2HNAA

Solution structure of a bacterial apo-flavodoxin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures and backbone dynamics of a flavodoxin MioC from Escherichia coli in both Apo- and Holo-forms: implications for cofactor binding and electron transfer
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords Protein mioC
total genus 39
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hnaA00
2QWXA 4YAWA 4HS4A 1FLNA 1ZX1A 3F6SA 3K1YA 1DXOA 1AG9A 2W5UA 2HPVA 3ESXA 2Q62A 3OJWA 5F4BA 1XYYA 3F6RA 4YALA 1QRDA 1F4PA 2RG1A 4N82A 4H6PA 4PTZA 4YAFA 5ULLA 3W78A 4BMPB 3OX3A 3ESYA 2Z9CA 5EMNA 1FUEA 4XDHA 3NHFA 4ESEA 4F8YA 4YAUA 2QX6A 3QE2A 1FLVA 4YQEA 5B3KA 2Z98A 1OFVA 3W79A 3N3AC 1YCFA 1WSBA 1JA1A 1GG5A 2QX8A 3GAMA 3KLBA 3NHJA 3UXEA 4C76A 4GI5A 2BF4A 3U7IA 2FAXA 5EAIA 4FGLA 5JROA 4C0WA 1X77A 5LBTA 3TEMA 2MOKA 1AKWA 4YAOA 1D04A 3B6JA 1D03A 3NHYA 5TGZA 5LJIA 1RLJA 3NHUA 1YKGA 3R6WA 2FX2A 1CZKA 2Z9DA 3K20A 5BUCA 6NULA 1RTTA 4FGKA 4QOJA 1OBVA 4J8PA 3P0RA 4N65A 3LT5A 4QOHA 4C14A 1QBGA 5NLLA 3FX2A 2QX4A 3NHRA 1QR2A 3NLLA 1NNI1 3B6IA 4PU0A 2QX9A 3OWXA 3QFCA 2OHIA 3N39C 4DIKA 3OX1A 3HR4A 1AKRA 1AKUA 1RCFA 2M6SA 2V5UA 3G5MA 1KBQA 3O2NA 3ZHOA 3EDOA 1AKTA 3L9WA 5F51A 1H69A 4LA4A 2QMZA 4QOEA 5LJLA 1CZUA 4BMOB 5FX2A 1J8QA 4U7HA 1AZLA 1J9EA 1T5BA 2GSWA 1CZOA 2KQUA 2ZKIA 4LTDA 5F12A 1TIKA 1DXQA 4QOFA 2F1OA 2M6RA 4NULA 4U7GA 3NHKA 4NLLA 4D02A 1AKVA 3FVWA 3NHWA 1E5DA 1FLDA 2QMYA 2FLVA 1FTGA 3HA2A 4Y7CA 2FVXA 3U7RA 1AMOA 3KAPA 2V5VA 3O73A 4QOGA 5A4KA 3F90A 1XT6A 3NHLA 3KAQA 1CZNA 3GFSA 4S24A 2OYSA 2FZ5A 3OX2A 2WC1A 2QR2A 3B6KA 2V9CA 4ZVLA 4C0XA 1I1OA 3SVLA 2KLBA 4DILA 2AMJA 4XDGA 2FCRA 1SQSA 2R97A 2XOEA 4GR9A 2BMVA 3TE7A 1C7FA 4LTMA 1XYVA 2Q9UA 4CETA 5LBUA 3NHPA 4LAFA 2B3DA 3EYWA 3B6MA 3FJOA 3KEGA 4R81A 1CZHA 1J9ZA 3W7AA 5LLDA 4CF6A 5LVAA 1D4AA 2FZVA 1T0IA 2HNBA 4ZVKA 1RLIA 3OJXA 1OBOA 1YDGA 5LMCA 1BU5A 1ZWKA 1CZLA 2BZSA 1YRHA 3OVMA 4H2DA 4PTYA 3RPEA 1ZWLA 1AHNA 3HLYA 4LTNA 1FVXA 2OHHA 2BPOA 3D7NA 3GFRA 3ES9A 3S2YA 2Z9BA 4ZVMA 3OWHA 3NHSA 4Y9RA 4Y9UA 1VMEA 2FDXA 3FW1A 1V4BA 1SG0A 1YCHA 2HNAA 3W77A 3LCMA 4OXXA 5FA6A 3F2VA 1WSWA 1YOBA 1FLAA 1DX9A 4U7FA 5B3LA 1XI2A 2FOXA 1AKQA 3TZBA 4N9QA 2ARKA 4ICIA 1BVYF 1B1CA 1H66A 3QFRA 4FX2A 3FNIA 5FUQA 3UXHA 4FGJA 3GFQA 2R96A 2N1MA 1TLLA 1QHEA 4HEQA 4GQIA 3ESZA 5NULA 4DY4A 5EA2A 2BN4A 4QOIA 2MTBA 4QODA 4M0CA 3NFRA 1YCGA 2OHJA 4ZVNA 3N3BC 1CZRA 2D5IA 3L9XA 1J9GA 2X2OA 2A5LA 3JSXA 1FX1A 1JA0A 1KBOA 2X2PA 2XODA 2MWMA 2MT9A 1C7EA
chains in the Genus database with same CATH superfamily
3DWFA 1O0CA 1EUZA 4NJMA 2EZTA 2IZ0A 4MYSA 2C7BA 2C84A 2JIBA 2LCFA 1AG9A 4KAFA 5T3YA 4RHTA 1LVGA 4ZYXA 4G8BA 5ADVA 2UVQA 3D4PA 4LOKA 3LVBA 3VZCA 3CTPA 3FTCA 5ED0A 4KQXA 4DMLA 5TMEA 1JR3E 4YX9A 5L3SB 2EX4A 3TLZA 3TLCA 4NABA 1Z5NA 3L7MA 5ICSA 3AFNA 1RWOA 1L7XA 5L3RA 3C74A 3H3XA 3JQRA 4HWPA 2OG2A 4Y2GA 3OTIA 1L5QA 4GL4A 4LDPA 2AKAB 3IQFA 3L07A 4HZGA 1UZMA 3O47A 5K3FB 4CM3A 4BFXA 3TWOA 1Z5WA 2O2DA 1MQSA 3L1IA 5LBTA 4ARUA 2QY9A 5AT1A 1YL5A 3ZDRA 5B7GA 4UEOA 3S5JA 5EUCA 3IBTA 4LSZA 2G1JA 4B3IA 3G0OA 3S44A 1GCAA 1HE4A 1NMEA 1W49A 4R2KA 3SEFA 4UU0A 4B0OA 2Q29A 1UCFA 2AYXA 4NQRA 3VKVA 4HGOA 3IO3A 2IU0A 1GRRA 1NUTA 3N2YA 1U2GC 1BDJA 1V16A 4JLAA 3A05A 1LW7A 4J0EA 3WKBA 1NJSA 3F8WA 2GCNA 2R6AA 2W2MA 2E4XA 4C43A 1H1LA 3CNLA 3KOOA 3O0TA 4J4TA 5J58A 3VMMA 1EVQA 1AMUA 1SD5A 2BRUC 1OE0A 1UZAA 4UVDA 3IXMA 3LT2A 1S7GA 3DFZA 4X00A 2BEUA 3SDSA 4B7XA 1C29B 4GSKA 3L4BA 3LDUA 2J9RA 3DE3X 3K3PA 2VCHA 1T5LA 3OMXA 1GD1O 4FN4A 4HI0E 2HREA 3GA5A 1Z4JA 4LOLA 5HIMA 4AF8A 5I5EA 3DEIA 1ZINA 1DADA 5CVVA 2JB9A 1LBSA 4RSHA 3QVXA 3X3HA 2HRBA 2JD1A 4G65A 3O73A 4MJLA 4JBHA 3VU9B 1PWEA 3BB3A 5CVUA 2EIXA 3DR3A 4W4TA 1PWXA 1GZUA 2PUHA 5IF3A 1Q22A 4HDSB 1W88A 4R2HA 4MPTA 3FZYA 3HI4A 3M2TA 3TIFA 4A7PA 4B9AA 4AU1A 1U94A 1WUKS 1C7FA 3DMTA 4QYIB 3ZHOA 4TKLA 4KRGA 3GFVA 1D2RA 3ZR4B 1XDGA 3X2SA 4QHTA 4HAZA 1YA6A 4TYYA 1MO3A 3H9EO 3AF3A 3KBBA 3STYA 4ZCIA 2DEUA 3LQKA 1D2CA 3DE7X 4XLLA 1ZLXA 1VM6A 4H08A 2PIDA 3QBVA 4XFDA 4UU7A 2QTTA 1E3WA 4DTIA 4ZN6A 1B43A 3SHWA 4EPYA 2XZOA 3NW9A 2JGMA 1KP3A 2VHXA 2X14A 4MUYA 4MS1A 4BZWA 5LYJB 1U1GA 3OA0A 2PZKA 3BXHA 3IHTA 3KDPA 3H5IA 4FDTA 4RTKA 2HQRA 2WBLC 2IOFA 3QW2A 1Q1EA 2R65A 2PKCA 3EZNA 3KB6A 2FEWB 4OXQA 1BIFA 1SXJB 3U3OA 3WTBA 3AVUA 3E5NA 4HNHA 3IMFA 4JY7A 1XZBA 4AJLA 4II7A 4ZEVA 3CLSC 4JOQA 4D7AA 2DUWA 3JD3A 3OIFA 4YP0A 2VXBA 4RXUA 4HPXB 2P90A 3L3BA 5BSUA 1DQZA 3W6ZA 1BA2A 1JEEA 1KJJA 1LLCA 2BEWB 2QPAA 3EDYA 4TQGA 5F4ZA 3G1TA 3FPBA 4B2PA 4JV5B 5H16A 4RK4A 4W5WA 3I42A 1MT3A 5AVSA 1IEVA 1UK8A 1OSNA 1IOZA 1XZNA 5JPDA 4TLDA 1NM5A 2XMCA 5FTKA 2CHGA 3ZU3A 4BRZA 2X19A 3D6MA 4L2IB 2XTAA 2V65A 1M2FA 3NVDA 1AN0A 3IV6A 4I9HA 4Q1FA 2BGTA 4DRXA 5ULLA 3H8JA 1ZNZA 2VHTA 3VX4A 2WUDA 1OWLA 6CHYA 1F1JA 1TUEA 2ZREA 2NXCA 3GGJA 2DQSA 3UAYA 4UU1A 2FFHA 3NEYA 2HIGA 1Y7LA 1SCNE 5JV5A 4IZ6A 5HA5A 2DMRA 2NW6A 1HG1A 4RF3A 1WR8A 2GWRA 2I5PO 2W22A 1P3DA 2RGEA 3K0HA 3QBTA 4P0PB 4BTLA 1KQFA 1GGFA 2ZRNA 2GFQA 3WLSA 3CPEA 3VPAA 1U3DA 4X90A 1F0YA 4L8FA 2PGOA 4AS3A 5KVVA 2JIZD 2GARA 3A4NA 1E66A 3ABZA 2GZSA 4K3UA 3BB4A 5BW4A 3KS9A 1TECE 3GIWA 2GM4A 4K9DA 3CF2A 1JEQA 2RAUA 2P3LA 4ON9A 1G8PA 1ZXLA 2VPPA 1ZQ1A 4X7RA 4ND8A 4YRPA 2UU9B 4PXYA 3LQQA 2RC6A 3PSHA 3V1NA 1AXRA 1SVKA 4GXQA 2DFVA 4AO8A 4ZJUA 2J0SA 1RWPA 2GOYA 3C4VA 4Z2AA 3KETA 1Y34E 1E7SA 1ZK4A 4I1IA 5FPYA 2ATXA 1P0MA 1K08A 2ZTHA 3QF4A 1GT91 5EJGA 4Z7JA 1H0HA 2H9YA 2Z8YM 3FH0A 1ZXBA 1TIKA 3TZLA 3AFIA 3COPA 1WHTA 2M6RA 5KNDH 1KZ9A 5A3VA 3OQBA 5KJ6A 5K0TA 2O3UA 4AZ0B 1WTCA 4TUYA 5HOEA 4BCCA 4NU8X 1GPKA 4PNZA 4R0NA 1V11A 3NDPA 5CB4B 1R0ZA 9GPBA 3BGIA 1G5RA 4MQBA 1E64A 2YWBA 3FWNA 2NZVG 4E2WA 2H5JA 3DD1A 1MGPA 2YKGA 2XQJA 4GR9A 4Q6BA 4L57A 4RU1A 4YRSA 3AHJA 5LMNB 1L5WA 5KTNA 2FPPA 2P2YA 5EN4A 2OPHA 1SA0B 4AWXA 3OH8A 3FTFA 3I6MA 4ZO4A 1P9OA 1RJEA 1SG6A 1ZD1A 1JXOA 5AR1A 3WGMA 3EGVA 1Z3IX 4FDVA 4D25A 4DNQA 1QOQB 2ENUA 4HYQA 1C4WA 3VSBA 2PUCA 2ZIXB 3CVYA 4ZHQF 4DGSA 4UBLA 1C4OA 4KDFA 5D00A 2E3JA 3REGA 3FFWA 3CWCA 3M70A 4O4HA 4GO1A 4X60A 1DL5A 4ZHQA 1SXQA 1H1LB 1RACA 3HB5X 4BGUA 1RQ7A 3DV2A 4DIEA 3B38A 3O4GA 4YS6A 3RT1A 1BJTA 1YRLA 1ID1A 4MW4A 4V0LA 1QIGA 5JARA 1UBRS 4QYMA 1FP4B 3ND7A 4EUFA 2G4LA 4AC9A 1FYWA 1PJSA 3Q15C 2Q2NA 4DDWA 3W6OA 1U1IA 2GZHA 2CXXA 5TQVA 1VBKA 2AL7A 4PLWA 1JEYA 4KXLA 3F5DA 3EVBA 5DHUA 2CFOA 4G0NA 3MHPA 4JNCA 2VYNA 3U0BA 1KBOA 4BNHA 1QP8A 3B3JA 2JFNA 3GPIA 3RTCA 4TZ6A 2WJIA 3UK7A 2FZCA 3A3OA 3N0WA 3P9XA 3VU1A 4WKCA 3AM1A 2IS4A 4PGAA 4IO1A 1IXZA 1S1CA 3DNFA 3FNRA 3VAZA 4HDAA 2QAIA 3H99A 2PT7A 4EGCB 3GJ4A 2Z9CA 1KAEA 3TYXA 1T1SA 3NBQA 1J07A 4RQTA 4FTWA 5D85A 1CWUA 3I0MA 1RXSA 3AW8A 4X6XA 1NI4A 4C88A 4DZRA 4GEKA 1NJ6A 1F4VA 3O75A 1PWYE 1D4FA 3AVPA 2PGNA 4AF7A 3IKVA 3JYQA 3LZDA 3OTHA 2IV7A 3F47A 4LF7B 1O9GA 1YRWA 3ZW8A 3WNBA 2HSJA 1R4AA 1QH1A 1XNJA 2OENG 1M2OA 4AZ3B 1G16A 2QU7A 4BUCA 3T9AA 2FHPA 4B75A 4Q9KA 4KMRA 3ME5A 1CZKA 1VHWA 3ILXA 2QR3A 3Q9UA 1CJSA 4N65A 3VOTA 2WHRA 2ZSFA 4EJSA 5J47A 4A23A 5C37A 2PTGA 4DNXA 4JQCA 4GT1A 3IUYA 2XVXA 5JNSA 5A1JA 2FQXA 3PE6A 2E7ZA 4EFLA 2BH2A 2A0UA 3LT4A 1AKRA 3MAJA 4U2GA 1HM5A 3U39A 1XLTC 1LLQA 5I01A 1S2IA 3AETA 2R2AA 4J94A 5ICCA 3EC7A 4R1SA 3TQSA 4CN8A 1NWCA 3ONVA 5BSTA 3SBXA 3GX1A 1Y1SA 5I51A 4U2FA 5DYNA 4CIDA 5EIBD 4BO0A 3VMFA 4MRPA 1UJ4A 1IOVA 1V9SA 1EBUA 2QR5A 4JK3A 4ARCA 5FNVB 1VL2A 1XCJA 3P9SA 1CUVA 3U3ZA 4FNOA 2VJQA 4D80A 4IHKA 1OXTA 1IQPA 1UBUS 4UCXA 4TL8A 1UFRA 4BVFA 3K35A 4EEZA 2J0QA 1U81A 3CT6A 3KZOA 4FJ2A 3W6UA 1MAAA 3EHEA 4NV3A 3IHWA 1M6EX 1MEJA 2WKPA 1E20A 4PZYA 3V7FA 1N2EA 1P18A 2NYUA 2HB6A 3S3TA 1SK9A 4MITA 2R7MA 4MO9A 4PLTA 4RVGA 2I4MA 3HDYA 5EP2A 4BX9A 2BKEA 1JEQB 1K6IA 2XNDA 1Q50A 3ZGVA 5KPDA 4UBKA 5P8WA 4LGMA 4A8HA 3ORRA 4GC5A 3B7GA 4I46A 4CM4A 5C1BA 1RFLA 1E0SA 3LTEA 3O94A 4N3GA 3NTOA 5KNDA 4Q24A 4RANA 1IMJA 4PZUA 3ACCA 1VLQA 2CHEA 1YIOA 2H65A 4R3NA 3RLFA 1JXMA 5KMGA 5LNK1 4M36A 4EUKA 3RYIB 3N05A 2GH1A 1VIAA 5JZBA 2I9PA 1G2PA 2WG2A 3BFVA 4DLPA 2I8LA 2GCPA 3LUFA 1DX6A 3RJ9A 3L7NA 3ROGA 5E4JA 1AMNA 2ZB8A 3ZDEA 4H7KA 3ZQKA 4BNNA 2VRNA 3EDCA 1EX1A 4BLSA 3BFXA 3L8MA 4TYQA 2FFAA 4XYMA 2JRCA 3ZZTA 1DJQA 2AQHA 1FU4A 4OQFA 1QWSA 4QUDA 5SYNA 3VC3A 4L9SA 1VPWA 1VYUA 4BO6A 4LHYA 1K27A 3OZTA 1Z4IA 3AR3A 7ADHA 5CX4A 4IIVA 1XFAA 1E6WA 3JQ9A 5M3BA 2JGDA 3COJA 4PTZA 4HDMB 1RYBA 3SHFA 3QWAA 4F21A 2XV1A 5L3VA 3WV5A 2A33A 5CA1A 5ENDA 4R7ZA 2ZYRA 2FPIB 2EWWA 3Q3HA 4U9IS 4LOJA 3CIOA 4Q18A 2VHJA 3FJYA 4B3MB 4G5SA 2WYWA 5IVDA 1ZHOA 1WUHS 3GUUA 1HE2A 3TINA 1QQBA 3GWGA 4BEJA 4K3VA 3W2EA 2H2HA 1O0SA 1BHO1 5KWJA 3CE9A 1O5IA 5AI0A 1CJKC 3TB6A 3CLSD 4Z4CA 3GDWA 3GDFA 4DV3B 1M1UA 1P4AA 2VVTA 1HORA 4KI0A 4QULA 1GTJ1 5KYXB 4BVJA 1NVTA 1VFPA 5HQ3B 3RIXA 4KCGA 2XYQA 5IAKA 5H81A 2OCIA 1T2FA 2TMGA 4JZKA 4GR5A 5JXHA 1E6KA 1S2NA 2A9PA 1B2LA 2FEKA 1ZOSA 2EG5A 2PMKA 1J99A 1D9XA 3GLUA 2CK3D 3E8SA 3M89A 4M9XA 4AN1A 4GZ6A 4OQYA 1GV1A 5DWDA 1OV4A 3P32A 1ZM7A 4CKCB 2OZEA 2WRZA 4CKEB 1ZLYA 3VM6A 4RNDB 4EBBA 2CXTA 1IY0A 1OC2A 2BFDB 4L76A 1BCRB 1WXFA 4D0GA 1F17A 1JALA 4G4GA 4EZIA 3K8QA 1L7RA 2QIOA 2BYTA 4DR6B 2J9GA 1K5DA 1N7JA 5JMPA 4LDNA 1G7CA 4CMEC 2CJXA 2C3UA 3GZTB 1IUPA 1RYZA 1HQDA 1KVTA 3IR7A 5CD9A 2PUDA 1QVZA 4EX7A 2VTBA 4J0GA 4C1BA 1G9SA 4ZOEA 4JL6A 3A1UA 3AF4A 3HZZA 3HHPA 4PG6A 1JKJA 1S02A 4PN3A 2O48X 2JGJA 3KO8A 2PH5A 4RCVA 1ZGHA 1UQTA 3AMVA 3G1WA 5J40A 1A77A 2GT1A 2P30A 1FNDA 1N25A 5BV1A 2RHLA 1MNAA 1POWA 3KZ1E 4HNSA 1W19A 1PYOA 1V8ZA 2R66A 5I4BA 1CF4A 1RXYA 5L3QB 4J4HA 1OA1A 1W581 2IXDA 1M2WA 4RIGA 1DUVG 4Y9UA 1LSUA 3BMNB 4UE6A 3FW1A 3LF1A 3MCZA 1C1XB 1GG9A 4X1IB 5DK6A 4ER0A 1G3UA 3ISVA 3GARA 3LCMA 1CG6A 4HATA 3AB7A 2DQKA 2Z2IA 1GYPA 3T4PA 1BS1A 2PUAA 5EHGA 1YAHA 1ZEJA 2K6GA 2AR9A 3G17A 4H4EA 5DGTA 4OHFA 5DLYA 1TVEA 4DPMA 2W4QA 5CBKA 2CMDA 1A3CA 1EP3B 1Z45A 3DDUA 2R2GA 1LJ8A 2J0VA 4L0DA 4UHEA 1SC6A 2W0SA 4MI9A 3AYZB 4OQPA 1K8QA 3KC2A 3HXTA 5AWFC 5SYMA 2D3WA 3STWA 5MN5A 2BAGA 1WJGA 2FUEA 1CE8A 1M8PA 2HEIA 1Y89A 4S1TA 1R27A 3WZ2A 4EDFA 4L4YA 1KDTA 2VHVA 3PSAA 3LPCA 4LZZA 3TQRA 4C7VA 2A30A 2PVPA 2HA0A 2WWTA 4FR0A 2ZUDA 1DXOA 3KPUA 4PS1A 1N2ZA 1ZVJA 2HRDA 2I4RA 1GXSB 3QA9A 1JYEA 3CLHA 4H6WA 2MJLA 4L3WA 1P0CA 1YC2A 2PWBA 2ACKA 4DUYB 3CVOA 5C8YF 4NZ9A 4TRNA 3HM2A 1CJUC 2BUCA 2ZYGA 4RDIA 2A35A 3GLQA 2DY0A 5G0UA 2XT0A 2R4TA 3ADBA 5LU8A 1E89A 4EVQA 1XVLA 2I6QA 3UXEA 2OCAA 2RJOA 2IUYA 1ZA1A 2HN9A 2X23A 3E3AA 3IAAA 4FGLA 5I9SA 3BREA 3MT9A 4Q47A 2DC1A 4HVTA 3GDOA 4DLVA 4EJ0A 2E4UA 3EAFA 2B34A 3TEMA 2P6PA 1BSVA 5DLQC 5AXDA 4FB4A 1D03A 1PTKA 5EJFA 2KWIA 4F12A 1M5RA 4DR2B 1G7TA 2FR8A 3PFFA 1SELA 2BFFB 3H18A 3ZHTA 2QGZA 2OBBA 3ZNOA 1QIIA 4P3OA 2PKWA 1VECA 4KVZA 4MUIA 4MKGA 4QPJC 3ABIA 1RHJA 2FN9A 1JBQA 1Q2UA 1H1DA 3AWDA 3EOAI 3PQ3A 1ZN8A 1DIRA 1I5OA 3NU1A 4TRJA 2Z2KA 4KZPA 5A3SA 1QXSA 2HU5A 4ZQFA 4PWYA 4B3CA 1HLPA 3NIBA 3VC2A 3I3SR 4MV5A 4EYKA 2GFIA 3PI7A 2YV3A 4IJ6A 4PZ0A 3W9UA 3SSOA 1YHNA 2RGNA 4YUVA 2FEMA 3DFFA 3WGQA 4AXXA 1S8OA 2AX3A 4F04A 2GUGA 4CT0A 4Z4HA 5CDTA 3IRVA 3U1VA 3EPHA 2QVGA 2QYOA 4S2EA 4G5QA 4JEHA 4LDZA 3IDQA 4TWBA 3AEQB 4YJ2B 5JMOA 3N87A 1Z47A 1UPUA 4ZMRA 3PRHA 1XT6A 1L6IA 4ABYA 1NF9A 4HG2A 4IIBA 4NBKA 2ZLBA 3H13A 3UT0A 4IIJA 4ZI7A 3BTOA 4REQA 2IY9A 4TPKA 3UK1A 4QGSA 3HNPA 4RCZA 1L4LA 3PDIA 2OKCA 3LG2A 1P2GA 2GCEA 4ZPJA 5UKDA 3R7FA 2ZIUB 3WKEA 3EEOA 2AYZA 2H0RA 3EULA 3WGTA 4O3FA 2JAXA 4O2RA 3DPUA 4OHCA 4FMDB 1UADA 1RLIA 1UC4B 3K2BA 1D09A 4H3VA 4EY8A 2L17A 4QPCA 3T8YA 5BWMA 5I7VA 3IOCA 2WV9A 1EK5A 2HO5A 3M5PA 5FEUA 3LPNA 4ZO7A 2HWYA 2GAOA 2VF4X 3DOEA 3O83A 5TGDA 1Z5PA 3TG8A 2DWPA 3KJFA 1E7QA 2PX3A 2VAMA 4HC4A 4Y7DA 2WR8A 4RE6A 1NU6A 3AVVA 2RGBA 5ADWA 1CS4C 3OLXA 2R1VA 1ETHA 3H19A 4G1CA 4AECA 4MWSA 4IOMA 4XSVA 1C7JA 1DNPA 3RC9A 5C3UA 4XRGA 4IAOA 1D5WA 4JSTA 4JSYA 5H9VA 2QVYX 3SR0A 2AUNA 3C3PA 4MVJG 1DEXA 1E7RA 2C83A 2G5GX 3BPSA 3PD1A 4PR0A 4PIVA 5M04A 5AKXA 1AJEA 3N7UA 3OEEA 1KE1A 4RPGA 4BMZA 3QLTA 5G4LA 3CVUA 1GL3A 2FZLA 4GDMA 5CLIA 1DZIA 3EPJA 2Y6VA 1O6CA 2VK8A 3PGKA 1JU3A 4GVXA 5LUBA 4TTQA 5D5PA 1WXHA 2CL6X 2ZCUA 1MAHA 2ZPUA 3QV2A 2OQIA 4MV3A 5CGZA 4N0DA 5DP2A 5EMNA 5G4KA 1VJTA 4BL5A 1KOGA 4KBYA 1N0VC 2BFNA 3CTMA 2AEJA 4OYHA 4EG0A 1DG3A 1NBOA 3LYUA 1F8YA 1PFKA 1CR2A 3F6EX 5IDVA 2UZ4A 4HZIA 2WJJA 4QO7A 4UAJA 3I5AA 5TIIA 5DSZA 1TUBA 1N32B 2AMVA 2DY1A 3FNGA 3KKPA 1UAGA 4CT4B 2Q5HA 2G63A 3D4NA 3VPXA 1Q83A 2W37A 2W2VA 3F46A 3P2KA 4TMYA 1M34E 1IHDA 4KFTA 2YWRA 2X42A 2MHCA 4UBJA 5G02A 2F8TA 1EDEA 1U0JA 1YVEI 3IT0A 2VK4A 1OT5A 3P52A 2NP6A 5FJJA 1NYRA 2FF5A 4B74A 3HYCA 5I7RA 3MS2A 1GAEO 2XQVA 4GZLA 3PXXA 1ECFA 4C3ZA 4D98A 3D3EA 1M2OB 3W5DA 3PRJA 5ALFA 3AGPA 3NTVA 1G7SA 2GS9A 5CMLA 3TCKA 2ZJ4A 3LNTA 1N78A 2BP7B 1XZEA 4QU0A 2IXBA 2WF9A 3ENKA 2NX2A 3KKQA 1MB3A 2EYQA 2Y0PA 1KKUA 4QQNA 3IQXA 3PZBA 4XIYA 2Q3CA 1I7PA 2FWJA 4MQMA 1W35A 2NN3C 2EU8A 4Q7KA 5LL6P 2VZLA 1BJKA 2JFYA 2OBXA 4MVJI 2Z3ZA 4MW9A 4RLHA 1G55A 1C0LA 5SY4A 3WKCA 4D6XA 1XEWX 1PR2A 1R7RA 2DM6A 3AHFA 4IDBA 3D2AA 1KSJA 2R8PA 3HWWA 3U37A 2VJMA 3P20A 1V1MB 5F1KA 4ND3A 5BW5A 4RSRA 3VI4B 1K8RA 2OV1A 1I1NA 2ZRMA 1EUDB 4R81A 5T6BA 2YIMA 2QLTA 4BJ3A 2XMDA 1NPTO 3RYHA 1RQXA 4D9EA 3U44B 4EL0A 1K6XA 2DLDA 1A8QA 4CE6A 5BRJA 1UEIA 1ZJJA 1UEXC 4HBZA 4G5OA 3L41A 3R7BA 3ABSB 1WP4A 1VSQA 1YUNA 2Q07A 3HKBA 2NU6B 4DSOA 2Y99A 4O25A 3S27A 1XTIA 2QENA 2QD2A 3VQTA 5AJVB 4C6TA 5A03A 3ZNQA 3VNBA 5IDWA 3I0NA 1QMPA 4TV9B 5LQJA 3U13A 2DPLA 2TRSB 1I3KA 4FS8A 5CCDA 4DYDA 5LB2A 5B4UA 3R8CA 2YMLA 3CV3A 3UMVA 4GDFA 2G04A 4H7JA 4E5SA 4OGKA 1F0KA 3CUEF 2O9JA 3B3AA 3ADKA 4OHBA 2C5AA 3ZY4A 1XN1A 3AH8A 3R0IA 2EJVA 3SNHA 1UMBA 5EWMA 2VPYA 1BDIA 2XHZA 5A1TA 4UNRA 2ZUVA 5FTMA 4B3HA 2FZKA 2IC5A 2P9BA 3N2EA 4YUYA 1ULAA 2WSMA 2CSUA 4WDQA 4HB2A 1IH8A 3OF2A 2PA3A 4ROTA 4REQB 3RYIA 1W76A 4RJKA 2VJLA 2J5BA 3MRXA 3SE0A 4DDTA 1A8IA 2HTEA 1RMYA 1WLYA 4TMVA 5DTRA 3FWKA 3CVWA 2JHCA 4K26A 3H4IA 1APBA 4PZCA 1JIQA 4EHKA 4X1OA 4CCAA 1BE0A 3BGOS 2QX6A 5F2NA 4FFBA 4W1QA 2VAWA 3K9WA 1MEEA 2B83A 3PEUA 2PWPA 2YJ4A 1E3LA 1TYZA 1NMSA 3FPCA 2C04A 3BWBA 1A5ZA 8ADHA 1G8KA 3H11A 1BVUA 2UZIR 2ZS9A 3OTQA 1QIKA 4U7JA 1SBIA 2MOKA 4PZZA 1H8ED 5HK9A 4CMIB 2K7ZA 2Q99A 2MCFA 4K28A 1GEEA 4XZ3A 2OKGA 5KNCD 4XWWA 5JWHA 5KTSA 2BJVA 2JEOA 3N5CA 3KFLA 4YASA 5DNWA 5ALOA 2I6TA 3AVYA 1KZ6A 4WFJA 2R4UA 2VI5A 1EWQA 3KG2A 3FNBA 3T3HA 1NJ1A 1V16B 1FVOA 2BTQB 2D4AA 2ODBA 1U0OC 2QZZA 3L92A 3W1EA 4BNJA 1OAOA 4LFBB 4IL5A 1T25A 1A8HA 1TQ4A 3IERA 4KODA 3EVZA 4O1HA 5DOVA 1E2NA 3CG0A 3IAM6 4C7MA 4C04A 4S2UA 1HLGA 5B7QA 5L40A 4Y1GA 3VZRA 1WKCA 4KXMA 3EOBI 2CFRA 4HAXA 3RU3A 2JFBA 1VSTA 1T9ZA 2FX5A 2YQZA 3FVVA 3KHSA 3NIGB 1JW9B 4O3MA 1QHHA 2ZWOA 4ZCPA 1OFTA 4OHZA 4XD2A 2P6RA 2WWHA 2H4JA 3AKCA 4FSDA 1JFFB 5EP4A 1QIFA 2W93A 2CVPA 4HZUA 2PY6A 2RMKA 5GOTA 5IAEA 4YUWA 4L1KA 3JVEA 4N18A 1EXNA 3FHJA 4B17A 3ENVA 3OJCA 2CFIA 3ZKWA 1DJLA 1CS0B 1I33A 3FGNA 4MI3A 1JHAA 2G08A 1OX6A 4R5MA 4TLMB 4UVIA 3FIJA 4F4UA 1JQEA 2BGGA 3H6HA 4MUFA 3AM4A 4IY1A 4HQRA 3TLGB 1EK0A 3IIEA 3PFNA 5THXA 5C32A 2IBTA 1UDXA 3KSMA 5EQTA 4CG1A 4X3PA 1MNQA 1G18A 2YJTD 1M2JA 4Z4IA 2KB0A 1DAGA 1TZJA 3E2IA 4P31A 3IYLW 4JXZA 1SIBE 4H0NA 3MZ0A 4IJVA 5CPFA 4PTYA 3R3SA 1H0KA 5JH7F 5EQFA 3G0GA 5JCOA 3NI2A 2LRHA 3WADA 2VDOB 3JQGA 4QO8A 1M0TA 4XVCA 4PYOA 4BNWA 2C5BA 1N7IA 1QTIA 1SC4A 4EHIA 1PNRA 3AIIA 2PUGA 3K8OE 3HTXA 2O52A 4X20A 3VYSB 5FI0B 5KNBD 1R9JA 1LC3A 3CZPA 2IS6A 4F93B 1DT3A 3H8SA 5KJCA 1QUFA 1A9SA 1H66A 1MOZA 1PVOA 2Q4OA 2Y1DA 4CL8A 1HFKA 4TYMA 2GZDA 2H1IA 2J9YB 3QJGA 3ESBA 1OJ7A 2ILVA 3HGTA 4I81A 5A3JA 5A6VA 2IH4A 4KR9A 1L9XA 5B57C 2GJ9A 1PG5A 4GP6A 2HCRA 5L3QA 3MLBA 1GA4A 3IFSA 5CNMA 4C0QC 1Z6YA 3BGSA 3NYWA 4HNRA 3DKPA 4F6LA 3JATA 1RABA 3JY6A 2LPMA 3H9BA 4FR2A 1V6SA 4DLUA 2AZDA 1WUYA 3QLUA 4UBIA 3TR6A 4Q3AA 1UBOS 3T7RA 1N2BA 1OGIA 1XB2A 4DLLA 1JKFA 1KP2A 1OQAA 1SCQA 2R6FA 4TQAA 3COYA 4JX8A 3RVLA 3TX6A 1P6QA 4NJOA 3BJZA 4Q3BA 4G1VA 4YXWD 3HI6A 3RYTC 1GRQA 2D54A 2ZI7A 4O4LF 2O05A 3KQQA 5DDIP 4DRXB 1VBNA 3CXUA 1NDUA 2RH9B 4CM5A 1RRFA 3F1KA 3P9QA 3KDAA 1OPRA 3N3AC 5ELXA 4D9CA 3D7KA 3DBHA 1WZIA 3EEYA 4RZUA 1NVBA 1GPLA 2NU6A 4I6GA 2PQ0A 2QJFA 4RKRA 4MGHA 2P8JA 4PYRA 1WV1A 3D3NA 2C2BA 1YKSA 1MA3A 1WZUA 1PHRA 3NHYA 5H4GA 1IPFA 1IN1A 1M6VA 2WHEA 4TS9A 4P8RA 4MV8A 4OB7A 3GBSA 1KJZA 4EVSA 3H0CA 4QOHA 1I0IA 1ZM3A 3G49A 3KKLA 1Y3HA 3IDFA 5COAA 2C0CA 3E5RA 5HUJA 1UINA 3ETEA 1BWSA 2C8KA 2OSVA 3EB9A 5FAXA 3C1UA 2OLKA 4YRZA 3B6IA 3AT1A 3CR3C 1KSFX 3VR4H 5TR9A 1E69A 4TTPA 1U1EA 3RW9A 1C4KA 3FWZA 2V8OA 4CLHA 5ICEA 4HS9A 2FR8C 4M2LA 3UB4A 1JT2A 2IYLD 1I01A 4JP3A 4HWSA 1R8XA 4IDQA 4OL0A 4PBSA 5FOWA 3WMGA 4BQNA 3QELB 4F2DA 1GSIA 1MBZA 3R0VA 2HU8A 2PPLA 1P1RA 2IL1A 2RIRA 3F6BX 3TLKA 2AIRA 1UIMA 5HIKA 4MWDA 3HJAA 1BOOA 2EZUA 4G4IA 1Y3BE 5AKJA 1EUQA 2YWXA 3AF0A 3V1UA 3BXPA 3PQFA 2JAUA 2R00C 1KJNA 1PR1A 1QGYA 1PEYA 2XMBA 5L51A 2PD6A 4BVAA 2RBEA 4FFBB 5CAEB 5E3HA 4BECA 1NMZA 2O5VA 4MVJM 2VDMB 4UHCA 2FZ5A 1P3JA 3VR0A 1O77A 1NBWB 1ND6A 4CQMB 3GYBA 3ZK9A 2ZJ0A 4IIHA 2PQ2A 3T38A 3OOYA 4BWYA 3ZOZA 1KZ7B 2OT3B 4GC9A 1N92A 3E9DA 1U3VA 3KZMA 2FP3A 2QJRA 4IG4A 5IX8A 1ECGA 4GW3A 4AFNA 3DUFB 1QOZA 1L0BA 1VCNA 2PV7A 1C50A 4FE7A 2OHGA 2V6MA 1KOLA 1SA0A 3HU1A 3LCCA 1OBOA 2Y1LA 3KPWA 2AX4A 3B7PA 3LWZA 4I5FA 4JJFA 3KR0A 4ZAWA 2ZVQX 3VHQA 1YFJA 3Q5EA 1P9RA 2H4FA 3PUXA 2HMTA 3GRAA 3PC6A 3WSVA 2F3SA 1KERA 3ZQUA 3PTAA 5FADA 1E77A 4W9MC 2R1UA 1IUNA 3FLAA 4F45A 4JGIA 1SG0A 3IQZA 3PDIB 4DIDA 5JDIC 1SOVA 1MOPA 3NUZA 3VISA 3TUJC 3CEHA 1HV8A 2VTDA 5ALEA 3REFA 2IT1A 3P2EA 3NO4A 5EXXA 4HNAA 3ZWCA 4B34A 2Y05A 5KC8A 2PXAA 1BAPA 1BDMA 5BQFA 3MRTA 4BVEA 4LCEA 3CF4G 4ZVPA 4Q7EA 2F1KA 3K94A 4Q3KA 2X0IA 5KOYA 3JALB 3ST7A 2Q21A 5LQNA 1Y4SA 1TEXA 3NPAA 3OX3A 4ANFA 1XE3A 3W2IA 1Z4MA 1FX1A 2ZBUA 4FGWA 5ICFA 3FWHA 1L4MA 1DLIA 3FR7A 4GOMD 4WNYA 3CR8A 2W5UA 3LC1O 1L6RA 3BQMB 1ONOA 1F9AA 1IUOA 3CEPB 3FKJA 1L4HA 3DNMA 3ZY3A 2R1VB 4ENSA 3OPYI 5I8PA 4I08A 1T8WA 1NOIA 2FWRA 2QT1A 1U31A 1SIUA 3C16C 4XEUA 1AUXA 2FWIA 3PUVA 5E1MA 3FB1A 4WXRA 1H9AA 5GVRA 4FSXA 4RQBA 1KDRA 5D5HA 1KYIA 2CHUA 2AOTB 4TKVA 1EWYA 4RK5A 5DHFA 3C8MA 3LJKA 5FT9A 5BN3B 1CUBA 3R3ZA 3ET4A 2F8MA 3BM5A 4U39A 1WULS 1YZYA 2PRJA 3BF8A 1Q0ZA 4YRMA 1CFZA 1WLSA 4AULA 5AOAA 5KEIA 1NLZA 3HA7A 4OYRA 5B55A 1ABFA 3COSA 5A2QA 1AUPA 1EFPB 2BBOA 3LY7A 4L4ZA 4R9VA 4TMZA 4XD7A 3VR1A 3F5FA 1UUFA 4G0XA 1FTWA 3FPKA 5JD5A 3OLZA 3G68A 3LLVA 3CLUD 2ZTUA 2I6GA 3F71A 3TTTA 1VQ1A 2JLCA 4PV7A 1LS6A 1UWLA 4JDPA 4E22A 4OI4A 2X15A 2OXEA 3EVEA 3H1GA 2G28A 4GOND 1QK5A 4QJ4A 4QPNA 3JATB 3GT3A 3D1VA 3QITA 5ALKA 4ZYLA 1J9EA 2C99A 2CNOA 4JC8A 2VK1A 3HZRA 2WM2A 5D1NA 4PCVA 4IDPA 2BGJA 4BMDA 4IHJB 5CIQA 3DYVA 2A57A 4UMEA 1W0KA 1PQYA 1M83A 2O50A 3OQVA 4HN9A 3WRYC 1P2FA 1YT5A 1K6EA 2V1XA 3Q11A 3I6BA 4WH0A 4RORA 2MYPA 2BFWA 3FMGA 5F77A 3MRVA 3SHQA 1AV7A 1JFSA 2PKYX 3KKZA 4JQYA 5EZQA 2PMFA 4IMIB 4XRRA 2ZATA 4YCJA 2XXAB 1G64A 3TLJA 4CMJA 4Q03A 3A31A 4DNPA 4Q9IA 4U8HA 3STUA 4CEJB 2CL5A 5HCUA 3K2EA 5JYEA 4U7DA 1OD6A 1E9AA 4HUTA 1RQLA 3WB2A 5AW8A 2AA3A 1D07A 1ORDA 2OAQ1 1Q7BA 1G6KA 1XZHA 3PEYA 1L8LA 5H68A 3K09C 2QTAA 3SD7A 2WVHA 3MYRA 3OCYA 2JATA 1XMVA 4Z53A 2LP4Y 3M1AA 3MWDB 2QW8A 4ER5A 3L0CA 3FDJA 4TMTA 5A9SB 1F60A 1N6LA 1V4BA 1YCHA 5K8JB 2D59A 1XC7A 2L42A 4DDHA 3EVNA 1EUDA 2VJNA 3Q7QA 3ZDBA 1MMFB 1JEJA 1U6JA 1G8MA 5ANRB 3A3KA 4YYEA 3SE7A 1IBMB 4BN5A 3ISJA 1KDYA 1DAIA 5C4GB 1RKUA 2B0JA 4YMVA 4JS0A 4V0NA 3V2IA 4EYOA 4YAKA 3HKBB 3SZLA 3G2JA 5LOVA 1TUGA 2BFBB 2PRYA 2BFOA 4U9UA 4KP7A 4M76B 3DOIA 4IDGA 1AC5A 2R87A 4FMCF 6NULA 2J4FA 3ELWA 1R74A 3FNFA 1T5HX 3DW1X 4XB1A 3V4ZA 3DHNA 2WT9A 2E37A 3CLTC 4UREA 3YASA 1NL3A 5JAUA 2UXDB 2O6HA 3UG7A 3W78A 3TSZA 4B32A 4BLTA 4Y0NA 1U4NA 1RXVA 8MHTA 1G60A 3KD2A 4LOHA 1R8JA 3DW3X 2G09A 4CG3A 3O38A 4KSYA 2VF2A 2FN8A 4Z86A 1C7ZA 2VLBA 2BGWA 2FYTA 2VT7A 4OKSA 3ZCUA 5JJLA 1W4AA 1ZOIA 2AFIA 2ZITA 4BQQA 1UJMA 3BMOB 2V6GA 2PX8A 5GOZA 4DIBA 2NZXA 2HZBA 3IPXA 4X91A 4MAFA 2V45A 1ST2A 1VLLA 2VRBA 2Z8YA 2ZYTX 4ADSG 1VA5A 1B2RA 2KI5A 2V59A 3C3AA 1R4NB 2ZBVA 3I9FA 4HYTA 4N54A 3RARA 5A5DA 4M9ZA 2O8VA 5EFOA 2VK2A 3KYDB 1BE6A 5ERYA 4BC1A 4RZQA 1KIFA 1ZI6A 1T8RA 4I6EA 1FUYB 2QX9A 3MWEB 1OROA 3MA0A 3MOIA 5J2UA 1QP0A 1I9GA 3ZIAA 2C7QA 1FCJA 1ZK1A 2ZXEA 1Q20A 1RLOA 4ZZ0A 5IU6A 2VR1A 5I9IA 2Q50A 3VNSA 3R8FA 1QHXA 3QYPA 5D5QA 2A7XA 3O9MA 1T0UA 3EIHA 4LV8B 1FMCA 3SBEA 4DAOA 2WV7A 1LDYA 2BL4A 1TYAE 2Q4RA 3BN3A 5FOTA 1C0IA 2D1RA 2OK8A 1VKOA 3IAXA 4UD6A 1ZUIA 4F72A 1RCUA 3TIGA 3HA2A 2G36A 2QKYA 3G9XA 1C0KA 3NAGA 2B8TA 1RSZA 4FHDA 1OASA 4HH1A 2FSFA 5CM2Z 1FPMA 1ORWA 1KS9A 1GUBA 4KEAA 2GZ2A 2J7PD 4LN1A 2HDOA 2ZRBA 3C6YA 1HYGA 5A4DA 1GZ3A 1SUDA 3PKJA 1N9GA 4XDGA 2R97A 3PT9A 1X3SA 3DE5X 3MG9A 4Q4JA 2VTBB 4MMXB 1TT5B 2P5UA 2Z08A 3BA6A 5EZYA 4EPRA 2JFVA 2VUUA 3FLBA 3KU4A 4W7SA 1O58A 5I7OA 2A2ZA 1AX9A 5EZYF 1QHHB 5FOVA 1P31A 2GQ0A 3LP8A 1X70A 5DYGA 3R6DA 3HE3A 4N3BA 3U7FB 5EYPA 3UA4A 4O29A 1FC0A 3JTMA 5JVDA 4ZAZA 2A9JA 1WDKA 2ZCVA 1J2EA 3S2YA 2Z9BA 4Z0PA 1VYTA 2D1FA 2HC9A 3H0KA 3TQTA 1Z5UA 3D7MA 3UWDA 4DMHA 5JYDA 1DSSG 1G20B 1QVWA 3BH7A 5A0FA 2DOKA 3IEPA 3Q41A 4BBJA 4C30A 3S40A 1RKXA 3TLGA 5K3OA 2HHHB 1DAKA 3UPTA 5GZ6A 5C51B 2OGZA 1DOZA 1SQ5A 3I9NA 2J0UA 3WWEA 2AG1A 3VR3D 2JRLA 2IHVA 2YW2A 7YASA 2IY7A 1FVFA 3BXEA 1KRWA 3R7LA 2WFZA 2VH5R 2I3DA 1RJGA 1ZG3A 4P7KA 3EC2A 1U8ZA 2BBTA 1ZPDA 3CNBA 2X2PA 4RSMA 3PLNA 1WKVA 5M34A 3QKRA 3WLQA 2GKGA 5TPZD 2WIAA 3VR3A 3C43A 4M1WA 3NQ41 1VL1A 3JYOA 3QVUA 4PYIA 4CEJA 3SVTA 5ILQA 5C8YB 4YAFA 3VYRB 3ZHRA 3K30A 3MTQA 1YDEA 5E7JA 3WYDA 4XDHA 3VC1A 4GPD1 1JQDA 4FHZA 4BFYA 1XL0A 1DTSA 3DHWC 3H05A 1E3EA 2X0JA 4IVNA 2GZRA 3GHYA 3QYAA 1I4LD 1SH7A 1O96B 1ZHHA 2G7MC 1HLFA 2CFSA 4TWAA 4NDZA 3MWDA 4GH5A 3AU9A 4F4CA 3T3PB 1KJWA 4D57A 3I05A 4L0CA 3PL1A 1J8DA 3T0IA 5A9SA 3RRNA 3LOQA 1IOWA 4I0WB 3WXBA 2R84A 2WWFA 1XA3A 3EARA 1BC5A 1LTQA 1JQKA 4UHHA 3LDHA 3PPIA 1KZ1A 3WYCA 1J49A 2LDXA 4PYJA 5IFLA 1E2DA 3C5HA 4RWEA 4YAGA 5SY9A 1GU7A 4NFHA 4O1IA 1KTVA 1QGOA 3IUBA 2J87A 1J09A 1UZNA 2CJFA 2G0NA 4XCXA 5AHOA 1XBTA 5IJZA 4FFNA 3ADOA 5K45A 3TPCA 1DKQA 3GT4A 2FA9A 2GEDA 2ZJBA 2XBLA 3CBQA 5AM0A 4EGQA 4ZCTA 1E3MA 1K7EB 2NT4A 3IT3A 1XKTA 4QUEA 3AP3A 3RRJA 1OF1A 1NXTA 3IE2A 3WK5A 5K3BA 4ENPA 1ZIYA 3TL3A 2OQRA 3A4MA 3EZXA 2XRZA 2NVUB 3SJAA 1I3MA 4B9EA 3VKGA 1S1MA 2XTJA 2ODAA 3V1YA 1Q0PA 3H5LA 3QEMB 4P22A 1GT6A 5F12A 3LUAA 1ULUA 1XRRA 4KI7A 4Q9HA 3DC7A 3FROA 4NULA 4U7GA 2P5SA 4YAEA 2AG0A 3GNQA 4XIJA 3O74A 5JFOA 3EXHC 4Y2TA 2JFOA 1UKAA 4JC4A 3WHLA 4Y7CA 2CBGA 4YDRA 4X71A 3R0JA 4C7OB 3NWBA 2HA3A 1SG9A 1XK6A 1JLLA 1E2JA 2DHEA 4MVXA 2XQKA 2ZB3A 3DBVO 2VZ9A 3UEOA 5DNUA 4QUHA 4BQIA 3HUTA 3GPBA 4QTTB 1N6KA 5GJWC 3U1BA 4KG7A 2O2IA 3T54A 3OY7A 4L9WA 3WWPA 3IILA 3ZS9A 3CRVA 4P0TA 1KO1A 4PZ9A 3TQCA 4Y2QA 2FLWA 2AG6A 3WB9A 4B5LA 1TXGA 1GKIA 1C41A 1EFHA 3L1HA 4EAAA 3RVRA 3SN6A 3N9IA 3DEFA 2O59A 1WBBA 1FOEB 4B09A 4R7GA 2ZJ7A 1Q1BA 3W5IA 5IXYA 3FCCA 5H80A 2UVPB 3RIHA 3GN1A 3OC6A 3EWNA 1GPUA 2CDCA 4PICA 4JWTA 4OGGA 4F71A 5JOQA 3A6GA 4A2CA 5TSDA 4BB9A 5GIOE 4PX2A 5EGSA 4YVFA 1OAOC 1Z4QA 2PWYA 5JNUA 1NLUA 4PQEA 2CMHA 3U62A 3VU8A 1O08A 1WW3A 3EIUA 2JI4A 3LBFA 1P9NA 5CLGA 1FS5A 5AO9A 1CQPA 1WCYA 3R3JA 3X1JA 4AAYA 4BP9A 4NH0A 3HR7A 2D5IA 5HCNA 3DFMA 3O3NB 2XVZA 4O4IF 4JCCA 4BV8A 1PFQA 4URWR 4QWWA 4JB0A 3C7AA 1E4EA 1J97A 2X3UA 2ZE7A 4HNAB 5JEDA 3DTVB 4N82A 3AI3A 4LGVA 3TI7A 1X39A 1I0ZA 3DLAA 4U2DA 5EXPA 4PFKA 1KU0A 4WN9B 1IMOA 1NVFA 5KYVA 2B9EA 1I3CA 5TVKA 3NTQA 3PCTA 4UC0A 4ESEA 5DN6D 4LSGA 1ABBA 4NCAA 3SYKA 3AUSA 3DQPA 2XYHA 1QIJA 2NUTB 3AB8A 5FA8A 521PA 4P36A 3M5WA 2OECA 5IZCC 4I1RA 1Z25A 3E03A 3IUNA 3Q1KA 2EZ4A 3K9NA 3WRYA 4X65B 1VYVA 4MS3B 4NZZA 4MDHA 2W2TA 3CVJA 5I7SA 1Z4LA 4WDRA 4O8ZA 2VHYA 3P0FA 3SF8A 1VIMA 1AF7A 1NUQA 4YQZA 3B1ZA 3FCOA 4F6RA 2B69A 1Y42X 2NUBA 1J42A 1NVKA 4RD2A 3VA7A 2NYAA 2D5AA 1Y6QA 2FJUA 2WHQA 5A5FA 4G0MA 3WBBA 3R0ZA 2NQ2C 3OQPA 5IARA 4E13A 4B6PA 2PSHA 4YBZA 3SX2A 5KYYB 4ZYTA 4Q21A 2OGWA 2OMEA 4MOWA 3ZWOA 1KH3A 1G291 2CHVA 1PO7A 3F98A 1VBMA 2AGVA 2JAWA 5JJKA 2HZ7A 2Q9CA 2Q3FA 1E79D 5IYZB 1CQXA 1DRVA 4QGGA 4AG3A 2RHTA 2Q4DA 4RJJA 4URHA 3RJZA 3I8OA 4D02A 1AB5A 4E5KA 4FZJA 1A96A 1E1MA 4BNLA 1VMIA 3T7KA 1G5HA 4H7PA 4TX1A 2ZIZA 3CN9A 1Z6XA 3OFND 1DDOA 4KLZA 3ZX5A 2NYVA 4R9NA 3RJ5A 2QN6A 3IRUA 3SKVA 4MAAA 1A4RA 4YECA 2FFBA 3ETJA 3I6YA 2NSLA 1AHPA 2WT4A 3U3XA 1NMYA 4DOMA 5TT0A 4QZVA 4YTEA 3BWVA 2XRYA 2P62A 3C6XA 4TSRA 3GLFE 4A8JB 1FFXA 4XR9A 2O2HA 3WNZA 4IHJA 4BVHA 2JLRA 1YJBA 1P4GA 3A32A 4CMEA 1RPJA 5E95A 1IM2A 4EEXA 3MYYA 3DMNA 5LP6F 3X1XA 2VDJA 5E6SB 2EFCB 5JCZA 1CY8A 1ZKDA 1OXUA 4DR7B 1KMHA 1Z5OA 3NC1C 4PPNA 2AR7A 2R1TB 3VJRA 2ZT7A 3PVZA 4FNAA 4F5YA 1JDTA 3FBWA 2WTMA 3AR5A 2JPDA 3CNNA 4OQMA 1MRNA 5DBIA 5H02A 3JD2A 1U7TA 5E4TA 3A1FA 2PBFA 4EY3A 3EMKA 3L0YA 3EXAA 4G81A 5HNKA 1J4AA 1SPXA 2VBGA 2G5TA 2WP0A 1EFVA 4NNOA 4QGFA 3RUAA 4LWOA 4AT1A 5L53A 3TD2A 4OQQA 4GPBA 1N3IA 3L04A 1X7HA 2PLRA 2QL7A 1HBJA 2ZWAA 3SMVA 2D5CA 2J7PA 2VT2A 4I55A 4BO3A 3PYXA 1B6SA 5IK2A 5JCXA 3OCZA 4JXJA 3MTBA 3ETNA 4NFSA 3VRHA 3B1XA 3DP9A 3KAKA 3D59A 3DXFA 4PEVA 2ABWA 4O2AB 4I9NA 5E2BA 2XBUA 1EM8B 3M49A 4Z51A 3KUCA 5EIEA 4JEMA 1HH4A 1V26A 1Q1QA 4JQZA 2O2GA 1TE2A 4GLOA 1AXEA 1BMTA 1B93A 2I3GA 2VYVA 3ELUA 3PDCA 4EB8A 2Q1TA 4Q66C 3S2EA 5HKKD 5H82A 1BQ4A 3ONFA 1JFVA 2E87A 3D8NA 1PVVA 2BHSA 3RKUA 3GZJA 1J1IA 4FN5A 5CJ2A 5CT9A 5FORA 4EELA 4ITUA 2H8KA 5KX5B 3EEIA 4J1NA 1DC3A 2BM1A 2ZGVA 1RZRD 1B8PA 2NNLD 4NZYA 4CTNA 1C3XA 1K7XB 3D2BA 3V2HA 5K0JA 4K46A 3BSSA 3Q3EA 1YHYA 2Q8PA 1G21B 4RA6B 2RB5A 3AIMA 1B42A 3CX3A 2NXEA 4ZT4A 1TPYA 5DM60 5BY2A 2VA9A 2X0RA 3FKSA 4OOEA 2XGSA 5JJBA 1P1IA 3I1IA 3DMFA 4FOPA 3NX4A 4YR7A 2AC7A 2Y1GA 3D6NB 4PQGA 1ZD4A 1X1AA 4KVGA 4IKEA 2PL9A 1N2GA 2ECPA 1T10A 1TM4E 1N0IA 3TPZA 4QU5A 16PKA 1S3SA 4Z4EA 2LW7A 1SBZA 2OBFA 2WHPA 3ZWXA 1EGAA 1QWOA 1Z18A 2OAEA 3I58A 4KTVE 5DHSA 4DB2A 1T26A 2HU7A 1NV8A 3AHDA 1SKAA 4ZOBA 3MINB 3V42A 1EJ0A 1E2LA 5CGQB 1UOOA 2K87A 4HYYA 1GLGA 4CM7A 5FAKA 1VZ2A 1IN4A 1AZLA 4DCVA 3UT6A 4LEIA 5ALNA 4TV8B 3KLOA 1VG1A 2F1OA 5FP0A 3K31A 1U80A 2BGRA 2WF8A 4L75A 3IAEA 4P4UA 5ERGB 3W3AA 1FW8A 4EY7A 4Y1RA 3V7UA 3FPGA 3MWEA 1XRLA 2HQBA 3N28A 3DP7A 2O7RA 3LC2O 4MAMA 2C95A 4Y6LA 1H5QA 2XNDD 3TRHA 4BNVA 4TOIA 4KOAA 5F7JA 3KQUA 3FZGA 1BXRA 3O7WA 4UNPA 3OZ7A 3FRJA 4M21A 2EARA 3KJHA 4YONB 4HP8A 2PZAA 1VC2A 1RRGA 2ZVJA 4MS3A 1R0WA 3KR9A 4GPAA 3AIKA 1PJCA 1Y1QA 3ADPA 4HEA6 5ADUS 5CCXA 4B7CA 2XB8A 1OR8A 1SUIA 4NBLA 4W5HA 2Z43A 3JZDA 3W2FA 3JVUA 3RSFA 3M3HA 1IATA 4BEBA 4BRWA 1CUEA 1F2VA 1PR4A 1M1XB 3AU8A 5A04A 2HHJA 1AHNA 3IKLA 5K6AA 2A0KA 1E7WA 1P7CA 2GYUA 1Y9ZA 4PANA 3GR6A 3LVFO 3SR4A 3VV3A 3WXMA 1SZCA 4JGBA 2HFKA 3PHJA 4G1FA 4FYHA 5HVNA 3UKJA 1KVRA 3U4GA 1WB9A 2PH1A 3MW8A 2A9KA 1EHCA 1VTKA 3QTBA 3P26A 5CT4A 3THYA 3CZ5A 4BDTA 2ETVA 3GRCA 4FBGA 3VYUB 1G38A 2DBVO 3G0BA 2ZUEA 1RBMA 5EYPB 2Q6VA 4HEQA 2QL5A 1FJHA 1GAWA 5AJWA 3QXJA 1S3IA 5AVKA 4AZVA 1G8SA 2IE0A 4Y2SA 1YZNA 2G1AA 4BJHB 4RLQA 4UUNA 5E2AA 1ORHA 2QQ0A 1P1KA 1MG5A 4FU0A 3QQPA 4XCQA 3WK4A 5CFNA 1PX2A 2Y66A 3JQ7A 4NH4A 5HRUA 2ZYHA 4NBSA 4E15A 4Y6QA 1E4YA 2NPOA 2Z30A 1C3LA 3I6QA 2J0UB 3N0RA 4IX9A 1RPTA 3WQRA 2OA0A 4ARAA 5LXTB 4PWZA 4TMXA 4KXVA 1E2EA 3PC8A 1UFKA 4MVCA 1IBLB 1FDRA 4RPKA 2FUNB 2DBRA 4FWBA 3A27A 3KRTA 2J7KA 3HU2A 1NXOA 1RYNA 1Z34A 5I9BA 2QD5A 3AEYA 4CV1A 3GFOA 4GWKA 3V3TA 4WSOA 3PPXA 3DBHB 1YFZA 1E58A 4CDRA 1D3AA 1U7WA 4LS3A 5IJ0A 1YJXA 4V0ME 5HXAA 2GK7A 1VI5A 4QGAA 1IY2A 1GYQA 2CXSA 2FGKA 2AS0A 2IP1A 3CH7A 3L6CA 4R2MA 4BNZA 5JSFA 1P60A 1CEYA 2I7XA 2QG9A 2EBUA 3ESQA 3J81k 1Z0DA 5K0CA 2QRLA 4P7BA 1YJQA 4U2KA 1DKUA 1PG2A 1NY5A 1QONA 1R1DA 4YRNA 2MSKA 1KBQA 5I3CA 4TT3D 3RFVA 3U61B 1JT9A 4PSDA 2ZI9A 3CFYA 2PZBA 4ALLA 3ADDA 5EEGA 1NC1A 1CB0A 3F74A 3CRRA 3LPLA 2OD7A 2P6OA 3PNSA 4KFSA 4RQAA 4RV5A 4AUEA 4LJ9A 1BS9A 1DC4A 1LI4A 3N53A 3OMWA 1Z2AA 5FBZA 1SPBS 4XE5A 2EOAA 3RG8A 4UXHA 1E9RA 1P1HA 2LDBA 3LYAA 4LJLA 1QZ3A 4PC2A 5EFZA 2GO7A 3LFTA 2XDWA 1KZ4A 1LI7A 1PT6A 4LZWA 2P2LA 4KQ9A 4ZU1X 1YZGA 4K2AA 2J9FA 1NASA 3M9XA 2JAPA 3DULA 5A2GA 2G1UA 3OC0A 1U0TA 4A2WA 2A7QA 4QNMA 3IDOA 3IEKA 1E2HA 3SVLA 3AL0C 2XOEA 4LX0A 2WJHA 2XSZA 4HWOA 3RVOA 1II0A 2FR1A 5B1YA 1HDXA 4IOJA 1MEOA 1E1RD 2VDWA 3N0XA 5TT1A 2WUEA 3D6UA 5KNCA 6Q21A 1H8EA 1K06A 2ZUCA 3O9ZA 4RYDA 3H86A 5CA1F 3DONA 1ITZA 4B6QA 5A02A 3K6JA 1DEHA 2DWQA 2AQKA 2GN4A 1ZWKA 2P9YA 1Q3KA 1L3CA 3QLVC 4RVUA 3ZWYA 5DMHA 3UM9A 1A5SB 1TK3A 1S7CA 2DTDA 2OGUA 2QLBA 3D7NA 2FPIA 2Q28A 1USVA 1P1BA 1U4OA 2HA5A 2ZRIA 1JNYA 3CH4B 3P9ZA 5JSQA 2UV8A 2GYVA 2JAQA 3PI6A 4NCHA 4EG3A 1PGQA 1U7XA 1P17A 2QXUA 3C3BA 4OF4A 5BPHA 4UQPA 2V74B 2QD3A 4KQMA 3TN7A 4DLRA 3BL5A 1R37A 4YQYA 2RHRA 3EISA 2EF1A 4BEVA 3D6VA 4FCTA 5EJ7A 4NE7A 2CNBA 2P2ZA 3UXHA 1ZM9A 2OY0A 3MTIA 4R98A 5ELLA 2WILA 2PAAA 4W9NC 3AUAA 5EA2A 5JALA 1SVMA 3K15A 4G4SP 4JJ6A 4RPLA 4EOGA 2C4VA 1J8FA 1TAGA 4DRZA 2FPGB 2O5CA 2J4CA 3DJFA 1EI9A 3IELA 3R6LA 3N2LA 5J2UF 1RYDA 3D8RA 1Z0FA 1NRXA 3PQEA 2O7VA 4FYJA 4ND7A 1GSOA 2HPVA 1Z73A 2XOKA 2YXBA 3OKPA 3ZDXB 2PO7A 2D0IA 3AC0A 1I2DA 3LIPA 3L7BA 3PQDA 1QGAA 5ALQA 5HFNA 4D9HA 4EQZA 4QELA 3ZJ5A 1F0NA 4RX1A 1CDZA 3R41A 2KMLA 4KJZA 5TF0A 2VP3A 4QX6A 4UCWA 3WZLA 3Q9SA 1N2HA 3L02A 3GLVA 1KY4A 3WK6A 5KTTA 3HB9A 4WOCA 1FUIA 2WWXA 1ORIA 1SHZA 3F6YA 3FVQA 4P3NA 3ZGYA 4CW7A 3L46A 2GN9A 1S96A 5I6DA 1AKYA 4MXDA 2Z6QA 2JJ1D 3JQ9C 4QAJA 4ZT6A 3M5CA 4OP2A 2WTUA 4M9UA 1ESEA 1WXGA 2H52A 1I51A 4R2WA 4XX0A 4EPXA 4JAVC 5BN3A 2IS1A 4CTKA 1WQ1R 1E1QD 1NBME 1P81A 1YHZA 3QXCA 4H0CA 4E3ZA 1K7YA 4N5LA 2B8EA 2LCIA 1L7MA 1Y3FE 2X2FA 4OQ4A 2D2VA 3L4EA 3OBIA 5KSOA 4KHZA 3T3NA 2DB3A 2QAGC 2Z3WA 3B1FA 3NP7A 1JJIA 4UM7A 5K8CA 1N57A 2QP4A 3AEXA 3V1MA 4KITB 3TD9A 13PKA 3L7LA 4BNXA 2JIRA 4XB6B 3JQ7B 1V1JA 4HGZA 4BLRA 4XPZA 5GV7A 3U7EB 1R5OA 2GD0A 3N2ZB 3UZUA 3ITEA 2WSSA 3WO1A 2H31A 5AW5A 3G2NA 5IBQA 1FA9A 3WAKA 1PFWA 3LBAA 4MYCA 5EXSA 1O03A 2ZROA 1R6DA 1R6TA 4QOGA 3KEFA 5DP1A 4YY3B 1XVTA 5FPTA 3GAFA 4Q4HA 4QEKA 4ZEWA 4ROSA 3UHFA 1RXEA 3L1UA 3L1VA 5T5QA 3QNUA 3TM4A 3DVQX 3MUNA 2KW5A 4L3VA 5REQA 1ENOA 3QKSA 2F48A 4HEHA 1JH8A 4Q4CA 2YYYA 1N77A 2PK3A 1I0LA 3V7NA 2ZIVB 5C8ZA 4DV4B 2XXAA 4K86A 3V8VA 4ES6A 3Q7SA 4L16A 4W7IA 5LLDA 3HM9A 1M34B 3JW8A 1T0IA 1WZNA 3B3QA 4EJ6A 4JVLA 2O2SA 3LP6A 2BZSA 3HFSA 2PCJA 4F96A 1QHNA 2CJYA 3K9GA 2VSOA 3L4BC 3BXOA 4I50A 2JJYA 4JLBA 5IBRA 5BMVA 5T6MA 3M9LA 1DOAA 5KNLA 4G07A 5F2EA 2PUVA 4WINA 5HCIA 4M7PA 2AFHE 4N8SA 3RTEA 4UARA 3T52A 3ZWPA 1DGQA 1DJNA 3KQKA 5AW0A 2HMVA 2H9IA 2W98A 3QPVA 2FP4B 3D64A 3UK0A 1GDHA 4V0QA 1U2RA 3PQCA 2Z3VA 2DH5A 2XCIA 3CSDA 1NFQA 1WW2A 3FLEA 4NE2A 4U0KA 1I7DA 2O8EA 4GQIA 2XCUA 1B14A 2GBLA 4MP8A 5KYUA 1QRTA 3G2PA 3NKFA 1LEHA 1P44A 5ALGA 2O57A 5L7YA 1E1DA 2XAUA 3ZY2A 3NVAA 4B3RB 1AH2A 4FQ5A 1UAYA 4RK1A 1GYRA 4NBRA 4NNPA 3VPDA 3WDSA 3TOCA 4V03A 1E2IA 2JS7A 5DOZA 4V39A 3R9WA 4G0YA 1QO7A 1C1HA 1NXXA 3AF5A 3ESCA 3GEMA 4R8VA 4AUKA 4ZV4A 3L93A 1G4UR 2GN1A 3ZQJA 5JAZA 5FFNA 5DBOA 3ZXUB 1R8SA 1WF6A 5GP1A 1QK3A 2GK4A 1Z75A 2HM7A 1QUEA 1CETA 1EK2A 4L4XA 5BN1A 2G80A 2H59A 3IB3A 1CQJB 2QT0A 2ZJZA 2JH8A 4M8LA 3KJGA 4DJEC 4UUQA 1RLMA 1II9A 1X13A 2YV4A 4R8KA 1X14A 2J3LA 4JQSA 3SFVA 1QNLA 4QBFA 2CJWB 5HKKA 1DT5A 4FJ1A 7AT1A 1T15A 1ZVMA 4OD0A 1E2PA 3PUJA 2J3MA 3ABOB 1EQAA 1E61A 5H7XA 4LF6B 3A2KA 1U2SA 1IZ8A 4CLRA 4P3PA 3GGSA 4R51A 4WOPA 4TUYF 4Y2RA 5BYJA 1P0PA 2FFRA 5LQUA 1QBGA 1C9EA 1GPH1 2SCUB 4CFSA 4Q9LA 3AOEA 2OZLA 4GMXA 1EFRD 4IIYA 3K0CA 4WK4B 4XGNA 3DPIA 3JASB 3SHTA 4AJIA 4DLSA 2WDPA 3KYDA 4Y1FA 3EAQA 5E4YA 4I2VA 3RUHA 3O4FA 1E3TA 1DCTA 5BSEA 2AZ4A 1JMYA 1JIIA 4JLPA 4RA6A 4TKMA 3AJEA 4K40A 3UO8B 2ORYA 4CKBB 4G25A 4GYKA 3R9XB 4OFZA 1ZN9A 2WM8A 4XLTA 5E3JA 5LQAA 4U1RA 3OZCA 4C7XA 1R5BA 1NSYA 1BD3A 2DCMA 3IODA 2VYND 3JYPA 2E85A 2PZGA 4MLPA 3GNSA 3V46A 3ZHZA 1XZMA 5I9MA 5K8UA 3HR8A 1X6VA 2XBMA 2ERYA 4PFSA 3LH5A 4EVIA 4OH7A 3QFSA 721PA 2ZJ8A 5HGXA 2WA1A 3SM9A 4I5IA 4NAUA 4DR4B 1Y7HA 4MUKA 2GNPA 4B8YA 4AP5A 1OILA 4YRAA 3RS5A 3LC7O 1L5RA 2RGWA 4BQEA 4LE0A 1C1YA 3HN6A 1OXBB 1N9GB 1Q0LA 4BFUA 4AMGA 10MHA 1PWZA 1FQKA 1HEUA 1TU0A 2JIDA 4D3YA 1NN5A 3AHHA 1ZH0A 2H1HA 2K2QB 3DDZX 3K0FB 4URXR 3A26A 5HP4A 1SNYA 1X15A 4GS5A 1V8BA 4A0FA 1P5FA 1L3BA 3VU3A 2Q5FA 4H0FA 1PS8A 1WEKA 4QXOA 2YMPA 4ZVQA 3DKVA 2HLPA 3BIFA 4HQNA 4D4IA 1YB5A 3O2QB 4FC6A 4LVUA 3C7TA 2NSDA 4KMOA 1VLZA 4LCBA 4BBZA 3JWHA 4M55A 4M8SA 2W2OA 4FMPA 3DB2A 2O2JA 3OLVA 2AZXA 3EW7A 2HT1A 2Q7OE 3WLNA 4N9QA 1X80A 1Z2PX 1BOFA 4NJEA 1MJNA 1VJGA 1A9PA 1XTPA 4QWMA 1ONPA 2F3PA 3EZ2A 1TLLA 2XGMA 1A50B 1VPEA 3ZTTA 2BVNA 3IDZA 1KI1A 2EBFX 3DE2X 1J6UA 1RE1A 2QLFA 1ZYUA 3ASYA 2REQB 2ZAIA 2DUJA 4JBNA 4M1OA 1OREA 3E22B 3RT7A 4NK5A 3U5ZB 1FZQA 1NBEA 4MMYB 1B3RA 4TL6A 1E59A 4RZXA 3GJ3A 1VG0B 1USIA 1OFUX 3OHMA 4FKZA 4YAWA 2WOJA 1ZNQO 3C0KA 3H3JA 3Q2KA 2OCYC 2OCXA 4D79A 1QFSA 2GGSA 1GZDA 4ZAGA 5EMMA 2QTFA 4CM6A 1Z39A 3KXPA 4WKGA 3TDMA 3W3AH 1M6YA 4RULA 1T43A 4KKVA 1NOKA 4QDJA 5BSGA 3CY6A 5CW1A 3TS1A 3H0EA 1XQ1A 3OIUA 3RVSA 4CEIB 3LO5A 1SUBA 2P9JA 3L8GA 3QOFA 2C3MA 4OHRA 2HK9A 3BFKA 2O8FB 1JA1A 1XDBA 4R9SA 1W93A 1MJGA 4P3XA 3CU5A 1PSDA 2V97A 3IBGA 2BJHA 4QRDA 4P0QB 3QVTA 4L8LA 4TVBA 3TE6A 1CY7A 1X77A 2FE1A 3D6HA 2A5DA 2BM9A 2Q1SA 1ZNWA 2CLDX 2WU4A 1R0SA 4UEKA 1FNSA 3DR5A 2GM3A 4OMDA 4KQWA 5JH7B 1PUXA 1W1WA 1T0PA 3OIWA 3MCVA 3LGXA 1YQTA 5DXFA 4RCYA 1EFKA 1O95D 2PGDA 3KVRA 2P6UA 3LFUA 1FUKA 1NF3A 3HR4A 1EP1B 1QVAA 1OW3B 1RHMA 1IY8A 2QIPA 3ZBTA 3HO8A 1NUAA 3H2JA 4LX8A 4TLEA 3U9SA 4CV3A 4HVCA 2A0WA 5AW1A 1SKMA 2KM1A 2H92A 2B20A 5CD1A 4U7HA 5IJ0B 1GZVA 1PUJA 1YOVA 1PFGA 2X3YA 1ZITA 1QCZA 3T3EA 2SECE 4E32A 1LF0A 1EXWA 3R5FA 4INZA 3AHGA 4IWYA 3F1LA 1LK0A 2O4CA 3QEMA 2PMEA 1C81A 2IYQA 3FWPA 2HMUA 1P1JA 1GNPA 3TVYA 3KAPA 3VSCA 1R9GA 2JHAA 5C5EA 1HETA 1GUYA 4TZ0A 3FG9A 1X87A 3PTLA 4F2WA 3KAQA 3PWKA 4XUGB 3E9MA 4D8UA 1WU7A 4FOTA 3EQ2A 1I1OA 4DXAA 3Q12A 3E9CA 1XPUA 4HAOA 1TGVA 2ODTX 6AT1A 1ZK2A 3NJ4A 4ZOLB 4RQUA 2EQBA 1W0JA 5LQMA 2W90A 2QUJA 4I3FA 3HCPA 4KLRA 1CZHA 1ZCFA 3FPHA 2UZAA 4EW1A 4C3OB 4BGVA 5M2QA 1VYHA 1UKZA 5LYYA 4UE3S 2V4ZA 4ITVA 3TVDA 4MUXA 1N7GA 1ESNA 1ZW1A 1B0UA 2ADOA 3U4DA 4A0RA 5B1HA 3IV7A 3T1TA 1TF2A 2NZWA 4GG1A 2H5LA 4I9UA 2WZDA 5KTKA 2BR4A 1AUQA 2H4WA 2HHAA 1RWKA 3IVXA 1SCIA 4HWGA 1Z2CA 5GM1A 1TEZA 1QX3A 1W4ZA 2WKRA 4LJ4A 1SKBA 1ADYA 4QXQA 1H6DA 1TQDA 3D3WA 4Y2JA 1XD8A 1NG9A 2PGAA 4CIVA 3AZQA 2BE7A 1Z36A 2QTGA 1OV6A 1O1YA 1U2DA 3MLEA 4KH0A 4HAUA 3U7QA 1IVSA 1U0GA 1N33B 3LXUX 2Q3HA 4BLOA 3RG2A 2C4WA 2P5TB 3PPWA 1J2RA 2EDCA 3IVRA 2BMEA 4S0ZA 1WMBA 4KLAA 1R00A 2DX7A 3SIPA 3N75A 5AK5A 2GZ1A 2HL6A 3F5SA 3ROFA 1F38A 1SUWA 3HBMA 2YR0A 1GP2A 1JB9A 2QQ5A 4UEJA 3N3BC 2O06A 4WBNF 4TN1A 2O19A 1FW6A 1BEUB 3VDXA 1CIPA 3WWOA 1DEOA 2XTZA 1XJ0A 3W2HA 4RKYA 2WINI 1TU3A 1UDWA 1G9TA 3GEEA 2JZCA 2X8BA 1K4YA 2ZP1A 3ZX4A 4H9GA 4CF4A 5DEIA 3ZE7A 4PAMA 1ML3A 1E0KA 3FOBA 3HBAA 1KKMA 4QYIA 4ME6A 1I1QB 1F4PA 3OPYB 2COEA 2IYOA 1BGVA 4R2LA 4V0SA 3JU3A 1E4EB 5JYCA 3Q8LA 3V48A 3DTVA 4BMYA 3NM5A 3IEXA 1DELA 4P7JA 1B8NA 3EUAA 1L4YA 2TECE 2EP7A 2HXSA 3EXHA 4FHGA 4OSOA 1KI4A 4MCAA 3SZRA 9LDTA 2I8CA 4OATA 5LYJA 4TMFA 5JSYA 2H0AA 4MQ4A 1USGA 3LOUA 3NIWA 1HNZB 3O1JC 4KPUA 3FCSB 1TQ2A 3GNTA 3H4MA 1OAAA 4IHJF 4EYSA 1ORTA 1EWKA 4H1TA 3DDHA 3OD5A 3G89A 3FPEA 2ZRLA 3P0JA 3WMXA 3ICVA 4NJEB 4PYMA 1P75A 4E2FA 1CFJA 2IDJA 1IXKA 2QS9A 4HNQA 4TVOA 3HDQA 1BN6A 3O2NA 1GFZA 4HDKA 3FMPB 4ZVOA 1VCOA 1LBEA 2XUAA 5EVJA 2VWGA 5TB5A 3HB7A 5JRZA 3I32A 4KIGA 1JDPA 1Y6JA 3K09A 3V7WA 3LQ2A 4YROA 1R6AA 3M4JA 4MZXA 5TQJA 2ZRKA 4EM6A 2KLHA 5IYZA 2UUBB 3DKRA 5B7PA 2QTWB 3A9WA 1TX4B 2Y6UA 4JFRA 2ZYIA 4NOLA 2VSNA 5AUOB 1I7SB 5CX1A 1LQTA 3UWMA 5MGBA 3RS9A 3T5BA 2G6BA 4G0ZA 4I8IA 1EX6A 1W36D 1JKXA 1I13A 2VNIA 2ZIGA 3AZPA 3IBFA 5G0VA 4OSEA 3T7JA 1Z88A 3MK31 1Z0AA 4WBXC 2ZQYA 3L5OA 5EHQA 3RFUA 4N3AA 1OI4A 3HN2A 3CBGA 4RGVA 5CYGA 3I39X 5IF9A 1IZ7A 3BSFA 2NU9A 3EUEA 2WLSA 4GM0A 4HR7A 3VSDA 5A4AA 5C35A 5CEEA 2VF8A 2JHGA 2XSZD 1E99A 5LC1A 4TLLB 4EDHA 2Q9AA 3VV2A 4EWLA 1QK4A 3AY0A 3NWEA 1V4NA 4OAOA 4RACA 1PLJA 4E5YA 5JH7A 4ESVA 1ZXXA 1KBZA 5KS2A 4MS4B 1RBZA 1UJBA 4OI1A 3IEUA 1KYQA 4XLZA 1XYGA 3A06A 5F1OA 1SOAA 2C0PA 3WVNA 4ZO6A 5EMKA 4JJGA 3MBKA 4XVRA 4YP5A 4MI1A 4D4KA 1JTVA 2X4DA 3DTTA 1C2YA 1XNGA 2PXHA 2C97A 4Q7QA 1IFXA 3RHFA 3I5YA 4FX2A 1PJRA 5DYWA 3RF7A 1KJ8A 2EHDA 4Q0MA 2OD9A 3SY8A 2EL9A 4YBRA 4TUYB 4BE7B 2G9NA 1ZGZA 3OOHA 3DFKA 4H1VA 1OZGA 2RCYA 4I55B 4D99A 4CLOB 3LYLA 4POOA 1WCXA 4CM1A 1ANKA 4N6NA 1S3FA 5BN4B 1UC9A 4L9RA 1MQAA 2EATA 1WD5A 4LZPA 1DZ3A 3U5TA 4ZD6A 4GIBA 2JKZA 1W1IA 1JR4A 1FDTA 4EG8A 3LWDA 3E8XA 5ALXA 2A9OA 2A1TR 2QZPA 4HLQB 3RFTA 1EIWA 1MUUA 2I2AA 2RAVA 3EGIA 2FPPB 2CKDA 3A8TA 5EIFA 1PVDA 3LNCA 3TO5A 3K70C 2KPOA 4ZDWA 2YX1A 1ICEA 4JHXA 1BDBA 1L5VA 1T3HA 3PHGA 4L5JA 1WP9A 1E5TA 2Z04A 3EWAA 1N5RA 1GKLA 2C8JA 1SBYA 3NIFB 1XEXA 4CM8B 2OK7A 3S70A 5BQ3A 4X85A 2ZJ2A 1WX1A 3OFVA 5EEHA 1ZRNA 3KOUA 4K88A 4QQKA 1Z62A 1QHYA 1J7KA 1N2CB 3E05A 3LKVA 1EFCA 2QM8A 4L07A 5LJIA 5D8DA 1G8GA 3AHEA 2WTXA 1TVCA 3LRTA 1Y5RA 5AK4A 1M76A 2A9RA 1G17A 3OJFA 3Q3IA 5IVHA 3TLEA 3CYFA 1J0CA 4G1BA 3ZVNA 5AM5A 4PINA 3NC0C 5JAHA 4IXNA 2Y1CA 3OT1A 3TTWA 3U31A 4B6JA 5A0TA 4BZZA 5K2MA 3NCTA 3IAS6 4C2BA 2DKOA 2FDCA 1P6UA 2RSLA 3WS7A 3GRFA 3ABQB 4YJGA 3LM8A 3WV4A 3T7EA 5FLKA 1A72A 4RHFA 6REQA 1DBWA 1RRMA 3EVDA 2ZKIA 3GLIA 1EVJA 2VSQA 1WMDA 1VCIA 2OXFA 3A2MA 4N9WA 1QM5A 2HI0A 4KHPB 1NV9A 1Z83A 2HQSA 3OCUA 4JWKA 3NHWA 2D3TA 4U3JB 1Q17A 4EW6A 1MTOA 3BAZA 3CQ9A 4HDRA 3FM9A 4X62B 3KFVA 2WB4A 1DI0A 4QTXA 1ODJA 1QDUA 4UKDA 3WB0A 1KWGA 1PNTA 2X7HA 4EGFA 1ULZA 3PHHA 2V9CA 4O2BA 5F5LA 5EHNA 5HK8A 1U0EA 2XVAA 1E3IA 5JXJA 2GN8A 2EX1A 3RS8A 2QRMA 4JBXA 4XEHA 2DLNA 4UBNA 2J6HA 3EYWA 3AR6A 3QVMA 3RBAA 1LC0A 3SS9X 4J0JA 4CF6A 2GXUA 4ZI3A 3ZVMA 3GOQA 1GNVA 2CK3A 3CJRA 3PICA 2AJBA 1R18A 1CJTC 1Z0ZA 3AXSA 4A8PA 3AWIA 3ZXSA 4BLUA 1SXIA 4GYYA 3OZWA 1CUUA 1MV5A 2YVLA 5ILOA 3L0DA 5IEBA 3FPSA 5LP6C 4X66B 2B8WA 2X9NA 3RSZA 5ETJA 5CFLA 1YNSA 2AN4A 4JR2A 2IPNA 4W99A 2FQ1A 1W0KD 4Q9DA 3TBFA 3ZXXA 4FZVA 4D9BA 2AOTA 2P4SA 4KZKA 5IKEA 2BFMA 1XI2A 2XGOA 1I80A 4N5DA 3QVSA 3RV4A 1O9HA 1AGYA 4CUZA 1EGQA 3IA7A 2IYSA 4QXRA 2J3JA 5TS2A 3TW8B 5BOSB 2G40A 5JI2E 3THYB 3GFQA 5KOJB 2I3BA 1D2NA 3FBTA 1NW9B 3P5BA 5HZHA 1XZFA 2C77A 2CMFA 4OXIA 1M0SA 4YUAA 2KS6A 1IM5A 1O89A 1SUPA 4F5DA 1GTMA 4O5AA 1K75A 2DUNA 1SCJA 1NBMD 4I1OA 4ND6A 4FHCA 4LYFA 2PMDA 2FWNA 4LC0A 4NHEA 3WOVA 2R0QC 1G1AA 2H1LA 1IBSA 4YV0A 2ONJA 2FMXA 3C5WP 3ILVA 3S2UA 4BB6A 2QRVA 5H9WA 1NRWA 5BV7A 2CVQA 3BMQB 1Z29A 1V95A 2RGXA 5JASA 1KFCB 2F1HA 1PV2A 5HX7A 1F2DA 1P1FA 2C07A 2RHMA 1GU0A 4P38A 2Z95A 2PUJA 1QF7A 5FL3A 3NM4A 5HMLA 5B37A 3HXPA 2AZTA 5TLSA 3IXQA 1XELA 2JL1A 1AY0A 1KU6A 4N12A 3S2SA 5HW0A 4YQEA 3T61A 3BZBA 4Q12A 5DX1A 4G24A 4KFCA 3IIMA 1T3ZA 3E22A 4MQ5A 4I1PA 4PG7A 1SU7A 2VJYA 3RBXA 4EKNB 3U7IA 2FAXA 4FOOA 5EAIA 4DMFA 4CM4B 2HBRA 3DLIA 3LKDA 3QEKA 1D0IA 1FBNA 1E1QA 2NXWA 2RH8A 1XZGA 2PV0A 2VYVD 4LE1A 1HNXB 3D9QX 3JQAB 1ZCZA 1QTQA 3ZK8A 4H15A 4XWAA 3UUWA 4IRXA 1YZKA 3ZLUA 4MB2A 1IK6A 5ERXA 1GV0A 1SKQA 3HFGA 4FFPA 4ALMA 4CQMD 4YCSA 1MXFA 3NBAA 4UZFA 3KJEA 3QNMA 3U1TA 3WRVA 5C7YA 4IKOA 5C5DA 2YJ3A 3BJIC 4K6FA 3WKAA 4IQ0A 3NEJA 2P78A 4JD5A 4QSMA 2O8FA 3OHPA 5KDOA 5IK2D 2QU8A 3KP1A 1B7GO 3GG2A 1I4TD 4DCNA 2QSZA 1ILWA 2H1WA 3KOMA 4JENA 1X7YB 4GLLA 5GM2A 3O8OA 1IHOA 5BN4A 1NGSA 1DIAA 2PX5A 3R3WA 5EXEA 3U16A 2XOKD 4UHDA 1DO8A 3NS7A 2ZJ3A 2GBCA 1WOMA 3S55A 1M8KA 2P6MA 4DDKA 5A0VA 4C4PA 2PIAA 4WT7A 3BWCA 5ITWA 4B4OA 1T1RA 2WTEA 3LUKA 4PAOA 5DH9A 3AJDA 1G42A 1OBFO 1ULHA 2QMEA 5IASA 4FD2A 3ANXA 3ZH9B 3WNDA 1JR2A 4ZRDA 2YWJA 4C6SA 4DJAA 2XUQA 3H2HA 2X5JO 1VFNA 3L4SO 1P19A 4GKVA 1PNVA 2D0OB 3DT9A 1ZH8A 5KREA 1Y5NA 4MR7B 4REOA 3X1YA 5E7IA 1X38A 3AIOA 3SOPA 3T4XA 1O9BA 3IQEA 4CMKA 1O4VA 1C0EA 1N0UA 2BDUA 3RYFA 5F5NA 4AJ1A 1G8YA 1CQIA 5LIPA 4DSTA 3FYTA 1CR4A 2FZ4A 2P1DA 1V3QE 2ZIEA 1FL9A 3LGSA 3MCUA 4L5IA 4AKGA 1STOA 3I2FA 3W1WA 1I7QB 2WKWA 2Y0EA 3ORYA 3FMVA 2FSVA 5DT2A 2OM6A 1Y7IA 2FOIA 1EAMA 2HF9A 2WYOA 4B4VA 3LX5A 1Z8NA 1P0IA 3PJRA 2JW5A 1XMXA 1V7PC 3UAWA 2XYVA 3PLRA 4KGZA 1E1RA 4LSMA 1A82A 1P2SA 4YJGB 1NDQA 1KC3A 2FPWA 1DO2A 3MWJA 4M9CA 4M8KA 4Z1OA 3OCJA 5DNVA 4Y9TA 4AUMA 1BVYF 4AO7A 3AF6A 2CFCA 3RSCA 4C3UA 3V4LA 1QGED 4MEJA 4KR7A 1KF0A 1ORRA 2BFDA 1ZESA 2Y3IA 4EGJA 5FUWA 2J3IA 1UAAA 4X3OA 4RABA 5U4XA 3AI2A 2C8VA 3TEFA 1E7MA 1R4NA 1LBHA 3CINA 4CGZA 1E0JA 5ECDA 1FRZA 2W9XA 4OLJA 1PHPA 3QUSA 1KAOA 3PBKA 1ZBQA 2HXGA 2H07A 4MHSA 1D7AA 1EPUA 4BMVA 1CW2B 3G5UA 2NO4A 5D3MB 1BEZA 3I01A 2XUFA 5H1YA 1CQZA 3EG5A 4RDCA 3VZBA 4PCLA 1TD1A 3WC4A 2A94A 2GPYA 4F8JA 5DN6A 2PPVA 1EDOA 2AH5A 2BGUA 4HGNA 4RGYA 4PRYA 5IN5A 3GAMA 1SKYE 2C20A 3PGXA 4ONEA 3O8NA 4Y2UA 4JI6B 4B1FA 4UTNA 2EFGA 4AP9A 3H3FA 1D1TA 1NULA 1C3JA 1QNFA 3P0HA 4I2NA 4UFOA 4P5EA 3DL7A 4BYGA 1KK3A 1YE5A 2HDWA </