A 5TE9A 4DADA 2GBPA 4RDCA 4NCAA 2E4UA 3HS3A 5TQ2A 1MIHA 4MS3A 4Z4IA 5JNTA 4YRZA 2B4AA 4EVSA 2B1JA 4MLCA 4PEVA 5IX8A 1SD5A 3N75A 4F8JA 4RV5A 2PUAA 1E6KA 2ZAYA 2FKAA 2CHFA 1P2FA 4ETMA 1FFSA 3TO5A 1EWTA 3MYYA 1JDNA 2H0AA 1JL3A 2HQOA 2L18A 5KC9A 4EYKA 2TMYA 1KRWA 2JCGA 2OQRA 4MQFA 2WY2D 1D1QA 1FQWA 1PEAA 2A9PA 2NT3A 3CHYA 3O21A 5IBQA 3VNAA 1QP7A 4NCBA 1T34A 3EQ2A 4WXMA 2J48A 1DCMA 2GWRA 3MF4A 3LUFA 1CHNA 2LPMA 4N0PA 4NV3A 1EFAA 2L2QA 3LMKA 1E2BA 3KKEA 3OLVA 1Z2DA 3DLHA 3E3MA 4YLEA 2YHAA 3NHZA 4JOQA 1A0OA 5BR1A 2IPAB 3QEMB 1ABEA 4RXMA 4XLTA 4JASB 2F8TA 3D02A 3HV2A 5TQ2B 3HVRA 2MSLA 1ZY2A 1PEYA 4Z4CA 2FN9A 1SXGA 3H6GA 3KCNA 1YTUA 1DC8A 1M5UA 1YVUA 1ZAYA 3T95A 3SQNA 5KQMA 4OLBA 3H1EA 2AYXA 3FFWA 1DBWA 5DCLA 1KRXA 4G0OA 1BDIA 4RXTA 2QVGA 3UK0A 4RWEA 4L85A 5IC5A 2VYCA 4MGEA 4G97A 1BDHA 3KLOA 4KFCA 2I6FA 2NZVG 5B3JC 1U0SY 4KK4A 1C4WA 4HYEA 5I4CA 5ED4A 2WJAA 3TB6A 4Q7EA 1M2FA 4RY0A 5HKOA 2LP4Y 3ILHA 5JNRA 5DGCA 1QPZA 2PUBA 3JY6A 3I5AA 3Q7RA 4MRMA 1C0EA 3O74A 3CZCA 2FMKA 1NXOA 4MS1B 1TLFA 4QPJC 1JHZA 2FEWB 1JWLA 1D5WA 2JBAA 1RNLA 2X7XA 3N0XA 4FB4A 2PE5A 1DBPA 4IF4A 4LZLA 3H1FA 5TPWB 6CHYA 4RK0A 1GUBA 3ILYA 4PICA 4TN5A 4XFKA 5TPZA 3HK2A 4N03A 5IEBA 3Q41A 4MR8B 3QX8A 4HNSA 1XWWA 3T38A 4ZJPA 5JNUA 1CEYA 5EWLB 3HCWA 4RKQA 5CHYA 3A10A 4O1IA 1XHEA 4XXHA 3H5WA 4G0MA 3JPYA 1ZVVA 2N9UA 2MYUA 1PNTA 2VK2A 3SG0A 4KVFA 1QO0D 3CU5A 3QLVC 3GWGA 3JPWA 3B2NA 1AB5A 2LIVA 3N0RA 4D74A 3QEKA 3R0JA 2MYPA 2GX6A 2MSWA 4G0XA 3RVMA 4EY3A 3C3WA 2KYRA 2M1ZA 4RK7A 3OLYA 4MR8A 2VUHB 4Z4EA 2MSKA 3RVJA 3M9WA 4G0QA 3NNDA 1OXKB 2PUGA 1NATA 1ISRA 5EWJB 1Z26A 5HQJA 3GL9A 3H5IA 1EAYA 1SXHA 3RVLA 4EYGA 4N47A 4KZKA 1D4ZA 1JFVA 3GA5A 2E4ZA 2NUBA 1RXIA 3N8IA 1DZ3A 4Q6WA 4RZSA 5DTEA 1QP0A 4LRQA 1KGSA 3BILA 3KYIB 4E7OA 3MIZA 3OLWA 2DRIA 3LUGA 4KQ9A 4NICA 4Z9AA 3F6CA 3SAJA 4RY8A 2L19A 4KV7A 3GRCA 2AYZA 2R48A 5FWXA 4YWHA 3Q7TA 4MLDA 2Q5CA 4LDAA 4XAQA 2RDMA 1GUDA 2FXIA 3ROTA 1QQBA 2RJNA 4KRFA 3HUTA 3D8UA 4M88A 1BAPA 5TQ0B 4G86A 1FSPA 1H9CA 1NXPA 4OATA 1QP4A 5JNVA 2FMFA 3TMYA 3N53A 3KLNA 4N0QA 1VLZA 2IPLA 4ML3A 1D1PA 4MQEA 3IPCA 3P9YA 3O75A 4FE4A 4F11A 2IPMA 5CNJA 3KHTA 2L17A 5D2CA 1GCGA 3O2SB 1U8TA 4O1HA 1PHRA 5KQLA 4G0YA 4UHKA 5IUKC 3RQIA 3QLUA 2QR3A 3F7NA 2JB9A 4P1ZA 3RVRA 5IEJA 3EDCA 3KTOA 2HQBA 1BVHA 3LFTA 5B3JA 1U2QA 3W9SA 1VRVA 2R47A 3LUDA 3NNNA 3CNBA 5FBHA 5C5EA 1DJMA 4MS4A 4RS3A 1KMIY 4D6YA 2LBPA 1NY5A 3N6VA 1LK0A 1YK1A 4RK6A 1MAVA 4W5QA 1JYEA 1U2PA 3A3KA 1B00A 1SRRA 5PNTA 1DRJA 4MQFB 3RVQA 1ZITA 2IOYA 4E7PA 3KG2A 2F8SA 2PJUA 2ZWMA 3M9XA 3T8YA 3C3KA 4RY9A 5F64A 1M5TA 1DCKA 4Z99A 1QQAA 4W5OA 3H5OA 5JNWA 2FQYA 1Z17A 3T6KA 3SNKA 5HSGA 4W5RA 3UKJA 3EJWA 3IP5A 1RZRA 4H3HB 5T3YA 1E6LA 3H75A 4OBBA 5KWSA 1DRKA 2ID9A 4MRMB 5EWMA 3LOPA 6ABPA 5FWYA 4G0ZA 5GQSA 2PUFA 4JP1A 5DLEA 4IMJB 1Y1LA 4ETIA 3G85A 5TQJA 1NXTA 3GYBA 4RU1A 1VPWA 1URPA 4ZMSA 3LUHA 1R8JA 3OMWA 5CNMA 5TPWA 4F06A 2QSJA 1JFTA 4W5TA 2PUCA 3OQNA 1DC7A 1USKA 2FLKA 2CHEA 3LUKA 3DLBA 4P98A 1EWVA 3F6PA 3HXMA 4MS4B 3HUUA 4EYOA 1PNRA 3QK7A 1NXXA 3H6HA 4IILA 2FLWA 3GBVA 1TM2A 3IP7A 3MMNA 3OLXA 4H60A 4QYMA 3RVOA 4Q6BA 1NTRA 1QNLA 4O5AA 3CFYA 1DG9A 1YK0A 1F51E 4HNQA 1WETA 3HJFA 4IGAA 4LDZA 4B09A 3OM1A 4EVQA 2FW0A 4FE7A 3DBIA 4Z0NA 4G0PA 4MR9A 2FMIA 4S05A 3OO1A 1DP4A 1J56A 1BDJA 2HQRA 4MR7B 4JAVC 1LBHA 5FBKA 3L49A 3FMVA 4MAAA 3RVNA 1JBEA 3RVKA 1EWKA 1W25A 4N41A 4MS1A 3H5VA 2XDYA 3LKVA 1I3CA 3I45A 4IRXA 2R25B 4Y9TA 4YP9A 2M98A 3LKBA 5T7BA 1PUXA 1W9HA 3CG4A 3OM0A 2PUEA 5ABPA 4RKRA 3K9CA 3CTPA 4RK4A 2PMCA 4LE1A 4H3KB 3NHMA 3FGZA 3H1GA 1AB6A 5BRAA 4WUTA 3EQZA 5CNIA 4ZPJA 5EWJA 3NNSA 2FMHA 4YS6A 5JS1A 2A9OA 3KJXA 3RH0A 5TPZD 4KMRA 4EUKA 4Z4GA 3IP6A 1QO0A 2PL1A 1USIA 4XASA 3A0RB 3QX9A 1ABFA 3G1WA 1JDPA 3MA0A 3GBPA 2WRZA 3CG0A 2QXYA 4RK5A 2QV0A 4WWHA 1K68A 2CWDA 4HNRA 3KSMA 4WT7A 2MYTA 3HSYA 1GCAA 5IUJC 2IYNA 3I42A 4Z4FA 3UUGA 1YIOA 2RGYA 2GKGA 3O1JC 3OMXA 4JA2A 4YCSA 5E3JA 3OQOA 2WWVD 3TX6A 3GV0A 2FSPA 4YR7A 4KREA 1Z13A 1M2EA 4MS3B 4PZ0A 2NT4A 3C97A 1Z18A 4OLAA 3FFXA 1NXWA 1S8NA 4QYWA 1L5ZA 1QKKA 1TJYA 3GT7A 3ROFA 3URMA 3K4HA 3O2QB 3JVDA 1TVMA 3QEMA 4LX8A 4YGXB 3I09A 3CKMA 3DGFC 5KI6A 2JRLA 4N76A 4GNRA 4OG2A 1CYEA 2HJ9A 1E6MA 3Q9SA 4OTZA 4Z9BA 3Q7SA 1UDRA 2WJWA 2MYNA 2JBAB 5FWXB 1Z2EA 1FFWA 2PLNA 3HDGA 1JLKA 4LE0A 1P6QA 1ZDMA 3QELB 2QU7A 2RJOA 2FVYA 3E61A 4GPAA 4MR9B 5KQPA 1JH9A 4MYRA 1ZH2A 1JX6A
chains in the Genus database with same CATH superfamily
1GN9A 1M34E 1PDWA 1PZEA 1II8B 1NC1A 1DG3A 1YXMA 2AMVA 2FYTA 4H3SA 4IXMA 3UUEA 3ZTTA 2P9TA 1KU0A 2D0PB 1EB8A 4BFYA 2BCGY 2YZMA 3P52A 1BIFA 1WQ4A 3CMMA 2WUDA 1V3VA 4FS3A 1KDZA 3BWXA 2IH5A 3EDRA 2LCFA 3CLTC 2REQA 3DDZX 1JEEA 2XBMA 4M36A 2ACWA 2FQXA 3BK7A 3GU3A 1V11B 1YMQA 1BDMA 3HZRA 3A28A 4M1ZA 8OHMA 4NG5A 4ZTUB 3NTRA 2XKBA 1VKRA 4C4XA 3GGPA 1Y5RA 2C82A 1DXYA 4H0FA 4HWRA 4S3MA 2F9FA 3VPFA 3U3MA 5J3JA 2VJKA 1PZFA 2WFAA 1E2KA 4L9RA 4XFJA 2OBFA 3AL3A 3TNYA 1ADCA 1SVSA 5LM3A 1N7GA 1NI5A 4Y9SA 3GEPA 5L53A 2MMGA 3P26A 1D3AA 2LZ0A 3H3JA 4WTOA 4YGYA 1JN0A 2I80A 1G5FA 3RK4A 1UZAA 4LFBB 3M4ZA 2EFHB 3HDQA 2IA5A 2ZBUA 3KD3A 4B7AA 3PDHA 4P4UA 4TWRA 4IOKA 4U5QA 5AH0A 1T0BA 3U3RA 3INNA 3HDJA 5ALEA 1OREA 2HYDA 5T8KA 4Q7LA 3ZKWA 3I72A 4BKRA 1C29B 2W43A 2Y0PA 3ESXA 2B2CA 3I32A 4H15A 2HMUA 1V37A 5DJ5A 1L5NA 5BQXA 1DHRA 5C8VA 4R2KA 1UMBA 2ZB4A 1DEHA 1ZJ6A 1JLMA 4PPFA 1N1EA 1TYEB 2C8LA 2BCEA 2W98A 2ZAOA 3H5TA 3UFBA 3IPAA 2QDKA 1IFXA 3DG9A 4RF5A 3IELA 2VDPB 3H4VA 2FTKE 1U04A 3N1UA 4AQDA 3CJQA 5FLKA 4J3NA 1E2QA 5CK4A 4MI9A 3TSWA 3WL5A 3WP1B 3D5EA 3M81A 3NHAA 4DM3A 1A50B 3X1DA 5AKIA 4BV8A 4HV4A 5JLAA 4QLBA 1MFZA 3PKIA 1TE2A 2CD7A 2MR5A 2QRPA 3N7UA 3C87A 3LPAA 4ZA2A 4BO5A 5BR8B 2TMKA 3CINA 5A2GA 1PLJA 1CQPA 1L5VA 4YHBA 5DGHA 1TO6A 3N59A 3T3PB 4DNFA 3MERA 4DSAA 3MQ4A 5DEOA 4W99A 3QLTA 3NQ41 5FO1A 5GGXA 1XK6A 1FW6A 1KVSA 1EGMB 2AYYA 1E94E 2CXRA 3UMFA 2WJ6A 2P4HX 2CUNA 2UYHA 4HQNA 1RDFA 2PM8A 2OBYA 3ENZA 2B6NA 2FWPA 4HB0A 5JMTA 2YJZA 5I9TA 5KBYA 2W71A 3E9CA 3Q9NA 3WRVA 3DHEA 3C3CA 1GHTA 2OPBA 1CVIA 2OHGA 2DH6A 4J8PA 5C5CA 2N46A 3O3OB 1X8JA 3W8DA 3WRYA 1E8MA 2XTZA 3HU1A 5FLEX 2JVJA 2APJA 3B1JA 4DV6B 2EX4A 3IEKA 4REOA 4LF4B 4UASA 2HK6A 4GH5A 4TVBA 5BXYA 3CZPA 1PK7A 4QULA 2XVZA 3U39A 2OB2A 2WKRA 2P9ZA 2EKZA 4R2HA 3ELUA 3FCEA 4DEXA 3ZIUA 3UATA 3HWWA 3FLBA 5BV8A 2PH3A 1MIHA 3DHYA 3E7FA 5C52B 1DTWB 3DCJA 4TS4A 4UHCA 3EN0A 2PUAA 1ULAA 3H11B 1ZFNA 1UXKA 3LCMA 3KYDB 2WF6A 2ZI7A 4LC1A 3PEEA 1JV2B 1OU0A 3LQFA 3O2NA 1KI4A 1PBTA 4LC0A 2DQZA 3TIGA 3V2HA 2HSEA 2O4CA 1Q0TA 2XCRB 4MIEA 4FHFA 2Y9MB 3TUIC 4HLUC 3OJCA 5DNDA 2C3YA 4JBLA 1AZTA 3O21A 1FQWA 3L7YA 4ZT2A 2D2VA 3ELBA 1ZYUA 2C2HA 1ID1A 1QSGA 2FWMX 3EXFB 3GJYA 3JCZA 1RKVA 4AU1A 2GTIA 2GPAA 2X3FA 4X9XA 1GJRA 4NXMB 5BN5A 3DMTA 3LMKA 4DGSA 1OWNA 3RRBA 3OLVA 4JLJA 1JPJA 1O94C 5DBOA 5GMOA 4CMGA 1TQ4A 2OD2A 3U37A 3OHSX 3CYFA 4DLKA 4JBIA 4H4DA 4OXYA 4DFDA 2B8NA 4L75A 3C5HA 2ZTUA 4PS0A 5EAIA 5FAKA 4EL0A 2G83A 2NV2B 3DTVB 3ODGA 4MVJD 2P6UA 4QJ3A 3TF5A 3OQIA 4JEUA 2BFCA 1SCJA 1BYIA 3NAMA 1W4CA 1RAHA 1Z37A 4L2IB 1XZ8A 4BU0A 2VDOB 2CY0A 2X15A 3GEHA 3K2BA 5GZ3A 5J4VA 1GITA 5L4SA 3ZCTA 2EFYA 1CS0A 3GRUA 3VKGA 4EW6A 3HFGA 3BSSA 5T3UA 4LTNA 1MRZA 2Y1CA 5HZKA 1RMYA 1NLZA 4G97A 3HR7A 3PJDA 4NZ9A 4HNAB 5BVHA 1EK5A 1W35A 4ZALA 1KI1A 2EBUA 4HTAA 4QBFA 1VG1A 2CW5A 4KPGA 2Z8XA 5KNDD 1YT5A 4Q21A 2G8LA 4NNPA 3R3SA 1B6GA 5DYNA 4ECAA 2GXSA 3WBBA 1GDDA 2ATXA 1A4RA 1R9JA 1T2VA 2JI4A 2R8BA 3L6RA 2JASA 4Q7EA 3GEDA 1LFAA 2LP4Y 5EZQA 5K0JA 1M6WA 3LWNA 4E33A 2P1DA 4ZVRA 3UB3A 2Z5GA 3R6TA 3CPEA 2PMBA 3CZCA 3DUWA 5DCUA 1SUDA 3VPXA 3GIWA 3CNOA 2YN4A 3L7BA 4U02A 2RCNA 1AHPA 2RBGA 2GA8A 4KQWA 1JHZA 3R0VA 1LU9A 2QRJA 2JBAA 3A9CA 4P3YA 4IIFA 3WNVA 1LPMA 4WFJA 3Q8KA 1BS9A 2XSZA 4MLZA 1ZMOA 3HWX1 5TPWB 2G7ZA 5HF5A 3ZHOA 3EFOA 2X4IA 5D84A 1P2UA 3S2ZA 3OZGA 3Q87B 4AJJA 4JWTA 1G9XA 3QX8A 3DDHA 3GN2A 4JMLA 1FY2A 3AIKA 2C5LA 4LAFA 4UJ5A 3M2PA 5D3KA 3T38A 4F8EA 1UOQA 4YA6A 2D0IA 5TRTA 4G5FA 3UHAA 4R8MA 4NR0A 3NS7A 1DOZA 4NCKA 4KYUA 4V2IA 4J4BA 2KHZA 4W9RA 3FWYA 5DK4A 5A5VA 5F7XA 5GGYA 4NONA 4CWAA 1RZUA 2DQKA 5TARA 5G3YA 5C4IA 4OI4A 1WHSB 4FSHA 1WDWB 2P9CA 5MFPA 5JVDA 1RKQA 1A5ZA 3M6VA 2JIDA 5ALVA 5LXTB 3GEBA 4PPNA 5FF9A 1YJXA 3ZY3A 1ZUNB 2WZCA 3ENKA 4CT5A 5KPDA 1I3LA 1AUOA 2MSWA 3MD9A 1E5LA 3QXJA 5AVWA 3DLAA 2OHFA 2UYOA 4MV7A 3WYAA 3TB4A 2POCA 2G17A 3OLYA 3NI2A 2OBLA 3OPYI 3R3ZA 4C29A 5JYEA 2O5EA 2O1EA 4X60A 2WM2A 3MZ0A 1BZYA 2OXCA 3LP5A 2H1IA 5ALMA 1EU1A 3BIFA 1BWSA 5A0TA 3CRVA 4DUPA 2BONA 2XV1A 3RT7A 1KI6B 2FW7A 5EWJB 4E5KA 2PUGA 4FXPA 1M7BA 3HFJA 2IHVA 3H5IA 3C7AA 1AURA 1SVLA 4X6XA 5DTRA 1TLTA 3HB1A 1R6AA 2H1FA 2NUBA 3B9QA 5CXQA 2QMEA 1Y63A 1F6WA 1YBVA 1HY3A 3EXG2 1GAQA 3G8AA 3OTWA 2J7KA 1IMJA 1N8SA 4MUKA 4ROTA 1IHDA 2EP5A 2HSZA 3HWSA 5K8VA 5KWIA 4H77A 1HLFA 2AOUB 5IZCC 3GLGE 3LRPA 2BJVA 3T1VA 2JI6A 3DMGA 2YV4A 5HXAA 1MAAA 3B70A 3AY6A 3EFHA 1XCLA 3DZGA 4NMXB 3DW1X 2ZI6A 3PQ6A 5FBZA 3ML1A 1G5PA 2MOKA 1I0LA 1FXUA 2PZBA 3ROTA 3TDKA 1HL3A 3DEAA 3DE7X 4YI5A 3WGTA 2QRVA 5F9HA 3RJ5A 5TQ0B 4UM7A 2FFAA 4YJDA 1FNDA 4TXHA 3QPBA 2YMPA 4DXDA 1E3QA 3BE6A 3T0FA 2PD6A 3EIHA 2XPCA 3MSXA 5E7MA 3EB9A 3U60B 1H94A 4ML3A 4MZDA 3OFND 2PTGA 3C16C 4V2UA 1Q7TA 3BGOS 2ZPUA 5IT5A 3NIGB 3PGLA 5D3MB 1E4EB 1VSTA 4RQAA 5F2NA 1N9ZA 1O4WA 3JVEA 4AYTA 1AKEA 2GPWA 1SUCA 1SZPA 3OOSA 4GQBA 2F9LA 4P35A 3COYA 4FOSA 1UWKA 3UHOA 5FBHA 2H1LA 5B2ZA 5LIRA 5A2QA 5HRCA 2IJGX 2HMAA 1P4RA 2FEXA 3ZIDA 1FSSA 1FBTA 2YJNA 5L3SB 1R74A 1YCFA 5BWCA 2DHQA 2FX3A 1PV1A 1ZITA 2WTAA 2ZWMA 1L5RA 2NSYA 3KQMA 3CLRD 2Y76A 3M6WA 3G0GA 2F43A 4HYQA 5HEKA 1QFJA 1QTNA 3VPCA 1UXOA 3KSRA 4RTSA 2XA1A 3U1BA 4BNMA 2GKOA 4I4CA 4F2DA 2ZRFA 4CM3A 4R1TA 3OA2A 3H75A 3QGMA 4JGIA 3WB0A 5A1JA 5LNK1 1XNRB 4M9ZA 5BN1A 4G4GA 1I7QB 4ARCA 2BRUA 4QRHA 3KT3A 2IHTA 4Y2PA 4BUJA 1GZ6A 3HNOA 3G2PA 3NOOA 3O73A 2ZR0A 5ALYA 4CMKA 5L6MB 2FU5C 5DLEA 1W73A 2WTBA 2X8LA 4F5YA 2CLEB 2ZI3A 1X14A 1X3SA 3H83A 3HABA 3OKCA 4UBJA 5JDCC 1JEYB 2G1PA 2X5XA 1J0CA 2RAVA 3G79A 3SXUB 4LMAA 1XD8A 1NTOA 4O4JB 4DCCA 1AKNA 2GPJA 3CNLA 4AM8A 4WBNF 3QNUA 1K1EA 1WR8A 1M0WA 4DT1B 2ZUUA 4IKPA 4CQMA 3I53A 1C9KA 4OQNA 2HU5A 3EFBA 4FZRA 3VV3A 4EHJA 1H2AS 1MR3F 2F4NA 2V97A 3OC6A 2ATIA 4L15A 1BHQ1 3W2EA 3AFNA 4AICA 1UQTA 1DBRA 2V9CA 2VYVD 3D6VA 3D8TA 3KQPA 3PL5A 2XOEA 3QK7A 3EWAA 3QZUA 2LXNA 4HN9A 3KQNA 3LYUA 5AUQA 1YE8A 1NQUA 5CVCA 1HZZA 2JLRA 1KR5A 2PZJA 3HNRA 4FOLA 3B3JA 3O8QB 4RGBA 1QWSA 4QVIA 3MMSA 2V6MA 3B6JA 1P0IA 1KDPA 4F1JA 3ZVNA 2WPDA 1TEVA 3KIPA 1ZIPA 1UAGA 4I0WB 3UHJA 1T4CB 4ND6A 5DNVA 1IK6A 1HDYA 1ODCA 1P6XA 2IGTA 3I9FA 4KDCA 1UBKS 1JSLA 3NV7A 3G5AA 2XRZA 1JPNA 1PFWA 3L4BC 3UAGA 1FP2A 2O23A 1N25A 3A6FA 3LKVA 2B2XA 2WABA 5EJ8A 1VDMA 4Z8YA 4LBYA 4B2LA 4PYJA 1ORWA 4X45A 4BRWA 4OH7A 2TSYB 1GUYA 1J5PA 2BH9A 4IMRA 3UOGA 5BRNA 3F0TA 3BFKA 1LF0A 3OM0A 2W2NA 4MKZA 1E9FA 3FKJA 1U0GA 2AN4A 5J40A 2PAAA 1DPFA 5AHRA 3UGTA 3D1LA 2UUPA 3ESDA 2Q5FA 3HO6A 3HB5X 1Z0ZA 4YMLA 4C1NA 2I1LA 4WKBA 1ZA2A 4KYTA 3VR5H 2BZ1A 5L7WA 2P6PA 2HLHA 3IILA 1TUIA 1LLUA 4BQSA 5JCOC 1YFKA 3RBAA 1CR0A 1NVXQ 1P0CA 1AGPA 3MAGA 2BFBA 2C07A 2JANA 4BV2A 1D04A 1NMZA 3FPGA 1GFIA 2Z2YA 4MOWA 4EWLA 1EZ4A 4F0JA 5FTLA 3UH0A 3NTVA 2DPLA 4BXOA 3MA0A 4BX3A 3KKPA 1J1UA 1G7RA 4QLOA 3BXFA 4XWTA 1L4FA 3L8YA 3KJNA 1QS0A 4URFA 1YZ3A 2FX2A 5AOBA 3DEKA 3G59A 3QW4B 3FTNA 3WLPA 2QTVB 3DR5A 3I8XA 4DQUA 4ETWA 3NHUA 1HYGA 1XLWA 4QPPA 4REMA 5DASA 2WWVD 3GK3A 1AN0A 1CQIB 2FRXA 3EBLA 2V3CC 1QIKA 2Z5VA 4KREA 3WYEA 3NHKA 1IC6A 4MHOA 3NHBA 1A9TA 2XGSA 3GRFA 4J0CA 2YYZA 2BHNA 2JEYA 1NXWA 4YPOA 4JMPA 3W2IA 1OA1A 2VJMB 2ZJ0A 3PIDA 3QMWA 4L4YA 1K86A 1WKCA 3J7TA 5YASA 1VE9A 3SX4A 5EQJB 1KO5A 1RJEA 3LY9A 2D2FA 3QEMA 1UFOA 1P2VA 1F6BA 3DEFA 3K9GA 4WZBE 1KJZA 5DZSA 2FUG1 3U6KA 1M67A 4QA9A 1GSAA 1BCSA 1O77A 1NBHA 2PMDA 1C30A 3DEIA 1GZDA 4IXWA 1G2QA 4BO7A 2CLKB 4TSFD 5IPFA 1L4LA 1MW9X 1V9CA 3PPXA 2QEQA 2A7XA 5HF6A 1T3TA 2JCYA 3MOGA 5GJCA 2PLNA 1Z5GA 3OF5A 1PQYA 1ATZA 1PGNA 4GE3A 1N6OA 1D03A 1D07A 1P45A 1ECCA 4OMCA 3GUVA 5B4TA 1TZ2A 1WKBA 5H16A 1JH9A 1O96B 1W93A 4MR9B 5D7BA 2JJ1D 1ZH2A 3RVDA 3TXYA 1L4MA 5ILGA 2VF7A 3ZGXA 4BVEA 2X6RA 5TVGA 1W0JD 4L7VA 2I91A 4KQCA 5K0NA 3QV2A 5HW0A 2WUGA 1KAMA 3COSA 5IVKA 5J23A 4CM9A 1ST3A 5AVOA 4TKVA 4ER0A 4A0HA 1WVMA 4L5JA 1O6ZA 4J90A 1UDCA 1O94A 3BAZA 1E7SA 3DT9A 4GM1A 4OFZA 4J75A 1XPRA 3E9MA 2BGGA 1RD4A 2FRDA 2O8NA 2OGUA 2V7GA 3K9BA 3NBZC 2I3ZA 4HL6A 3SKXA 3HDVA 3ZNPA 3ZVRA 4AKTA 5TF4A 3BKWA 2HYIC 1V3QE 1U5CA 4U4AA 3WLRA 1F4VA 1OBFO 4DMRA 5L3RA 1ZSYA 2ZJ8A 4YMGA 3FMOB 2H4YA 4I55F 3ECSA 5T67A 3IHWA 5BSRA 5JJIA 1SXIA 3IB3A 3K94A 4FFBA 3F6RA 3MJRA 3SHOA 4L3OA 4Q4JB 5K6AC 4HX5A 3K09A 4E3ZA 5BURA 2YHBA 5EJAA 1Z33A 3G17A 4Y2GA 3B1ZA 1ID8A 4H7EA 4U00A 2DFVA 1GFZA 3VZRA 2RKWA 4YUXA 3S27A 3I62A 1OGIA 2HIMA 4LZWA 3EODA 1ZD3A 4DG5A 2EGUA 4F96A 2H9YA 3L43A 1Y42X 4R9SA 3KUUA 3N0TA 4YDHB 3QF7A 1G8HA 1H3FA 3B9RA 1U2GC 3WNBA 5AM4A 4Z4QA 3G3EA 1AKUA 1WS6A 4B4VA 3PDIB 2N47A 2ZUSA 3OI7A 5IKPA 4WHMA 2C5FA 4TLLB 3RVPA 4Q4HA 4ONEA 4B47A 3B6MA 3W5AA 2V6IA 1N5KA 3TIXB 2NSDA 4M89A 2I9KA 1AA6A 3NYRA 3AEYA 2QL5A 3QWBA 4QKQA 4TV9A 4CR8A 2XOKD 4OHZA 1Q95A 1VJRA 2ZREA 5ALWA 2FAXA 1OTXA 1JJFA 1H4TA 1X38A 1ZK0A 2FSVA 2OD7A 3FCSB 3OQVA 4UE6A 4AKIA 1RSZA 4C3UA 3HO1A 2IPNA 3TNJA 5LMNB 4JQZA 4V24A 5CVVA 4F92B 5K2MA 3PD0A 4IKEA 3UNXA 4L27A 5JIBA 4DPLA 4PX5A 4P0QB 4MYTA 1TVEA 2P65A 3IC5A 1M75A 1Q11A 1ZGHA 1B74A 1RWMA 2JCSA 2VPPA 1JF8A 2ZWOA 3G2QA 5CT4A 5ENVA 1M8JA 1DC3A 2C7GA 2R8RA 3P9RA 4YDRA 2WTXA 3M49A 3OPNA 4AECA 2XJ9A 5LA6F 2KX7A 3HH8A 3DXFA 4DARA 5A4IS 2EBHX 3FNFA 3A9UA 2J6IA 4MQLA 1Q6YA 2D5LA 4G9EA 2OENG 3P0EA 1FTYA 1LLFA 2H1HA 3S1AB 4DM4A 1SXQA 4UDNA 1U28C 5BOSA 2IEYA 3EGXA 3WNZA 2QNRA 5LQRA 2JLVA 2H1WA 1IE3A 5A1TA 5CJ2A 1U2DC 3GGJA 3CKKA 3RNOA 1SBHA 4HD8A 1EQUA 1YQEA 3AR2A 3CW8X 3IUJA 3NTQA 4W7IA 1BVRA 4MVCA 1B43A 2YWEA 3DDWA 4WV3A 3U9TA 4ZMBA 1H1DA 1TNDA 4I5IA 3MLBA 4AJNA 2ODTX 3GHHA 1NW9B 4LMRA 2B1JA 6YASA 4NZYA 2A58A 5CXUA 3PV0A 3AYZB 4E30A 2XQKA 2ZAYA 3TNFA 2YXBA 1XB2A 3MJTA 4YRMA 2AN3A 1RM5A 4IGIA 2Z8YA 1EXMA 4P7FA 2A8YA 2G9VA 2Z1NA 4K86A 4PNPA 2J08A 3SPXA 1K5HA 4GUAA 3T5DA 4DHWA 1WPGA 1OI4A 2IUYA 2L18A 4EM6A 5IVPA 1K7XB 1OFUX 2WM3A 4LFCB 1FRFS 1N0WA 1ZC3A 2AB0A 2DFNA 2FWIA 3NJRA 4GX2A 4HTFB 3P9NA 2COKA 2H31A 2ZWVA 3BWBA 3KALA 4JC5A 3AFGA 4NLLA 4NU6A 4XX1A 5DRTA 5AXCA 4C9BA 4JYZA 4HLDA 1Z73A 1MVLA 1VJ1A 4EY5A 1DCMA 4JODA 1NG1A 1THMA 3D54D 5H70A 3ZY5A 3JVUA 4B4OA 3OZVA 2ZTMA 3L7IA 3SX2A 2L2QA 4CG2A 1RQLA 5KTKA 2G07A 3TTXA 1J09A 1CR4A 3E3MA 4IHAA 1QQTA 3JWGA 3DLHA 5BR1A 1ZVKA 5DHRA 3ZD8A 2QSUA 2QYHA 2ZDQA 2HCRA 3F8SA 3JAWB 3AJEA 4HATA 4E88A 2PQ0A 3O4HA 3PENA 4QOFA 1SIBE 3EVDA 1SOWA 2YYAA 2VHYA 2IITA 1E3IA 2BL4A 3FIJA 4RTMA 4B3RB 3LYLA 3EE6A 1RWVA 4QSMA 4CQLB 1QHFA 4EARA 3J81A 1EFVA 1UJBA 2XRMA 4DMCA 2BUAA 2HA4A 2NX2A 1YBMA 3FZYA 1QGAA 4H7IA 5AI4A 4BVKA 1BMQA 1E63A 4I55A 5LZ9A 2R1VA 1RAFA 3CUSA 3NGMA 3ELWA 4ISBA 4R9NA 3AP1A 3PUZA 5DYYA 1ICIA 2ZBVA 4WCFC 2PT7A 2DEUA 2PGIA 3DLTA 2DFTA 1N77A 4CEJA 1RRFA 3V8VA 3DE4X 1QE0A 3E9EA 2OPHA 3ZW9A 2DKOA 4Q7KA 2ICAA 3RRNA 2D00A 1C2TA 4KK4A 4ZAGA 1E3SA 4D0LB 5I4CA 4HWGA 1PV4A 1H85A 3N39C 5ED4A 5T41A 4EO9A 4K03A 1AV7A 4IGEA 4U9IS 4KLCA 4GLJA 5JRZA 2VLBA 2VPIA 1V43A 2PS0A 4KUGA 1IULA 1AUPA 1B93A 2Z9DA 5DNUA 4ND3A 2Y1XA 3TM5A 2WMNB 4TROA 4DAOA 1TUGA 3GLGB 5H80A 1K2WA 1PJLA 1UWVA 2RHWA 3CRW1 1U3TA 3L41A 1CNMA 4TUYB 5PGMA 2XZLA 1KYVA 3IEMA 1DDGA 1Y6RA 1HE1C 1VB5A 2QWXA 5ITVA 4QAJA 3IDZA 4U2FA 1LUAA 1IB0A 2DJ5A 3TQFA 4NBTA 5AHXA 3W6UA 4D3DA 4DC0A 2AKYA 5JOQA 5IEBA 5AWFC 2D7JA 1LEHA 1Z5VA 4YAGA 1OJ7A 3L7LA 4HNSA 4YJ3B 4XE5A 3R6LA 4Q39A 2ZU0C 5REQB 3G2JA 4IWXA 1R0WA 4F5DA 2ZS7A 3DE6X 2ADFA 2WP0A 4E3WA 1A2QA 3AR5A 3HCWA 2VDJA 4QBKA 2DQ4A 4W9NC 4ZT3A 4KN8A 3X1JA 4EUFA 3A10A 3W5IA 1VMEA 4G8CA 4EECA 4UCXA 3E27A 4RL4A 4WKGA 4XXHA 2GCIA 5BYAA 4L4XA 5ALPA 3SDSA 3B3GA 3CEPB 3C1AA 4IDQA 4PW0A 5DB4A 2VK2A 4L4ZA 4EJSA 2F1JA 1VE1A 4KQGA 3FVTA 1DI0A 2G8NA 3Q98A 3FE2A 4RD3A 2HDOA 3L9XA 1NBMA 3DWIA 3QLVC 1I4TD 5LA6A 3UK1A 2LIVA 4DLWA 1AXRA 2ASVA 2CLMB 3NB0A 3JQGA 4YRDA 1X7GA 4B4UA 4RJIA 1H2RS 1AXEA 5HOEA 3ZXSA 1FUUA 3TEFA 3UM9A 4EYSA 5FWAA 3F3MA 1VECA 3PC4A 3A31A 3WV4A 2UVDA 1VSBA 1VZ2A 3A1DA 2WVAA 4BMOB 4CCWA 3O8BA 1LS6A 5E8JA 1WBJB 5GWXA 1RC8A 1S8AA 1GFSA 2ONZA 2V3VA 1WUKS 1QK5A 1C7IA 3C4VA 1QYXA 4J0EA 1D4ZA 1EUDA 1SXJD 3M34A 4L28A 1Z4LA 4DPKA 5H3HA 1VCOA 1OAKA 4IR7A 4K05A 3QF4A 4YQFA 4QXQA 1E4VA 2DRIA 4FS8A 5ICGA 4WLUA 4LGVA 2VATA 2OMKA 3UOAB 2V5VA 2VTDA 2R48A 2BGRA 3BTSA 1T6XA 4ND1A 1FMLA 1R0KA 3DD1A 4LDAA 5P8WA 3V1MA 4PN3A 3D6MA 4KVGA 1TRHA 3I12A 5KDOA 4H6WA 1Y3AA 3K92A 1GUZA 3ZDAA 3RYIA 1RAGA 4AT1A 3W7VA 3D8UA 1J5EB 4B6PA 4ZCQA 1BAPA 2RCYA 1HI9A 4Y6RA 1G8FA 3KFLA 4MO2A 4OEHA 4RGQA 2VAPA 1FSPA 5JLJA 2H4WA 2FMFA 5EEHA 3QEBZ 1TU0A 5A0VA 4KAXA 1L8OA 1PTJA 3BT7A 4FE4A 3TIIA 3H5RA 2QRGA 1ULHA 2F67A 4RHEA 2NYUA 4EFLA 1ODJA 1J5XA 1P9LA 3TAUA 1TQ8A 1QG4A 3RODA 3HBMA 4INJA 1PJRA 3F7NA 3AF6A 3OTGA 5HNKA 1V4VA 4NYMR 4IDEA 2OC4A 3RABA 1YHYA 3VZCA 4DL9A 1FU8A 3ZD6A 2F1HA 2X8BA 4PZCA 1XPJA 2BC9A 6NULA 4AMYA 4D6YA 2Q8NA 4MRPA 3IDAA 3OX3A 3RANA 4EATA 2BMVA 3V9AA 4CM4B 1HZJA 2P3SA 1SRRA 1QOQB 2WE8A 3GD5A 1PGOA 3LUBA 5FQOA 1VA5A 4HDSB 1PCXA 4H7JA 4DW8A 3KG2A 4PLFA 1UBSB 3BQMB 3PYMA 5JWHA 5K4AA 2CMFA 10MHA 5TGTA 4G0NA 1C50A 3QFHA 4MMXB 3DHVA 3NKFA 1SU7A 5H4GA 4LECA 2XDAA 1K5PA 4P0TA 1HQCA 2JFGA 3C70A 2I62A 1F8YA 4BFCA 2G9RA 4W5RA 5C1DA 3DZIA 5LDGA 1RZRA 1Y3HA 1YZGA 5FUBA 2NSHA 4X1KA 3SFVA 3UPUA 5G02A 1DJNA 4ITRC 5IARA 3C39A 5AW3A 3SYKA 5K9ZA 3TKAA 3FPAA 1XAIA 4KXQA 3CUYA 1CEXA 1KY4A 2VK8A 2XOKA 4MVJA 3W5BA 3U44A 2Q3MA 4HAYA 2XGOA 2IKQA 2JLCA 3GRKA 4PCAA 1N5IA 3KPYA 3AM4A 2H51A 1VCIA 3WR5A 1KNXA 1XT6A 3S70A 5C8YF 1UC9A 1XMXA 2AMJA 3PXBA 3DKVA 4H16A 3Q0TA 2J07A 4N5IX 4HWOA 4B80A 1U0BB 4XKJA 3S2YA 1JR6A 3L1JA 2Z1DA 1RJDA 5J9FA 2G9ZA 4NBSA 1CR2A 3FFAA 5EUQB 2P6NA 2WWHA 3DB2A 4HBGA 2IS4A 3KTDA 1UUFA 4KMMA 2GZRA 1OV6A 4FMBB 5E6SA 2IYPA 2XZTA 1QRTA 4BZWA 2E37A 2XQJA 4IDBA 1S4MA 4NFYA 3FDZB 4LWZA 4LDZA 3DL2A 3EVBA 2C9DA 3KT0A 4H0CA 2ZS8A 3C3XA 4JI5B 3KZNA 4Y9UA 5IKXA 3GB9A 4PO3X 5KDDA 2P0EA 3EGIA 2BH2A 3WGJA 3GLVA 4LY9A 1BDJA 1HYBA 5ALLA 2NSLA 5E1DA 1P73A 1P2DA 2NO9A 3AETB 5IABA 2YQZA 4ITUA 1D7AA 3OOYA 2HGSA 2V58A 2QX6A 4RSGA 4PYKA 1CFJA 4N41A 4BO0A 4S24A 1RQ7A 1C81A 3JASA 1N33B 3HY4A 3KE8A 2JI9A 3U7QB 4YR9A 4MDHA 2Y4OA 6LDHA 3UJNA 4NNJA 1OFVA 4JXKA 1HE3A 1GSOA 4PR0A 1TCBA 2XKKA 2BE9A 4CF6A 5JANA 2YNMC 1F8FA 1BCRA 1CUYA 1P3Y1 2Z0MA 3F47A 3R3VA 4LE1A 4H3KB 5B1IA 1TC2A 1KVQA 2K6GA 3FGZA 3ORSA 2A0XA 5FI1B 3PUYA 2BI8A 4WUTA 1N92A 2ZSUA 3VPDA 1V6CA 2YX1A 2F3PA 4KAAA 3JQ7B 4FYXA 1H5NA 4P4TA 4Z3KA 5HKBA 3AHHA 3PQ8A 1X77A 1QGOA 2OOKA 3ZE0B 5I45A 2X8AA 3AVUA 4EG0A 1VLLA 3KB1A 3FBGA 3ECCA 4PWYA 3N8DA 2NLOA 3K72B 3U81A 2B83A 4ALNA 3IIMA 3OD5A 1ABFA 5G0UA 3VR5D 1BE1A 2FPIB 2TECE 3GYGA 3L7CA 3L0CA 1ZJWA 1Y9EA 3LCJA 4DANA 1A71A 1N5OX 4YP0A 4DLAA 3KSMA 3BWCA 4P38A 1PNVA 1FFDA 4GRAA 3RC2A 2C9OA 3BD9A 1P74A 3O4GA 4ZT7A 5HIJA 4PLYA 1XTRA 3IV9A 3R7LA 4PC2A 5EJ9A 1E96A 1JDTA 5JBNA 4AMZA 5I6DA 1VG0B 1HFJA 2R7KA 2W2LD 1AQIA 4M9XA 3VGJA 2H2DA 1J1ZA 1A1SA 2WHYA 5JJKA 4OIMA 2P1RA 3DMDA 1GEEA 1PL6A 4Y1GA 5HX7A 2XWSA 1VPDA 3D5QA 3DCNA 3CKMA 3CO0S 4O6VA 5CT5A 4C03A 1RQNA 4Y1FA 5EHXA 1ZI6A 4EL5A 3LSYA 3I6YA 2FF7A 2BOVA 4CL0A 3F7OA 3A1FA 2P40A 2WYHA 5KNBD 2GMWA 2WJWA 5JYBA 5AJYA 3AC0A 5L7YA 1FCJA 1P7WA 2IXAA 1L0BA 1WV1A 3MGCA 3WGGA 3WAKA 5JDCA 5GP1A 1KF0A 1VKJA 4Q4HB 1N6LA 1PKEA 2A5FA 2ZSIA 1K4MA 4GPBA 2PZEA 4YMSA 3LW8A 4F86A 4DR3B 2RGNA 1DQSA 3JQQA 2IP4A 3SS9X 1Y81A 2BFEA 3W05A 4RJ2A 2DQSA 4X20A 1QUFA 3PC7A 2G1UA 2WBLC 3WYNA 1LTHR 1U9YA 1XTPA 3VNVA 1G0NA 3TG8A 2FUKA 1DBQA 1O57A 2VSYA 4M9QA 5IC4A 4QXOA 4QYTA 1XELA 3AONB 3W8EA 1KEEA 1IN5A 3D4NA 3NPMA 3IAAA 2F17A 9ATCA 1Z2AA 3DVAB 2R79A 2I2BA 2ZVQX 4ZIRA 3HU2A 1XYVA 2YQ4A 3EVZA 2I4RA 2E4YA 2EBFX 3L84A 4B31A 2WJZB 4CTJA 1L4EA 2K7ZA 3D0KA 3ANMA 1OFGA 4M38A 4P2GA 4ZU1X 1P1RA 3W6OA 4I6EA 2OYCA 2R7NA 3CKYA 1MU0A 3AIIA 4JQYA 3UTDA 3AT1A 1ZINA 1A5AB 3GFGA 3O7WA 1GRVA 4HR7A 3B7GA 3RSGA 5JCPA 3JATB 1ZD8A 4FT2A 4L73A 3HEBA 3D9QX 1P6UA 5BN4B 5LPNA 2EYUA 1YMVA 3AU9A 1E0DA 2P6OA 3A0UA 2QVCA 1BS2A 3HC7A 4OL0A 4OXKA 3OJWA 1OAAA 1E1LA 3LUCA 4HB4A 5ER9A 4F56A 2ROQA 3MUNA 3EG9B 4EB6A 3IA7A 3L7MA 3DL0A 1X74A 5ERYA 1K3UB 3T5CA 3VDQA 1T9KA 3EEBA 3FX2A 5CX4A 3HB7A 3GPCA 1NUUA 4DQDA 4F6RB 4CQMD 521PA 4Q7JB 3KWLA 4EGSA 1ECJA 3INYA 4O2AF 3U4QB 1IL0A 2PX2A 3I1FA 1OLSA 3JQ8A 2CMKA 3FNHA 1P77A 5AUPB 3HJRA 3PFKA 4MW1A 2E5WA 4JSYA 1PT9A 2CFRA 3QVGB 4MHSA 2WPNA 1BNCA 4ES6A 2YV1A 4B3HA 4S2UA 3I39X 3Q85A 1TYDE 2DUJA 4MUYA 5K7SA 4B4WA 1QGUA 1K6EA 2XDQB 3ZV5A 2EVWX 4U2EA 2CZQA 3NHFA 3BMQA 4Y8VA 4ZYZA 3SQWA 2W6PA 3KKQA 2J30A 5JXWA 2A0YA 4GYWA 1BXGA 2QN8A 2XNJA 2ISQA 4G01B 1UBNA 1ZUWA 2MDTA 2VTVA 3PXGA 2JAQA 1XQ6A 4NECA 3FDFA 1KO4A 3KZKA 4RTNA 1DC4A 2IIBA 2JIZA 4RK1A 5CNKA 3QELA 4MP3A 4IAOA 4UEWA 3VDMA 4Q9NA 1J0BA 4TLEA 2Y6UA 1Z56C 2ENWA 1HO3A 1P7VA 3BS4A 4TXJA 2CDBA 3DMHA 2ZR9A 5IK2D 1EHYA 3A4MA 5KEIA 3D4BA 5BP7A 3IDOA 3B51X 4J76A 4A0SA 1PJTA 2A86A 1XC7A 4YRNA 2ZR7A 2GBLC 4RQUA 4WJKB 9ABPA 1ZU4A 4CIAA 2J9XB 2JVIA 1XCGB 2XUAA 3EGEA 3V1TC 2QBYB 1C1XB 2FN4A 3HVIA 2B1GA 4GEGA 2I0FA 4QGBA 4U7GA 2JEOA 2QZSA 3SOPA 3X1MA 2ZBFA 3BCRA 1Q57A 4AJ2A 4CF5A 2ODAA 1VYVA 1CZNA 2RH4A 2V6FA 2AN1A 5JJ5A 1N75A 2Q4OA 1KQPA 2Y1GA 4XD2A 1Z4MA 5ADHA 1OAOA 3PJFA 5DT9A 3U19A 4BASA 1IOVA 2HOQA 1S01A 1F9EA 2C9CA 2ZIFA 3KVNA 3RSZA 1E6KA 3PBKA 4IJVA 4FEEA 2EZ8A 2UZ3A 3ZWWA 3HBAA 4GOOD 4LGYA 4HFNA 5B2EA 4TV8B 4QRIA 3ANXA 3EEOA 4RPJA 1JU3A 3OZEA 3AKEA 3B1XA 3B36A 4CN9A 5IBQA 2GM3A 3SXPA 4U9HS 2R60A 1A9RA 1M2GA 3AU8A 4GPEA 4B43A 1SKYB 2K87A 1MENA 3KR1A 4NZMA 1R0CA 1MTOA 2QN6A 2WWFA 2YCLA 2OK8A 2REXB 3IMKA 4XB2A 5T57A 3AM3A 1KOGA 2DXIA 5KOHB 1KKUA 5HMMA 1H2HA 1SY7A 3HRHA 1I5RA 3EUEA 3CRZA 3X2FA 3OCVA 1ABEA 5CB4F 2G09A 4TWJA 1LLQA 1OLOA 5H59A 1I3OA 1ILWA 1R0LA 3D02A 3P5BA 1TZBA 3T4PA 5TQ2B 4D98A 2NVOA 2VYVA 1R5NA 2V1XA 4S2EA 4NZPA 3X1WA 1Y8ZA 1KZGB 2O3JA 4BLPA 4DZZA 3VKWA 1T2FA 2GARA 2QVYX 3QA3E 1KYXA 4Q01A 3AEUA 1VMKA 4B6EA 4POOA 4F3NA 1ZHFA 3KKOA 4XWKA 3SQNA 4KWIA 3ADBA 3RFVA 3I37X 1XMOB 4OAOA 2P62A 3HUEA 3GJRA 3SSAA 4EIWA 5A04A 5DCLA 4L8VA 1QO7A 3EVGA 3FR7A 3NBXX 4D41A 3T5AA 1XCJA 5A05A 2OWEA 3V97A 1KFKB 3BJZA 1NJ1A 2G70A 3DAFA 3BWMA 4HMPA 4BB0A 3WMEA 2WQ7A 4JA0A 3RGWS 4GBMA 3WJ1A 3IBYA 5FPTA 5CFMA 5J43A 5JD6A 4KE6A 5FX2A 2RAFA 4LWOA 3SZLA 3BPSA 1EB9A 2HPZA 2BFOA 2PFSA 4E22A 5F23A 1XD9A 3OM9A 4Z53A 1JEOA 4RY0A 1IJFA 5JXGA 1QPZA 4FC6A 4H9GA 2X7HA 1XTZA 2AR7A 2F8MA 1RM4A 1IY8A 3GEIA 5HK9A 1TW3A 4OFBA 1ZRHA 4IJ5A 1GTMA 2X23A 3WO0A 4CLXA 4F3CA 2XMGA 5E2IA 3G68A 3EG5A 1JE1A 4O2RA 4QPJC 4YUVA 1RM0A 4KI0A 3ZWPA 5IJ9B 1JYSA 1CUZA 4ILEA 1RNLA 2QOEA 3BBPA 1P29A 4UPDA 1F5NA 3TSOA 4AI6A 3T06B 3SQDA 5EJIA 5DOZA 3F8TA 4LPSA 2HD4A 4E07A 1I1OA 2QTBA 2QRVB 3H2IA 2HXGA 1WW2A 4MKRA 4NBWA 2Z8YM 1YB7A 2D13A 1G16A 2AWOA 2QZZA 3KHSA 3LHKA 3KQKA 3MS4A 4NMMA 4I8XA 3K70C 1Z45A 4WFIA 3UOWA 1G6Q1 1P2TA 5AKLA 4KN6A 4BJHB 2GCOB 1NVUQ 4GHWA 1NWHA 1LI7A 2G9NA 3PGA1 3QE3A 4OJTA 4RS4A 4RPHA 1FS4A 2G77B 4TTJA 4O8CA 1XF1A 3UMMA 4PO1A 2PCLA 2OVFA 4TYPA 1EUCA 2AFRA 3KQHA 4YROA 3EFEA 2YASA 1Y8QB 3ZHUA 2JARA 3N0RA 4OD0A 2ODPA 5GJBA 5CYOA 2GX6A 4RAOA 5HF9A 4F9GA 1LWOA 1YZNA 3IYLW 3ZY6A 2MMCA 5FPKA 1LDBA 2EP8A 2IHBA 3G8BA 3C85A 5LZ8A 4GBGA 1J99A 1TZJA 3UBMA 3F5DA 4PBTA 1AUQA 3E9DA 2NN3C 1UFQA 2G1AA 2DZDA 3DULA 1BVYF 1F8UA 4ZO4A 4DWVA 3UMCA 1CDDA 5KTMA 5FXMA 4LEIA 4P7JA 4ZANA 3W5SA 4XPIA 2A0FA 2CSXA 3WY9A 1VHQA 5SY4A 4RC9A 5FQNA 4J94A 1QGZA 4IDAA 1KGSA 3VU3A 2PGJA 3PDUA 4IHJF 4IDCA 1ZNWA 1ORDA 3UUFA 4BLOA 5JPDA 4NICA 1QHSA 3ESYA 3VZDA 2L19A 3GLFE 2WHQA 1OTHA 3A9TA 4FONA 5LCXA 2PX6A 1K92A 2ASEA 2W2LA 4XM1A 4EKNB 3C7TA 2QU8A 4NZOA 1UM9A 1KZ1A 3WIDA 4F91B 3S81A 2X4DA 4RLFA 4Y2HA 1ESMA 1MJFA 2QTAA 2EKDA 3G9ZA 1E3EA 1E5TA 1YR6A 1Z06A 3HUTA 3LX8A 4I4TA 4LRUA 1GR1A 4M88A 3SJUA 1JAYA 2CK3A 4UTXA 4PNZA 4TL6A 2HDWA 4RKYA 1OXVA 3QI7A 5G41A 2AD5A 3ONWA 4L57A 1KK3A 4N0QA 1PZXA 4R31A 1ZEJA 1DJOA 3JX9A 4QJ5A 1JKXA 3ZZMA 5I8WA 3C1UA 1QU2A 3TPCA 1ZW1A 2IPMA 3ZDBA 2E48A 4NFSA 4MP8A 1PBNA 1UBJS 2GZAA 4IEFB 4OO3A 1XZEA 2H7YA 4G0YA 4Z0TA 1JAXA 3THXB 3WL4A 1EHIA 2O07A 3GZNB 1RMTA 3LXRA 2JB9A 4KUEA 3CB4A 3M70A 3EDCA 1ES9A 3A14A 3CX4A 1XVIA 1MA3A 5F9FA 2QTZA 5AKHA 2R86A 4GX1A 1EUDB 1GL9B 1RWBA 3KM0A 4E94A 4R1UA 2W0MA 1E6CA 1U9IC 1JHQA 1QYDA 2P3LA 3QOFA 1NY5A 5LYJA 4BEJA 4HTFA 5KWJA 4OHRA 4HG2A 4N3AA 4AIIA 1AUXA 4D97A 3VQTA 1M1NA 3NM5A 2I29A 2Y0BA 1LB1B 1P44A 2ZPAA 3KOXA 1FDUA 4O1MA 1UJCA 2VPTA 3LYAA 3HVUA 3JAKB 4HDMB 4XD7A 4MWBA 1H5UA 3A1EA 3KVVA 5ICCA 2WU1A 4JUBA 3DOIA 1IPHA 2QUZA 3ZU2A 1NW4A 4DAEA 2CF6A 5L3ZA 1YBAA 3MTBA 1EQAA 4P36A 4CHGA 4EG7A 1HYHA 3ZX5A 4CV1A 5IJAA 4PQRA 1ABBA 1TADA 4BNXA 4F04A 2P2ZA 1ZGBA 2J32A 1P7PA 3T6KA 4BGEA 1Y89A 1UINA 4IINA 3VFDA 1IN1A 3NLLA 1R4MB 1DRKA 1RRMA 1C8LA 2YJGA 4KXYA 4QC2A 4RBNA 4RJTA 4G07A 3IEXA 4RJJA 2O7VA 5K3FB 5K3SA 9GPBA 6ABPA 1AGYA 1YB5A 4P81A 5GINE 1SCIA 1J42A 2UUBB 1DCTA 1NI4B 3G85A 2RJ3A 3VYTB 3LVQE 5GV7A 4XIFA 2HBYA 5IH7A 5COQA 1XD2B 3ZK8A 4ZMSA 4GMHA 1BX3A 1FDVA 2AE1A 1KYWA 3ESRA 3FBWA 2GN0A 4HN4B 3QUTA 2H1SA 5FAXA 5B55A 5JT1A 1TEZA 2XKJE 3H2HA 4MWSA 1CZUA 4PIPA 5BMVA 2WU8A 3T94A 5AKKA 3QVJA 4DCGA 1NJFA 4HEA6 3PA8A 3OBIA 5L95A 1VFNA 3CX8A 2GF2A 2Q3BA 4MV6A 2IYWA 1C3OA 4M1SA 4OMUA 3PUJA 2XYVA 1Z63A 4D96A 1D2HA 5JTUA 3NX4A 4GGMX 2XDQA 4LBZA 2I55A 2KJQA 3CVYA 4B2YA 4LHEA 1F51E 1OXUA 5B3KA 3Q12A 4MO9A 2DWQA 3ZHQA 2HA6A 5A4AA 1FQKA 3R44A 1AQLA 1JNXX 3O9VA 4HH0A 4IGAA 5KX5A 4TYWA 1J0XO 3L46A 4O08A 1VOTA 4MARA 1XEWX 2LW7A 1CJSA 3I6BA 1QCYA 3GNTA 2CB0A 3R5KA 1J56A 1RHJA 3F3SA 4B81A 3KQUA 4NV0A 3T7JA 3L49A 3K9WA 3FMVA 4GIBA 4NYMQ 5LP6C 2NQ8A 4BQEA 1W25A 4CGYA 5CPBA 2OBXA 1XFDA 4D4LA 5BXQC 2JJ2A 2YXDA 2G0NA 2R2AA 1TAGA 1SK9A 1UODA 1QZZA 1S7GA 3EZXA 1PQUA 2J0VA 4QUAA 4YUZA 3SQXA 5IWAB 1NG9A 4P4SA 4Q00A 2FN7A 3AJ8A 1ZJ5A 3AJAA 5AK4A 2NU8A 3RLFA 3X1ZA 2RARA 4G24A 4YCCA 1XXLA 4GSKA 2F1IA 2P90A 1P0MA 3RF7A 1KIMA 1VL6A 4X65B 4X71A 1W49A 3VR4A 1SKUA 3U3JA 3R23A 4ZCLA 3EQZA 5EKTA 2FSVC 2AVDA 1A8UA 4MAMA 1TM1E 1V1RB 2BMWA 4EEZA 2AOTB 3BICA 4PFKA 5E9AA 2KLHA 2OA0A 4YY3B 2I6GA 2YWXA 1NRWA 4H7PA 4M98A 2AX4A 2FZWA 3F5QA 3F5FA 4C20A 5EIXA 2XCLA 3A0RB 3H7IA 4MJ3A 4X93A 3R5FA 1ESEA 1E1RD 1HC7A 1KC3A 3F46A 5BVGA 2VQDA 3SOZA 2ZIZA 3TVDA 1YR3A 4J7XA 2MT9A 2ZJFA 3MAAC 1IHUA 1X2EA 1TK9A 3OKFA 4OB6A 2JIOA 3H7AA 4WT7A 3KK0A 2R0QC 2WHRA 1UPTA 2UYYA 3KQOA 4M8IA 1L7QA 2NAFA 4UMDA 4JLUA 3FOZA 4WLFA 3PZBA 4OVKA 2X2PA 4RVOA 4DA7A 2FSPA 2I9PA 2OBBA 3P19A 3BGWA 4TKUA 1SBNE 2I66A 1V6AA 5IP5A 3MFYA 4A82A 4MCHA 1JJIA 1SUAA 4L8FA 1JEDA 1QR6A 1MIOB 2NXJA 3GT7A 3H4MA 1TIBA 3K09C 1LQUA 3EEYA 5EPUA 4X6YA 2HCBA 3Q6MA 4P5DA 4JI6B 4CCAA 3JR7A 4RFVA 3LPLA 2QVZX 2XAAA 3I5YA 4EBFA 3HN7A 1ADGA 3I09A 3PP8A 1IHPA 4H7FA 4Y7DA 5KI6A 1W88B 1PWEA 2R11A 2G88A 3L77A 3EZNA 4NG4A 2Z3ZA 2EF0A 1V5FA 4RA6A 2XHZA 4IJMA 3KPUA 3VYUB 2EDCA 5CB8A 4QU5A 3U40A 1Z5OA 5IDXA 4DC1A 1IG0A 3COPA 4LE0A 2JNWA 4YPFA 2QRMA 2GERA 2WAAA 3O8OB 4JLKA 4R2JA 3DBHB 3CVJA 4KH1A 4L7QA 5SY6A 5J4HA 3GZJA 1KDVA 1MBZA 1ISPA 3DAOA 4CLRA 1ZK4A 4KAJA 1T3HA 3PWZA 1J22A 1SU8A 4LTMA 3EZ6A 3G8DA 4NYIR 1KS9A 4MUJA 4D5EA 5THXA 2X0JA 4ZYLA 2OV1A 1V0JA 3AX6A 3B20A 1R18A 3GZ4A 4BVLA 2JAWA 1A5TA 1B2LA 1I7LA 1NPDA 2FDRA 3PIRA 3OO0A 3L3BA 3U48A 4DZTA 1ZM2A 3K6JA 3ZH2A 1SXPA 4MW2A 4K5QA 1BGXT 2ATCA 2RK6A 4YT8A 2BBWA 4P84A 1DRVA 3IHLA 3QKRB 1YVDA 4JU9A 1EMDA 1CUJA 4KL8S 1OFUA 1QORA 2O2IA 1VL1A 4LCBA 2OLJA 5DYIA 4ZI3A 1IDOA 2HJRA 1TYBE 1ZC4A 1VP3A 1C0IA 2A5JA 2JBHA 3A1TA 3CNHA 3AUSA 1WRBA 3ZJ5A 2I3DA 2PT9A 1U7WA 4N40A 1JVNA 3F90A 1MC1A 1HDGO 4TLMB 3UA4A 3V48A 2ECFA 1F1BA 2C1EA 4PCLA 1U0HC 3UCEA 5HM6A 4V03A 2ID7A 1M8KA 2OR3A 1TIKA 3HWRA 3V42A 4EO4A 3DUFA 3TKYA 1QWOA 2OCAA 1L4GA 1M2OA 4DWWA 5KCZA 2VSQA 4BN0A 4Q4AA 4UUQA 1VCHA 2B1QA 2IDJA 1WNTA 5FL7D 4FGZA 1WO8A 1XDUA 1HE5A 3DBRB 3H3XA 2RG1A 1Z5PA 3I9LA 1Z4PX 4QUEA 2YYSA 1MB0A 3QU7A 1J0EA 1ZQ9A 2JA1A 3DAPA 4NATA 3OZ7A 5CJJA 1YCHA 1K7CA 4OXRA 3U9SA 1DX9A 2QW1A 3QG1A 1JB9A 3DBHA 3M6MD 3F71A 5L7TA 2QVBA 1G9TA 2HSGA 2QROA 3PXEA 1S3IA 4K9NA 1KEUA 1KK2A 1L3IA 4MUHA 4XGKA 5FFFA 3MWGA 3OEWA 3TXAA 3H05A 3DP9A 1Z07A 2R4QA 2WICA 3FOWA 2QUHA 1QF9A 1Y0BA 5HQ3A 5MFZA 3V7NA 3GLIA 2ECQA 2ZIEA 1QYIA 2JK1A 1T5HX 4BO2A 5LU8A 1N9GB 1WPQA 4BO4A 2NU6A 3BWDD 3U9LA 3SZUA 1MEJA 3ICOA 3JQPA 1TDJA 1DCFA 1Y37A 1TA0A 1D8TA 3HB4X 4NYJR 1QFMA 1XROA 3QFSA 5FI3A 4DMKA 2VTBB 2J8ZA 3ZHBA 5KKCA 3E7PA 2O20A 3X3HA 2J5XA 3X2SA 4EKYA 2BEVA 2V4UA 3PHCA 3A1UA 2CFOA 4C6HA 1KXJA 2AVNA 1X1CA 4GECA 4YJ2F 5KYGA 4YRJA 4FMCB 4HJXA 3RSHA 2Q1SA 3R9KA 3URKA 3AJDA 2LTAA 3E6AA 2O8DB 1XPUA 2BFFA 3L7KA 1MW8X 1TA9A 1KL7A 2PKRA 2E4VA 3KDPA 3KYJB 3HV0A 1BGWA 1UF9A 2ZRBA 3RUHA 5AUOB 3VSDA 1Y7IA 4PSDA 4QYXA 1FSGA 1PNOA 3E9QA 4BKQA 1IB6A 4I7EA 4Q19A 5TQ0A 3VNBA 2ZEJA 4B6RA 4Y6PA 3UB4A 4AF6A 3GG2A 3SJAA 1R8YA 1E2FA 2GJ9A 3CXUA 3I2IA 3PPIA 2CV0A 3E2MA 3WLFA 1GD1O 1RTTA 2D5CA 5HK8A 3LD9A 2O1WA 3WWPA 2YMLA 3AR9A 1PJ2A 1I0ZA 3AIMA 3L1IA 4EVSA 1AOXA 1SD5A 1DKMA 3BIJA 3K1AA 4KDRA 1SCQA 3LA6A 4LI0A 4MB6A 4UARA 4AP5A 3JWJA 1COWA 4D9GA 3Q5DA 4LOJA 2VNKA 4F8YA 4A36A 3KEGA 5LUBA 3IAHA 4I19A 1O6CA 4C6RA 2P3OA 4P7KA 1CT9A 1MG5A 1O9HA 3CCCA 4FUTA 7REQA 4I50A 1M10A 3E8MA 2IBMA 2X1VA 5ELMA 2WA1A 3QPCA 2C57A 2RGUA 3D8NA 4HNTA 3IIIA 4QU8A 2X7JA 1O0BA 4M7RA 4GKJB 4MWGA 3PRKE 2VP3A 2GWRA 2QL6A 3HVKA 5LLDA 4RACA 5EVCA 1CUEA 4N6NA 1GZHB 4ZDIA 4IUDS 2RH5A 5IJ9A 4IIEA 1P9WA 1JZSA 2HSJA 1HEIA 3EASA 2HCJB 4FGJA 4NABA 2I2AA 3UJCA 3E9YA 3OEED 3M4XA 1X7HA 5BN3B 3K0SA 3NHZA 1PI3A 1RI1A 1PNQA 1YZVA 2GAFA 2VRBA 2YWCA 2W4MA 3QEMB 4MQBA 3RSLA 3VVCA 3P20A 3JZFA 3NJ8A 4MEAA 4V0SA 3W79A 3MN1A 4XWYA 2OLEA 2M1XA 3KEFA 3FHLA 1FP4B 2C9ZA 2PNFA 4N3BA 2GCOA 3W4IA 3TLGB 2JGFA 1NDHA 1XEAA 3IAM6 4BLSA 4PN7A 5AYVA 5K05A 2VAWA 4J1SA 4NRDA 1DV2A 1XZGA 4R6XA 1X87A 4K6KA 1NUSA 1TTTA 1SUWA 2X13A 4QDKA 1SNYA 4WIAA 4COKA 2FJUA 2ZRLA 4ZZ2A 5EXDA 4XYGA 3THWB 4C3VA 1GWNA 721PA 5E7QA 2BEWA 1H1LB 2H1CA 1J2EA 2PZFA 2SHKA 3OTQA 4KXLA 4MCIA 1U6IA 4UZFA 2ZI4A 3AY0A 3LW7A 1KEKA 3B5EA 5COAA 4CV0A 4XA8A 4DKXA 2GPBA 4JL6A 3K6SA 1I36A 4RHYA 1AQUA 3IPXA 1WL8A 3NBUA 4ZI2A 3BIWA 3OSZA 4QVKA 2H4ZA 1FVXA 1J8QA 4DC9A 3W78A 3NH6A 3JZAA 4HY3A 3RR2A 5DGCA 2AW5A 1NC3A 3HKDB 2VSOA 4IO1A 4XDYA 2JJ1A 4KIJA 4L72A 4PANA 4BCBA 2QENA 3AHIA 3B3QA 1UKAA 1G6OA 2Z3WA 3W2FA 3V7UA 2E5LB 4EP1A 4JC8A 1CW2B 1I5EA 3MT8A 3BXOA 4NARA 2GYUA 2Q4DA 5CW1A 3RQSA 3WBKA 4ED9A 1U3VA 4PSUA 4FOTA 1ECFA 1BWRA 2J5QA 3BWYA 3M3PA 5FNVF 2W4IA 3SR0A 2R68A 4R3UC 1IEXA 1N4DA 1P1FA 1CJVC 4IF4A 4LZLA 4RK0A 3K0CA 5AIAA 3RJTA 3NJ4A 5EP1A 1YB6A 3BJRA 3SZMA 3BHNA 1PR0A 1ZD2P 1BQ3A 1CZOA 1W6RA 4XZ3A 2GYVA 3LQQA 2ZRJA 4UOEA 1Z5NA 1BD4A 3G5TA 2IW3A 2C59A 4PYMA 1TAQA 4O1IA 5DX1A 5CD1A 3QX7A 1MNAA 1TTPB 4RPIA 4N12A 5CLIA 1XTUA 2NU9B 2PRYA 3SSNA 1ECBA 4P82A 4NOLA 4Q1DA 5C3MA 1S4QA 3H13A 1HRDA 4TQGA 1RWKA 2Q8PA 2REOA 3AQIA 2XHEA 1KNQA 2OE2A 2VJQA 2DC1A 3CX7A 4GLFA 4HRVA 3FUCA 1TO1E 3RFUA 4DS3A 5JH7B 1D1TA 1AHNA 2PD3A 3GCZA 4CE6A 1ZX1A 3QWAA 4C89A 4EY3A 5ESWA 1B6SA 5B37A 4YREA 2QW8A 4KRXA 4MWZA 5FA5A 3I1YA 1FQOA 3WMFA 5HKKD 1N9GA 2Z4TA 4MQ6A 1OXSC 3CSSA 1OBCA 1NVTA 2R4TA 2XE4A 4F3RA 1OXKB 2AIRA 3VDNB 4BNTA 2RMKA 1F2UA 5GIPE 3CPSA 4FYMA 3MB8A 1ZHOA 3VTZA 1EYZA 2BTEA 4BWVA 4B2IA 2H0RA 4GBED 1GKYA 5F2OA 2R62A 1EAYA 1WOYA 5HBGA 3ZTWA 3P2IA 1O03A 1QH0A 3I0MA 4MGIR 4YT5A 2C1XA 4LHVA 3R3WA 4KWTA 3QUAA 1Q1QA 1UQRA 2P0YA 3B85A 2XRYA 3OQBA 5DTEA 3LL4A 4ZCMA 1KVUA 1Y5MA 3BH0A 3KYIB 1ZN9A 4L0CA 1CERA 1YTLA 2ZT6A 5KSPA 1TFRA 5IAEA 3LRTA 4B2PA 1YGYA 4UU0A 3GP3A 4RF2A 5I4BA 4DV0B 3JZIA 3ONDA 1E5QA 2YTZA 1PJSA 4YWHA 1NJ6A 5CDUA 4ZC1A 1RBYA 3R9WA 4KGZA 2BLLA 1U11A 1U90A 2PKQO 1XGKA 4WK0B 1STOA 4O4HB 3UAWA 1YE5A 2PS1A 2HHCA 3OIFA 3VU0A 3W5JA 3K1JA 3SGLA 1DHTA 1GPH1 2FZVA 2VJPA 3QNWA 1BA3A 4O4LF 4M7WA 2Q50A 3TQTA 4CUZA 1BCSB 3OECA 4PIMA 4L5YA 4ZQFA 2DTXA 4DVGA 1ZSNA 3HA3A 1MEEA 1TLLA 2E2WA 3VO1A 5JNVA 1HQDA 3AOGA 1PL7A 4IJ6A 4URZR 4XGQA 1AKVA 2AFHA 4P08A 1EUCB 2V6JA 3WQSB 3WGLA 3FIUA 4BMDA 3O75A 5ALUA 2VRNA 5BV7A 5CM8B 5D2CA 1MOQA 2XNHA 2BJHA 3S0JA 2PO7A 5HM8A 3NDIA 4IYJA 1JIQA 1NKTA 1DKQA 5M29A 4GUDA 1U0LA 4Q3BA 1X6VA 3CUUA 3LJKA 4KBFA 3KLPX 2I8AA 1HGXA 3U09A 4V0LA 3SD7A 3RV4A 4M53A 5LJIA 1VIYA 3CNBA 4HDQB 1O87A 5HE9A 2B4QA 3SXUA 1N7HA 3MJDA 5AJWA 1OD6A 1LK0A 2HWYA 2VZEA 3I5UA 4FNAA 1WNFA 2BTQB 4RYLA 2RONA 5FTWA 1WF3A 2B3TA 1JYEA 3NOXA 2WB2A 5PNTA 2EIXA 4MQFB 3GAMA 1E62A 1QE3A 1UADA 4XIGS 4XLLA 4XSHA 2BKEA 2XYHA 1Z68A 4OY3A 1GGVA 2ZYIA 2FZGA 5EHQA 4EY4A 2GBGA 5C8XA 2MCFA 1SEVA 4CETA 2B7BA 3DR3A 3U7HB 1N8NA 1E8DA 2FV8A 1XUOA 1V96A 2NO5A 2H4XA 3ICVA 2FEMA 2GSDA 5JNWA 1TJ3A 4LI3X 3CO5A 4Z8XA 1S2GA 3TRJA 4FYHA 2JGDA 5D85A 4A0QA 4OBBA 3C15C 1PT8A 4A6XA 2WTMA 4FWIB 4IQ4A 3PX7A 4OU5A 4WACA 3LOPA 1KRWA 4FDUA 4DR1B 2C4KA 2YIVX 2Q27A 3AFHA 1MV8A 3UXMA 5IFLA 2ZUEA 1XZKA 1NAIA 1K06A 1WB5A 3I8OA 3IMCA 4KQKA 4MMYB 3KV3O 4HAXA 3K2QA 1JP7A 3HI4A 5DN9A 3UAOA 2PLFA 1B6TA 1S2OA 2HRBA 2WAOA 5KJEA 3I6QA 5H5JA 4DG9A 4F4FA 1QCZA 2HIAA 4F21A 4TV9F 4LGCA 1VRCA 4N39A 1JFTA 2OAP1 1DC7A 1QTRA 5J47A 2IT1A 1M6EX 3TSZA 1J06A 4PLGA 5GONA 3ZDCA 1XSEA 1JQKA 3MTEA 5E9QA 3M3DA 5CCEA 2J5RA 2B8JA 3P5SA 3NDRA 5F51A 5BQFA 1PNRA 4PIVA 1MJHA 3A1WA 2C2MA 3UVEA 4E1VA 4D8YA 2L0XA 1OE0A 3NEYA 3ZE8A 3AJ9A 3TVYA 2J33A 3IP7A 3K15A 5HA5A 1PEDA 1A76A 4CQJA 1NTRA 1QNLA 1V26A 1G98A 4MJXA 4GMKA 1GL6A 1M0TA 4QO7A 3ZIAD 1GZ4A 4Q66C 3GLSA 1ZMTA 1E9VA 3E8SA 4QGGA 4HEJA 4MR9A 5CXSA 3WRYC 4S05A 2A2ZA 4Q16A 4EHLA 2W9XA 2NP6A 2F59A 1SBZA 3OIVA 3OO1A 4L74A 3K1ZA 4MR7B 3RW9A 3NP7A 3VSAA 2VDRB 4KLNA 5J2UA 2XRFA 3RF6A 5IAOA 1GGHA 1H65A 5D5HA 4QNRA 5SZJA 3SJCA 3MHTA 1R3UA 1SVOA 4MS1A 2L82A 4N9WA 1P0QA 3PUKA 4DV2B 4IIVA 4KNVA 5M5BA 2FPPB 2R44A 2R25B 2MU1A 5BNWA 4YP9A 3L0IB 4GLBA 2P7IA 4O8ZA 2WJJA 1W9HA 2XVXA 1LV8A 2C8VA 4R3NA 5ALJA 1Y34E 2GR9A 4C78A 1G5TA 3JD0A 1LVGA 3I0ZA 3RYHB 1PE0A 5F7OA 1MCZA 3C41J 3G2LA 4OA8A 3RT1A 2F3TA 4ZI7A 4ERXA 1BX1A 3C3EA 3VYVA 1F7VA 1U8AA 4ZPJA 1LSOA 2FCRA 1UJNA 2YFKA 3TRDA 4QU0A 2FMHA 1NGSA 2D5AA 1YJ5A 3DQZA 3V1KA 5CB4B 4P5PA 2FZ4A 3EPLA 5BQ5A 4E2WA 2PL1A 1NDQA 2O6LA 2RHBA 1NU6A 4IJQA 4FYVA 2JPDA 1SHTX 4IGKA 4XASA 3WFZA 4BZQA 2PBRA 4BIIA 2OK7A 1NQVA 2X2EA 4KPUA 4W8OA 1VMIA 5CVUA 1CJBA 3I8SA 2KBEA 3TLZA 2CUTA 3QVUA 3D8BA 4MGZR 3RK1A 1UPXA 4L3WA 3MS7A 4V0QA 4Z4FA 1LLDA 2BW0A 5I7VA 3AINA 2IOQA 1DQYA 1VZ3A 4OXQA 3EUAA 1Z13A 3TTVA 2IHNA 1BG6A 4MGHA 3DMNA 1E61A 4R5HA 3MXOA 4ZCRA 1G18A 1Q2UA 1JR3A 4QYWA 3ZU5A 1KJ8A 2F8LA 4GZMA 2BUCA 4Y6GB 3GO4A 3HJCA 2HRQA 4YPVA 1LW7A 5JSHA 4FFNA 3NRBA 3NUZA 1QVZA 2VF8A 3KQQA 1SQSA 3R7NA 5L9AA 2IS6A 1JDZA 3SZRA 1CR6A 4YEDA 5FULA 4TN1A 2RBEA 3BAFA 4MVYA 4FK8A 1RRVA 2NNWB 2ZWPA 1WTAA 3E23A 3O0TA 5JD3A 4I55B 3LDFA 2QR2A 3PK0A 4AY2A 4I9GA 3RS4A 2PMKA 3U3XA 1WE2A 4ZK6A 1RXVA 1UXIA 3D0OA 1JGTA 1T4CA 3L0ZA 2ZJ5A 1YJCA 1VPLA 3E61A 2FVYA 1PW5A 2PIDA 1CRWG 2PKEA 4IDOA 1VHWA 5C31A 3GGOA 3FTQA 1RHKA 1T3GA 3AW9A 5LKAA 3P9CA 2UYCA 5I8ZA 4FFVA 4C7OA 4RZXA 3LUAA 1BA2A 2NU7B 4OQXA 3I92A 4P5EA 4DCVA 1OHHD 5GJVC 2XMCA 2H29A 1Y1TA 1T9GR 1ZOOA 4JLDA 1L5HB 3NHWA 1ZNXA 2HQSA 1CUIA 3ETLA 4FNOA 4LSWA 3JS5A 2GGSA 2J4DA 2RHTA 3CUTA 1D0VA 1HDRA 3AY3A 3WDSA 2QUKA 2QF7A 3CM0A 4BP9A 5JZBA 3WIVA 3BM5A 3MC1A 4QWMA 5J4KA 1U3FA 1VKOA 1YC5A 2C54A 3KAKA 4FPXA 1SG0A 1MF7A 2C1ZA 4ZQIA 4H7HA 5AK0A 1DXQA 3AUXA 1RCFA 3FPKA 1V8PA 3FI9A 1TD1A 3KOMA 1GIAA 4UEQA 4F2PA 4LY3A 1ND6A 3DMFA 4KPYA 4EY7A 4FD2A 4KGDA 3IVCA 4CL2A 2WQZA 3DKRA 1QQ7A 3S8EA 3CZ4A 4G65A 5CLGA 1Y9JA 2EHJA 4I4TF 3AY7A 5K0CA 4NYJQ 1ZUIA 1KRHA 4KO8A 4GDFA 2QM0A 1K63A 4J7UA 1Z8HA 1Z16A 4DMUB 3IUNA 4BJ3A 3QY0A 4KNYA 1U0FA 3QH4A 2Z4SA 1SKQA 1OIXA 2WNIA 4XI9A 3RSQA 1YJQA 3CZQA 2V4ZA 3H19A 3IKJA 5G1PA 5JROA 5FYDA 2W6ID 1UQUA 4D4HA 1AF4A 3FZEA 3FOBA 2IXBA 2IYLD 4MQUA 4YMHA 2OTCA 2H07A 2I34A 2OXEA 1USUA 1JECA 1Q17A 1PVDA 1R0SA 1ZD4A 5AVJA 4Q34A 5GOTA 2JAOA 2RIPA 3OCJA 5D87A 1IXRC 4RVHA 1ZH6A 1XLTA 1A9PA 3LHFA 5CVEA 4X3PA 1EFVB 2IZ6A 3C8ZA 5KYYB 1XDGA 1XN1A 2VTKA 1BO6A 1M8PA 4QOSA 3CLUD 3A32A 4I9UA 3QKUA 1L1EA 1LI5A 1ONSA 4LY0A 4RYDA 4FP9A 4NJOA 1WY7A 2XWQA 3WL7A 1QR2A 2FI1A 1HEYA 1J1IA 1ESNA 4D9BA 1JHVA 3LKZA 3ZV7A 4M0MA 4B44A 1CC1S 1B1CA 1A8HA 4I1RA 2ZFUA 3E4DA 5K45A 1AZLA 1JJAA 2A9RA 1ISSA 4DILA 3OLCX 1LSUA 5B1HA 4Q3DA 4M7OA 3W5HA 1GZ7A 4ZKEA 3BF8A 3ZLBA 2D2XA 1WPXA 3SY8A 4UZSA 3MUOA 3CVWA 4D3FA 2AOXA 4UHJA 4LE2A 4TL8A 1EDBA 4Q9DA 2A3NA 3OQPA 3G2NA 3ISJA 4GE0A 2E1RA 4QHSA 4HUTA 3TJZA 3GLFA 2B25A 1QH8A 5AOAA 3MTAA 1BKSB 3D3KA 5BQ3A 4ZOLA 2QMUA 4PYIA 4CMEC 1CFZA 4D9IA 3V8EA 1OC4A 4H3VA 3VKUA 3ZXUB 2R3SA 4PXAA 1RJ9A 4OH1A 5ERXA 1ZIYA 4H6VA 3GUCA 2HWUA 2ZYRA 1AGRA 2VUTA 3KPWA 4KHPB 3OBBA 2J3QA 4ETMA 2Z2KA 1IONA 4CCSA 2ODEA 5EZYF 3V9PA 2V1UA 2AJ8A 2C96A 4XJVA 1TF7A 4BDTA 5J1SB 3GELA 5EOVA 4GOLD 1D6NA 1B0UA 2OY0A 3E84A 5LQMA 4TVSA 2WY2D 3PTZA 1FW8A 1G8JA 2AMYA 4TLBA 4B46A 3JWEA 1ZK2A 1DL5A 3JALA 1KXZA 4F5EA 4WSOA 4GKKB 1W48A 4WLOA 5IM4A 3WRXA 5KOJA 3MWDA 2WAMA 3IBGA 3AWDA 2IOFA 1ZICA 3GLRA 1GYPA 4RXMA 3B1WA 4KVAA 3V4FA 1OZHA 2KSQA 4LYAA 5H9WA 2PXHA 4EI9A 3NTXA 1T6BY 1P17A 1P81A 2R7AA 1NSFA 4MKFA 5CX1B 3FSGD 2JH3A 3LVFO 1FVOA 3VYSB 3WS7A 2W6JD 1V6SA 4MDYA 3W7AA 3QJYA 4DIDA 1YNSA 1EEXB 4DA6A 5JBIA 3K8YA 1M2VA 1ZAYA 5EE1A 2FSHA 3L01A 5KYXA 3EXEB 3HU5A 4YJGB 3ZIAA 4B6JA 3LXMA 3KUKA 3EZYA 1ZR2A 2LVBA 4BQOA 3B2EA 3PC6A 2JKZA 3UBTA 4BE4A 4B6QA 1B8OA 1YS9A 1X7XA 1XZJA 5DIFA 1JLRA 3LNTA 5FYQA 3W4JA 1H23A 3QJGA 3N5CA 2I6FA 3NHRA 3VAAA 1CF4A 4ZVTA 1GPWB 4FYJA 4U7HA 2XECA 3VBCA 4XDZA 2AJCA 1BDBA 2HDNB 2JAUA 3AXTA 3EBOA 3GJSA 4K9PA 3THYB 1JQBA 1SC9A 2ZAMA 3N9IA 4X85A 2CC2A 2ID4A 2QS9A 5A3SA 2ZUDA 3R75A 4DCNA 5HKOA 2VH2A 5JNRA 3HYSA 4BN4A 4Y9RA 5CIWA 3UWDA 1P19A 3V34A 1NV9A 4PGFA 4WJLA 4D3XA 5EQDA 1ZL0A 1JFLA 3M3HA 5ELLA 1T5BA 1V4BA 4WNCA 4A0RA 3G0BA 2X1HA 1AKTA 1VBKA 2NPOA 2XODA 3IXMA 4I5FA 4QOGA 5IBRA 8ADHA 5SY9A 1GEGA 3VMMA 4C4ZA 5I4IA 3UT0A 4DWOA 2PE5A 1B26A 2GN1A 2W5UA 6CHYA 1P4JA 5C46F 4JEHA 1GRNA 2EQAA 2MTBA 2W2VA 2EL7A 4AXBA 1HLDA 2UZIR 4AZ0A 5BYKA 5C8DA 1DUSA 1G3QA 2XMZA 2IY9A 4JT2A 4K6GA 4NC9A 5BSTA 5JNUA 3PEWA 1R7RA 3KQTA 1BE0A 2PHZA 2VBCA 3IOYA 4HUQA 2B0CA 1FRZA 3LSTA 5EWLB 3U3ZA 4BBAA 5CEJA 2RHRA 1WLSA 2DBVO 2OFWA 1AKQA 1M1YB 4QECA 3H5WA 4JKIA 5A7GA 4EFKA 2P9JA 1YZLA 2B35A 4BNZA 1G2OA 2JFOA 2QGNA 3TZHA 2CSUA 4K9MA 5K8CA 1QC5A 1JUDA 3GZNA 1CY8A 1EE9A 3JV7A 1NW5A 3CUEF 4AROA 4QG3A 3RYFA 5I9BA 1SUBA 2HY7A 2F48A 3IEVA 4D4KA 3BZWA 4PQYA 3M7IA 3REFA 3NOQA 4IIBA 5AJVB 2MSKA 3HGMA 1Z4NA 3P9KA 5M3BA 1GZVA 1W0CA 1XPOA 4W7HA 3KU1A 2AZMA 1P4HA 3T12A 4B35A 8GPBA 4UAVA 3EIFA 4PPGA 3CURA 3MILA 4WKPA 4BGVA 3LCVB 1QHYA 5ESDA 1O97C 2YHUA 4KZKA 3COJA 2N0SA 3OZCA 4FIZA 5AVYA 1QRAA 3EF3A 4B3JA 2H7VA 1DZ3A 3A1VA