2HNAA

Solution structure of a bacterial apo-flavodoxin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein mioC
publication title Solution structures and backbone dynamics of a flavodoxin MioC from Escherichia coli in both Apo- and Holo-forms: implications for cofactor binding and electron transfer
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 39
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hnaA00
2Z9BA 1DXQA 4LA4A 1QRDA 4LTDA 1GG5A 3TEMA 2Z9CA 2BF4A 2FX2A 2Q62A 3ESZA 1WSWA 3KAPA 1CZKA 2V5UA 3OX2A 4C76A 1B1CA 2B3DA 3B6KA 3ES9A 1YCGA 1BVYF 2FZ5A 1YCHA 1AKUA 1E5DA 2OHIA 3OX1A 1YOBA 4XDHA 1AKTA 1CZUA 4CF6A 4DILA 3OJWA 3GFQA 2FLVA 5NLLA 3NFRA 5BUCA 4Y9UA 1X77A 1RLIA 4ZVMA 3K20A 3R6WA 3HR4A 2BN4A 4QODA 3KAQA 4YAUA 4HS4A 3NLLA 1FX1A 4YAFA 2FDXA 5LJLA 2HNAA 1YKGA 2RG1A 1J9GA 1T5BA 2N1MA 3S2YA 4DY4A 4C0WA 2FOXA 2F1OA 3OWHA 4H2DA 4U7FA 4ZVNA 3NHYA 4QOEA 1ZX1A 3FX2A 1JA0A 4OXXA 2HPVA 3F6RA 2QX9A 3P0RA 3F6SA 3QFCA 1CZHA 3ESYA 2X2PA 3FVWA 2R97A 4XDGA 3O2NA 3NHPA 3NHJA 2QMZA 4PTZA 1J9EA 4YAWA 5LVAA 3QFRA 2AMJA 1I1OA 3ZHOA 4LAFA 5FX2A 4ICIA 2QX8A 4S24A 1V4BA 3FW1A 5LBTA 2QMYA 3UXEA 1DXOA 2WC1A 5F51A 4NLLA 3N3BC 1YDGA 2X2OA 1TLLA 3FNIA 3GFSA 1SG0A 4FGLA 4YALA 1AG9A 2QR2A 1T0IA 3L9WA 5F12A 4PTYA 3W78A 1AKRA 1C7FA 2Z9DA 4PU0A 1NNI1 1AZLA 1D04A 1QHEA 2BMVA 3U7RA 4Y7CA 4F8YA 1XYVA 4GR9A 2MOKA 3B6IA 4U7GA 2XODA 4ZVKA 3G5MA 3OWXA 3TZBA 1OFVA 2KQUA 4CETA 4J8PA 2W5UA 1AKWA 5ULLA 4HEQA 5LMCA 1CZNA 5EAIA 5F4BA 3GAMA 5A4KA 4U7HA 1CZLA 3HLYA 4LTMA 2FVXA 4GQIA 1DX9A 5B3LA 5LJIA 5LLDA 4BMOB 3LT5A 1TIKA 4FGJA 3NHRA 1RCFA 4GI5A 1FUEA 2OYSA 1J9ZA 3O73A 3NHKA 1XT6A 2OHHA 1AKVA 5TGZA 3JSXA 1CZRA 4QOIA 5B3KA 4N9QA 2M6SA 1QBGA 1YCFA 3W77A 4ESEA 3F2VA 2QX6A 4QOGA 3TE7A 1ZWLA 2FZVA 4N82A 2FAXA 3EDOA 1AHNA 1YRHA 1H66A 3N39C 1H69A 2M6RA 1RLJA 1J8QA 3ESXA 3FJOA 5FA6A 3OJXA 2FCRA 2ARKA 4C0XA 2XOEA 3QE2A 5LBUA 6NULA 1FTGA 4ZVLA 2MWMA 1F4PA 1VMEA 2Z98A 3N3AC 2MTBA 5EMNA 3SVLA 1WSBA 5FUQA 3F90A 3W79A 1KBQA 1KBOA 1FLAA 2V5VA 3B6JA 1XI2A 4FX2A 1AMOA 1CZOA 5NULA 2QWXA 3UXHA 1AKQA 3K1YA 2QX4A 4Y9RA 4N65A 4C14A 1OBOA 2MT9A 3W7AA 4NULA 2R96A 2KLBA 3RPEA 4DIKA 1C7EA 1BU5A 3KLBA 2ZKIA 2GSWA 1FLDA 3NHSA 3U7IA 4BMPB 2OHJA 1QR2A 4FGKA 1RTTA 2BZSA 1FLVA 5JROA 3GFRA 3NHWA 3L9XA 3B6MA 4H6PA 2D5IA 3EYWA 4LTNA 3NHLA 1D4AA 1D03A 3NHUA 1FVXA 4QOJA 4YQEA 2A5LA 2BPOA 2HNBA 3D7NA 4YAOA 1FLNA 3HA2A 1JA1A 3OX3A 5EA2A 4M0CA 4QOHA 4D02A 4R81A 1XYYA 1OBVA 1ZWKA 1SQSA 3LCMA 3NHFA 4QOFA 2Q9UA 3KEGA 2V9CA 3OVMA
chains in the Genus database with same CATH superfamily
2IXAA 3IC5A 4JLPA 4BQNA 1Z6QA 3A05A 1S9DA 2M98A 4KXVA 4CLOA 1DXQA 2PS1A 3G1WA 1EG2A 1L7EA 4TLEA 5FQNA 3V4VB 1ODTC 1JG6A 1QRDA 3ADPA 5ALMA 3S1SA 1UJ5A 4N5LA 3O0DA 5HZKA 2KPOA 3H99A 5HS4A 2YY5A 4M22A 3N53A 4PY2A 1MHTA 1F7UA 3C1OA 3M4JA 2LV8A 2OZLA 2WAAA 1AMUA 1VP3A 1OYOA 4L51A 2GZHA 4P3NA 5HR5A 3VV2A 3CEHA 1KH3A 1S5PA 4V0MA 1ZCAA 3QFFA 4FFPA 2DFLA 3DBIA 4RFSB 4TKVB 3U7QA 4DGSA 1LBTA 2AFRA 1KU6A 3L7KA 4E94A 2FX2A 4DABA 3TG2A 2GDZA 1XTSA 4QA9A 5B12A 2GM4A 3M34A 3WWEA 2WIBA 5I8WA 3OTQA 3D81A 1OT5A 1KS9A 4BNHA 3E9YA 3FYTA 1WX1A 4N3NA 1CNEA 4C01A 2QUBA 1E8NA 2I03A 2WHYA 2UV8A 3TK1A 3AOEA 3V1LA 5KS2A 5HK8A 2Q1WA 5B4TA 3DTTA 4OXIA 4UDOA 4C2BA 3HP7A 3UK6A 3D8SA 4ZEMA 1RZRA 3SE0A 2FZLA 4MUAA 2OHIA 1NC1A 4MRVA 1B23P 1A50B 4ZCPA 1VOTA 2P6RA 2JGNA 2DH5A 3E1GA 2NVWA 3QPAA 1UWKA 4AJHA 2VN8A 1I9GA 4AK9A 4P0QB 2QDKA 4IV0A 5C5CA 1XR3A 3WGMA 3TQFA 3TQOA 4U2CA 1RAIA 2EKZA 3H4IA 2YCBA 5IC5A 1C8VB 4LG1A 2D2IA 5LQNA 1HDCA 3WLTA 1XZBA 2P4UA 3O94A 1X77A 3SXPA 2WPDD 1UAAA 3W7VA 4N7JA 4LYHA 1W59A 4HZUB 2V0CA 3HO1A 2R44A 3LC7O 4F85A 3NTVA 4KG7A 1F2DA 4OV6B 4QQNA 5KHOC 5T3UA 4QYMA 1WU7A 4E6PA 2R48A 1GZ7A 3GDOA 3OD1A 3ZTWA 3CWZA 1BGVA 3KLPX 5KBYA 3A3OA 2V7QD 3DCYA 5EKTA 4PYRA 4EO4A 2LR0A 1MLDA 2IX9A 4H1UA 2C2KA 3FHJA 3WI7A 3B5IA 3QITA 2PTHA 3C6KA 3USZA 3TE6A 4UOEA 4MGZR 1YJCA 3DKIA 4BGDA 4UM7A 4ZRDA 4JU8A 1VIMA 2XUHA 5TR9A 4V0LA 2FR0A 2PANA 4H7DA 4RMNA 4OK5A 2H54A 2QG6A 4MNTA 2WUEA 2B9EA 4QOIA 3D7KA 3ESCA 1EJ0A 3HMKA 3CNEA 4H7HA 4MPTA 4CJXA 3D6JA 2XMGA 2QE7D 3DGFC 3SU8A 2E4XA 3HZZA 3I1IA 1NF8A 2ZTHA 2IXDA 4IHAA 5H7XA 4YXWD 1P19A 2W6JA 5JC1A 1CS0A 3VNUA 3UJ6A 3V8MA 2PV0A 4DE5A 4MA0A 1GVHA 1YWGO 1WPRA 2IYZA 1U7XA 3GJTA 4EG6A 4F7DA 3AIIA 3HCPA 2GERA 4H2DA 4CFZA 4MZDA 3SYTA 3KSBC 2H9AA 2FPIA 1CYDA 1ZK3A 2DU8A 1GVNB 5AOAA 1ULTA 1M5TA 1QIHA 1V8ZA 1X7ZB 3OZFA 3O8CA 5HCIA 5INTA 1X6VA 1FYFA 3EWIA 4TMKA 5FHRA 4N5DA 1X7YB 2FR8A 3HB7A 4BVJA 2PXAA 4CKYA 2F3PA 3QKTA 5CPFA 3FYUC 1BWSA 4HWKA 3C48A 1X3LA 2JAUA 1UT6A 4YA6A 2FPLA 2FSVC 2G88A 3AESB 4JEHA 5A05A 1L7PA 3JQ9A 1S7CA 1WXDA 2B4AA 4KDRA 2JHGA 2BE9A 4FGZA 3WGIA 1M7GA 3QPBA 4R1OA 3PUKA 4EYOA 3BMNB 1V47A 3ZXYA 3M6LA 4JY7A 2D6FA 3DV9A 4B5KA 2CHVA 4JC5A 3KCNA 5B2FA 3CM0A 3ROZA 2QYTA 5IX8A 1Y4ZA 4V2UA 5L51A 3K6SA 2C94A 4KLRA 1PNVA 4R83A 4F4DA 4IFEA 1AK1A 1J9EA 4CCWA 4J0HA 1YNSA 4C4YA 3OQNA 1LFDB 1JKJB 1F60A 1DRUA 1ZDMA 3QU2A 4ZO7A 4YVFA 2J9YB 1OPRA 2PWPA 1J56A 2V7EA 3CCCA 3VR5A 2F3RA 5ALOA 4BO3A 5DGIA 2H0AA 3U3KA 1GEEA 1GZUA 1I7NA 2FRDA 4NMWA 2A9RA 3LXMA 4K9PA 4I9FA 1HK7A 4TRNA 4U6NA 4HGRA 4L8VA 2VAXA 3PD0A 1P0IA 2HDNB 2IYSA 3PDJA 3GV0A 2PH7A 1T4DA 3MQFA 3IUBA 1ZEJA 3A6GA 3QKRA 3QKUA 3GQBB 2OAQ1 4HMOA 1ZOSA 4EF5A 1PT7A 5KTMA 2I6UA 2J6CA 3M9XA 2H3EA 5EQJB 4DDMA 5F21A 4E22A 1C7JA 2NQ2C 4BC0A 3WIBA 2WTAA 4NCXA 2V0NA 3O8RA 2XTAA 1K7EB 3U5TA 4V39A 1FS6A 2CUKA 4H3HB 2PR7A 4DPMA 2XCRB 4OFWA 2JAWA 4QTZA 2YV5A 3STTA 1YR7A 1MEOA 1US8B 5GVRA 4ABYA 4W5NA 2ZRJA 3DHWC 4LRTB 3LBNA 1WXFA 5F9HA 5J5CA 1K5HA 2X7XA 3ONWA 3JTMA 1SG0A 1LSJA 4YCJA 5BQPA 1ZITA 5FFMA 1T0IA 3I4LA 4O2BA 4EYQA 1Z5GA 1S4MA 2GXUA 3JX9A 1GTJ1 5EERA 2JCGA 3KOZA 2WA2A 2Q7XA 5KUTA 1F6BA 2DPXA 1M10A 2WFAA 2PCLA 4HDNB 4AG3A 1ZW6A 3PXXA 4OYHA 5AVSA 2NP6A 4NDZA 4ZHQA 5IXJA 3GXOA 2ZR9A 4NU0A 2CXSA 2IPXA 3RS7A 1YR1A 3RCBA 3AEYA 1B8VA 4WWHA 3GHHA 2JARA 1X1CA 3PX2A 5GINE 3DAGA 3OQ6A 3AI3A 2QRZA 2G3YA 3WZLA 2HHJA 2Y2UA 5AHOA 5MF6A 3NVKI 4MKXA 5GQSA 1E4EA 1NBHA 4UFNA 3UMRA 4F4IA 2AR9A 4AJPA 3DFFA 5A4IS 1Y3BE 2IBSA 1NL3A 1E58A 3CYFA 2XXAA 1T5DX 1HQYE 1B0AA 5J2UF 4X54A 1PS9A 4BGIA 1Z9BA 4PO9A 1UPAA 5H16A 3R3ZA 2O05A 3U4CA 1IDOA 2NNWB 3B9QA 4W5RA 3DKKA 3AUXA 3PRHA 1SK8A 1KC3A 4RHUA 2BFFB 3LECA 3DEAA 4D9GA 3OCXA 5SZHB 2HA3A 1E3WA 1KC1A 4N49A 3RGGA 1N3BA 4QLBA 4ZZ1A 3BXPA 2HEGA 4UHDA 2G9QA 2G5PA 1QFMA 2ZYGA 3PDUA 4Z4IA 1RXIA 4OYYA 2VRBA 3RFCA 4DLYA 2R00A 1XZFA 3NVMB 3GAMA 4L9SA 1DIBA 1WA5A 3DEHA 4RC9A 4IH1A 4HPJB 3LYAA 2BP7A 2IHYA 2JLRA 3EIUA 2GCOB 2RHRA 4XM2A 3A1CA 4UEJA 1NBME 1MAHA 3LCUA 4XGIA 3INNA 2BEVA 4LJSA 3CB2A 3O1HB 5A2QA 5B37A 1VLVA 3QVUA 2W90A 1UBLS 1Z6PA 1E1MA 4MUBA 1U1CA 1CUVA 4A5OA 4K26A 3ZPXA 2R60A 3ABOB 2DTXA 1YMUA 2CN1A 2H6EA 4BVEA 4D92A 2X58A 4EYSA 2ZCJA 2I9KA 2QK4A 5MN5A 1TIKA 4KYTA 4FUTA 1R8QA 1HSOA 2J0VA 2P3OA 2ECKA 3MW8A 4X24A 4R9VA 3K2QA 5ERGB 1BZYA 1Y6ZA 1J8DA 4FYKA 1ZOPA 2C3YA 1ZH4A 2JASA 2ZCVA 4HQNA 4ED9A 3TGPA 3TQHA 2Q3JA 1V95A 4G41A 5PGMA 3TZKA 1O96B 3H5LA 3N8DA 3JSXA 4KPUA 4B6QA 5KNBD 4NAUA 3W2HA 3R6LA 3DR3A 3C8HA 4B32A 2AXEA 4CLDA 5CB4B 2H1WA 2J9RA 3ZWYA 1DAEA 1EVJA 1FP6A 3HBNA 3ASZA 3FD8A 4PW0A 2VWGA 3O4RA 3I92A 1SCUB 3GT4A 1TM4E 3KVOA 3OESA 1MOPA 3B2QA 4V0NA 3TE7A 3HVRA 4GMXA 1VXOA 4XB1A 5G0UA 3EG9A 2HT1A 2BM8A 2DGDA 4MQFA 4P3YA 4JJEA 3ILYA 3Q15C 2ZIUB 4C03A 3TZHA 1LLUA 3DMGA 3Q6NA 3THXA 4C2UA 1UBMS 2FUG6 5BRAA 7MDHA 2VK1A 3QG1A 3N39C 2QSUA 3C3XA 1SXGA 4D3XA 5CT8A 1RWOA 1F8YA 5JPCA 3BRSA 1S8AA 2NO0A 2IYQA 3H1PA 4NEQA 1NVVQ 3I3OA 4K3VA 3VR6D 3KQPA 3QVOA 4LC1A 1RWQA 1ML4A 3BB1A 4WGFA 3WKBA 3MJVA 3B13B 3D3WA 3UPDA 1QUFA 5C52B 4FYWA 3AM4A 1VCIA 2XEDA 3PENA 4F06A 3VHXA 2EZ4A 2IQIA 4OHCA 4BLRA 2QP4A 4N18A 1NV9A 4IQGA 2J7KA 3T4EA 2C1EA 1NM5A 1XTPA 5KJ6A 1VHLA 1YDWA 2V45A 1IN5A 1U04A 4A36A 3RRFA 2QPAA 5F1OA 4MQEA 3DXFA 2Z56A 3LP5A 2H5LA 3MT0A 2PH3A 2H9IA 5BSUA 1HNNA 1XZ8A 2NUAB 3EC7A 1WSBA 2CV2A 1RM3A 3VU0A 2XAAA 3LGAA 2EL9A 3EXIB 5C1OA 1GPUA 1P91A 2WHEA 2WG0A 2JANA 2Z2KA 1OAOA 3IUPA 4ZV7A 3UGTA 1KP3A 1A98A 3HS3A 3PIRA 4IRXA 2VUIB 1K6XA 3GA5A 1TTTA 2P40A 2BKAA 2GM3A 3QWHA 4K2AA 4Q01A 1BRTA 1EAYA 4PLHA 5D3ZA 1Z4KA 4DXDA 5K2OA 4V3CA 5E6RB 3MGBA 2P69A 2EFJA 4G4SP 1DJPA 3VGPA 4XWGA 4CCYB 5BY2A 1VYUA 3VC2A 3CNLA 3D4IA 3KLOA 4RA6B 4BEJA 3HLKA 1VM6A 1F48A 2G5TA 2MHCA 3LVFO 3O84A 4L57A 3UY4A 4QD3A 4V24A 2CB9A 3W9YA 4R9RA 1DIGA 2X8WA 5EHQA 4A10A 2A7QA 1S0UA 2NU9B 3VU9A 1GRRA 2XAUA 1H4SA 2QB5A 2VI5A 5I47A 4I46A 4OUDA 4NJEA 5CXQA 1J20A 1JEAA 4Y6LA 1UBEA 5KYKA 4WK4B 3VPSA 4B48A 1G0NA 3QLVC 2AC2A 3SXUB 5F7OA 3WLNA 1RHRA 3LVBA 2P2NA 4H6VA 1MX5A 1RCUA 3F6CA 3JAWB 3GLIA 3GP8A 2V4UA 1FRVA 2O8BA 1T2UA 1YHZA 5KNDA 4NX2A 5CMLA 5EVJA 1HM5A 4JXXA 1MABB 1ISPA 1R6XA 4MV8A 5GTDA 3E61A 1YRAA 2YZKA 4QUIA 3QVGB 1VJ0A 3EVDA 3L8YA 3L0DA 5A6SA 2XB6A 2QG9A 1V48A 2C2BA 1CD5A 3C6BA 1M3SA 3KJQA 3T0IA 2FZWA 2I66A 4FK8A 2NO9A 4F84A 2AFVA 2JHAA 3KQKA 3C7AA 3UV7A 2CYAA 4OA8A 4V0RA 1T4CA 2CLCX 2WU3A 3DAYA 2G0NA 5C7YA 3H18A 4IH9A 1AQUA 1XTTA 1YR6A 2FEKA 1G1MA 3A1NA 5EPEA 1S2LA 4RIHA 4PCAA 2WHQA 2PUJA 4WXYB 1Z8HA 3CBQA 1JFFA 4TS1A 4D8WA 2GK4A 2H85A 2PUTA 3CPEA 3OA0A 2ZE8A 4BATA 1PK7A 3U49A 3JTEA 4M98A 4BFVA 3OZ7A 5EHNA 5HVNA 3IV9A 2IZ0A 2VSOA 4Y0NA 1JNYA 2IHBA 2WAMA 3U4AA 2D2EA 4LF4B 2O2CA 1NNEA 3FMPB 5BMVB 4BB9A 5KTOA 1ZH6A 1PU2A 4OKIA 3GAZA 2H4FA 2J32A 3KU4A 4FKBA 5K4HA 2DY0A 3IVMA 1IK4A 1JXQA 4LHVA 5MFPA 1A1VA 2O2ZA 3V8BA 4GEGA 2WA1A 4AMZA 4URYR 4HCJA 1YE8A 2RAVA 2AK3A 1W85A 4Q7QA 3SHFA 3UMCA 2DFVA 5DLYA 1HLGA 3ZZ1A 5AW4A 4TYQA 3F47A 3WQQA 4AKHA 1VL2A 2I22A 1ZXBA 3HR8A 3ONEA 4G0PA 5DN6A 1EX9A 1BAPA 1T9BA 2APJA 3JPYA 3VR3A 3GLUA 2Z8ZA 3CF4G 1E5QA 4PO8A 4C9BA 3IEVA 3NR2A 2C31A 4H6WA 5AFSA 1SNYA 3HYNA 4G9BA 4E2ZA 5J4KA 4F9TA 1YFJA 2GVDC 4KFRA 1FYWA 3O1LA 5U4QA 3PF9A 3KKNA 4BIIA 2PIDA 2ATVA 1G6HA 3AY0A 2ZG6A 1V9CA 4P3OA 3WSWA 4KC0A 4J4HA 1EFHA 4EQZA 3PQ6A 2NYRA 5DI3B 3V32A 1D6JA 2B5OA 4CLXA 3KQWA 3SM3A 1DEXA 3RSOA 1W88B 2QMUA 4DIUA 1EX7A 5JPDA 3NHFA 1F3OA 2P2YA 1PQPA 1D2GA 3O9MA 3PD1A 3WIVA 3ZLBA 1GV1A 4E4RA 5BSHA 3WMXA 2C8KA 3PBKA 3IAUA 3HVKA 1O9GA 3A4LA 3DOEA 4FT4A 3ILVA 4WJZA 2Z6AA 5TXGA 2QUKA 4R2IA 1H9BA 4CR7A 3UYLA 3K0CC 3OLXA 1LVHA 1K8QA 2FSUA 3ND9A 2J67A 3TQQA 3IBYA 5TGDA 4YJ2B 2OPBA 3JRWA 3HKDA 5LYYA 3R9KA 1WUKS 1H1TA 3DV2A 3TTTA 1Y7LA 1P1RA 1CIPA 1G4AE 1QMPA 5GONF 1NGSA 4LXTA 3IAFA 4PPQA 1BCSA 4XUEA 1DKMA 2VQDA 3QKIA 4IW3B 4BVAA 4YFYA 4KITB 1ISGA 2VEOA 1WMSA 4JHLA 4MKZA 3VZDA 2GHRA 1UIRA 3VSDA 1EWQA 1QGAA 1MAVA 1FTWA 1RQ2A 1XRLA 2VHUA 4BKUA 3K16A 5AI8A 3PXAA 3OOWA 5DCUA 4ARUA 2AI2A 4M1WA 1Z2OX 3FKSA 2O6LA 4X91A 2YOFA 4HAWA 3REQB 3CN7A 3KQQA 1FZQA 2P9GA 1BXGA 1HE8B 2PZJA 4HFRA 4RVUA 3NU1A 3RASA 5AM2A 3I05A 4DR6B 2O8DB 3DYIA 3WVNA 4INJA 4RZIA 4MDEA 1PAUA 3E3OA 5LLSA 3R7SA 2ONCA 1TM3E 3HYTA 2NAFA 3ZDQA 1THZA 1T26A 4QGHA 3WJAA 3NB0A 2Y27A 4JYBA 4G84A 4B3IA 4UJ3A 2O8VA 3PDIB 4OQFA 4L72A 2J6HA 5F3RA 4ARVA 4KUEA 3FPSA 3OX1A 5AJHA 2VTBB 2HBQA 1ULHA 1XEXA 2PVCA 4GR5A 2WWGA 5DYWA 3IMCA 1JIQA 4GKBA 4LF5B 2E4AA 3W9UA 1QYXA 2ZREA 3BDVA 2K2QB 2QUHA 1I4TD 4F9GA 3OA2A 3SJZA 3ZEAA 3EZXA 1KMHA 1RLIA 1UZMA 1LSOA 3G6KA 3ST7A 1T3GA 3UB2A 4D4LA 2C2YA 4DSNA 4ZJYA 2GK3A 2X8JB 5FNVF 1UWVA 5FJJA 2Q6TA 4EYEA 4RPJA 1FU4A 4AXXA 2WD9A 2I54A 1CTQA 3DNMA 1PT8A 3ZU5A 4BMSA 3ODPA 4M8NE 1RAEA 1XQ1A 4L76A 4QODA 2J9ZB 4TXLA 1A8PA 3ZCQA 3LH5A 2QXTA 4K9NA 3VO9A 1MFZA 5JRJA 2AMVA 1M66A 2C9ZA 5L4LA 3LZ6A 1PSWA 4EEZA 1GQYA 3R8XA 3NBYC 1D3AA 2FFQA 3G9ZA 2BDEA 2XH8A 4GLFA 5C1PA 1JILA 3AV3A 2XUFA 2Z2YA 3EZ7A 3RBZA 1LRKA 4JLNA 4OHKA 5AOVA 3S6JA 4ESHA 3ER8A 1ZOLA 4QVGA 2N1BA 2VUSA 4P3PA 1VE5A 4A0FA 3PNSA 2MCFA 4EJMA 4H7FA 4JXZA 1J9GA 1PWEA 2VT2A 4P80A 1RYYA 4QWMA 3ZTYA 1QH1A 4JYMA 3HCNA 4AP9A 4CM4A 1QTNA 4B71A 1N0UA 2YYZA 1RI5A 4R2MA 3CH4B 4C0WA 3NP9A 4YT2A 1E69A 4XB6B 1EBUA 2AHRA 2W4QA 4UHJA 3RF7A 2P2CA 2CLDX 4BBJA 2PKCA 2O8FB 4PHHA 4Z86A 5TF0A 3AERB 4BZZA 3CKYA 3GRVA 3T7IA 4JMPA 3ZE7A 2XHZA 1XJ5A 1BG6A 1RP7A 3R20A 2JW5A 4TWJA 2H9YA 3UMVA 3VKVA 2EX1A 121PA 2H51A 4GKAA 4C0KA 1TYZA 1Q3KA 2OBFA 5C5IA 4OLAA 5FBLB 4DTIA 3A6DA 4B3SB 1EKXA 3WK5A 1M0SA 2VUHB 4RTQA 3WJ2A 4RK1A 2WSLA 5CD1A 5AVQA 5KNBH 5FOTA 5BURA 1E3JA 3GLFA 4GUDA 5I5EA 4HYYA 2V54A 3EHDA 4QAQA 3N28A 4C22A 1R50A 2CXUA 2A0WA 2DUNA 4LDAA 4WCVA 1JYEA 2Q28A 2X3FA 3DV0B 1UXJA 2JKYA 3R5FA 1WE2A 1MB9A 4XQGA 3M6AA 7YASA 2PKXA 3X43A 2AA3A 1TYDE 1P80A 1ZA2A 3MXOA 2R97A 2FR1A 4TZTA 5LA6B 3C5CA 4H3VA 4KAAA 4A8TA 1L9KA 4BWGA 4O02B 2F8TA 3K9WA 3NHPA 1DFIA 3HWSA 4YAGA 4NENA 3AO0B 2QTAA 4Y6OA 3V2HA 4CGYA 1E1QD 3WIOA 5EFOA 5IBPA 2KHZA 1Z7WA 4FGWA 3BIFA 4ZPJA 5CLFA 1QK5A 1G9TA 3HXLA 4DQUA 2DMRA 3LVRE 4BXOA 4C0JA 4JB2A 1DAGA 2XA1A 2PY6A 3W3AD 3OIVA 3H16A 4EHHA 1SBNE 5CDFA 4W7IA 3B1YA 1T2DA 2D59A 2G4CA 1L7MA 1KK1A 2O2EA 4Y2UA 4JK3A 3VR6H 4ASUA 4E08A 5CG1A 3FUUA 4G1CA 5B3JA 4Y9DA 2KW5A 4YMGA 2O9JA 1O97D 1EM8A 1TRKA 1HKHA 2NM0A 4IM7A 4N6GA 1IB6A 3BEDA 2QJFA 1AA6A 4CLOB 3PS9A 3BPSA 1S3SA 1WD5A 2OCDA 3RE1A 1NVVR 2ZSUA 2B83A 3DONA 1TZCA 2HLDA 3TLCA 4DBVO 3RWBA 2Q9BA 1JLLA 3R7LA 1J0AA 3K9CA 1TA4A 2OG1A 2TMYA 1HTWA 1EFRD 2OZLB 2VC2B 3UXMA 4GLOA 5I7OA 3O2SB 1E1KA 4PZEA 2Y66A 4LFAB 3CUSA 2PZEA 5TQ0B 1MFPA 5EKSA 4F5ZA 4OQQA 2OV1A 1FP4A 4RVHA 2Q3EA 3U7QB 5LIRA 3F6YA 1K7YA 5DXJA 2CLKB 1QS0A 3D2CA 3L07A 2WFLA 1E6MA 4KQHA 4OK3A 4GMHA 3O4HA 3VOBA 3ZG6A 1KO1A 4UXJA 4HT3B 4DR1B 4GSKA 5GIOE 4YYZA 1X38A 5JH7F 4HDRB 3FHTA 2OV6A 1G8JA 3HPQA 4ZO9A 1GQSA 2ZB4A 4DCMA 3H87A 2D4AA 3IV7A 1AY0A 4CT0A 2IYWA 4UTRA 4EFLA 1U2EA 2Q5EA 4G0XA 1MP0A 1HQDA 5J43A 4S04A 4NS1A 3PNKA 4I2VA 1N0WA 2C5HA 1ST2A 4PG5A 4HVTA 3VTFA 2QTRA 4CU5A 1XKLA 1BHQ1 2GB4A 3AW9A 3FJ1A 1RVV1 4MVJI 4PANA 1YZ3A 1QHEA 3GIDA 3AR5A 5AVJA 3TB6A 3K9LA 2BMVA 3PC2A 3HBLA 3UAYA 3OY7A 1G7SA 3HN6A 4RK6A 1XTIA 2ZSJA 2NZVG 2XODA 3RAPR 5KB3A 4DMRA 2X0JA 1KMQA 1PT9A 3G5MA 4GOMD 3MQ4A 2VXBA 3LE8A 5IBCA 2QP3A 2ORWA 4QASA 5FBWB 1QZTA 3K7EA 5FUWA 1GGFA 1QRSA 1JI0A 1I1NA 4IIUA 3VH2A 4N76A 1JWBB 5FOQA 4AS1A 2BGKA 1R6TA 4PYNA 2XX3A 3BL8A 4TM8A 2B6NA 1FTSA 2IDMA 3EF0A 3PHCA 1RAHA 1XF1A 1AKWA 2W5UA 2WT8A 4B3GA 3HCEA 4NWIA 5LZ9A 1I51A 2VKTA 2R6HA 3HZHA 4BGUA 5CJJA 5H81A 2IIQA 2YHIA 4AN4A 5EAIA 1JF8A 3TSYA 2VJCA 4JEMA 2HWUA 3WS7A 4I1PA 1EFVA 2AF3C 2CWWA 3HUTA 4NCNA 3DMHA 3TXXA 3WDMA 1X7XA 2R1VA 3VNSA 5AKZA 2UXDB 4UE2A 4CM7A 1AIPA 4TV8A 1G9SA 4AZSA 1LDEA 2FVXA 1E2LA 1PE0A 5I8ZA 1YQWA 4AMVA 2FZ4A 2DSTA 3CX7A 1R8JA 4UEOA 2BTEA 1EFTA 1RABA 3AZPA 3EXEA 3IAAA 1IN4A 3CEJA 4GZMA 4NYJQ 1A8HA 4BMVA 1ZD2P 4RGQA 1E3QA 3NNSA 2CVOA 2JI4A 3PR2B 1S3IA 4YLEA 1DI0A 2PGDA 2XITA 2K7FA 5KMGA 5IZCA 1DJNA 3KTAA 1R2QA 2WUDA 1YDFA 3BQ9A 1MO5A 2IXTA 3O82A 4ME6A 1CS0B 1AB5A 1QFYA 3LYLA 5DB4A 5DYIA 3HDYA 3HJUA 5J1SB 4FC7A 4DCNA 1N5DA 1N77A 4GOOD 3OO0A 4ETWA 3Q5DA 4RTMA 2G1AA 3SY8A 4GX5A 3VR0A 3D8TA 1ECFA 4QFBA 4D5GA 5BP7A 4QC2A 1AKVA 2PRIA 3Q4GA 5F5NA 4RKYA 3KAKA 4JAVC 2RKOA 3ZD9A 2NZYA 3DT8A 3O7MA 1Z4NA 4JJ6A 4YI5A 3GJ6A 4LOAA 2XTNA 2OQIA 1VIYA 3M82A 5FTNA 2XCLA 1GT6A 2PUGA 3NZEA 1YCFA 4BMYA 3UWDA 1PJRA 3CJRA 5EWMA 3NWJA 5IH3A 1OVGA 2AC4A 4JR0A 1WCWA 3H5AA 4YRLA 2AG5A 3NBAA 5DM4A 2N75A 1XTJA 3AY3A 3NO4A 3O8QA 3KALA 4RPHA 1IDN1 3N86A 3T7EA 1GU7A 1OAKA 2R7LA 1XAHA 4GYJA 3AIMA 1NF9A 1SU4A 3LL7A 3RYIA 4PNEA 1QQBA 3ZUGA 1VMKA 4PYKA 2FSSA 2GYVA 1UDXA 2BFAA 1U81A 2LPMA 2RAPA 4KQJA 4EMUA 3K6SB 2QUAA 2B1QA 2ZQ5A 3W0LB 3HP1A 1EB9A 3BWCA 2QI9F 1JAZA 4GQAA 4ANFA 2ADOA 1UBRS 3NBMA 3RG2A 3VVLA 3JQGA 2PSHA 3VPGA 1V5GA 2XDYA 1G3QA 2E89A 3NX4A 1SK9A 2P9CA 1NUPA 3ESBA 1QBKC 2CDCA 3C85A 3WA6A 3KE8A 4LXHA 1SUEA 4MWZA 1AV7A 1JHVA 3CTPA 1WVIA 1NWHA 1U9JA 2VPWA 3ESAA 1ZCFA 1K68A 2XOEA 4FDMA 2OCBA 2RH9B 2WWWA 1PFYA 3I2GA 2DJIA 2ZYRA 4GOND 3CLRD 4MPDA 3GCGA 1L3CA 4X71A 4Y98A 3VR2D 9LDTA 1M1YA 3QKRB 1JBEA 2FPMA 1C1HA 2H06A 3L02A 1VMEA 4O4LA 1MG0A 4P5EA 1A71A 4RU1A 4HLNA 2G6TA 4LMRA 5I8PA 2XUDA 4K0KB 1VLJA 2GCPA 4BUZA 5HMMA 4P3XA 5IDVA 2PUBA 4MYHA 4MYRA 2PL3A 2II6A 1IU9A 2VL7A 3V4PB 1R9MA 1ZSVA 1XWIA 3NALA 4L4ZA 3WMEA 3F3MA 5A4FS 3AWIA 1N1EA 3FFXA 3ECAA 1Z3IX 2HLPA 2EEZA 4DC0A 1DLJA 1ACMA 3I30X 3UGJA 3I0MA 2B2NA 3WGJA 4N5IX 4XFKA 2QD3A 1SKYB 4KQKA 4AU1A 4KQXA 3B6EA 4OI1A 3NHAA 3T3EA 1RWNA 4C30A 3QYFA 4O2BB 1J2RA 1CZOA 1XVIA 2BMAA 4FTWA 4XOIA 3PQCA 4C0LA 1HDZA 1HC7A 1W87A 3IESA 2CUNA 4B82A 1I3MA 2W2LD 2VZEA 4GMKA 2JD0A 4BAGA 4XQ9A 4RD2A 5CT4A 2PUVA 4DDWA 5LIPA 1BS9A 4ZHQB 5DVZA 2WF5A 3HB5X 1EVEA 4QU0A 3GF4A 4MMZB 3WKDA 3AR2A 3ZGXA 1FDWA 5LXTA 1SUPA 2PMKA 3OAAA 5BPFA 1YCDA 4DS3A 1VYHA 1PD0A 4M9QA 3KK0A 5IULC 1W4BA 2JVKA 2YZMA 4RY2A 1NRIA 1R0YA 3FJYA 3HEBA 3AG5A 3CLSD 5ICEA 1E4EB 4MLPA 3C1UA 4PZDA 2VDVE 4DXHA 3CRZA 1SBQA 3JQCA 2C88A 1T3TA 2VVTA 3FBGA 5I7RA 4BB6A 2R8BA 4F71A 1VKOA 1NULA 3MLAA 3KLMX 4JI5B 1JH8A 3Q1KA 4EUHA 2V7BA 1KEKA 2DE0X 5F33A 1ZMXA 2GSWA 3L4SO 1XFAA 4DSAA 3AWDA 2I6FA 2QU7A 4BDSA 4RMJA 1NATA 2KSQA 4R1SA 4A23A 1S1CA 4R1TA 4O4JA 1PZMA 1L4UA 1YB5A 4DHWA 3A3KA 1E9DA 2C7OA 2E85A 1E3WB 4Q39A 2BAGA 4TL8A 2EDAA 4G56A 2IOHA 1JPJA 1LVGA 1RBMA 2J3IA 3DM9B 4RIFA 4EYKA 2VTVA 5HTOA 4DR3B 4DMHA 3I2KA 3HZRA 4Q3CA 4NNOA 1LCIA 4P4NA 1MOSA 3DDHA 3BWXA 4WERA 4HLDA 4TMTA 4YMLA 2H2GA 3S99A 2DP4E 5I3CA 4C78A 3AVVA 2CDRA 3CX6A 4HKTA 1NZFA 3WRVA 2WJ6A 2BP7B 2J59A 4MB0A 1TYBE 1E2EA 3LV8A 5BQFA 2GJAA 4GBED 2VDOB 2XNJA 2BEVB 4Z7OB 3JVVA 4ZEXA 3CZRA 3G0CA 1FF9A 4M53A 4NVRA 1UPUA 3D7RA 1WG8A 4OL9A 5D84A 2PBZA 3D2LA 3SIRA 1S96A 2XUIA 2ZZMA 1T36A 4MQ5A 3MB5A 1JBKA 3NHLA 2DHCA 4BS9A 3DUWA 4KIUA 4R9NA 2ZPAA 4YH1A 1VLQA 4EUKA 1T3ZA 5ALPA 4A0RA 5K8LA 4KX5A 2NYAA 2B7LA 2NUPA 4ENWA 3NWBA 4JT2A 4O4HF 4NV1A 3E3AA 4OSOA 2IKSA 4G0WA 4DG8A 4G37A 3BAZA 2FWRA 4KPUB 4NEGA 5TQ2A 3VZQA 2GRJA 2IS2A 3AZQA 3NT4A 1BKDR 4DM7A 4M0PA 3OUUA 3B36A 1IXSB 3D4BA 4ACAA 2VPQA 5MN6A 1XYYA 2HF9A 2AKAB 1T15A 1PK8A 3CSUA 1V1RB 3DSRA 3VOAA 2GBIA 4DLKA 2JNWA 1SD1A 1TO1E 4NOLA 2ZK7A 4TLBA 3L5OA 3VI3B 1TK9A 4RTNA 4KJZA 3WQHA 3EDQA 1VA4A 3LCMA 4ZQCB 5JR3A 3DDSA 2ZRKA 3S5UA 1YZLA 3DDNA 3EG9B 1TUGA 4MQFB 4TWIA 2FUG1 3EZLA 1SHLA 2I3GA 1T43A 2PZFA 1TMKA 3THXB 1OZ0A 3QI2A 4JSTA 3W3AH 2BGTA 4RFVA 4BP9A 4LNHA 1W8DA 3WDLA 1CY8A 1VHJA 2FUEA 2OFWA 2AJTA 2C7BA 2QTGA 2Z1NA 3IKVA 4HGYA 4IOMA 4P36A 3TQSA 4C05A 5BN3B 1XVLA 4I3HA 3K1ZA 4I5EA 1EWTA 3NAQA 4J0EA 3U0BA 2FHSA 3O90A 1N2IA 4UBJA 1TTPB 5FPSA 3QPVA 3CSSA 1RKVA 1ULUA 3PUJA 1R64A 3TPZA 2VYCA 1H85A 3D3WB 2OXCA 4ND8A 2ZBUA 1KMNA 3A0RB 4RESA 5ALSA 4CVNA 1XHLA 4QNMA 4XR4A 4BV8A 2G80A 1AVTA 1VHDA 2X5OA 3U7EB 3VHXB 1VCNA 4A9AA 3ZGOA 4UU1A 2WVGA 2VNAA 3BICA 2O3QA 2AGVA 2FRDC 2HJWA 1FSFA 1QRRA 3SVTA 2AZTA 1Q3HA 1W9MA 3OLCX 1J21A 2A9OA 3R5TA 1NJFA 1N9ZA 2D1FA 1BMQA 4KE9A 1RR6A 3B2EA 1B0ZA 2WJPA 4MQEB 3SS7X 5JADA 3DZHA 2V1XA 4OJKA 2TS1A 2ZRQA 2C4WA 3UJAA 2X9VA 2QD4A 3D6AA 2WWVD 4F5WA 1BDHA 3NDBB 1V8DA 4G26A 3UJ3X 4UC0A 4EY4A 3KQLA 4FSHA 2UXCB 4P33A 4C0BA 5IUKC 3EHEA 3D4LA 1OW3B 5JWOA 1EX6A 1RRVA 1N1GA 1CZUA 1P45A 1MKYA 3GFFA 3U16A 4NU5A 1CY7A 3HXKA 3M3DA 4DM4A 3E8XA 2EKDA 4KKVA 4FJ1A 5DLEA 3RWOA 3U39A 3K4HA 3UWPA 4KMOA 2HRDA 2ZWVA 3KHSA 3MFQA 4D0RA 3FOZA 2A4KA 2FWBA 2I55A 3OOYA 3QF4A 1LNSA 3GBPA 4BEWA 5BQ5A 4GPEA 1BH2A 4TM7A 1WW2A 2E4YA 1XD9A 3FPLA 3UWKA 1CRWG 1ECBA 1QIEA 2V7PA 4ZVRA 4O1IA 1HDEA 3U9TA 1MC5A 4DUGD 4A15A 2ORVA 1G6KA 4LRWA 3MYYA 3UT0A 2FQYA 1GTSA 1IVYA 4OUDB 1NF2A 4NJEB 3PQ8A 4TQ9A 1PYOA 5F3WB 2WPDA 1GZVA 2WW8A 4IDGA 5BWCA 1RC8A 4HNUA 3B82A 1FX1A 4IF6A 4BV3A 2FUKA 1E8DA 5JIBA 4RHFA 4X65B 2GSDA 3IXLA 3GEGA 4OBBA 4IV8A 3G2KA 3JPWA 2RONA 1O94D 3M9LA 2PX6A 3VAYA 3WBKA 4BAZA 2VDMB 4RPIA 1Q12A 4AZ3A 3GLIB 1CUCA 1ZHFA 2O8BB 2VSXA 4JP5A 1G6Q1 5CVTA 3FWPA 4N7RA 3H1BA 1L5RA 2RIRA 4GYKA 2HA4A 3BBLA 2B8NA 1WKBA 1CQJA 2V7QA 2VDJA 2VH5R 3WL3A 3LX8A 5A6SB 2PX5A 1TQ6A 3S8YA 5CU7A 1U5BA 4FFRA 4BL5A 5A7HA 2IHKA 2PS3A 3HYSA 5FPKA 3QELA 3WYBA 4EVRA 4KLZA 4LCBA 5AJYA 3WXMA 5E9AA 5AM3A 5D5HA 3TZCA 1NSTA 1T4CB 4ZVNA 2B4KA 2JD2A 1GAJA 1ISMA 3K92A 3K9NA 2QE7A 5FQOA 4Q93A 5ED0A 4YXWA 3RANA 3TCXB 2FNAA 3H8SA 3KPWA 1G8PA 5BW6B 1ZX1A 2R00C 4NYJR 5JVDA 3F98A 3FVRA 3P94A 3EJWA 4CIVA 4KJXA 1G60A 4DA6A 1U98A 4RD3A 2XT9A 2VOJA 1QDUA 2QJRA 3ZDFA 2G0TA 2IITA 1LVUA 1CZHA 4PFSA 2J3HA 4QPNA 2IZ6A 3PDWA 4YHBA 1YNOA 1T8YA 3WFIA 2YXBA 5EWJA 4YCCA 3PQ5A 4JBGA 4CMEC 1W85B 3OOSA 1L5GB 2W2XA 1B8NA 3ANSA 4L2IA 4TMXA 2LD4A 4F04A 3HK2A 4IZ6A 1TJ4A 3Q2KA 2UUCB 1EVZA 3NHJA 3RTGA 4Z99A 5BV8A 2RHMA 4M76B 4BNVA 4QTTB 5BSVA 3MTQA 1DOHA 1LZLA 1TCAA 3OZDA 1JXAA 3MWEA 1CJVC 3SIXA 5HILA 3X2SA 4B3DA 1C0PA 5IJAA 1T91A 5KAPA 1R4NA 3E0QA 5FI5A 1U7ZA 4BWYA 1EEXB 4HF7A 2ZSBA 4BLTA 2P8JA 2HCTA 2XHEA 4RL6A 5IFKA 4M8LA 3LOQA 2W98A 5FX2A 3KQUA 3ZCTA 1WUHS 2W43A 4DWVA 1V1MA 1I4LD 2CWDA 5ELLA 3RS0A 3UENA 2E1RA 3WRYA 5C8YA 2YKGA 1KPIA 4U7PB 3T3DA 4L85A 3AFIA 1YTUA 3EZNA 1GCIA 1HH4A 1ZIOA 5D8DA 1FNDA 5IXYA 2V3VA 4UUNA 3CT6A 4HH0A 2IPOA 4YMVA 3ZWAA 5DHQA 3RRJA 5I4BA 1MR3F 4UVHA 5EMKA 3TMAA 2AW3A 4RZHA 1E98A 1VIAA 2W00A 4B6PA 4D3SA 2ZQYA 5C81A 3HKDB 5CYGA 2WAOA 3A4MA 1R12A 1A5ZA 1LPOA 3E3MA 3N3BC 2QF7A 2AXNA 1PVOA 4P9NA 1BCSB 3G1UA 4UNRA 2R85A 5TEVA 4QQFA 2WJGA 3N59A 3GT7A 3FXAA 1R6VA 1FJGB 4MS1A 4Q7KA 1WV1A 4EA6A 5DGHA 1Q6ZA 1CRQA 4G8JA 2ZT6A 4HDAA 4LDNA 4URHA 4BRUA 2DPMA 3PZBA 1ZGAA 2XQVA 3W2GA 3LHSA 5FPQA 6Q21A 3EZ9A 3QXCA 3EQ2A 3NG1A 4OVKA 2PEYA 3W78A 4TLAA 3FKQA 1AKRA 2ISCA 1I30A 1U9IA 2CD7A 2X86A 1BXGB 3VTKA 4RJJA 3GRYA 4DPLA 4Q9KA 5DP1A 3VNQA 2PL9A 2VJOA 3WYEA 2VF8A 3ZHQA 2CLMB 5KJEA 4J75A 1DAFA 3CZ4A 3C74A 1WR8A 3HVIA 1FC0A 4FB5A 3L6RA 3S81A 3GJSA 4WZBE 5HUJA 2PQMA 7GPBA 5FTWA 1HT3A 1XCBA 1CVRA 2YN0A 4YUZA 3CVYA 1OA0A 2XMPA 1W93A 1V7ZA 4Q4AB 2HWXA 1XEXB 4Y7CA 5DBHX 3SZOA 1JR4A 1OAOC 1P72A 2HJHA 3GGJA 1CJMA 3KVNA 3VHRA 1U0HC 3WNDA 4F56A 3ZW7A 1JJ7A 1RAFA 1VG0B 1YTLA 4QX6A 2VCHA 1H2XA 3VH3A 1KMHB 3OWXA 5F7ZA 4N40A 3ID6C 5F5LA 2FFRA 2PE5A 1COZA 4F4JA 3LPAA 2PYDA 4KWHA 1FSPA 4MPPA 3CLTD 2AN5A 1E63A 2REXB 4TZ0A 4ZYXA 5ULLA 2GN2A 1GYPA 3BGVA 4XM1A 2ANBA 2YUIA 3Q40A 4WK0B 3L06A 3J80A 5K3BA 1JWAB 3PNMA 4F2GA 5K0SA 2OD7A 2Y99A 3KQVA 2AH5A 4KVGA 4P22A 1XLVA 3BCHA 1HNWB 3LQYA 3CIOA 3K94A 3PGA1 2QLFA 4FNMA 4I4IA 1N33B 1NU8A 4C4ZA 2RGCA 4OU5A 4ND7A 1YBMA 2X1MA 3F49S 4NS4A 3T7KA 2J8ZA 1RQPA 2ZTLA 2ZBQA 4PSVA 1I94B 2ZJZA 3NV7A 1YVUA 2D8AA 3PNOA 3INRA 1NONA 4H1HA 2QTCA 2HK8A 1RYHA 4ZOEA 3SQMA 2WUWE 4CMCA 3UGQA 1K8RA 3CR7A 3U4HA 3PJRA 1QH1B 5DNYB 1JHPA 1N2XA 2I8CA 2ZANA 1F2UB 221PA 2H5EA 3ILXA 5ILQA 4CM4B 4DCPA 1NFFA 2C0QA 3OF3A 4G5GA 3RD5A 2CLSA 2WNIA 3ZWDA 1XGKA 2YOGA 2HSWA 4WOCA 4MCJA 4P4GA 1IJFA 4B0PA 3L84A 3JD0A 2G04A 1JIKA 4GM1A 2J08A 5J2TF 1KP9A 1U3FA 3H6KA 3OZEA 1F9AA 3AL2A 5EMMA 2B4YA 3EDYA 4BZXA 3E9DA 1J4AA 5A2GA 1GUDA 4AB1A 4DJJA 4DCJA 1QORA 4BQIA 3OZUA 1IOZA 1FFCA 1JDUA 4EABA 1JDPA 5BT9A 1XEWY 3GLFB 3ZDDA 3IHKA 3Q2IA 5KNBA 1MXFA 1Z38A 2IEZA 4GR4A 5G02A 1U2TA 2Y6VA 3BMCA 3VC7A 2X9GA 4M87A 4JEIA 4H35A 2VFAA 2XUOA 3BSWA 3I9NA 2OYRA 2ISQA 3OE7D 5BNIA 3G3EA 3GA0A 1KTVA 3DOFA 1DWPA 1AZSC 1O6FA 2HAEA 1QANA 3JQEA 3RLIA 4BTVA 3T1YB 4ZGBA 4ZTUB 4JI0B 1CP2A 1RJEA 1Z4LA 2DPGA 4JA2A 4XSVA 3OQBA 4K6HA 3EYAA 3KVYA 2A1TR 2HF2A 1QQ5A 1VJGA 3BB4A 5HM6A 2DFDA 2M6RA 4Q4LA 4RXTA 1P17A 4AJ4A 2DECA 2DWPA 1TF2A 3PWTA 4X3CA 1TM2A 3TOZA 3O91A 2AL7A 4K9QA 3K9QO 1CY0A 4BXOB 4RYDA 1NHGA 2GYYA 1J8YF 2J3MA 3ON5A 3OJXA 1SXJD 4QDZA 2JHFA 3HV0A 3G5UA 1ZK2A 1M2VB 2DWCA 5JD6A 4FVTA 1EVQA 2HXSA 1T9GS 3DEKA 4IGIA 1UBHS 4LISA 5BNTA 4Z9AA 5JSZA 2RH8A 1M6NA 4TKUA 2X0RA 1WSDA 4I3GA 1TE2A 4R40A 1D2EA 5CH8A 4JQOA 2C9OA 2PNJA 3VR6A 3ZHTA 1YRLA 1EM8B 2PFKA 4IL5A 4ZI7A 4YCBA 1DTSA 3M6UA 1XL0A 3HEMA 4P0TA 4R7GA 3VPBA 2JZCA 3ASUA 3BIWA 4EAAA 3BGWA 2BMEA 4MOWA 5AHXA 1RKQA 4MRAA 3CBGA 3JY6A 2ZJBA 3FFTA 3F90A 3L7AA 2HA5A 4MIOA 1JLLB 1OXUA 2C58A 2OP0A 4MPJA 1E18A 1SKAA 2HXGA 2VPTA 2ZUUA 3PTZA 4XRRA 2INGX 1CKEA 1DWOA 3EMVA 3H5RA 2XI4A 1P4HA 1E3DA 1XI2A 2BBWA 3C43A 1GUBA 3NDPA 1VRVA 4LC0A 5DYTA 1XCLA 3TLZA 3T1TA 3ABZA 3SKXA 3CLUC 3OOHA 1FP4B 4UHKA 3COYA 5FOSA 1QS0B 3PT9A 2CFRA 2QWXA 3CONA 2NYUA 3KVRA 1ZLXA 5A02A 3IUMA 1K66A 2M32A 1YUBA 1K2WA 1PG2A 3K1TA 6GPBA 1U4SA 1QAMA 3F4LA 5FTLA 5ISMA 3FTQA 2V6IA 1RM5A 1UKYA 3PE6A 1OBOA 4YBRA 4DWOA 4F3KA 1A4RA 1BXRA 1W1WA 1Z07A 2XCTB 4UHCA 5BQ3A 1O6BA 4NZMA 3QHQA 3GVHA 3UK0A 1YJ5A 3WZ2A 1R9GA 1IQRA 2KJQA 3DZ8A 3IX7A 4JN6B 5AJWA 1R6UA 4EK9A 2R96A 4BMZA 2VQFB 1YA6A 2FWPA 3DE0X 1UJNA 3QWBA 3TLXA 4KPGA 4BZWA 5IM4F 2HIGA 3R5JA 4Y1RA 4EMSA 4J07A 5CVCA 2BRUA 3T7SA 3HACA 4XVUA 3PXGA 3N2NA 5ALZA 4WOKA 5DU2A 1L4KA 3T5GA 4IXMA 3I73A 3UHPA 1KZ6A 3IO5A 4DJ5X 5I7EA 5FR2A 5KU7A 4GG1A 3UICA 1EBBA 2XE4A 2FSIA 1NVWQ 2PMDA 1UKBA 4JB3A 4EFMA 4OQEA 3SDSA 4ZGWA 2AT1A 2EWWA 1K9VF 2B5WA 2HC9A 2OHXA 2XYRA 3BXOA 3O93A 1ZMOA 2ZSAA 1FNCA 1XP8A 3BD7A 4KN6A 2WJIA 3DW1X 3P97A 4JT4A 1EFPB 1KY3A 2CXTA 4UULA 4EQ6A 4BMPB 4Q1BA 2XA9A 1KFJB 2UVDA 4EB8A 1QR2A 1J97A 4F5YA 2LUOA 4MLDA 1NLZA 1EFVB 3GRZA 4WFQA 1S2MA 3EMDA 2EX0A 3DMTA 1G5HA 1ZP6A 3GR6A 3I4CA 1IZYA 1MO2A 2JLVA 3CNOA 1YIDA 3MD0A 1X70A 4YECA 2ZE5A 3T9BA 1M2NA 4TV8B 1CFZA 1AXGA 3RS3A 3TNFA 2W4IA 2HPHA 3BCRA 4R0MA 4TMFA 3KLNA 2LKCA 1GCUA 3MFYA 2BFCA 3EXEB 3N58A 4LQCA 3UATA 2ZOSA 2P0YA 2OK8A 4G4IA 1QSGA 3GJZA 1WOYA 2IH5A 1IQPA 3P71T 2QN3A 3NHUA 5KMGB 3KTAB 2NN3C 4HQ6A 1QHHA 4H18A 2OCXA 2CMFA 3MOGA 1R9JA 2H1HA 4PBSA 3CWCA 1E8MA 2NZUG 1XVVA 3EJ6A 5E3HA 1WPXA 3KQNA 4U7JA 1U1IA 4N0EA 4LYGA 4UCQA 3ANMA 4E1VA 3ORRA 2CGEA 1L5KA 2H17A 4JODA 3AYXB 4Q18A 2AVNA 3DMPA 3IBCA 1G8AA 1P4GA 5AK6A 4BVKA 1MH9A 5EA2A 1KQFA 3L7YA 4II2A 4JC8A 1E0JA 5IYZF 3LQ4A 2BBTA 1WPGA 3S44A 3WNVA 3A6LA 3RVQA 1LXCA 2EP5A 2R66A 2BW0A 4G2TA 4B6EA 4G0QA 1XCMA 5T41A 4DDKA 4LKRA 3D8BA 5EWMB 4ZVSA 3PTAA 4KXQA 4IIXA 3K0FA 3O8QB 3N8NA 3C5WP 1ULBA 5KYNA 2JLBA 1PFUA 2FPKA 3RYIB 5FI3A 4TTAA 3CVUA 4HNAA 1PI3A 1YH3A 4FFNA 4B43A 5BNZA 1QNFA 1VHWA 4MB6A 4YRNA 4LUCA 3IUSA 3OCJA 1G42A 3STUA 2BISA 1Y1SA 3D3EA 2DT8A 1T5LA 2JHCA 5I7AA 4HUJA 3ZCSA 4YCSA 5ADHA 1GGNA 4X90A 1FDTA 3VKFA 1LNZA 1JR3E 3GOQA 4KODA 4AN1A 3O1JC 3A7DA 3JQGB 2EGHA 4I4TA 4OP3A 4IQ0A 4OGGA 3DQZA 3L4BC 4ZOLF 1IBSA 3FGZA 1VP9A 2FW9A 1IQUA 2NSYA 4XWTA 3T4XA 4MDFA 3KEOA 1DAIA 1FUUA 4F4CA 1R5NA 2IYNA 2FK8A 4NNJA 2HK7A 1CZKA 2XOXA 1F0KA 4ZARA 4PRZA 4QDXA 3OIFA 4UTVA 3P9XA 2C00A 2N0SA 3IEIA 1M1YB 4IEFB 1B1CA 2ZJAA 1ELOA 3SLRA 4OXNA 5LKRA 3KXDA 3NOQA 1KJQA 1X92A 5B3JC 4Y2RA 2TYSB 4MI1A 4EDHA 2C3PA 2PKQO 2BHTA 2HYIC 1K92A 3DDCA 1FRZA 1VJ5A 1RZVA 1Y42X 3L0SA 3V5NA 2G1KA 3A4VA 2WHPA 3RUFA 3NGXA 1A9QA 3R0VA 9ABPA 2XDAA 3MSCA 2AVDA 3NI2A 4Q02A 2VBIA 3NEJA 1WXGA 2Z1MA 4GEKA 4JFAA 5EKXA 4J4BA 4NFHA 3GEHA 4X3OA 1L5WA 2NWQA 4K9DA 1IPFA 1U0LA 2FQ1A 1WLSA 2A8YA 1E3TA 1OH5A 3MJHA 1J7JA 2Z5VA 1SBYA 1Q91A 2CVZA 3K0BA 3QEKA 1Z4OA 2R79A 4US0R 4EVIA 4ZFNA 5BN4A 4A2PA 4UPVA 5KQLA 2O0JA 4E32A 1BS2A 2ETXA 2HU2A 1UXKA 2A9VA 3OU2A 2JJ2D 4MW9A 2VHVA 3WRXC 3C6YA 3TINA 5LXTB 1Q1NA 3BMQA 3LFUA 3B1FA 4J0QA 4M36A 4R98A 1J2TA 2NTNA 4A8HA 1H22A 5J4LA 1EJBA 5JZ9A 3IOBA 2XADA 4LJ8A 4RK0A 4BO1A 4YPOA 1ILEA 1WXWA 1JTEA 3RRMA 5BW5A 5AKXA 3VU8A 5HQ3A 1N2CA 3LW7A 2J0QA 2P4SA 3PEYA 3KFXA 1KVUA 4ARIA 1N6OA 2WF7A 5CX1A 1X7DA 2FDXA 4KUGA 1NNLA 2XWJI 1FP2A 1SQ0A 2DLCX 2H0QA 1PTJA 1KA9H 4JLJA 5JMTA 1NBMD 3HG7A 5A06A 3D3NA 2X0DA 5CCEA 2RG1A 3C97A 3DR5A 1CR4A 4CM6A 5JCPA 1VG1A 2G17A 1P39A 2Y1CA 3DHNA 1OXTA 2GMWA 3W4IA 4B4VA 1HOTA 1DRKA 3ISVA 3UK2A 1BIFA 1W581 4KZKA 4W6QA 1JAIA 3RTAA 1ZK1A 4RKRA 4KBYA 3WC4A 1GPAA 4QVIA 2CFOA 4G1VA 4J1NA 1NSYA 1VGVA 3F5DA 4O4JB 5J1TB 3S2YA 3VUEA 3ROFA 1PJBA 1ZJ4A 2VYVD 2XW6A 5DLDA 2J9XB 4UUMA 1PNRA 5DBIA 4DLAA 1APBA 1ZNXA 5KX5A 1N5KA 2ZTVA 1O4VA 4INAA 5HRUA 5EJGA 4LHYA 3DL2A 3GNLA 3JWGA 3LUFA 4RJTA 3GMTA 1PTKA 3SR0A 1ZN8A 3ZD8A 1OI4A 4YJ3F 5HF5A 3INGA 1EI9A 5FFFA 4BBZA 3R9WA 4KO8A 3ETGA 1VHTA 1JA0A 2PUHA 5C1BA 3AJ8A 3I64A 5G3ZA 4CUZA 3X1XA 1U31A 1SVNA 1ST3A 2ODWA 1D1QA 1YHYA 3UJ9A 4HO1X 5JZSA 1T36B 4D9IA 3OQ1A 4B6FA 2GXSA 3THRA 3IAEA 1XZKA 2XQKA 3UCXA 4UD6A 3GPBA 3K8YA 3H2SA 5J47A 3HKEA 1YGYA 4YPFA 2NUPB 5IZCC 2YFYA 4MEJA 5CEFA 4YCMA 1MV8A 5CNJA 1NFRA 2JAPA 3I09A 1KEVA 3T3IA 1H0HA 1P1HA 4BQQA 4TWRA 1YMVA 5TQ2B 4YMTA 2JGLA 1C41A 2IIPA 1I3LA 1H2FA 3AGQA 4Z9FA 4HBGA 4KX3A 1X7GA 2I78A 4MUFA 2AMJA 4P8RA 1EDDA 5LP6B 1K4MA 3C7KA 4ZOQI 5ITWA 1DCTA 4DZZA 3CX8A 1ZH0A 2XQGA 2BGUA 3O4JA 4JDPA 4Z7QB 1K6JA 4Y2XA 3W1VA 1Q0SA 5EJFA 4E1AA 5H3CA 2XF8A 1SZJG 5FPTA 3RS8A 3K5IA 1Z26A 3KDPA 1E1QA 3ZCRA 3SC2A 1Q2UA 2Q5CA 1W36B 4RSRA 1XJQA 3SBEA 1USGA 2Q3FA 2GBGA 3C45A 3CRQA 1GR0A 4NFSA 1YO6A 4F3YA 3HR7A 1XDBA 3OCWA 3G5LA 1TU4A 5AJUA 3DHVA 4ZZ0A 2C4MA 1G21A 3SEAA 3P0JA 3W3AA 3DBRA 3IIIA 4AFNA 4BE9A 3CR8A 3X44A 1FXWF 2B92A 2V55B 3H1GA 1Y8QA 3E9ZA 1W5AA 4L95C 4AWAA 4D0LB 1RT9A 1CEEA 2FX3A 1CY4A 3V42A 4DANA 5AESA 5LNK6 1LPSA 4U2GA 3REGA 4BLSA 1RS0A 5FYQA 5B1IA 2CYCA 3SZUA 5EXTA 1YR8A 3CV3A 1EZ4A 1PJTA 2O5VA 5TLSA 4ND8B 4FGLA 4FOOA 5B3AA 3C24A 4Q3NA 5JAQA 3CLVA 4Q24A 2AZXA 3TX2A 3WLOA 1IXKA 3JALA 3KOYA 1L4FA 1UFRA 3QIVA 3DBOB 5CFLA 2DKNA 3KPUA 3BMXA 1AJEA 4LKOA 1ORTA 1EFRA 2OL4A 3B8EA 1WB9A 3DMYA 1ZO8A 2ZJYA 5EEGA 1SGWA 4KQWA 4NEHB 1BHJA 2VNHA 3LPLA 4Q7LA 3A6JA 1TF5A 4XQ0A 1U1DA 3QVLA 4DLXA 2PUCA 4BQOA 1AZWA 1O9BA 2BFDA 1NOIA 1ZCZA 2E18A 2A7XA 2IDKA 1G8FA 2IDJA 1V8BA 2IY7A 1DJOA 3LG2A 3LRTA 1PK9A 4XIFA 4U0KA 2NZXA 3C98A 3T9FA 4PLGA 4YDQA 2AB0A 1KSGA 4RIIA 2Z57A 3DVQX 2H11A 3SBDA 1RFLA 1GPKA 2CNKA 3U1VA 1LJLA 2IF0A 3I6IA 3KZ1E 4GR9A 3DWEX 1Z7GA 4U7GA 4CTJA 2EP7A 3TECE 3TKLA 5D00A 1H3FA 4G4SO 4HQKA 1EXVA 2VP6A 2ZDHA 2XQFA 3BN3A 1DC8A 4YUXA 1J8VA 1HF3A 3UIEA 3H4TA 2I33A 2O8CA 4Z5XA 3QF4B 1LLFA 5BORA 1KFCB 1QHFA 1MTOA 1UXOA 1V8PA 1XCPA 3H2ZA 4WI1A 2C7GA 2PA0A 5CXSA 3IUEA 3K8ZA 5CK4A 2RD2A 1FXSA 4GS5A 5IN4A 3EPJA 1E4OA 4LJAA 1G20A 1Z62A 3RKUA 3BTUA 1RWXA 2WJZB 1J8MF 3BS4A 3GGOA 1KXJA 4CL8A 1TEVA 4B45A 5JZBA 1PW7A 4R51A 3UG6A 4D0GA 3HVUA 5J59A 2GKSA 3V1YA 1CUSA 3JV7A 1X94A 1CJKC 2GR9A 4W8HA 3RYFB 2BY4A 2XXJA 3W2TA 1L4EA 3SF8A 1BROA 4GZ3A 4LTMA 1VMDA 2CNOA 1T0BA 3TW0A 4AZ3B 2XBMA 4XLTA 4HNTA 3RU2A 4UOQA 1J42A 4H08A 1EGVB 3NMUF 3C1AA 3ELDA 1P5JA 4ESVA 2RB4A 3BFJA 3MMZA 4BCDA 4E03A 5JCJD 1Z4PX 3AUUA 1FMLA 2VJMA 4HQOA 3LY5A 4UAUA 5FNZA 1ITZA 3RHSA 1CQJB 2NZJA 3ACDA 1IAQA 3H1FA 2WWTA 3HMQA 3LQQA 5HDQA 1GZ3A 5AVXA 1DXYA 4Y6SA 5DHAA 3L7LA 2RGDA 1U5BB 1MO4A 2JFGA 4FYJA 2J4FA 1P5ZB 1KYZA 1NQAO 1UBKS 1FUEA 3MTBA 3QELB 3QM1A 4GRAA 2QT0A 4C4OA 5IT4A 1LC3A 3KFLA 1J0DA 2OXTA 2C20A 3JATA 2FN3A 1BQ3A 1C4KA 3TM4A 4QT4A 1Z73A 3W4KA 2A9JA 1EK0A 4K6MA 3P2YA 4JBXA 1H6DA 3C8UA 1BVHA 5JVDB 4DUZB 1GPYA 3LY8A 1CR6A 1KDYA 4DJFC 3PWSA 5SYMA 1HEIA 1Q20A 4TL6A 3PLAE 2C57A 4D9KA 4WUTA 2WVJA 1I7SB 1NMZA 5LZ4A 4IO1A 3OU6A 4JBNA 2PRYA 4IIJA 1AUXA 1CR2A 3KXPA 3ZU4A 4HWRA 4NP6A 1YQTA 3ED1A 4OXYA 2FAXA 1WCXA 5EWJB 2E87A 1QVZA 1GZDA 4PTLA 3SG0A 2WMYA 4AL4A 4D4KA 1WULS 2Q46A 4ZO8A 1GNVA 4L2IB 1GEGA 4XOUA 4B6GA 1NVTA 2OGWA 4DLNA 3AUYA 2Z09A 3A06A 3DDWA 4EFNA 1XMVA 1MTZA 1KEPA 3DZBA 3OICA 4MIKA 1I6KA 2FRVA 2OXRA 4TL9A 3TSWA 2NQTA 2NXEA 2GT1A 2A1UA 4QTUB 3L04A 4ISBA 5EZYB 4DNQA 2VXYA 1R4NB 3CZ9A 3NIDB 4ZAVA 4MQ6A 4P83A 2NTVA 1TW2A 4L22A 4MRPA 5C18A 4GDMA 1VSQA 2I2FA 3BEOA 4MHSA 2R7MA 5EY5B 4PHCA 5LP6C 1V1MB 3LXRA 3M6FA 3EG5A 5DF1A 1Y3HA 5C8YB 2WG2A 2PKEA 4MWGA 2B82A 1V4VA 1X8JA 1Y98A 2LDBA 1I01A 2P1DA 4RNDB 2PX2A 3AF5A 4RV9A 3B20A 2EFHB 3RRZA 2Z6UA 2R6FA 2QQ0A 3F74A 4GI2A 1G0OA 2P30A 3FPEA 2P67A 3PCTA 4H4DA 3M6MD 4LDRA 4AY4A 4ABTA 1PIWA 1OB5A 1DJLA 1Z5ZA 3O6VA 3S68A 5D86A 4BP3A 1XNHA 1I0LA 3I1JA 2XE7A 1BGWA 1B4DA 2NYVA 3VR2A 1NJ8A 1O7JA 1FLAA 1RADA 1GL3A 1EESA 3M1LA 2BGIA 4K46A 3ROXA 5BYBA 3WMWA 1WNFA 3A9RA 4MS1B 1X1RA 4ML3A 1I0IA 1E1YA 4ZD6A 4XIIA 3U4GA 5K4GA 2HL6A 2AJBA 2YYAA 4C1BA 1HRKA 1C14A 1J2EA 1X8LA 1ZNYA 5GJBA 3HUFA 5DM60 2O59A 4HX5A 4P4UA 4PZZA 3LDGA 4XYMA 1P2FA 3WAJA 3IAHA 3GAAA 3KZVA 4MUEA 2YHBA 3GUYA 5TE9A 2BEWA 3A6HA 3QYJA 4N65A 4TS4A 4MZXA 4UCFA 3HDJA 4JL8A 1B6SA 1HA3A 2GBCA 2H4ZA 3AR6A 4FKMA 4HR7A 3W7AA 3WISA 1I3OA 4MUMA 1I5RA 4K6FA 2CB0A 2QRHA 3MMSA 1NBOA 4WNCA 2ZYTX 2Q99A 4MQUA 1S2IA 1A2OA 5EE3A 2VK8A 4F93B 3IJRA 2OC9A 4BO6A 1RAGA 3GARA 2H16A 4M1EA 5A1TA 2W2LA 1ZG3A 3GFVA 3P19A 1PDOA 3AY6A 3F6PA 3N05A 1R8YA 1THGA 3AKYA 1XZMA 2JLUA 1C9YA 5AO9A 5GZ1A 3WLHA 5F9FA 1H3EA 4NXMB 2B1JA 4EJSA 2VR1A 4V1CA 5H3HA 3E53A 4IUDS 3M1YA 5ALEA 5EIHA 1AD2A 3H0KA 1E59A 4E4TA 5CB6A 1OXBB 1SG6A 1XEAA 4QYXA 2CMGA 4DRZA 5BT8A 5E1DA 5A62A 2V7TA 1SQ6A 1DO8A 4KP7A 4KTVE 2C7VA 2ERXA 3P7MA 2IYRA 3II6X 2RH4A 3B1VA 1ZR4A 3D3QA 4UPDA 2G67A 2VNKA 4WW0A 1JVNA 1PL6A 2BUAA 1GWNA 3G7SA 2C8LA 2OVBA 4M7OA 4MUJA 3T52A 2B30A 1FRQA 2PS9A 4BNZA 5A4AA 2VJYA 4KBGA 5C32A 1PZFA 2WSYB 4EHJA 2QM7A 2RHOA 4H0FA 1CLEA 5DIFA 1PGOA 2XB2A 4HD8A 3O47A 1FNMA 2DRIA 4I5FA 4OQDA 4B83A 1T5TA 2L17A 2NO6A 5ECYA 4LRQA 1ZJZA 5BR7A 3EYWA 1TDJA 2H1SA 3GUUA 4WBSA 1KQ3A 4BRZA 2A14A 1LY1A 2IEIA 2BI7A 4F92B 1CJSA 4IGFA 3HP4A 2MR6A 4ALKA 1VLLA 3FMOB 2A5LA 3MPOA 2H7YA 1KNXA 1P9WA 3BIJA 4QT0A 3GROA 3K30A 1W1IA 5T57A 4MVJE 4A4DA 1TD1A 3TJMA 1XA0A 4GNRA 1OCEA 2O4UX 4I55A 2A1TS 4NCHA 4CF5A 1PT6A 1YVDA 2KM1A 2PTGA 3HYRA 5H80A 5HMLA 3ZIAD 2CHQA 2CXOA 5LCXA 1OX6A 2XYHA 1WQ1R 2YMLA 3KVVA 1VQ1A 3M5PA 4H3SA 4YC7A 3WHLA 1RJDA 1KVRA 3HDQA 1JHUA 2I6TA 3BTSA 3KJFA 3NHZA 2QRUA 5ADUS 4W9NC 1P6XA 2X1VA 3EXG2 2PMEA 4RETA 3IL2A 3GYGA 4YRBA 2E7ZA 3M1IA 1TT5A 4FMDB 3GX1A 1GPBA 1XRPA 4OQLA 3CZAA 1BDBA 1MVNA 4ETIA 3BMCB 1QVAA 1PV1A 2ZRHA 1U0NA 2GK6A 1VDMA 4PX3A 1GOTA 1R0CA 1S9HA 3MC1A 4S1VA 1JQ3A 1R6DA 2PJUA 3RFVA 5TJHA 4BFZA 3BWYA 4LA4A 2O0LA 3C4QA 2V3WA 5DWDA 3FY4A 1P4SA 1QZUA 4DV2B 2DXIA 1A9SA 4PLYA 4F4FA 1J0XO 1XMOB 5KDOA 1FRNA 1MGOA 4LTDA 3T5CA 2DHEA 3WSTA 1UP7A 6ADHA 2F3SA 4MWOA 5E38A 2DR0A 2GFQA 3PJDA 1SUWA 4PCVA 4TTRA 5JC8A 1RRCA 2Q62A 1HYBA 4MMXB 1R8XA 2LXNA 3LXUX 5BWNA 3RADC 3IS3A 4TKUB 1P77A 1UFOA 3GUCA 1XAIA 5DGTA 4KQIA 3WJ1A 3WRYC 4XJXA 5AVWA 1RXWA 4ZI7B 2FW6A 1OE0A 2HA6A 4N48A 1GCGA 3QUQA 1AQNA 4DBLC 4ON9A 3LBHA 2F59A 3OX4A 4G5RA 3Q0IA 4W7HA 3DWIA 2ZROA 4RD1A 3NIFB 4WFIA 4WACA 3N8GA 1SPBS 4X8MA 3LF2A 4TV9A 3OZTA 4MUKA 3RVLA 5JQGA 4FOSA 3QX9A 3IMFA 4BJ1A 2PMBA 4CZ2A 1T3LA 3PX3A 1IVSA 1E9RA 4CF6A 1QFJA 3A1TA 1RLOA 3QA3E 4HDOB 2Z95A 5J5VA 1AGXA 5IMSA 2NPOA 2ZWOA 4UUOA 3CZCA 4JR2A 3NJ4A 4NCBA 4CG0A 4CG1A 1I4DD 1MA3A 2JEZA 2P6MA 2F9LA 3WG9A 5L3VA 3MF4A 3P0IA 5LP6F 2PEZA 1NT4A 5FBKA 4QE3A 3RIEA 2HI0A 5JG7A 2FZGA 3MTGA 3O74A 4F7WA 1VJ1A 3N2GA 4IMIB 1U9IC 1V96A 5T4BA 3BHIA 3H6HA 4UE6A 3PI7A 1PQ4A 1F06A 4LYJA 1ZGCA 4DJAA 4S12A 2CMKA 1R10A 4CLRA 3G2OA 4EPRA 2AF4C 3T54A 3AL3A 4ZO6A 5K01A 1B42A 4ZRNA 1TO6A 4NESA 4W1QA 4NKRA 4YAFA 3ZCUA 4B7UA 4KRFA 3HH8A 1E6CA 3C3AA 5KCMA 1E9VA 3H9CA 4BFYA 3ZI4A 2P75A 5C8VA 3A1WA 1DEHA 4DUGA 2CFIA 4QDUA 4O8CA 5JFTA 4FILA 1Y0BA 3LDUA 1NX6A 2P7IA 1TOAA 3E2IA 2Y2VA 2GLUA 4FS8A 1ODIA 4L4SA 1VYVA 4YLGA 3SGLA 4DWWA 3AC0A 3AVXA 4IJUA 1C50A 2BMJA 4GOXA 3DOJA 2WSIA 3T8YA 2X0EA 3UM9A 4EGCB 3A11A 1O94A 1UADA 4JQSA 2DUMA 2BM0A 4DF3A 4OKSA 4EHLA 3OJ0A 1GPNA 2EL7A 5K0ZA 1CEQA 4MW1A 1SBZA 2X5KO 3I3SR 3LD9A 3RH0A 1KYYA 2HCFA 2ZTMA 2QM0A 1PWHA 3BCUA 3VVMA 1Q14A 4ZDWA 1R8SA 2FQQA 5HE8A 4BEVA 2JLXA 5JNRA 1UBUS 2BGRA 1EXMA 3MCAA 1DBVO 3A26A 2QUZA 3GG9A 2W2KA 1B43A 1NR1A 1IZ9A 1WUIS 4JASB 2EKLA 1IZZA 2QTLA 4G0YA 1EXWA 2JLSA 3R0IA 4U39A 3SSOA 5LP1A 1DKOA 3HU5A 5LU8A 4XVCA 3NANA 3GEBA 4Q1EA 3HBMA 3LX5A 2BFCB 2IOFK 1HX7A 1K63A 4KDEA 3UVEA 4YRMA 2AFIA 1CUWA 4P5DA 1RE1A 3TD6A 3TLJA 1VJCA 3UV6A 1KVTA 2H1IA 2IEYA 2Q2NA 2ASEA 3BGSA 1GHTA 1NUUA 1SOMA 3RHFA 3AJAA 1QHHB 2ADMA 4YWHA 4FYPA 4CM8A 3FVWA 2HD4A 2JZOA 3WBJA 1Y8CA 3NCHA 4MVCA 1Y4UA 4RK5A 3RVNA 3VC1A 3RS5A 5FOWA 3VXKA 1EK2A 1FSSA 1QQ6A 1FJ2A 1WBJB 1OJLA 2F00A 4M54A 1ZKMA 1SCAA 4UM8B 4B35A 3W8EA 2O54A 2IPAB 4JQZA 1GIAA 5LVAA 4LWZA 3QFRA 4RTSA 4LZZA 3RABA 1JJVA 1NLFA 5JLAA 3TDNA 2C04A 3M3HA 3EIXA 5ALRA 3RQIA 4C0SA 5CEEA 3U1BA 1XQWA 3WYCA 4QDTA 4HXEB 3OEYA 4S2UA 3QI7A 4RBNA 1HG0A 2D00A 4F8EA 3BE5A 2W42A 3TB4A 4ETMA 3DDZX 3QUAA 1K88A 4G8DA 4RVCA 4KQ1A 1XPJA 3MCTA 5GWXA 1E0SA 3K0FB 2IHJA 3B12A 4DQXA 5BPHA 4AQ7A 3WYAA 2HYDA 3DM5A 4M9RA 4ETNA 4W5QA 4R31A 3ZGYA 2OY0A 2RK6A 3IV6A 4HNAB 4C06A 1CUFA 1QKJA 4RQAA 2W6MA 1ADJA 2TMKA 3S28A 1QTIA 2GX6A 5FL7D 1DXOA 1KZHA 2GBPA 3DO5A 3RYHA 3LO5A 1FFYA 1G66A 5DTQA 4JS0A 1ECJA 3U0VA 4M7RA 1EG7A 4PQFA 3O26A 2B20A 4KI0A 1E2DA 4N7MA 3SHWA 1NRWA 3F8TA 4UAJA 3ZDZB 4L07A 5EJ6A 5AW7A 5KVAA 1XOIA 3D8UA 5C4MA 1YQUA 2EIHA 3UK7A 1JFRA 1WY5A 4I50A 4I4TB 4WX2B 4NBWA 5HBRA 1U5CA 2RKBA 4XI9A 2VAMA 3B70A 4YALA 2BMFA 3WQBA 1OU0A 5DASA 1NVMB 1H4QA 2JKZA 1GNSA 4YTEA 4BO9A 1M83A 3NM4A 3T15A 3ZN2A 2Y1EA 1TYCA 4J6FA 4ZCSA 4L28A 2XE6A 4QBTA 4OUKX 4KK4A 2ZYUX 3FOFC 3BH7A 1AUOA 2PZLA 4P6VF 3UN1A 2YVKA 3RUDA 1OBHA 3RU7A 5DWQA 4ZJUA 1XAJA 3FCUB 3P9ZA 3AUAA 4PU0A 1CR0A 1GTMA 2CLHB 1NJ5A 2GWRA 5TPWB 2CXNA 3T5AA 1N6PA 1RCTE 4Q3LA 1FVFA 1QVVA 3GLHB 1C1XA 3VPAA 1M2FA 4RKEA 1KYXA 2NO1A 1G3UA 2ORIA 2R6GA 2WHPB 4MVXA 1ZNQO 1J07A 1ODFA 3MJEA 1EINA 1M2GA 3HGMA 3O1IC 4MVJG 1XRRA 4GVLA 4L5AA 2A33A 2HUPA 1YKFA 3G13A 3W5BA 5IVPA 5BNWA 2YS6A 1DP4A 3CO0S 4NQRA 2C4NA 2MOKA 3ZV5A 5FWYA 1F0NA 5KSPA 4EY7A 3ENVA 3GH3A 4J0GA 4OX9B 1M1ZA 5AICA 5BN4B 1S2NA 3TH5A 1DCMA 3P2JA 1AA9A 2IHUA 1IWOA 1KYTA 2BE7A 2VDRB 1CJCA 1Z06A 2Z4RA 1QYDA 3A4YA 4IZIA 1IONA 1T4MA 4R05A 5HFJA 3STHA 2PZ8A 3UAZA 3WL4A 1RWWA 4M9ZA 1QIKA 4LGVA 3SEQA 5A4DA 4XIGS 4ALJA 3D6VA 3AF6A 3HBJA 2DYKA 5DX1A 4U9HS 1HFJA 2P9HA 2BHNA 5E7JA 1IUNA 2YZGA 3H9QA 1I6WA 1CZNA 1WIWA 3JCZA 3PQFA 3Q98A 4LHSA 4MLZA 3BB3A 1GP2A 5HQ3B 2BEJA 1ZMTA 1KS2A 1KZ9A 3ND7A 3JRXA 5CX1B 1M6EX 1PJLA 4CHGA 1L9XA 4N54A 4CQMD 4JI8B 5AW5A 5T8KC 2WIAA 4EY5A 1CF4A 2RGUA 3GXBA 3V4SA 3CVVA 1OV4A 1XROA 1CVLA 2GA8A 3G2NA 3K6RA 5L7YA 1HPLA 1X13A 2BRUC 3OLYA 3IHLA 2XVMA 3ZQ4A 1G98A 2ZSHA 3VOTA 3IDOA 5JRZA 4N0PA 3BRWD 3KTFA 4ARCA 2QPTA 1NPTO 2AR7A 4CLEA 3EMBA 3LW8A 5A9SA 1VXRA 3ZGNA 3CKLA 1RHKA 4JVLA 4B4WA 4FE7A 1T9KA 4KR7A 3SK0A 3OO1A 2V03A 3LS2A 4Q9AA 4QU5A 5LQRA 1CHDA 1HMYA 1USIA 4PZUA 2IW3A 2WOJA 5FLEX 4U00A 1Z6YA 4LXYA 4UUQA 4WXMA 5I9NA 5KX5B 1MX3A 1YA4A 3FMFA 4ODIA 3IPRA 1W0JD 1ZC3A 1RQGA 3PUYA 3RW9A 2OCLA 1YZUA 2Y92A 4HPXB 2Z08A 4QXMA 4CODB 1C9KA 4EGSA 3LC1O 3DMTC 4PINA 2ALJA 3D0RA 3KEFA 2GXQA 1JP7A 1ODKA 1F9EA 1H6BA 3LL4A 4UNPA 5D01A 3W77A 2WR8A 3ECSA 1K8ZB 1SUAA 2HSEA 1JLRA 2JF0A 3PSAA 3AZOA 4PNPA 4AP6A 4F97A 5KQMA 4D4JA 2UAGA 5DXFA 4F2HA 4YWJA 5IF9A 3OTOB 3EGEA 5JJKA 2FXVA 3MLBA 4M9UA 1TEHA 4D1YA 4G0OA 2XRYA 3TEJA 2GD2A 1ZVJA 2JGDA 4LJYA 3HKEB 4ZKDA 1N7GA 4D9JA 2C8VA 1LB1B 4HX9A 4O6VA 4OQXA 5TIIA 3I4FA 1YRHA 3K5HA 5TQVA 1GQFA 1D6SA 2VP2A 2XZOA 1G16A 3GL9A 4F3CA 4LWOA 5BWBA 3DQQA 3TO5A 3F5MA 1H1LA 5GOZA 3MJTA 4E5MA 4Y2JA 1GZ4A 1X0XA 2VHZA 4KWEA 1Z2PX 1ZM4A 1DFHA 4GPZA 2WF8A 3OE7A 4KE7A 3QQPA 1XP5A 3WL6A 2VSFA 1G2QA 4V0ME 5KC8A 4KSCA 3WWZA 2ZJ4A 4OQZA 1XPOA 3QU4A 2JRLA 4BAUA 5IW8A 4G5XA 4EB3A 2B2CA 2GD0A 3E03A 3QU9A 4M9SA 3EY4A 5CNMA 1W4ZA 2ODQA 1BMTA 2ZI3A 4NPCA 5K0GA 4GOJA 1FDVA 2PV7A 2Q0HA 3QE2A 1AN0A 2ZYVX 4OGKA 5LBUA 3SC2B 2I1LA 4BNUA 3G0HA 2FWAA 2A86A 2HF7A 5D1NA 4ZAZA 1SU6A 1F4PA 2XMQA 4P58A 1NU6A 2MU1A 1UKEA 1V9LA 5B53A 4B4DA 5B5SA 2ZYIA 4GYWA 2I87A 4C3OB 1SXJA 3P96A 3OTIA 3D2BA 5JCXA 3DBRB 5LNK1 3MBOA 2I62A 2ID4A 2Y0DA 4WKGA 3FCXA 5CLIA 2NTYC 1E2FA 1N6KA 1Y8QB 2HDWA 2OGTA 2P91A 4Z9YA 3RKRA 3AMVA 5IJ9A 1LF5A 4MX8A 3LX4A 4JJIA 1KBQA 1SUDA 2D1RA 3P9QA 4P86A 1Z2EA 2TSYB 1NTRA 4MWCA 5FTMA 4ZMSA 2G9RA 5KIAA 4W4TA 3P45A 5HXAA 2GEKA 4DDUA 1KDOA 1V3QE 3LNTA 1RHJA 4JLBA 3SHQA 3R3VA 4L3OA 4IXDA 5KVSA 1ATIA 1T25A 2JGEA 4IHJF 2DBRA 4WVLA 4ZALA 3P5BA 4DIOA 1Z2NX 3JALB 5KKNB 1ZL0A 4J94A 4YRFA 4IMRA 1YVRA 5FBZA 3UB4A 3DOOA 1WZUA 4BVHA 3MLEA 2BGWA 3BERA 3UW1A 2M6LA 1P60A 3G8AA 1DX4A 2GBFA 1GRNA 4Y7DA 4KFCA 3N2YA 3PVSA 2HA2A 1YIAA 1ZONA 2CLLB 1W30A 2D1QA 2IWHA 1Z8DA 3UYKA 2CDAA 4DQVA 1IMOA 2JI9A 2XDQA 1AGNA 2BFDB 5J3JA 4JJFA 4C4SA 2Q3HA 2CYBA 2NX2A 3RFUA 1V6AA 1YJ8A 2DULA 2J45A 2Z2IA 3F3YA 2R8RA 1U9ZA 1XA3A 5GJVC 1FMCA 2VPXA 1QFZA 4TX1A 4TT3D 3TI7A 3RUCA 1BU5A 4NE7A 1XF9A 2J0UA 5SYAA 5IAEA 4RZSA 1ZZGA 4LDZA 1CFJA 2VUUA 4ECEA 3TRHA 1W49A 4ZYYA 1O0SA 2V8BA 4P5PA 1II0A 1PG5A 4KMRA 5KAMA 4C3ZA 3ZE8A 4D5EA 1LPAB 2WV9A 1NBIA 4NDAA 3RVRA 3VAAA 4L9WA 2R3SA 4P93A 5CFNA 1KR2A 3EY9A 3GT3A 2J4DA 1LS1A 5AKYA 1QM5A 3EODA 3CPHA 3QEMA 1G20B 3U7IA 2ZKLA 4KO4S 4XDZA 2QYSA 3TRFA 2WI8A 2IZOA 3ORHA 4CMGA 2FP4A 4UVDA 1Z56C 2ABWA 1J1ZA 1WL8A 3H5OA 4X92A 2Y67A 3IBFA 5FI1B 4OHMA 5IMBA 1DAOA 4BJ6A 2C5BA 4D99A 2OGUA 3GJYA 1EZZA 3FCOA 2PX3A 4IVNA 5K51A 3VQTA 5KTRA 3GFRA 2GGSA 2AQHA 1EUCA 1BN7A 1WUJS 3UBMA 5JISA 1B6RA 3OIYA 4BUCA 4HYEA 2WKRA 2GJSA 4FI3C 3R7DA 3ZI7A 4EL5A 3P9SA 1ZUNB 2AE1A 1XO1A 1PTJC 2C4TA 3DE2X 1KEZA 4FHCA 4H6PA 2A57A 2Q2OA 5EN4A 3RSQA 2VJMB 3ZJ5A 3VKHA 1GGEA 1XRJA 3PHJA 4A3SA 4DR2B 2P77A 5ES3A 3SOZA 1D03A 3HC7A 2I3ZA 1WZIA 2VBGA 3RSCA 1BTOA 4ND2A 1TC1A 1X1SA 4ZHQF 9ATCA 4DHEA 2I1QA 1X1EA