2HNAA

Solution structure of a bacterial apo-flavodoxin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein mioC
publication title Solution structures and backbone dynamics of a flavodoxin MioC from Escherichia coli in both Apo- and Holo-forms: implications for cofactor binding and electron transfer
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 39
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hnaA00
2V5UA 1KBOA 4FGKA 4H6PA 5FX2A 1AG9A 4PTYA 3KEGA 4H2DA 3NHKA 3EYWA 1JA1A 1AMOA 1KBQA 5NLLA 1CZLA 2FZVA 3GAMA 1ZX1A 1FUEA 3JSXA 2OHHA 1QR2A 4QOHA 3GFRA 3N3BC 3W7AA 1XYYA 3OWXA 1FX1A 4ZVMA 2Z9CA 2AMJA 3B6IA 4GR9A 2M6SA 2ZKIA 5EMNA 2QX8A 5F4BA 3F90A 3ZHOA 1J9GA 2MTBA 3NHPA 3HLYA 2RG1A 4LA4A 5JROA 3ESXA 3O73A 1AKQA 1WSBA 4PTZA 2BMVA 1C7EA 3OJWA 3ES9A 3OX2A 3N39C 2FOXA 3NHWA 1J9ZA 3KLBA 5EAIA 2FAXA 1FLDA 1F4PA 2FX2A 3UXEA 1RLIA 1D03A 3KAPA 1YDGA 4QODA 3OJXA 1AKVA 2HPVA 3OVMA 1AKRA 1T5BA 1QRDA 4ZVNA 3F2VA 4U7GA 4U7HA 4QOIA 3FVWA 1YRHA 1I1OA 2QMZA 2FVXA 2X2OA 2FLVA 5FA6A 3QFCA 4M0CA 4C0XA 5BUCA 1E5DA 1DX9A 5F12A 2BF4A 3NLLA 2M6RA 2X2PA 4LAFA 1WSWA 2ARKA 3ESYA 3LCMA 4YQEA 3QE2A 2QWXA 1D4AA 1AKUA 4GQIA 1J9EA 3FNIA 3OWHA 3UXHA 2KQUA 2A5LA 3TZBA 1FTGA 1X77A 1ZWLA 4QOFA 4Y7CA 1V4BA 1AZLA 6NULA 3HA2A 2N1MA 2Z9DA 1B1CA 5NULA 3TE7A 1SQSA 3FJOA 2Z98A 3P0RA 2HNAA 2QX6A 1BVYF 1VMEA 4YAOA 4YAFA 3LT5A 2QX9A 4CETA 4C0WA 1AKWA 1CZHA 1YCGA 1QHEA 1RTTA 5LBUA 4QOGA 2BZSA 1AHNA 5B3KA 1BU5A 2OHJA 5A4KA 1NNI1 3QFRA 5EA2A 1FLNA 1YOBA 4N65A 4DY4A 4YAUA 4C76A 1OBOA 1AKTA 4FGLA 1JA0A 3OX3A 4DIKA 4NULA 4CF6A 1DXOA 3F6SA 1T0IA 5LMCA 5FUQA 4GI5A 3GFSA 1FLAA 4U7FA 3SVLA 3RPEA 4LTNA 2B3DA 3NHLA 4OXXA 2Q9UA 2MWMA 2Q62A 1OBVA 2XODA 5F51A 5LBTA 3HR4A 4R81A 4LTMA 3L9WA 1J8QA 1XI2A 5LJIA 3NHUA 2QMYA 2QR2A 3NHYA 2GSWA 4HS4A 2MT9A 1GG5A 1CZUA 1FLVA 4F8YA 2BN4A 2OYSA 2W5UA 3F6RA 4YALA 1YKGA 3K20A 5TGZA 4NLLA 2D5IA 1FVXA 3U7IA 3W77A 3W79A 2HNBA 3L9XA 1RCFA 3EDOA 2FCRA 3W78A 3B6JA 5LJLA 4BMPB 4FGJA 2F1OA 3B6MA 1ZWKA 2V9CA 3D7NA 2FDXA 3N3AC 5LVAA 3NFRA 4S24A 5B3LA 4N82A 3B6KA 1TLLA 1XYVA 3FX2A 1YCHA 1C7FA 4ICIA 3U7RA 2FZ5A 1TIKA 3NHFA 2WC1A 1H69A 1OFVA 1XT6A 4ZVLA 3S2YA 1SG0A 3FW1A 2Z9BA 1H66A 2KLBA 5LLDA 4J8PA 4N9QA 4Y9RA 2XOEA 3OX1A 3GFQA 4XDHA 4BMOB 3NHJA 4QOJA 4D02A 4HEQA 2V5VA 3R6WA 5ULLA 4C14A 4QOEA 1D04A 2BPOA 4DILA 2MOKA 3KAQA 1CZRA 2R96A 4ZVKA 1RLJA 3O2NA 4Y9UA 1YCFA 3G5MA 1CZOA 3NHRA 3K1YA 4PU0A 3ESZA 4FX2A 2R97A 1CZKA 4ESEA 1QBGA 3NHSA 4YAWA 3TEMA 2OHIA 4XDGA 1CZNA 4LTDA 1DXQA 2QX4A
chains in the Genus database with same CATH superfamily
2ZJ7A 5CW2A 2WIAA 2WJIA 3EIHA 1F14A 5SY6A 2QVBA 3VVCA 1NYLA 1KEWA 1TJPB 1Y3BE 2YY7A 1DEHA 4QBGB 3TVTA 4ENPA 2PSEA 3HYNA 2VQ3A 4H2DA 4PCVA 4HNAA 2JGNA 3DZJA 3BXEA 1F1JA 3BE4A 1QJCA 4MJ7A 4UU0A 3DEAA 5CGQB 2BGWA 1JDSA 3GG2A 4N5DA 1RWKA 1XUOA 4RFSB 4RGYA 2XDYA 3TI7A 4LF4B 5EZSA 3ZGLA 5FFNA 5KSYA 2QTHA 3PZBA 1I13A 2OZVA 2PKXA 1LWNA 1QRAA 3G85A 3GLUA 4C4XA 4YMVA 2V4UA 1A0OA 1ARZA 4QOHA 4ZI7F 1LD3A 3GFRA 3I28A 1Y8CA 3O9MA 2HTEA 4KUEA 1C9DB 2GAJA 4BO9A 2HSEA 3BFJA 2VHEA 1OX6A 4NYJQ 3OWXA 5F3RA 1CJKC 1MOSA 1PYDA 2ZIGA 2C2KA 1G8PA 2GDZA 2OFWA 3CSSA 3O91A 3FOBA 2EYQA 4JA2A 3VR5H 4W82A 3EIOA 2N9UA 4OTZA 2W8ZA 5A3QA 2R5WA 1H0RA 5AMXA 3NPAA 2A35A 1GRCA 1QIKA 2B37A 2J3HA 3IAXA 3OM8A 4WZAB 5CB4A 1QYRA 1RCTE 2C8LA 4ARIA 2O8BA 4MGEA 1ODIA 4OB7A 4TOIA 1XFDA 4OGKA 3I4FA 3VI3B 4EECA 1HZJA 3BKXA 3KZVA 2IYLD 3PNSA 4D9KA 3TKLA 2C4MA 3PQ4A 4YEDA 1RSZA 1Y42X 1R0CA 2B4AA 5SYAA 1TTQB 3DZBA 3GWGA 2YQZA 1VCOA 1ESNA 4BP3A 3NIGB 4NRDA 5G1OA 4CEHA 2VDUE 4Q4AA 2P0AA 4GDMA 3WTCA 1ICIA 1ZIOA 3SHQA 1P9NA 2GEDA 4KPFC 5TARA 1ADYA 2VT3A 4EB8A 5CCXA 3EWNA 3TYXA 1OWOA 3J81A 1T10A 4TVBA 4TXNA 5CVVA 1AKQA 2I67A 3TAXA 5EHNA 5C4MA 1ULAA 4IRXA 1NXWA 2C7PA 3QMWA 5KX5F 1YR7A 3VRHA 2TSYB 2YN2A 1QIMA 2MSCB 2HRDA 1DC7A 2Z04A 2FKAA 3ZGNA 4UUMA 5AVOA 2WJHA 3RVSA 1YR1A 5AI5A 3D7SA 4ZCMA 3HJFA 2HJRA 3TAUA 3F74A 1Z6TA 5CFRA 4RKWA 4DIUA 5T4FA 2C9BA 3I9V6 4KQJA 3K0AA 1VL8A 2GJSA 3ZE9A 5GIOE 1KPIA 4QNRA 1Q7TA 4JGGA 3QIVA 3NMUF 4YTEA 5JW6A 5I5EA 3CEAA 4HNUA 1M5RA 3TX2A 1J42A 2HMYB 3M6LA 1YJQA 2XYGA 3JSAA 1C7IA 4HEHA 4RX1A 3UYLA 3WB0A 4A8JA 1ZH4A 1L5KA 3KLBA 1S96A 3FE2A 4TKLA 1E3TA 1U8TA 2EAUA 3E5RA 1J7KA 4HXEB 1U7DA 4LOIA 2BEVB 2VHZA 2ZR8A 4W5OA 2FX2A 5F1OA 3D54D 2P4SA 1E9RA 4G4GA 3PGLA 1U31A 1SXJB 4FDUA 1FMTA 2WT9A 1PS0A 3C8DA 4V3CA 2HK6A 2ZZKA 2J3LA 3RYHA 4A26A 2ZJ6A 3WNCA 1EYZA 3L0OA 1IZ7A 3HI6A 2J6IA 1XLTA 3DXZA 1L4EA 3EA4A 1QKIA 3LCRA 2HI0A 3MGCA 3QY9A 1JRLA 1PT5A 4KLCA 3UA4A 1LVUA 3WZMA 4OAQA 4BX9A 3DWFA 2XUHA 3D6JA 3FF4A 4EPRA 4J1TA 1ECPA 4XVCA 1CU1A 1QBKC 1Z8NA 4Q00A 2F4VB 3WZLA 1C81A 3A9WA 2VP2A 2ISQA 1OWPA 3PFNA 2FVXA 1BH2A 4KXXA 4PFKA 2M6LA 3ZZNA 1NKVA 2P91A 5J4YA 1HZZA 2KBFA 4EYGA 1SHJA 1N6LA 2VHXA 3OQBA 3TGWA 5ITSA 3ONWA 4DUGA 3N2YA 1A9TA 2C9CA 2GS9A 3OKFA 2G1AA 5EJIA 5L3ZA 4DTCA 1SVNA 4GXNA 3L4BA 2FPPA 2VHVA 4MUGA 1ORTA 2IZ6A 2ZAOA 3CWQA 4KQGA 4UXHA 3Q3EA 5DP2A 1DCFA 3T41A 2AG0A 1MJHA 1ZNWA 4RIGA 4P31A 3C43A 4YT5A 5H83A 2PHZA 4AUKA 3DONA 4OV6B 1H0KA 1I6LA 2J0SA 1O87A 1ST2A 2CFIA 1RWOA 2HLDA 2Q3HA 4Y2QA 4BYMA 4EO7A 1EVZA 5GONF 2GK7A 3KQWA 4U5QA 1UP6A 2EKLA 1DX4A 1Y9EA 2G1UA 2WV9A 4EKEA 3A6GA 3RFUA 3RK1A 4WW0A 1GGVA 5AVYA 3N8NA 3QKTA 4OQYA 4LK3A 4YCLA 3DO8A 4LXIA 2JEZA 1T8YA 4I55B 1JVBA 1Z8HA 5EIWA 4NU6A 2CUZA 2FWRA 2OO5A 5LDGA 3VM6A 4BB9A 1T5OA 1G63A 2HMVA 4DUYB 4DB4A 4OKIA 4PLTA 1E58A 4B6SA 5B7PA 1UBLS 3CLSC 2E3JA 1A7KA 3I23A 2WWIA 4QL3A 4W5JA 1GV0A 1O08A 1NXPA 4EY6A 2AT1A 3ADKA 4NE2A 4MWEA 3BJMA 1T5HX 1U7UA 2VJDA 3HS3A 4JOBA 2F00A 4WLOA 4H7JA 2Q5EA 2WR8A 1CQXA 3AHDA 1RPNA 4D9BA 1GTZA 1N57A 2DFDA 5D01A 4OI0A 1Z4QA 2SKCA 1Y4ZA 3MAGA 4UZFA 2Y0EA 3JQCA 4QOFA 1E9VA 4NWIA 1M74A 1UC4B 3HWSA 3P5BA 3SWWA 1EVJA 1XD2A 2MINA 3E7PA 5J2UB 1XTQA 5IKXA 1GGJA 2XYHA 4UHHA 5DASA 1D3AA 4PPYA 5IJAA 2AVDA 2AJLI 2C84A 1FSFA 3HVIA 4FDTA 4NZNA 4TLEA 2QE7A 3MOSA 4LHEA 3H0CA 5KYUB 5DSZA 3ZCVA 2ZUCA 2XGMA 4G1VA 4HPJB 1ONSA 2VOJA 5FFFA 3PXUA 5J63A 3EE6A 2CSXA 5IVKA 2QS9A 5HIMA 2RJNA 2V3CC 3UWSA 3ZWWA 2E4UA 3S7TA 3K3PA 4LYAA 3SF0A 1EH5A 3I4CA 3CINA 5I4CA 5EJAA 2DFPA 4BGVA 5BQFA 1E98A 3DCIA 5AWFC 3FCSB 2WD7A 4TMZA 4DBVO 3ZDCA 2H0QA 3BD9A 3T7DA 3ZS9A 4BEBA 1AKWA 5GM1A 1D4OA 1N5RA 3F1LA 4UU8A 4HL6A 2NUPA 2O2ZA 1UDRA 1K88A 2BZSA 4W9MC 4A27A 4NH4A 2XZOA 5BUZA 2B1GA 2Q1XA 2PGLA 4GE0A 1VKOA 1CY1A 2KI5A 4B43A 5ADHA 4HDNA 2VYND 1QKJA 1Z29A 3P8ZA 1RBMA 2J46A 5I8PA 3I30X 4KBGA 4KLZA 4TV9B 5BPFA 3JZIA 3K9HA 5J1SB 1CUVA 3CNNA 3PBKA 1H8ED 5IAEA 1UH5A 1I7DA 4IXMA 2X15A 2XR1A 4XTRA 4NPCA 3ZBUA 1E2LA 4A6DA 5J4VA 5AESA 2ZWVA 4F84A 3GZTB 4ARVA 1JWBB 4X7MA 4U4AA 4R1MA 3L8DA 3ZK9A 1NXOA 4H59A 1XXHB 4Q1AA 1R8QA 3VDNB 2J3DA 5LMCA 4O5AA 1VIDA 4F38A 3OE4A 1E2DA 3SPXA 1TJ5A 1DTWA 3CKLA 3RAFC 4Q4HB 3IVGA 2FWMX 3OIWA 3TTUA 1FLAA 3L0CA 4ROTA 5D3MB 5JNRA 1B8OA 4L8GA 1FSGA 3PC2A 4RD1A 5HDQA 3WRYA 4AKGA 4B8ZA 5ECWA 3OZTA 3B85A 2V4MA 1FPMA 2C3UA 2IGTA 3Q7TA 4OXXA 2BTOA 2Q62A 3GY0A 3JARB 5AI4A 3ZH2A 3R76A 3RREA 3V6LA 4M36A 1O77A 4HNSA 4HUTA 5IYZB 1U0TA 1LPAB 2FPSA 2I55A 1XO1A 2AYYA 3GEMA 3OTQA 1J8FA 2JHGA 4LYEA 4V0OA 4W4TA 4ZXFA 3EZ6A 3HMKA 1KO7A 1VBKA 4K2AA 4RS4A 2JGIA 3NHYA 4ER5A 3HJHA 3D02A 1GDTA 4E31A 3HABA 4MYDA 2AJDA 2L69A 4R2WA 5E95A 3QBEA 2BEWA 4GPEA 4D9IA 1N8KA 5LN1A 2I3GA 2MT9A 4P92A 4WH0A 2FPUA 1J4AA 1REQB 3JR7A 4I36A 3M6IA 2PH5A 4CMAA 2A9OA 8OHMA 3A32A 4Z2AA 4L0QA 1Y33E 3G2PA 1KQFA 4LCJA 2ILTA 2PL9A 1GILA 3OA0A 4HQ0A 4URUR 5TQ2A 4RMIA 5JISA 1YQUA 3EXG2 2H4JA 4RVDA 2K2QB 2ZIXA 5TQ0B 2LIPA 3PENA 4U9HS 1B42A 2W5UA 3PD7A 2QIOA 5DHPA 2DJ5A 5ES3A 3CONA 4Q1EA 1CQPA 3KL2A 4YJGB 2OSBA 4YRGA 3EOZA 3VR4D 3ZQ6A 4CUKA 1JHVA 3OUZA 2A58A 4NBLA 3TVDA 3L06A 1OAOA 1FFHA 2ZUSA 1Z39A 2IOFA 2OLKA 2VQDA 1JE0A 4C4AA 4C43A 1UBNA 4Q1BA 4Q9DA 5E4YA 4GGPA 3H1GA 1KAMA 4R68A 3T7TA 5BT8A 4JP2A 1USVA 2IY8A 1RHRA 2COUA 3FTEA 5IM5A 3UUEA 3DG9A 2R6HA 3PHBE 3AZOA 4NI5A 1CB7A 4IJKA 2IXFA 5AKGA 2IHYA 5LUBA 3B2NA 1MG0A 1E1LA 3ZIDA 5HR5A 1KDOA 1RBZA 1UK6A 2QQFA 1TPZA 1U1DA 3B82A 3COZA 3W8EA 1A2BA 4HFRA 4P7FA 4AJPA 4JDUA 4BKQA 2O8DB 2GUGA 2YWJA 1JEOA 3WG9A 3NWEA 5C7LO 1PEYA 2BGMA 2DFTA 3R6LA 4BFSA 1NMYA 2XHZA 3I52A 4FBGA 4BGEA 3DEFA 3K1ZA 4PNHA 3VPBA 4BFZA 1CUZA 1JR3D 3QV2A 5ALIA 3QVKA 3FYSA 4XJXA 3FRIA 4QO8A 4MUYA 4ABYA 5GZ3A 1MZPA 2CXSA 1GGEA 4R8LA 4TWJA 2YVAA 2PEYA 3B6MA 2G0TA 3Q7QA 1KI8A 4L6IA 1CIVA 1JT2A 3V9PA 3D7NA 3GGDA 4J76A 3TZ6A 1SH7A 2IPXA 4Q1VA 2W6JD 5JMPA 1EESA 2EF1A 4RF3A 4EW3A 1YNOA 1YR2A 3COSA 3KZ1E 4J03A 4A10A 3PQCA 4AWXA 3WRXC 2V45A 4WSOA 3RIEA 2OAEA 3OG9A 5K8LA 3IHKA 4RWZA 1DAGA 3OIFA 3T7IA 1SIUA 1LZLA 2I2DA 1I7QB 5BSKA 1IUPA 2J85A 2G9UA 4CRWB 1QVZA 1X1SA 1Z2EA 4RL6A 3H16A 2GEUA 5JAQA 4XWYA 1LW6E 1T9GR 1EIZA 2H2AA 2NTNA 5FOVA 5BXQC 4X66B 4P38A 1CVLA 5C34B 1UCFA 2CB9A 1NSTA 3H87A 3FSJX 3M6FA 1GARA 2IY9A 4KGDA 4PC7A 4UVDA 4Y2HA 3VPSA 1I3OA 2HL6A 5IC6A 4RL4A 2H7YA 3TW6A 3WQRA 3MBKA 2OV2A 1MTZA 4YASA 4F3KA 4UOEA 3EUFA 3C87A 5CNMA 4MI9A 1TKRA 4FYIA 4RLQA 3A2KA 3C6ZA 4QJ4A 1IPHA 1L4UA 2ASVA 4NYIR 4IUBS 2XQVA 4MROA 3U3MA 4DAEA 4B4DA 4COKA 3KKKA 1Y9AA 4H7HA 3GJ3A 1SG0A 1P5ZB 1TAHA 1VECA 1W0JA 1ZL2A 3EXHC 2GJ8A 4MW4A 1XAJA 2NTYC 2O50A 3OJEA 2DT8A 6GPBA 1IG3A 2EHJA 3UT5A 1IN6A 1GTRA 4JT2A 2CDNA 4PO1A 4D97A 1KKLA 1Q0QA 3BMOA 4CNQA 4R71A 3TF5A 2X0NA 3CLSD 1JNYA 3LVFO 2XOEA 3PFKA 2FN4A 2I1WA 4EKYA 4Z4GA 3HKBA 4UHJA 4LQCA 2B4KA 4LXXA 2NO1A 3T15A 2H7CA 3SLGA 3DHYA 5IK2A 2PKQO 3Q3HA 1RHQA 3MJHA 5SYMA 4LDAA 1P8JA 3DFZA 3B12A 3PA6A 3ZCSA 2C0QA 5C7YA 4TWZA 4RDHA 4URXR 3EQ7A 2I4NA 2DFNA 3ZEAA 4D0RA 1JPUA 1KMCA 1U5CA 4RK6A 1PWXA 3ZJUA 1JSCA 3EUWA 3FMIA 4NX2A 2J0VA 1CV2A 4HAOA 1BE8A 3T35A 3EEBA 3B7WA 2NQTA 4YJ3A 1CIPA 1E5VA 4NMHA 3GA5A 5EWLB 1DLIA 1F2TA 4G0NA 3DMTC 3AUUA 3FHLA 2ZU0C 1SCJA 1JNXX 1C1HA 2ZAYA 3A2NA 3HJBA 4I4CA 4BP8A 3EHEA 1E3WA 4QX6A 1RKBA 4CFZA 4ZK6A 1Q21A 4M55A 4DCOA 4RTSA 1R0WA 1N77A 4AT1A 2G06A 2C0CA 4DCTA 3M3PA 3JWPA 1TYDE 4XQ0A 2P6UA 5EIAA 2YDYA 4QPZA 1TW2A 1G4HA 4NV3A 4ZVQA 5M04A 3RADC 4FD3A 1KTVA 4NS1A 3GVCA 5LA6B 1SXIA 2RIPA 3M9WA 3OQJA 4D3XA 3U7EB 4DQDA 1DFIA 5HMMA 1CZKA 4N9WA 3JCZA 3E22B 3Q41A 1X7WA 1Z6QA 1XQVA 2A9VA 2I2AA 2Y1XA 2FGKA 3PVZA 3HU3A 4ETWA 1FRFS 2HYDA 3GK3A 4JQSA 2G5TA 4R54A 3ZE8A 1M1NA 1P45A 3X43A 3P9QA 2ZUFA 3KTFA 2FZ4A 1WMSA 3OZBA 2CL0X 1RWMA 3BL5A 3L0IB 1AHIA 1R0BA 1I5EA 1RWWA 2RI1A 2IIBA 2QQ0A 3IBCA 5TDHA 1KVSA 1JZSA 1UBEA 2YV5A 3VNSA 1XZQA 4TSRA 3A1TA 3INGA 3NHBA 4X6XA 4I4TF 3CC8A 1JDJA 1RU3A 3AY7A 4OHXA 3S1SA 1B0UA 3EEFA 2G7ZA 4FGKA 1LTQA 1NTRA 1JR4A 1O95A 4B84A 5K4GA 3BGWA 3N7UA 1L6IA 1SHLA 3ZD7A 4HSEA 4HXYA 1EUYA 2YNMC 1JA1A 1N6KA 2YMQA 4WY2A 2AFIA 2GD2A 1ZGHA 4M0UA 4Y7DA 2J4CA 2CJXA 1GA6A 1NUHA 1USKA 2VAMA 2A5DA 4IJ5A 4BVEA 3SMQA 5JSZB 3BDVA 1R4MB 1SKBA 1YZGA 4X85A 1Y7LA 3RKUA 3DAOA 2EQAA 2B92A 2QSUA 2QJRA 4JBHA 4TXJA 2C4VA 2WB2A 5T6BA 4IGFA 1TEVA 4PFSA 1QP0A 2OGSA 2NNLD 3NEAA 3AH8A 4HDAA 3P2JA 4TLLB 1VXRA 3RNLA 4OK5A 2Z1MA 1SBIA 1NF9A 1TYCA 1XV5A 2C1EA 2G7MC 2KWIA 2R7MA 3I9LA 4M21A 2GH1A 3A1CA 1DXYA 5JJKA 2GN4A 4R01A 3USZA 3I0MA 2B30A 1LI5A 1GITA 2PFSA 4GX2A 3R3SA 3LDUA 3C5VA 3E27A 3DFFA 1GADO 2KMLA 3KKMA 3KOUA 5EWMA 4DYHA 4DPMA 4IIDA 4YRLA 1T43A 3IOYA 4UMDA 3QWFA 1JQBA 1JQ3A 4GG1A 1RYHA 3GEGA 3DOUA 3LWZA 2O1SA 1WCXA 2B34A 1GAQA 3BWCA 3QWIA 1YZ3A 2W4IA 4RPLA 1TD9A 2Q8PA 4LC1A 5SYNA 4LVUA 4I0WB 1NPYA 2JFQA 3JZDA 4KIJA 2MMGA 2HA7A 5TNXA 3R7WA 3HN2A 5MFPA 3LQRA 4TV8B 4HNHA 1ZOPA 4P4SB 5A02A 5IF3A 1KVUA 3NKLA 4L4XA 1Z17A 2EZ9A 4LRTB 4RW0A 4LGYA 3GUVA 3Q1LA 5A7FA 3R5KA 2HRBA 1RJWA 4KJZA 4I46A 5KYVA 3HLYA 3UB3A 3IP7A 3CZQA 3JWIA 3P9NA 2WV7A 2CLDX 3A6ZA 4XGKA 4AZWA 4CIYA 5K0GA 3BUSA 2F6RA 2ZWPA 4E6PA 1FDVA 2XRFA 1FW6A 1QGED 1KS9A 2D1RA 1VJDA 1I33A 1M1YB 1N2ZA 2Z2IA 3DDWA 3NT4A 3O03A 4NJMB 4NCBA 5EUQB 4CM1A 4US0R 1KYVA 1LBTA 3E9MA 4L5IA 5AXCA 3ZIUA 1M0TA 4DQKA 4EVIA 1WZUA 1Q1GA 1W25A 2XYQA 2P11A 4AO6A 3S4YA 1EFHA 3K53A 4K87A 3CZ5A 2NW6A 1BSVA 3PVCA 4CL2A 4PX5A 1O94D 2WAYA 1DC6A 1FTNA 4FVTA 2QRZA 4NECA 4R05A 4KIGA 3UMCA 3BD8A 4E5PA 2C03A 1VG9B 2VCYA 2A3NA 4XLTA 3RKSA 3AHHA 3DGFC 3UMMA 4CF7A 5G41A 5FR2A 3HA5A 3EVZA 3AOEC 5DBHX 1QO0D 4JI2B 4B6FA 4QXOA 5G3ZA 2LGJA 3ZVKA 1JHMA 1U2DA 1A9XB 1XZGA 2YYYA 3BSWA 3S3TA 4BLSA 5IM4A 3CHYA 3UXEA 1GCGA 1YASA 4P9NA 3AFMA 3WE7A 2MSKA 5J40A 3ZJVA 1Q0HA 2HU2A 3IC5A 2VUTA 3AWDA 2BDEA 3PPWA 4Y2YA 2R6CA 4E4RA 1GKIA 1GNPA 1LPMA 2O5EA 3DWIA 2CLCX 1ORVA 4CV2A 5C1DA 1U2PA 3GARA 1P1RA 4GKBA 4YROA 2AZMA 1T5DX 2QW1A 3AESA 2W6ID 5ALNA 3TZLA 2GYWA 5IXJA 1SNYA 1QIIA 4Q7MB 1ZGBA 3IJRA 4AKSA 4JGBA 3WLJA 1QRSA 1J0EA 3ZDDA 3PGXA 3J7TA 2VG8A 2IXEA 4Q3EA 4AP6A 4KCGA 5JECA 2E4VA 4CG2A 2GNAA 4F9FA 5AW6A 1GPUA 2ZB2A 3IBTA 4NJEB 3M34A 2KE5A 4LDQA 3BE5A 3G79A 2BFOA 2IBMA 3SYMA 4XIFA 2B82A 2DSTA 4Y6PA 1ULBA 4Z0HO 1S9HA 4EDFA 3ICWA 1ZOIA 3F73A 4P32A 4X61A 4HGNA 1H94A 2P9FA 3A1NA 3KVRA 3ZXIA 3IMCA 4KQKA 2CNKA 4L76A 2OQVA 3RUPA 3ZPXA 1ZD3A 4OFWA 5DYIA 2B4QA 4JJIA 1HH4A 2O4UX 3V2IA 4WUVA 2RGYA 3AW9A 2F3TA 3K0EA 3IFSA 2OFXA 4UBNA 1GQYA 1VB3A 2I54A 2R65A 2DU8A 4H1VA 4BQQA 4EJMA 5EZ5A 3OOJA 2HQRA 3JWEA 1M72A 5K0BA 3N0VA 4YQZA 3E9DA 5ALXA 2QOEA 2PX3A 2ZUDA 4MYUA 4RFVA 2GZDA 4ZRDA 5HFNA 5F1YA 3WA7A 2V7PA 1GPDG 2YBEA 1ADFA 2VNSA 5IN5A 2VF4X 3QSYA 2AXPA 2QM3A 4K1XA 4X65B 1YZUA 1CJTC 1G3MA 1RYFA 2DBYA 1ZM3A 5LYJB 5DJ5A 4ZYZA 3T7KA 4KEAA 5IUJC 1PZHA 1U2ZA 1LK5A 3N8IA 4GI7A 5A3VA 3HI4A 1EE2A 4QUEA 4YJHB 2JA2A 1ZR4A 2Z6AA 3EWIA 5KI6A 3RRFA 1R8JA 3BXHA 4XWTA 1A50B 1SBNE 3L01A 5FTNA 3TXYA 4B5LA 4DLSA 1T9GS 2VH1A 2PUTA 2GAAA 3IALA 3I4LA 3OSZA 4MR9B 1FTGA 1PK8A 3W7BA 1DIAA 1A8QA 2W6NA 1IN1A 3VPXA 2BFWA 1OZ0A 5EJ8A 1I0IA 5KYWB 4HWKA 1II9A 2ONCA 2FPLA 2V96A 2ZAIA 3HU2A 3JQ8A 4MYCA 1QYVA 4OOEA 4PNPA 4QDKA 4JR2A 4D0SA 5L3QA 2L19A 1XHLA 4EZIA 3WL5A 1HFKA 2UUAB 2EWVA 1Z6PA 2F8MA 3GZNA 3M89A 1E5LA 4CI9A 5M29A 1XWFA 2FQQA 5I8ZA 3ER6A 4FQ8A 1QC5B 4Q9NA 4V2UA 5J23A 2UXBB 5LQSA 4HX9A 4R1OA 4X60A 5AHKA 4J07A 3ROEA 3RFCA 3ZWYA 1BD3A 1M83A 3KRTA 3EWAA 3OC6A 3RTBA 3ONDA 1CUUA 3PRKE 4FEAA 2EX1A 2GN0A 1C4XA 2R7KA 3C3AA 4AP9A 3GBSA 3KEMA 3I34X 5KQPA 4L74A 1LPNA 1XVVA 5LP6F 1OILA 2AFIE 1FSPA 4ZVSA 2A67A 3U5ZB 4WCFA 1HE8B 4KVFA 4OAPA 2QM7A 5LLSA 3ZHTA 4J0IA 4BGUA 1PW5A 3VV3A 5I9NA 2XOKD 1Y7HA 1B14A 2GCNA 4ZYYA 2IUSA 1XDSA 4UKDA 4NNOA 5K8JB 5LQAA 2I33A 4BLPA 1N7GA 3KXLA 1YZHA 3KKOA 1XPUA 5ENDA 5FIUA 3O92A 2HGSA 2ZVPX 3WK6A 2YNMD 4DY4A 2UZAA 1UZMA 1J97A 1M76A 4JI8B 3I2JA 2ANCA 2FPGA 1EXMA 2X3UA 2JCVA 4NCXA 3PX3A 1E1RA 1JXOA 1OLXA 2C5FA 2H1LA 5CTAA 1DELA 4JLWA 3VPHA 1G5HA 3BVPA 4Q16A 2J5QA 3DE4X 1NFQA 1PU2A 1DRVA 1PBTA 2QGFA 3F6SA 2NU9B 1S6YA 4D8UA 3FLEA 1UK8A 4RPHA 2PK3A 4ED9A 5IH7A 1U6JA 4KPEC 2ZJ0A 3NT5A 1TJ4A 2HLHA 1EGHA 4MRNA 1T8PA 4WJLA 3BFPA 4CM4B 1FZTA 3N8DA 1E1QD 2HQOA 5FORA 3SVLA 1S2NA 2IPOA 4V03A 4BB5A 4LCEA 3DBRB 2DGDA 1WG8A 4ALLA 3VUEA 2WF5A 2CFCA 2ZE5A 4X8OA 4ZEVA 4BC1A 1JIQA 1MB4A 1NW6A 2ATEA 4HLQB 1UJ5A 1QH0A 1X1EA 3CBQA 4PYNA 1XEAA 2WMOB 2QJOA 2WMDA 3JQQA 5DCYA 4EUFA 4IQFA 1SCKA 3WLFA 2CZQA 3NYWA 4Q1FA 3N5CA 2FXVA 1WB6A 1PWHA 3ESRA 3ONEA 2VP4A 1AM4D 4ZVOA 3UG7A 1CEYA 1BROA 1OSNA 4L08A 3JD4A 5BQPA 3FKJA 1XALA 3SQDA 5CFPA 1G5TA 1X8JA 2HWKA 1ISMA 4NK5A 3DTYA 5FWNA 3BGVA 4FYMA 5E38A 1I94B 4KOAA 5KNCA 3JXEA 3X3HA 3LLSA 1EGMB 1CY0A 1LK0A 3JYQA 4F3RA 2CJWB 3C3WA 2G4VA 4KO4S 2IYOA 1CZUA 2AW3A 2OY0A 4HGYA 2GCEA 1YS2X 1Z5VA 1Z8DA 1NE2A 1YRQA 2QTVB 2VEOA 4B9EA 1KAQA 5F3WB 3GDHA 4P84A 3UM9A 2UZIR 1UK9A 4XKJA 5TF4A 3II6X 3DS8A 1VE5A 2BN4A 5K4AA 1U7XA 3SHWA 2P4HX 1GSOA 2GTPA 4IICA 1E3IA 2FN8A 3G9ZA 3K94A 1ZI8A 3OD5A 3Q2OA 4XB1A 3VMMA 3OPMA 1Z13A 4P4LA 3Q9NA 2YH2A 1LSUA 1PGNA 2J9FB 1AOXA 1KPHA 1NBMA 3FIJA 2OCBA 3EGEA 2LCQA 4INOA 5LQMA 2A0KA 3NBAA 2G6TA 5FUWA 1N0VC 1SC9A 1TLTA 2C04A 3V46A 1IBSA 2QZJA 2OVBA 3VPCA 4OK3A 4KWCA 4BWFB 1QDEA 3PC6A 1FFWA 2HMTA 4H3KB 3N0WA 1G20B 1RADA 2EGHA 4MKHA 2IJGX 4CCAA 1EUCA 1TRHA 3IQWA 1YS1X 1UZNA 3PGKA 1OJLA 4QFCA 2VT7A 4MPTA 1ZM2A 1NQXA 5EY5B 1EVKA 1OZHA 3R7FA 2G1PA 4FNMA 3KCQA 3PQFA 3QOFA 5BNWA 2PRKA 1OFIA 3DBHB 4XOUA 2J6BA 3AINA 3KQPA 2DPGA 3UMBA 3W5IA 2I2XB 2IXDA 3A1SA 1GGHA 3BPSA 2Q0HA 2ZYWX 4LV6A 2YQ4A 5J2TB 2C7QA 2BM0A 1ULUA 5CLJA 4C78A 4YO8A 4F56A 1UKBA 3PD0A 3FZNA 4YRCA 1FUUA 1RI4A 2ES4A 5A6VA 3SYLA 2JJ1A 5E3IA 2D5BA 1YQGA 2JFYA 1I24A 4RPKA 3L0BA 1OLUA 3EY9A 4HAZA 2V9CA 2IHJA 3OQIA 5LBIA 4OHPA 3GCGA 2W2QA 2VQFB 2FDXA 1P61B 3PXGA 1OVGA 2OAP1 5DTJA 4KE9A 1JI3A 1TYAE 1JQEA 4QPCA 3S27A 2X8JA 1DKRA 5EQJB 4CQLA 1BFUA 3M4JA 4TMWA 1SHKA 1V37A 4XM0A 4YO7A 4DQUA 1FDOA 5HZMA 2WKRA 4RVHA 1JE1A 4KVGA 4BCCA 1QS0B 1TGVA 1GLGA 5FP0A 1NYTA 4OHWA 1NUAA 1U80A 3GXOA 4KXMA 3OZ7A 1XYVA 3LFUA 1YRYE 1N4AA 4XYMA 4ZP1A 4I5IA 5CEFA 4LF6B 2J3QA 4EH1A 4IHJF 5FRDA 4L2IB 2RHLA 1WVIA 3VGPA 4AS3A 3LHDA 2ALJA 1S2OA 1X80A 2EU8A 3UVEA 4EIWA 3JYNA 4OHKA 3FH0A 1R15A 4BMZA 4KFTA 3EYAA 3M6AA 3T3EA 2AFHA 1H69A 3LE8A 1W94A 5CCBA 2EFEB 1XN4A 1NR5A 2W6OA 4Q03A 2X0IA 4LJ7A 3BMQB 2A8YA 5AJWA 5DU2A 5T67A 3TKYA 5DH9A 1ZAKA 4LOJA 3LQKA 5IDXA 1VG8A 3IOMA 2IVFA 1H1LB 2FFAA 5IJ0A 3HKCB 2BFEB 3AVVA 3ROZA 4F97A 4UM8B 4GI1A 4BNJA 1HMPA 5C5IA 1Y3AA 2G1KA 3OX1A 3AEKB 1CQJB 4IMJB 1A5ZA 3KTAA 3G6KA 1KI2A 3KKEA 4RE5A 5HKLA 4POOA 5HIAA 4IIFA 5AI0A 4HEQA 1FPQA 2C4WA 4RY9A 5TPWA 1AY0A 1KY4A 5KX5A 2FRDA 5HMLA 1CRWG 4PM4A 3U9TA 3S70A 4AK9A 3BD7A 4U02A 2VNAA 3FCUB 2V7XA 1S9DA 5ER9A 3PWKA 3TZKA 3MLEA 1V9CA 4DVJA 1RAFA 4R8MA 1PT9A 4L51A 2Q5IA 3AM3A 2XXJA 1B2RA 1KU0A 1M6EX 3LY8A 4HSGA 2ZSAA 1NUSA 2WU8A 1IUOA 1GLVA 2X0JA 1R5JA 2W4MA 3HM2A 2I9KA 1LW7A 4C03A 2BCJQ 5EJ9A 3R4VA 4Z4IA 3O8NA 4YDSA 1B76A 2R1TA 1PR4A 4LHWA 2HN9A 4EUSA 2XAAA 1NVFA 1KSHA 1MH9A 4ZQEA 3WJ7A 3R3JA 4AG6A 2ZFUA 2J0UB 3TQFA 5C3MA 3RT7A 1DO2A 3TRHA 3Q4GA 1JXQA 1VA4A 5H1YA 4NEGA 1MO5A 3MF4A 2VJAA 1V1MB 5AKXA 5EMLA 2PUCA 5D84A 1D5CA 4JVNA 3UT6A 4JUCA 1C3JA 2WF8A 1OFTA 1GZVA 2H5EA 4QTUB 5JASA 5G0WA 4AQ7A 1B74A 3HUTA 4GUDA 1BKYA 1ZA1A 2QQGA 1X1DA 1RW4A 2AR7A 2QZSA 3RUEA 2V1XA 1ZUD1 3DDSA 2HU8A 4MAMA 3HL0A 1P0IA 4MUAA 1OJ7A 3ASVA 4Q39A 2RAUA 4PLFA 4EABA 1I3MA 3MOGA 3GRFA 3TFQA 2ZSDA 3W6PA 4B76A 1CR0A 1N6HA 3OF2A 4JT8A 3OLYA 4G07A 4BDSA 5HIJA 4H6PA 4LC0A 1VQ1A 2QMOA 5F35A 3OT4A 1T4BA 2REQB 4GH5A 2I6FA 4GMGA 4UXIA 4EA7A 5AKZA 3L77A 5D1NA 5JARA 5JQGF 4IDPA 2N46A 4PCLA 3NUGA 1FW8A 3GAMA 1KFCB 2OBYA 4GOXA 1C1XB 5AQEA 4CCSA 4I50A 3UY4A 2XZDA 1BS9A 4DDMA 5A5DA 1IXSB 1HE2A 1HYHA 1UBTS 4B3FX 3SYKA 1H9CA 2XXAA 3AUFA 5EHZA 4JKOA 1UP4A 1ZMOA 2P68A 3F9IA 5COBA 5KBYA 4R1PA 2ZTHA 5B7GA 1NM5A 3ZLBA 3X1JA 4R7TA 1LTHR 5C8XA 5GONA 2JDIA 3CZPA 4GBED 5KJ6A 4UHEA 1IVNA 1BJTA 2H1FA 1H6BA 2Z5FA 5EOVA 3GCDA 3VUFA 1JILA 2PA0A 1K75A 3WAGA 3MINB 4ZJUA 1K66A 4LFAB 4JYZA 3TW0A 2KW5A 3N86A 5K45A 4HG2A 1Y63A 2CN1A 2RI0A 5JU6A 2ZSUA 1TO2E 1FSZA 1VPDA 4IIJB 3DDCA 3UUFA 1CDEA 1UIRA 1S4QA 2VXOA 2NP6A 2QSZA 2JAQA 1ODTC 2W2LA 3KZXA 4LZPA 3L1UA 4WOCA 5KHAA 4UPEA 1FQWA 1WXDA 3ZE0B 4ZQCB 1Z0ZA 4RY2A 3ZE1B 3FOFC 5JJLA 3HCPA 2JCXA 5KPDA 4WFJA 2Q5LA 4M0MA 5SY9A 3ZS8A 3KQNA 3DOHA 2NYUA 3DLTA 4UASA 3WJAA 2GZHA 3TL6A 3AR3A 5T8KC 2FDRA 2QN9A 3RYFA 1H5NA 1NBME 3DE1X 2OVFA 3U61B 2F8TA 1OXVA 4NZZA 2NAFA 2D7CA 1NVWQ 3RSOA 3TGLA 3UHOA 3G2IA 4JBXA 4TLBA 5JSQA 1H2EA 3N87A 5JS7A 1DTSA 2IZ0A 1O8CA 1WV1A 3NYRA 3OX2A 3P4XA 2DWCA 2NPOA 4AJEA 4ZVUA 1NJFA 2A14A 4JQZA 4Y2SA 3QFFA 4YAKA 3VH4A 3BZBA 1A4XA 4J2HA 2B83A 4EW2A 1U2SA 4CF3A 4DA4A 1TI7A 4M0DA 1MJGM 1OI3A 2BSXA 2RGGA 3FY4A 2QLJA 3LPDA 3QPBA 2O0LA 1QU3A 2QXUA 3B5IA 1XC7A 3GDGA 2WFZA 1PJ2A 1ZN9A 2QROA 3HDTA 3MIZA 3FAZA 4IJWA 3RIGA 4E2ZA 3J81k 1L7PA 4Z7NB 1DC8A 3H1TA 5LMUB 5H70A 2E6UX 4HNAB 3SSOA 2GHQA 2J7PA 3T4EA 2AE1A 4PZPA 5BVHA 1AGRA 1KSJA 2FE4A 1F0PA 3EIEA 4U6SA 1Q0UA 3ND5A 5FPHA 5A04A 7MDHA 5K01A 4PZDA 1YONA 4I1YA 3EGDA 4Q7LA 4DMRA 4H31A 4PCAA 3QBJA 4M1MA 1QP8A 3I1YA 4E70A 5SZKB 1F6BA 1M8FA 4Q3BA 1LBIA 3DOIA 4TX1A 5A3RA 4YLEA 6LDHA 1DRWA 4CKWA 1VSQA 2O7NA 3E9ZA 4H08A 1W4BA 1NJ8A 3OZAA 5DM2A 4U7GA 4C6TA 1NRWA 4L27A 3JVDA 4M38A 3TSYA 1HNXB 1LQ2A 5HHTA 5LU8A 5TV2A 1RYNA 3PUKA 1VE9A 2YJ5A 3DDNA 3F7TA 3ERCA 5FT9A 3COYA 3G7SA 2H2DA 4PHFA 4D45A 5CB4B 4G89A 1BKSB 2GAIA 5DSXA 5C2JB 3REOA 1R9JA 4IOLA 2EJWA 2O8BB 3BQNB 5IAAA 3H2JA 2GLXA 1N0WA 4QIHA 1DBQA 2AFHE 2UKDA 3BH0A 2BBOA 2GXQA 2DVMA 3HPRA 3MNFA 3ZC3A 3PICA 4R1UA 4F5ZA 3RJ9A 5BW4A 2AQHA 4FINA 5TGDA 5ALQA 1D0IA 4OJMX 4Q21A 4CEHB 4Q4AB 1Z12A 4NDNE 4OHYA 1V8DA 3W2GA 3W3AD 4HB2A 2WG2A 2NXJA 3TUJC 4O0MA 2FPRA 4KAFA 4R31A 3SJZA 4G5HA 4M1QA 3NR2A 4Q05A 2HDNB 3DXXA 3RFFA 2X5JO 4GBJA 1XE3A 4ES6A 5ICEA 4AKHA 1T24A 1NT4A 3WGOA 3SQWA 3E82A 5KS2A 5HVNA 1NLFA 4OX9B 2FMHA 4J0HA 2E2WA 4A5SA 1PUIA 1NYRA 2EG9A 5H7XA 2CV2A 1FJXA 1UJ4A 2HW8A 5KSZA 2NQ2C 1GZ5A 3ZE7A 4F12A 1ST3A 2GZ3A 2P7HA 4LIPD 2W71A 2WTMA 3K0AB 2YQ5A 1FQKA 1DQPA 3LRPA 5CYPA 5AK0A 3UAOA 3UXHA 3KR2A 2AD1A 3C5HA 4IAOA 3DL4A 4R1LA 3ZKAA 1TEZA 1QVWA 1QQTA 2PX4A 5EVCA 1E3SA 1A69A 3QJGA 3F9RA 4A8JB 2O3QA 2XCTB 1H2AS 3K0CC 3L05A 3HU1A 4NYJR 5TMEA 4ZZ3A 5BWMA 2I8LA 5BWLA 4GXRA 2Q3DA 5LIPA 4LWOA 3AI1A 4CLRA 3WADA 3DTVA 1IZYA 3IJ5A 3TB4A 5CA1F 2BLNA 2DERA 4JD5A 4ZTUB 1U02A 4ENQA 1HMYA 3BF8A 2AK3A 1WVGA 5LNK6 1UWLA 2BM8A 2DUUA 3CUYA 5E9JA 1SURA 2P9CA 4IHAA 4HZIA 1EFTA 2AQKA 1HWYA 1GNRA 1SHZA 5ESRA 3RYHB 1ZICA 4Z49A 5K8CA 2WHQA 4KNWA 4A2QA 1WNFA 1XQ1A 3DP7A 3L0ZA 1KRXA 2IQIA 1QYIA 1K27A 2H4ZA 4ECEA 5HFAA 3GLIA 2ZJYA 3DF7A 5HZGA 5JLJA 1R3DA 1WPXA 3OMXA 3RS5A 2QX6A 3QTBA 2HRRA 2B3TA 1DFHA 1VMAA 2BKUA 2ZR7A 1HE1C 1XZDA 3LBNA 3JRXA 1QRRA 5KDLA 1T3SA 2EW2A 3WBBA 1R6DA 1P4GA 4HGRA 1CDZA 5DWQA 1ATZA 3S2FA 1N5IA 3AJ8A 3FHTA 3CV3A 1CZHA 1VXOA 3QX7A 2IUUA 2C20A 2YINC 4NYMR 4WFQA 3GJZA 3ZCPA 1FQJA 2WMYA 1H3EA 1W85A 1T1IA 2J9YB 4I2NA 1P1JA 4BBZA 4AZVA 3VU9A 2KB0A 1T1RA 4JU9A 5B3KA 2JI8A 3IODA 3S0JA 2FPPB 1DC4A 5GJBA 3K9CA 4GOND 4IJQA 2AE2A 2AI2A 2YXNA 4JUFA 2IA5A 5AUPB 2WKWA 1NY6A 1FLNA 5TE9A 1NVUQ 1I7NA 2UYYA 1Z47A 2QHXA 2PNFA 2PT9A 2D13A 2VP6A 2X4GA 5ALFA 1NURA 5CEJA 5KQLA 3IQFA 4KUGA 4ETNA 4ENWA 1U9IC 2ZJFA 3SLRA 2CMKA 5D1HA 1Y4DE 3A0UA 4ND8A 4MIOA 4DJ5X 2IS1A 2N3ZA 3FTQA 4IDAA 4P7KA 5HKBA 3ETJA 2PGDA 3SGLA 2BKVA 1I51A 3AF2A 4JDPA 4MVJH 2XUPA 3GT0A 4OHCA 3TLBA 4HGPA 4LE0A 4B6OA 1U7OA 3W6ZA 3ZX4A 2HYIC 4C2TA 5CFQA 3LX5A 4Z1MD 1MIOA 4FS3A 3WLEA 1EFVA 4HJXA 1RI5A 3BWVA 4EYKA 3N0RA 4GMDA 5JHGB 1H22A 4YMGA 2E4WA 3ZHXA 1GNVA 4B6JA 2IHTA 3OJFA 1Z0IA 3R75A 3R8FA 3GBVA 2V1UA 3T5AA 5AXAA 4B75A 2K5UA 2X9NA 1RYZA 1QX4A 4UEWA 5H3CA 5LJIA 3E48A 2X3FA 4MUJA 3T12A 4PINA 2QPAA 5L7YA 2Q6KA 1N2BA 2C78A 1BD4A 1NMZA 1XD2B 2MINB 2P6NA 2XI4A 2ZLBA 3FYTA 3N7TA 1OGJA 5EUCA 3MS2A 1QYDA 5CDFA 4JFRA 4EF4A 1ULHA 3EXIA 1GL3A 4CL0A 2ZP1A 3HCWA 1I4OA 2Y2UA 3EF0A 2ET6A 4KLRA 4EGCB 2DH5A 2ABWA 3DD1A 4NPAA 2QX7A 3L6DA 1EXDA 1IATA 1UJ6A 2WU0A 2VDVE 4DE5A 1VP3A 2E18A 1W2HA 2FOLA 2ZRGA 4N03A 2PXXA 5AM0A 1DDOA 4XVRA 1SKYE 3BOSA 3FFBA 4GUAA 3V33A 5AM2A 3ICQB 1EZZA 1THTA 1JL3A 4QOSA 3LO5A 3MPUA 3SK0A 5F5NA 1SQ0A 1NMSA 2EFYA 2FMFA 2OWDA 3GF4A 1Z2PX 1TEHA 2C82A 2ZB4A 3A26A 2WD7B 1W4ZA 5E8RA 3T06B 4MPRA 3TD6A 3BEDA 1AIPA 2G4CA 3BRWA 1PQWA 4P6VF 1P2SA 4TN5A 4E46A 2V6BA 1WZCA 3WO0A 1ES9A 2J9XB 2NUPB 3G5UA 2QD4A 4RAOA 3QXCA 3TZEA 4LVOA 3IPLA 2QGZA 1FVXA 5BNIA 2R2AA 4HDNB 5I7SA 5CLQA 3U7IA 4G0UA 4IVRA 2DWUA 2Y92A 1EK1A 4KQXA 4OG2A 2Y4OA 4RESA 5J5AA 1KDZA 2R6AA 4FWBA 4BNNA 4FI3F 1E99A 1PRYA 2FZLA 5KOYA 2Z08A 3OUTA 2P8SA 2DQZA 1VZ2A 4KFRA 5H4GA 2Z3VA 3SDBA 5DGIA 3A28A 1H0SA 3EXAA 1EBFA 2O52A 3F8SA 1PQPA 4E32A 3TW4A 3F5FA 1IQUA 2XUJA 4I4TA 3FPSA 1J25A 2GLUA 4G2TA 5EP4A 1GZHB 3LBIA 1TFUA 4F4HA 1DTWB 2RGAA 2VNIA 2I6QA 3AUXA 3OLQA 3VR2D 1KGSA 2JGAA 4EJSA 4WZ6A 3VOBA 1WMFA 2ZM6B 1AUQA 2AIRA 3EODA 2EJUA 3C85A 3G0OA 5EP1A 1MJGA 1N5MA 2IYNA 2XEDA 3PFHA 5E9AA 3IPRA 3VNBA 5CXUA 1CF4A 5CEEA 3AVXA 3IYLW 1UWVA 1FDTA 4MQUA 4LZOA 4HFJA 3GT3A 5IBPA 2JPDA 3GPCA 1MMFB 4Q34A 2WE7A 2A9JA 3ANYB 3JALA 3VYSB 4PE5B 4HGZA 1YHNA 2VUHB 2ZBPA 3NP7A 2Q1TA 5T64A 4H1WA 1RFGE 2XNDA 1VTKA 3QYAA 3X1WA 2OG2A 1BN6A 3CH6A 3RK4A 2BEWB 3BYZA 1YCHA 1P2FA 4AULA 1L7OA 4GM4A 4OHRA 4E03A 4OLBA 4ICIA 2QLFA 4PZ9A 2B35A 4QGGA 1HG1A 4R40A 4QPNA 1WDWB 2B8TA 1JHRA 3HZHA 4YRAA 2Q3FA 4Z4HA 1OLSA 3M9XA 4R7GA 3AVWA 1TT7A 2PH1A 3NHFA 2CMHA 1ZGGA 5TQ2B 3UV7A 3ILVA 3Q9LA 1XAGA 4MI3A 1DFGA 3NOVA 1ESZA 2AF4C 3NI2A 2X4DA 4ALIA 4YXFA 2UV8A 5FOXA 2ZIXB 4NXNB 1R8XA 2ENWA 1X9HA 1DAKA 2QI9F 4JB2A 1JS1X 5FD8A 1HETA 1IEQA 4N5HX 5HGJA 2Q1UA 2ZIEA 1U1GA 2IYQA 4JNKA 5EMHA 5U1PA 2R8YA 1M2EA 3OHPA 4WCDA 3X2EA 2CC2A 3K5PA 3MGGA 1R5NA 2BKXA 2JH8A 4N3GA 3D7LA 3L4SO 3N2ZB 3E7DA 4E08A 1Z07A 4P4TA 1C2YA 2B6HA 1NP3A 3GEPA 4EDHA 3ZBTA 1QP7A 4G36A 4LX8A 4PS0A 1HLFA 2OXRA 2PKYX 3IAHA 2I4IA 2B21A 2DWOA 3T61A 3FPLA 1USGA 2P6OA 4KO8A 4N7BA 4YT2A 1TM5E 1EXWA 2VUUA 4UHDA 3RIYA 3TD2A 4DLBA 4W5TA 1JXMA 3ZD6A 3C6XA 1G2QA 1L5VA 1RVV1 3I6MA 3WLTA 2O0MA 3WP1B 3IGFA 4WERA 1WE2A 1WP4A 1E2IA 4FMDF 2VJQA 4DNPA 3JQ9C 1QK3A 3NBZC 1KQGA 1CRPA 3PU6A 3RRYA 2FUG6 2VJYA 1Z5UA 4TQAA 1ZA2A 4GZMA 3I6BA 5CM9C 3RQIA 1XF9A 5C80A 1VLZA 4X63A 4EG8A 1Z06A 4CIAA 3PLAE 3RYCA 1C7ZA 4PQFA 5K3SA 3FPFA 4UEKA 3SYRA 4F6RA 3NM6B 3SQLA 2K6GA 5LPNA 2G83A 4EGJA 5A0TA 4RD2A 3GLFA 1CZOA 1ZCBA 4JJ7A 1UANA 3NHRA 1MGOA 1OYOA 3K1YA 1XKXA 1DS6A 3ESDA 2UVPA 3IVAA 4EGSA 2AYZA 5HWSA 3B1VA 4N3NA 4JKIA 2W6MA 3KUKA 5HXAA 3C6KA 2VHQA 4LEIA 1Y3CE 4PC6A 5FPYA 1VPVA 2VT2A 3E3LA 2QENA 4FKZA 3BE8A 3GVPA 4AMVA 1H2FA 1YO6A 4A9AA 1DMSA 1XIVA 3QPUA 1EM8A 4XQCA 2I0FA 1DNPA 1C3XA 1O03A 2HF8A 2XITA 3H5TA 4FFLA 1WIWA 1Q7GA 1ZJ4A 2OO3A 3OMLA 4ND2A 3IJEB 2VLBA 5LU9A 3H7AA 4IYRA 3EZYA 3P4UA 5ALVA 1RXSA 4J0JA 1NVAA 4FLFA 5DO9A 4OXIA 3C3EA 4YAEA 4BRSA 3OCCA 4G1FA 1QAOA 2RGBA 3LUGA 4TYPA 1NJ1A 1XZFA 2ETXA 1P5HA 3G2OA 4YYEA 1L7EA 3H2ZA 5KYGA 2PQ2A 4BASA 2IX3A 1TCCA 1U7HA 1KBOA 4F5WA 2IP4A 1KQ3A 5DNVA 4B9AA 1JIKA 1UEIA 1Q84A 1HQDA 3KEGA 2CE7A 4HQOA 4MV4A 5M3BA 4ZEWA 1P5JA 1FFDA 2RC5A 3K9BA 1CPYA 3P45A 4OA8A 3OIYA 3MRTA 3FBGA 2AMVA 3LX4A 1UPXA 4HH3C 2JLAA 3DEYX 3W04A 3LG2A 4AJ2A 5CDSA 2YXLA 1P4HA 3KBBA 3CZAA 3QJ5A 4TMXA 5FJIA 1OW3B 4RZUA 4J16A 2BLLA 3ZV4A 4F6LA 5IPFA 1JLRA 1QG4A 1B73A 3UT5B 3T7EA 1NSYA 4KE8A 3GNQA 2ZSHA 1SXGA 3W8FA 3BMOB 3PDUA 4JC4A 1VGRA 2BM1A 2NXCA 4ZI5A 2JGRA 4Q18A 13PKA 2QM0A 3U4DA 2JA1A 3DMNA 1T2AA 4TQ9A 3HKBB 3J7AC 3ZGYA 2H2HA 4E3WA 3K9FC 5ADUS 3LY7A 3WL6A 5CDFE 4YMIA 3PV0A 1J0AA 5EGSA 3ZU3A 1TZBA 2JIZD 1PNOA 5IMBA 4ALMA 2ZIVB 4JBIA 2EQ5A 4JHLA 4X71A 4RDXA 2BD0A 4XVQA 4ZO7A 3H11A 1XZJA 4DXAA 5C18A 2A5JA 4UQLA 5JJ5A 2N75A 3IAFA 621PA 2EX4A 3TINA 6ADHA 2Y2VA 3GMDA 1Q3HA 3T6KA 4ZRNA 4R6WA 1RPTA 3CRNA 4YJ3B 3I73A 3OWOA 4PYRA 2EJTA 1C7QA 3GUUA 4I55F 4L9WA 4E51A 3NIBA 1F2TB 2ZG6A 1OR8A 4GX5A 4V0KA 4WN9A 2FRXA 2ADFA 4J94A 3NC4A 3UJNA 2PRIA 1XVTA 1E3WB 2G8LA 4ZV7A 1CB0A 3I6ZA 4U6QA 4WKPA 4BMDA 5JXIA 4TS9A 1J5EB 2FP3A 5KTKA 1O57A 5JROA 2JIRA 3NJRA 2R6R1 4RSHA 1KQOA 2FJUA 5IABA 3CE9A 1J06A 1GL6A 4L6CA 5H9WA 2EDAA 3HRHA 3UKOA 1OA1A 1Q3KA 3Q5DA 1W5AA 2OXFA 4F72A 3DM5A 3W8RA 1X7WB 2AG5A 2EEZA 1GAWA 4LPKA 1DO8A 1MRZA 4V39A 2L2QA 1FF9A 3NGMA 5JCOA 3ES9A 4YUYA 4KITB 4OATA 5I7VA 3R4CA 3QVOA 3WLSA 1DRKA 1M1NB 1U1EA 2Z2XA 1SUPA 2F64A 4MMXB 4NABA 1RAAA 4OM8A 5DLQC 3IKTA 3THOA 4F5YA 4FJ1A 5MDHA 1IBLB 1VBNA 3KXDA 2AUTA 1E7QA 2I4OA 5FUMA 3SXUA 1II8A 2ZWAA 4FOSA 3WGKA 3U7QA 5A4JA 5AUOB 3LXXA 3JYPA 4FCCA 4HDMA 2WWXA 4ZCIA 1AA6A 3HVRA 1D6NA 1U0NA 4RKEA 1B0ZA 1PJ4A 2APJA 3EK2A 3GMIA 1XZNA 4MEAA 3QBDA 2C5HA 4R3UC 4ZQFA 1RWNA 2AFIB 3ZDAA 3U19A 2PLRA 5JSYA 5LP6A 1QCDA 4KR3A 3UMVA 2HBYA 1W6UA 1N6RA 2VKQA 1PR5A 1XDWA 2IYTA 4K6MA 3FI9A 3MRSA 2NTJA 2R5FA 5CVUA 3HA7A 2JLZA 3PHGA 5CX1A 4PCUA 2VRCA 1E5XA 4JYBA 1L4MA 1VE6A 1W6RA 3Q12A 1TT5A 5HOEA 1JP7A 4OL0A 2J45A 4V24A 3QI2A 4LDRA 1WPQA 3UK0A 4ZDKA 3TIVA 5JFOA 1NYQA 3FPJA 2O20A 1LKZA 5CT9A 2DQKA 1AGNA 3T7SA 4UE3S 5B58C 3BHMA 2CZCA 3FKSA 1TM3E 4FEYA 1BDMA 3CX7A 4TV9F 3DFIA 1RZUA 3F4KA 4JHXA 4LMAA 2PX5A 3FNFA 4B2PA 4EG7A 1AF7A 1OU0A 5EWMB 4D44A 4HGOA 1GY8A 4LNUA 3U13A 4TTIA 5KNBA 2I7CA 1E4VA 3RBAA 2NZYA 4RH0A 3AUSA 4IGKA 1C8VB 2Y1OA 1NU6A 2FLVA 4TMTA 5FUYA 3N2GA 1Z82A 2WAAA 1EEHA 2H85A 3LZDA 2WQ6A 3FMPB 2GF9A 1BXRA 3R7WB 1K6XA 3E0XA 4JVOA 3VTZA 2WIDA 5IULC 1H05A 1ZD2P 3IAS1 3GFBA 3L6RA 4P5DA 1YIAA 1Y7IA 3FFXA 2Q1WA 3M6UA 4V1CI 3HFGA 2GBLC 1E79D 3TQIA 3OOYA 1SBCA 3F7NA 4Q37A 1FU8A 1R3UA 3EDRA 3I2HA 4OLFA 4FE4A 4E88A 4TZ6A 4O63O 4NKRA 4C0KA 2Q6OA 1KGDA 2ZBUA 2PVSA 1NVVR 5IYZF 2Y27A 4RYLA 2B8EA 3KJEA 1NXSA 4G4SP 4CLOA 4NBWA 1RXUA 2H1WA 1L5GB 3TM4A 2H06A 3TRKA 4KUHA 3IP9A 3B3QA 3PEUA 3WYCA 4Z4FA 4RA6A 2FW0A 4DCVA 4HVAA 2JLCA 4L22A 4JIGA 3D2CA 4G0ZA 4C89A 2I22A 4XWGA 2PD3A 2QAGA 4UC0A 5FV7A 4C87A 1JWLA 4QBKA 3ZDZB 3VKVA 3JPYA 2MIIA 2Q99A 2GWHA 3D4NA 4KSCA 2X5KO 3FNEA 3GRKA 5DGCA 1P1IA 5IT9A 4GC5A 3DC7A 2VTBA 3TZBA 5JIBA 1R0RE 3GLFE 4DXHA 4W5NA 4QJBA 2ZT6A 1UFKA 1LLCA 1KI9A 2HSGA 1AZLA 2OBXA 2VNKA 4IO1A 4C5BA 4EYOA 2PU5A 2VPPA 3CH7A 3N6RA 3E1SA 4ERXA 2QNBA 4AN1A 4GOLD 3EVNA 2BZ1A 2AWOA 3FVVA 4C3OB 4CM6A 5KHLB 1Z6YA 5K3OA 1G8YA 4FC6A 1G60A 4HN2A 2B2XA 1F3OA 1YACA 2G09A 3OTWA 4DUGD 5IC5A 3RCBA 5J3JA 3KJHA 3QXJA 1KZ9A 1X13A 2D7JA 3HCNA 3P0JA 5FULA 5F9HA 1Z5PA 3AESB 1KDRA 1LZKA 2H0RA 2JHCA 3QW4B 2O19A 3T54A 1RRVA 3AIOA 4LY0A 4HNVA 3JS5A 3AY3A 3K31A 3OURA 5K7SA 3GRAA 3KB2A 4RD3A 4OEHA 1CNFA 2WD8A 2GYVA 4I66A 4RCYA 5F3DA 4JP1A 3B1ZA 2VF8A 3HYCA 4ND6A 4YAFA 3AUTA 3M5WA 4OBBA 1IHYA 4PIPA 1J00A 5LUAA 3N8GA 2QX9A 3ROKA 2LE0A 1WL8A 4CETA 2AWNA 9ATCA 3PXXA 1A4UA 3U39A 1QNFA 2XTNA 3ZDBA 2B7BA 2H2FA 3B1FA 4A8PA 2FZEA 2BY4A 1GPJA 3O2SB 3O7MA 5K8TA 3O21A 4ZANA 3DZCA 4CMEC 1IOZA 5EHIA 5JNSA 3DC2A 4G3XA 3QFRA 4YLYA 3HNOA 2V9PA 3RE1A 3WKDA 1T2CA 2NUBA 1YOBA 2O3RA 1I7PA 1HYQA 1S4MA 3G9XA 3RDPA 4ZOAA 3WWEA 3DLHA 4MKZA 1ZXXA 3ZG6A 3KKPA 2A1TR 3I9JA 1WOYA 4U2CA 3ISVA 3S8MA 3TVYA 4NOJA 2WI8A 3DT6A 4URFA 4E2FA 3HKEA 2WMNB 4EI8A 4N5MA 1DXOA 1DDIA 3MFQA 4MW9A 5D6NA 4ZCPA 1ZVQA 3V5NA 3OCWA 4FHCA 4EENA 3P2OA 1LSJA 1APBA 2MU1A 5B5SA 5KTRA 1G8HA 3GPBA 2P78A 2I3ZA 4AY4A 3VXKA 4BFYA 4QG3A 3SJUA 1MRNA 3LKVA 4AJKA 3DTTA 5LQCA 2QE7D 5M5BA 3T5BA 3GQBA 2P9JA 2YOHA 3ND8A 1V7PC 3CIOA 5KQSA 3IDOA 2J59A 2PUDA 1OGIA 3OZUA 1A8SA 1O9BA 4FONA 2EP5A 3DVSX 2V7BA 1G16A 1ODLA 1U28A 4IVPA 3M1LA 4IV5A 4CKXA 4F11A 4UNPA 4IOJA 1EFDN 2AH5A 1J5XA 2Y68A 1TYEB 1XCBA 3L6UA 1L5QA 2YW2A 4RF2A 3YASA 4DV2B 1JFSA 1KYXA 1O6ZA 2LXNA 3JQ8B 1Z2NX 5A71A 5L3QB 3FXAA 3OO0A 1OB5A 1W1UA 4U0JA 1HQKA 5JXWA 1PEKE 3AVPA 1G42A 5B2EA 3T94A 1M67A 5ERGB 2O2IA 4B82A 4DNQA 2CT8A 3QM1A 4G8JA 4P98A 3AXSA 3L49A 2GHIA 1J07A 2K2WA 2ZE7A 1COWD 1FLVA 2JVJA 3GZNB 1U3CA 3PC3A 3AF1A 4QBTA 1LLQA 3U2QA 4CWAA 4Z4CA 4DV4B 2ACKA 4DR2B 5AVZA 1BTOA 1CF2O 1FRVA 4QTXA 4BWGA 1I4TD 2REBA 4IFBA 1RLMA 4JXZA 1L7RA 1GUBA 3FIUA 3PFCA 1FB5A 4BECA 3IRUA 1L9KA 5A7GA 1FA9A 4N6GA 3I9NA 3DLIA 2JW5A 1O58A 4OQDA 4W5HA 2Z6QA 3A36A 3GROA 4JLDA 4GL2A 4JOCA 2OP1A 4E11A 4YDQA 4TRNA 2REOA 4FYXA 2RONA 2ZT8A 4NZOA 4XDYA 4WCFB 4J2TA 5C5EA 3LBYA 4D79A 3AJDA 4M9UA 4MW2A 1PHRA 4YCSA 1JSRA 2EQBA 4MQFA 3CVWA 1WWKA 2GN9A 4WXPA 1U2RA 5CK5A 2J6CA 4I08A 1LK7A 1G4AE 1YTLA 1ZIYA 2FPGB 3KZMA 3LVRE 4EZBA 2AUNA 3SY8A 3KQLA 1OLXB 1YBVA 2RGNC 1NVMB 1FS5A 1V6AA 1QK4A 2O1XA 2X19A 3EIQA 1VL1A 3L79A 1MQ8B 1V8PA 1YQDA 4MUBA 3LL7A 1DV1A 5BV2P 1NMQA 1VFPA 2RHBA 2ZJ3A 1U1CA 3EEQA 4FWIB 4X3PA 4YRRA 1I01A 4FR2A 2D3TA 2WKQA 3PUXA 4OP2A 4XVUA 4IEEA 3DA8A 2Q0SA 2ZJ2A 4HH0A 2WUEA 3QIAA 4IZHA 3V97A 1MXHA 3H6GA 3FJ1A 3B6EA 5DLPA 3PYLA 1MNAA 4F96A 1M7GA 4MVWA 5JANA 4UFPA 2WUWE 3MJEA 3PNPA 4EY4A 2A30A 5EMJA 3O2JA 3WNZA 4F7WA 4BVBA 3WMGA 2POQX 4N82A 4Q47A 1U8AA 3B1XA 1CULC 1A4RA 2ZATA 3OQPA 2IS4A 521PA 3DKVA 4XR4A 3HXLA 1F7UA 4F2PA 3MD0A 4QFBA 2FR0A 1E6KA 5EE3A 2P5UA 3K09A 3T9AA 3VAYA 3SCZA 1EX9A 3T3IA 1TIKA 4BC0A 1DKUA 4EF5A 2G71A 1JJVA 1RWQA 2VUIB 1QG2A 2V5AA 1P4JA 4CEIA 2VK1A 4CKEA 1KJ8A 3RGGA 3VGJA 1UBKS 4GZLA 2EFHB 2AEJA 1SA0A 2CB0A 3NBXX 1WNTA 1XWWA 5EI5A 1WLYA 4DLVA 1EM6A 1CP2A 5JY6A 5E3HA 1PTJC 1NXXA 2JHFA 2VZ0A 2G40A 4LVNA 2PUEA 1Q50A 1JSZA 3RVMA 3I42A 5BSEA 1E8NA 2PM8A 4TV8F 4X62B 1ZCJA 1B16A 1T4DA 2G07A 4IHQA 4L9SA 1Q5PA 1GNTA 1TUIA 4BEJA 1IB0A 2BEUA 2CNLA 3CT4A 1RACA 4TZTA 3MUOA 4QOJA 4F1JA 1IM8A 4ZPJA 5LB4A 2CNWD 1F4LA 2H63A 2SICE 3ZU6A 4H7KA 5I7OA 4RIHA 3VNAA 4H7FA 3MD9A 3ENVA 5FI1B 5JNWA 1SOAA 2WHEA 2FFRA 2PMBA 4QOEA 4P86A 1RE1A 2GCGA 1V11A 2PGAA 2R2GA 1OH7A 1F8YA 1DU4A 1DZIA 1EUCB 1IWPB 3GI1A 4H0CA 1YB4A 4CMGA 3OT5A 5AW4A 4G4JA 4PR3A 1IFXA 1A72A 1U2TA 4IIHA 1YS9A 1ZK0A 1DBSA 2VI5A 3FWPA 1GZ3A 3WQHA 1YZYA 1Y6ZA 1VRVA 2YMPA 3U7GA 3P9ZA 4M60A 3R7BA 2OB2A 3OLCX 1BGXT 1XAHA 4HQ6A 3NALA 4KN5A 1SCUA 4X1KA 3UIEA 3WLRA 2Q4RA 1TO1E 1OLUB 3CVJA 1VBMA 2AUMA 1S01A 1XJWA 5D7BA 3OQIB 3QENA 3EWSA 1V25A 4LXGA 1H2RS 1YULA 4CQLB 1H1TA 3L41A 5IDYA 3IVCA 2X8JB 3B3AA 4P58A 5HILA 4C1NA 5J5CA 4ECAA 3QEAZ 1RPJA 4OSPA 2J07A 1RM3A 2H8GA 4G01B 1FRZA 3CRW1 3I04A 2Z6VA 4RF5A 3ODPA 3B51X 1SKQA 3FWHA 4OJTA 1W5TA 4IPTA 2HFKA 4S1TA 2V0NA 4LRSB 1T1GA 1F8GA 2B6NA 2I4LA 1YA8A 2BHSA 1G41A 4INAA 2DR2A 2FYTA 2H4XA 1VJ0A 5JZBA 5TX7A 3CCBA 3G0CA 1JHYA 4OBEA 2DBQA 2QUIA 2Y1GA 1M2OA 5WRFA 1X80B 3CU5A 1SRRA 2O5RA 1DHRA 2WK1A 2P9TA 2C5GA 1JEEA 2OQRA 1N5JA 3QX9A 4J4TA 4PC2A 2AFHB 1E6MA 4Z53A 1UAAA 2P9HA 3IERA 1PL6A 3WZ2A 3AI3A 4CW7A 1P39A 2HDOA 4ZODA 2IUFA 2PH7A 4FLEA 2VYNA 2JIMA 2Q2QA 5L6LB 3L5OA 4KXQA 2DXIA 4PC1A 5IJ0B 2O23A 1F38A 4N41A 2VPXA 3QUTA 4WEQA 3IMKA 4FQ7A 4LXYA 3IE1A 3DEKA 4NV1A 4OQZA 1NJGA 4KAJA 3Q10A 1UIMA 2G70A 2N42A 3FPBA 3KTAB 3TRFA 2QRHA 3LDAA 2FDCA 2V98A 5FADA 4FFPA 2FP4A 2HSDA 1KETA 3WKEA 1ACMA 1XRPA 3FOAA 4FN4A 3VV2A 5TPWB 4GMKA 5KX5B 2NO5A 1X1TA 2WJPA 1FP2A 5FV4A 2DY0A 4R1TA 2IYYA 2ACVA 2JK1A 3EA5A 4K9DA 2HDHA 4QUAA 5EMNA 2Q7OE 1X0VA 4DOMA 1DBPA 4H7IA 3QU2A 2JZCA 1F0YA 3VNVA 3ETNA 4ZT2A 3P71T 5L53A 4QTZA 2A1TS 5LYJF 2CDAA 3GJYA 4RZHA 4RKQA 4UATA 3WLAA 3ZHOA 3LC1O 4R41A 4BATA 5DM70 3FOEC 1GZ6A 4FNGA 2WUGA 2ZYUX 4J0QA 1R74A 4BBJA 1P75A 2BBTA 2JNWA 2R1TB 3TSOA 2QLNA 1VPTA 5HIIA 4F85A 2OUIA 4L8VA 4WCFC 3T5PA 3A6DA 5FI3A 5IW8A 1JLHA 1B6TA 4FEEA 5ECYA 1SBZA 1W48A 2A9PA 4MWBA 3Q2KA 2NXEA 1SQ5A 5AOCA 4BN4A 3HA3A 4F4CA 3D1JA 2DR0A 5G1PA 3M4NA 4PSAA 1UDCA 3UEOA 2BGLA 5D87A 3QLTA 2D2IA 4BMXA 3DBVO 3CH5A 1YAHA 5CU7A 1KYYA 2NXWA 3JY6A 4HNRA 3TLCA 1E1DA 4CFYA 2V6FA 1RWVA 3CJTA 2XPCA 1JHZA 3CGWA 3DE5X 3D4LA 1XK7A 2A0UA 3HLTA 4RZQA 1UJMA 3QBVA 3O26A 1XDDA 2CXHA 3NVAA 5CJJA 4IR7A 2NVBA 4M8LA 3LWNA 2B1IA 2V7UA 2Y71A 4WGGA 4BNGA 721PA 1AKMA 3HYSA 4KX5A 3L0PA 3GDWA 3VZRA 1FNCA 2FAXA 1TU3A 3O9ZA 4O4JF 1RPZA 1KEEA 3MG9A 2QRGA 3GLQA 1GSAA 1ZGJA 2CUKA 3D2LA 3IURA 4G0OA 4NPHA 4EM6A 4NY1A 4FYYA 4C06A 2AN1A 4DT1B 1T15A 2IEBA 4C21A 2PLWA 2F43A 4DGSA 4EI9A 4XIIA 2XVXA 3FOCA 3LFTA 4I50B 2HCRA 4P80A 1HE4A 2BUBA 1T3HA 4DAOA 2HCBA 1BFDA 3ZZ1A 2FJPA 4LYHA 2XXAB 4EKNB 1E7YA 1ZD1A 1U65A 3I2GA 1M2NA 3KSRA 4JI0B 1KC3A 2H4FA 3U3RA 2QU7A 4FR5A 3EZ2A 1KERA 2GBIA 2WD9A 3F2VA 3NH9A 5GONB 2QT1A 1J2JA 2VDQB 1BZYA 3ELUA 1L9XA 4XWOA 1JQDA 4IH9A 1W2GA 3GVIA 4RMGA 3KJNA 3E05A 1ISSA 7MHTA 2XB6A 5AKKA 2H11A 4LCBA 2QMZA 1DX6A 2PEZA 2Q45A 3NDIA 1C9YA 5K0SA 4X3CA 4XPIA 1GR1A 4M99A 1A7AA 2YRWA 2YYSA 5HK9A 5JSUA 3CSDA 1GD1O 1M2GA 4YGYA 1XNRB 1FVFA 3M49A 1IN8A 1QE3A 2P67A 3NBFA 4GVXA 4PAGA 4JK3A 2W6JA 5B4UA 1AMUA 3DLBA 4HDKA 2PD6A 4V0QA 1BE0A 3O3OB 3K6KA 4IIEA 3TTVA 3AM5A 3A3NA 4HPWA 4XB6B 1EHIA 3IUQA 4V02A 3KZOA 2WNSA 1T13A 3A25A 1MA0A 4EMSA 9GPBA 5FH9A 5L4LA 1VA5A 4WECA 1ZJYA 2OAQ1 3CR8A 5FB3A 2QTNA 3TLMA 3RTGA 3D6MA 1GT91 3IUBA 3SN6A 1ZUHA 1IRXA 4TLMB 4Y1RA 2PWPA 3RYFB 1CXZA 1BMQA 4PWYA 5IASA 3UQZA 1U9YA 4OH7A 3C45A 4UBMA 1ZHFA 2C88A 3HO1A 1Y82A 2WJZB 4IXTA 2FW1A 1L7QA 1SD2A 5JY1A 1GOTA 1UM8A 1WXFA 2YJ3A 1PJ3A 4WKOA 5HTKA 2BTQA 2DSNA 3UAVA 2PWZA 3PWSA 1NUTA 4BN0A 1FS4A 4WINA 3R6DA 3HZRA 3EG5A 5JCPA 1T0UA 1SKYB 2BJHA 2PGNA 3BA6A 3W5SA 4B3JA 2BUAA 3F98A 4E2XA 2ZXEA 3GJ0A 2BYTA 1J2EA 2KQUA 1PFGA 2RDMA 3D3JA 1T5IA 4MVJA 1VL2A 1KJJA 4YHBA 3IQZA 1D2RA 1CS0A 3WLOA 1Y1QA 1Y5MA 5DX0A 4ZT5A 4I1SA 1RHKA 2CL7X 1ENOA 4EWLA 4AL4A 2VATA 3FD8A 1SJ9A 1P1CA 3IQGX 3C1AA 1YR9A 2Z2JA 2XB2A 2W8BA 1J0CA 3WHKA 5BVHB 1S3SA 1NR1A 1ZISA 2QQ5A 1G66A 2C2WA 2QGNA 2I87A 2JATA 3HA2A 4HFMA 4HLUC 2RMKA 4JYPA 4Y2UA 2N0SA 3SIWA 4BCDA 3BIJA 1CW2B 3CYFA 3EGDB 3D81A 1OV4A 5KCMA 3WGLA 4AO7A 1NRJB 2C2GA 3SC6A 2F9MA 2POCA 3TE7A 2YJ4A 1BX3A 4R8SA 3CH4B 3HRIA 4MARA 5A2GA 4YRIA 3ZKWA 4AJ1A 1T9KA 3H4TA 5CM2Z 4CKWB 1IONA 2CGEA 2GFQA 2X8AA 2LP4Y 3KYBA 4N0EA 5TB5A 4C6TB 1AH2A 3H4VA 2XNJA 2JI6A 3RIMA 4C3ZA 3NIDB 3NTOA 4YWHA 2WIFA 4RJJA 1FOEB 4CCYA 1ML4A 3LT2A 3CX4A 3V4LA 2PT6A 2Z4TA 4ID9A 3OJLA 1T36A 2H5JA 1YFJA 1A5AB 2GHRA 4JITA 3C74A 4OYYA 10MHA 1LBEA 2OGUA 2RK3A 3I6QA 4BJHB 2H08A 5GQSA 4GYWA 2ZOSA 2E89A 3EFOA 3HP1A 1YRWA 3B53X 1F51E 3KETA 5KWSA 1IQPA 4RZ3A 1QIHA 1E9BA 4IFIA 2YZGA 3DMGA 1T9DA 3KFXA 4DR6B 4TL6A 4PWZA 4GD3Q 4X9XA 4UHCA 3GCWA 4ZO9A 4JC5A 2OUKA 3INTA 1W581 2J33A 5FWXA 4NULA 2SCUA 4QXAA 1ISJA 1UDBA 4GI2A 5E0OA 3GELA 4YRBA 1HDGO 5K6RA 5TQVA 2J09A 3R44A 1L3IA 1E1KA 4KMMA 3WYBA 4BE7B 4F92B 1CVRA 2IITA 2O3JA 3R3ZA 4UCQA 5EE9A 2PQ0A 2IEAA 2WYIA 2H2IA 4Y1EA 4DR7B 5DTRA 4A03A 1KDVA 4FMPA 4MCJA 2BONA 1MRSA 1R37A 3O0DA 3GP8A 3U4MA 4JUBA 5JH7A 2GPTA 4MVXA 1XGKA 4RMHA 1IBCA 4OUKX 1CK4A 1X1BA 2C2BA 5DHFA 4JJ6A 3JQAA 2LR0A 4KV7A 4M7RA 4RPCA 2HQ1A 3ZY3A 3B9QA 3ZLUA 1O1YA 4GF5A 5EIOA 5IFKA 3I2IA 5BY2A 5E7MA 1OH5A 1FNBA 3I9V1 4CLRB 2RE8A 1EVIA 1UBFA 2ZZNA 2HA6A 3DTVB 3HY4A 2QR2A 4OFZA 3RBZA 2GSWA 2W2PA 1HGXA 3OQHA 1WY7A 1E9DA 3JWGA 4G84A 5GTDA 1V1JA 3DDOA 2QYTA 3BRQA 4YMUA 4UNIA 2CVOA 4P3OA 1U0EA 1ODJA 1UZAA 5JDCC 3TJMA 3KSDO 4KYIB 4UEJA 1NY5A 4CG3A 5A4MS 5GJCA 2EERA 3QVGA 1XELA 2I66A 4XYEA 3O95A 3JWHA 4QUHA 1GKKA 1GG5A 5IUNC 1YDWA 3LUFA 5IZCC 2Z5LA 4KV9A 1U98A 3ST7A 1PZNA 2EW8A 3HGQA 4QYWA 5DF1A 5FYDA 3GLIB 5BR4A 1HXHA 1V47A 1ZMRA 2DRIA 4HKTA 5YASA 3C6MA 5AVQA 3STYA 1JW9B 2V7WA 3W1VA 3K30A 3UJ3X 4Z4QA 3LYHA 1XL0A 2HH9A 3F3KA 3PX7A 2FJ0A 4H4DA 4C5AA 4B4WA 1ESMA 1IB6A 2A0FA 1SUDA 2GF2A 2BAGA 2XDQA 5AJTA 4Y0AA 1OXSC 1V5WA 1E1RD 1IN5A 1HNNA 1SUCA 3CE6A 4UPVA 2GM5A 3ADCA 4HUQA 1JHXA 1W85B 5DHSA 5DK4A 1OYVA 2D5IA 3Q7IA 1WABA 2PL5A 4HDQB 3VU9B 1U3GA 3TGPA 5LD2C 1MC8A 2X0RA 5IUKC 1KPGA 2ACEA 2C31A 1SC6A 3AB7A 4S0XA 4XFDA 1DOHA 1T1JA 1WMEA 2AX4A 2PUWA 2C95A 3QVJA 1Z0SA 4PFJA 2PR2A 3LQ2A 3GJSA 1MEOA 5F2NA 1PZGA 1J0DA 3TNJA 3WWPA 1RKUA 1D8TA 3B1KA 5I7FA 3EDYA 5KOJA 4ZHQA 4LMPA 5CG1A 3FNBA 2J3MA 1A27A 5EP3A 3RJ5A 4UW9A 2TMGA 3AZQA 1KIMA 4ND8B 1Z5ZA 3EPHA 1JJIA 4J3FA 4LOAA 4QJIA 3AEXA 1FDUA 1Q2UA 4M6WA 4NATA 2Z57A 5EG5A 1NW5A 2SNIE 4J9UE 4IUYA 1G0OA 3WQQA 1QO0A 1EHYA 3KUUA 5I4BA 4B3RB 1HE3A 3Q7SA 2R1ZA 2RHWA 3M2TA 2BRUC 4MVCA 3F6CA 3VZCA 5JZ9A 4FMBB 1MIOB 4RK0A 1Z6GA 2QAJA 1JFLA 1JLSA 2FN9A 1EFVB 1WB4A 3CY6A 3K0FA 3LHSA 3QE0A 3Q8WA 3UB4A 3NXKA 1F4VA 1K8RA 3NFRA 4KQEA 4PBTA 1QAMA 1Q20A 1SUIA 3D6UA 4WA7A 4V0MA 4RU1A 4DA0A 3I62A 4TS4A 3UATA 1RR6A 4QVIA 1ZJ5A 1OROA 2D4AA 1KQNA 4DRYA 4CN9A 1UMKA 4H6VA 2W2KA 5CLLA 4PANA 2AOXA 3WAJA 4C4PA 1SB8A 4IDGA 1A9OA 5CVEA 1P2DA 3C97A 2XUKA 2BSAA 4ZU3A 1JT9A 2KJQA 1YZKA 2W6IA 3VKWA 4XLLA 3SHOA 2YIJA 2PL3A 3PKZA 5CCEA 2BKLA 1FFGA 3A9UA 3HPQA 2Q3EA 2X13A 4KQHA 1QZUA 2CHGA 3EXIB 2WIJA 5AKLA 4KXUA 4EYEA 1C7FA 3PQ7A 4G25A 2GN1A 5JUWA 3EVAA 4TSFA 4Q3OA 3RB8A 3WRXA 4BP9A 1PWZA 1GPKA 3CG0A 5DZSA 1W35A 1XVLA 2W2XA 2FZKA 3CBGA 1XQWA 1KDPA 1KXJA 1T2NA 2FZCA 3HH8A 3KLOA 3ID6C 3LOUA 3NCHA 3OTGA 3WBKA 1MABA 2WJGA 4S1VA 1I6MA 1UJBA 2GOYA 4E5DA 4F6CA 1YWGO 4EJ2A 3CR3C 4OLAA 3S2YA 3IPCA 5AOVA 4EHBA 3D8TA 1TFRA 1RLUA 1YR3A 1RD4A 2QP3A 3PQ2A 3QWAA 2CFRA 4MVJE 4PTLA 4TYWA 3KT3A 3FW1A 2J30A 3HDJA 4PQEA 5EXDA 1DLJA 2NU6A 4N47A 4FC7A 3AMVA 3ZHVA 3SOZA 2PMEA 4CT4B 4QPJC 4LKOA 4DMMA 3VTFA 4CN8A 2K7ZA 2CCKA 3SJAA 3SNKA 5HGXA 3WB9A 1G9SA 2ZULA 3JQPA 1NAIA 5ALPA 3UH1A 3VKGA 5DBGA 1PQYA 2H1HA 2GK4A 3QWHA 1OIVA 2EARA 3MGAA 4B7XA 1WDTA 4RGVA 4F2GA 3O4FA 4KRFA 3GJQA 3B6ZA 5E2AA 5BSUA 2CUTA 3UWOA 3JQDA 3EXHA 4HEJA 4K9NA 4I2VA 1Q17A 1IUKA 3RWMB 3T8YA 1JPVA 1K9VF 2CV1A 5HUQA 1E2EA 3AXTA 1XMIA 3BDAA 4NJOA 2VHUA 2JI4A 5F9MA 4Z7QB 2VHCA 4FDVA 1EQAA 1QFJA 3TOZA 2X9VA 2PPVA 3KC2A 3WWZA 4ZC8A 1C0EA 4KL8S 4DLNA 5F98A 1MC1A 3GEHA 2GEFA 1R0LA 2RJ3A 4LYDA 1Z26A 1NXVA 4I1OA 3L84A 3ROPA 2BHRA 3OHSX 2QRUA 2J9GA 3RR2A 3DV9A 4G23A 2WVHA 1R8SA 1MO2A 3GPIA 3U7FB 4X1IA 1F9EA 2XTMA 2ODAA 1JLMA 3MOIA 3I92A 3QTLA 1LJLA 1JIIA 2D5LA 4TLCA 5DBEX 4DCMA 1RAIA 4EJSB 2IYSA 4F7DA 3SEFA 3D6TB 3DMTA 3ENZA 5ESDA 3BTSA 5BRNA 1JFFA 1FTWA 1UC5B 5I48A 2IUYA 1OWMA 2PZJA 3ABOB 5ABPA 1IJBA 2Z6UA 2CLOB 3JALB 1J8VA 1BXGA 1EFPA 4X90A 5T6MA 4FFMA 3R3YA 1UPTA 3UAWA 1B0AA 4TV9A 3ADOA 4AFNA 1AQIA 2RBGA 3NOOA 3GUCA 4BZQA 4ZICA 3LUKA 3OCZA 5G4LA 4YXWA 3NV9A 4DCSA 1URPA 4RULA 1ZK1A 3N75A 1KEVA 1NONA 3ZQKA 4BJ6A 4YV2A 1OLSB 2ACWA 3PR1A 3CUEF 3TLAA 2YRFA 2YIMA 3EIUA 1KBQA 2GCOA 1UXHA 3DTNA 2FZVA 5KQMA 3R23A 3TTXA 3HBFA