4JA2A

Structural basis of a rationally rewired protein-protein interface (rr468mutant v13p, l14i, i17m and n21v)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
121
structure length
120
Chain Sequence
SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 42
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ja2A00
2E4UA 4RSMA 4IMIB 5FWYA 3Q15C 1P6UA 3A0RB 2E4ZA 3OM1A 1FSPA 5C5EA 2NZUG 4LDZA 2FMFA 3KG2A 3I09A 2X7XA 1Z2EA 4RZSA 5CNKA 1QQBA 3KYJB 4MS3A 1JL3A 4DN6A 3OLYA 1E6KA 2IPAB 1DC8A 5EWJB 3ROTA 2MSKA 1BDHA 1EWVA 2H0AA 3H5LA 1YS6A 2JB9A 4JOQA 4MS1A 1AB6A 1ZN2A 3QLVA 2CD7A 1NXSA 4QICA 5EWLA 2WY2D 4PEVA 1EFAA 2A9OA 3N0XA 3LKBA 4ML3A 1B00A 3BBLA 3FFTA 3EJWA 3W9SA 1JWLA 5JNTA 4JB2A 3B2NA 5TQ2A 3DGEC 3ROFA 2JK1A 3S99A 3CZCA 2RDMA 5HQJA 2FLWA 3ILYA 3GT7A 3R0JA 4L85A 1QP4A 6CHYA 4G0YA 4KVFA 3FMVA 3H5OA 4XARA 5TPZA 4RXUA 1LJLA 3IP9A 5FWXA 3MQ4A 5CHYA 2P9HA 2HJ9A 2FEPA 4XAQA 3O1HB 1TVMA 2FXIA 5DTEA 1QO0D 2CHEA 2FLKA 3L49A 5FWYB 5IULC 3GBVA 1W25A 3T6KA 4EYQA 4F11A 3KJXA 3IDOA 4MS4A 1M5TA 1RPJA 3O74A 3A10A 4MS3B 3SM9A 3CHYA 4PE5B 1QQAA 1QPZA 4NV3A 4MR7A 1LK0A 1IIBA 2CHFA 1PEYA 1RNLA 1MAVA 3N6VA 2J48A 2QV0A 5EWLB 3FFWA 4MS1B 3JY6A 2JBAA 3MMNA 4UHJA 5BQ3A 4NQRA 3FGZA 4G86A 1YIOA 5TQ2B 2MYUA 2R47A 3H5VA 3NNDA 1BAPA 5IEBA 5TPWA 8ABPA 2FTKE 4YO7A 2WWVD 3NBMA 3TD9A 2GX6A 2F8TA 2E4VA 4YLEA 3F73A 3Q7TA 1RZRD 5KQPA 2IPMA 1DBWA 1DBQA 1TM2A 2QXYA 2B1JA 3OO0A 3QK7A 4JB0A 5F64A 4YWHA 3URMA 5FWXB 3H5WA 4G0MA 1QNLA 2GBPA 2CWDA 4O1IA 1JFSA 1D1PA 1GCAA 4KFCA 2QSJA 5JNWA 3A3KA 2IDMA 2WB4A 2A9QA 4LX8A 4F8JA 3HVRA 5C5CA 2QVGA 4YGXB 3C6QA 4KRFA 1YS7A 1ZVVA 4LE1A 3HEBA 4MS4B 3ILHA 1TJYA 2E4YA 4Z4IA 1MIHA 1CEYA 3FFXA 2FEKA 3KKEA 3HM9A 4S05A 3RVLA 2L17A 3H6HA 2OQRA 5IBQA 1USGA 4MR7B 4P1ZA 1JBEA 3RVSA 5KC9A 5KWSA 4RK0A 2PKXA 5T7BA 2GI4A 4Z4GA 3C3KA 3I42A 3CFYA 1QP7A 4OTZA 2R4QA 3RVQA 4EY3A 2AYXA 1DCMA 1K68A 2ID9A 4WT7A 3RQIA 1D5WA 2LP4Y 4KNYA 2PLNA 3Q7SA 1VLZA 2WJAA 1A04A 5TPWB 2FQWA 1JFVA 2Q5CA 4XXHA 1JYFA 5IC5A 3P9YA 1VRVA 5TE9A 3OMXA 4N76A 3MIZA 3E3MA 3HSYA 3QELA 1JX6A 3VNAA 1S8NA 2VYCA 3EULA 3H6GA 3OQNA 2MYTA 4RY0A 1URPA 4MPTA 3QLUA 1NATA 3NHZA 4N0QA 3RVRA 3GV0A 4N03A 3JVDA 1HEYA 4Z4CA 1QMPA 3TO5A 2RJOA 3KTOA 4PZ0A 3RVKA 1Z12A 4ZMSA 1Z17A 2FN9A 4IRXA 4MYRA 4MQEA 2N9UA 1D2AA 1U8TA 1YVUA 4QPJC 3MF4A 4LE2A 1KGSA 2E4XA 3G1WA 4MGEA 2RJNA 4KZKA 1ZGZA 4RXMA 3GA5A 4W5NA 4JP1A 4LDAA 1ABFA 3MA0A 2HQBA 1KMIY 3C3WA 1ZDMA 3QLUC 4HYEA 4RK1A 5IUKC 1ZESA 3H1FA 2B4AA 2YHAA 7ABPA 4IGAA 1XHFA 4RXTA 4PICA 4IILA 3DLBA 5HM6A 2PL1A 4L4UA 5DKFA 1NXVA 4XFKA 3M9WA 5KQGA 1BDIA 4Q6BA 2JVIA 3QELB 4TMYA 3CNBA 1DG9A 4N41A 3DZDA 3JTEA 1MVOA 1DJMA 1JDNA 1DZ3A 3KCNA 1QO0A 1VKRA 3E61A 3HV2A 4G0PA 2PMCA 4O5AA 1SXHA 2IPNA 2L19A 5JNVA 3CU5A 2FQYA 1Z2DA 3LKVA 4E7OA 1U2PA 1F51E 1VPWA 3H5TA 4H3KB 2GWRA 4IF4A 1NXTA 3O1JC 1NXXA 4D6XA 2A9RA 4KK3A 1E6LA 3EGCA 3SG0A 2LIVA 4MQEB 3LTEA 4W5RA 4JA2A 4FB4A 2NUBA 1NXPA 2FW0A 1U04A 4TN5A 2QR3A 4MQFA 3BRQA 4RK4A 4KMRA 3H1EA 1CHNA 1JYEA 2E4WA 4OLBA 4NICA 1M2EA 3IPAA 2HQOA 3O2SB 3HDGA 5GQSA 3NNNA 4EUKA 2JCGA 1DRJA 3CS3A 1D1QA 1P6QA 3OLVA 4RK5A 4D6YA 4RV5A 1DRKA 2TMYA 3KYIB 2PUAA 2R48A 2L18A 4G97A 1M2FA 4Z4HA 1EAYA 4MR9A 5ABPA 5T3YA 1FQWA 1Z13A 4GNRA 3UKJA 3KHTA 1GLGA 1PNTA 2MYNA 1ZH2A 4HNRA 4GPAA 1RZRA 1ISRA 2HQRA 1XHEA 3CRNA 3G85A 5TQJA 3SAJA 5JNRA 9ABPA 1ZY2A 2IOYA 3A0UA 4OBBA 2FEWB 4Z0NA 4G0ZA 2L2QA 4KREA 5CNJA 3IP5A 1A2OA 1ZHHA 3Q7RA 3UUGA 5ED4A 3RH0A 3N8IA 1APBA 3N75A 1Y1LA 1NY5A 2KYRA 2M1ZA 5DCLA 3LUKA 3HJFA 2VK2A 3RVMA 2QU7A 3EAFA 3LMKA 3O21A 1FFWA 1OXBB 1Z26A 3LUHA 4Y9TA 5IUNC 5PNTA 1I3CA 4WZZA 2LUOA 4MQFB 1KRXA 4YP9A 4KQCA 2BGGA 2PUEA 2FKAA 2A9PA 2OENG 2JBAB 1BDJA 3IP7A 4FE7A 5DLEA 1LBIA 4EYOA 3HUTA 2F8SA 3I45A 3HZHA 4LE0A 3SY8A 1JFTA 4F3TA 4JAVC 1SXIA 3K4HA 1PHRA 2IYNA 4EVRA 4MLDA 5KQMA 5IUJC 3OQMA 3LUCA 4CBVA 4YRZA 3N0WA 4PYRA 1PUXA 4N0PA 3LFTA 3QX9A 3L6UA 2LBPA 2PL9A 3GWGA 3Q41A 2ZAYA 3TMYA 1EHCA 3SQNA 1YTUA 1SD5A 3OLZA 3Q9SA 4KV7A 4F12A 3TX6A 3HS3A 1OXKB 1LBHA 3OO1A 2QW1A 5D2CA 4ZJPA 1W9HA 3LUGA 1RXIA 2GKGA 4XLTA 1KRWA 4Z9BA 1DP4A 1FFGA 3O75A 4RKQA 1ZITA 2AYZA 4G0QA 4S04A 4YV7A 1LJUA 1YK0A 3BREA 4EVQA 1PNRA 1UDRA 1ZGGA 4RY8A 2PAFA 3I5AA 4YR7A 2I6FA 5EWMA 1NTRA 1USKA 5GOTA 1MB0A 2QZJA 4RKRA 4RY9A 1XWWA 3MM4A 1M5UA 5BRAA 3F7NA 3OLXA 2YHBA 3OLWA 5E3JA 2DRIA 3O2JA 1ZH4A 2P4UA 1USIA 4MAAA 1DBPA 2V0NA 4OG2A 1FFSA 2IPLA 3BRSA 1EWKA 2NT3A 4RK6A 4XASA 1YMVA 1DC7A 3K9CA 4TLMB 5I4CA 1CYEA 4Q7EA 1L5ZA 4W5TA 1NXWA 1JHZA 4KK4A 3H75A 3M6MD 3OMWA 4KQ9A 1BVHA 4OATA 3EQZA 2IKSA 2PE5A 5KC8A 1SXGA 2PUDA 1A0OA 4B09A 2PUCA 3HUUA 5JS2A 3HO1A 1DCKA 3RVPA 5FBKA 2R25B 3O1IC 5IEJA 2FMIA 2FVYA 3GBPA 1C0EA 3GYBA 4Q6WA 1E6MA 1R8JA 1Z25A 4W5QA 2FMKA 3IPCA 3KSMA 5HKOA 3RVJA 3VNBA 4ZMRA 4EYKA 4OLAA 4W5OA 1H9CA 2VUHB 4MR8A 4LRQA 1NXOA 3O2QB 3EDCA 3OM0A 4FE4A 4ZPJA 5JNUA 5BRJA 5JNSA 3CTPA 4G0XA 3NHMA 5TPZD 4WUTA 5CNIA 1C4WA 5EWMB 4P98A 3F6CA 3CZ5A 3CKMA 5TQ0A 3GL9A 3CG0A 4RU1A 2FQXA 3T95A 1TLFA 4H3HB 3QLVC 2PUFA 4YCSA 4G0OA 4EVSA 2FSPA 4NCBA 3GRCA 4YS6A 3LUFA 4H60A 3CLKA 3QLTA 2FN8A 2MYPA 3T8YA 3H1GA 4M88A 1ABEA 4Z4FA 3HK2A 2NT4A 2RGYA 3KLNA 3LUAA 3DLHA 4HNQA 1GUDA 1QP0A 1J56A 4IMJB 4HNSA 4D74A 4QYWA 1QKKA 2QVCA 3HXMA 4Z99A 1Z16A 1GUBA 1F4VA 1Z15A 4ETMA 2FMHA 3JPYA 1ZAYA 3RVNA 4MRMA 1TMYA 3LOPA 3H5IA 2O20A 3JVIA 3CG4A 4MR8B 1SRRA 3BILA 5BR1A 5HSGA 1WETA 3EQ2A 1K66A 1P8AA 2WJWA 1T34A 3QEMA 5B3JA 3SNKA 1U2QA 3LUDA 3KLOA 6ABPA 4ETNA 1JLKA 1DCFA 5TQ0B 3M9XA 1E2BA 5IX8A 1ISSA 2JVKA 4QYMA 2H3HA 3UK0A 4KPYA 2JVJA 4RK7A 2HPHA 2MSLA 1BA2A 2ID7A 4JASB 3FDFA 1YK1A 3LUJA 4RDCA 1MB3A 4WWHA 3JS5A 4DADA 3QX8A 3D02A 4F06A 3EODA 2WRZA 3D8UA 4MR9B 3C97A 3QEKA 4O1HA 2M98A 4ZYLA 3F6PA 5B3JC 4EGSA 1JF8A 5EWJA 3T38A 4RS3A 4Z4EA 1Z18A 3DBIA 2MSWA 4WXMA 3MYYA 4EYGA 2XDYA 2PUGA 3JPWA 5DGCA 4Z9AA 2VUIB 3KS9A 1L5YA 1GCGA 4WXEA 1AB5A 3OQOA 4MRMB 5JS1A 1P2FA 3C3MA 2JRLA 4RWEA 4N47A 1YMUA 2LPMA 1RXEA 5FBHA 1EWTA 3TB6A 1JH9A 2ZWMA 4NCAA 4MLCA 4TLLB 3IP6A 5CNMA 1PEAA 3QEMB 1JDPA 2PJUA 2WMYA 1D4ZA 3HDVA 3NNSA 3RVOA 5KI6A 3N53A 4UHKA 4DQDA 3N0RA 2W42A 2PUBA 4LZLA 1U0SY 2HSGA 3DGFC 3HCWA 4E7PA 5KQLA 4ETIA 2NZVG
chains in the Genus database with same CATH superfamily
1P44A 3C6YA 3TSOA 4B45A 4DEXA 3O2NA 4H0NA 4QJ5A 4WKOA 1MR3F 1FJGB 3PNMA 2E4ZA 2WDPA 4ARZA 3WLKX 1KXZA 2JAPA 1IU9A 2O2ZA 3OX1A 3ZDBA 3NDBB 4LW8A 1KYVA 1Z3CA 2QSUA 2OZKA 4HYTA 3SP1A 2Y71A 3DO8A 1QQBA 1MEJA 4PSDA 2J9ZB 2ZJFA 5TGTA 1JL3A 5MFZA 1SUWA 2VP3A 3E7WA 4PQYA 2IPAB 5IH7A 4R1PA 5EWJB 4E15A 1FNCA 5MGNA 1G4HA 4IJMA 4D0NA 4P80A 4MRRA 2CFRA 2ZIUB 2V8BA 1J0EA 2RKOA 3VSAA 3DCJA 1EFAA 1XTQA 4QYTA 3S44A 3SFVA 3PF9A 3ZXSA 1IOZA 2HA3A 3LKBA 4X94A 2QUKA 2JPDA 2QP9X 1GGEA 1IY0A 3DD5A 3DEKA 4L8GA 4U7TB 5IM4F 3K20A 3CR3C 3NKVA 2FPXA 5C46F 3JQAA 1L5MA 3CVYA 3PR3A 1NONA 2DBZA 3FF4A 4TTPA 3LVRE 4MLPA 2A0KA 4O4LA 1GCUA 3UW1A 4XYEA 1JSLA 4KQIA 2CLLB 4YT2A 4IXWA 4KE9A 3ZQ6A 3AEUB 2H06A 1LPSA 4OXQA 1FUIA 2A3RA 4X8HA 2EIXA 1X7XA 5K05A 1NIJA 3L2OB 1XVAA 8LDHA 1NM5A 3GMDA 1PS9A 1HDRA 2MMCA 3O1HB 3VKGA 2XIQA 1E2NA 2FXIA 3A4NA 3KU1A 1VL8A 2EGUA 3K9QO 3PUYA 5FFNA 1JEEA 5FPHA 1CRZA 1ACJA 2ANBA 1Q7BA 5DMXA 2Q3EA 2XUIA 4NMXB 4B71A 1QZZA 2H08A 1QF6A 5AD1A 4IOJA 4LXUA 5CW1A 3E9DA 2OVFA 2VTKA 3O74A 2RGXA 3MNFA 4RPLA 3AR6A 4UEKA 5DRYA 3GMIA 3UJCA 3NOXA 1IIBA 3D31A 5HGJA 2Y77A 5GONB 4PYIA 3GLGE 5BNIA 1U5BA 3I1IA 5F2NA 2DPLA 4ERNA 1YULA 3DDZX 4XWYA 5BSVA 5IT0A 2GRAA 4QAJA 2ZIVB 2YC4C 4FFBB 4V2IA 5J5AA 3GCDA 1E0SA 1R0WA 2DHCA 3BC1A 3TRJA 1V26A 4JJ4A 3NDRA 4UU8A 3VAAA 3CXUA 5DO9A 3FGZA 4WTOA 4G86A 3LS2A 1R9GA 2RGDA 2PX3A 4HFRA 4C2UA 1W5BA 3AEQB 2JIOA 2OXFA 3ANLA 2EVWX 1COZA 2PSEA 3IMEA 3QZUA 4J1SA 4LYJA 4ZVMA 5F3WB 5JAUA 4HDCA 4BVKA 3ZHUA 2DPYA 5DYWA 1IRIA 3PC8C 4NBRA 1ECPA 1T43A 4AJJA 4R8KA 2GTPA 3PNQA 3JRWA 1SWWA 3ROXA 3TAUA 4Y6GB 5L7WA 5EERA 1R0BA 2BMJA 3QXHA 2GSWA 5AVYA 3K70C 1SC6A 3MG9A 3T1OA 2P91A 3PKZA 2OVBA 2PA0A 2XB4A 2OCBA 6PFKA 5E2AA 3A3NA 4UZEA 5EN4A 3JZDA 3NPAA 1PZMA 3FLBA 1EE9A 4MITA 4G0WA 1U65A 3A6HA 4GKBA 2D3TA 2FW9A 3QTLA 4XDHA 4YJDA 4LE1A 4CMJA 1G42A 4L4ZA 3NHSA 4WV3A 3VNVA 1PYOA 1GRCA 3RVLA 5HFNA 1P2UA 3LY5A 2BZGA 3GJTA 3H7IA 4JGGA 4XWTA 3KZKA 4FLFA 3BDAA 2P2NA 1JIUA 3AHFA 5ALDA 4LFCB 3K09C 2JLYA 3UT0A 1QONA 1V8OA 1Y1PA 2GI4A 2JAOA 1GCOA 2PFGA 3GLVA 3LX6A 3LPCA 1HFJA 4N8DA 4U7PB 3WRYC 2GRJA 4Q1AA 3IXMA 5UKDA 3O82A 4XJSA 4K26A 3HFRA 3VAZA 4IV5A 2ZCUA 1TM3E 4HNVA 3DEAA 2IXBA 5TE9A 1AK2A 2QD3A 2QRUA 3HVIA 3R9IA 3HKCA 1ZXLA 1HURA 3R6LA 3WIEA 5IDWA 4N76A 5JWRA 1C8KA 2ZBFA 3FNEA 4PS0A 4PXYA 4XOUA 5G3ZA 4AFNA 1YR2A 2VYCA 1KEUA 3DT6A 3LOUA 5ADWA 3K6KA 4MUAA 2VRNA 3Q7EA 2WEKA 3EA0A 4FFPA 5DISB 2DJIA 4DXAA 4B4OA 2AXEA 1JB9A 2AZ4A 4AJNA 4AKIA 3MUNA 1GRVA 2IA5A 4IOKA 1FFEA 1QB7A 5IN5A 1IHDA 2AEFA 3ND7A 3STXA 4AQ7A 4L3VA 1YASA 3AJRA 3RVKA 3OIWA 2D4AA 2XUGA 2PYIA 3LWBA 5K0NA 3LH5A 3UTCA 1ZW1A 3S2GA 1U7WA 3I9MA 1YVUA 2IYFA 4OFWA 3G79A 1Y3FE 2B37A 3FCXA 4CV1A 2VAMA 3MMSA 5TVGA 1RYBA 3V9PA 3OJXA 3CF4G 1EBBA 1HDIA 4M46A 2ACVA 3PGMA 2AR0A 3PUHA 3RYCB 4G0NA 3K9WA 2FSIA 4IIJF 2GF9A 3DZGA 5E4FA 2AK3A 3RASA 3DVLA 5BV8A 5BNZA 1FA9A 3SU8A 3KK0A 3NBKA 1AGXA 2O8EA 5LL6P 1M6YA 5H80A 3GCXA 1UPUA 5SZKB 1NF3A 4EB8A 2CB9A 2NU8B 4F3CA 1X7WB 3CMCO 1JE1A 3RSCA 3RUAA 4IILA 3E9ZA 1RQRA 1RACA 3U26A 1MX9A 5HM6A 2NYVA 3A9TA 5AI4A 3P7MA 1SBIA 2J3MA 4HGZA 1WZ2A 1E2EA 2XOKA 2FUKA 3NUQA 5E6SA 4BNLA 1HQKA 1EKXA 2YJ3A 3DOJA 2PXAA 3K2BA 4TMYA 4ALMA 3CR8A 1DG9A 1EHYA 2VBCA 1FZQA 3DZDA 1ULTA 4GPTA 5E9AA 1YIDA 2H1LA 1PW5A 3KCNA 4R1MA 3C8HA 1KOLA 1Y7LA 1VSUA 4Q01A 4B3BA 3C45A 3A6FA 2XGOA 4Z9YA 3JQ9A 3ZE1B 3O92A 5LNK6 4MV8A 4OJKA 2Q2QA 5FOUA 5C35A 4G2NA 1EH5A 2P1ZA 2ZWPA 4UM9D 1XAHA 2GWRA 2QTCA 3ASUA 4NOKA 4YASA 4D02A 4ZI2A 1E98A 4GQIA 3F3MA 1N7JA 4FQ8A 2FF5A 2LIVA 3O4JA 1TVEA 1VHQA 4R6WA 4G6ZA 4D0GA 3LTEA 5IMBA 2V6GA 2Y05A 4JJGA 5CFQA 4U39A 1Z4PX 2XGSA 2JGIA 3EYWA 3GD7A 5BNTA 4J1TA 1QIFA 4URYR 3WXMA 1C29B 2X6QA 2IY7A 3T9DA 1BVYF 3ZTWA 3HDGA 2EDAA 5GQSA 3L1JA 3M81A 4ZHQB 1VGVA 2IS6A 3PT5A 4JU8A 3ZXXA 3ZKWB 1IL0A 1SA0A 4UBJA 4N54A 2UXCB 4OSPA 1L4KA 3RTCA 3TZ6A 4Z9XA 3ROKA 5ALRA 1W34A 1WS6A 4MYSA 1YWGO 4QDOA 3WGGA 4ZV9A 4ALNA 4E5KA 3NM6B 4GNRA 1LBSA 5JEDA 4G1FA 2XE8A 3UFBA 1ZH2A 1Y4ZA 2XBUA 3C3XA 3RF7A 3VGJA 4HNGA 4ACBA 3B3GA 3BRCA 3HBMA 4FUTA 4B32A 4EPWA 1OH5A 1MFZA 3H1PA 2HC9A 2FWRA 3FVRA 3FPLA 4JJFA 3JRNA 3LK6A 2DETA 4RQAA 2QB5A 1Z88A 1LPPA 2HRQA 4J7UA 1YQ9A 1T26A 4X9XA 1GD1O 2F43B 2KM1A 3SBOA 3FYUC 5FUQA 3UKOA 1ZGAA 2I67A 2HADA 3EZ2A 5CT5A 1DKMA 1G18A 4RLFA 1Y1LA 5EINA 3WRXC 4J16A 4KW7A 4EQZA 4PC6A 4UFPA 3HFJA 3BXFA 4GZ6A 4KQHA 2JKVA 1L8XA 4MUGA 4FGLA 5EHZA 4U5QA 4O2AB 2VKQA 4LXIA 4MA0A 2WAYA 4LRUA 3PC2A 2HPVA 2GARA 2A9PA 3M3HA 4ZDWA 2I4MA 3F9RA 1TIBA 4DR1B 4EI2A 3GEMA 3WGIA 1GA1A 3DVQX 3HDYA 2LR0A 1JFTA 4YI5A 4H27A 1XRSB 4F3TA 2V98A 3I04A 4N1AA 1I4EB 2AOVA 4MV3A 4QO7A 3P9QA 3C7CB 2RKBA 3L6BA 2ETXA 1ESDA 5EXTA 2I4NA 2PGJA 1H6BA 4ONEA 2JLBA 2Y0BA 3H0KA 5JJBA 4E5DA 1PUXA 1SQFA 1U3DA 4Z8XA 1WDLA 4QJ3A 5JSZB 2GWHA 3FPEA 2PL9A 2K2QB 5DYIA 4EMBA 4BO0A 1XZPA 1JHAA 1RHJA 2XMZA 3WL3A 4B34A 3D4PA 2OSBA 2JGLA 3AIKA 3Q9SA 5EP2A 4NCNA 1H8ED 3G7NA 3NGXA 4IIEA 3QV1A 3I01A 4UHHA 3UVEA 4IR7A 5JS7A 4PZUA 4B81A 2HU8A 4UAGA 5BSGA 4QPCA 1UBSB 2FJ0A 1A97A 2C1ZA 1IEQA 3L92A 2V7QD 3PPYA 4J0IA 4RKQA 3CRMA 3UWKA 1GG8A 5C7LO 4JLSA 1E9BA 2I2DA 5LZ4A 1WKVA 3HNRA 3VHRA 4EVQA 1UBNA 2R85A 2ZKIA 4OXKA 4R8LA 4RHYA 1ZGGA 4XFJA 4W8OA 4AJPA 2VBIA 2PVCA 1D2GA 2QM0A 2I6FA 3T12A 1KJIA 3GQBA 5I7UA 2IPXA 3KKKA 3GA7A 4QKQA 1Z38A 2O2DA 4ZT4A 1VXRA 3B6ZA 3M6VA 2GBCA 4EFLA 2G25A 3LGXA 5IYZA 2NXWA 4YCMA 4MO9A 1USIA 4CMHA 4A8TA 3V33A 4PCVA 1W94A 1XBTA 8MHTA 3E9RA 4JYCA 4XASA 1T35A 1QPGA 1H5QA 4ZT6A 1FVFA 4TQAA 4OV6B 1GZ5A 4U2BA 1MAHA 3MXTA 4KBGA 2XQVA 4B3CA 1FEZA 1YJXA 2D00A 3JD2A 3UEOA 5KWIA 1CTQA 4DLRA 1Q11A 2IYYA 4B09A 4U2KA 1YI1A 5CLFA 4KODA 4J9VA 2O1WA 5H5JA 2FVYA 3DP7A 1C0EA 2YTZA 1V1MA 3VR6D 1Z25A 2F4VB 2KJQA 4QXAA 4NCXA 1RWXA 3KDPA 1UBEA 2CCKA 1N9GA 5FWDA 2GZMA 3AV0B 3R3ZA 4HK4A 5EXPA 4CTJA 4DVGA 1VCMA 4OQQA 4PYKA 1D07A 1NXOA 3WDSA 3ZCVA 4RULA 1XNJA 3IVAA 3M6FA 4FDAA 3IOYA 2KS6A 3TBFA 1OOEA 1LC3A 2C4TA 1ZK4A 5LJIA 1PFWA 3SGLA 5BO5A 3QKUA 1JQLB 2QRQA 1ZJ6A 1P2GA 3WL4A 4Q21A 1KKMA 1Z6YA 2C9CA 2C42A 2FPRA 3EBOA 4GW3A 2GPTA 1PJLA 1E20A 2RHOA 1ZOPA 1K8YB 2Y0DA 2YZGA 1JZSA 1XYVA 3IIKA 1L1FA 5ITZB 5DH9A 5FUYA 1GTVA 1W1WA 3WWEA 3SXPA 4YCSA 3ONWA 4F6RB 1NE2A 1AKUA 1MTOA 2C9OA 3LBNA 3QUSA 4U4AA 3REQA 4PZAA 4G0OA 4EVSA 2F3UA 1DTWB 1ETUA 2Q4EA 4MQUA 5E95A 2IU6A 5LIPA 1SHZA 1W85B 3TZKA 4JUAA 2X4DA 4EKEA 1ONPA 5JRJA 2HLDA 4XDYA 2O3SA 4DGSA 3HCNA 3H1GA 2A33A 4M88A 2XCIA 5J63A 2CDAA 1JS1X 1UPXA 1W9MA 2WWXA 2N3ZA 3DZHA 1JKJB 2GCOB 2AW5A 2G0TA 3F78A 1PR1A 4PIMA 1VM6A 1FRNA 4D8YA 2VBFA 2B8EA 1JDSA 1O2DA 1NM5C 3G49A 3OQBA 1OLSB 4YRMA 2O8EB 3ZZ1A 3LOPA 3PDWA 5DULA 2IX3A 1W88B 2DKNA 4ITUA 5BQOA 3ASVA 3U4GA 3OWHA 1T2FA 1EA7A 1G7CA 2QN3A 4Y2RA 1SXJB 3OE1A 5LMNB 4N65A 4UHEA 2OAGA 2A4MA 3AKZA 4TYQA 3C6XA 4BLWA 5I6DA 1H6CA 2ZSHA 1M7BA 5KPJA 3G6WA 1WXDA 2OLKA 3QWBA 2EHDA 3NGLA 3WTBA 3ABIA 3NWBA 1A5ZA 1CVIA 2Y66A 3BZUA 4FGZA 1ZWKA 5IJXA 2CLKB 3T7RA 2HA6A 4WWHA 1Y34E 3JS5A 3KUCA 4U7JA 1MCZA 2J9RA 3QX8A 3VPAA 2C5BA 3DZBA 5BVGB 4Y9SA 1IBCA 5FBVB 2G80A 5EJFA 3KSAC 2C2GA 2IE8A 2C5HA 4ZOBA 1YMQA 4UOZA 3ULKA 4PN3A 1XKTA 1RP1A 4QTXA 4MP6A 3SYRA 4MIKA 1A7UA 3DPIA 1G9TA 1RKQA 2IUTA 2XTMA 3QY0A 1JAZA 2K7ZA 3LQQA 2CSUA 4G8BA 4N5NA 5AJWA 1RRCA 3CX6A 3PDJA 2DT5A 2EEZA 3CRW1 3GRYA 4DM4A 5ICEA 4W7IA 1TEZA 5EVJA 3QKTA 2J0UA 1JHUA 1Z5PA 1KI7A 2PRJA 1Z29A 3FWYA 2ZIXB 3OJOA 1YMUA 3S2IA 2XWJI 5FBHA 2GM4A 3WICA 3HY4A 4G23A 1UMBB 4YREA 2XZDA 2SCUB 1A71A 3HE3A 4FYWA 1W4AA 1R8SA 2HLNA 4D96A 3BWYA 4EARA 4P4SA 1RQXA 2B0CA 2I5PO 3C6MA 2B61A 2WDZA 4CLOB 5ALFA 3TR0A 4HVLA 3GG9A 1Q57A 1QV7A 3ZV4A 5JPCA 1D7AA 2HQSA 1B2RA 2NZVG 3IV9A 1AO0A 4CIBA 5JZSA 5JNLA 1VCIA 2D5AA 2DOKA 3LFUA 3JX9A 5B12A 1NLMA 1YDHA 2PD6A 2Y0PA 2YMQA 3FMIA 5EJ4A 2C2BA 5FBLB 3G5AA 1IXRC 1E89A 2QZPA 2WK1A 2P4EA 3AUKA 3BGWA 4RJKA 3E70C 4LF9B 1BEEA 2OZEA 3PDUA 5L6LB 4F1JA 4YJFA 2LCQA 4A4DA 1V39A 2HO5A 1WSDA 2ZJBA 4JUFA 3ROTA 1Z5VA 1UBHS 1IN8A 3OICA 3H5LA 4M60A 1A77A 1LLCA 4GOMD 4JOQA 4XOIA 1B93A 3BB4A 5DBGA 3VU9B 1R0YA 3DPSA 4JENA 4M4SA 1CD5A 3FTQA 4QDZA 4D9KA 1SQSA 3NC1C 4MVYA 2IV7A 1JYSA 3BBLA 3PQ4A 1FFBA 2ONCA 3FB1A 1QC5A 3CLRC 1Q1ZA 2X2OA 3FWPA 4CTMA 3MHTA 1DIHA 3TIVA 5BSHA 3S7ZA 2NU9B 5FL7A 1YB2A 2O57A 1BW9A 3D6VA 4C2AA 1R64A 2XI4A 3ZKAA 3BKXA 2D54A 2ATCA 2P2CA 4L16A 5BWMA 5K0BA 1C9EA 1PVVA 4LX0A 4AKSA 3KUDA 1V43A 3ETCA 3L7KA 2DPMA 4QGAA 4KNVA 2E7ZA 4EZEA 2GETA 2YMMA 5CHYA 3SYKA 1EFVB 1E0JA 2GHTA 2GK3A 4DIFA 1E5TA 4RD2A 2WSYB 1XRQA 1TVMA 2ZRAA 5JC8A 1EFCA 4CM9A 4RF2A 2B4QA 4OP1A 3FPCA 2QP3A 4C1BA 1P3Y1 1ORHA 2D62A 3C8DA 2WAXA 4O4IB 4FILA 1T25A 2I6XA 1QZTA 4PE5B 1BH6A 4OKIA 1XQYA 3F5DA 3SF0A 1W581 1UC9A 1WLSA 1VG8A 2K4MA 1F8FA 4R2JA 3PT9A 5ESDA 3VV3A 1IIRA 1DVRA 3THSA 1JA9A 1WVIA 2QV0A 2ZIWB 3LL4A 1USWA 4PYOA 4XUEA 3IO3A 5DGDA 3NDPA 4YDSA 1N8TA 5BY2A 1HX7A 1VLVA 3HKEB 3L7LA 3BGDA 4LV6A 5BNFA 1TTPB 3EXHA 1QK5A 3OZAA 4RD0A 4KQFA 4FFMA 5ULLA 3JQ9C 4RESA 4BXOA 2XXJA 3EHEA 3GMTA 3OWXA 1D03A 3QYPA 2R66A 4MPDA 5TGZA 2X76A 3VOSA 4TYNA 3AHIA 2JGJA 2E3JA 4JLKA 4JSTA 3MPOA 3PFWO 1I9GA 3OE7A 3AX6A 2C2YA 1CJUC 5IARA 5B3LA 3GJ7A 2II6A 4S1NA 4X93A 4UM8B 3TJRA 2V97A 1V47A 2GZSA 1YXMA 5AHOA 4J4HA 1QAOA 4E3ZA 2VTBA 4FM9A 4NL4H 4OHZA 5DDIP 5J2UA 1FNDA 4L51A 4OU4A 3DFUA 2OKCA 4NMMA 1I3NA 4RANA 1U28A 3QWFA 3WLHA 5EQDA 4BGDA 1WU8A 4WRRA 1E7RA 3L1IA 4P4GA 3CB2A 4H0CA 5B6PA 4CV3A 2VDWA 4NU8X 4YGXB 3PD1A 1N2XA 1K6XA 2VHWA 4UAVA 2A0WA 3B36A 1DQSA 3FFXA 4U2GA 1FLAA 1GEEA 4G25A 4XGQA 4BU0A 1YF3A 2R6JA 1UKAA 4J0JA 4B3GA 4PZPA 2W2TA 3C70A 1S2OA 2ZLBA 1H2BA 3DAHA 2HJSA 4X84A 3BXEA 1ZK2A 3B8EA 4O0LA 5IDYA 3W0LB 3IE1A 2XE7A 4RZIA 5IYZF 4PG6A 5ESXA 1IBRA 1E5QA 3CFYA 4OTZA 5CFRA 2ZSJA 1UFOA 3W7BA 3JSXA 1I80A 3RAGA 4MTCA 4EY8A 3K1ZA 2PZJA 2XWPA 3AR8A 3AR9A 1QUEA 4JEHA 1QIGA 2NZYA 2Y0EA 5A2QA 1E18A 3EVZA 5B1YA 4R9VA 1PJ3A 3MT8A 3F8SA 1GPYA 1Q7GA 4Z0PA 1PLLA 3LKZA 3MWEB 3KT0A 3BWEA 4K6KA 1QDUA 1H1LA 3KAJA 2C5AA 1KVTA 2IF0A 4W5WA 2JFHA 4R0VA 2JANA 2FWJA 1U63A 1K7XB 2W4MA 3WIOA 3QE3A 3EFEA 4MV5A 5E2BA 2CB0A 1L5HA 4EPRA 4N3BA 4BEWA 1U0BB 1XN1A 2YVAA 5IAOA 2PKQO 3G5TA 3A7EA 3S1AB 2E85A 2NQ8A 5K2MA 4AO7A 3LVQE 4WFJA 3UJ3X 2NUTA 5JI3E 4KYIB 3QFFA 2BEJA 2QUAA 3LCRA 5D7BA 2XXAA 2XRFA 5CH3A 4YRSA 2PY6A 1Z6QA 2HDOA 4LE2A 1B8UA 3TAXA 2W83A 2DULA 1I1QB 1OBFO 1RRFA 1FY2A 2ZJ7A 5ESWA 3PNVA 2HQBA 1AS2A 2JEZA 3C3WA 3QLUC 1EPUA 2BE7A 4HYEA 4OH1A 1CDEA 2AFVA 3EMBA 2UZIR 4F9EA 5IJ0B 3IAXA 1GY8A 2CC2A 5FBWB 2NX2A 1J22A 3KU4A 4KP7A 4IGAA 5DZSA 1XHFA 1KVUA 1PFQA 3IKLA 4FHCA 1DAGA 4OKSA 1MO3A 4J3FA 4L4UA 2XUZA 1HTWA 2C5EA 3LXXA 2CLCX 3KQOA 5DI3B 2IYWA 4ZFNA 1QYRA 2ZPAA 3DDOA 2ET6A 4AY6A 1BDIA 5B1DA 2RH4A 3C0KA 5CXXA 1IMJA 3HGTA 4C5CA 4EI9A 3JD1A 4Z2AA 1CB7A 4A5OA 1BH2A 2CNDA 2W98A 5ALPA 3RRMA 1MVOA 2PLAA 4UM7A 2GB4A 4BE7B 4O4JB 1CUFA 4QQFA 3M5WA 1OYVA 3KD3A 1UOQA 4M89A 2B2NA 2QMUA 2ERCA 3ZY3A 2CDNA 3HVKA 3K9GA 4M3NA 5K51A 2BKUA 3EEQA 1M8KA 1SVNA 1CJKC 3IMKA 4KDRA 2SKCA 4RVSA 1P7WA 4TS9A 2E21A 2R62A 3B1XA 5IXSA 5LD2B 4D6XA 4CM5A 4EA9A 4INPA 4I66A 2P0EA 3OIDA 3CLTC 3SMVA 1LFDB 2UZ1A 3HU1A 5A7GA 1OI7A 2JW5A 2WM8A 2GNAA 4I8IA 2JGAA 2RHGB 1OD6A 3FY4A 3MRTA 4CM1A 3FTEA 2AEEA 3IPAA 3BSFA 4A0GA 4DB2A 1I6KA 3P9IA 4FINA 4FLEA 4D45A 2QRMA 4BNVA 1LDEA 1AS3A 1D1QA 1E5XA 1KPGA 1F4LA 1RR6A 3EF1A 3FZGA 1E1LA 2A1UA 2HU5A 1E1RD 1JWAB 1A69A 2EHJA 3EPRA 4YCBA 3TQQA 4CKYA 1DB3A 2PUAA 3IUYA 1EAYA 4KI0A 3QKWA 1SZDA 5T3YA 1RQ7A 2UUCB 3QOFA 1FQWA 3NXSA 3VVBA 4D97A 4LF8B 1U98A 4OHBA 4FSXA 4F2DA 1RZRA 1HORA 1OZAA 2DMRA 4A8JA 1A9TA 5TQJA 2NV6A 2ODNA 4DV3B 4R7TA 4KTTE 4RZQA 2YZ7A 2OOSA 1KYIA 1W93A 5C51B 4HGOA 2I29A 3NFYA 5HF8A 2D1TA 3ON5A 3CO0S 5DU2A 4MK4A 6REQB 1CC1S 1GM5A 4ITRC 2NXCA 3ENVA 1M0WA 3B78A 2WTBA 4DPMA 2CL7X 3CNOA 4E21A 1UBTS 3QBVA 4IIBA 3VZDA 4BTEA 2UZAA 1XXHA 3UYLA 4YONB 3DKIA 4EG8A 1XU7A 2XA1A 1F38A 1OT3A 1EG2A 2I2XB 3OEYA 3E2PA 1F2TA 1Z26A 1OZGA 2QVLA 4K0RA 1H93A 1LU9A 2B78A 4MWZA 3U7QA 3LQ4A 2LUOA 1IJFA 3AMVA 3X43A 1MZPA 4C05A 2EG9A 1ISPA 1Y8CA 1GAWA 1O87A 1NBEA 3INNA 4QFCA 2BBSA 4MWGA 4TWRA 4AY4A 2OENG 4AKEA 1CP3A 1KVSA 1OCEA 1Z6TA 5F33A 4J3JA 2HL6A 4NG4A 1O6FA 1R6DA 3TQTA 4B76A 4BU1A 3OOSA 3RYHA 3S28A 4JJ6A 1E99A 2IYNA 4PZCA 3LLUA 4F0JA 4PLFA 5ALJA 3UNXA 1NZFA 1YBFA 5G0UA 1BJRE 1FTSA 2ZJ8A 4N0PA 4PPNA 3MTAA 1BVRA 4BPRA 5KYUA 1H8HA 4P08A 3E5MA 3BXPA 2JH8A 3DA8A 4M38A 3GVHA 4R1TA 4ZO7A 1Q20A 4W9RA 4IDQA 3JYNA 2M2IA 4KV7A 3AVXA 3W2GA 2GJ8A 3DTVD 1UK8A 4N6OA 4UARA 4CCYB 2DR2A 1A3CA 4QRHA 4BNMA 1E62A 1DQRA 1NJ8A 4HFMA 5CG1A 3ZWWA 3G89A 3A4IA 2H1CA 1O03A 2QL5A 3NM5A 5IXYA 2R1VA 4AYXA 3Q8XB 1WZNA 1T1SA 1ZZGA 2JAHA 3D0QA 3GOHA 2FMXA 3KKZA 3C85A 4MX8A 1II0A 1WV1A 3S6JA 1NRIA 3OJ0A 1XCOA 4X97A 3DFMA 1DIAA 1SEPA 3OJEA 3CH6A 3KQPA 4HWGA 5HKKD 2C20A 3CRZA 3IPYA 3FKQA 2WF8A 3DUWA 2QI9F 3WDMA 5EKTA 5JVDA 4IQFA 2HJHA 1USKA 3I62A 2BE9A 4PNZA 3JWPA 2NZ8A 1SHTX 2HIGA 3F7NA 3OLXA 2IUEA 3H4TA 4XB1A 2DZDA 1O94D 2GILA 4M98A 1TC2A 5BYKA 1EK2A 2GSDA 4PCLA 2P4UA 1GXSA 5HK8A 2YUTA 3C5WP 1WMBA 1G63A 2QPLA 2VHJA 2W2NA 1JQAA 1SZPA 1P9RA 3EY9A 3JQ8A 4JN6B 4Q34A 4WY5A 1JPVA 3TN7A 2PSHA 4CT0A 2W2KB 2VZ8A 1NXWA 5H3CA 5I9TA 3CEPB 2YZNA 3PSAA 1PS0A 2CK3A 3V32A 1IY2A 2O7QA 4TZ6A 4G5SA 3S8EA 1K3UB 4Z0TA 3EGXB 1SXGA 4MCJA 5GP1A 4EB6A 1UMKA 1X7DA 1YZVA 5A4AA 2RGNC 3EVAA 5LLDA 2VJYA 4HKTA 3HO1A 3WLSA 2OHOA 1HQCA 5AVTA 4Q6WA 4ZKEA 4H17A 3UV6A 2CJWA 4WGGA 4IDOA 5LP6A 1XZBA 1YHNA 1V16B 2P7IA 5HKOA 3G5MA 5TMEA 4EZBA 5HGXA 1LBQA 4KR2A 2QLBA 2VSXA 3ET4A 1CYDA 3GCWA 3TEJA 3TLKA 2P2LA 4H16A 1BXKA 1COWA 2EIHA 2IHYA 3K6SA 4HLDA 1SHUX 1SVLA 1JLLB 4PYQA 1E2PA 1GTZA 1MJ5A 2MOKA 4OD0A 2HHHB 3SHTA 2WT8A 5LOVA 3IOBA 3QH4A 1MV5A 3SLGA 5J2UF 1ZINA 3CG0A 2HXYA 2QPAA 1UWCA 3IMCA 2X14A 4OL0A 3DR3A 5BV2P 1GSAA 2A30A 3UFXB 4ACAA 4EHNA 1QHHB 2QNRA 3JR3A 1Z82A 4CKCA 5M2QA 4Q1CA 1Z7EA 1XO1A 2HA7A 4OX9Y 2I6SA 2PBFA 4B9EA 4TT8A 1XPUA 2OZPA 3GAFA 4HATA 4YIHA 2XYQA 1TE2A 4NH0A 4BATA 3KQYA 4DG9A 4YS6A 3O9ZA 3SD7A 1U8EA 2B99A 1XVLA 3BE6A 1Q95A 1ENZA 2FN8A 3QIVA 5LBTA 3WNVA 1IOWA 5TSDA 2EXXA 3L4BA 3I52A 2QMZA 3Q85A 4FT4A 1JQEA 1P2VA 3FYCA 4CF6A 4Q3CA 5LZ9A 2VK4A 1Y6GA 2OD9A 1N25A 5GZ1A 3RR2A 1AE1A 2TMGA 2Q3MA 4JXKA 1Y7IA 4BE9A 2ORWA 2X2EA 4TMZA 5ICMA 1DRUA 4J07A 3BF8A 4MR8B 3E05A 3THWB 1BS1A 4V0SA 3P0EA 4FOPA 5EJ2A 3VX4A 1Q17A 1N9KA 2O7SA 5B3JA 5BT9A 4UCWA 4KVGA 4IG4A 4DBVO 2EWWA 2BVNA 1XRNA 5BT8A 4FR5A 3D7SA 1LTKA 1NJ6A 2P2YA 2R5WA 2Z6VA 5KCZA 4G3XA 1YZLA 1RTTA 2XNSA 3LW7A 4LMPA 4M9SA 1X7YB 3E3LA 1GKKA 3LHFA 5JZBA 3H2BA 2ZROA 3VH4A 1N57A 2ID7A 2W2LD 3FXAA 1N2ZA 1N9ZA 4NFHA 5CTAA 3C6BA 2O59A 3EQ8A 3WMXA 4DADA 4F06A 1ZBQA 1GPAA 5HNKA 2RB4A 2CD9A 4FFDA 4RVUA 4WQMA 2TECE 2VDPB 3AEKA 1VFPA 3BORA 1GZ3A 3HABA 2AEMA 1Y9ZA 2RIPA 4K9QA 2C59A 4DF3A 3PCRB 4IUYA 4P53A 4UHFA 1PE0A 2YHIB 3IH5A 5DGIA 2BUBA 3TUZC 1ZNWA 2GFIA 5CA0B 1TA0A 3G5LA 3ZDCA 4R8RA 4DWOA 2A94A 1I7QB 4N7MA 1EA5A 3KS9A 5IT9A 1GCGA 1AB5A 2H57A 3G9QA 4WESA 3FM9A 4J90A 3I9OA 5JD5A 4D9HA 5E0OA 3KETA 1RXEA 5HG0A 3IT1A 3UATA 4I9NA 3WBBA 3ZE0B 5EMLA 4J03A 5KTMA 3KQTA 1D4ZA 2VYND 2NU6B 3LQKA 1XJ0A 3DAOA 3I6QA 3MTGA 2NV0A 5ALNA 3SS8A 2R97A 4TV9A 1UBLS 1O5IA 1ZLXA 1U0SY 4MZXA 1OFTA 4ZTZB 2O0HA 1ZX1A 1XEFA 1UKEA 1RVV1 3Q15C 1P2SA 4Q9IA 1P4HA 1R0ZA 2WHYA 3DEJA 3PKJA 1QQ5A 5TLSA 2IH2A 4Z5XA 4M86A 2CXOA 4UHCA 3WQRA 5LPNA 1P0FA 2I2AA 3MVEA 1H2XA 1V37A 5CFZA 1G38A 5JIBA 4MS3A 5KB3A 4YUYA 4HB4A 3QHAA 3VSCA 1Z2OX 4FFLA 4MUKA 4O6VA 1YUNA 4TRMA 4R2KA 1JTFA 1HEUA 1DC8A 1RAAA 1T9CA 2VNIA 2XHEA 1KIFA 1ZM9A 3KKMA 3MBOA 2QEQA 1FU8A 1WXWA 4NXNB 4MEBA 1LRKA 3VDRA 3ZV3A 4JH0A 2Q3BA 3QEJA 2WY2D 1O5OA 3V8PA 1JH8A 1K7YA 1HDYA 1NKTA 1QORA 5AI0A 4OQZA 4PHHA 2AZXA 4BQNA 1CVRA 4JMPA 3ZGLA 1VI6A 2OGWA 5JNTA 5KYWA 1JILA 4OMUA 1HGXA 1XLTC 3LHDA 1QANA 2JK1A 1MQSA 3I6IA 2P9YA 3DZJA 5DOZA 4BVLA 1TM4E 2ZS7A 1DSSG 3O38A 3BULA 4BEJA 2CFCA 1QP4A 3RC8A 2QT9A 4JX8A 4WNAB 4TTSA 2OM2A 1GU0A 4UUQA 1A9XA 3GGDA 2A3NA 3T1NA 4V0MA 3FR8A 4DZRA 1P9WA 4OI2A 1G5FA 2EX4A 4ZU6X 3S2YA 4BNUA 5CBKA 2ZBUA 3CF2A 2I4IA 2CHEA 1Z8DA 3D0OA 1QHXA 3EVNA 3QPBA 5F12A 4YRAA 1AKVA 4KLRA 1PTKA 4OGFA 4QGFA 4Y1EA 5HMLA 2DB3A 4A8PA 1IEXA 1W19A 4WFIA 1LNSA 5K3BA 3ZHSA 4BNHA 2HLPA 2JARA 3H9GA 5IJ9A 2YR0A 4ON9A 4D3ZA 1JI0A 4NV3A 5DASA 4HCJA 4MR7A 3EXFB 2FSSA 3M7IA 3X1KA 4BZZA 4KFUA 2ZK7A 4N5MA 1XEWY 1ZL0A 2YVLA 4OK3A 3PHJA 4Y2VA 3S7TA 3ZG6A 1FNNA 2PO7A 3MMNA 5LMZA 2X8JB 1Y8QA 5GAJA 4CI0B 1PIWA 2QYOA 3NUGA 4XVCA 2W8BA 3KRTA 3BWDD 4E1VA 1E4EA 3E53A 4JQOA 1W0JD 5DX1A 3H5VA 2WWVD 3OZIA 3GK3A 4YMUA 4ZOLA 3SCZA 5KYXB 3K4PA 4NZPA 1K7FB 1SCUB 2GBIA 1ESEA 5KQPA 1YNOA 2ZI4A 2HR1A 4D9CA 4HADA 1TM2A 1Y42X 2ZJ1A 3GAAA 3QK7A 4GAEA 5F64A 4DBZA 2V9ZA 1W4LA 2ZE5A 3AGQA 4WKNA 3WQQA 3G9ZA 4D9IA 2REXB 1YB6A 5B7QA 4TKVB 1D1PA 4RD4A 4I2NA 5E1DA 4KYUA 1FS6A 4LY0A 3BXOA 3KAPA 1NU8A 2IIVA 4ARAA 3SEQA 4S1VA 1N2GA 1IM2A 1YS7A 2QWXA 3JQFC 2J9FB 3RS0A 4LJ4A 3E9NA 1TJYA 2ZQZA 1T8UA 3G8CA 1AURA 2ATXA 3HJCA 3MB8A 2ZSUA 3DVSX 4ZO9A 5EKUA 4EHHA 5JVDF 4B17A 5FUMA 4P1ZA 2E18A 2FR0A 2PS9A 4MPJA 1ADCA 3K70B 4N7RA 1O4WA 3AB3A 5CB8A 3J80A 2Z3ZA 4E03A 4WOKA 3ZCTA 2B94A 2FJUA 4NENA 1Y4SA 4AZ3B 1X80B 2NWQA 3QPWA 3ZD8A 5KWEA 3ES9A 4IZ6A 2RGGA 2WAAA 3CNNA 3GLGB 2PN1A 1OJ7A 2XMPA 1VLZA 1ZGJA 2BR5A 3UWPA 4DL9A 4K88A 4YAFA 3IFSA 3LDGA 2Z98A 1N6IA 2CLIB 1HE5A 4MKFA 4TL6A 4DIOA 1M5RA 4QSMA 4FNMA 4WY8A 3GJXC 3C1TA 2ZJ3A 2AFIE 2PMFA 1IOLA 3S8MA 3UMGA 2MYTA 3I58A 1V8ZA 4MPTA 4XPZA 1XCPA 3IA7A 3FKSA 5CA1B 4HDMA 4H7EA 2OPHA 5ITVA 5LP6F 4BB0A 4F56A 2Y2VA 3TTXA 4CM7A 3PWZA 1TYDE 3EW7A 5CM8B 5JO0A 2V65A 5KTYA 1G8AA 1REQA 2GKSA 1Z0IA 5DGHA 1Y81A 1HEYA 1UQRA 2TSYB 3L7JA 1MDBA 3NHPA 4PX5A 3OIGA 1P7ZA 3B70A 3O8OB 4IQ0A 1AGNA 2ZGVA 3MSCA 4ZMSA 1LS6A 3ED5A 3F96A 4OHRA 4FDTA 4IRXA 4MYRA 5EUBA 3ELYA 4B3RB 1CJSA 5CEEA 2L69A 3INTA 4ZT7A 4OI0A 1VSVA 3O4HA 4W5NA 1F17A 3OPXA 4Y6SA 4H15A 3UB4A 3EGDB 4I1PA 3L05A 2CF5A 2C3YA 2ZVDA 3E3OA 4EJSA 1J49A 1XTPA 4D6PA 6Q21A 3RNLA 1W6UA 4RK1A 2FR1A 1FF9A 4DZTA 1EXNA 2Y6UA 3R5FA 5BN1A 3VHXA 1V41E 2QUHA 4AECA 1Q16A 4RTNA 3BDIA 4P0PB 4PICA 4LFBB 3I23A 1TU3A 4IXTA 5EESA 4TXHA 3R2JA 3C3DA 4BUJA 4ZQBA 1Q15A 3AL3A 3A9WA 1L7OA 2YY6A 1I2MA 3VR4H 1MX5A 3VI3B 2YICA 3EEIA 6NULA 1NI4A 2XADA 2AJLI 3Q0EA 3QXSA 4UPDA 2JEOA 2YYAA 4EFMA 3KQNA 3I9JA 3CNBA 3O7WA 2C4NA 2YNMA 1F2UB 2B8TA 3ZWQA 3WFZA 2BF4A 2VWHA 3Q3HA 3OFKA 3UMSA 4DGQA 3WNZA 2Q2VA 1UPFA 1NVVQ 5ERYA 1DC6A 1TKBA 3IBCA 4OGGA 3CRRA 2A5DA 1JDNA 1DZ3A 1KDOA 1DG1G 1MAUA 1PGQA 2FPPA 1JKXA 2Q41A 2G6BA 4TPKA 4YJ3B 4KOEC 2G71A 2PT6A 3ERCA 2JHGA 3G82C 3AFNA 4XUGB 4RA9B 3BFKA 3RQSA 3A7DA 1SKBA 1DO8A 3B1KA 3KR2A 4O2BA 1J23A 4IF4A 3RK4A 4PLYA 4HX5A 5A1TA 4ND1A 3OZEA 5J47A 2A9RA 4FMBB 1A4RA 1W73A 3U39A 1SKYE 1DMRA 2BDEA 2VNHA 5CB4B 3NKFA 1NXPA 2WLTA 4DFDA 4YT8A 4I4IA 1JEYA 1VE6A 5AHRA 1YJ5A 4AMZA 4KE7A 3CSDA 4EUHA 3NAZA 3AVQA 3HWRA 1ENYA 2DPHA 1EP1B 1XAJA 4KO4S 1PQYA 1CNFA 4CM8A 4PFJA 4KI7A 3OLVA 3QE2A 4H08A 3FUTA 1B7GO 3G0GA 3GNQA 4TSFD 3W2IA 5IKXA 1M0SA 4D5EA 2LKDA 2GNPA 1ZUHA 2DFVA 3BS4A 3U3ZA 4INZA 1GITA 1EE1A 2VLBA 4JXJA 3UJBA 2FSVA 2J87A 5DT9A 4QG3A 4GICA 1CDZA 2C8JA 3CLUD 3R5SA 3A1EA 3TQHA 4QXOA 5EJ8A 2ERXA 1XHEA 2Y9MB 5ECGC 1HLFA 3LXMA 4D8XA 3GZJA 1H0KA 9ABPA 4OBWA 2ZYHA 1YKSA 1P9NA 1U31A 1EX1A 2B8WA 3OC6A 4IEIA 4DNFA 5ADHA 4Q47A 3C2QA 4KXUA 2F3PA 3W6ZA 3IR6A 3PI7A 1BXZA 4Z0NA 3C3PA 2CE7A 4K1LA 3DFZA 4L5IA 2IHJA 2AFHE 3KOUA 1QH1B 2CXRA 3Q2OA 1FSFA 2J7PA 1P5JA 2O7VA 2ZI6A 3RG8A 1A8PA 3Q9UA 1CUXA 4HQLA 5EJAA 3RSOA 3T0FA 4EY6A 1G9SA 2X40A 4X65B 2WU1A 1TF2A 1BRTA 3DE5X 3QYFA 3RRJA 2V6FA 1GGNA 1TI7A 3FOWA 2VNJA 4GP9A 4TV9F 1YVRA 4PW0A 4URWR 3SSMA 3V00A 3UK1A 1FW6A 4GMHA 4YUWA 1DEXA 4HDKA 4UUPA 4WK6A 1E60A 1PZHA 1GPJA 3AXTA 5E3IA 2I1LA 3FYUB 5H83A 1X8XA 1XJCA 1WHSB 3A25A 1ZC4A 2BHRA 4JAVC 1ZHFA 4L8YA 4EVRA 5DVZA 3NIGB 4B5KA 4MQ5A 4RHTA 3HY3A 1DWPA 2O3UA 3F0TA 1TA4A 4ZU1X 2QPOA 3Q6IA 1KEPA 3O4VA 3X3HA 4JA0A 2A59A 2JS7A 1BOOA 1RKVA 4I5DA 2J3HA 2J46A 1FRFS 1R50A 2FWIA 2Q99A 2GYUA 4LG1A 2P75A 3Q41A 4NI5A 1MX3A 2W6OA 4XD7A 5BUCA 5K2OA 5INTA 2CLHB 2V3VA 4K05A 1WB5A 1DAOA 1XE3A 3JR7A 1U3WA 2XD9A 3AR7A 1NULA 4MA5A 2WMNB 3G8AA 2C9BA 2VSOA 3IILA 4LOKA 4XZ3A 4QX6A 3UMYA 3RIMA 1JJIA 1JR3D 5JHGB 5FT9A 4XVQA 2ECOA 4EFDA 4JK3A 3SR3A 3V7UA 5F5LA 1ZI8A 2QR5A 4MOWA 3ESXA 1QS0A 3RBVA 1CUVA 1YQXA 2Y1GA 3PP8A 1A5BB 3ADBA 2J9YB 1K5PA 3U7HB 4NSNA 5GIPE 4ESEA 3AVTA 4EL0A 2HMVA 2PAFA 4Q1VA 3SKYA 3J7TA 4PFKA 4XSHA 3VZQA 3ME5A 4EECA 2ZYTX 3R20A 1OWOA 1IAQA 2OV3A 4KUEA 4LZJA 4QUAA 3RNOA 4FWIB 5FJIA 2BF7A 2F4NA 2YHBA 2OV8A 3EZ7A 2DQSA 5A0FA 1A8HA 4DZZA 1JFFB 3UAXA 2Y9PB 3G1TA 1DWQA 4G1BA 1DBPA 4XPIA 4YXWA 5MDHA 3PC7A 2VP9A 2IPLA 2QW8A 5A5GA 4HC4A 1VKHA 1U7PA 1BMTA 1QKJA 4GU5A 1OXTA 2DPGA 2H1SA 4R05A 6AT1A 4ARCA 4N48A 3K9CA 4IG9A 2GA9A 4P8RA 2NNWB 2BDUA 4PSAA 3CVJA 2NAPA 5AK6A 3RTEA 1TC1A 2CXHA 3IBGA 3PGA1 4N18A 4I7EA 5ICGA 2CZGA 2ONYA 1IHPA 2QG4A 3C3BA 4KQ9A 3HPQA 2R8OA 1P1RA 2NTNA 1YOBA 3FUXA 4EHAA 3ESQA 1QQ6A 1KKLA 1GTMA 5KJ6A 1BD4A 3IDAA 3GBPA 4FI3C 4V0RA 3EGVA 3F7MA 3AM4A 4WZBB 5AKYA 3W5CA 1BYUA 2PPVA 2JCSA 3A1CA 2FYTA 2CNBA 4J7CA 2UAGA 5I9LA 3FCSB 3ONVA 4N8EA 4BKQA 4CGYA 1CR4A 3UWOA 4D41A 2GFQA 4ZOLF 4YP1A 3W34A 4AWXA 4FHZA 1CQIA 4OB6A 4MI3A 1VJGA 1ZU4A 2WHPB 2Y2UA 4W1QA 2JGKA 3T9AA 3WGMA 5L4NA 4BFTA 1P8JA 2GPYA 2ODEA 4OP3A 4IHJB 1GKIA 3DL7A 3WAGA 3CKMA 3A1VA 1NMQA 1E8MA 4ZEXA 3TDNA 3PQCA 3QG1A 2BKLA 1YZTA 3VNSA 1IVNA 4YRFA 2E4AA 2YOHA 4DDUA 2CLMB 3E2IA 1L5RA 1XJWA 4RZUA 5LYYA 4AXBA 2PCJA 5G0TA 4DLLA 4GWLA 3T3MB 3AVOA 2YY5A 3RADC 4JDUA 3HK2A 3GJYA 4BQQA 4JB3A 5GZ3A 3RU7A 5E7QA 4RWZA 2OGTA 5CJ2A 4GX1A 2ZRLA 5AM0A 4DREA 3WWDA 1X87A 2HUPA 1NG1A 2GZ3A 4P9NA 4OPMA 4HNQA 3O91A 3UMFA 4C03A 2R7AA 1VMIA 3ADOA 1CRPA 3ZUPA 2YWHA 2CMHA 4X44A 3HXMA 2OKGA 2PO5A 3CURA 1SO8A 1Y1QA 4I4TA 5ELMA 5BSUA 1RYHA 3WGUA 2W6NA 4WINA 3CLHA 2C4WA 1HYEA 1QHEA 2C07A 1NJSA 3TR6A 1TIKA 2O8DA 4UZSA 4UM9B 2YZMA 3MUEA 2BLLA 3OAAA 4Q4DA 2AKEA 5ELLA 4QM7A 4NK4A 3E48A 3OIVA 5FORA 1OZFA 2OXCA 3GDHA 3TZQA 1PK8A 2R1UA 2C0CA 3OVMA 4RKEA 5KNDA 2C9MA 2QE7A 5I9NA 3IKVA 2VYVA 3HDJA 5TQ0B 1X1BA 4IX1A 4YXFA 5LYJA 4AC9A 3SVTA 2ZTHA 1DJOA 3HYCA 5CX1A 5AIAA 2FPSA 1IY1A 3E15A 1LQUA 1P33A 4RK7A 5DMHA 1X1CA 3GRFA 4P6VF 1A7KA 4OQPA 4RHXA 1TRKA 1DKQA 4Q39A 3VDQA 1S8FA 1P4GA 1FX0A 1UBUS 2WIAA 2YBDA 3IQZA 2VDVE 4DA7A 2ZE8A 3UMVA 4IO0A 2QSYA 2M98A 1CP2A 3Q40A 4AJIA 1Y37A 4PC7A 1JF8A 3C48A 3ZIDA 5D01A 2OC4A 1AGRA 4Y2QA 1FYXA 3T38A 2FG5A 4RSHA 4A1OA 4PRYA 1XQXA 5K6AC 1V5FA 1RSZA 4E2FA 1MEOA 2Q21A 1FTGA 5CBPB 4R54A 3JPWA 1EEXB 2REBA 1RAHA 2ODTX 2X3YA 1CS0B 3G17A 4JR1A 4X20B 1SG6A 3FTDA 1AMNA 3LT5A 4UOQA 1LS1A 1O6ZA 1MGPA 1U5AA 4AG3A 1N2CA 1NVAA 4KPGA 4Q9JA 5H68A 4KVZA 4GDFA 3TW8A 3LYAA 1EWTA 3QU2A 4HH3C 2YVUA 1B0PA 2GEKA 4RENA 4CQLA 4XWWA 2NXJA 4JI4B 2NQTA 4BOYA 5FCDA 5FUWA 1R27A 1Z5GA 1UKYA 3VO9A 4DTCA 2BDTA 4A82A 3N53A 5JT1A 2EFJA 1R4AA 3EOBI 4LHZA 5HFJA 3DM5A 1TX4B 2PUBA 1NZJA 1O58A 3HUTA 5BWLA 4FYKA 1VHTA 4K9LA 4H7IA 4RSMA 2D0PB 1KDPA 2HV8A 1H0HA 1Y3BE 2AT1A 1Z0DA 1WUYA 2A86A 1I3KA 1R0XA 2NSDA 5DYNA 5CB6A 4BMXA 3N2EA 2CL0X 4JP2A 4ZWNA 2J4DA 5B7GA 1Y6ZA 3KDAA 3UM9A 3OPYB 1JG7A 3NRJA 3ESCA 4Q82A 2HRDA 3H8VA 4LF7B 4CETA 3U56A 4LZNA 4JOCA 4KR9A 4F86A 3TSAA 2CJYA 4K6OA 4DDHA 2Y93A 2ZTSA 1NBME 2ZSAA 1NL3A 1CPYA 4HB2A 1D9XA 1GTG1 5IH3A 1XP5A 3MT9A 5ENDA 5LC1A 1S2IA 4L27A 4QUEA 4D8TA 1I5EA 3L7AA 4GUDA 3SC2A 3CW2A 3O8QB 3BCSA 3VBEA 1P0CA 2G7MC 3D0RA 3PGJA 2W22A 1BHO1 3TLGA 4E11A 4AKGA 1FTQA 1XXLA 3W9SA 1ZRSA 3R40A 4OLJA 1FSZA 1UXHA 1Y48E 2QYSA 3OIYA 3ROFA 1BIFA 4N8SA 1VCOA 1C1DA 2V5VA 3NTOA 3ZHQA 4ZCTA 4YMVA 5BMVB 1GFWA 3DXFA 3KP1A 3L6CA 3HCCA 3PNKA 3TSWA 1LA2A 4EPTA 2PX5A 1NJ1A 1TQ2A 2WKQA 1MABB 1CETA 2ZOSA 3H7AA 4XRGA 2R86A 3MUOA 1GGKA 3FNGA 2XT9A 2QRNA 3HEMA 5MN6A 1J0AA 3TKYA 3BK2A 5B64A 4DV4B 2QZ9A 1M1YA 1NVDA 3AKDA 1PSWA 3W06A 4F60A 4D9BA 1CRQA 1KEWA 3VR5A 5IULC 1ZUNB 1N4AA 2ONJA 1W49A 1P72A 3E0XA 4DUGA 4PANA 1O8CA 3E58A 2QVBA 3KUUA 4RJLA 2NUPB 5AICA 4ALLA 4MS4A 3T54A 3KPYA 1RMYA 1TCUA 4K6MA 4U6QA 4NECA 3R76A 3QUTA 1YRBA 3ZWKA 4A6EA 2HYIC 2AD1A 1B6GA 3G0BA 2IH4A 2FZVA 1R9NA 4B47A 2KQUA 1I1OA 1CQJA 2P0AA 4FMPA 4RD1A 4AY3A 2J48A 4G1EB 2ZI7A 4BHTA 4EHKA 1H6DA 4TUYB 2FWPA 5KSYA 2EW2A 3LWNA 1V9SA 2OTCA 4QBKA 1QRUA 4E12A 1OAKA 1WXHA 1IXZA 2Q50A 2E6UX 3F6BX 3IAS1 4JQCA 4J2TA 1NMEA 5K99A 2QZZA 3AI3A 4TS1A 3QJGA 5TPWA 1MC8A 2QTGA 3KKPA 3NBMA 1V6SA 4JUDX 4OHFA 1IXYA 5LXTA 5JANA 3C3EA 3LQFA 1I1NA 4F8EA 3P8ZA 1DBWA 4GUAA 3ZW7A 4R0NA 2Q46A 3NBFA 3N9IA 4H1VA 1OWNA 1OX6A 2V7UA 3OZXA 2YIJA 3BIWA 1QLWA 1F5SA 1KAGA 4P4LA 5GJWC 3DEFA 4IIYA 1NNLA 4O25A 4CHGA 2J5XA 4ODIA 4EDHA 4B82A 4ETWA 5JAOA 1D6JA 4E5PA 1YQGA 2KI5A 2WIBA 3ZD6A 3SE0A 3DCYA 4I5IA 4WK2B 3SIXA 3VPHA 3WMGA 4NJMB 5EZYA 3LHIA 4C43A 2BYTA 5F7JA 2ZB2A 1DIBA 5AQEA 3U3RA 1G21B 3C7DB 5BR7A 1QHFA 1Z68A 4JBHA 2Z1NA 3M6XA 4BNFA 1MIHA 3NEAA 3FTPA 4TV8A 9ATCA 1W4CA 2CV2A 1MC1A 4ILKA 1PQ4A 3GPDG 1JBEA 1TTQB 4NPHA 2WP0A 4R2XA 3SQMA 1YFJA 4MP3A 4IS2A 2ATIA 2F62A 3TNDA 2QUZA 3ED1A 1U8YA 1M66A 3L02A 1EX6A 1NC3A 1EEHA 1Z6AA 4TXNA 3I12A 2NM0A 1O3YA 3ONNA 2RGRA 1DCMA 5THXA 3RIYA 2ID9A 1EZZA 1KETA 3UC5A 2OECA 1T36B 3O4RA 3QFSA 1CRWG 1CUDA 2VXOA 2DCMA 4HWRA 5A4MS 3PJGA 2DP4E 5AUPB 1TJNA 5IC5A 5JZ9A 3N28A 4PF1A 4HX9A 3KFXA 3O31A 3O8BA 4ZAYA 5HTOA 4WBNB 3EIUA 1HKHA 3MIZA 3E3MA 1J1IA 4MPRA 5CPBA 4U2EA 3UJAA 3EXAA 3TW6A 3S8YA 1SCQA 3EULA 3FSGD 1B15A 1RI1A 1URPA 3EFOB 3TBHA 4YRIA 5IF3A 4JLNA 5M5BA 1ZMXA 1C1XA 3L0YA 4Z8YA 3U7EB 1B0UA 3G7SA 4B3FX 4J4TA 2H0RA 3PXUA 2EFEB 4INJA 2IFTA 4JEIA 3L82B 4PRKA 1K3FA 2GZRA 2GRUA 4FJ2A 3IDSA 2W71A 4BWGA 2BFNA 5A5EA 1E64A 2JHPA 2FPIB 2ZRFA 2DJ5A 3AKCA 4E1BA 4F6CA 2I87A 1NW5A 2NW6A 3KYDB 2E5WA 4D9GA 4TMVA 5JWOA 2X9GA 1KARA 3ETHA 4IIGA 4I55A 1SQ5A 2GN2A 2C2MA 2UYHA 4GH5A 4YT4A 3CNQS 1YRQA 4CUKA 1E7WA 1U3CA 3OZRA 3G2JA 4CIAA 3BL8A 3O4IA 3VYVA 1SBZA 4WLVA 3WLNA 3D3QA 3DBOB 7ABPA 4IDDA 4MKZA 3OT1B 3ORQA 4RXTA 1Z4JA 4OMFG 4UEQA 4B2PA 1SHKA 4IW3B 2BJVA 3IPLA 2GD1O 1PEDA 3ZCPA 3O4FA 4MVCA 3P96A 4CT5A 3GDWA 1F1JA 3Q8KA 2QL9A 3AVYA 3ISVA 1RM5A 1PUJA 1X1RA 1WMDA 1EQUA 2EF1A 4PHFA 1OC2A 4UCXA 1ZJJA 3RUHA 4TMWA 4BVBA 4DLTA 5BN5A 1R00A 1Z7GA 3W2EA 3AL2A 3H8SA 5EI5A 1QHIA 4BFSA 1SH7A 2CXXA 3CZPA 4LWQA 4B8WA 1E2JA 2AK2A 2GZDA 3CZAA 1JLRA 1T9BA 4O5AA 2W70A 2DLDA 1HC7A 5KTOA 1AM4D 1XUOA 1FDOA 2DBRA 2GK7A 2PKYX 3U49A 1P7YA 3HN7A 1NW3A 1C2TA 3TTYA 1CY8A 5BW6B 1HQYE 1II8B 4LVUA 1WEHA 2WFLB 5HJEA 5JYBA 4IIFA 4W1RA 3QKIA 4DC9A 3LU1A 1EGHA 3BMOA 1DE0A 1FB5A 4RMHA 1GUYA 4BJ6A 2QN8A 5LYJF 2PZEA 5JYCA 3HQ4O 1QTRA 3CF6R 4WOJA 3GJSA 2EV9A 1GQFA 4X1KB 1O77A 2LTAA 1E1CB 3QVTA 2X4LA 2WWFA 4LNAA 4RFSA 5LA6A 3HO8A 2G8NA 3PR2B 3IQEA 5CD1A 3OD5A 3IAM6 4DQKA 2GAOA 4QTUB 1GKUB 3HMKA 4Q05A 2Z0MA 4L2IA 5ELXA 1A8QA 2TRSB 1FL9A 4BNGA 4JL8A 4V3CA 1GZ6A 3U62A 2GASA 3LLCA 1HLDA 2J9XB 1EVQA 4B48A 1F0YA 1LDGA 2VR1A 1TT5B 1U1GA 1UKBA 3I1JA 5AOBA 4N7JA 4GPAA 3QWIA 1ISRA 1S8AA 3CRNA 3F4BA 3HR4A 1WXQA 1KO8A 3NIDB 2AIRA 2VJBA 1LH0A 1GN8A 4IOMA 2FNAA 1UMCB 5C3UA 4YYEA 5LQCA 3T5PA 3FROA 2ZZNA 2XYVA 4C4TA 5CNJA 1QM5A 1ZHHA 3O8LA 4CIVA 2MU1A 5ED4A 5LMCA 4WJLA 3FCEA 3GJ3A 2HWKA 1TKAA 3ML1A 1KOGA 2ODAA 4B5LA 1QGOA 4M1OA 4JGIA 3U44A 3T5TA 3PUIA 4A6XA 4FFNA 3TLXA 1I14A 3BFXA 5LQAA 2BL4A 4GX2A 3WA7A 4HTFA 4KHPB 2DBYA 1PQWA 2QZSA 1I9CA 1OXBB 2ES4A 1U7ZA 2HEIA 3I6YA 1M54A 2RGCA 1LI7A 3IVGA 3BL6A 4KMSA 3UAOA 5DIFA 1SB8A 4MCAA 1KRXA 4TS4A 3QLJA 4J0GA 3HVUA 3NHAA 4WCVA 5JISA 4RTLA 4MPPA 3RUIA 2JBAB 2O54A 1GQ2A 1TPZA 5EE3A 2CLFB 3I45A 5AQ1A 4M9CA 4CCWA 2QD2A 2BY4A 4BO8A 5KYNA 1NN3A 4NOMA 3KJNA 4Y0AA 2H2AA 5DF1A 5B3AA 2QOEA 4AURA 2XJ4A 1YB7A 3LUCA 3RC7A 2XT0A 4YRZA 2JNWA 5LLSA 3REFA 3QUQA 1S89A 4OJQA 4YV1A 3L0BA 1V11A 1L7EA 3STHA 4EG3A 1AD2A 3G02A 1DC4A 2XKKA 3EEOA 1G21E 3VPGA 4D4JA 4JSRA 2JCYA 4EB0A 2HZBA 2WJZB 1GA6A 3QVVA 1ZZEA 2UDPA 2N1BA 2R751 1TW3A 1H4VB 2QW1A 4JP8A 4NJEB 3LCVB 4DIKA 2J09A 3DW1X 1YJAA 2XMDA 3LUGA 5JV5A 1PV2A 1R18A 2V7WA 5K0JA 1PWEA 3M8KA 1SC4A 2ZDGA 2X5KO 3GLGA 3H8WA 4CLRA 2OZLB 4OXRA 1V1RA 3T7DA 3WK9A 4JOSA 1C4XA 4UM5A 1F12A 4KUHA 1HE8B 1I32A 3R0IA 5K0ZA 2GPWA 2LCFA 5JSFA 1KA9H 4UTXA 1PX2A 2A5LA 2ZSBA 2XNDA 1R10A 3B1JA 4KR3A 4Z53A 1P5FA 2NO0A 3UOWA 3L01A 3QI7A 3W6NA 4DMKA 5KS2A 1NGSA 1OX5A 1GYQA 3OEHA 2VG8A 2I66A 5AW8A 2XVZA 2IV3A 1JJFA 2J6IA 2YWCA 2CY0A 3KR9A 4H7FA 5IPFA 3E9CA 4DT1B 1JP7A 1MO4A 1Y5NA 3Q8WA 1DJPA 2FFHA 1GNTA 1LRJA 2AB0A 3F4KA 3QKRA 4DJ5X 5KOHA 6ADHA 3ICEA 4YC7A 2IITA 2VAXA 3AWIA 4KX3A 4ZVPA 4L5JA 5IC6A 5K0LA 1IEVA 1GUAA 1ZEMA 2NO5A 4HS4A 4KLNA 3CUSA 1MP0A 2GMWA 3MTEA 2Y67A 1G16A 4JLVA 1NVBA 2AN5A 1MUUA 3H75A 3DG9A 3DFFA 3OMWA 3M3DA 3RHFA 4AZSA 4UBIA 1N0WA 5EUQB 2NUAB 2WM9B 4UTPA 3QQPA 4MO2A 4OREX 4R9RA 5JJLA 3S2SA 1XZIA 3C74A 3GDOA 4LWOA 1ACMA 4XCVA 3K96A 1EUDB 4WMLA 5FBKA 1ENPA 2VYQA 3PFGA 1ONOA 3QIAA 5AXCA 3W5UA 1KFEB 3ZLTA 2QP4A 3IPCA 3ZLJA 2FSHA 4ZMRA 2CKDA 3KAQA 3N8GA 4FWTA 4NR0A 4O3FA 3DAYA 4AULA 4LRQA 4CMAA 1OLOA 1T6YA 1SKAA 5LXTF 4UMDA 2BV3A 4B4WA 4FE3A 2O5CA 1QGUA 2AJDA 3ZK7A 1KH1A 2GT1A 2F7SA 2QQ5A 1L7QA 1YOVA 4G0XA 3CA8A 1RJ9B 4PLCA 4IP0A 5ERXA 1R4MB 3FOFC 1HTTA 2OB1A 2QBYA 3FRJA 5LSAA 4C4XA 2ECKA 4KBYA 3WLLA 3ZGZA 2KWIA 1PRYA 5D6OA 3KTAB 3LC2O 1WR8A 4WXRA 1ONNA 2OCDA 4RKFA 2ICAA 3H9EO 3DM9B 2ECFA 1OMOA 3BT7A 5T4EA 4TV8F 1Y7PA 4TKMA 2HLDD 3PWKA 4H60A 3MAGA 3CLKA 4PLWA 2G1KA 4TLCA 4A0FA 4ZDJA 3B7WA 1PVOA 3BBPA 4E94A 4FXPA 4RO0A 3KLNA 3GVCA 3ZK9A 3JQBA 1CQPA 3ANXA 4OJTA 3DZIA 4XWAA 3UANA 4RHCA 1U3UA 5J58A 3QOXA 1R7RA 2R7NA 1ZK3A 2GXAA 3PEEA 3KCQA 2XUDA 5B1IA 1N75A 3O93A 1J07A 2VPPA 4PG4A 3DLPX 2HAEA 5KJFA 4NCKA 1JGTA 4A6DA 5C8YB 2PGOA 2VTDA 1SHJA 2WJHA 3WYBA 5HSGA 1E6UA 1E94E 1QB8A 4G1MB 4B79A 2FR8C 1P8AA 3QEMA 4HBGA 2WPNA 2X0DA 2XE6A 4FFVA 3N59A 4OHKA 3TGWA 3UY4A 2VA8A 5ARBA 3QTTA 4JOBA 1UT6A 2VP0A 1C8BA 1TQDA 2YN4A 3P52A 4AN0A 4OXYA 4Y2UA 5DN6D 1I0ZA 2DGDA 2BFDB 3FCYA 3H19A 1NLZA 2VTVA 2YV3A 1M2OB 5CLQA 5TJHA 2H16A 5BV0A 1XQVA 2K2WA 4KB5A 4PZYA 3KQVA 2O2HA 1XZAA 3C4QA 1KS9A 3HA7A 2PNJA 1JAXA 5JY6A 1DNPA 1FX1A 2P6MA 2OO5A 2YQZA 3KWFA 3N2YA 4KNWA 2PLWA 2VVTA 4GHWA 1Z2CA 1EK1A 4LI0A 4OA8A 5EC8A 3A1NA 4AZ0B 5E8RA 1T15A 2YV4A 1EX7A 1PZFA 4QEKA 5AHWA 3IDQA 3NTRA 5EWJA 3QY9A 3EG9B 1ML4A 3PSHA 1RPAA 1KI2A 1WXXA 3U4AA 2QUBA 3P9NA 5E4TA 1ZOSA 2ODQA 3I4LA 2EFGA 2AUNA 4JT2A 2BFPA 2C9ZA 3RC9A 3IQIX 3IVXA 2OLEA 4C07A 4MRMB 5JS1A 4UTOA 1KS2A 5K0CA 4JLUA 3OCWA 3VH2A 4ZHSA 3DE3X 4G41A 4NHEA 2Q7XA 1ISFA 4JYPA 4DG5A 1XPOA 3KE9A 3RVBA 3GHHA 5CNMA 4HJRA 3V4OA 1JIQA 2ZP1A 2ADFA 3B1VA 1EUQA 4HLCA 1UODA 3EIHA 3PUJA 4Z3OA 3AEUA 2VAVA 1ADJA 2Z4RA 1NNUA 4QASA 5IJZA 3K6JA 4MICA 4GSKA 2W42A 1NJGA 3DJYA 3K0KA 2EZ9A 4S2UA 2WF5A 5DGTA 3TLJA 3TRFA 5KQLA 5LLTA 1QH9A 2FOLA 3MK31 3UT6A 2H1HA 1P6UA 2PGNA 2QTLA 3PZBA 3TMKA 2GA8A 3AY0A 2NLOA 4NIMA 5FO1A 1P0QA 3WADA 5C80A 1I7SB 1G3MA 2C99A 3AU8A 2N1MA 2W6ZA 2F64A 2ZI9A 4UNRA 3I09A 3B5IA 1OTYA 1Z2EA 1EFTA 1X86B 3C39A 3P2OA 3LPDA 4GPIB 2IP1A 3TTSA 1PCXA 3B6MA 3GFOA 2WVGA 3KFLA 5D85A 4HLQB 3DC7A 5GONA 1ZMTA 3RC3A 3B51X 2C0PA 121PA 2O2XA 5LA6F 1QJ4A 1J99A 5LN1A 5AM1A 2YJZA 1F8UA 1AB6A 4FFBA 2W90A 2ZXUA 1NXSA 4FYYA 1WM1A 1DO2A 1H3NA 4F1KA 4MYDA 1QO7A 3EUEA 3L8CA 2P1RA 3EZNA 4XCXA 4JB2A 2GN6A 2ZWIA 1LRLA 5G0WA 3AEQA 3DGEC 3IT3A 4F5DA 5FL7D 1TU4A 1QG2A 5G3YA 3WISA 1O57A 4XA8A 2QSZA 2RGUA 2XB9A 3H86A 3UB2A 4FFWA 4GI1A 3GB9A 3OF5A 1KJ8A 1BJKA 4E51A 3GFQA 4KOAA 5MGBA 1J42A 3MD9A 4HEA1 1U7TA 4ZQFA 5EGSA 3USZA 2TMDA 1IBMB 1K0FA 2QU8A 1UBMS 4HJXA 3H3JA 4P84A 4R41A 5EP4A 4AJ9A 3OX2A 4JYMA 5KYGA 4RCZA 3NP7A 2GLXA 2IKQA 1H05A 1YVEI 3GC6A 3T7SA 3VTZA 4D3XA 4E70A 1DINA 3AETB 1QOPB 1I4TD 3ABZA 4NBWA 5IZCA 5FWYB 4CM9D 1E2DA 2A0XA 2DBVO 2CMDA 4QBGB 1BKSB 3BF7A 4YTEA 4LNUB 2VJQA 4DA9A 1D6SA 1EP3B 4EYQA 2RHMA 1DLIA 3EXG1 3HBFA 4BN5A 4ZQEA 3O90A 1HO3A 1MQ9A 2WWGA 1T4MA 4L3OA 3UHOA 4MYUA 1RJDA 2GM5A 2G9ZA 2WOOA 3H11A 4ZRMA 3QRWA 1JT2A 4TMFA 5G0VA 5FULA 4FYIA 4GE3A 5HZGA 1M7HA 3VA7A 4HAZA 5EWLB 1T2CA 4W5JA 2EBFX 1SOAA 2PZMA 3D2AA 3K0CA 5BQ3A 1Y5RA 1ZD1A 1LLUA 1NR5A 1C2YA 3ZGYA 1UT8A 2XMBA 3T3EA 1ZM7A 2OCAA 2I9KA 1D2NA 4DWVA 2BI7A 3ENZA 1JAIA 1CVLA 4YO7A 4NPCA 3H0CA 5IJAA 2GX6A 2CUNA 2V3CC 3OH8A 1CUGA 1L7PA 1SM4A 2VPQA 3OE7D 4YLEA 1FSGA 5JZOA 1OFHA 1GGJA 4FHFA 3RS4A 4N01A 1GT6A 5CDHA 5JY1A 4XYGA 3EASA 4JB0A 3AW8A 4KTVE 2BMDA 4TYPA 3H5WA 2P5YA 4EWLA 4AMVA 4WZ6A 2GYYA 2IW1A 2FWMX 3KTFA 4C6SA 4Z7NB 2A9JA 1U8XX 2P5UA 4JJ8A 4AUKA 4KBFA 5K9ZA 4YAWA 1ZISA 5GPBA 5IBCA 3EE6A 2O2CA 3GJ5A 4XTRA 3VAYA 5JTTA 5GIOE 2N75A 2YUIA 4KXNA 3DBVO 4EGAA 4HVAA 4MKXA 3KKOA 3C3JA 3ZDRA 5BWBA 4JI8B 2X0RA 2WHXA 3ILHA 4C06A 4UEWA 4X8MA 2W6CX 4GLFA 1YCDA 2QRZA 3X1XA 4KH1A 1IE3A 1KZ9A 2OEPA 2D7JA 3B1ZA 3VFDA 3WL8A 2I34A 2ZATA 1KGDA 1ZGBA 3ZNNA 4BO9A 3RYCA 1JHPA 1TGYA 4G4SP 3FZQA 2P27A 2YCBA 1K68A 5KMGB 3UG7A 1F48A 1T3LA 3D4NA 1KR5A 2BZ1A 2HWYA 2ZIZA 3CUWA 2NU8A 4EW1A 1AXRA 1X7WA 2B4TO 2H2DA 4G37A 1GRQA 2ZULA 1WP4A 1R3UA 4DCMA 2O06A 5EOVA 3TLMA 2IW3A 1LB1B 3BZWA 1JYFA 4XXHA 2NSHA 1WOYA 2ORYA 2QHXA 3AHCA 5K3AA 4ZI5A 4EKNB 3WAJA 3U09A 1F7VA 1M75A 5KDLA 3AF6A 1OVMA 4OQMA 1JX6A 1CDDA 1EK0A 4KIJA 4QWWA 5HF5A 4MIYA 1GZ4A 4BX2A 3VR2A 1AKRA 2DUWA 3UUFA 5CFPA 1H2HA 1VJCA 2RK6A 3MILA 2EARA 2VUTA 3MWLA 3KVYA 4D9JA 1DRWA 2J3EA 3ECSA 2BSQA 4ZEOA 4TT3A 5M04A 4I1VA 3U19A 3ETLA 4NMWA 4S0ZA 3STVA 3KWLA 1WQ1R 4EQ6B 3QMWA 4MP8A 4IIHA 4NS1A 4AUNA 1CK4A 5EG5A 5IRCD 1OASA 1QVVA 3PWSA 1G60A 3PXDA 4B4UA 3TKAA 1E9SA 1QDLB 4RTOA 3UCXA 4NNJA 2YV5A 2IYLD 4OQXA 1AKWA 4YAKA 4DDWA 4G8JA 3I61A 2N42A 3WWYA 2MJLA 2W48A 3ZDDA 1FRVA 2BGIA 1XG5A 2YFQA 1N5MA 3ND5A 5D5PA 4N3CA 5TEVA 3ZKWA 1E2QA 2I1QA 3GGJA 2J1LA 2PR7A 3O47A 1G6HA 3BCUA 3ESAA 3VPSA 2VJMB 1HE4A 4Q9HA 5IDQA 3TZHA 4L8LA 3PDIB 4D80A 3IAAA 4BLRA 3L5OA 3OQ6A 1GGFA 4PGGA 4XVRA 2JVIA 3PVCA 1HYGA 3R41A 1DBIA 3VISA 4HNTA 4PZ9A 3U7JA 2BFOA 2I1VB 2BEWB 4CTKA 1HFWA 1UDBA 1QV9A 2FGJA 1OI4A 3FOEC 2JJMA 3IXLA 3OBBA 3T3IA 1VMEA 4CU2A 3CEHA 1QO0A 4RTPA 2F43A 3B52X 2IPNA 5CAEB 3L7OA 3OKAA 4I1SA 3AR4A 1FJ2A 4M7OA 5DNAA 4KIGA 2P9CA 1YBVA 5I9SA 4GSYA 3M5CA 5FHRA 5DOVA 4BMNA 4AVYA 5DWVA 1NXTA 1TJ4A 1ZD9A 1NXXA 1T10A 4HDSB 4R1NA 3MFQA 5EE5B 1SUCA 2KPOA 1PWXA 3PNSA 3ZHTA 2HJRA 3ZOZA 3KJFA 4JJZA 4DIDA 1VJRA 1SXQA 2QG6A 4TGLA 2W2QA 3TLBA 4EYSA 3E7PA 3PXEA 5I7HA 2HRCA 1JYEA 5K8JB 3DMTA 3KZOA 1QZUA 2WHRA 2I6QA 4WIAA 4AQDA 5JBNA 1GPLA 4TTIA 3CS3A 3CQ9A 1MU0A 3FOZA 4DB4A 2WFZA 1TJPB 1UINA 1KMHB 2D1FA 2WIKA 3RRYA 1ECFA 2YFYA 4KQKA 1AOXA 5FPSA 1Y9DA 3PITA 1SU7A 2I76A 2PFSA 3QM1A