4JA2A

Structural basis of a rationally rewired protein-protein interface (rr468mutant v13p, l14i, i17m and n21v)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
121
structure length
120
Chain Sequence
SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
molecule keywords Response regulator
total genus 42
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ja2A00
1PHRA 1BA2A 3IDOA 1C4WA 2I6FA 1MIHA 3FDFA 4JP1A 4MR7A 5IUKC 4W5QA 1Y1LA 2AYXA 1P8AA 3IPAA 4PZ0A 2B4AA 1DRKA 3LUHA 4YO7A 5TPZA 3TMYA 4TLLB 2WRZA 4KK4A 4LDZA 4QICA 4ZMSA 3RH0A 4S04A 2IDMA 3O21A 3EGCA 4Z4EA 2QU7A 3RVNA 1PEYA 1LK0A 4G0QA 5CHYA 2L18A 1ISRA 1Z16A 2PMCA 4PICA 1EWKA 1ZGGA 5HM6A 2WB4A 1APBA 5KQGA 4RDCA 4Q6BA 3N0RA 1M5TA 2ZAYA 1VKRA 3F7NA 3KYJB 3N8IA 3HK2A 2FVYA 5FWXB 1U04A 2PUBA 2YHBA 3M9WA 7ABPA 2OENG 1NTRA 2WMYA 3I45A 3LFTA 4ZMRA 3BRSA 1DRJA 1USGA 4XFKA 3EAFA 2MYNA 3KCNA 1RZRD 3HUUA 6ABPA 2M1ZA 2XDYA 5TQ2B 4KNYA 1ZESA 4NCBA 4XLTA 1TLFA 3JTEA 3H1FA 5C5EA 4YCSA 1JLKA 3KHTA 1YS7A 2NZUG 2ID9A 4ZYLA 5KC8A 4LZLA 5DKFA 2QW1A 1QQAA 3KYIB 4OLAA 4YWHA 1BAPA 3NHZA 3CKMA 1Z13A 2MSLA 4OATA 5JS1A 5E3JA 2PUAA 2JBAA 4Z9AA 3MF4A 3Q7SA 1NXPA 3EODA 4MLCA 3CLKA 3N53A 3HDVA 3GBVA 4QYWA 4KVFA 3C97A 1CEYA 4YV7A 3H5IA 3I5AA 1YIOA 3MYYA 3RQIA 5ED4A 4GNRA 4W5OA 1CYEA 2GWRA 3SM9A 5IUJC 1U8TA 4DQDA 2IYNA 4HNRA 3P9YA 1BVHA 2QVGA 3N6VA 4YGXB 4E7PA 1QQBA 4MAAA 1YS6A 3C3WA 3EQZA 3T95A 2JVJA 3CNBA 4WZZA 4OLBA 4RSMA 1SD5A 3KS9A 3I09A 1DBQA 4F3TA 1I3CA 5EWJA 4S05A 1W25A 1PNTA 4TLMB 3LUGA 5BQ3A 1M2EA 3TD9A 2PUCA 2PUGA 5HSGA 5GOTA 2VK2A 4LX8A 1QO0D 1S8NA 3LUKA 3LUFA 3CTPA 5DLEA 1K66A 3GWGA 4N47A 3HM9A 2FXIA 4ETMA 1YTUA 3MMNA 3M9XA 1NXVA 1QPZA 1NXXA 4UHKA 1MB3A 4L85A 1JFTA 3A0RB 2TMYA 1D4ZA 3N0XA 2KYRA 1XWWA 4P98A 3C3MA 3A10A 1ABEA 3QEKA 5TPWA 3IP6A 2NT4A 4JOQA 3ILYA 1A04A 4IGAA 3H1EA 1ZH4A 1RPJA 3OQOA 4W5NA 2MSWA 3NHMA 3LOPA 4RWEA 5EWLB 6CHYA 1L5YA 4H3KB 3H5TA 2FQXA 1OXKB 3RVQA 1H9CA 3QLVC 2A9OA 3QEMB 4Z0NA 5TQ2A 5JNRA 3MM4A 3TB6A 3O2SB 2P9HA 4MRMA 2BGGA 2FLKA 2IKSA 3Q7RA 1E6LA 3A0UA 3F6CA 4N03A 1P6UA 3N75A 4FE4A 2ID7A 2H3HA 5IUNC 1LJUA 1F51E 2DRIA 3T8YA 3I42A 4MS1B 4MR9A 1TM2A 4D6XA 4Q7EA 2RDMA 5IEBA 4WWHA 3H5VA 3LUAA 1SRRA 4RY8A 1BDIA 5IX8A 4RKRA 1ZGZA 3HO1A 2CHFA 1U0SY 4G0OA 3JPWA 3JS5A 1JH9A 4E7OA 3EJWA 3SQNA 4MPTA 3KG2A 3BBLA 3EQ2A 3OMWA 2PUFA 2WJWA 2F8SA 3GT7A 5KC9A 1E6MA 1TVMA 4IF4A 1LBIA 2QXYA 5FBKA 2PUEA 2GKGA 3HV2A 5JNWA 1HEYA 3ILHA 5EWLA 1NXWA 4ETNA 9ABPA 1QP0A 2E4XA 3O75A 2VYCA 1USIA 1Z12A 5CNJA 2FEWB 4FB4A 4ZJPA 1MAVA 5C5CA 3IP5A 2IPNA 2R48A 3HVRA 4IRXA 1A0OA 1R8JA 3MA0A 3QEMA 4N0QA 3HXMA 2L19A 1DCKA 3FMVA 1NATA 5DCLA 3OM1A 3QELA 4Z9BA 1JHZA 3NNNA 2P4UA 2MYPA 3GL9A 4HNSA 1GUBA 4JASB 1QMPA 4RY0A 5DGCA 3R0JA 2GI4A 1JYFA 1KGSA 1Z26A 1RNLA 4EVRA 4D74A 1DC8A 3HJFA 3CG0A 4NCAA 2FKAA 2JB9A 5F64A 3VNBA 1D1QA 3LMKA 4KV7A 1JX6A 3FGZA 4Z99A 1JFSA 4KPYA 2E4VA 5BRAA 3H6HA 5T3YA 2N9UA 4EYOA 4TMYA 5B3JC 3OLYA 3NNDA 3QX8A 5CNIA 3QLTA 4NV3A 2HPHA 2PLNA 2HSGA 1FFSA 2IPAB 4RKQA 1VRVA 2OQRA 3KJXA 2FMIA 4ZPJA 4N0PA 3KKEA 2LIVA 1ZHHA 4RK0A 3O74A 4B09A 2IPLA 4H60A 1ZAYA 1LBHA 4MQEA 2PL1A 3CG4A 4JAVC 4MQFA 1Z18A 4RY9A 5CNMA 1NY5A 1D1PA 4RK4A 1KRWA 3GRCA 1URPA 1U2QA 3DGEC 3ROFA 1SXIA 4EGSA 4KMRA 2R47A 3QELB 3BRQA 1JFVA 3CU5A 3VNAA 4O1IA 4OG2A 1TMYA 4O5AA 4MS4A 3Q15C 5GQSA 5T7BA 3K4HA 2RGYA 5JNVA 1DC7A 1OXBB 3H1GA 1ABFA 4N41A 1QKKA 1FSPA 1Z25A 1YMVA 4LDAA 5TQ0B 2A9PA 1Z15A 1DCFA 3ROTA 2FMKA 4IMIB 4W5TA 1P6QA 3H5LA 2FN8A 3SAJA 2HJ9A 3TO5A 3HCWA 5KI6A 1YK1A 4G0PA 3FFWA 1VLZA 2IPMA 3BREA 4RZSA 5CNKA 1GUDA 1VPWA 2O20A 1DBPA 5D2CA 3SNKA 4EYQA 4P1ZA 2FSPA 3LUCA 3H5WA 1NXOA 3QLUA 1XHEA 2A9RA 5PNTA 1NXTA 5TQJA 3RVRA 3LKVA 4EYGA 3MQ4A 1DBWA 4DADA 2VUIB 2A9QA 4YRZA 2E4ZA 5BR1A 1MB0A 1PEAA 1WETA 1E6KA 3C3KA 3JVIA 1IIBA 2CWDA 4UHJA 4F06A 4XXHA 2CD7A 1RZRA 1DG9A 3UKJA 3Q41A 3FFTA 5BRJA 1ZY2A 4F11A 1RXIA 3L49A 3CS3A 2GX6A 1F4VA 3JVDA 4EUKA 3G85A 3IP7A 4RK7A 5FWYB 1KMIY 2RJOA 3O1JC 3FFXA 1DP4A 4WUTA 2NT3A 4G86A 2LPMA 1YVUA 3T6KA 4F8JA 4EYKA 4MLDA 1ZH2A 4Z4FA 2JBAB 1Z17A 1FFWA 2PE5A 2GBPA 3A3KA 3KSMA 1D2AA 1ZN2A 2LBPA 3CHYA 4RK6A 1SXHA 1W9HA 4YR7A 3RVKA 8ABPA 2WY2D 4RXMA 3OMXA 4JB2A 1C0EA 4NQRA 1GCAA 3LTEA 4Y9TA 4PE5B 4MS3A 1PUXA 4QPJC 4KQ9A 4LE0A 5HQJA 4Z4GA 1P2FA 2M98A 3CRNA 3KLOA 5IEJA 4G0XA 1DJMA 4YP9A 4QYMA 5TQ0A 3EDCA 4KRFA 4JB0A 2WWVD 1EFAA 2F8TA 5I4CA 3W9SA 1GCGA 3LKBA 1YK0A 2W42A 4RU1A 4DN6A 1LJLA 4KFCA 1MVOA 1RXEA 3CZ5A 3H5OA 4MS4B 4PEVA 3GV0A 3HS3A 5FWXA 3KLNA 3OLXA 4MR9B 4PYRA 4WXEA 2QZJA 3N0WA 5EWMB 4MGEA 3GYBA 3NNSA 4RXUA 2HQBA 3M6MD 4XARA 2PUDA 4Z4CA 3QX9A 4LE2A 2R25B 2E4YA 2L17A 3HZHA 5KQMA 1EWVA 1EWTA 4CBVA 2J48A 3H75A 3IP9A 3JPYA 3K9CA 1A2OA 4XAQA 2FMHA 4W5RA 1K68A 3OM0A 4RV5A 2FMFA 3OQNA 4YLEA 4Z4IA 2LUOA 3MIZA 3QLUC 4LRQA 3TX6A 1QNLA 3QLVA 2NZVG 4TN5A 1T34A 1U2PA 2QR3A 3F6PA 3GBPA 5TE9A 3UK0A 3OLZA 4MQFB 4WT7A 3OLWA 5FBHA 4H3HB 5ABPA 2HQRA 5B3JA 4KQCA 1L5ZA 1JL3A 2FN9A 4KZKA 3DGFC 4O1HA 3T38A 2X7XA 1SXGA 3HSYA 4EVQA 1Z2DA 5EWJB 2PAFA 3OO1A 3QK7A 1FQWA 1M2FA 3L6UA 5DTEA 4N76A 1USKA 2FTKE 1NXSA 1DCMA 1BDJA 4L4UA 4RXTA 3RVJA 4MS1A 5JS2A 1JYEA 1ZITA 4Q6WA 5JNUA 3C6QA 4XASA 2JVIA 4LE1A 2MYUA 2QVCA 3B2NA 4OBBA 3URMA 4MR8B 2RJNA 3DZDA 3KTOA 4MRMB 2PL9A 3HDGA 4MR8A 1KRXA 1QP7A 3CZCA 2E4WA 4MYRA 1FFGA 1EAYA 1UDRA 4F12A 3RVPA 2PKXA 4ML3A 1JF8A 4FE7A 3OQMA 2Q5CA 4OTZA 1DZ3A 5KQPA 2FQYA 3RVMA 1AB6A 3RVSA 4Z4HA 3DLHA 1CHNA 3O2QB 1E2BA 5TPZD 4G0ZA 4KK3A 1M5UA 2AYZA 4G0YA 3F73A 4G97A 1YMUA 1QP4A 3JY6A 3UUGA 5IULC 3HUTA 3BILA 3IPCA 2JVKA 2FEPA 3RVLA 3OLVA 1Z2EA 1GLGA 2H0AA 4EVSA 4D6YA 1BDHA 3DBIA 4MQEB 2CHEA 5KWSA 2MYTA 3E3MA 5TPWB 3S99A 1D5WA 1B00A 1ZDMA 1EHCA 2FEKA 2IOYA 3D02A 2QV0A 3NBMA 3OO0A 4WXMA 4KREA 1ZVVA 2ZWMA 4GPAA 1JBEA 4MR7B 4RK5A 4HYEA 1JWLA 1PNRA 5KQLA 4IILA 2VUHB 4EY3A 4G0MA 2QSJA 4MS3B 3E61A 5FWYA 2LP4Y 2MSKA 3O2JA 3GA5A 5JNSA 2JRLA 3O1IC 1J56A 2E4UA 3O1HB 5IC5A 3EULA 3CFYA 3H6GA 1AB5A 2B1JA 4IMJB 1XHFA 4HNQA 1TJYA 3SG0A 3DLBA 2FQWA 2V0NA 2FLWA 4M88A 2WJAA 2FW0A 2NUBA 5IBQA 3SY8A 3D8UA 4YS6A 4RK1A 2PJUA 3HEBA 4JA2A 4NICA 1ISSA 2L2QA 1JDPA 2YHAA 3G1WA 2JK1A 3LUDA 1QO0A 3RVOA 4ETIA 3Q9SA 3LUJA 1JDNA 4RS3A 2HQOA 2JCGA 5EWMA 5JNTA 2R4QA 3Q7TA 5HKOA
chains in the Genus database with same CATH superfamily
1ZN7A 2ANBA 2UVDA 5F12A 5U4QA 3GMTA 5AHKA 4UNQA 4B4UA 1VECA 5A0FA 1OXXK 2XUJA 4MIOA 2EF0A 2JGDA 1KJYA 4FD3A 5JY1A 1TJ5A 1IU9A 1K5DA 3D43A 3IS3A 1G2PA 1JDZA 2CUNA 5LZ9A 4DSAA 1MQAA 4CMCA 3ZXIA 1AN0A 3O9VA 2VDPB 4HDOB 1XJQA 4QYIB 3WFIA 3OQ1A 5CRIA 5JZMA 3R0QA 2UVQA 2ONJA 2QB5A 1EWKA 2ZR7A 4QQRA 1BMQA 1FMJA 3DXFA 3IV9A 1GWNA 1F14A 4WKBA 4PO3X 4QELA 3D4LA 1U7UA 3MD9A 3EIUA 1P91A 4ICIA 9ATCA 5KKNB 1WF3A 3CRQA 1JMVA 1W4ZA 2Z95A 3DZ8A 4BZWA 1N2HA 4MIYA 4I8DA 4YRFA 3AI7A 2Z58A 1T8YA 1XBTA 2YCLA 1RZVA 3GLHB 5T3UA 4B3CA 1RKXA 1SOUA 2J6BA 3IP3A 2VF5X 1XZDA 3CCCA 3CW2A 3F49S 5A5FA 2E87A 3B3GA 1F2TA 4AP9A 1LI5A 3HVIA 4AD8A 4GLBA 1GUAA 4MJXA 5CIYA 2XUHA 1WULS 3O84A 3U4QA 2ZWOA 4REQA 5JAOA 5LZ2A 4TMVA 2OV8A 4HLNA 1W1UA 2IYRA 3WMWA 5D3KA 2ZRAA 3L02A 2EV9A 2I34A 1ND5A 2QRNA 4K6FA 4C08A 2IS4A 1LV8A 1X3LA 3IIMA 1U4OA 3HHEA 4HH4A 5LQAA 1NWCA 2ZK7A 1ID8A 4PU0A 5EMLA 3MF4A 3PQ6A 4BCCA 1O6CA 1JG6A 1R4NB 3ASUA 1Z06A 1P29A 2NO5A 3L8DA 4O4LB 4YV7A 5HUQA 3JWJA 2QPLA 2B4QA 2P40A 1QCDA 2IZ0A 3TDNA 1EP3B 1OI7A 4KX5A 3TLJA 3UYLA 3HVHA 2PL5A 2D8AA 5CGQB 5THXA 1E1CB 5IJ9A 5ULLA 5AJHA 4BV8A 5HDQA 1XRRA 1KC1A 1Y3BE 1ATZA 4MWBA 5ALDA 1Y1RA 2VPIA 1CDEA 1VHLA 3ZH9B 2VJKA 3KLMX 4RM2A 3ZCSA 1NTOA 2GJAA 5LLDA 3KS9A 4PPNA 3VDNB 2QUJA 4MW9A 5EA2A 1IONA 1X3SA 3B7WA 3DR3A 3QWIA 1L4LA 2PS9A 4LGVA 4QHYA 4Y2GA 4BB5A 2NU6A 4RFSB 5CX1A 4QUEA 2X5KO 4D3ZA 2FWPA 1R0YA 2K87A 5DLEA 4RA9A 4C3UA 4N47A 2N46A 2AZDA 4ZKEA 1SB9A 1PJ3A 2WA1A 4LK2A 4MARA 2WJ3A 1PWYE 5IAJA 4DMKA 1A8QA 3G17A 4DB4A 2KW5A 1QBGA 3A0RB 3DD5A 3VKGA 1GR0A 3N0XA 3P9ZA 1GOTA 4IAOA 2O8DB 5JSQA 2DBRA 3DAOA 3G2HA 5IG2A 2EIXA 1XEXA 2BDUA 3LSYA 4YDHB 3I2JA 3AR7A 2GBIA 4IUBS 4ZZ0A 1L3BA 3EVGA 3JZDA 3KWLA 4MQLA 4U6QA 2R85A 5HGJA 1TGYA 1AGPA 2D13A 3GAAA 3NTRA 4QATA 3EXG2 1WL8A 2VVTA 4DUGA 2XGOA 2FZ5A 2MSWA 4UM7A 5IJXA 3K1AA 4E4TA 1DKLA 1F06A 2F6RA 3RHSA 4C22A 4E1AA 2FN7A 5DBOA 1RJ9A 1IZYA 1BWRA 3KVVA 4G0VA 1USUA 3R7BA 1XP8A 5CXXA 5CAEA 3AVXA 5GINE 1SNYA 4I55B 3P0IA 3N2KB 4WLFA 3MJTA 2ZM6B 4MQUA 2YWDA 2QD2A 3GFOA 3AR3A 5DWVA 4CETA 4DR7B 4B0OA 1SKYB 3NHLA 1L5FA 2PGDA 3LIPA 4D9NA 3H65A 1R3DA 4DLPA 1Z3IX 2K2QB 5H16A 4ESOA 2RK4A 1EXDA 1KSJA 4JNKA 2GZMA 4XX0A 5G1OA 4E5PA 4A2WA 5IVKA 3OCZA 3OUZA 4PBSA 1WQ4A 2FPGB 1E5TA 2GVDC 5FPHA 1Q7RA 4HTFB 4NDNE 4QXRA 5BNFA 5LL6P 1T91A 4MUFA 3FH0A 5ERXA 4R81A 4Q18A 3HB1A 3LC0A 4MVJH 2VT3A 2ZI5A 4QPZA 4CNBA 4BKMA 3LP5A 1NBMA 5TGZA 2Z5VA 1M3SA 4ADSG 3LCRA 4QUHA 4TYNA 3AR2A 2B1QA 1O94C 2C8JA 1X86B 2Q1XA 3D7LA 5FULA 4CVNA 5ECDA 4O8ZA 3OMWA 5KVCA 1Z83A 3RADC 4P4NA 2C2BA 3ZV6A 3OM8A 5SY4A 1OH7A 4CM6A 5K7SA 4QXPA 1C0LA 1L7AA 3AESB 4H7EA 1PQWA 4O0LA 2WYHA 5AKIA 3TQQA 4FLMA 2ZJ4A 9ABPA 1MU0A 1I0LA 4CKWB 5D8DA 1AIPA 3AHDA 3PDWA 1JR4A 2PX0A 4FPXA 3EYWA 3T5CA 1QS0A 4OHOA 4CQMD 4FB4A 1MA0A 5LOVA 1KH3A 1M75A 8ADHA 1PYGA 3K70B 4Q4HA 2NU7A 3ZQKA 1QF9A 2EZUA 4J7XA 4TS4A 1W85A 4YI3A 4XB2A 2WDPA 3TPFA 4BVFA 4CV2A 4ZAZA 2GYWA 4IIDA 1XZIA 3QKWA 3TSZA 2GBCA 4DLAA 1U65A 4HNSA 1ZJZA 2QS9A 1OV6A 3M3PA 3NEJA 4Y1GA 2G5TA 2IUTA 5E6RA 1P4HA 2DP4E 5FEMA 5J59A 2ZUTA 2XCSB 1WPGA 1I4OA 2NG1A 3AHJA 3F6BX 4S35A 4E5VA 5C8XA 3D7MA 4V1CB 2PJRA 1L5KA 1E3EA 3IBGA 3UYKA 3HUDA 4L57A 1N6IA 3UWSA 3MTJA 1FA9A 2DFNA 4DMHA 2CY0A 4FDUA 2G9VA 3EMDA 2B0CA 2NU7B 3ACBA 4OFXA 3LMKA 3I9NA 2E4VA 5BRAA 3FMPB 3TLGB 4G9GA 1LPSA 3NJ8A 4RUKA 1E2FA 4OAQA 3QLTA 5FPKA 2XTMA 1GKIA 2FPGA 2PLNA 2QM8A 1VIVA 4DWOA 1TA9A 1U0LA 2FMIA 3CCBA 2AE1A 1Y5IA 3SFTA 4N7RA 4BNUA 4CR8A 2QTRA 3UN1A 4MVJD 5LM3A 5KYWA 3IV6A 2KE5A 1CX9B 2WSBA 3P7MA 1SEVA 4ZYYA 4AMVA 3L1HA 3RUAA 5IJWA 3L7CA 1Q0LA 3BXPA 3JQAD 4KIFA 2ZFUA 3WGQA 4EARA 2EJVA 4MB2A 1ZH0A 4CU2A 3DBLA 1FW8A 5C1DA 4FB5A 1SXPA 1Z5PA 1QFMA 2ZQZA 1S2MA 1DKPA 1MA3A 1L1QA 3QTLA 3GR6A 4I55F 3VNAA 5IYZA 4HB4A 4O2LA 2BTOA 6REQB 4DR4B 3O3OB 4I1UA 1DINA 1DUSA 1Y63A 3JWIA 3FLEA 4I5GA 1SA0A 2OC4A 4IV0A 4J91A 1CDDA 1AQLA 2TECE 2RGNC 4K9LA 3RC9A 3Q8MA 4BX2A 3BXOA 1S4MA 4J16A 3PXUA 1G21B 3CMMA 6PFKA 3IQDB 1W0JD 4HN4B 4KDCA 3PDJA 2DUNA 1UEXC 1I7DA 3BQ9A 3IKJA 2JHFA 2E9SA 2HJ9A 4K88A 5AT1A 4DE5A 4EKIA 3IQIX 1JDUA 4XGRA 3JQAA 2DZDA 2QAGB 4NI5A 2DLCX 1V96A 2BIFA 2V74B 4AJLA 3D31A 3QTBA 1CDZA 2AA3A 1ZVJA 4DCOA 3ZD6A 1IJEA 3BXEA 1KZYC 5EJ6A 2IL1A 1ISMA 3N2EA 3V2GA 4XM1A 3QEBZ 1DOAA 2FEXA 1IK4A 3FY4A 3LKVA 4O4JA 3SBXA 3U4AA 4L08A 4DY4A 4DADA 4EQ6B 1KK2A 1DX6A 1SUAA 1L5QA 2IEYA 3L05A 3PS9A 2JARA 3QE0A 3RWBA 3VYSB 5BN5A 2VF7A 3WWEA 3C3KA 1ZGJA 4FKMA 4WX2B 3U4GA 4DA9A 2KB0A 3JD1A 1M10A 1DBVO 1YACA 2AF3C 4KR0A 4FDVA 3WLKX 4UASA 5ADHA 3MLAA 4RZIA 3OOJA 2OBBA 1UPFA 5DHSA 3BWYA 4RMIA 1K98A 1W4RA 3GEHA 2VXYA 2QRKA 5JJKA 4NATA 4DA7A 3ULKA 4EG1A 5JWRA 4FXOA 2A57A 3NANA 1IG0A 1O9BA 4CIVA 2V8BA 2G07A 4CJXA 2IYPA 3DCNA 4DR2B 1UKEA 3TRKA 3S2SA 3OCJA 1ZNYA 1NVUQ 1Y48E 1ESCA 3LQ2A 4WY5A 3PEWA 2O5EA 4LJ4A 4EYKA 2J67A 1M34A 1PW7A 2PGAA 1VMAA 4URZR 2FKNA 3VPBA 4MI1A 5EIAA 1YR6A 4BB9A 1KU0A 3HA3A 1DKMA 3KPJA 1EP9A 5I9LA 1R8SA 4GP6A 2Z2ZA 2WAAA 4IDBA 3RARA 5K9ZA 3LJKA 5C4MA 3LLMA 1L3CA 2QMHA 2ZVPX 4G5HA 1C0EA 4YAOA 4PYNA 4E33A 4ECEA 3VTAA 3EPHA 1T4CA 1ZA2A 2BBOA 1R0WA 1TB4A 3FETA 3NCHA 3PC4A 4AJ9A 4BQPA 2CSUA 4M1SA 5K2MA 4CPDA 4J1TA 4N0EA 1JGTA 4DJJA 2CDCA 4CM8A 1WUIS 3HLKA 2IS1A 5LQNA 1JVNA 1JSLA 1E2PA 1OX5A 1CIJA 3BSFA 3EDCA 4OY3A 2G9QA 2LDXA 1V7CA 2DT8A 4B4DA 5I4CA 5JI3E 4JV5B 2AJBA 4ZO4A 1OJ7A 3EWNA 1Q1NA 2P27A 2R79A 2GKOA 3A4VA 3TTWA 3GK3A 3HSKA 5JOQA 3ESRA 1QGAA 4CDNA 5DZSA 2H2GA 1T4DA 2HWWA 3C3EA 4N6NA 4NU5A 1Z5OA 5JH7F 1ZI8A 4E5SA 1U0FA 2GLUA 1LPNA 4H0NA 1S02A 2JW5A 3CWZA 5HILA 2BFCB 1IVSA 1X7XA 2Z5GA 3HCBA 2OEPA 2YCBA 5K0GA 4AUEA 1FOEB 3NVDA 5AXCA 4Z4CA 3AKZA 2PZAA 2DPHA 2E4YA 3DBVO 4MW0A 3PQ3A 5LJIA 3FR7A 2NM0A 1NT2A 2PVPA 1KORA 3LWNA 2HJRA 3MWKA 5FADA 3SGLA 3IHLA 5EPUA 5FLXA 1A2OA 1UFKA 3IHWA 2EBUA 3ETGA 3NAMA 2DB3A 2B8EA 2YY5A 1O4WA 3WNQA 4RIHA 5BN4A 4F4DA 3SDZA 4LYHA 1MT0A 3FDZA 4X1OA 3FGPA 4QU5A 4TSFD 2IYYA 1ECFA 2X4DA 1QIDA 4EMSA 3EA5A 3PUZA 4GVXA 4W1RA 5CFLA 2UZIR 1BHJA 1N3YA 1E3TA 3NAZA 2VJBA 3H2HA 3QKIA 4GUAA 4DWVA 5B3JA 1T4MA 4CUZA 4YAKA 3V2UA 2I7DA 1L8OA 1Z2DA 2JLAA 1A95A 4N3BA 5TB5A 2YVUA 3REQA 4B83A 5L53A 3H2SA 1ILEA 1GYPA 4Q4JA 1VM6A 3GJTA 3KOZA 2FTKE 2DQZA 3NWPA 4H0FA 4JLKA 3CLTD 3N8NA 3O92A 5CT5A 4HAXA 2BELA 4LZZA 2WG1A 3WXMA 5FWNA 2HSZA 2R44A 4TV9F 2Z1MA 3B38A 3ISTA 1JW9B 3TZCA 3TLMA 2RE8A 3K2IA 1T4CB 3U61B 3CE6A 4LBZA 5A7GA 3RASA 2BP7A 2EAUA 1SKBA 5D84A 5ICFA 2VHYA 1RHKA 3RTCA 5JWOA 2A5LA 4AZ0A 2XWJI 3ILVA 5B1YA 2HTFA 3T7CA 1TVKB 5IC4A 1H85A 1UJNA 4QVIA 2GAIA 3OQMA 2PFSA 4TMFA 5JTTA 4ARZB 4X20A 3AUYA 1TL7C 1GRRA 1BVYF 3BHMA 3OHMA 3OZTA 1FUUA 3B1JA 4NEQA 3UF0A 3ZR4B 1E2BA 4TS9A 2B94A 4ZQFA 1F2UB 3RC2A 3SMQA 5AD1A 3ENVA 1Y7PA 2KQUA 2XQGA 3ER8A 2YIMA 4S24A 2JVKA 2PQMA 4A1FA 1AMOA 1J00A 5EFOA 2H4ZA 3BWBA 3CX6A 5AK3A 4L6CA 3B5IA 3C3PA 1DXYA 3CIFA 1P0IA 2FEKA 1ZDMA 2IOYA 3EA4A 3EUAA 2QRGA 1X9IA 3SIXA 4HQ6A 3L4BC 1QVWA 2VTKA 3ER6A 3S40A 4MR7B 4GPAA 4Z51A 1QZ3A 3EDQA 3H9QA 2OB1A 5BPFA 4FR5A 4WZBE 4IILA 3RYCA 3A9UA 3N1UA 4G0MA 3OPYI 4H7IA 4Y9UA 2HJHA 2V58A 4BV3A 2MSKA 4NRDA 4RDHA 1AMNA 2Q5EA 5FHRA 4Y1EA 2V7GA 4RJJA 1RS0A 1JSRA 1J0EA 2IEZA 2PRZA 3DDHA 1BXZA 1U9CA 3VHLB 4EKDA 5JASA 4B3BA 4CW7A 4A0HA 3R9IA 3DBRB 1PR2A 4YQYA 4GPBA 4DLXA 1ORIA 1X6VA 2WV9A 3MWGA 4YH1A 2FW0A 1QU3A 1VL5A 1ZCFA 2ZRNA 3HEBA 2NLOA 4RAOA 2A78A 4RPKA 5EHGA 1RPNA 3G1WA 3NOQA 2F3RA 1Q11A 3KSZO 5DH9A 2AC7A 1AQ6A 2OY0A 3U80A 5FORA 3HCPA 3Q9SA 1H2HA 1THTA 5HRCA 1NN0A 1EEXB 3LUJA 4P08A 1EUDB 4DCCA 1C7IA 3DFIA 3U1BA 2O8CA 3HADA 1SVIA 2G36A 3FX2A 2X0RA 5EXPA 5TARA 1TM7E 1X1QA 3RTDA 3ZHZA 4IFTA 2WBLC 1MIHA 3U48A 1L7XA 2W6ZA 3W9YA 5EI5A 2AYXA 1XZHA 3VV3A 3C5EA 1E5DA 1VL1A 3BH7A 4PFJA 4RKFA 1G19A 2WZDA 4ZDKA 2ZBVA 4GX0A 4H1VA 3UGJA 2BTQB 1O03A 3FWZA 4CMIA 1JEAA 2AH5A 1OA1A 2V1XA 1SOVA 4WOJA 1XNRB 5EZYA 2IS2A 1XU9A 4KITB 4PIMA 4BGVA 5DBGA 2DU8A 1ISRA 2FMUA 1N5DA 4ZHQF 1XLVA 4GXNA 4URWR 1BXRA 5CLFA 2XZLA 2J3HA 3N0RA 4A5SA 1YJXA 1WMDA 2J4CA 4GRDA 1A9YA 4D9EA 3TL6A 3I2GA 3X2SA 3DO6A 1Y8AA 1BCSA 2DFKB 3MJFA 4NAHA 5AW7A 1J5EB 3N28A 4OAPA 4ZVPA 1T43A 1GR1A 1P0CA 1W4AA 5FNVF 1C2YA 1DRJA 1OBCA 3ZVNA 1EK6A 2GASA 4Q0MA 2DWQA 3HU3A 4RHXA 4XI9A 3BTVA 1XEFA 3TM5A 3L7BA 5HK9A 2P78A 3OBBA 4EF5A 3HBLA 3WHLA 4FFDA 3W2IA 1P0MA 2XDYA 3C41J 5AO9A 3PC3A 4U2KA 2PPLA 3P4UA 1VOTA 3K0FB 4HFRA 5B1IA 1YGPA 4QVGA 3D0RA 3I1FA 4ZWNA 1JLKA 1N2BA 3ZJ4A 4U9IS 1JLSA 5HHTA 1CUUA 4B8YA 3GT0A 4E2ZA 1YIAA 2EJBA 1HT3A 1ZLXA 3TQFA 3P9XA 4RZUA 3DMYA 2H0QA 1L5GB 3ZHBA 3ZVMA 3P32A 3WRWA 1OVGA 4KNWA 3CKMA 1G38A 3TJMA 3GLFE 3QXXA 1PR0A 2ZYWX 2OQVA 4M7OA 4OPMA 4WLNA 4PYLA 2AV6A 1PUIA 1P1CA 1D9ZA 3QWHA 3PRKE 4WNYA 2AG5A 3THXA 1K75A 3D9QX 2HSWA 2EIHA 3EVNA 4NY1A 2GVZC 2VJNA 2WIAA 4QYWA 4JC8A 5T67A 5B30A 5B58T 1NOIA 3MTIA 4YB8A 1II9A 1FLVA 1MR3F 3AINA 3HRKA 5D3MB 1JR3E 5KOHA 3T7TA 3HB4X 4DSTA 5KTRA 4O4LF 2E48A 3O94A 5J23A 3G8BA 3N6VA 1RXVA 2K7FA 1QKJA 2O7NA 4LSMA 3T3EA 2RI6A 1FP6A 1DBRA 3QVVA 5AM4A 1QUFA 2C2YA 1UM8A 4BLRA 5GV8A 3EZXA 2Z5LA 3JZFA 2QI9F 4RSMA 4BO4A 2DECA 2HPAA 5G4LA 3A28A 1JN0A 4F3TA 1UQTA 1WABA 2QTZA 1FQKA 2H4HA 3RK0A 4S05A 4ESVA 1YC2A 1DIBA 4F3YA 2HSDA 3WGOA 3E7WA 1PNTA 1V4NA 2IFTA 2FG6C 3MCWA 4L8YA 1DJQA 4RORA 2NU9A 2OP1A 4DMLA 1D8AA 2UYYA 2V65A 4H15A 2H16A 4GOLD 3RFUA 1ZUNB 4HS9A 4Y2VA 3H4TA 3KD2A 4BWFB 5B55A 3MGAA 2JLVA 4TZ6A 2TMKA 1QIHA 1QGED 3FPCA 1YJBA 4HH3C 4RPGA 5JAQA 5F2NA 1GVHA 1OLXB 1MB3A 4BNFA 1GPBA 2WW8A 1U1CA 1YB4A 3L1JA 1LUAA 3JATA 3Q3HA 3LBYA 4KJXA 4NESA 5CLHA 4R9SA 4P83A 4MWOA 4XTCS 3W2FA 3WWZA 4ABYA 4JUCA 5C81A 4FFMA 3Q8WA 3A10A 2JCBA 3OKAA 5FL7A 2Y0CA 4HVTA 1R4AA 4ZGBA 3EW9A 4LC9A 4WOCA 2HLDD 3SJUA 4GEGA 1Z4KA 3OCCA 3ZE7A 4KIWA 2ZIVB 4URUR 2YYYA 3QKRA 1UBKS 4KSBA 5HJ2A 4A2PA 4K86A 3ELUA 4UOZA 1FC0A 2ONCA 3P9IA 2P0AA 4PYKA 5ADVA 5KNCA 3I01A 1A50B 2DTEA 3MYRA 4KFSA 1VKOA 1XMIA 1YJQA 1F0YA 4F9FA 1UXJA 4TYPA 2BFMA 2O3QA 2QROA 3NONA 1OZAA 3GLIB 3IR7A 1C1HA 2CNDA 3UJDA 4B4OA 3LA8A 1Z5WA 3WNVA 3M5CA 4Z0PA 4HK4A 3ET4A 5WRFA 2NU6B 3QXSA 4IKOA 4REQB 1HDZA 1F51E 4YALA 3HJAA 5CX1B 3CX8A 3W8DA 1FPMA 2XYVA 3RF7A 2N42A 2GSDA 4YCJA 3OJFA 3DEJA 3PG5A 5DLYA 2GMWA 4KAAA 1AV7A 2UXDB 2A9VA 3V4ZA 5D7BA 5I3ZA 4M60A 1TLTA 2J30A 3UK2A 3WSVA 4YP1A 1IY1A 3B6JA 2G9RA 2MOKA 3QWFA 4G0OA 4IQFA 1TQ4A 3FSGD 2WLSA 4TTQA 5ENZA 4HNTA 2H1VA 4G84A 3SWWA 4DLTA 4HHEA 1JKXA 1FLDA 1MIOA 3KG2A 2XMCA 5BN3A 3DUFA 1VCIA 4G5GA 3K0CA 4FKBA 2PUFA 2FPUA 2YDYA 3AEYA 4IF4A 1IATA 2Z3VA 3QV2A 2X0FA 2WHPA 4C7MA 1PFUA 1VTKA 2QQ5A 2B2XA 3O75A 2C5LA 1MX3A 4KCGA 3E9QA 3RGWS 1O95D 1V1RB 1Z12A 3GFRA 4I50A 5FUWA 1XCBA 3TOSA 3KB8A 1Z28A 3GFPA 3C8ZA 1OY1A 3C43A 1XCPA 1UPCA 2W71A 2R48A 2YHIB 2A0FA 3L6CA 4S0ZA 5AKJA 4PZUA 4IRXA 3W1WA 3ZWCA 4MVJE 3S1LA 1RI4A 4ND3A 4XD2A 3HXMA 4I99A 1M34B 1KIMA 3KXPA 5JS7A 1MG5A 4PHFA 5C46F 1Q7EA 2HUPA 1YI1A 3NTOA 2DUJA 1A7KA 4P53A 4I9GA 3VFDA 2NVBA 2QZ9A 3NFYA 3UOGA 2O5RA 4YPOA 2QQGA 1L4NA 2EBFX 3PHCA 4IFIA 4LVCA 4ENQA 5TS3A 2BMWA 4EG7A 5JPDA 3L7MA 1Q0HA 2VJLA 3LX4A 3UAZA 3UJHA 2W2PA 2ORIA 2V5AA 1P44A 1G3RA 2VBFA 1UZMA 3Q40A 4NCAA 2FKAA 2C5BA 1KNXA 3BZBA 3CURA 3NT2A 2DR3A 1V11A 4XEUA 3KOWA 3FIUA 1LDYA 2WJYA 4OOFA 3GPDG 4Z99A 4OV6B 5FPQA 1QIGA 2CL5A 5DNDA 3DEIA 3N87A 2WFMA 5J2TB 3U17A 2JD0A 3C4JA 3EZ2A 3F2VA 1N0VC 4C0XA 3QX8A 4GOND 2SCUA 5AW1A 2ZQ5A 4MGZR 4A73A 1FFSA 1EDZA 3M4YA 3T06B 3TRHA 4CKBA 4DKXA 4R3WA 4TLDA 4BTVA 2ODPA 1E77A 2C1XA 2YTZA 3P8ZA 3SKYA 4TXHA 1U0HC 3MJVA 2PYDA 5T6MA 2JC3A 3ZPXA 4G2TA 3FCSB 4CE6A 1JG1A 1D2EA 2CVQA 2JHPA 1G55A 4UM9B 1ACLA 3JZAA 2I66A 2DSNA 2JGKA 5AHWA 1G8AA 4BO0A 4RHCA 4C4TA 4BDTA 2OO3A 5F3RA 4D98A 4YAGA 4KMRA 1MZVA 3QELB 4NOKA 4YVFA 1IHUA 1DXQA 2VYNA 3RSQA 3UAWA 1K5HA 1ZD3A 2YFKA 4PIVA 5FUYA 3OFKA 4N49A 2EKLA 3R3SA 4L8GA 1XF9A 2C2KA 3ONNA 1V5GA 4P3OA 2PY6A 2OP0A 1C3OA 3WLLA 4TT8A 3EZ7A 2ZITA 4GSYA 5HA5A 5ITSA 1T3TA 4K28A 4NHEA 3UJCA 3ONVA 4TVSA 3SZRA 3LOUA 2Z04A 2VPZA 3LHIA 4W5TA 1YDEA 3BCRA 3ZY4A 1H6DA 5IZCA 3ESAA 1WD7A 3D5QA 2WAXA 3AIIA 3M2TA 4AJKA 1RYHA 1EFCA 1WTAA 3U2QA 4RJLA 4YQFA 1UMDB 3FFWA 2H31A 2VWQA 1VPWA 4PCLA 3GGSA 1XNJA 2ZPTX 1ACJA 3SSAA 3IHKA 4FDLA 1QZXA 3P5BA 3IDSA 2CHQA 2FA9A 3BE4A 2FUNB 2G67A 3LCCA 3ELWA 2ILVA 3TBHA 4EI7A 5ALVA 5KVVA 2ZYRA 3KUXA 5K5EA 4YT5A 5J43A 1ZGAA 4M8KA 5A2QA 4FBMA 3OZXA 1VA4A 4EFMA 1S8FA 4ZREA 5LKAA 4HFMA 1ZGCA 5LP6B 3ELYA 1JE0A 4DUGD 4B47A 2AI2A 3QF7A 4J03A 4ASUA 3TQRA 1RPTA 3L79A 1RZRA 3ESXA 5BSKA 3IP8A 1FUKA 2JA1A 2YZ2A 5DWQA 2FWJA 4PQEA 4ZO6A 4XVRA 1I14A 1RXIA 2R00C 3P9KA 3SYKA 2ZRBA 4H4CA 5TF0A 1HQCA 1GAJA 3CVUA 5IM5A 3T1QA 4R7TA 2OVFA 5CDGA 3LPCA 4HAZA 4LDPA 2NT3A 5LYJB 3IAHA 1G20E 1E20A 1WTCA 2A7XA 5C1BA 4D8VA 5KTPA 3F6EX 4B4VA 2PBLA 3PX3A 4Q4CA 1PZXA 3ZTYA 1XHLA 1VZ3A 5TGTA 3CHYA 3G68A 1NF2A 1C7ZA 2OCYC 3O38A 3A04A 2HL6A 4MWTA 1SXHA 1W9HA 3BWCA 3VPHA 3V7YA 4R3UC 3HBMA 5BW6B 1GZ6A 2O2HA 1QRTA 1L5OA 5TMDA 1EH5A 2OZKA 2RKBA 4ZICA 4EW6A 4IKPA 3IJEB 2IT1A 3I5MA 2RHJA 5IBRA 5K4GA 2VTEA 1PUXA 4N5IX 1OD6A 2O7RA 3VOAA 2DERA 1ZSNA 1OZFA 3JZIA 1G7SA 1SG9A 3LLUA 4H08A 1P2FA 4X3OA 3WB1A 3GG2A 2O0MA 3CVXA 1SBTA 3AZPA 1RAIA 2HC9A 4R8MA 5IHPA 1Z35A 4MW4A 2ZJ2A 3F5QA 2B2CA 5I7UA 2Q4EA 5LA6B 1EVZA 1GCGA 1NP6A 1NVKA 3E3AA 3FPGA 5JBNA 1K5GA 2ZVJA 4DARA 2C3UA 1LJLA 2QN3A 3G79A 1SBNE 2ZJ0A 1B42A 2VHWA 4W8OA 4FWIB 1AQIA 2O7QA 4UZEA 1VJTA 3DMRA 2OO7A 3ZI0A 3I52A 4PW0A 3BXXA 4ZEOA 1ZPDA 1CJCA 3WBKA 3C3XA 1LSSA 4P38A 2FZ4A 1DQZA 1TADA 1DOHA 3GYBA 2PTGA 4PGFA 3GEPA 5LVAA 1IBKB 4BE9A 4I5DA 2C9MA 1XTIA 2Q2QA 1E9EA 3CBGA 4Y3UA 4Z1OA 3WX0A 2VXOA 5K6AC 1OIXA 2RAUA 3ND6A 1MO5A 4PRYA 5CDUA 3U7QB 2V1UA 1WA5A 4JFAA 2HDWA 2E6UX 2BKEA 2FFQA 5CDTA 1PV2A 4FS3A 2PKRA 3EXG1 4LQDA 4ZJZA 4JQYA 2AW5A 4Q93A 4W9NC 5GZ3A 1EESA 2QL9A 2HMWA 1VJ0A 1X42A 3BHNA 4Y7CA 1PGJA 3GCGA 3KQVA 3SJZA 5I7OA 2NZVG 1O58A 2R7AA 3A1SA 3DLPX 1T1SA 1VIMA 3B6KA 3K1ZA 3D5EA 3EPRA 1OU0A 3CEHA 3QVSA 2Y1KA 3FYUB 1Z0KA 4KXWA 4JP8A 4F2HA 3EASA 4K9QA 3RLIA 4DDUA 4URXR 1A3CA 3ZD7A 3SMVA 1JIVA 5MN4A 5K6AA 1GA6A 1GJRA 4U2CA 2ZJ1A 5ECWA 2PLAA 2VP0A 1FQWA 4NOJA 5H80A 3DZGA 1IAVA 3AEQA 1P61B 2JFZA 3PCXA 1FLNA 3FIJA 3WTBA 1Z6QA 4MINA 3QA3E 1QBKC 1THZA 3UWDA 1AMUA 1XTZA 3UJBA 3L93A 1HFKA 3DDCA 1J33A 2J45A 2HBRA 2PA3A 2CNWD 1Z5GA 2Z2KA 4BO7A 3DZDA 3P9CA 5FBLB 2H65A 2QPAA 3HDGA 3RUFA 4D3SA 5BVGA 2ZIEA 5KHLB 4KL8S 2WTNA 1B0PA 1D6MA 3GLGB 3VZBA 3U0VA 4RIEA 4U7DA 4KIUA 3EIFA 2PKXA 1B3BA 4LAFA 4OTZA 3I12A 4FEEA 1R15A 3NM4A 1ECBA 2CMKA 1LDBA 5GVRA 2CFCA 4NCNA 3ZHCA 1CY4A 1QCCA 4QJ5A 3N2LA 3LZ6A 2UUCB 4MB6A 5E7QA 4MPDA 2R3SA 2XUZA 5AKZA 1GU7A 2W6JA 2H92A 1XI2A 3CUEF 3DSRA 4YPFA 3ZHTA 4CEIA 1JQ3A 4WCFA 3AXSA 2CHEA 1CC1S 1Y82A 2C31A 3I1JA 3JYOA 4G1BA 5CJ2A 3ZXSA 4FX2A 3IGFA 3FB4A 3AV3A 2WTUA 3GRFA 4IH1A 3UB4A 2WM2A 1YMQA 2I9PA 3SF8A 4MV7A 2I3DA 2H2IA 2V3WA 2P2SA 2GF9A 4LYFA 5MN6A 1ACMA 1CVIA 1T9GS 5K8CA 5L45A 3K73O 5JH7A 1B74A 3O2JA 4J2OA 2AFIB 3N6RA 1FSGA 2E37A 1EPUA 3II6X 3PHBE 3ZHXA 1SXJC 4R9RA 2ZPUA 1R5JA 5KJ6A 4JA0A 2PD3A 2B5OA 2BJHA 2AOWA 3UH1A 4ZRMA 1SURA 4PTYA 2FQWA 3VSAA 2BR5A 1U3GA 1EX7A 4M88A 1Y1SA 4MQBA 1DHRA 1EMDA 1AZSC 2P4QA 3A9WA 4NICA 4B3IA 1EWYA 1H2FA 1IM8A 2HRBA 3HXPA 3IPXA 3RANA 5BN4B 1M0EA 1FTGA 4W5HA 3ZKAA 1CJSA 4A23A 3A1DA 3AF5A 4FHZA 4E5YA 2AFIA 5EZ6B 4PN3A 1CWUA 4IVNA 2PZEA 4J6FA 4FR2A 4IG4A 4IXWA 4MVJP 3Q3GE 1XLWA 3Q7TA 5AJUA 1NXQA 1KI8A 4LYGA 2VDLB 3IDOA 2J9XB 4DLBA 2CXRA 4G4IA 4YRIA 3TGWA 4YMVA 2GZ3A 1R66A 1ZU4A 2YNMD 3JASB 4G4SO 2DBQA 2ZDQA 4D56A 3LUHA 1SVKA 2HXYA 2D59A 2OZLB 2DOKA 3E6AA 4BX8A 2BH2A 2O2CA 4ZMSA 1KZ7B 2NW6A 3QMWA 4N5LA 4KXMA 1IM5A 3EGCA 3I2FA 5FTNA 4Y1RB 1TAUA 3G7UA 1GYQA 2PEZA 2XYHA 1HDCA 3WAKA 4ZYXA 5IN4A 3S44A 3NALA 2PXCA 2PLRA 1BFUA 3HB5X 3HO8A 1AY0A 1SXJB 2CNLA 3GELA 1TF2A 4J76A 4OHZA 5BNZA 3HEAA 2I4NA 4BJ5A 4J2HA 2OT3B 4Q3NA 2YRXA 4QGFA 2BT4A 4M8LA 3RKSA 3F67A 3CLHA 4WGFA 1JLRA 1MTZA 3M3HA 3TZ6A 2XF2A 5AM1A 1GFWA 4CCAA 3B6EA 3I45A 4R51A 5JE8A 4ZI3A 3ONWA 2QYOA 3R5FA 4L5YA 5DI3B 1UJMA 4NU8X 1MJ5A 3CGWA 1CR0A 3MZ0A 2MYNA 4JT4A 2R8ZA 2VOJA 2ZIAA 4EGJA 1PV4A 3GHYA 2UDPA 3B3QA 1BS2A 1G3MA 1G7TA 3TQCA 1ZD5A 1W93A 1ZL0A 2ZYDA 5JMOA 4JL5A 1GLNA 3CW9A 3SHVA 3MBKA 2UYQA 3TF5A 2AW3A 5ES3A 3RS3A 821PA 4UDYX 2HFKA 3ONFA 4UKDA 1B6SA 3AFMA 2GB4A 5I9BA 1X80B 3NHZA 1KH1A 4XWGA 2CSXA 3C3JA 5AESA 1Z13A 1YONA 3RWOA 3I2KA 5JQGB 4PC2A 1V3QE 3U3JA 4F38A 5HBGA 3D3KA 5TEWA 4DIEA 3TG8A 3CONA 4RDXA 4DBZA 1N6NA 3LIIA 4NYMQ 4EA7A 3D2AA 3F7MA 4KRYA 4C7VA 3AUJB 3ESCA 3H5IA 1Z7BA 4RHFA 1UAAA 4FDAA 1NMSA 2W2QA 2QTVB 5ED4A 2HGZA 1BIFA 4B6EA 2IHTA 4NCHA 2QQEA 1EDDA 2R9VA 4WBNB 5M3BA 1MD9A 4AS1A 4B87A 3P9YA 2ACVA 2HF8A 2CXSA 3GUHA 3RBXA 1IXSB 3JARB 3H8WA 3HG7A 4N82A 3ZWVA 5I7HA 4E09A 3RWMB 1J22A 2QTHA 4WZZA 1E2LA 3NRBA 1CIVA 3X2FA 2IZ7A 1R6TA 2YWEA 1SD5A 2INGX 1Z6PA 3PNKA 4HOYA 1HETA 4ALMA 4R0MA 1RZUA 4WZAB 3UZUA 5DCUA 1NVVQ 3FGOA 4AKTA 1K2VN 1LQUA 4TLMB 2JJ2D 4NZPA 5DPMA 1G8PA 3TK1A 5LLSA 1GV1A 1QFJA 3PFKA 3V3TA 4RQAA 4XDZA 4QGGA 1CLUA 1CQZA 3F9CA 4MROA 2AG0A 2FXIA 3KPWA 4LX0A 3RU9A 4ETMA 3LO5A 4GBMA 1Z68A 1SELA 1D2GA 1XLTC 3SICE 1ETHA 2GAFA 1PG5A 3LL7A 3OZSA 4C76A 3KXLA 1GDHA 1IXKA 4BKOA 3ZDZB 3NIGB 3THXB 2AWNA 3IVCA 4P98A 5HZGA 3MVEA 3GDFA 4BWYA 1KXJA 4LBWA 2JI4A 3ZGOA 3T3DA 4XCVA 5JO9A 2W00A 1FL9A 2GLTA 3NIBA 3Q2KA 3PP8A 1BCSB 4HR7A 1F4PA 4JOQA 4XRRA 4BVKA 1CUSA 3JALA 4FNMA 2X2OA 1DUVG 1DGQA 1C7FA 2B8TA 4CG1A 2PGJA 2QX4A 3TPZA 4EHFA 3GJYA 4RWEA 2C7RA 2RHRA 3TE6A 3OE7D 4MMZB 4FYKA 4KQ1A 4TXNA 1N2ZA 1OTHA 1VYTA 3MD0A 3SIWA 1EQ2A 3OOHA 3N7AA 1JQLB 1BGXT 3H19A 2EZ4A 4BL5A 4EVIA 4DJTA 4LFAB 1GARA 5AJXA 2ZYUX 5FL7D 5EJ2A 3KQYA 4GWLA 4U7PB 4YP7A 5K03A 4X63A 5DJ5A 3HB7A 4H3VA 4U63A 3ND7A 3N2ZB 4OK6A 1N7HA 3ENWA 1KE2A 5K0TA 1I5RA 3X1ZA 5SY9A 5DHPA 2DPLA 1QH8B 3ZWMA 2UZ4A 4CKCA 4D96A 5T8KA 1UH5A 5IX8A 1NY6A 4KR9A 5AUOB 4R6XA 4TLBA 3TQOA 2YKGA 1HSZA 3VR0A 3KJEA 4JP3A 4B6SA 4BMNA 3W2HA 3KYBA 4E7OA 1PEKE 3ORHA 4Y2QA 3WSWA 5CYFA 4MPTA 1ARZA 2GJ9A 1BRTA 3DNMA 5CB8A 2ZUSA 3P2EA 3GLUA 3EVZA 4M8IA 4JI1B 4LMAA 5B7NA 4BU1A 1DO8A 4LRSB 4EBBA 1Q0UA 1EFVA 1L4EA 2F3QA 1NN5A 1QUEA 1E58A 3RFVA 3CT6A 1NJ6A 4FUQA 1V9CA 1SC4A 3G0OA 4BLOA 5K4HA 4P7FA 1F12A 1ONSA 3BA6A 3EZ9A 4GXQA 721PA 3ITKA 4IBOA 5A5DA 4CGYA 4MKXA 4KDRA 5AJYA 5KYYB 3FUVA 4EKGA 1UT8A 2Y0BA 2P4SA 2G1PA 2YXDA 2IDKA 3HEMA 4RANA 3SEFA 1MQ8B 2GESA 3EWAA 4AZTA 1CFZA 2H1IA 5LQJA 1ZEJA 1KI2A 1Q44A 1YWGO 1N4DA 1DC8A 3TW6A 4DGQA 2C88A 2GDZA 3ENKA 4CEJA 3G2LA 1WVIA 1CIPA 3P0HA 3AUXA 2WILA 3ADPA 2FMTA 3W6UA 3V9AA 3VNBA 4S3MA 1OHHA 3W6ZA 1P1KA 5FUMA 1MDBA 3V3KA 1B0UA 1CS4C 4US1R 4XJVA 5HMMA 1G2QA 1W9MA 2QGNA 1XA3A 5H3CA 1SHUX 1Y89A 2XGMA 2ZSKA 3GLTA 4YCBA 1TMOA 3BH6A 3GFVA 3UGTA 4D46A 1G7RA 1UBCA 1QX3A 1YRLA 4LJ6A 3KJXA 2CF5A 4GYKA 4KGZA 4QOIA 1Z0UA 3PNVA 3DOJA 2NO7A 4QARA 3TOXA 5HK8A 4DY6A 4JEMA 3O74A 4AO8A 4H60A 3SNHA 3IQWA 3D7SA 4QG3A 3P0EA 3CG4A 2X5JO 2QTNA 4MQFA 2QJRA 3EMKA 4LJSA 3PGMA 3PJGA 2UKDA 4L7VA 3ZV3A 3IIKA 3OA0A 3SYMA 1KWGA 5BR8B 2PFKA 1KO1A 3DWFA 1SIWA 2P6PA 3V80A 4EGSA 4BMPB 5DF1A 2O0KA 4DM3A 1GQOA 4X20B 4AXBA 2WWFA 1EZZA 1PIWA 3ZWPA 2JG3A 4BZQA 1BH6A 1I1HA 4TKVA 4RLSA 3OBIA 1NMQA 2IEGA 5C7LO 2BW0A 5IJAA 1RP7A 2VYQA 2XZPA 1WP9A 5AJTA 3SQDA 4CIYA 5TX7A 2ZUBA 2H51A 2XCOA 1N92A 2ZKIA 2Y1WA 2GN2A 1ZBQA 1MNQA 1TT7A 2R97A 3IC5A 2FCRA 3PR2B 1UFOA 3JQDA 1RVDA 1GUFA 1WR8A 1SU8A 1DUIA 3BREA 1L0BA 1AOXA 1NUUA 2N3ZA 3EGWA 3MBOA 1DKNA 5AIBA 3MJ4A 3FNEA 3AJ9A 2VKTA 3VSBA 4DSZA 2P9CA 3GNSA 3DWEX 3H5WA 2WE7A 1LK7A 3EQ8A 3D4IA 1XD8A 4WBSA 3RVRA 2HYIC 4WLOA 1UFRA 1K86A 2GFIA 2VUIB 1AHPA 1NW3A 1DIGA 2A33A 2PUTA 3D4NA 4DBVO 4PG8A 1SC9A 4RA6A 1L8AA 4YIHA 2FB9A 1JLHA 3GP5A 3JVIA 3V8BA 5BXQC 1UT5A 2AKAB 2WF8A 4F4CA 3UKOA 1KPIA 3ESDA 3NBKA 1GTVA 1JAXA 2ZRIA 4HX2A 5EKDA 4FYWA 3JV7A 1NUTA 4NJOA 4W9MC 2OCPA 3AZQA 1LVGA 1HE1C 3HV0A 3SEZA 1L4KA 4YRAA 1N2CA 1SZCA 3QVKA 2FAXA 4I46A 4LYJA 5IRCD 3K4PA 3WE7A 1QXSA 2VRBA 2CE2X 1F9AA 5DNWA 2JKYA 2OOSA 1IXYA 3R3ZA 4G81A 4QT4A 3ZXXA 3TI7A 1WF6A 1ZN2A 3IE2A 3HJBA 5DFAA 2Y92A 3TFQA 2OORC 2W98A 1PI3A 2BFNA 3LC1O 4CLOA 1DRWA 4ZU6X 4BNYA 5AW5A 1J8DA 4JB2A 2R1ZA 3L84A 4JKOA 5ERYA 1GCAA 3IB3A 3DDUA 4FMCF 1G66A 1AGRA 3L06A 1MO4A 3NOOA 4CKEB 2I6XA 3BCHA 2FF5A 3DO8A 4QPJC 4KOEC 1G8MA 5CFNA 1ZMBA 3KQLA 3AETB 4Z4GA 3R9XA 1GV0A 4L74A 1HL7A 1A7JA 2D1RA 4IUCS 4JOBA 4LUCA 1DPGA 4M53A 4TVOA 4WFJA 5FAXA 5IYZF 2UVPB 3EC2A 3N8DA 2JAOA 2VSOA 3EMBA 4P7KA 1PR6A 3UGKA 4EPXA 3CVYA 4XJSA 1LGYA 5NULA 2P68A 5F7XA 2IYSA 4MS4B 4CKCB 1PFWA 4ZAYA 1Y8QA 3PQEA 1DT5A 4J3JA 3HCFA 3JAKA 1EK0A 4RLHA 4MR9B 4PYRA 3FAZA 3ZOKA 3SHFA 3N07A 4M6WA 4EY7A 2BFOA 2OYCA 2BDTA 2DWPA 3SYRA 1PT8A 4P4LA 1P1RA 3LQYA 2AXEA 3A32A 3D54D 4R2JA 5CA1B 3U7QA 1GILA 3S55A 3W8NA 4E0BA 3L9WA 1P8JA 3GCZA 3PX2A 3B52X 1OE0A 4JJIA 4IFEA 2E1RA 2ODQA 3KJNA 4QT0A 1ST2A 1P75A 1TD1A 4L9RA 2LUOA 1E4EB 2B8NA 2ZEJA 3NTVA 4RKWA 3FNHA 4R01A 4TSKA 1AUVA 3O2NA 4M7WA 3UV6A 1U2PA 1IN6A 2HIMA 1YCDA 3TTTA 1CUXA 3F6PA 4KAFA 3TGLA 2Y1XA 4BQQA 1FP1D 5ANRB 1BMFA 3WP0A 4YCDA 1G8FA 2HCBA 2XUDA 4FVTA 1Z29A 4YMWA 2LVBA 5K3SA 1SXGA 1C14A 1ZW6A 1ZICA 3FZEA 2P77A 3ZY6A 3QK7A 4OGWA 3L6UA 1CZUA 2I3GA 1U7ZA 1QH8A 1DWPA 1FMTA 3AUAA 4YRMA 1XROA 1WSAA 1F8UA 4RMGA 4UQLA 2Q6VA 1OXVA 3RVJA 1IXRC 4OEHA 3VOSA 1Q12A 3DXYA 5GGYA 3C6ZA 4XIFA 4HDMA 1NZFA 2OWEA 5DTIA 2GZRA 4DDVA 2QVCA 2Z5FA 3BCUA 3D64A 4R2LA 3N86A 2OLJA 5AKKA 1J9GA 1NOKA 2VDQB 4S2UA 1T1JA 3QFSA 3RREA 2QRHA 3RAFC 1ZR2A 1XR3A 4O63O 3T35A 3GARA 4EMTA 3H2KA 3QQ5A 1KYYA 1XDDA 1EBFA 3EE6A 3K4QA 4G26A 1B2LA 1N6LA 4QPNA 3IXQA 1NDUA 1Q6ZA 2I6TA 1LU9A 4Z9YA 3TLKA 5BQFA 1H05A 3DBRA 4JGBA 4ECAA 2FQYA 3K6KA 3C14C 5FXMA 3AY3A 3FRHA 4J29A 1WD5A 4XZ3A 2REBA 5DULA 1DEAA 2WUFA 4G0ZA 4PLYA 2O3TA 3U6BA 1OCEA 5FCDA 5AK4A 3SX0A 1I0ZA 3I6IA 3S7ZA 4DLUA 3SE7A 1FCJA 5CA0A 3RUCA 1M83A 2PR7A 1LI7A 3F2IA 2NIPA 1FUIA 2V6FA 2QM0A 1M34E 2PZKA 2VSQA 5ALRA 1J97A 3CGGA 1P5FA 2FWBA 3PZBA 3CVVA 2IH2A 3MFYA 1N7IA 4NZYA 1E2MA 2OG1A 1EFPB 2XTAA 1JMKC 3OG9A 4H6WA 4QRHA 4RULA 3FUXA 1GZUA 5K0ZA 4AYTA 2DETA 1ZIDA 4I6GA 2QSJA 2GN0A 3AFOA 3GVCA 5FUVA 1NYRA 1JPVA 3E9DA 4M1ZA 2WMOB 4WBNA 1RKUA 4Y0VA 4M9SA 5B4VA 2A4MA 1C8VB 3FM9A 5IFKA 1K92A 3NVKI 5J2UB 1EFRA 4HZUB 4RJ2A 4DC9A 3DDSA 4G65A 4R68A 4EATA 1LEHA 3EAGA 1AUQA 3IMFA 4Y6OA 1LNQA 1L9XA 4L78A 4FMDB 3B8EA 1WDWB 4V39A 3B70A 3VKWA 1P9OA 3F8TA 5E6UB 3UA3A 4PCUA 3WGZA 5A7HA 5IT9A 1C9DB 2C1ZA 1IOVA 3OPYA 1ISSA 4LSZA 1SPXA 3WP1B 1V39A 4KYUA 4N5DA 1PSZA 2IX9A 4Z86A 4Q1EA 1RE0A 5FOWA 2ECPA 1I01A 3V6MA 1PFGA 2XKJE 4II3A 4TROA 3ZWQA 4L8FA 3B8HA 4I55A 4NJMB 4E32A 4MWEA 1U6IA 3I9FA 1U5BB 1DJLA 1W30A 2O8EA 1V2GA 3CLVA 4C1BA 1TAGA 5G3ZA 4D02A 5KKCA 1DDOA 2WTEA 2NYRA 4YJ2B 4H1UA 1SC6A 3RJMA 4CQMA 4ERNA 2OGUA 1KFBB 4KYVA 3V46A 3TKAA 2PSHA 4BFSA 4DLRA 5AUPB 2XECA 2RH5A 1XPJA 3V34A 2WF9A 3QH4A 5LR6A 3DE7X 1JNXX 4R9VA 2RGNA 2VNAA 4RQTA 1M2HA 3E9MA 4I3HA 2O48X 2X14A 3GOQA 3OICA 4FHFA 4NR0A 3E2MA 2BKUA 4KN6A 7ADHA 3P19A 1C7RA 1U8XX 3E1SA 4TX1A 1CJVC 3N8IA 3FVRA 1W5SA 2QU8A 4MUMA 3W8EA 1LRLA 3WB2A 1CEQA 2ERYA 2IU3A 5KNCH 2EX4A 3MN1A 4OQDA 1CRZA 4LJRA 3M9WA 3DMHA 1GRVA 1KI6A 1QVZA 2YZNA 3FSEA 4NAVA 1TRHA 3ZQUA 4D41A 5L40A 2HN9A 3F7TA 4IZ6A 4QUDA 5E6SB 1XRNA 3EVAA 3NWJA 3B5EA 4J0FA 3WXBA 3OEHD 4QXAA 3PUIA 3VZPA 1WMAA 5DYWA 3AYZB 5JYBA 5KTTA 3UB2A 3R9XB 1G5IA 1ZESA 2CXPA 1MO2A 2CMGA 3NR2A 1XZQA 3VR5A 4ZAVA 4W1SA 3HDHA 5EGSA 4BKPA 2CEKA 1BOFA 4DLSA 5L7YA 1SUBA 2QM7A 5CT6A 5DKFA 4J9VA 4EWLA 4M36A 3WIDA 3QMMA 1XAHA 2PIDA 5DSXA 1JKJB 4GKKB 3TS1A 5JC1A 2DH5A 1P7VA 2GT1A 3UG7A 4IO1A 1T5DX 3ZN2A 3G5UA 3L0IB 3BL6A 2P2YA 2XKAA 1EXMA 5T8KC 4DQ0A 5I47A 3H7IA 3E1KA 2AFHE 5SZHB 4ZCSA 1NKSA 4DJDC 1O4VA 1WPXA 1XZCA 3GU3A 4MLCA 4N1AA 4AJ4A 2G1KA 3IJ5A 2ECFA 3CKYA 4QWWA 1U1DA 4I7EA 3WLSA 3NYWA 5LFAA 2V54A 4JYBA 3PC7A 3OFVA 3R4VA 3UFXB 3GN2A 4DDWA 2LCIA 3WQQA 3REQB 3A6KA 3FJYA 4GNRA 3ROPA 5ENVA 2ODBA 3OU2A 4F9TA 5JYEA 2X40A 4AG5A 3TZKA 4NS1A 4O29A 1E3QA 4CM8B 1OBHA 1NPYA 2X8AA 2F1KA 1DEKA 1REQA 1TDJA 3BIXA 5DIFA 2HHCA 3GVIA 4V0MA 5IKPA 3NBQA 4URFA 1OHHD 1IWBB 1W4LA 4O2AA 4JSRA 1E0KA 1MQSA 5BWMA 2W2MA 4JHXA 2VK2A 2B7BA 4L9AA 3I1YA 1QWOA 2QPOA 2I29A 1R6AA 3CEAA 3UJ6A 3G2MA 1NXVA 2N47A 2O54A 5CM9C 4FQ5A 3HKDA 1D4ZA 3PNMA 2OL4A 2PQ0A 4IXMA 5SV2A 5CCEA 1TK3A 3DKRA 3L7OA 2R4TA 2XQJA 4GRIA 1PUJA 1PK7A 1J09A 4GBJA 2FW1A 4ZO9A 2B82A 5TIIA 2JGRA 4IDDA 1EJ6A 1VLQA 4UULA 1UJ2A 3VR6A 3KQKA 1O08A 1TCVA 1PLLA 1MRSA 1NI5A 2GEDA 1N5RA 3BIOA 2VQSA 5A3VA 3K2QA 1R6XA 2YBDA 1K89A 1R8QA 4FUTA 2O1SA 2X0DA 5EWLB 2HFJA 1OQAA 1CRLA 3IBSA 2BE7A 3ZI4A 3K2EA 1ZD1A 1PJBA 4IEIA 3FFBA 4PX5A 5HJ7A 2Z6QA 3I83A 4NBKA 1RI1A 4OYLA 2PZBA 3P27A 4JB3A 1IHDA 2A5JA 5JPIA 3SLGA 1SZDA 3BWDD 2WWYA 1YRAA 1XXHB 2EJWA 3L6DA 4MHOA 3IXLA 4XUDA 2WNIA 4WJKB 3DJYA 2F1OA 2V98A 2QVLA 5JRZA 2QLFA 4E08A 1I3MA 1RRFA 3K9QO 3THRA 5A3JA 2GXAA 2OE2A 5DNAA 2W2OA 3BFPA 4US0R 4ZQBA 1JLMA 1GEGA 4RKRA 4XYEA 2QTTA 5CW2A 4U7HA 1DT3A 3DE0X 5F76A 1VSUA 3F3KA 2OBXA 1K7FB 1ZXBA 4LV8B 4UHCA 1XPRA 1K8QA 1JH9A 1CUJA 1E66A 1WW3A 4EHNA 1NULA 4EUEA 4XSVA 2IUFA 4HVAA 4OGGA 5IDVA 1FXSA 3WRXA 1NNI1 3E7XA 5HFNA 1N5MA 1QNFA 1V4VA 2AZ4A 4G3XA 1PT7A 4AYWA 5K6TA 2H5IA 1V8ZA 5FBKA 3EDMA 3VPFA 1NRXA 1XD9A 3N0TA 4GDFA 1R9MA 1KPHA 1XKQA 2ATCA 3A9VA 4GI1A 4GR5A 4JBNA 1GAXA 2UV8A 3VJRA 1C9MA 1WXFA 2OZPA 2BONA 2E3JA 5EKUA 3B7GA 3R9KA 2QAGC 4MZDA 4F5DA 2VI5A 1GZ5A 3D8NA 4RCYA 2JFHA 4NK4A 4OK5A 1AC5A 3FSJX 4HB3A 1CB7A 1LBQA 4L76A 1IM2A 2CNNA 5IANA 1K5PA 4NFHA 4RETA 4FMCB 2W4IA 3WC4A 3A2NA 1ZOSA 1Q1AA 1E5VA 1T35A 1UAGA 3WSTA 4CMEC 4QM6A 3Q3CA 3FZYA 3H0KA 3G2NA 3JQFA 4UHDA 3VI3B 1BWPA 1U8UA 2J0UB 5BO5A 4DMFA 4YCAA 3VVBA 2CMHA 2VRNA 1N2GA 2R7LA 3G0BA 3SS9X 1RXCA 4MZXA 4FD2A 4QO7A 4M9ZA 3DPUA 2CEAA 4Z3OA 1G64A 5JIBA 1KKMA 3NJ4A 2GZHA 3RYIA 2I4RA 1Y3IA 3WHKA 1XRSB 2NNWB 3BMNB 3H2GA 4AZ3A 2B83A 1YR3A 3NXSA 4E3ZA 5BV8A 2WPDA 4EL0A 1U02A 2ZZNA 1VG9B 3QXCA 5LB4A 5CTAA 3E4CA 3ERCA 3DZKA 2VP2A 2YFHA 1OH5A 4ON9A 2C5HA 1T8RA 2FP4A 4N0PA 1QHGA 1RWPA 4MA0A 4WV3A 4CMIB 4OP1A 1FRQA 1VHWA 2FSVA 3B1VA 3AM5A 4CIDA 4YCLA 1TYAE 4NZ9A 5GMOA 2YMQA 1RQXA 3K6JA 2PCJA 4QDXA 2BEJA 2ZATA 3PIRA 1T10A 2EW8A 1U2QA 3DDWA 5ALEA 3ROFA 7REQB 4DVGA 3UJ3X 2IELA 4FCVA 5IZCC 1N1MA 1HMPA 1X77A 2WFLA 1X7ZA 1A88A 4GMGA 4QL3A 4PF1A 2VZEA 4F2DA 3N8HA 4PC3A 2Z1NA 5D7NA 3E27A 1GEEA 1H65A 3KAQA 4PGAA 3DCJA 3T5BA 4BS9A 4L1KA 1J9ZA 2LKCA 4MB0A 4IIJA 3WKEA 3T5DA 1QHFA 3E7DA 3VNUA 1LY1A 4YV0A 4M1OA 1GPKA 5A1JA 1DCFA 1G2IA 1KY2A 3UKDA 2O07A 3ZCTA 2XXAB 3HCCA 1UMBB 1V8OA 3D6VA 3KEMA 4GC5A 4K6HA 5B1HA 4ND6A 1BYIA 3ZHQA 2SNIE 1J0CA 3AVVA 3CE9A 4C43A 4DLKA 1P7PA 4UM5A 3GEGA 2BSAA 5HKAA 4N48A 4C29A 1H0SA 3JQRA 4ND4A 2X8BA 1KBOA 3HCNA 2IYUA 3IHTA 3INGA 5JI2E 1T2EA 4P1ZA 3ZDEA 3OHPA 4QJ3A 4M0LA 1Y0BA 2XDWA 3PTZA 4KVAA 5TQJA 4IWXA 2P2LA 5KTMA 5L8VA 1TVCA 3HWWA 3A6FA 1F2UA 4QUJA 2HW8A 1XRPA 4UCFA 1KFKB 3SYLA 3ADOA 4HDMB 3OCUA 2ZSAA 4BAZA 3CEMA 5KYXB 3UWKA 1SKMA 1NN1A 3RB8A 5A5VA 2RD2A 4DM7A 4RIGA 4QXOA 1FTSA 3M1YA 3VU1A 4XX0B 1K8RA 3LDGA 4PC1A 3KHKA 5BSWA 1T9CA 3Q8XB 1FU4A 4RJIA 1SZJG 3VVCA 3K70C 3OLCX 5JEEA 4I36A 5A3SA 1SQFA 4HB2A 2UAGA 2PV0A 1KMIY 1X92A 4O4IA 1GNQA 2FOXA 3JQQA 1T0IA 1UJCA 1UWLA 4TM7A 1CJTC 2VAWA 4URYR 3N6XA 2GEKA 4P3YA 5JXIA 2IXEA 1I2BA 3ANYB 3T6KA 2D2IA 1W1IA 2FPIA 1JQKA 4NL4H 4Z4FA 3HP1A 4J16C 5DBFA 1A9RA 1FFWA 1QAMA 1SUDA 1U0RA 3GRVA 1QYXA 4LJLA 2XVMA 2PJDA 3KSMA 2MR6A 4OYYA 4F3CA 2GXUA 4PYOA 2QBYB 4W1QA 1J0DA 3P0RA 4FDMA 2JCXA 2W37A 4G5RA 3T9AA 3TI9A 3WL8A 4MV9A 1XKLA 4MLPA 1V5WA 3B6MA 1ADGA 4OB8A 4CFSA 2W58A 4EP1A 2BFFB 3EIEA 4EABA 3M9LA 5E7IA 1E1DA 4YBRA 2C8KA 4PAOA 1EA5A 2BKAA 3IAS6 1SVUA 1U5AA 4MQMA 4MS3A 3WL7A 2J5RA 1KVUA 1CUFA 1U11A 2H0RA 1NJ2A 4LE0A 1ISJA 4WXYB 2WWWA 5L3RA 3GJ6A 4BMOB 1KEWA 4CG0A 5IEJA 4ZEMA 1CUIA 1HM5A 2FFHA 1O8BA 5LSAA 2VYFA 1RXUA 5FQOA 1N2CE 3BZUA 1YJCA 3UPUA 4MDFA 2XMRA 1MW8X 4HB0A 3OZGA 4ZXPA 5JCPA 1PTJC 2AVDA 2CLSA 3DM5A 3EGVA 4TRMA 3TRDA 4DDTA 1MGPA 1RXEA 2CJWA 4FZ3A 4E4YA 3VPCA 3ZUPA 3L6EA 4AUNA 1L7RA 4AUKA 1JT9A 2G04A 4W9NA 5FI5A 5J5VA 1RC0A 2B25A 3M6AA 5FBWB 4B3DA 1CRPA 1LS6A 1QPBA 3CM0A 2ZJ8A 3G2KA 1HFEL 1M6VB 4I3FA 4YJFA 3A4MA 3Q5EA 2HWKA 2OLEA 1B8UA 2REQA 3LBHA 3QX9A 4GZ6A 2A88A 4BBPA 2H4JA 5BYKA 4WGGA 2X0EA 2QNRA 2ZP1A 3LT4A 1QG2A 3VZDA 2FSIA 4CBVA 5KNCD 3BZWA 2BGMA 2V3VA 3EB9A 4IJUA 1Y7IA 2GBGA 4MYDA 4ACBA 3K6SB 1H4VB 2JF0A 4QEDA 5KJEA 4WOBA 5EJFA 2CXTA 5BSMA 2WWXA 3IO5A 4CF7A 5CXUA 4QBTA 2I80A 3IUEA 3I04A 4MQFB 3R75A 4IMPA 2IXAA 3OLWA 421PA 1TZJA 2VLIA 5DTJA 5U9CA 1E6EA 3WLPA 4B7XA 1ZZEA 3Q7EA 3LQQA 3TSCA 1DDIA 2G76A 2OCGA 2X7XA 4RX1A 2ZWPA 3LDAA 1T2DA 3G0CA 3COPA 3OO1A 5JRJA 1TVEA 4PXSA 2JLBA 2AUNA 3ZQ6A 1PQUA 5G02A 5DGTA 3FSRA 3EZ6A 1Y8CA 2MCFA 3IDQA 5ALNA 1ORTA 2DJ5A 4XPZA 4TL7A 2VYVD 1DIRA 3VYTB 4EECA 1MG0A 3SF0A 4MSUA 4CU5A 3DVAB 3KD3A 2JH8A 4DR3B 4DRXB 4KVZA 1FDRA 2IHBA 1HGXA 3GZNA 1GT6A 4Q4DA 4RE5A 3DUFB 4BNDA 1SXQA 5ALYA 1PR4A 1KRXA 4COKA 1G6HA 2DUMA 4Z0TA 1EVKA 4TWZA 3PKIA 1JLLB 4YRGA 3B2QA 1JF8A 3ED1A 1T8TA 4FEGA 4KGVA 2ETVA 2P9JA 2RGUA 1NDHA 4UEKA 3R6LA 1E9FA 2PAAA 2VDWB 3PVCA 1BD4A 1RI3A 2R1UA 2HEIA 2PR2A 2ZIUB 3LP6A 3O2QB 4KK3A 5ESDA 1LSJA 4R98A 3UAXA 1N34B 2NSLA 4EUFA 1X9HA 4AB1A 2YWFA 2XUPA 4HXYA 4UOQA 3WYEA 1WP4A 2RBEA 4F3NA 4HLQB 5AVTA 3R41A 4MP6A 3AV0B 4B7ZA 2YW9A 3R76A 1WLYA 4S1PA 4QPDA 5E2IA 5FOUA 3HI4A 2HZ7A 4LJ9A 1UBFA 1VIYA 2Q27A 4LJ7A 4OYRA 1E2EA 3IFSA 1G8GA 1H42A 1XZLA 1GQFA 2OAP1 3NU1A 3PGJA 1EI9A 2H1LA 1SKAA 3MWDA 3W7VA 4MO2A 1QVVA 1SA0B 3BE6A 1ZLYA 1IFXA 3CFYA 1XJ0A 4Y6QA 5DNEA 1Y7TA 1PWXA 2WYOA 4Q16A 4KBYA 5GWXA 5H70A 5DHQA 1LZLA 1R4ZA 1JJVA 2C0CA 3MTDA 2VNSA 3WWOA 1ZKMA 2ZI9A 5FPTA 3FI9A 4N12A 4Z7OB 1S7GA 3D81A 1ISIA 4DNFA 1BQ3A 3PUYA 1RAFA 3CZAA 2QQ0A 2JIBA 4RGBA 3SXUA 3PC6A 3SY8A 3D8UA 1SCNE 2GK4A 2VH5R 3CRVA 2NTEA 4G25A 5H83A 1DBSA 3G23A 4J07A 1ZN9A 2V7QA 1D4AA 4UU7A 1C1DA 4BECA 1UBRS 4UAJA 5JSYA 1EGMB 3AL0C 2FFRA 4DG8A 2VPWA 3PNQA 4BNKA 1AV6A 4N3NA 4WA7A 3QFHA 4R1NA 5CFPA 1BJRE 4ZOBA 2OFWA 4UVDA 4Z8YA 3NEYA 5IUKC 2H1FA 2I6FA 4FHDA 1BHSA 1PNQA 2GRUA 1GIAA 2J09A 4NC9A 2JLXA 3GT4A 2B4RO 2VPYA 1EHYA 2GZDA 4JKIA 4BLUA 1O9HA 2Q1UA 2XLCA 2YXBA 4EGQA 5EQDA 1E0JA 1XQ6A 3BL8A 1GGJA 3L5OA 2JL1A 3WKCA 5HF9A 4ND8A 1R0CA 1CJKC 3NYQA 4G36A 4ZAXA 5B1DA 3UBTA 1GITA 1PL0A 1ZK2A 2HBYA 5JD6A 1K0FA 2GPJA 4L4RA 1CRWG 1T5IA 1CE8A 5H4GA 5LD2B 2PV7A 2JBHA 1AKUA 3SBOA 4EW1A 5CG1A 3CZ4A 5AW9A 1M73E 3ESBA 3BJEA 3EVTA 2NUAB 2P3LA 4E11A 5H7XA 3F9RA 2IY8A 2B5VA 3FVWA 5FYDA 1P62B 3GPLA 1OW3B 4DR1B 2BEWB 3UUEA 6YASA 3JQ7B 3QFCA 4HNAB 3T1NA 5ISMA 4X6YA 3HYRA 2GNPA 2RARA 3H3XA 4IYJA 3LFTA 5EFZA 2VQFB 5BWBA 3GFQA 2PMDA 1K9VF 1X9GA 3BRSA 3E5RA 3G1TA 2J9GA 3U9LA 1Y34E 2XA2A 3OF5A 4NWIA 4HFJA 2R8YA 5ED0A 1WKCA 3DF9A 1EGVB 1FTNA 4YO8A 2I99A 3LQRA 3HXLA 4G6ZA 3L0CA 4YLYA 2TS1A 4GZMA 1MAAA 2VT7A 1E3SA 3H1TA 3UMVA 4OI0A 3FPAA 1QTIA 2VQDA 3GEEA 5DCYA 4P4GA 2FX2A 3AK4A 5DX1A 4ZYLA 5J58A 4JC0A 3ID6C 3HBJA 1VE7A 2Q49A 3FGNA 5D51S 7MHTA 1E32A 2ZJBA 2R8EA 3K0KA 3PUJA 3WFJA 3Q4GA 2XZOA 3HJTA 3P2OA 2GM3A 5HJ5A 3WK7A 5IJZA 5D87A 1MTOA 1K6IA 3VKUA 5E3JA 4Y2SA 4Q4AA 3LWZA 4D9FA 1N77A 2HMSA 1CTQA 2ATEA 1DO0A 2Z6UA 4PONA 5AUNB 4UBNA 5GONB 1IJFA 4BQIA 4KVFA 1G8YA 2D5BA 1CP2A 3M70A 4GE3A 4ZVVA 4Y9RA 1AHHA 3WYCA 2ZI3A 3VM6A 2IYZA 2GCPA 1E4OA 1NA5A 5E4YA 4WESA 2FFJA 4M98A 2CCKA 3ZD8A 1CYEA 1SBIA 1B6TA 5FLYA 2VC2B 3EDYA 1T0HB 4DLWA 1QK4A 2E1PA 2O1XA 1CQIB 1NM5A 1FFYA 2FDRA 2OHFA 4UBMA 1UIRA 4B32A 1HURA 2QTBA 2HY7A 5KJFA 2BR4A 1A8UA 4F1KA 2Y1DA 3HCAA 4TKZA 3PNPA 4DV5B 2QDKA 4PX9A 3I09A 4CLHA 3PRYA 3P52A 3L43A 5F1KA 16PKA 1M1NA 2GZAA 4LXTA 3K9NA 2SHKA 4NNOA 2QYTA 3V8EA 2Z4TA 2Q6OA 3BD9A 1WB6A 3DW1X 4PNPA 3RYCB 1QCZA 1Z5ZA 3GLHE 5HQ3B 3C1TA 1G42A 1EQUA 1NJGA 3K1AB 1RD4A 3PCRB 1XG5A 3M9XA 2NU8A 4BGUA 1TKCA 2OCDA 2GO1A 4E14A 1M0SA 1ND6A 3T1VA 1TU3A 3BXHA 2PKWA 3I2IA 3ZWXA 4W63A 1HYBA 4JELA 4WEOA 5IXJA 2POQX 3A6JA 2P5SA 1NU6A 1EGAA 4BGEA 2BP7B 1ZJJA 1WSBA 2QYSA 5KAPA 2UZ1B 2DR2A 2GPSA 2XUIA 2VSNA 3K2BA 3MINA 5LP6C 3ILYA 3UAVA 1CU1A 2GQ0A 3LBNA 4WSOA 3FNRA 4DIUA 4RDIA 5E2BA 1U0EA 4ACAA 1S3SA 1WZCA 5K0FA 1KYZA 2IYFA 1OIWA 2OHHA 1FBTA 4V0SA 3EQ9A 3H5TA 2JAPA 4RO0A 1P5JA 1OXKB 5DHUA 4KODA 2ZRQA 1UC8A 1NGSA 3LT2A 3QEMB 1XXHA 1WBDA 1J8YF 4RFSA 1Q1EA 3PIIA 2CNKA 3OZIA 1QIKA 4JITA 4MYCA 4XA8A 3R5JA 4F7DA 3ZJVA 4KXQA 4E15A 1TW3A 1KQOA 4FE4A 3KQHA 1N5LA 1ZJ6A 2RBGA 4D1YA 1NX6A 3HBAA 1UKAA 4D0GA 3L2OB 1Z4OA 1ISHA 2CHGA 3EZYA 1NVDA 1G4AE 1A5AB 8GPBA 5LDGA 1D6NA 3FHOA 4ZO8A 2AOTA 2VHXA 3S1AB 1ZRSA 3YASA 5A2GA 2CHFA 2GDJA 5FNVB 4W7SA 3O82A 3G9XA 1Q50A 1MH9A 2JCSA 5EQFA 3K8ZA 3TTUA 4E1BA 3HH8A 4QLBA 1P45A 2HSJA 1A7AA 4MKIA 4PX2A 5CK4A 5DT2A 4JLWA 1YDHA 4PBRA 1IL0A 1ZO8A 1SCUA 3K94A 3J7AC 1DTEA 1JH8A 2Y71A 4WASA 3SVLA 2IE8A 4FFVA 3V1LA 2GN9A 3ET5A 3W7AA 3W5BA 3ROEA 2EQBA 2PZ8A 1HI9A 1VSQA 2YRWA 3AR9A 4OXXA 3F4KA 1Q16A 3ROXA 3SXPA 1Q20A 1Z4MA 3QPWA 3A26A 2NYVA 4DNPA 3I9MA 1KFCB 4X92A 4EI9A 4IWYA 4WVFA 4TLEA 2IPNA 1WB5A 2V7VA 3SDBA 2V6IA 5JAHA 2H9AA 1W5EA 2ACKA 2PS3A 4MKFA 5I4BA 3C4QA 3MB8A 1B41A 2EBWA 3PQ5A 4O33A 4CEHA 2XSZA 3WQRA 4E94A 2MYPA 2PSSA 1KS2A 3VSEA 5DASA 2DKNA 1J2RA 4YGYA 1GCOA 4W7IA 5LC1A 1B16A 3DAYA 4XQ9A 4WNCA 4LYAA 3FWKA 3AONB 3H2BA 4E2WA 3FOZA 5HRUA 3O8LA 3AHGA 4KDEA 3QXHA 2X2FA 3PXAA 3V7NA 1YB2A 4EJ2A 4JI0B 4B8WA 4HVCA 2I55A 4C7OB 2RHDA 2QX8A 2RGBA 3E22A 1S2DA 1JHRA 4BFUA 1K7CA 2H48A 2D4AA 4KLZA 2BGNA 4NCKA 4V38A 3UFXA 4CF3A 2WP8J 1PG2A 4IVPA 4EYOA 4EY8A 2ZT6A 3LW7A 4ARBA 2Y3IA 3VC7A 4BPBA 5KYTA 2EFCB 4IOKA 2D7DA 2P3SA 3WLOA 4YRDA 2P90A 5KCZA 3LHKA 1FJGB 4OXQA 1EVLA 2V9PA 4CM9D 1EE9A 3DVQX 2XR1A 1NF3A 3RIMA 5HIMA 1X7WB 5FNVA 3WDMA 1ZOIA 2GAAA 2WNSA 1GT91 3FPKA 4WCFB 1KTIA 3K9HA 1Y7LA 1D03A 2WIBA 1Z6ZA 2VKQA 3P4YA 4OKIA 3K53A 4B3SB 1G21E 4EGFA 2W6PA 1AKWA 2XKBA 3CJQA 3DGEC 4MDYA 2R84A 3IEIA 4ZAWA 1GPJA 2D3TA 3PD7A 5E7JA 3R3UA 3ZNOA 2C2XA 2VJCA 4O8CA 1XYYA 4JI5B 5K0BA 1SUCA 5JEDA 2ZSBA 1A8SA 1OKKD 4HSEA 5J47A 3EXIA 5FOQA 4LZAA 3K8QA 4G07A 1BX3A 1CW2B 3VHXB 1YNOA 2P9GA 3H1GA 4R41A 4S1VA 5K8UA 1PVOA 1QC5B 1YMVA 3QOXA 5TQ0B 1O7JA 1Z6AA 5EP1A 3CY6A 1B1CA 2RKOA 4P54A 1FXWA 4YJGB 1T1GA 4DPLA 5EYPA 5J1SB 4DQLA 1E2JA 1DU4A 4GHWA 1DOZA 2VZLA 4JXJA 1ZJ5A 4L7QA 3SAJA 2JLUA 3STTA 5HX7A 3SE0A 5CT4A 2XWSA 3OKFA 1WB4A 5KI6A 4X1YA 1X1EA 2B20A 5D86A 1JSZA 1OZ0A 1J06A 1SGWA 3LECA 4PPYA 2DX7A 5D2CA 4EO4A 1JG3A 2ODEA 3DC2A 1NC3A 1NC1A 2OV4A 1SR8A 1XHEA 4HDCA 1NXTA 4PPGA 2HU5A 1DJPA 4FN4A 4G37A 4O2RA 4EYGA 4FYXA 2A9FA 1MV5A 1Z34A 3PUXA 4ZTUB 3NUQA 3T7SA 1ODCA 1W88B 1U1FA 4RW0A 3M5WA 3R7NA