4JA2A

Structural basis of a rationally rewired protein-protein interface (rr468mutant v13p, l14i, i17m and n21v)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
121
structure length
120
Chain Sequence
b'SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 42
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ja2A00
1YS7A 3H6GA 3MIZA 1H9CA 3OLZA 1MIHA 3IDOA 1YMVA 4DN6A 4IF4A 4ZPJA 5IEJA 4KZKA 4KK4A 2WWVD 2R47A 4MAAA 1AB6A 4D6XA 4N0QA 3OMXA 1P6UA 4ML3A 1QKKA 3RVSA 2W42A 3A10A 4JB2A 3RVRA 1KRWA 5JNSA 4F12A 3KHTA 4QYMA 2MYTA 3EULA 2F8SA 4Z9AA 1MVOA 3LUHA 2MYPA 4W5TA 3LKBA 2JVKA 1JHZA 1MB0A 3LUGA 4JA2A 5F64A 2H0AA 2HPHA 3GA5A 5JNRA 1BVHA 4MQFA 3DLHA 1DBPA 2VUIB 1F51E 3CG4A 3QEMA 4LE0A 2WJWA 4LDAA 4MRMA 5FWXA 5DKFA 4Z4HA 1TLFA 1JYFA 2JVJA 2YHBA 3CU5A 3MM4A 1C0EA 4MR8A 3CNBA 3QLVA 4TN5A 3FDFA 3UK0A 1U2QA 3M9WA 4FB4A 1APBA 2AYXA 5BQ3A 2JBAA 2ZWMA 3JVDA 3IP7A 5KWSA 3KYIB 5FBKA 4F06A 1D5WA 3O74A 5KQMA 2QVGA 1NXSA 1RNLA 3I42A 2CWDA 2L19A 3F6PA 5FBHA 2I6FA 2E4WA 4G0XA 3HUUA 2FXIA 5JNUA 1M5UA 1R8JA 3H5TA 1NY5A 4WXEA 1JYEA 3LUDA 2IDMA 3NNNA 4HYEA 2NZVG 3OLYA 1DZ3A 3ROTA 3N6VA 4KPYA 4YV7A 4RY9A 5IEBA 2FMKA 2ID9A 4MR9B 1Z13A 1ZHHA 4MQEB 4PYRA 1F4VA 4ZMRA 3H5IA 4MR7A 4RY8A 5EWLB 4YRZA 4RK4A 1QO0A 5TPZA 1WETA 3A0UA 4HNRA 2XDYA 3I09A 3RVMA 4B09A 1NATA 2E4ZA 1U2PA 3LUCA 4YP9A 1JFTA 2E4YA 3ILYA 4N0PA 4HNSA 5IUKC 4WWHA 4IMJB 4FE4A 4JOQA 4E7OA 3UKJA 3CTPA 4H3HB 1ZESA 1ZN2A 4Z4EA 2ZAYA 2PL9A 2YHAA 4Z4CA 1EHCA 3RH0A 1SXGA 1ZDMA 4RS3A 5DCLA 4MS4B 2JRLA 4EY3A 5EWJB 2AYZA 5TQ0A 3OM0A 3OM1A 4XXHA 2FSPA 3MF4A 2RJNA 4MLDA 4PEVA 1ZGZA 2QU7A 3F73A 4Z0NA 1K66A 3HCWA 3OO1A 3VNAA 3G1WA 5CHYA 4MS3B 1DBWA 3F6CA 3NHMA 3GRCA 3BBLA 2FQXA 9ABPA 3RVOA 3KKEA 4O5AA 4D6YA 5I4CA 2PE5A 5KC8A 4Z4GA 3A0RB 3O1IC 3H5VA 2F8TA 2RDMA 3NHZA 3OLVA 3KJXA 3EQZA 2HQRA 2IOYA 2OENG 4DADA 2GKGA 2WY2D 5JNWA 3O75A 4IILA 2QZJA 4JP1A 5HQJA 3GL9A 3DLBA 2RJOA 4F3TA 4ETNA 1Z26A 4NV3A 4QICA 3H1GA 1U8TA 4RSMA 2J48A 3LMKA 1C4WA 1GUDA 1AB5A 3SY8A 3LOPA 3O1JC 2IPNA 2NZUG 3HZHA 2WJAA 5DGCA 3H1FA 4JB0A 3HJFA 1KGSA 4W5NA 3QLUA 1ISRA 1USKA 2WMYA 3H75A 1CHNA 2LP4Y 1EFAA 1QMPA 2P9HA 3GV0A 5EWMA 2NT3A 3QX9A 1ABFA 1YMUA 1PNTA 2O20A 3E3MA 2IPMA 3DZDA 4GNRA 4L4UA 3RVPA 5DLEA 1LK0A 1U0SY 1XHEA 2DRIA 2LUOA 3D02A 4NQRA 3IP9A 4P1ZA 4YLEA 5IBQA 1L5YA 1SRRA 2M98A 3CKMA 3FFTA 4IMIB 5GOTA 1YTUA 4W5OA 2LPMA 1YS6A 4ZMSA 3JS5A 4G0PA 2A9OA 3DBIA 1E6MA 4Q6WA 3KLNA 2MYNA 5JS2A 3HDGA 2FW0A 1PHRA 1QP7A 2P4UA 3C6QA 3N0WA 1CYEA 3HXMA 1EWTA 4MQFB 3T6KA 3SM9A 3N75A 4G97A 3RQIA 1BAPA 2B4AA 4G0QA 4MRMB 5FWXB 3SQNA 5KC9A 2MSKA 1HEYA 2QW1A 2PUBA 2JCGA 1ZH4A 4OLBA 3KSMA 3NNSA 1NXXA 3N8IA 3CHYA 3JTEA 2NUBA 4L85A 8ABPA 4LRQA 3TB6A 4WXMA 3BRSA 1VPWA 5TQ2B 1KRXA 3DGEC 1TJYA 1W25A 2E4UA 4ETMA 2PAFA 2L18A 4Q6BA 2LBPA 2PUEA 3BILA 1ISSA 3Q7SA 4KREA 1OXBB 1ABEA 1DG9A 3OQOA 5KQPA 4EGSA 1Y1LA 1EWVA 1JDPA 5C5CA 1DCMA 3H5OA 4ETIA 5T7BA 5TPWA 5JNTA 3LKVA 1IIBA 4Z99A 5FWYB 4Z4IA 1JWLA 2PMCA 1YVUA 4RZSA 4ZYLA 4GPAA 1GLGA 2FMIA 3I5AA 1M5TA 4YWHA 4CBVA 2BGGA 1JX6A 1GUBA 1LBHA 3MYYA 4KV7A 4MR7B 1CEYA 4RU1A 2V0NA 3TD9A 3SAJA 3QLTA 2FEWB 3BREA 1SXHA 3H5WA 3L6UA 4KMRA 1ZH2A 1Z25A 1MAVA 3Q7RA 3S99A 1NXOA 2IYNA 1QPZA 1GCAA 3O2SB 1P8AA 5TQJA 1ZITA 3HDVA 3GYBA 3LTEA 4NICA 1JBEA 1YK0A 3MQ4A 4S04A 5KQLA 2FQWA 3H6HA 4MQEA 4EYOA 3O2QB 2FEPA 4G0OA 2QV0A 4G0YA 2VYCA 1PEYA 1P2FA 1QQAA 4YGXB 3FFWA 5CNJA 3H1EA 4KQCA 7ABPA 2VK2A 2E4XA 5B3JC 3NNDA 5TQ0B 1DJMA 4N47A 3ROFA 4O1IA 1NXTA 3E61A 5KQGA 1VRVA 3KYJB 1J56A 1ZAYA 4IGAA 4MS1B 2QR3A 4RXTA 5PNTA 3KS9A 1NXWA 1TVMA 2FMFA 2JK1A 2A9RA 1Z17A 4TLLB 3Q41A 3RVQA 2RGYA 5BRAA 1T34A 3LFTA 5KI6A 2X7XA 4S05A 3OMWA 3KLOA 5D2CA 1U04A 3URMA 1BDJA 1Z12A 2M1ZA 3BRQA 2MSWA 1Z2EA 4RK0A 1P6QA 3QLUC 1VLZA 4JAVC 3D8UA 4UHKA 2QXYA 4G86A 4Y9TA 1JLKA 3Q9SA 4YCSA 1Z15A 4RK7A 5HSGA 3MMNA 3C3MA 3L49A 1RZRA 3R0JA 1TMYA 4PZ0A 4KNYA 2FQYA 1USGA 3TX6A 1BDIA 5CNIA 1SD5A 4XAQA 3C3KA 2E4VA 1E6KA 1QO0D 5TPZD 5E3JA 1E2BA 3T8YA 3RVNA 1YK1A 3HV2A 1D1PA 3O1HB 5IX8A 1LJUA 2QSJA 4RK6A 2GX6A 2FVYA 3RVKA 3CRNA 3TMYA 1FFSA 1M2EA 4O1HA 3K4HA 5ABPA 1JFSA 1JL3A 3QELA 4PE5B 3IPCA 3EAFA 1DP4A 4JASB 2QVCA 1W9HA 3IP6A 1NXVA 3T95A 4RXMA 3RVLA 4G0ZA 5IC5A 2PUAA 3QEKA 3HEBA 3QLVC 4RKRA 3GBPA 3H5LA 3LUJA 3P9YA 1ZGGA 2PJUA 2H3HA 2FKAA 3HUTA 2R25B 3C3WA 3N0XA 2OQRA 3QEMB 2R4QA 5IUJC 1DRKA 1GCGA 2IKSA 3M6MD 3G85A 4YS6A 1BDHA 1XWWA 2TMYA 6ABPA 4MR8B 1M2FA 1BA2A 4XFKA 4PICA 3LUAA 3VNBA 1PUXA 5C5EA 3HM9A 1DCKA 4RV5A 2JBAB 4LE1A 3OLWA 3KTOA 1Z2DA 4G0MA 1S8NA 1EAYA 3DGFC 4H60A 4M88A 4RKQA 3RVJA 4XASA 4N41A 4F11A 4ZJPA 5HKOA 5JNVA 4F8JA 4EVRA 2A9PA 1D4ZA 4RK5A 4RK1A 2HQBA 4P98A 4NCAA 2HQOA 3EGCA 1FQWA 1RZRD 3QK7A 1RXIA 2IPLA 3B2NA 1NXPA 1QP4A 4LE2A 1JH9A 4XLTA 4RXUA 6CHYA 3Q15C 1D2AA 1ZVVA 3IP5A 5TPWB 2A9QA 1D1QA 1DBQA 3MA0A 1EWKA 3O21A 3EJWA 1Z18A 5IUNC 5TQ2A 3GT7A 1VKRA 3FGZA 1TM2A 5CNKA 3OLXA 4DQDA 5ED4A 2PLNA 3SNKA 5T3YA 2PUGA 1DCFA 1JFVA 2FN8A 3CFYA 2KYRA 3LUFA 1FSPA 1KMIY 4Z9BA 1A0OA 4KFCA 2GI4A 4KQ9A 1A2OA 2GBPA 5FWYA 4W5RA 3A3KA 4LX8A 3TO5A 4MR9A 3T38A 4WZZA 3GBVA 4LZLA 1PNRA 3OO0A 2CHEA 2HSGA 1MB3A 2L2QA 5HM6A 3EDCA 5EWLA 2R48A 4YO7A 2FN9A 1FFGA 2PL1A 3N0RA 4OTZA 2ID7A 2JB9A 3CS3A 4EYKA 3HO1A 1UDRA 4N76A 3C97A 1E6LA 4EYQA 2PUFA 4EYGA 1Z16A 1L5ZA 5BR1A 4W5QA 4Q7EA 4RWEA 1DC7A 3HSYA 1YIOA 4IRXA 3JY6A 3SG0A 2B1JA 4MGEA 4MLCA 4OG2A 4WT7A 1FFWA 2MSLA 3KG2A 3W9SA 1LBIA 1URPA 4N03A 1XHFA 2Q5CA 1RXEA 4WUTA 4TMYA 2FMHA 2LIVA 5DTEA 4KRFA 4MS4A 2WRZA 5EWJA 1K68A 1QNLA 5IULC 1DRJA 2WB4A 4H3KB 1DC8A 3QX8A 3CG0A 4RY0A 3HK2A 5BRJA 3K9CA 3F7NA 2PUCA 2JVIA 1QQBA 2CD7A 4MYRA 4EVQA 2GWRA 3Q7TA 4MS3A 4MS1A 4KK3A 4OBBA 1USIA 4HNQA 4LDZA 3OQNA 3JPWA 4FE7A 4E7PA 1JDNA 2HJ9A 2FTKE 4D74A 5B3JA 3FFXA 1LJLA 3HS3A 3JPYA 4EVSA 3NBMA 3EODA 4UHJA 4YR7A 2MYUA 4RDCA 3LUKA 2NT4A 1QP0A 2L17A 3M9XA 4XARA 2VUHB 3JVIA 5EWMB 3N53A 1PEAA 2PUDA 2CHFA 3HVRA 3GWGA 3IPAA 3CZCA 3FMVA 3OQMA 3QELB 1OXKB 3I45A 4KVFA 4QYWA 3CZ5A 4Z4FA 4TLMB 4OLAA 3UUGA 3CLKA 3ILHA 1JF8A 2FEKA 2FLWA 2IPAB 3KCNA 4MPTA 4QPJC 4EUKA 2N9UA 2FLKA 1ZY2A 1SXIA 1NTRA 1I3CA 1A04A 2PKXA 3O2JA 4OATA 1B00A 5CNMA 4NCBA 5GQSA 3EQ2A 1RPJA 5JS1A 5TE9A
chains in the Genus database with same CATH superfamily
3LY7A 1WA5A 2BJWA 4Q4HA 1KVRA 3VHLB 3FWYA 2XTJA 1I30A 3JQ7A 3UT5B 4UKDA 5GZ6A 3BJIC 5E6SA 1XCOA 1GGJA 1XYGA 4NENA 2J6HA 2EVWX 4DRZA 1AB6A 5FDFA 3W5UA 3JAMA 1G64A 2YRWA 5GGYA 3RVSA 3RAEC 1OBCA 3DJYA 4HUTA 2P5UA 4JB2A 1ENYA 2P2ZA 4EFNA 3F90A 4LOLA 3EULA 3UA4A 3QPBA 5C8ZA 3BL8A 3MWKA 3BEDA 1BXRA 2IVFA 2OQ2A 4LG1A 2CNLA 4QUHA 1ISPA 2BCGY 3TPCA 2A94A 3TTVA 2OO7A 3MINB 5KINB 3U7EB 2X9LA 1OTHA 2PQ2A 5CJJA 2CL5A 4IYRA 4AURA 4OIFA 3FBWA 3NW9A 2VUIB 3QEMA 3DMTA 3G8BA 1RVV1 3HJBA 1YHZA 2CXNA 2FSVA 2UYQA 1HDZA 3MBKA 2DYKA 2IZ0A 4HQKA 3OSUA 4RJLA 3UMCA 5JG7A 1U3GA 1J0AA 5CGZA 4XQGA 3M5CA 3DQQA 4QE3A 3KZ1E 3GLQA 5REQB 2CXUA 2AYXA 3S28A 1X19A 3RIMA 4C14A 2FJPA 4F9TA 1SVIA 5KWSA 4DUPA 1EXNA 2RE8A 5D84A 3RROA 3EE6A 2JG3A 1G60A 1WHSB 3GRRA 2GPYA 3Q9NA 1TEHA 2A1TS 4MV5A 5LMUB 3CVYA 1N33B 1TZ2A 3QYFA 4Q9NA 1A88A 1GDDA 1XEXA 2FFRA 3E4CA 5YASA 5IH3A 2RG1A 3SFTA 1XDZA 3SZOA 4Y6OA 5FJJA 4ARIA 1A1VA 4V2UA 2ZJFA 2QNRA 1CERA 1YJ8A 1G2IA 1M72A 4KPYA 1P7WA 1QIJA 1VHTA 1VP9A 2PGAA 1OXSC 2XMDA 3G13A 3DL7A 4H2DA 4MICA 4ZAYA 4XA8A 1TKAA 1ZK2A 3NONA 1Z56C 4QXAA 2WSMA 1TO1E 2H4FA 2IIPA 4UHEA 2B5VA 2MIIA 1YQXA 3KOYA 4FR0A 3G5UA 4CIVA 3WYEA 1X70A 4YRSA 5A4IS 4LF7B 3ZLJA 2R87A 3ZIUA 1XNJA 4E0BA 3UFXA 1NMZA 1UPUA 4JYCA 1JWBB 5KVVA 1ZL2A 3K0CA 5ALLA 3WG9A 1E9RA 4YQZA 1OIWA 4JQCA 3CEJA 1LW7A 4FLEA 4BP3A 2JJ1A 2H29A 1CY7A 1S6YA 1VE5A 1C9JA 4PHCA 2ZVDA 3I3OA 4WK6A 5LQCA 1AKWA 4C9BA 2A0KA 1EFLA 4JOQA 5LMNB 3A1NA 1Q0ZA 3GEGA 2WV7A 1COWD 2XTMA 2FZEA 1CR1A 3TLXA 5JSZA 4Z4CA 2VN8A 3AP1A 1Z8HA 4UULA 1V8DA 2BM1A 2H0RA 3M5DA 1M1YE 1ZDMA 4H77A 1J0DA 3HVUA 5DXJA 3TINA 1MQAA 1GAJA 2Z8ZA 5DE3A 1VRCA 1FC0A 4QYTA 3KFVA 3UPDA 8OHMA 1N2BA 1TT5A 3DAYA 4Q4JA 4Q7QA 1E3LA 1KI6B 1RXSA 2HO5A 3ZU4A 2HEGA 4GMDA 4DR6B 3AHFA 2OOKA 1PFWA 4QHYA 1JR2A 1GZ7A 1KQNA 5LXTB 1I4OA 1UXHA 1KP9A 3ORSA 1VIVA 3DVRX 3L7CA 5FQNA 2IPOA 4ENSA 1AMUA 3D8NA 3CB4A 5EFOA 5DHFA 4O4HF 5FJIA 2ZRIA 4EPXA 1U7TA 1J25A 3EEIA 3TZLA 1PR3A 2GKSA 5BWLA 2B9EA 2P3LA 4Q1FA 3A0RB 1XTUA 1YCDA 2ZB8A 3EZNA 2DBYA 3O1IC 4QXRA 2H6EA 2IITA 3O0TA 5DT2A 2F8TA 5K3DA 1UWCA 2IOYA 3IQEA 4GBMA 2BN4A 4TYQA 2O14A 4KFTA 3H5AA 3UC9A 4HAZA 4QU8A 2YVLA 1WSDA 2C9BA 1MCZA 2PXAA 4NBKA 1LD3A 4KSBA 4TMVA 2ZJ2A 3KYDA 5DXFA 2Y93A 3IPLA 4RZ2A 2GOYA 2OV2A 3C7AA 4M9RA 1XB2A 4TTAA 4X94A 3V8VA 5CFNA 4KE6A 2RBEA 1P0CA 1Y9EA 3KTDA 5BP7A 2QP3A 2Z5GA 5T8KC 2IPNA 2MJLA 3VZSA 3UV7A 1CQWA 2ZUUA 4E5MA 4J6EA 1ECPA 1D4AA 1GR0A 2BF7A 2I87A 2I4IA 4M1KA 3W5JA 3AUYA 3ZJTA 4W5NA 3TZCA 2Q21A 1H0HA 2NSHA 2LP4Y 4ZVVA 1I3KA 1N25A 2JIRA 2P68A 2ZS9A 1PR6A 4MW4A 1J8YF 3FZQA 1IN7A 1P17A 5EMNA 2NT3A 1T3SA 1E1YA 1N7GA 1PZNA 4BO8A 3MXOA 4A2WA 4C21A 3E27A 3GP5A 1CUIA 4LMPA 4G8DA 1XNHA 5AVXA 4DHWA 3D02A 3QWAA 2FX2A 3IT2A 3IP9A 3LRPA 1SBQA 3AXSA 1OWNA 2Q62A 3RSLA 1S9DA 2E49A 4GZ5A 4IAOA 4TWJA 2I99A 2XH8A 3BPSA 3EK2A 4F9EA 4RTKA 1V4NA 1M2OA 3SBDA 1AN0A 2JZNA 3PLNA 3KLNA 2E48A 4G5YA 3AY3A 3R7WB 2N75A 4BBJA 3O92A 1UWKA 4A91A 4KKVA 5KMGA 1YVDA 3CLRD 3KUUA 3ZVMA 1ZFNA 1II9A 5FWXB 2GYWA 2QM3A 1YAHA 3DMPA 4KI0A 2FPIA 4PWZA 4OAQA 4RIFA 1JW9B 3B48A 1I01A 4G41A 2FUKA 3RIGA 5C1IA 2OAGA 1V5GA 1UJ2A 2ZRLA 3H1PA 4XSGA 3ZY5A 1QG2A 3ZD6A 4IKPA 4IWXA 1GDHA 1KI2A 4HX5A 2FOXA 5AW1A 3BSSA 1MZVA 1OX4A 2ILTA 2E4UA 2WAMA 3GB9A 1W30A 3SZGA 2E1PA 3QWBA 2IU4A 4JLBA 4BFCA 1DKNA 4L3OA 4XQ9A 3D4OA 5JALA 2R62A 4KSCA 1RWWA 1HMPA 2W6NA 5JRDS 2PUEA 3QFFA 3L05A 2Z30A 1E8NA 4K9SA 3SHQA 1NUQA 3KU1A 4OL9A 1I36A 2G71A 4MA4A 5HF8A 4OXQA 4I1IA 2WSBA 5BT9A 3VHXB 5K3BA 2EIXA 2EBHX 2FWAA 5DBGA 4B6RA 1X1QA 5IDVA 3ANTA 4NYMQ 1SQSA 4LBWA 1L1FA 1TQ2A 1NE7A 5TB5A 4MV0A 4EI9A 3MC1A 5F5NA 1XVLA 2GVNA 4R1MA 4EG6A 1EXMA 2EW8A 2F1KA 4JR2A 1B76A 5K3CA 1ZUIA 3D6VA 3UMVA 4N8DA 3J7TA 2HV8A 2FZWA 2Q99A 4RZSA 1LUAA 2XTNA 1TCVA 1GLGA 4IHAA 3DAOA 5EOVA 4EL0A 4RVCA 2VA8A 4I4TB 5K09A 1F8FA 3LVBA 3CH4B 1XMQB 1M73E 1XPJA 2QU8A 1JFFA 4RU1A 5MF6A 5IKEA 4FT4A 1L7VC 1NR7A 1Y5IA 3ROGA 1ZH2A 5KNLA 1GTVA 1QK3A 3SS9X 3ZE7A 2GTIA 2P2NA 3LO5A 3G0BA 3O2SB 3RT1A 2IS4A 1V47A 5IZCA 2ECOA 2QN8A 2WIAA 2CY0A 1Y6RA 1JBEA 1NQXA 2HLDD 2PMFA 3AM3A 2BFOA 2P2YA 4AUKA 2P77A 3QE3A 1Y4SA 1PW7A 2C31A 2JZCA 4TXHA 3FYHA 3R77A 3REGA 4HNTA 5LD2B 1SG6A 1W19A 2G4CA 1A50B 1GPNA 2F3SA 3M6IA 3ZXSA 1JQ5A 4W7HA 1CK4A 1PEKE 5LUAA 3CR3C 3FHOA 1UADA 5ITSA 4W82A 3E61A 4RJJA 1YI0A 2IE0A 1ZAYA 2VQDA 1XZHA 3IHLA 4BAGA 2QR3A 2QNBA 3BSYA 3WBJA 3IVGA 5B6PA 1RM5A 3ECSA 5A2QA 3U5ZB 2C5SA 2WFLA 3NFYA 1KJ9A 3PCXA 3T54A 3T7KA 3V80A 4KVGA 2OB1A 3WQSB 3I1IA 1T34A 2WUDA 3ZJYA 4F86A 2R6JA 3CPSA 2X9GA 1UP7A 3LFTA 4GICA 1RYBA 2PCLA 1G7SA 2ISQA 3C3PA 4IJMA 4L50A 4UXJA 1ZUD1 1ZL0A 2B36A 1KZ1A 1M1UA 4ONEA 1C3EA 3X1ZA 1Z2EA 4D5EA 5IU6A 4K9RA 1TX4B 1EX9A 4Y3UA 3WWPA 1FLDA 5K0EA 1A8QA 5IABA 3H2BA 1R6DA 3EIFA 3ELDA 5JCJA 5DTMA 2ZPUA 3MD0A 4NZNA 4RNDB 5HFAA 4YV1A 1FMTA 5KYXA 3LIPA 5CLQA 2V45A 1UBSB 2HU5A 1X87A 4O2BB 3OIYA 3V4FA 4OQZA 2B25A 1DHRA 1Z34A 1SAYA 3WZMA 4KO4S 4E46A 4HY3A 1GPDG 5CNIA 1SD5A 4XAQA 4D8UA 5HIAA 4YT4A 3EXFA 2OZPA 3PDHA 2QDKA 3G82C 4BNDB 4LDNA 3I30X 4YN3A 3KQLA 3O1HB 3QFSA 2D2FA 2QSJA 4BXOB 3LLVA 2OWEA 4KAJA 2AOWA 5AW7A 1OXMA 1TL7C 4O1HA 1CLUA 1MIOB 2B2NA 3IUSA 1B43A 2V7GA 4B6PA 4BE9A 3TEJA 3LFHA 2GUGA 3IPCA 2GN4A 3CLVA 1ESDA 3UXEA 3ZJ4A 1F4PA 3Q6IA 4BMVA 4P58A 1I3NA 2EZ8A 5KEIA 3LHDA 1YCHA 3CM0A 4IDOA 4M6WA 5K3SA 2JIOA 4Z7QB 2B8EA 5I48A 1QU2A 1VPTA 1E7RA 4KHZA 2J5QA 3SU8A 3BMQA 1PS0A 1K7XB 1TYEB 4NI5A 4EW6A 1G20E 3AVOA 1UAAA 2H1SA 4WCVA 1W5FA 3RUHA 1BMTA 1T35A 3OQPA 3WK8A 1DCTA 4C06A 4ZVNA 3QUAA 4YIKA 3DB1A 4L4YA 3L02A 1P4HA 3RYCA 3WGZA 1P4GA 5ESXA 4GKKB 2XXJA 4MPJA 2ZTUA 3QU4A 2R7NA 3GY0A 3OIUA 3FLEA 2JD1A 4ZXPA 2AI1A 4E4YA 2C7PA 4L5IA 5B1SA 3IJPA 3PXDA 2X9QA 3NBKA 4UAUA 1NI3A 5I9TA 2ON6A 1EGQA 3K1JA 3DZHA 3KTOA 4L02A 5F76A 4D0NA 1EAYA 1NYLA 2D2VA 2E0IA 2ZCVA 3EPRA 3F3MA 4LV8B 5C18A 4GSKA 1WR8A 4JI1B 3IB6A 3A2NA 2GM9A 4GUAA 4QO7A 4DLYA 2EYUA 3R20A 1R4NA 1ZBDA 2FPPB 4L5BA 4URYR 1BQEA 4NCAA 1J21A 1XJCA 2AT1A 4XDZA 1QORA 1P45A 3EGCA 3DV0B 1U7WA 4HNVA 1GEEA 1EUCB 3WYAA 4E2WA 1YJXA 1U6JA 1ZMXA 4UTRA 1HUQA 1ZINA 1IJKA 1DAMA 3AI1A 3P9ZA 3FYDA 3IP5A 5CVJA 1JAXA 1K2VN 1EWKA 3TKLA 2GUWA 1NMQA 2P9QA 3PI6A 4PHHA 2PZLA 3I58A 3S2YA 4RTNA 3VC2A 4BQPA 1UIRA 1OT5A 2VT7A 3FETA 4ILEA 1QAMA 4RPCA 5ADVA 5IM4F 2NU9A 1WU7A 2I62A 4HPXB 1ZUWA 3GJ5A 4YBRA 4YJKA 5E2BA 2CW5A 2AX4A 5AQ1A 2RI1A 3GDFA 2GYVA 3CF4A 1DCFA 1GQ2A 4DY4A 2CJPA 3T99A 1RKVA 1RCFA 2QRMA 121PA 1U1EA 2QYSA 3WWOA 5BYAA 4PSKA 1M2VB 1U4SA 3SDZA 3ZNNA 3LUFA 4AMZA 4NBLA 2XVAA 3LYLA 3UW3A 1R3DA 4DCSA 5JAHA 1TQ6A 1D2MA 1XTSA 3GFPA 3QKIA 2BRUC 1OH7A 2XB2A 1EUDB 1Y3HA 4QDZA 5KVSA 3TUJC 3MTDA 3LTNC 4F1KA 3WRXC 3B53X 3FSGD 2C84A 2H4JA 2R8EA 3HUDA 1GJRA 4LRSB 1VJ1A 2XOKA 3RRXA 4B2LA 1W1UA 1ZM3A 2XY4A 2BFMA 3R5JA 1WKCA 3UQYS 4CKEA 4WBNA 3JRNA 4DLXA 1IL0A 1FTWA 3LD9A 3RTEA 4FNAA 4TPKA 2CHEA 1J90A 1GGVA 1U6KA 1WNTA 2DF8A 1E2PA 4MULA 3EDCA 5FFMA 1YUMA 3U6BA 3HO1A 4ZJZA 3CEMA 3L1JA 2VRWA 2WT8A 4FN4A 5J5CA 3ZCTA 2GM4A 3JAKA 1SQGA 3GN1A 3WKCA 2QZ4A 4QRIA 4MOWA 3C74A 3SDBA 3VR3A 3O8LA 2FPGA 1KU6A 2QT9A 3AR7A 3IFSA 3ZE8A 4AJHA 5A3RA 5LQAA 1U81A 2O2YA 4UM9B 1JWAB 2AC2A 1ZHOA 1DQNA 5CXQA 1XU7A 4O4JA 4G4GA 1M74A 1RXEA 5JFGA 4EZIA 3DZJA 1CDZA 5COAA 5MN6A 3P9CA 1SOVA 1YD7A 5AW2A 1U28C 3TTSA 1DRVA 4X91A 2QX9A 2ZP1A 5G1OA 5B6IA 4PLTA 3DP9A 5SYMA 3ZDDA 5BRJA 2RC6A 3OQJA 3GLFE 1KMHA 4D5GA 1BX0A 4OYHA 3BB4A 2CCGA 2X23A 2CXSA 2OHXA 2P5YA 2IW1A 2WKSA 3CXUA 3LBFA 2FV8A 3GBSA 4HGNA 1DU4A 3T95A 2R2AA 3ZWYA 1A8UA 3RVDA 1WMDA 4ZEVA 1O2DA 1GRRA 1QJ4A 5I4IA 3A14A 1VIAA 2BJVA 2QW0X 1OU4A 3DNPA 1Z4QA 3ZU5A 4CL3A 4QZVA 4QVIA 1RXWA 5D5PA 1KEPA 3I05A 1JPJA 3R41A 3S40A 4L6CA 1YRQA 1JV2B 4W1QA 2JHFA 4HLNA 4Y2SA 3O9ZA 3RV4A 3TQRA 1H2HA 1Z4MA 1RCUA 2P3SA 3B3GA 1X1DA 4ZIRA 4ZYTA 4FEGA 2PD3A 4WZAB 3CXRA 2XZOA 1PV1A 1GL3A 1VBNA 1JKJA 2NXEA 2ZUSA 4EPRA 3TZEA 5MFPA 3IAUA 3JX9A 4R2XA 2IPAB 3A6JA 3THRA 4ZAZA 3T3EA 1MOQA 2G8NA 3V3KA 1ZY2A 1QIDA 3G9XA 3IKVA 4UXHA 4ARAA 2UXDB 3OZWA 1HG1A 5CFOA 2KLHA 2OM6A 3PHLA 1B00A 4CI9A 3TGPA 2X1LA 5JS1A 1RPJA 2B0CA 1EK6A 2GA8A 1LPOA 1FFBA 3EFEA 1J2RA 4EDHA 1R00A 2AI2A 2D5AA 5IYZA 1KI9A 3BZBA 2DLDA 1A7KA 1BEEA 1GL7A 1FNBA 1DE0A 1I7PA 5G0UA 1AKMA 5EKDA 3RTBA 1QKKA 1WUIS 4JSYA 3QE4A 5KHAA 1HDRA 1JSRA 1QSGA 4H4CA 1M6VB 4C7JA 1TCUA 2V7UA 4DJFC 1PQ4A 3UXHA 3K0AB 2YWGA 1JR3E 2W37A 4WECA 5B1YA 3QPAA 1WU8A 4JC0A 2UZ0A 1GGFA 3TIXB 4IJQA 3VR5D 3WZ2A 3HB9A 1MEEA 1Z2CA 4OHYA 1BVHA 3I6IA 4RHCA 4II7A 4L5AA 3AZPA 3KQSA 2RH4A 1N8SA 4I19A 4ZVLA 2XKBA 1N4DA 3T7AA 3BHIA 4ZZ2A 1TLFA 3MM4A 3TVTA 2A33A 3FSRA 3PUXA 5F4ZA 3ZW7A 1ESCA 2C82A 1FRFS 1P81A 2H2HA 3M6VA 3NC0C 3NHUA 4MX8A 1EZ1A 1T0UA 2FUCA 4JBLA 1L5HB 1Q0RA 1QM5A 4MP6A 1NPTO 3A6EA 3HZOA 1D5WA 4TZ6A 4M7RA 5C7YA 1GZUA 4M0DA 4YRKA 5C1DA 1ZRNA 5MFZA 4MUIA 3K9HA 1Z6TA 3N0TA 4DQLA 1XD8A 3HJNA 4KL8S 1OTYA 4YAJA 1M5UA 1T0BA 3ULKA 4W7IA 3H5TA 5KAMA 2JATA 1U3TA 1VPVA 2I78A 2V7BA 1RHMA 2KJQA 2J41A 4R2JA 5I7VA 5JTTA 4X5OA 4KN6A 3GIDA 2OR3A 2DFNA 1Z4KA 3G59A 2JCSA 2KHZA 3ESBA 4FHEA 5JMPA 2QN7A 1DFIA 5KX5F 1N2XA 1KDPA 4EW3A 1HLDA 1NBAA 1OBFO 2AIRA 1XE3A 3EPPA 1VE3A 2YIJA 2P5SA 5ICEA 3T94A 3ISTA 2GETA 4ZMRA 4FWBA 3UCEA 5JASA 3Q8LA 4FFBB 3K9WA 1PT8A 4URWR 2XD4A 1UDWA 3AHDA 4DSZA 1VYHA 1PCXA 4HS9A 4N5MA 3OIDA 2PUHA 4IDHA 1QHYA 4AZ0A 1VMKA 4PNPA 5K03A 3ZWOA 2BTQA 2WU3A 4P33A 4DT1A 5FIUA 2GNPA 1IDOA 2ROQA 3LP8A 3KEMA 1JLSA 4DKXA 4Q1BA 4V1CI 3H8SA 5HIIA 4OGLA 1YVEI 5CT5A 1TTPB 1JVNA 3OPMA 1CZOA 3RS8A 3TZKA 4ZQHA 3SF8A 4MS4B 1BFKA 5TQ0A 2AYZA 1PR5A 3LY5A 5GAJA 3MF4A 5HFNA 4I4LA 2BI8A 3X1DA 1EFRD 1UBKS 4PAQA 3IOYA 3ZDRA 3K6RA 5EJ7A 3G2HA 1A96A 1VCIA 4Q9DA 2O8FA 4Q7KA 2ZIEA 1A69A 1A9YA 1TYCA 2P2DA 2W5UA 4KNWA 3AV0B 2V59A 5MHTA 2PEZA 1KI7A 5A5DA 2FQXA 1ZJJA 4M3NA 4A0QA 9ABPA 2VHEA 3D4NA 3WLQA 1V25A 2CK3D 1I51A 2PGOA 4TYMA 1OLXA 3IA7A 3ZD7A 4PLGA 3ESXA 3OLVA 4N4AA 4AL4A 1I6LA 1Y4ZA 2GD1O 2KM1A 5AM0A 1VP3A 2HQRA 3G68A 3BZUA 2WF9A 3REFA 2P75A 2ZLBA 2CT8A 2GN2A 4QHTA 5JAIA 1E9AA 1U7OA 4IILA 4KGZA 4Y9SA 4ZI3A 1OREA 1RS0A 4K03A 5ALWA 5C31A 2XA2A 1ZD4A 2AK3A 2YVAA 2IV2X 3BCUA 1U4OA 4AY4A 1RKBA 4Q4LA 1SQ5A 4MUXA 1AB5A 1U28A 1QGOA 4DLUA 2QAGB 3NP7A 3HZHA 4RABA 4S35A 2WJAA 3NHYA 3LPNA 1Z4PX 3QLUA 2RARA 5D3QA 1USKA 2BEJA 3RTGA 2WHQA 2YRFA 2PSEA 1P5ZB 2V9PA 4I55B 4L4XA 1X1AA 3GV0A 3GZ4A 3F47A 2YHUA 4CLRB 4BCCA 1EFPB 1NVBA 1RR6A 4YJFB 4Z1MA 3FCYA 4P0QB 3PXEA 2HSEA 3WHLA 4GNRA 3L92A 1KJ8A 2XE7A 4ZZ3A 2R65A 2I3AA 5DI3A 2DRIA 3FPKA 3TQTA 5TS3A 1MO4A 3F6YA 1KI3A 2M98A 1BX1A 3G5TA 1BVUA 521PA 1L8OA 2Z3ZA 1W36D 2YJ4A 1K06A 1KMQA 1SQ6A 4PVDA 4TT8A 2QPOA 5HK9A 3UMMA 2H65A 2BJHA 1ZSNA 1GRCA 4BVGA 3T6KA 1Q74A 1C30B 1V4BA 1U0HC 2QN1A 1KZ7B 1BIFA 3DTVD 1C3LA 4MRMB 2JLZA 5K6TA 1KOGA 3ZH9B 4FOOA 5CYFA 1RQRA 2QP4A 3BK2A 1FW8A 3B6IA 3GJZA 3L79A 1LS6A 3BWYA 1L4BA 1JU4A 3DE4X 4L85A 3ZG6A 4DBZA 2ACVA 1HM5A 4U7TB 1CQXA 2NAFA 2QD1A 4YRPA 4CIWA 4HI0E 5FA8A 3Q10A 3MINA 1KE1A 4W4TA 1L7MA 4BP9A 2H5EA 2Q46A 1K6JA 2L18A 1E1KA 4CQMB 4B80A 4P2GA 5LVAA 4BNHA 1T3LA 2PH3A 3GRUA 3GMIA 3LYHA 3NVMB 1I10A 5ENZA 1XZDA 2ZSFA 2JFUA 2BKUA 1PV2A 2DPHA 3OIGA 4XW2A 1N2OA 5REQA 4NE2A 2OGWA 1SHUX 5IKXA 1IIBA 1PGNA 4EM6A 3B6KA 1UUFA 1KFCB 4NYJQ 4FDUA 2PEYA 5HCNA 3ZGVA 2Q8NA 2FMIA 3H65A 1HV8A 3BDVA 4KV7A 1QG6A 2Q8PA 3WGTA 3EFOA 5LD2C 4L7QA 2EL7A 2V0NA 1Z0IA 1XCJA 3H6KA 3D8TA 3II6X 4X6LA 2Q4BA 3D4LA 2UZ4A 2J4FA 1NXOA 3U0BA 2YV4A 3W4KA 4R9VA 3UG6A 5JBNA 1XMXA 3BE5A 4BO6A 4AY3A 5HIKA 2G1PA 3F8WA 1O5IA 3FCSB 2IYSA 4LI0A 1ES9A 3T5TA 1JHQA 3FMPB 3IEPA 4QPPA 5AP9A 3S81A 3CF2A 3GLIE 3HFJA 3IBFA 4DWJA 1UBFA 1NW4A 4JBHA 1G8SA 2CEAA 3RLFA 2FE1A 5AJYA 1D7OA 3OT1A 5EE1A 2IOQA 1E3TA 3SFVA 2G1AA 1F2UA 5BQ5A 5E38A 4FX5A 1VA5A 5A6VA 5JI3E 1XA0A 1WB5A 1ENPA 1VJ0A 1X7WB 3H9CA 1YC5A 4YGXB 3OQVA 5ALXA 4UVEA 3UW1A 2J5RA 7ABPA 3HJCA 3I4CA 1F8YA 1F8XA 2PT6A 1FUEA 2V3VA 4J7UA 3NEYA 3FOFC 3B3QA 3KVOA 4M7PA 3GOHA 1W85B 4U00A 3B1ZA 3MS2A 3AHGA 3AF6A 3ZWNA 1G2PA 4MS1B 5AJWA 4AKHA 4ABTA 2VQSA 2VTEA 4OH1A 1TM5E 4WNAB 3IO5A 2VFAA 1QCZA 1XTPA 2XQFA 3E7PA 3E9ZA 5AHOA 4B31A 3DBRB 2QL5A 2X7XA 4PQEA 1M2KA 4S05A 1SVLA 1E18A 4XQ0A 5IVPA 3PRKE 1NHGA 1TK9A 1M8KA 2V7VA 4RYLA 4QYIB 3P27A 3NBYC 3BD8A 4EO4A 2BUBA 1XQ9A 1U3CA 4HLDA 1JA1A 3MS4A 1E6CA 2I7DA 2IYAA 4G9EA 2F8MA 4RK7A 3T9BA 5CFPA 4DFDA 4EUNA 4UNIA 2I6QA 5DN6D 5FL7D 3IQZA 5MGBA 5E3JA 1MC4A 1B4DA 1WMAA 3G0GA 1WY7A 3Q7PA 4YPVA 3W90A 1ADYA 2VWGA 1QHXA 1LJUA 2G63A 3EARA 4MMYB 4TMZA 3WIUA 2X8JB 5TT0A 3U40A 3CLHA 4TGLA 1QLWA 2IYOA 4NYMR 5BY2A 1W6UA 5LNK6 2DPYA 1M2EA 4BLWA 4Z5XA 4BJ3A 3AVWA 5AVRA 1U0OC 1Q7BA 3UB4A 2HF8A 5IPFA 1DKMA 1TLTA 2A6PA 1MOZA 2QA5A 4H7FA 4YRRA 1S96A 1GYRA 3KKOA 5D86A 3K0KA 1W9HA 4Y7DA 2VPYA 2VYFA 1IZ0A 2Q2OA 4HWKA 1NF3A 1H4TA 4RQBA 3SE0A 1YOVB 2ERYA 4BFZA 2FUEA 4GYWA 3NKVA 2RBKA 1ZMOA 4HAIA 3ZCQA 2PUAA 4CF4A 5C8VA 1LSSA 3I9JA 3S2SA 3VO2A 2Q2VA 4RM3A 5A7GA 5L3SB 2MDTA 3IOMA 5ITZB 2FDXA 4Y6LA 3ZOKA 3Q2OA 1P4JA 4IIHA 2X8WA 4FJ2A 2LTAA 4Q00A 3V6MA 5HOEA 4FM9A 1OROA 1WEKA 5F33A 1XKLA 2FNAA 4AKSA 3N2KB 4GLJA 4EA6A 4XLZA 2VPIA 4UE2A 1X7DA 3DOJA 1H5NA 1TTHA 2ZROA 4P32A 1L5FA 1DCKA 3D6UA 3KOOA 1A2BA 4OJMX 2Z2IA 3DXYA 5I9BA 3TXYA 3SC3A 3U17A 3WL3A 4Y0NA 2XTZA 5KOJB 4XZ3A 2VEOA 4TTPA 4XASA 3T7JA 3R7WA 2O3SA 3NO4A 2O3QA 2CNOA 4YAEA 4EX6A 3G7NA 2WT9A 4BCDA 1I0IA 2H52A 4AS3A 4ZGGA 4DR7B 4Y98A 4FU0A 1B2RA 3FTPA 2Z3VA 1ZK4A 5LMCA 4P3NA 5LBUA 1NG9A 3HQ4O 2Z6AA 1GN9A 1T9AA 2XD9A 1P44A 5EUCA 6NULA 4AUNA 1D4FA 3PITA 1DKLA 2PO5A 2VJOA 2YZ2A 3IR6A 2NO4A 5JYBA 3KKKA 3GAAA 4J0JA 4ANFA 4AD8A 1GV1A 1Z73A 3C6YA 3I72A 1U98A 3VSAA 4BLTA 2RK6A 4G1CA 3LK6A 1IN1A 3GG2A 4QJ5A 4GLBA 4F3CA 4A8HA 4E22A 3EGXA 4OYRA 1WCV1 2JBWA 2O7RA 2WIFA 1CDOA 3ZK7A 5T41A 3WQRA 1CQJB 3U56A 2C88A 2WNSA 3ZGZA 2YS6A 4H7KA 2D0OB 2PVSA 1XEFA 3VHXA 2JI8A 1T5TA 4LJ6A 1FSPA 1TJ3A 1YFKA 2BGMA 4PV7A 3AR5A 2FPLA 4UZFA 3BJEA 2CXHA 4TSFA 4ZOLB 5IN5A 3RYHB 4EEXA 5LZ9A 2AX3A 3OCJA 5FHRA 3WK5A 3U7HB 3UJ8A 2C4NA 4JVNA 4MR9A 5J2UA 4YUAA 4BNGA 1E66A 3I9OA 3GBVA 2IZZA 3L7MA 2WM3A 4GMGA 4I4TA 2OFFA 1KQ3A 3LC7O 2OZKA 2W2OA 3OO0A 4ZYLA 1QHIA 4IIJF 2R48A 2YMLA 3HY3A 4Z0HO 4AWXA 3NMUF 3IDZA 4EJ0A 1UDRA 2PL5A 1FUIA 2IP2A 3F3SA 4AJ4A 5E3HA 3B38A 4I2NA 3ZDBA 3OTOB 3UAGA 1G8KA 3IMKA 3SIPA 2H4XA 3P7MA 1TT7A 2PRIA 2J7PD 4TYWA 4CTJA 3D2BA 3V4SA 3GLGA 1Z08A 1G42A 3BGDA 4YK7A 2Q5LA 4AX8A 1BE1A 3CV3A 5M04A 4YROA 4ND5A 1TDJA 4PNZA 4YFVA 4KO8A 1N7JA 3K1ZA 2HK6A 1R50A 4C4ZA 4M9QA 2PGXA 4B0OA 1MB9A 2PS3A 2QTNA 1K68A 5DEOA 5CX4A 5EWJA 1DBSA 4AC9A 3BOSA 4MO2A 4BFWA 4EHHA 4EG1A 5EC8A 2QB5A 3AIMA 5DGTA 3RS3A 1V8OA 2IZ6A 4IQFA 4A26A 1M1ZA 1CJVC 3EOAI 1AURA 1DKQA 1YCGA 4Y6GB 3V7YA 3R3XA 2D0PB 3DEZA 2QJFA 1G38A 5THKA 4H6WA 5CVUA 3LPLA 2PN1A 1ZS9A 3RFCA 1DC6A 1YVPA 3BGWA 2HWXA 2HJ9A 1UZLA 4J0DA 3NZEA 4WEOA 2NMVA 2BLLA 4R41A 1EVKA 2VF4X 4KXVA 5CA1F 2PQ0A 5EIFA 2HU7A 3QUBA 4GG1A 1C9DB 2Z0MA 5AUQA 3RREA 5EUBA 3M9XA 4EF6A 1L0BA 1U5BA 2PY6A 2VUHB 4IIUA 4NOMA 4XARA 3CEAA 5DLYA 5EWMB 5A6SB 5ECDA 1G8AA 4CMHA 3ML1A 4NHEA 2P7HA 3EUWA 2V5AA 5HXAA 1YV9A 1IPHA 4V3CA 4JGGA 5LYJB 1AKTA 2PANA 3QXGA 3UOWA 3R3HA 1KO1A 3O4JA 1O9HA 4IXNA 4GYKA 3HYCA 3U3DA 3UENA 5AVUA 1I3CA 4JBXA 3TDKA 5ICSA 1MBZA 3RS0A 4EZEA 2VWPA 3CNQS 4BNDA 1G2OA 1LQ2A 1W0JD 2EX4A 2WLTA 3QF7A 4QTYA 4K8OA 3KZKA 3UK7A 3V8EA 4BXOA 4N3BA 4IJWA 4JH0A 2PVCA 5LQKA 3D6MA 1DNPA 2QM8A 2VJQA 1WX1A 4GYJA 3WK6A 1BEZA 4JUBA 4S1OA 3PPVA 2ONKA 4C0AC 4XWKA 3DEKA 4MGIR 2I4OA 1EFTA 3GNLA 4EI2A 2QV7A 4F5DA 3L04A 4W6QA 2WJ6A 1GTRA 3IAXA 4DIDA 4RA9B 2NSYA 3B12A 1HWYA 3DFFA 3GVPA 1YWGO 3BXFA 3I1JA 4GR4A 3IDAA 4HLQB 4MYDA 4O8ZA 2B6HA 4QSHA 4ZT5A 1II8B 1E94E 3JSAA 2C5FA 2PKQO 3A4TA 4YMTA 3UHOA 621PA 2RHOA 1YS4A 5KWVA 4YAWA 4MQFA 4YYEA 3AT1A 4CQNA 1S2DA 3RG8A 3QF4B 4NS4A 4QG3A 1FXWF 1RWBA 4H3SA 1EWQA 2AMVA 1BJKA 1I2MA 3NEPX 3OCYA 3PGXA 4S1WA 4MVJD 1COZA 1Y6QA 2DY1A 2WJYA 3O90A 4HNGA 3PUVA 3RBXA 4Q1CA 5EFZA 2WSSD 4JOBA 1J1UA 3MN1A 3INTA 3H3FA 2VPZA 3OZTA 3GU3A 2W8BA 2P5TB 1IK4A 5JT1A 5JJKA 1M54A 1RFLA 4R6XA 3WJ7A 5BPHA 3W9YA 5KQMA 1GKYA 3H0CA 1PT9A 1TGYA 4C7BA 5BMVF 4FHZA 4II3A 2L19A 1L1RA 1WSAA 3OZRA 2FPPA 2HO4A 2JGNA 2WT4A 3H2IA 1L5VA 4DUZB 3FAKA 3H4VA 2FXIA 1QR2A 4N6NA 3W6NA 1Y9DA 4UAJA 4DV4B 1AZSC 1NUUA 2H7VA 4IRMA 3ZLTA 4RMGA 3C70A 3FR8A 5B58T 1L7AA 3HHPA 2XA1A 4ZHSA 1NV8A 1R4ZA 5G4KB 1U2SA 4P7BA 1UPBA 2GXAA 2IHYA 4PIMA 3M89A 4C0JA 5IEBA 3WE7A 1QBGA 1CDDA 5DX8A 1D2EA 2ZOSA 2YRXA 1K5GA 1L4HA 5JLJA 1ZHHA 1M8GA 4DUYB 1Q1NA 1XZMA 1W1WA 5D6OA 2XYQA 3UXYA 3R9WA 1UK7A 4J0IA 3NOXA 4K6FA 4QVKA 2WM8A 4EP1A 4F91B 3IAM1 1LRJA 2QBYB 5TPZA 1M2VA 1YZUA 3I32A 4MHOA 3ZKWB 5D3ZA 1U5CA 2AK2A 3TCXB 3UT6A 1NX9A 1T8UA 3KCQA 3LCCA 2ZB2A 3FOWA 2P4EA 2QZZA 1WPXA 3A9UA 2YV3A 3CX3A 4KMOA 4KQMA 5I7OA 4C0XA 1UXJA 3F49S 4LSWA 4AXBA 2IBMA 5SZKB 1QFJA 4IMJB 2Q7OE 4E7OA 1GZ5A 1GV0A 4OVKA 5GV7A 2FR1A 4F8EA 4LCBA 2IA5A 5LB2A 3I0ZA 2QYHA 4H6PA 1P8JA 4EBFA 3GLKA 5I7SA 5K6AA 5CR9A 1SXGA 3ROKA 3ONDA 2Z2XA 3SJAA 1J22A 4XX0B 4ESHA 4O8CA 3W5AA 3DTNA 4ZO8A 3LQKA 3W8RA 3CPEA 3IBYA 4UU8A 2X76A 1THTA 1T2UA 2A9JA 3OM1A 4IIYA 1T9DA 2XITA 3EIHA 4XXHA 3THSA 2XMCA 1X7XA 4J94A 3TGWA 3R7NA 3QG5A 1UANA 1OGJA 3KWJA 3SK0A 3TAUA 4YRLA 1ENOA 2WIBA 3I2YX 3L4EA 4A82A 5C53B 4N5DA 2XWBF 3IULA 4WH0A 2F43A 2TMGA 3MCTA 3PFCA 3MAGA 2IDZA 3V7UA 3VA7A 3RFFA 5LIPA 2NU6B 1Y98A 4OXIA 5JO9A 3HCFA 4YA6A 3P0EA 1MEOA 3AOGA 3BFVA 5DHQA 5M7EA 3L0BA 1E2EA 4RZ3A 1NW7A 4A8JC 3QVUA 2CFTA 3VNSA 4YR9A 5K0CA 3E9CA 5ERYA 2QAGC 3CINA 4BKQA 5FUQA 4Z4GA 1V3UA 4ZGWA 2CLHB 3KSDO 3R3VA 3EQZA 3HKCB 4PAGA 1OXXK 2L42A 2BSXA 3C5VA 5LBTA 2ZJZA 1O0BA 5LQRA 1IM5A 3G2LA 2ZYVX 3GJRA 4AY2A 2XAAA 3A9TA 4O4HB 5HQJA 1S3SA 3N2YA 4KWCA 4N39A 5DM2A 4R7TA 5AHXA 4ETNA 2QG9A 4CDRA 3EF3A 4CW7A 4E1VA 3HN2A 2NX2A 3G8CA 5CM8B 4BJ6A 3AKEA 2FSHA 3MRXA 4IMPA 5A62A 2ZS8A 3SY8A 2NTEA 3UAOA 4CR7A 2SNIE 2EBWA 4R1PA 4B40A 5SICE 5DGCA 2F9LA 5E4FA 5H3HA 1KO8A 2D1QA 4IIGA 4ZVPA 5F51A 1IHXA 4J2HA 5IZ4A 4E51A 5K0ZA 4YMIA 4A23A 5BSGA 1VL6A 1S9HA 2W98A 1GCIA 3VNRA 1FXUA 3DCJA 2WYOA 4UVDA 4BRWA 2PYIA 4WZAA 5EKXA 3AFHA 2C2OA 2O1EA 4UW9A 3AYZB 2GGSA 3ROMA 4LNUA 1R5JA 2DULA 1LK0A 1XHEA 2HJRA 3F7TA 3N05A 3QLJA 5AKYA 3RDPA 2PHZA 5D3MB 1G3UA 4K2AA 3SICE 3V2UA 4DJJA 4YJGB 3KTAB 1UJ4A 1YTUA 1TW3A 2HGZA 3A6DA 2IIQA 4B82A 3WLFA 3DOEA 2RC5A 4ZDKA 2I8CA 4BQEA 1J2JA 2DBQA 2X0KA 1T0IA 4GGMX 4TYYA 1IQPA 1WQ4A 2K7FA 1LTQA 3R8CA 2D6FA 2Q1YA 1WB9A 4AG3A 2VDVE 1PHRA 4II2A 2HSZA 1EWTA 3HJGA 5BSHA 3NKFA 1PJBA 4Q5IA 1HZJA 1JYSA 1OMOA 1VG1A 2ORVA 1ZH8A 3L40A 1NVMB 4N12A 1BQ3A 3BL5A 4X97A 3RJZA 1ZH4A 2F48A 1F17A 3HBFA 3I0NA 1FA9A 4WN9B 4IWYA 1AX9A 3SVLA 1PT5A 2RK3A 1M6VA 4IOLA 4NX2A 1C5KA 1ZGCA 5E9QA 4LRQA 5HDQA 4IJUA 2CDBA 1PYDA 3AM4A 3FPSA 3K0AA 1SWWA 1YFLA 2F1RA 1XTZA 3WIVA 3PQ5A 1XMPA 1JVSA 4MKHA 3MUFA 2LBPA 1UBLS 3Q88A 1KI8A 5CFQA 4YJHB 2OYRA 4OU5A 3NGXA 2IEZA 3IIEA 3KAJA 1U0FA 5H7XA 5BV1A 1I6WA 5F9HA 1E59A 3PE6A 1ODCA 2PRZA 5TPWA 2VHWA 2R2GA 4B3MB 3WAKA 1XLWA 3D81A 4UBKA 4G1EB 5ER9A 1L5HA 2G25A 1P29A 2REQB 3JAWB 3H1AA 4MW2A 3VAYA 1KVSA 1YNSA 2EYQA 4ZV7A 3RS2A 5CXUA 1N77A 4LZOA 4QIHA 1BNCA 1FTSA 1HMYA 1N0UA 4KX3A 4ZCSA 2BGGA 1Q0HA 3P2EA 2GWHA 4YHHB 2B69A 2ET6A 1YR1A 3KAQA 5LDDC 2DHEA 3N39C 1VDZA 3OLCX 3IAS1 3SKVA 2OLKA 1N6HA 4CHGA 1HFWA 2AMLA 4GZ3A 3MHTA 3FTCA 4EY4A 2JAXA 3A1CA 2R6DA 4JL8A 1NMEA 1SQ0A 3M4NA 1JI3A 1OJLA 3WO1A 2NZ8A 3RW9A 4OGGA 2X4IA 2ZATA 1KETA 4BNJA 4RDHA 3QSGA 2QV0A 2PBZA 3CBQA 1XNQB 4YREA 4CLHA 3EFHA 3RODA 5JXHA 2P8SA 3ZHSA 2NTVA 2EFCB 2DUJA 1CNEA 1F3OA 4RZHA 2JHGA 1NXTA 4INPA 2IWHA 3TD2A 3L3BA 3OHMA 2ZSEA 5AJZA 3TI7A 1N6KA 1J56A 2AUNA 3KYJB 4L8WB 3E7WA 4EJ6A 4EVIA 4B73A 1HNXB 1KO4A 1J5XA 1LTHR 4TLLB 3F5FA 3WMRA 4U39A 3RPEA 4ADSG 2CC2A 1LBTA 1T5SA 2QGNA 3A1UA 5HF9A 3RYFB 1K7FB 2C20A 2IXDA 1YDGA 4F3RA 3VOAA 3ND7A 5BN1A 3VR6H 1GPYA 1RKXA 2YQ5A 2WWYA 5TNXA 3MTQA 1WY5A 2WWTA 3NHLA 3HCDA 3QBJA 2R9VA 3WS7A 1CVLA 3LCRA 4P4SB 1LX7A 4MWBA 2H16A 2POQX 2VAWA 3U7IA 3C1UA 5ULLA 3FDIA 5FNVF 1VIMA 3H97A 4D3DA 2GJ9A 5HSGA 3PTAA 4DC0A 4P2BA 3N2NA 1GLNA 2WSLA 1EDBA 3OX1A 2ODWA 1TMYA 5AUNB 3KU4A 3KB6A 2BMDA 4LXQA 3O4GA 2BMFA 1ZD9A 1UDBA 2ACEA 3FWKA 4HAUA 3WGHA 3X2FA 5B2EA 1B15A 4O4LB 1I94B 5BV2P 2ECKA 5DXAA 4BTLA 2PWYA 2O06A 4U0JA 4XUGB 3Q3EA 2C7RA 5KNBH 1A1SA 2EKLA 2OILA 3D7KA 1WWKA 4I9FA 4U9IS 5J58A 2A88A 2G9ZA 2C42A 4G6ZA 2EWWA 4BVEA 4IJ5A 3MIIA 1VJRA 1VYVA 1WP4A 3K0EA 4HC4A 4UUOA 3QELA 2CZCA 3L4JA 4LHYA 3HXLA 2XHEA 4D9JA 1CBUA 3NIWA 4BFVA 3GPBA 1J8VA 3PYLA 4JP8A 2O23A 2DFKB 4D9HA 4G63A 1G1AA 3AUSA 4TV8A 4TVKA 2GYUA 4YB8A 3VSBA 2QAGA 1BH2A 1VKOA 3G79A 4OXKA 1BDMA 1ETUA 2V8BA 4PLCA 1A9ZA 3GMSA 4G5XA 4WJKB 1SG0A 4LJLA 3ODPA 1IY8A 1VE1A 1WSWA 2FWMX 2QX6A 1JQDA 4OK5A 4X8OA 1BW9A 4F8YA 4KU4A 5HK8A 2G9VA 3EBOA 4INJA 2FZ5A 3QE9Y 4QUIA 1KZ4A 3AIKA 3C3EA 3LXRA 4C7KA 3P2JA 1IBKB 3M4XA 4WCFB 4WOKA 1AJEA 3HACA 2GKOA 1MMFB 1QPBA 4BVLA 3MYRA 5J63A 1U9JA 3E9RA 2YICA 4YS6A 1O6CA 2TMYA 2YCLA 4HP8A 3V55A 2YJ5A 1FX0B 1JDVA 2HD4A 1F12A 3KELA 2JHAA 5NULA 5KTTA 2G9UA 2W6QA 2D5CA 3OLWA 1Z2DA 2C7VA 4IZHA 5IF9A 4N3CA 9LDTA 2QZPA 2OXIA 4BN4A 2ZKIA 5EINA 1AS2A 1QRAA 1T9GR 4OFWA 4OBEA 1CTQA 2F3UA 2PKCA 3UK6A 3D2AA 2E6KA 2GEVA 2JIQA 3FJYA 4FDAA 1C30A 4NE7A 3A6GA 4OHZA 3DKIA 4MQ6A 1T5OA 4BMYA 2O5EA 3U3OA 4I5DA 5TEWA 1TUGA 3VPBA 4OREX 5I7RA 3LV8A 3D54D 3NH9A 3QOWA 2FP3A 3I6QA 1QCYA 4LVCA 2BZ1A 4H6XA 3HR8A 4OMFG 4HB0A 3ZX5A 2P0YA 3DO6A 1PO7A 4NOJA 5CEFA 2Z9BA 5IUNC 4DA4A 1C1DB 4JBYA 2BKLA 3GT7A 4EO7A 1UC4B 3FIUA 1IH8A 2VDNB 1E0SA 3HMQA 4HPJB 1WE2A 3CH5A 3CMMA 1KYQA 3ETNA 3LWZA 2WYIA 3AUKA 3AHEA 3OE7D 4CQMA 2W4QA 3NM5A 1I32A 4HDRB 3PNBA 4BLPA 2I9KA 1MC8A 4G0NA 4NJEA 3TM4A 5AKGA 4QUGA 3CVUA 3P5BA 2M9MA 1EM6A 1Y3DE 5L3RA 1S0UA 3C14C 5LU9A 4QBIA 3H16A 2GBPA 4G0UA 2XF2A 2RAPA 1UMBB 3EIQA 5IAKA 3ZJVA 1YAJA 1Q19A 2VJBA 4FGUA 3UCFA 5P8WA 4M9XA 3TWOA 3BA6A 4WBSA 4W9NA 3ZDEA 1SOMA 1UEXC 3C97A 3K0BA 1E6LA 2FY8A 2NNLD 1OVGA 1FU7A 2EHDA 4AX4A 1SUEA 3UAYA 1ZN7A 4RJKA 5FAKA 3E8MA 2G09A 1ST2A 3KT6A 3SG0A 1JQ3A 3QXHA 5KZMB 5KYUA 5EE5B 3ZZTA 2PLAA 1GUFA 2J08A 3LQ2A 3Q3HA 5AVVA 1IBMB 5CXSA 2XNJA 3DOIA 4W7SA 1RMQA 1URPA 3KHSA 1AU9A 4N03A 4ZU3A 3RV3A 3ZHYA 2X9NA 1Z5VA 5GTDA 5DTEA 2JJYA 1XF9A 5ADUS 1T1IA 1ECJA 1IM2A 1WXWA 1X7WA 2E9SA 2BGKA 2VI5A 2WTAA 3K9LA 4DMFA 2HMWA 1NBOA 1HSOA 1L5MA 3C3YA 2GSDA 3M5WA 3LF1A 5FV4A 2JAPA 3FKJA 3T5CA 3VR5A 1I7LA 2NUTB 4FYWA 1V5WA 3HFGA 4N6GA 2Q7DA 1W85A 2P9YA 3GLSA 4IO0A 5JS8A 5KTMA 3PPYA 1ZMTA 4RTJA 3AG5A 1QZ3A 1JEDA 4MS1A 2EGHA 4ZVKA 5JOQA 2P2LA 2RHRA 3D4BA 1I6KA 2XKAA 3DO8A 3OFND 4W63A 4WNAA 5T6MA 5I9LA 2AZMA 2IK8A 4F60A 4K9MA 1HDXA 3HI4A 3JALB 1ULTA 3DBRA 4AJEA 4DLRA 1KYVA 1AGPA 4AS2A 4LFCB 1MA0A 2VHXA 4QYIA 2TECE 1XA4A 1KR2A 2L17A 2L69A 3Q3GE 4RJTA 2QI9F 3JVIA 1XBTA 2FF5A 1SA0B 3N53A 3OFJA 4KO2S 2ZRDA 4O63O 4IIVA 2DB3A 2AR9A 4MKGA 3T4PA 3VH2A 3KPJA 3USZA 2EFHB 4MMZB 2H1VA 2PZAA 3SYNA 4YT8A 1KMNA 2GBIA 2ES4A 3ORYA 3P97A 4OY3A 3ADPA 1CIJA 1CVIA 1GFIA 3E82A 5TGTA 1N78A 2O9JA 3KBBA 3HLTA 4Q3EA 1C29B 3CRMA 1O6ZA 4R1OA 1UXOA 3DVAB 3I9LA 4EG5A 3AHHA 1EEXB 1R0KA 3WIBA 4P0TA 2VZLA 4RV4A 4UD2A 2JBHA 3DFIA 2GD6A 1IN6A 4J03A 2NV2B 4TKLA 2A30A 2CZGA 2WW8A 2X8JA 3H8WA 4OKIA 4XVQA 5CXXA 1FP1D 4N0EA 4ZPJA 4AECA 1F6DA 4E88A 2R6AA 1ULAA 2R47A 5HJ2A 5B30A 5AUPB 4B7UA 1P6UA 4FFWA 3ROPA 2NZXA 4HWPA 4KR2A 4EGFA 3RVRA 4L4RA 4CT4B 1RWVA 2X7JA 3RARA 3FNHA 1OTXA 5G4LA 2ZYHA 4NG4A 1JU3A 1JAIA 2PBLA 4JELA 3PNVA 3I01A 2OLEA 4JA2A 5F64A 1AO0A 3V4PB 5ITZA 4Y18A 4QTZA 5IDQA 2RGNC 1E79D 3C87A 4EZBA 5C3UA 4PNEA 4U7DA 3WLIA 2WJWA 1JXQA 1KXJA 2NQTA 1JYFA 2TS1A 1DTWB 4R1TA 5FUMA 2W2XA 4HWSA 4B2IA 1V9CA 4RUKA 4LFBB 3QMMA 1S1MA 2WMOB 1JE1A 2J0SA 4MQBA 3I5XA 2EDCA 3CX4A 1APBA 2HJVA 4D9BA 3JVDA 3L2OB 1NZJA 3Q9UA 4REMA 5ALHA 1A5ZA 4UHBA 2H2FA 1UBHS 3DHYA 4OUDB 4W1PA 4F06A 4HV4A 5A02A 1AUQA 1YONA 5CVTA 2B3TA 3QXXA 4QAQA 4MUBA 3NAGA 4KUEA 2E7ZA 5CA0A 4IUDS 4B8YA 4OD0A 5AHWA 2JGAA 3IT1A 3GK3A 1K6MA 3PR2B 5TXGA 3LY8A 3PDUA 2P4SA 1IOZA 1NDQA 2HH9A 3IERA 4HB4A 4E5KA 5J47A 1NY5A 3V1TC 1OXTA 3J81A 1SZPA 5KREA 2VBCA 2QN2A 1JR3D 4QBKA 2FEXA 2HQSA 1NWHA 4GZLA 2R6R1 4L9AA 3I12A 4E3ZA 4U2BA 721PA 3OCCA 1E1MA 4FW8A 2O3UA 1TIBA 5DHSA 5FOXA 3TIVA 4RY9A 1XSEA 3CT6A 5JY6A 2EP8A 1IVYA 2Y1EA 3H2ZA 3NUGA 1UC8A 1UT5A 4DLVA 3AESB 1V2GA 2WYVA 1C9MA 3I9FA 2G4LA 4MQEB 1Q83A 5DGXA 2BGIA 3UATA 2SECE 4FINA 1CQJA 4I6EA 4M89A 3ABRB 5IT9A 4DS3A 5IFKA 1OU0A 1YHYA 2EJVA 4DLAA 3ADBA 2C2ZA 3EOBI 3O3MB 4HNRA 3WL5A 4NV0A 2OZLB 3RVMA 4X65B 4AJLA 3GAFA 4ZQCB 1NUSA 2I33A 3AXTA 4M8IA 1ZD2P 4MV1A 4YP9A 5KX5B 3EW7A 3N2EA 3KV3O 2E4YA 4ZOLA 3RYHA 3OE5A 1QVAA 1M2JA 2I3BA 5CW1A 4ND8B 3DO5A 3SHOA 5JISA 5JH7A 1ML4A 1QWSA 1E4OA 3H2HA 1X6VA 5EJ2A 4WUVA 4YCAA 2DJ5A 1E0DA 4KW7A 3TBKA 5LJIA 3LZ6A 1CUZA 1IRXA 4A6PA 3HC7A 1IEVA 1G7CA 2A35A 4JEMA 1NG1A 1NUAA 2MTBA 3Q6MA 5H83A 4YRBA 1OYOA 4BU0A 1OF1A 2P9BA 2F55A 4X24A 2GK7A 1NOKA 4AYWA 1QG4A 1OLUB 5I7AA 4Z9YA 5ESWA 3OAAD 3RUPA 3TQFA 2R8PA 1VYUA 4EK9A 1ZGZA 1Z88A 5HBGA 3P9QA 2QLJA 1UJBA 1K66A 4UOEA 1BGWA 1CUGA 1NVXQ 1F5NA 5HEKA 1HYEA 1JEOA 4MS3B 2VP3A 3AILA 1HTTA 3OZUA 5EP3A 4Q24A 2OV6A 3NHMA 2YN0A 4JS0A 2FSIA 4ZARA 1JEYB 3G02A 4HZUA 3VOBA 4FOTA 1AV6A 5ICFA 2YDXA 3LZCA 2FFBA 2VPWA 2HF2A 4O5AA 5IRCD 4RSHA 4JT8A 2O8CA 5HPYB 4KQJA 4LXTA 5FADA 4NZPA 3EH1A 3IIIA 4GOMD 3E35A 2WF7A 3HLYA 1NV9A 1VGRA 1QHGA 1UKBA 5IVIA 6AT1A 1DL5A 3VAZA 5K8IA 4L8FA 4DR3B 2QVXX 5AJTA 2A1TR 3ZXXA 2QRZA 3M83A 1W4BA 4YXFA 4FYMA 1Z26A 2X0IA 3AW8A 5EJ5A 2XUZA 1JDTA 1U8TA 3UHAA 2XCLA 1F0PA 3EZ6A 5DW0A 3NS7A 4LS3A 5G40A 1IZ7A 1KK0A 4BL5A 2EJBA 3O1JC 3B36A 2ZDQA 3EA4A 4HMPA 3KSRA 2O8DA 1WHTB 5M3BA 5H8WA 4GT1A 4OMUA 4A03A 3O3CA 4E30A 1LU9A 1R6VA 3L7NA 3QVWA 5IJ0A 1PWEA 1AUXA 2WTXA 1MR3F 5AKLA 4R1SA 5EWMA 4EG7A 4ZYUA 5LDHA 5A6SA 2FK8A 1JXOA 1Y1SA 2ZULA 1EBBA 2KE5A 4RGYA 3TSWA 4L4UA 4UOZA 2GN1A 1VMDA 3TIGA 2CDCA 2V74B 2O8FB 4KIJA 5DLEA 1CD5A 2GJ4A 1I4DD 1D9XA 2LUOA 3CLSC 3FIJA 4KXXA 3WHKA 5F7OA 1Q0UA 4UC0A 4RO0A 4W5OA 3FTQA 1MO5A 1FU8A 3GFRA 4FHGA 1HKHA 1ETHA 3FKQA 4Y6QA 4IR7A 3U31A 1V43A 3NHKA 1PT7A 3R8XA 3VU1A 1QP7A 2B8WA 1ZEJA 1E62A 1M8JA 2AMJA 2B4AA 2ZSHA 3WV5A 3ZGXA 1H69A 3GJ6A 4P38A 4DG8A 1R8SA 4J8PA 1AQJA 2JHPA 1F0KA 4QTUB 2GZAA 2NVOA 4Q34A 4RA9A 1KOLA 4XYLA 1QXSA 1PZHA 1IXSB 3AU8A 2HZBA 1TKCA 3I4LA 2R8YA 4QFBA 1EX1A 1KYTA 1S2MA 3RUIA 1II8A 5DLQC 1NW3A 1W25A 4FZRA 3SHWA 1KP3A 3D7LA 3E2IA 5DRYA 4C4SA 4IQ0A 2BSAA 2ISSD 1AN9A 1TK2A 3QF4A 4HQ0A 4LHWA 2PZKA 3DQZA 5GY7A 2A67A 4L5YA 1TEZA 1LSOA 2G9RA 4M49A 5D6NA 4EY5A 3OTHA 3WLHA 2YTZA 1E2JA 4D9IA 4S12A 1EIZA 1F20A 2HUPA 1RMTA 3ZI7A 2BH9A 1W5BA 1ONOA 2H00A 3K53A 3RIXA 3TXXA 3TVYA 2XRYA 1E3DA 1F1JA 1U2GC 3HBMA 2UXBB 2I7VA 4ZT6A 5DN6A 2X3YA 4ZP1A 4BPRA 4PNHA 1YZTA 2JA1A 4X44A 1BO6A 2XBMA 3JRXA 3SAJA 4PONA 2YUTA 3S99A 2CJWA 5EJGA 3DHEA 5DYTA 3LW8A 1QPZA 5G4KA 2VDRB 2B78A 5F3WB 2YXBA 5ES4B 3CCBA 2AJTA 4S04A 1HPLA 3E5HA 1QYWA 4IKOA 4L22A 4RJ2A 1UDCA 4EYOA 2FEPA 2AFIB 3F5SA 4IXDA 4PAMA 3ZDQA 4EAQA 1PEYA 1P2FA 2QBYA 4JVLA 2ZKLA 2ESRA 2AA3A 3ZKWA 4BBPA 1K0UA 1JG2A 3KKQA 1AHIA 1Z4LA 3SKXA 1O96B 5EQDA 4J9VA 4INAA 4TLEA 1WG8A 1ADFA 1ZOSA 3I9V1 1VECA 4WRRA 3SDSA 3VDXA 4TRNA 1VRVA 4MIYA 1BC5A 2GASA 2VP9A 1CZLA 3FZGA 4KOAA 1RPAA 4RXTA 2VK4A 2XZTA 3CSUA 3OFKA 3C15C 5DCUA 4DV0B 4MRVA 2X9VA 3H9EO 1H2YA 1P77A 2E3JA 3PWSA 4MEJA 4TTRA 5JANA 5DHAA 4EGQA 2VDWB 1QYCA 2AR7A 4N18A 4XX0A 3ZE6A 2AFIE 5G0TA 4CCYB 3W5VA 4AT1A 2L82A 3SZ3A 3WMEA 4BUZA 5HJEA 3HVHA 3I01M 2H57A 4XOUA 2IEGA 3ICEA 2HHJA 1VLZA 3UT0A 3D8UA 3WV4A 1H6AA 4FOSA 4ZYXA 1GQOA 1PJ3A 2F6RA 5BW8A 2REXB 1CG6A 3U7JA 3VC1A 5FPKA 2ZRBA 2DR3A 2GARA 2GR9A 1RLIA 4FYYA 4RD4A 1TW2A 5BMOA 2FEAA 4B45A 4QPNA 1RM0A 2I80A 2I8AA 1KY3A 3TD6A 3WL7A 2E4VA 4FQ7A 1E6KA 4FNOA 4DTIA 4I1OA 1O89A 1CLEA 3JZIA 4QUKA 2B61A 3ZH2A 5KNCD 1YK1A 3G0DA 5HQ3A 3HKCA 3P9SA 4F9GA 1QLHA 4N01A 4LWOA 5FBZA 2GK6A 4OOEA 3RSFA 2A1IA 1WKVA 3EUEA 3FI0A 2VKQA 4GMFA 4DGSA 3JD4A 1A5TA 2JJ8A 3H13A 4HG2A 2WWGA 1PG0A 3R76A 3FNFA 4RAQA 1PQUA 3ED5A 1C0KA 5H16A 1D6MA 7YASA 4E5SA 3KUKA 5IC4A 1NLFA 2H7CA 3U1TA 1GA6A 1NJ6A 5EJ4A 1E98A 1JN0A 1X1TA 3IEUA 4YRFA 1E7YA 5IC5A 3VYVA 1T8RA 4Z7NB 4PC6A 1OFGA 1EDEA 3FWNA 3ZUGA 1AT1A 2AHRA 2FKAA 1MFPA 1SRQA 4A2PA 2RGWA 2JEYA 3VO1A 4Y2PA 3STTA 1XPOA 1YBVA 2OCBA 3IKLA 3R74A 2OQRA 3PWTA 5IUJC 4FS3A 4DMKA 2ZYSA 4L8YA 4HDSB 4RQTA 3IUEA 1LC3A 4B6FA 5KO2A 3CN7A 3KPWA 2HU8A 3VO8A 4B3IA 3H3XA 3PDCA 2C8VA 5D3MA 4WTOA 4PXSA 1R74A 3KTAA 2JIZD 1QOQB 4MCIA 4YJGA 2AH5A 3VNBA 2XNDD 3AONB 1T10A 1Y5LA 2HF7A 2HLPA 1Q6YA 5JZSA 4P5EA 3ZDCA 4E3WA 3NEJA 1WUKS 1R0RE 4DQ0A 4DSAA 2GAFA 4UFPA 1HORA 1XTTA 2CNDA 2UZ1B 1HF3A 4XSVA 5HIMA 4WKGA 2ZWPA 4EVRA 4JUFA 2F64A 2WE8A 4M38A 1E77A 3KSUA 1TZCA 1FP6A 3F0TA 2PM8A 1YE5A 1FQWA 4OB8A 3W8NA 1RXIA 2ERCA 2IPLA 4BFYA 4U1RA 4XWGA 1IK6A 1C9YA 2XNKA 1UMKA 1ZM7A 3OQBA 4WN9A 1K89A 1W34A 3TPZA 3U4QB 2ZAGA 1D2AA 2Q3JA 3CRRA 4JYMA 1HE2A 2VJLA 3AG6A 1Y9AA 3C48A 3ENQA 1SCBA 3ND9A 4MJ7A 3QM1A 2A7QA 3PTZA 1JQBA 3T15A 1QHHA 1T1SA 1A7JA 3VBCA 5IT5A 1M10A 1RHKA 5D8DA 4REQB 3ZIDA 4IHJA 3MGKA 1QE3A 2FPXA 2ZAIA 3DUWA 1LC0A 4JI3B 2NTNA 5J1TB 1P7VA 4D43A 4C2AA 2EJWA 1BHSA 3L6OO 5IARA 2O7SA 4M7WA 1X8KA 3KK0A 3GC6A 4JDPA 3GRVA 2JI6A 2J6IA 4YI5A 4YIHA 2KYRA 5EJ8A 1JG4A 3FWPA 1LWOA 4F4FA 3T5AA 4KN5A 4AS1A 1Y80A 2A0YA 5FYQA 3E70C 5BOVA 1S3FA 4HQNA 2QF7A 1FDOA 4AK9A 1A2OA 1SBHA 3HXPA 4NPCA 5B37A 2RG7A 2QLLA 3JWPA 4UVIA 1E5LA 2JANA 2IU6A 5K0BA 1ORRA 1QIIA 4WZZA 1R7RA 1J06A 2OV8A 4IV5A 2MCFA 2PWPA 1YKSA 3QHPA 2C1XA 4YAKA 5ICMA 3TRIA 3D7RA 2WIGA 3EA0A 1IDN1 3ITKA 4ZO6A 2VS1A 5COBA 4FFMA 3H04A 2ID7A 3VYRB 3BA1A 4EYKA 4XTCS 3W3AH 4QM6A 2ZUFA 5LP1A 2A1UB 1L5ZA 4F9FA 1VE6A 2WPDA 4LHSA 2GJAA 1OH6A 1S2OA 3K5IA 1DC7A 4J49A 2ISCA 3VQTA 3GLVA 1U2GA 3S2EA 5IDXA 1KXZA 2Z56A 2R11A 4WGGA 4BZZA 3DD1A 4IIJB 4DYVA 1GRNA 2GK4A 3EVGA 3WI7A 4HQ6A 2FP4B 2R7MA 3BIOA 3IUJA 3QEOA 1UWLA 3D7MA 4CJXA 5CDTA 4TZKA 4A73A 4HVCA 2DXIA 3ONFA 3OU6A 1Z29A 4KRFA 2FMHA 3ZV7A 2AXPA 3DDNA 5CCEA 1Z5GA 1M6WA 2WIDA 3QU9A 4GZ6A 4MGZR 5EGSA 2R8OA 4E13A 4FIZA 4CQLA 5IULC 1V7PC 2VZ9A 4RY0A 1TVKB 2IXEA 4YMGA 4QU9A 2QTLA 2ONJA 3F6SA 3UZUA 1FY2A 2FF7A 2UVQA 3D3KA 1ZKMA 3N87A 4B4UA 2IBTA 4P34A 3K05A 4MVJA 4PYKA 1GU7A 3ZVNA 2ZPAA 5D7NA 1JJFA 1N92A 4O2AF 3T1OA 5J9FA 2R7LA 4MGKR 2ORIA 1I1QB 2C5BA 1QR6A 1UXIA 3X44A 2WSSA 4C2TA 3L9XA 3OUUA 3D3NA 3EWNA 3MT7A 3K70B 2ZM5A 4HXYA 4AZWA 2XCIA 3F98A 2FUG6 1H1TA 2QORA 4P4SA 3TOZA 5A2GA 3DFKA 1C0IA 1BCSA 3R3UA 1DPGA 2PGJA 3RKSA 1EA7A 4BMNA 5FA5A 3WLTA 1NVVQ 1NU8A 1ZM2A 2M1XA 3BH6A 4NULA 2OM2A 2ZBQA 2NYVA 4RELA 3R3JA 2QZ9A 3IGFA 4ZPXA 4FSHA 3MILA 3O4FA 5CA1B 1CVRA 4LJKA 2VBGA 1M2HA 4QPJC 1FMCA 1W47A 3L0ZA 4O4LA 1SXIA 1NTRA 2O1XA 3O2JA 4OATA 2B4KA 1E3SA 1E7QA 1PLKA 2P6NA 4N7MA 5DTIA 1E99A 3RIHA 2FW8A 4ES6A 3COJA 4QREA 3TTYA 4I4IA 1Y8ZA 3GLTA 1XLUA 1XPUA 4BMPB 4YASA 4M1QA 4RVNA 3AF3A 2GQ0A 5L4SA 2C9DA 4HBZA 3IKJA 1T0JB 4K2HA 2C8LA 4U7PB 1SXPA 5KU7A 4J0GA 4JC8A 1KBZA 4IZOA 1B1CA 3G9UA 3MOGA 1Y33E 3O31A 4MCJA 1JHXA 1QDLB 3I64A 5A71A 1YFZA 3N6RA 1Z5NA 4CIDA 1BYUA 1T5DX 1ISIA 2QRNA 3EVCA 4MV4A 4KCGA 2E5LB 2BSQA 2O7NA 2GHTA 4F12A 2LV8A 2OXCA 2OCAA 2WUWE 5JPDA 3THXB 1DIAA 5K3AA 3H9BA 5C46F 3JQGA 2WOOA 4Z9AA 3LUHA 5HR5A 2MYPA 2QTFA 5LQSA 2JVKA 5E7JA 4RIHA 4D0GA 1JG6A 3FPFA 1EGAA 1NTOA 3SC2B 3CEPB 3LUBA 4E14A 1DBPA 1KJIA 1LDGA 4WCFA 4CEHB 4LMAA 5JUWA 2F3RA 4I8DA 2J3LA 2BTEA 4H4EA 4FFVA 4KFRA 3A1DA 4B35A 1S2IA 3OJ0A 2HA3A 2F1OA 2AQ8A 1RM3A 5IAGA 1NMXA 4TMXA 1P4AA 3E22B 3UK0A 1W88B 4GI1A 4DSTA 5KYKA 4WK4B 1RCTE 1B41A 5A3VA 1JHDA 4YDSA 1X80A 3RT7A 1Y5MA 2GPAA 1TGVA 2JFVA 1RYHA 4LBZA 1N0IA 4PPNA 2G4VA 2VRNA 1UK6A 1PGPA 2VBIA 2I6FA 2Q6VA 3EIWA 1GNTA 5T5QA 3WGJA 4YMSA 4E33A 2WWFA 4FFDA 4OFXA 5JNUA 3I3SR 3NVDA 4PYOA 4G1FA 2IDMA 4YAIA 2NZVG 3OZCA 5BMVB 1Z6YA 4EB3A 4C1BA 1WLSA 4U7GA 1NPYA 3W04A 5HKKA 1BYIA 3MUOA 1EDZA 5JJIA 2B4RO 2ZETA 1K1EA 3QVJA 3DOOA 1LQUA 1TB4A 2I6TA 3UJ3X 3CONA 3FRJA 4YHBA 5CDFA 3H5IA 3DUFB 4HDRA 4RY8A 3EBLA 4WW0A 5K0LA 5LC1A 1C0LA 3TRJA 3YASA 1FBNA 5FPTA 2BE9A 4FYXA 2E4ZA 4DDKA 4OLJA 3R5XA 2EL9A 4JEUA 3F7MA 1CJTC 4B3RB 1N9GB 4BHTA 4GFDA 1W8DA 1E0KA 2H4WA 2IU3A 4WXHA 4WWHA 5IUKC 4A92A 1DIBA 4HVTA 3T4UA 1UMBA 4I1SA 4URHA 3WBKA 5BV0A 2GBLA 4K3VA 4MSUA 5GZ3A 5KTRA 4CU2A 3A4MA 3KM0A 3WL6A 3HV0A 1E63A 4KR0A 1I0ZA 1VLVA 2IYYA 2I1LA 3L0CA 3ASUA 1KFBB 3ROQA 4UEJA 4EY3A 3E9EA 2JI7A 3THWA 1R0LA 3OX2A 1RW4A 2FVXA 2Q7XA 2FDRA 3NHPA 4J75A 3SXJA 1EK0A 3K0HA 5ALDA 2QU7A 4US0R 4E12A 5I47A 5CPBA 2PTHA 2VVTA 2FQQA 5DULA 2BZGA 3ZGNA 2QTWB 3T3IA 1RDFA 4K40A 4EO9A 1DDOA 1VBKA 3K6SB 4IDQA 2XGSA 4PZUA 4Y8VA 3EDMA 4P8RA 1WBBA 1T26A 4DG5A 4U2FA 3V46A 2V6BA 5A3SA 4M8NE 2FPOA 3BWCA 2RGBA 1KOFA 3NR2A 4WVLA 1AGYA 1Z83A 2WAOA 4X61A 5CCDA 1PFGA 2DPMA 4G8CA 5KC8A 4KRYA 4ALIA 1N3LA 1U63A 1IAVA 2EGUA 3U7FB 1I1OA 2NUTA 1P5FA 1RABA 1L5GB 1Z39A 3TK1A 5AOVA 5BN3B 2GHQA 4P0PB 2Y76A 5HFJA 4PG6A 2OWDA 4C6HA 4M9ZA 1TC2A 5IYZF 1N5DA 2C4UA 1RC0A 3ZVKA 1N57A 3JALA 4YQYA 2AQKA 3H1FA 4NJMB 4D8VA 4EG4A 1NW9B 2XKKA 2ECFA 6LDHA 4IX1A 1WCYA 3KBOA 1SK9A 2IYZA 4WKOA 4XE5A 1PX0A 4M8SA 4OP3A 1YMUA 1B1AA 4QYXA 3SHFA 2F90A 1A9SA 3NDIA 5ECGC 3CWZA 2IPMA 4JJFA 4BO4A 5CJ2A 3LUPA 4HBGA 1VZ2A 4BC1A 5A0FA 1YQQA 1Q7TA 3RHTA 4P1ZA 1VJ5A 2Q2QA 5AUOB 2RHLA 3VDQA 1E9BA 3A28A 2AWOA 2QP9X 3DVAA 1L5YA 4KIUA 4CF3A 3AERB 5ALRA 4AKEA 4A2CA 1YB7A 2AFHB 3MRSA 1XCLA 3CKKA 1DC5A 4D9EA 1T1RA 2WBLC 2LGJA 3A37A 3P94A 1V1RB 2V6MA 3QP9A 4DN6A 1VSQA 1T4DA 2GBFA 5DWQA 2XDQA 1XK6A 3DE7X 5CVDA 5FUYA 1M2GA 5A4KA 3AF4A 4D25A 1KRHA 3DKPA 1UZMA 1Z5ZA 1P3JA 2UZIR 2QLFA 4HEA1 3ISJA 3E23A 1BAPA 5EIWA 3UF0A 3VOTA 4EUEA 3ESQA 3QEAZ 2ZSBA 1Z7GA 4R2MA 3WTCA 2DQZA 1GPJA 5K5EA 3NNSA 1NXXA 1A3CA 1Q22A 2MSDB 4FX2A 1QQTA 4NZMA 4TQGA 5E4YA 3SN6A 1D5CA 4TMTA 3STWA 5GV8A 3DZIA 1UL1X 3TB6A 4EHKA 3VKGA 3ECAA 3H1BA 3TM5A 3EZFA 2AN3A 4QGSA 5JADA 3CISA 4RVUA 2WYHA 3CNOA 4KDRA 4JITA 4QO8A 3U39A 4WX2B 1UODA 5FBLB 3SBXA 4E4RA 2AOVA 2FFAA 3ETCA 3MS7A 4HZGA 1L4MA 4C3OB 1P9LA 5A3QA 1DTWA 1NBMA 2YN2A 4YJ3F 1KERA 4BMCA 3MWDA 2IF2A 4ETIA 1UM9A 3C5HA 4UM5A 4B71A 4QPZA 1T13A 4Z4IA 5IP5A 2VUSA 3EMDA 2QRQA 1ORTA 1HRKA 4OUDA 2P1DA 2ZXEA 4PX3A 4MVJM 1YQGA 1GFWA 3STUA 4G81A 1E2HA 3GIWA 3OU2A 1I7NA 2HPZA 4B6GA 1SULA 1UC9A 2DHCA 5EG5A 1WD5A 4Z0TA 2P9EA 2DLNA 1NQAO 5EEGA 5CAEB 3SQWA 2PKRA 3A6PC 1V8ZA 2H63A 5CK4A 1RI2A 4JT4A 4NHOA 3ZUPA 1VG0B 1YJ5A 1J7JA 3HB5X 4EJFA 5BWNA 3DJFA 1F5SA 5AM2A 4PZEA 3KUXA 1G6KA 4HMOA 5KBYA 1U80A 2VXBA 4LXIA 3LTEA 1E96A 3DAGA 4QT0A 3FKSA 2AVDA 1LF0A 5E0KB