2HNAA

Solution structure of a bacterial apo-flavodoxin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
b'MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein mioC
publication title Solution structures and backbone dynamics of a flavodoxin MioC from Escherichia coli in both Apo- and Holo-forms: implications for cofactor binding and electron transfer
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 39
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hnaA00
2QX6A 3B6JA 4U7HA 3NHKA 2QX9A 4LTDA 3NHYA 5EMNA 3W78A 5A4KA 3HA2A 1CZNA 3HLYA 2A5LA 4FX2A 2F1OA 1AKQA 4YAFA 1KBOA 2M6SA 1C7FA 1BVYF 2BMVA 3GFQA 3QFRA 4BMOB 1FLNA 5LLDA 4FGKA 5LBUA 1RLIA 2QWXA 4N82A 1J9EA 5NULA 3B6KA 1QRDA 4LTMA 3FVWA 2FAXA 1YCFA 2FCRA 1AG9A 3W7AA 2QMYA 1QR2A 4C14A 2MT9A 1ZWKA 3W79A 2B3DA 3O2NA 2FOXA 1DXQA 3N3AC 2Z9CA 4H6PA 1QHEA 4YQEA 1RLJA 3ESXA 1XI2A 1OFVA 1J9GA 1XYVA 2V5VA 4U7GA 3UXEA 1FUEA 3TZBA 2X2OA 1V4BA 4FGLA 3NHLA 2X2PA 4YAUA 1ZWLA 3N39C 4NLLA 1X77A 3JSXA 3B6MA 4J8PA 3LT5A 4HEQA 3TE7A 1YDGA 5F51A 3U7RA 2M6RA 4GR9A 1FTGA 4PTZA 2BN4A 2Z98A 3KAQA 2KLBA 2ZKIA 1CZKA 2FLVA 1AKWA 4NULA 4YAWA 2V5UA 4HS4A 1WSWA 1NNI1 2FVXA 4GI5A 1AKRA 1FLDA 2ARKA 3G5MA 5F4BA 4CF6A 4GQIA 1CZOA 1AHNA 4U7FA 2XODA 2OHIA 4M0CA 1TLLA 1C7EA 2GSWA 5LJIA 4N65A 1YCHA 1FLVA 1AZLA 4YALA 4QOEA 6NULA 3ESZA 1J9ZA 3NHSA 3NHJA 2KQUA 3P0RA 4QODA 4ZVMA 2HNBA 2MWMA 2Q9UA 5BUCA 2V9CA 2RG1A 2R97A 1DX9A 2AMJA 5FUQA 1TIKA 1AKTA 3R6WA 3OWHA 4DILA 1H66A 4H2DA 5LVAA 3OWXA 1CZUA 2BZSA 3B6IA 2OHJA 1YRHA 5ULLA 3KLBA 5B3LA 3ES9A 3L9XA 3HR4A 2HPVA 4YAOA 1BU5A 4D02A 5LBTA 3QFCA 4BMPB 1RCFA 2W5UA 4FGJA 1GG5A 4QOHA 2MOKA 3OJWA 1B1CA 3FJOA 1DXOA 1FVXA 1SQSA 1E5DA 3F6RA 3NHRA 4QOGA 3RPEA 4C76A 3NHUA 4XDGA 3OJXA 3L9WA 5FA6A 3OVMA 2HNAA 1H69A 3K1YA 3KEGA 4LAFA 2BF4A 4ZVNA 4LA4A 1OBOA 1CZHA 3NHWA 2QX8A 2QR2A 3NLLA 1QBGA 3LCMA 4XDHA 3TEMA 3FNIA 4DY4A 4Y9UA 3OX3A 3S2YA 3OX2A 4C0WA 3SVLA 4LTNA 2N1MA 4ICIA 1CZLA 3F6SA 2Z9BA 2R96A 2QX4A 4DIKA 1AKUA 1T5BA 1YOBA 2MTBA 2OHHA 2FDXA 3QE2A 1D03A 3GAMA 3UXHA 2Q62A 2FX2A 4ESEA 4ZVLA 5TGZA 3NHFA 2BPOA 1YCGA 3NFRA 1FX1A 1JA1A 1OBVA 4Y7CA 5LMCA 1AMOA 3KAPA 1T0IA 4OXXA 3O73A 4QOJA 1CZRA 5LJLA 1D04A 2Z9DA 4CETA 2FZVA 4R81A 1FLAA 3F90A 1VMEA 3K20A 3D7NA 5FX2A 4C0XA 1SG0A 5EAIA 4PTYA 4QOFA 3W77A 1D4AA 3ZHOA 3U7IA 1AKVA 3OX1A 5JROA 1ZX1A 4PU0A 1F4PA 3F2VA 3EDOA 3FW1A 3N3BC 2QMZA 1YKGA 2OYSA 5EA2A 1J8QA 2FZ5A 5B3KA 3ESYA 5NLLA 3GFSA 1XT6A 1RTTA 4S24A 3FX2A 3NHPA 4Y9RA 2XOEA 4QOIA 4N9QA 2WC1A 4ZVKA 1JA0A 1I1OA 4F8YA 3GFRA 3EYWA 1KBQA 2D5IA 1WSBA 5F12A 1XYYA
chains in the Genus database with same CATH superfamily
3EBLA 4ZCPA 3VR4H 1SVWA 2A3NA 3DHEA 5C35A 1T6ZA 4JP3A 2CV0A 3IUEA 4MVJI 1UK8A 3OT5A 3PPWA 5LQRA 4GOMD 1A50B 4M53A 3TS1A 5B55A 3EXHA 3OOHA 1CCWA 4PXYA 1PG0A 1WXFA 3R7AA 4HAUA 4WL0A 2F1OA 4BFWA 1Z29A 2AFHB 1E3MA 3DG9A 1BXRA 4P5PA 2EZUA 1U3UA 2IYEA 3JXEA 1PR3A 3BDAA 5KSWB 3R41A 4C89A 1ATZA 1CJKC 4P84A 1X8XA 2XZDA 4I50A 1HLFA 1RYBA 1OXUA 1X1RA 3DUFB 2B30A 3ZKAA 1K1EA 2JG3A 4C4PA 4FGZA 3ZCVA 4NK5A 3NJ4A 7ADHA 4C0AC 5D84A 2ZRJA 2DLNA 4G4GA 4A27A 3T9AA 3ZDEA 4P81A 4OFXA 2B5OA 3OSUA 5AVYA 1Q1EA 1DXYA 3B2QA 4KVFA 3TSAA 3H19A 3MT0A 3F7NA 3G88A 4ZO7A 1KO8A 1KTVA 2C98A 1C7QA 2C77A 2NG1A 3I5AA 3QMWA 4RACA 2POCA 1UFQA 4UBJA 1NE2A 4R5HA 4BRSA 4XDZA 3D7LA 5KNCA 1BTOA 3EFHA 5HKKA 4GPAA 2RIRA 3BWMA 4MRPA 5A0FA 1L8OA 1Y37A 3LQFA 1FSGA 3SGLA 5HF8A 4RDXA 2Q6OA 1IEVA 1IAVA 2YVLA 3DM5A 3GEBA 1OZFA 1RI3A 1NYQA 3A4TA 4DLUA 4HZGA 5IHPA 1R6TA 1S3SA 2XMBA 1CLEA 4BO9A 5JMPA 1EUQA 5ICMA 4RETA 3JPWA 4FT2A 3IJPA 3MHPA 1SKBA 2CE7A 4BVGA 1LBQA 1OWNA 1NQTA 4OQMA 4P3XA 2MCFA 2XNHA 4BBPA 5LU8A 3L6BA 1Q1ZA 1VLQA 3RK0A 5AQ1A 1GUZA 4NBTA 3QYAA 4ERXA 1S8NA 4H0CA 3JQ7A 1QHEA 2ZGVA 4QICA 1PKXA 4CIBA 1RLJA 2V98A 5FWNA 3UBTA 1D8AA 1GNLA 1N3IA 3RDPA 1QVRA 1Z33A 4KWCA 3ERCA 1U8AA 1P6QA 2JLSA 2OL4A 3HB5X 1LD3A 2OCXA 3ANTA 3FFTA 4LBZA 4QXMA 3HVRA 5IVKA 5INTA 2BFFA 4QDTA 5LXTF 3I09A 3VDNB 1V25A 4GLFA 4IXDA 1X7WB 2RK6A 4F4IA 3KZOA 1SHZA 4GXQA 2P6OA 2DBZA 2P3OA 3IRVA 3I8SA 3LTEA 5JR3A 1FCJA 3QJ5A 2LPMA 1FY2A 2IHBA 2HQSA 3F1KA 1Q2UA 2V55B 1FRFS 1R0SA 3SM9A 1C0LA 2AZTA 1JDPA 2QYOA 2EOAA 2N0SA 2HXGA 1EX6A 2FX5A 3C6ZA 3OJFA 2WUFA 3MXTA 3PZBA 2FI1A 4HXEB 4MR9B 1VYTA 4H7DA 1C9DB 5JWRA 4U9HS 5ISMA 1YZHA 4M0KA 3LIIA 4BQEA 2QLFA 1C8LA 4YREA 3BCSA 3RIEA 1BKSB 1ZISA 3P4XA 2Q1TA 1XB2A 4IHJB 3TJZA 1FS6A 4MWBA 4LFAB 4ZQHA 1KEEA 2LXNA 3E22A 3ABRB 5FUXA 4BO3A 4EBBA 1PG5A 3UEOA 4KK4A 1ZVQA 4RDHA 2YJ4A 1BJKA 1WM1A 1VZ3A 2BP7B 2QYSA 3ILHA 4HPJB 3VU9A 5KC8A 2DWUA 2I3DA 1JQDA 4CKXA 1G0NA 2ZAIA 4ZMSA 1V95A 3FOEC 3QEAZ 4O6VA 3OLCX 1M2JA 4I2NA 4YCJA 4IWXA 4CM3A 4XLLA 2PFGA 3TRHA 4EG8A 1VIYA 4KXVA 4WJLA 3VR2D 2NO4A 3ABQB 2Q41A 3W2GA 4X64B 4IYJA 1RWNA 3TOVA 3PIRA 4YS6A 4P7GA 3R0ZA 2LCFA 4IVNA 2DEUA 1G3UA 2I7VA 4FDLA 3PJRA 3E8MA 5COBA 1UWKA 4D0LB 5FR2A 2I4IA 3E8XA 3NIGB 4U7FA 5ICFA 3K2QA 1E2GA 1KHTA 2OHIA 3KUCA 1JEQB 2R00C 3G3EA 3HL4A 4AYTA 4P4UA 5HNKA 4BX9A 1XFDA 3BBPA 1SU4A 2ATVA 1AIPA 3G85A 3ZDXB 3E82A 5DNWA 1P74A 5MN5A 2DAPA 3LK6A 3H65A 4IL5A 4IY1A 1SHLA 1XU9A 4X8MA 3CH7A 3VOBA 2H1FA 1JHMA 4RX1A 1QYCA 2A8YA 1YCHA 2PAFA 1VSQA 1P5JA 3LV8A 4MQBA 4LF8B 2OB2A 1FFHA 4HEA1 1SOWA 4YALA 5JH7A 1CUWA 4QATA 1TYDE 1X7XB 1L3IA 2JJ2D 1EM8B 2PL3A 1NDHA 2CLIB 3A27A 3QZUA 4RAOA 2QDKA 5AI0A 4FUQA 2H4YA 2HB6A 1MAAA 5CW1A 1BCRB 5GZ6A 3WNQA 3R5XA 1XEWX 4H3VA 2OD2A 2JGDA 4NCKA 1DT3A 2JIMA 3K0CA 1PS9A 3KZCA 1U8TA 4JA2A 3IV7A 4DRXB 1Y5IA 4XFKA 1TTQB 2QTVA 3IT1A 1PI3A 1I94B 1ESCA 1F06A 1L7XA 4NMLA 3KZ1E 4Z0TA 1Q14A 4BEWA 3TVDA 5CLFA 4GP9A 1J0DA 1T0JB 4M38A 3LFUA 3WLQA 2M2IA 3OX4A 3OZBA 2QBYA 3ZV5A 2JIQA 2FZKA 4AN4A 4JSRA 4XQEA 2OAP1 2UV8A 4MW2A 4DMHA 5BWOA 3K31A 3X1MA 1C2YA 1Q1GA 1HYGA 1QKKA 5CVJA 4ETNA 4F1JA 1JKIA 1XROA 1AM4D 3W9UA 4LE1A 4ENUA 1D9ZA 3C48A 2OA0A 2H48A 2Q3HA 3FR7A 3ND5A 2X5XA 1SOVA 1EVQA 4Q39A 1M5RA 1JJAA 4OXYA 2H54A 4X00A 5H4HA 3AG6A 1XRRA 4Q4HB 3KYDB 2CLFB 3MWJA 3TQQA 1MG5A 2VJMB 1VHQA 3W4JA 1CXZA 2BC9A 1GGJA 3D1VA 4R2KA 3WMFA 2Q1SA 4BP8A 2KSQA 1GCIA 3N0XA 1CUBA 2HWXA 4HGOA 2Y1WA 5L3ZA 1X1QA 3V3KA 3ZLBA 3RHTA 4A36A 1NLMA 1RE0A 2HGZA 5AM1A 2CKMA 5LQUA 3FPAA 1X80A 4BNDA 1QM5A 7GPBA 1AUPA 3UA4A 5BWLA 1GPJA 5GADl 4UM7A 4EY3A 4HXGA 4IIBA 3V8RA 3G8CA 5IK2D 5IAEA 3EGXB 1T5DX 2BVNA 3FSGA 3PQ4A 3CF6R 1DNPA 1DXHA 3M49A 2WUDA 4Q48A 3BERA 3L6DA 4QUAA 5FTNA 3TL6A 2ZANA 4DDKA 1TD1A 1VLHA 5EGNA 1VE9A 2F8MA 4U8GA 4UNIA 3NHZA 4WK2B 1NMSA 2MMGA 3IFSA 1R10A 3CH6A 3TLBA 121PA 3TQCA 5H9WA 3ANXA 3P9PA 5B7GA 1C1YA 3AF6A 3IBYA 3IEKA 4M1EA 3A6EA 4DDTA 1NBOA 2VSFA 4LKOA 3AUYA 2C96A 1DRJA 1X74A 1WZ2A 1RAGA 5JFOA 1U2TA 1Y3DE 1DWOA 1CR6A 3C1TA 2AOUA 4H7HA 3TPCA 4CZ2A 1XD2A 4AW9A 3EBPA 5AK4A 5EXPA 3IQGX 1OYWA 4J3JA 5I6DA 5LL6P 4HKTA 1WA5A 3UJ6A 5GAJA 3ZJYA 5F52A 2C7GA 1E6UA 5JSHA 5DK6A 1V11B 2FFQA 1LSSA 2HA3A 4FBLA 4LJLA 1ZZGA 5DYNA 3I23A 2FEMA 4FFRA 4AJ2A 3F6YA 3CEAA 1DKPA 3C0KA 1E5DA 4YMHA 1EGQA 4HJRA 1V7ZA 2FEXA 3EDRA 5CDTA 4RA6B 2WM2A 4CGYA 2EIHA 5CEEA 4ZEMA 5JC8A 3HB7A 4CTKA 4XOIA 4ER0A 1KSGA 1XPOA 4AUNA 4X92A 4JI5B 4Q4AA 4HWTA 5TF4A 5DLEA 4ND5A 1H69A 4CODB 4UATA 4UBLA 4PC6A 2ZATA 2F3QA 2HJSA 2NTVA 3L5OA 4M60A 1E3DA 3VA7A 1QQBA 1ZDMA 1QPGA 3EEQA 3TI7A 2Y1DA 2C8VA 1IM2A 2WUGA 3ED5A 3LX4A 4MV8A 1MQ8B 5DHPA 3DHVA 3DUFA 2G72A 4DJAA 2GM3A 3RAEC 3NB0A 9LDBA 3OCXA 5AHXA 3RCBA 3QELA 2B21A 2Q8QA 2P8SA 4B8ZA 4UMVA 2J46A 3JD4A 4EO9A 3WB2A 1XZHA 5B3JC 2QX8A 4UNQA 2PWAA 1WU8A 3MJRA 2WI8A 1J4AA 4DV3B 5JAIA 5HOQA 1IZ9A 1NSFA 3IVMA 3M34A 3ZEIA 1E2FA 5I51A 1ZMBA 4XJVA 1JQJC 2PD4A 2JHFA 3ESAA 1WS6A 3E81A 4PZEA 3FROA 5EXTA 2CXTA 2LBPA 4KP7A 3D4BA 4UQPA 2Z2KA 4XJSA 3OX3A 3PXUA 2GHTA 1IZ7A 3TBFA 1PK9A 4OAOA 1K7XB 5KCZA 4IIDA 1VPWA 4Y8VA 4FIDA 4WJZA 1RI4A 4CKYA 1RU3A 2F64A 2FMIA 2WT8A 2ZDQA 3C8HA 4HB0A 4ENWA 4KQ6A 3PVSA 4OHCA 4C2UA 5K8JB 1AZWA 1U5CA 4WINA 4UD6A 1IOLA 1T3LA 2WYUA 1C3OA 4M8NE 4AB1A 2QD1A 3H13A 1LRJA 3LY7A 4BFCA 3R3UA 4WCFB 3G17A 2J87A 1UT6A 5IDQA 1JKJA 4HH3C 1KDTA 1R27A 1JJ7A 4RFSB 2UYQA 4MDEA 3UCFA 4GGOA 5DNVA 2PJDA 4ZOLB 4XARA 1X7WA 4IH9A 3QVXA 3PNOA 4N39A 3R7WB 1PAUA 2QRQA 4AS1A 2ZIUB 1W36C 1Y6FA 5IANA 5IWCA 1E63A 3Q3VA 3I64A 3G1WA 3D5TA 1RDFA 5DHAA 1DV1A 1PJRA 2I0FA 3O90A 1WKCA 4O4LB 5C1IA 5IXYA 1KE1A 5AXAA 2Q28A 4JCCA 2GEDA 3OZUA 4AY6A 4AMGA 3AC0A 5CDSA 1P39A 4MR9A 1E4VA 3PKIA 5BQPA 2FFRA 4HGPA 2EF0A 1P2VA 4AF6A 4BCDA 3PHIA 2NTEA 2XGSA 2YWFA 5B57C 1J2UA 2VPTA 5F1PA 1PGOA 5K8LA 5E6UA 4AN0A 4J0HA 2J0SA 1GUYA 2JKVA 2Q8NA 3K1AB 4WRRA 2HYDA 4Y6SA 4YBRA 1FVOA 2PGDA 4IHJA 5UKDA 1OH5A 2GHQA 2HYIC 1QWOA 4JU8A 2O3QA 1VLMA 2HMVA 3C15C 4HYYA 2O8EA 1WQ1R 4L8FA 5CB4A 1USUA 4OF4A 4LYDA 3R3VA 4B0PA 1A9SA 2HRQA 3QM1A 2O5VA 3D7NA 1SC6A 3E4CA 1XJQA 2BP7A 2FFJA 4IQFA 5E1OA 3USCS 4CMEC 4DTIA 5KJ1A 2CBXA 5AK6A 5E4FA 1PUIA 3X0DA 4BVBA 2YV4A 1ULUA 3PNQA 4AG6A 1QYIA 1SZDA 2PBFA 5HDQA 2FUEA 2J3JA 4GICA 4V0SA 1YR8A 1ZGJA 2LR0A 3VO8A 1XEFA 2NTNA 3P27A 5JDIA 4S0ZA 4ZK6A 1M2EA 4PTYA 4UULA 3WLEA 1G6Q1 3DBLB 3N70A 5GVRA 3VNAA 2XMGA 4CNBA 2IIVA 2GOYA 4E1BA 3GCDA 1NW5A 3ZWKA 4RULA 1SEPA 1AZSC 4HGNA 2W6IA 5AVUA 4LYJA 4Q4LA 5JI3E 2GPBA 2LUOA 3Q8XB 1VKJA 4HX5A 1YNSA 3T9CA 3WYDA 4IVRA 5CT8A 3F2VA 3LRTA 2EP7A 1X1DA 4CFSA 1UBTS 4IXNA 2C2ZA 4B4VA 4Z4GA 1FMTA 1U04A 2Y1GA 2HAEA 5HRCA 3E84A 2JJQA 2HY7A 2WIJA 3RS9A 3SJBA 4CXMA 3VNRA 4Z53A 4FGWA 5AWFC 3U4HA 3L8MA 3BXFA 5A6SB 3TZHA 3ROQA 1SNYA 3HBLA 5IH3A 3VU0A 1OAOA 4OHFA 4JKIA 1M2WA 3T5CA 3UV3A 4D9KA 2HMSA 2PYIA 4HRAA 4D6XA 2VC2B 1S2MA 3N28A 4DQVA 3B9QA 4K6HA 3TUZC 2BGLA 2Z5FA 2AUNA 3INYA 4KPYA 1IOWA 3FUWA 3Q8KA 3H1BA 1EM8A 1OLUA 3N8DA 4GRAA 1Z0DA 3WIEA 4WDRA 4CMGA 2LKDA 4DR6B 4I1OA 4DBVO 1USIA 1BCRA 3I4LA 5HCUA 5EI5A 2IITA 4CL2A 1I1OA 1S2DA 2GPTA 1DQSA 2PS1A 3UJ9A 1ZP6A 4DRXA 2AMYA 4GG1A 2ODNA 3FE2A 1QH0A 2PU7A 5JS2A 1FYFA 3DXXA 2PUFA 4JHXA 4LF9B 5J5CA 1EUCA 3D8NA 4FONA 5DTRA 4R68A 2Q21A 4OLJA 4DHEA 2N1BA 3CMCO 4LY3A 3PQ5A 1M8GA 3PLNA 3IIJA 1EA5A 4PSAA 1HDRA 5A7FA 3RVSA 1TZBA 5BSUA 3WYGA 1FP6A 1Z08A 3BTUA 2I6QA 3HO6A 3RSSA 3UCXA 2I6TA 5FT9A 2HBZA 3JAWA 1B74A 4MUEA 2RD2A 1YAHA 5KCMA 3DV9A 3HSSA 1UOPA 2A5DA 1ZIYA 2WHPB 5M29A 2TECE 4LTDA 1MENA 2XCLA 4UTNA 4RW0A 3HA2A 5AOVA 5LP6A 3KYBA 2P5UA 1N7GA 1C30A 2QE7D 2ID9A 4AUKA 1TEHA 4CM8A 1GHTA 3C45A 4L08A 1U6IA 1H4TA 2JHCA 4G5SA 4W82A 3SFZA 3WI7A 2DECA 3KYDA 2XQIA 4UUOA 2F3SA 1GLGA 1LJ8A 2H7VA 1HT0A 4ROSA 3GLIE 2BSQA 2R7KA 1GN9A 4KPEC 4ZOQI 1C7FA 1T8RA 3WGHA 4U1RA 1E2IA 2BCGY 3DMNA 5G0SA 2NVBA 2F55A 1MX1A 4U5XA 3E15A 4YRBA 2YHBA 1IIRA 4X85A 5LBUA 1BYIA 4HLDA 5K3SA 3TQTA 3EX7C 1OI3A 2VPQA 4WXHA 5L7YA 4B45A 4A0FA 2GDJA 4GKKB 1WCYA 2A30A 3FOBA 3IAM1 1A9PA 4KAXA 2ISQA 2C4MA 1YQUA 1FK8A 4JX8A 4PAQA 3TQIA 2W43A 5GV7A 4BC0A 2V4UA 4TL9A 5EWMB 4TV8A 5AI4A 1NSTA 4MIKA 1IN7A 2XUOA 5E7QA 1JHOA 2E4YA 3A31A 4N5MA 3VISA 2UZ4A 1ID8A 1MX5A 1RQXA 1EWTA 1MDBA 2ZCUA 2BM8A 5ED0A 1EE9A 3EOBI 1SA0A 2Y0CA 1IWOA 2OGWA 3LUHA 4ZGWA 4HH0A 5ERGB 1EFVA 1PEYA 4PIMA 2P4UA 3X1KA 3SYMA 3UJPA 1KJQA 3R4CA 4ZT7A 2E2WA 3DEKA 4TLBA 2TMKA 4B43A 3N58A 4DQDA 1ZOLA 1QORA 5CM8B 2C7QA 4PYLA 1CUJA 6Q21A 3PSAA 3HL0A 1TI7A 5I8ZA 5CU7A 4XUGB 1ORIA 2X8AA 4G07A 2FPGB 3EUFA 4F9EA 4ZRMA 4EG5A 3LUFA 3D4OA 1FW6A 1HDGO 3B60A 3LP8A 2Q2VA 2KX7A 3OI7A 1IZ0A 3G2MA 1B8PA 3KKLA 4BVLA 5DFAA 3S2FA 4BQRA 1JX6A 3ROEA 4NBUA 4PYMA 3R7LA 1M33A 5IN5A 4RA6A 2NO7A 1L7MA 3OTGA 4QBFA 5TXGA 5KC9A 2C3PA 2IEZA 5CD1A 3LCRA 4ZAFA 3ZPXA 3QWBA 5EY5B 3QXGA 3SEAA 3QJGA 1TC1A 4WK6A 1A82A 1AE1A 4NWIA 2EWWA 4H31A 4WVFA 3EG5A 1XG5A 4M9SA 2EBWA 4YMVA 4G4SP 1Z0ZA 2Q3BA 3HPRA 3KSRA 3KXIA 4B2YA 1CP3A 4EO4A 4QDKA 2GFHA 3WMXA 3DW3X 2HLDD 3PBKA 1KRXA 1RXYA 4KN9S 3INRA 2FWNA 3QK7A 4JBYA 4K1XA 1DZ3A 1NW4A 2G5TA 4XTCS 4D3XA 1XQWA 1EDDA 3LDFA 4QIHA 4XR4A 1KF0A 2X1LA 4ZI2A 3WFIA 2FWMX 5FBVB 2IYZA 2OUKA 2D5LA 1X1BA 2VPYA 1D6SA 4O5OA 4R3WA 4UUNA 5JNRA 5CCXA 2Y1XA 2NACA 2AJBA 2ZKIA 3WV4A 1H0KA 1KS2A 3K9NA 3RFCA 4RVHA 2ISCA 4DLAA 3IMFA 5B2ZA 2AXEA 4WEQA 1TGVA 2BHLA 3GYGA 3RUEA 4BFZA 1PKEA 4P22A 4FZVA 5AJYA 5T67A 1ZR2A 1BWSA 3BX1A 1ITZA 2B98A 3PEYA 1WXXA 4ZOLF 5JRZA 4JYZA 3GIWA 2GETA 4BVAA 4HPXB 2WJWA 5COQA 5I7VA 1KI3A 2ZZMA 1QE5A 5FTMA 1KJWA 1G21B 1UZMA 1OFUX 5EJ5A 3PGA1 3QF7A 3A14A 2WIAA 4O4LF 1HE2A 1QHNA 1I4TD 3WLRA 1JBQA 2Q1YA 2PYZA 1Z6AA 3LT0A 1G7TA 2QR3A 3M33A 3UAVA 1Q3HA 3UAXA 2VHWA 3WXMA 3R6LA 1BHQ1 2RC6A 3Q41A 3QA9A 2V7QA 3LHKA 4GW3A 5FUBA 5HF9A 1AO3A 3HBJA 4TS9A 3KQUA 3D6AA 4NSNA 4IXWA 1QF9A 3SIXA 4W9MC 1IHOA 1OIVA 2JPDA 1B76A 3F4KA 3RF6A 4DZTA 2XQJA 3IOCA 2C92A 4ZOLA 2IYUA 2OGUA 4RF2A 4OLAA 3R7WA 2EIXA 1YB6A 1D2GA 1JR4A 2PVCA 4I36A 4IV8A 4JT9A 3CRW1 4QOSA 2P2CA 1T2NA 4TXNA 4WOCA 1BFUA 1IVSA 1Y1RA 3H5LA 1FUYB 2ZE8A 3K4HA 2VDLB 2ZRNA 3OBIA 3N2GB 2OAQ1 1L6IA 3B3QA 1LLQA 4MKXA 7REQB 2FSUA 3D6JA 2C58A 3LBAA 5KQMA 4YMUA 3NDPA 4PZUA 3AL0C 4DAEA 1XLTC 1X1TA 2B2XA 3I1FA 3Q5GA 4X6LA 1N6OA 2Q3JA 3F97A 3P0FA 4HQFA 5H1YA 1V47A 2QUAA 1IJKA 5ERXA 1HETA 2TMDA 3DZHA 2ZUCA 3NHSA 3IDOA 1KY2A 3OMXA 3WGTA 1LNZA 2KQUA 2OB1A 4K2AA 4FWBA 2AJLI 4AZTA 5A1JA 2FX3A 2GQ0A 1NR5A 1DBVO 2XWQA 2JFPA 1RCUA 3K1AA 3QX9A 5GJVC 3RRMA 4MGKR 2FPKA 4X0EA 4JC0A 3DR3A 1RYFA 2C1EA 4J0IA 3V48A 4P3PA 1XJ5A 3JVEA 1YS9A 4QTXA 2UVPA 5EUQB 3PT9A 5FI3A 3QPUA 4QBGB 5FXMA 3ZE9A 3P5SA 5DTEA 2PT5A 3EYAA 2AQHA 3R5FA 4PHHA 2QN8A 1KZ9A 2ODWA 5LUBA 3BORA 2FKAA 3LVRE 2QJRA 5ALXA 5FUVA 1UAYA 1G8PA 4J1TA 4MWDA 4C20A 4HQ6A 2DETA 3IIIA 4YDSA 4MINA 1QZ3A 1RXIA 1RZRD 3I52A 2IXAA 4CI0B 3LECA 2B4AA 3HLTA 4J1SA 1IUNA 1XCPA 1Y1LA 3IRUA 3TAHA 5I7SA 3ZDBA 4ER7A 2C5HA 2ZYAA 3VBCA 3RS4A 4M9RA 1XR3A 2YW2A 2I2CA 4UE2A 1DOHA 1E1MA 2EKPA 4L9RA 3OUZA 3R0QA 5FBZA 1TXGA 1EFPA 1MOZA 2I3AA 4R1LA 3BH6A 5AVXA 4PG7A 1XKQA 4HAZA 4CF7A 1XJCA 4L5IA 1KL7A 2G9RA 1KZ6A 2W6OA 3GMIA 1QIHA 4MR7B 4AKIA 4MW5A 1A98A 5AO9A 1BKDR 4QDXA 2D0OB 2ZUUA 3CVVA 5A6SA 3TUJC 1UBUS 3AX6A 5DRYA 4XWKA 1MB3A 2PIAA 1ZRMA 1NW8A 2AMLA 2V4ZA 3TFOA 4C0QC 1TGYA 2HWUA 1Z6PA 2HPVA 2Z4TA 3FMVA 2D7JA 3M2TA 1YO6A 3KBBA 1DAKA 1E1QD 3NX4A 2ALJA 4LOIA 2YC2C 2RHRA 2J7KA 1LLCA 3GPBA 3LAWA 5U1PA 1D07A 4MJ3A 4MYDA 1HFWA 3SC4A 3FNFA 5EJ9A 1ZUD1 3NDIA 2C5BA 1WP4A 3QKIA 5IKXA 2V6MA 4XM2A 4W5RA 3HPQA 3WR5A 3ISTA 1UC8A 5DSZA 3SYNA 4ZK2A 3WRXC 1TO2E 2C94A 2Q49A 3QU5A 4MZDA 4WZBE 2HIHA 5KEIA 3V2UA 2B4KA 1LBIA 2RHJA 1OA0A 4RVCA 3O8DA 3UYLA 4UNPA 5J2UA 4BN0A 2BKAA 5EVCA 2XVAA 1UBLS 3DVSX 3UGTA 2HEGA 3HN2A 2BLNA 1TW3A 3R76A 1XZCA 3TAUA 1JLLA 2X7JA 1GUAA 1A72A 4GLBA 4M9UA 4CLDA 5L51A 2VDVE 5TDHA 4XIJA 1WDKA 2WHPA 4EUKA 1USKA 2RGYA 3G82C 3OJXA 4IMJB 2ATIA 2JFUA 4PPQA 3RHSA 4RGYA 3W4IA 3DPSA 5EZYB 3IAFA 3SY8A 4CQJA 2BRUC 4OO3A 4YP6A 4OA8A 3DHWC 1OC4A 3MJHA 1RAFA 2VJCA 4HZUB 4I66A 3NKVA 2BGNA 3RTBA 4N03A 4AP5A 2R7LA 4P4TA 1EQAA 4BP1A 2YN0A 4JGBA 4C1BA 2WSSD 4R9UC 4YNBA 1JGTA 1B1AA 3EDCA 1CZHA 3TSYA 4PRKA 2PZFA 3RAGA 1JP7A 3NHWA 3ZEAA 5LMZA 4QGFA 2XADA 1UINA 5F2NA 2P3QA 3L49A 1WR8A 1KOJA 1XRLA 2G7MC 1LSJA 2NNLD 3M3PA 3M6IA 3QVUA 4DR7B 1XO1A 1FMJA 2GBFA 3GFBA 3I8XA 2DQKA 4LVUA 1XOIA 2ZB7A 3BJZA 3G5AA 2C8LA 3PXBA 4KKVA 5EWMA 3ZY6A 5HZGA 1OQAA 4IDEA 4LBWA 1SZPA 3TCKA 1CUIA 3ZS8A 1OB5A 2I2DA 4DCMA 1RC0A 1SXJC 1S4MA 1ORVA 1KI7A 3HJNA 3LBFA 3C5VA 1U7WA 4Y7DA 3CM0A 4Y9UA 3RC3A 3S2YA 5D7NA 1YJQA 2EFGA 3A1NA 3SYRA 5C4GB 1QCYA 2B2CA 2E9SA 2YY5A 2AJ8A 4GD3Q 1XZKA 2C4NA 2IYLD 5C51B 1WUIS 2DHCA 3GUYA 4JY7A 4KBFA 4MEBA 1Y6GA 3ZDFA 2BBSA 4Y2TA 3VR0A 4DCTA 3CTMA 2ZAOA 4LTNA 1COWD 1BJTA 1WDLA 3I9OA 2GA9A 2PXCA 4O2LA 3O8OB 2XITA 2B7LA 1CUYA 2QJFA 2ORWA 3A2MA 3CKYA 2OV2A 4FDMA 1S2OA 2WWXA 5JLJA 5K20A 5CYPA 1QJ4A 4P9NA 4BO5A 1ZY2A 3DSRA 2QL5A 2OHHA 1UKVY 3NWJA 3FWKA 4Q18A 2IH5A 2I2XB 3C87A 3PD1A 2H1LA 5HUHA 3HWRA 3S81A 5H80A 1NQXA 3MRXA 5C5EA 3FTCA 3MMSA 4Q3BA 4QU9A 5KYTA 3MQ4A 1A8IA 3THSA 1YBVA 4Q34A 4V39A 1OYOA 2AEJA 2RGNA 3A3PA 2IW3A 1IUKA 2WVJA 5A7HA 3T1OA 3BRCA 4CIYA 1P1KA 4C0HA 1A5SB 3N0RA 3TIVA 4QASA 1O54A 2JKZA 4I55B 4DNPA 1CD5A 4C4XA 5BN3B 2BONA 2Z6QA 2IKQA 2QNRA 3CY6A 5B3AA 4JQCA 4JBLA 1T3ZA 1F2TB 4MQEB 3D0KA 3T41A 4E6EA 1EVJA 3B1JA 4L5AA 1FX0B 5ESWA 2YVQA 4R8VA 5KSOA 2YIJA 2P9FA 4LGVA 4A23A 4M55A 5GIOE 2CLHB 5IVHA 1J2RA 1C8VB 2QRMA 4KQHA 2IP1A 4WOJA 4X54A 1J70A 2G9QA 3D2BA 1Y1KE 2VSYA 1IONA 1E8DA 1US8B 3W5VA 4WESB 1KE2A 4TOIA 4M6WB 1VIMA 2RHMA 4CVNA 4TZ6A 3B9RA 5L53A 1U3DA 1NJ2A 4DANA 1FYDA 4OJQA 4I5GA 2VHYA 4Q3OA 5LP1A 1GT91 1SUCA 2B5VA 3E3OA 3GFOA 1I2ZA 2OCPA 4K6FA 4F3CA 3THXB 4EYSA 3OC0A 5LCXA 1TADA 1TRHA 3S7TA 1E59A 4JNKA 3VVMA 4EY7A 3H7AA 1VI6A 1NQWA 2W4MA 2YRXA 4YLEA 4ZVVA 3RE1A 4EKYA 3LY5A 1QQTA 2R2AA 3ONNA 3U7GA 5AVTA 4W5NA 2W2PA 4UTZA 3FYDA 5JANA 3GGJA 1SIUA 1RWBA 4YCSA 2H31A 2QA5A 3HXMA 4DQKA 2IA5A 3R3JA 1G21A 4MGZR 4E09A 4CLEA 2XNSA 2CT8A 4RMGA 2AFVA 3D6UA 1IHYA 1RQGA 3PPYA 2IYWA 4IDGA 4IDQA 2HIMA 2PA0A 4AJPA 2RHCA 3O1IC 2YRWA 4CE6A 2AV6A 1I0IA 2BEVB 1BVUA 2XNDA 3CGGA 4FYVA 1HE8B 4D99A 1J42A 4KXFB 3AV3A 2DBRA 4GOND 3SKYA 3Q10A 4C4YA 5JJIA 1E1RD 2CHUA 1RYYA 2EP8A 2IPLA 4GHWA 3OY2A 3GP3A 1JYEA 4MKIA 1J8FA 3G1UA 4PBRA 3GQBB 2NZVG 4I5DA 2IXDA 4UU1A 3UJDA 5IEJA 3H18A 3O4FA 4HNAB 5A5GA 3EPJA 5FJIA 3TLCA 3IR5A 2X8JA 5F2EA 4M8IA 4F0JA 1EWQA 4OX9B 4PZPA 2JIDA 1Q0HA 1N9GB 3S2IA 3BD6A 7REQA 1YTLA 1HOXA 4IYRA 1B0ZA 1XT6A 2Q99A 4R05A 5AI6A 1H65A 3ZV6A 1L5VA 1QQ6A 1A9ZA 1TQ4A 2B5WA 2GN8A 2C4VA 4LZAA 3EXEB 5AVOA 3CR8A 4TTVA 1JIKA 1C3VA 1KI6A 5DEOA 3JY6A 4W5OA 5ABPA 1RRMA 5FOTA 1M8FA 2CEAA 3RK1A 3T7RA 4RKRA 3B5EA 1LLFA 3I2HA 3NALA 4BRZA 1ZJYA 4ITUA 1E1CB 4M7WA 2WWFA 1MRSA 2B8JA 2PFKA 2ZRPA 2VK2A 4FBMA 1MO5A 1U0FA 4A15A 2EYQA 2J3KA 1EXWA 2XWJI 1P3Y1 2GTHA 2QYHA 1DJQA 3LCJA 2FXVA 2Q9CA 3JTEA 4R1NA 4ZU6X 4ZOEA 3RVKA 3RYCB 2VWPA 4JB3A 5BURA 3A9CA 1XNJA 4FCCA 3L02A 3JASB 5B12A 1Z7WA 5IU6A 2VF2A 4MPRA 1AT1A 3BWXA 3C7TA 3S6JA 1RYMA 4INJA 1OFIA 3MB8A 4FFOA 3NNNA 1C4WA 1SUAA 2WA2A 4E14A 4AKGA 1CJCA 1E1LA 2CYAA 4XX0B 1M6VB 5FAXA 4B0OA 2WU1A 3JQDA 5C3UA 1JDNA 1GFIA 3GHHA 4OI2A 4CDRA 1Q6ZA 1BW9B 1YBAA 1I8TA 3AB8A 3ZLUA 1IN1A 2OFWA 1E66A 4B9AA 3MW8A 3JRWA 2VSQA 2HF9A 4MPTA 1ISPA 1UKEA 1MRZA 1NY5A 2WUWE 1SVKA 3AEYA 3LW7A 5TV2A 4E2FA 1DTWA 4ZV9A 1TYAE 4HFMA 4E3ZA 1Y6JA 4YPOA 3U9LA 4DE5A 3ILYA 5IZ4A 5KNDA 1DLIA 4PLGA 1YRQA 4XQ0A 1CUAA 3KL2A 4JLAA 1SCJA 1U8EA 4KC0A 3T5PA 4OL0A 4F71A 4P38A 1BQEA 5LZ8A 4OHYA 4ZHQA 4ZT3A 3JQRA 4RK5A 2P2DA 4LZOA 3TAXA 2UUOA 4TKVA 3GARA 1JMKC 4BMXA 5LLTA 4REQB 1TD9A 4J0KA 1GA4A 1CS0B 1BXGA 1DJMA 2W22A 3NOQA 3TNJA 2P90A 4M0MA 4IDFA 5HDBB 1WUHS 2IL1A 2WPDD 3RIHA 4DPMA 4YY3B 2VF8A 1K5HA 2DTDA 4O1HA 3HVIA 4YVFA 1KQNA 3S2SA 1WEHA 4UOEA 4DXHA 1U0BB 2XW6A 1DUIA 4G3XA 3VZSA 1LTKA 2CL5A 3PNBA 1L7QA 1P0PA 4TV9B 4HBZA 4Y9DA 2J85A 5ICGA 5CAEA 4JENA 4UMFA 1UFVA 5EZYF 3GGPA 1J1UA 1TT7A 1WPGA 3DE3X 3EH2A 1SRRA 4UUAA 3GRFA 4LK3A 4OBWA 2GRUA 3S40A 1DWUA 3T52A 5ITZB 3C7KA 3ZNPA 3VPAA 3ADKA 4BGUA 4LPSA 1IN8A 4NDAA 1SM4A 3FF1A 2KE5A 4B4DA 2DWOA 3ESXA 3CQ9A 1AXGA 3JQAA 5LZ2A 4MNTA 1LPOA 3EIHA 4M7RA 1YE8A 1ADYA 4D41A 3K2IA 1PTJA 3QPAA 1C0EA 5CLLA 4HUJA 1K8XB 5DIZA 1JALA 1ML3A 5DOVA 4FJ2A 3IBSA 1U3VA 1F8XA 1ZSVA 3I2FA 4J7AA 4JC5A 4PWZA 3FTQA 1EFUA 1RAHA 2HO4A 3D43A 3H1AA 2B8NA 1L5NA 2GYVA 5EZYA 4IIGA 4Q1EA 2VPPA 2RB5A 2IU0A 1QHIA 4NCNA 3L0CA 1UXIA 3AJEA 1YR3A 1OI7A 1Z4PX 4IP0A 4HZUA 4NKRA 1MFPA 4QEZA 4GUDA 3TW6A 4J8PA 1NYTA 2D59A 4B34A 2IZ5A 4HEQA 2HCTA 4HNSA 4CIWA 1X13A 3ROZA 5JAQA 4PO1A 1Y98A 2FSIA 3GEEA 1T6YA 3QE3A 1IZZA 4LISA 4TTQA 3SD7A 3U48A 3VXKA 2GM4A 2D7DA 4NV3A 1DCMA 4D43A 1GKUB 4EO7A 2N3ZA 2WTNA 3MQFA 1UWCA 2YS7A 3TGPA 3HZRA 3RFUA 1JPJA 1DEHA 3GFVA 2VTKA 3SDZA 1AC5A 2B3TA 2GCEA 3TX2A 5E9QA 5KVAA 5G2OA 2JLQA 2OQ2A 4QQNA 2J5KA 4K5QA 1PJ2A 3R3XA 4A8TA 2E4AA 4YV0A 1H6BA 4IIJA 2I1WA 3NHBA 4NBSA 2DKOA 2FNAA 4C05A 1JRLA 1K7EB 1K06A 4MA4A 4FVTA 4JQSA 4KLZA 1AH2A 3FCCA 1G7SA 1QQAA 1GTSA 3OT1A 1TEXA 1YZ3A 1Z13A 2WA1A 1FLDA 1IIBA 1OAAA 3KOUA 4CKWB 1FP4B 5CLGA 5G40A 5JZ9A 4XCQA 4RXUA 4ZYZA 4XFJA 3V55A 4BLSA 3HSKA 1Z6TA 2DUUA 2R4QA 2DFTA 2VBIA 2JEZA 3KFXA 1YC5A 2AQIA 4I55F 1ZOOA 3T0GA 3T3HA 2P6PA 4ALLA 5BMOA 5GZ1A 1NVUQ 2BI7A 3O8OA 3GLKA 3QPBA 3R9XA 1Y42X 2G09A 2QRKA 3V7NA 4CKBB 2KWIA 3NWPA 1D2MA 5JD4A 2PZAA 1CRWG 2ZS7A 5CM9C 4R8LA 1X8JA 2W4QA 2WAYA 4B3MB 3IHLA 4WUTA 2XUIA 1OJLA 1JSXA 2WVHA 3MBIA 4P2GA 5KYVA 4KLNA 4E13A 1TM2A 1JNXX 4H7EA 4MKRA 3SWWA 1E2BA 3IAS6 1R0RE 3QVOA 1JDBC 3U3KA 2M98A 4KTVE 3VC1A 2R85A 3W1WA 4CT0A 2XYGA 3HDJA 4OJTA 1Y9JA 1XVVA 1N7IA 2PWPA 1O5TA 3EPPA 3JVDA 1K6EA 4I55A 4Y2SA 5EFOA 5G1OA 4QQRA 5KVQA 5BN3A 3ZVLA 1M0EA 3ENVA 1W4LA 3HUEA 1PHPA 2XXAB 1F2TA 3OLVA 1FDIA 3PS9A 4GH5A 5IP5A 4JI2B 3W2EA 3SE0A 1QX4A 3U4QB 2YQ5A 3UVEA 1R1DA 4K3VA 4B7ZA 1FX0A 1IK6A 2H2DA 1XDGA 4JQOA 2IC5A 2YX1A 3PQDA 4CR7A 4MW1A 4NVRA 4QODA 3TOZA 2NSLA 2D7CA 2X4DA 1QIKA 3LTNC 1US8A 3F9IA 4KPUA 4ND1A 5BUCA 4PS1A 4GPZA 4M6WA 3ONVA 2R25B 4UEJA 3VX4A 9ATCA 4Q9DA 1XWIA 1RHMA 1ULSA 1Y5MA 1EBFA 1SG9A 4DLXA 4N41A 4RGVA 4XM1A 1XZMA 4S1WA 3L0DA 4KNVA 3THXA 4KTTE 1WVGA 1NLFA 2QP3A 5JSQA 3L7DA 4PWYA 5DM60 1IUPA 1JN0A 1NR1A 1OVGA 2OCKA 4WI1A 3RJ9A 3FM9A 1JEEA 1MB0A 1DIRA 3DF9A 4Y1GA 3WRWA 5LKAA 5J5VA 2XDYA 1X0VA 4BTVA 4PO9A 1QCZA 4IWYA 2RGCA 1QUEA 1LI7A 5TQVA 3NONA 4BVHA 4GYYA 2NU9B 1XNQB 3V42A 4PC7A 4RHUA 3WYEA 2BFDB 3D7KA 2GAFA 5A06A 1OI2A 3ADBA 2FQWA 2GCNA 3LXXA 3IT2A 4J0GA 4JQYA 1CY0A 2FPPA 5J4KA 2WAXA 5L3VA 1K3TA 1KAOA 2WMDA 1Z26A 1QGDA 3L7JA 2B4TO 4TTTS 1DO2A 2W2VA 3QF4A 2PKCA 1UQTA 5BV0A 1XTPA 3G2HA 5IS2A 3T3GA 1QLWA 1QP7A 3RVPA 2ZIXB 1R6VA 2GAJA 2HM7A 3AP1A 1IOVA 2CXUA 2EJTA 2ZU0C 3B1ZA 3C8ZA 3KEOA 1PR2A 2R5FA 3BSFA 4R7ZA 1B8VA 1OTHA 4HNAA 5JXHA 1XZBA 1DKMA 2QTGA 2XVZA 3OFJA 1BO6A 3L8ZA 4RF4A 4AF8A 5K05A 4IS3A 4A9AA 3ZLVA 2V1UA 1NIPA 4UD2A 1ZUNB 2PRYA 3B78A 2A58A 4QECA 1L4KA 4JJEA 3FCUB 4C6TB 3ZJUA 1JHZA 3T5TA 3QFHA 4X7MA 2QSYA 1MN6A 3CE6A 1ZD9A 2OWDA 2IP2A 1QH1A 2BGTA 2EERA 2EFYA 3NWEA 1TCUA 1V8DA 2IE8A 4GOOD 4JEIA 4Q82A 4G0NA 3ZZ1A 3FTDA 1E1CA 1RWWA 1YFZA 1UMCB 4GX1A 3OO1A 2HF7A 4HLUC 4UFOA 4ZJZA 5JSKA 3WAGA 3FRHA 3Q7PA 3SIPA 3ZXXA 2AXNA 2MU1A 1I7NA 2JS7A 5A04A 4FT4A 1K88A 2AS0A 3RYCA 1GPYA 1SQSA 1KYVA 2CVQA 1N92A 1NJFA 3AFGA 3P2JA 5CK4A 4BECA 1M34A 3NHRA 1N2OA 1ABBA 3AGQA 2PKWA 5JHHB 4X91A 4UEKA 1UJ4A 3N6XA 5FV4A 1XNHA 1NKVA 2LDXA 4Z9FA 4TZKA 4B6FA 1BDBA 1YDWA 4Z86A 3D7MA 4KQEA 3DNMA 2NOAA 1RBZA 1EEXB 2WMNB 1EWVA 1PJLA 3IQIX 2XBLA 2YOHA 1OY1A 1BW9A 4YJ3A 4LOKA 3OQMA 4IFBA 3EXIA 4L4ZA 3BL6A 1S2IA 1NURA 2IHKA 3O21A 4MTCA 1FU4A 2HIAA 5CT5A 3RI3A 4CM4A 1FFSA 3D8UA 4TV9F 4QWWA 3AHDA 3FZGA 3ZW9A 2I22A 9MHTA 5ALKA 1XALA 3LP5A 4GQBA 1P9RA 4TM8A 3QVKA 5BUSA 3BJIC 2P41A 4EUNA 4FPXA 5IBPA 2I4MA 2ZUFA 2Y1FA 1Y34E 2ZROA 4MP8A 1ENOA 3K09A 2YVKA 1JJBA 3HI4A 4I9NA 5DGIA 3GF4A 2Z6AA 1XXHE 5AW2A 4ZN6A 4QUDA 1OXKB 4FNOA 4JGGA 3PJFA 3BJEA 5JFTA 1JB1A 3G49A 1JE1A 2J9RA 1A4XA 1O97C 3GN1A 1R74A 5ARDA 4NZOA 3TFWA 3L7AA 4HRXA 4B80A 1CF4A 2Y9MB 4C07A 4OGWA 4ZYUA 5DSXA 2QAGC 4XPZA 2GRJA 1EHCA 3PC2A 4MO2A 4RDCA 3SBXA 1P0MA 2AR9A 1BS1A 2QG4A 1Q92A 4N0EA 3PU6A 2PEZA 4JBHA 4DY6A 1KOGA 2QLNA 1NRIA 1W5SA 2OVBA 4RPGA 3RS8A 4Q15A 2JFOA 1ZSYA 3N6RA 3G13A 1O6ZA 3MN1A 2B36A 2FSGA 1GQFA 1FFXB 3PX2A 3TBHA 1WXDA 1PN3A 4RD1A 3SCZA 1VIVA 2IF0A 1AKUA 5F2OA 4FLEA 1YZNA 1SCKA 1Z75A 2GZAA 3MAAC 1N1EA 1P4GA 4TZTA 3U3XA 2Q7OE 5IJ9B 2BT4A 2FDXA 3S3TA 2Z5GA 1NVEA 1F3LA 2C2WA 2ECKA 3QE2A 2PGAA 3QXJA 5KYYA 2XPCA 2TRSB 4E5UA 1EFAA 4EUEA 3RSLA 3LCCA 4MUGA 4MHOA 3UXHA 3BD7A 2XZTA 4Q3NA 5KQPA 4Q00A 3H5RA 5TMEA 5CFZA 2P0AA 1EVYA 1KDRA 3L7KA 2V7GA 1XKLA 3M1IA 4HO1X 3RFVA 5CEFA 4C3OB 4XEHA 4A3SA 1KVTA 1TCBA 4FFBB 2E85A 2VDUE 3AEZA 3BRSA 4JL8A 4LCBA 1FVHA 2WG0A 421PA 3KPVA 3ZY3A 1H2FA 3EW9A 4Y9SA 3RVBA 3W2HA 6CHYA 3V4SA 3P9IA 1E3EA 2CZCA 4OQEA 2QD5A 2GWHA 3FWNA 3AGPA 4KMMA 4XOUA 3UGKA 4A8PA 4WT7A 1DUVG 3QPDA 1UC5B 4IUCS 3UPTA 4K1LA 1HQKA 2PUAA 5DHQA 3SQLA 1PW7A 1JG4A 3WP1B 2IH4A 2C59A 3L4SO 3KVOA 4X6XA 5DGXA 3OMWA 2BCEA 3ZH2A 3FLEA 3VNVA 1PJ4A 3DBHB 4L6IA 3G5UA 3SJUA 1EIZA 3FPFA 3MCZA 2AN9A 4K88A 4PF1A 3SMQA 1V16B 4MV3A 5A9RA 5FX2A 2ZI6A 1SELA 3EEOA 1EVEA 4L0QA 3K72B 2YN2A 5CT9A 3A0UA 3F8TA 2VP0A 5CJ2A 1GUBA 4QC2A 4P2BA 4BQPA 2OXTA 1U0HC 4MV9A 1SG0A 3UAWA 3T0IA 2XQVA 4PNEA 3GLFA 1FP4A 3WHIA 3M0EA 2FPSA 1AUXA 3URKA 2GJ8A 4YWHA 2V97A 1OGYA 2RE8A 4RFVA 2ZYIA 5ANRB 1VG8A 2SCUB 3ZGVA 4QTZA 3B3GA 4GFDA 2IV7A 3TI9A 3V4RA 3MLBA 1P4JA 3SHOA 4WOPA 1E4OA 2HSDA 3WGIA 4FI3F 2AH5A 2WK1A 4C2BA 4Z51A 3CSDA 1ANKA 1T5OA 3ER6A 4YX9A 1R18A 1QONA 2ZRAA 5CNIA 1K6IA 1R4AA 4LCJA 4PLCA 4RZIA 1KVUA 2MSLA 3KPWA 4GOLD 3ZCXA 4YI3A 4NR0A 5SZIA 4GI1A 4WKNA 2QN2A 5EN4A 4UAJA 3M4JA 4G5RA 3VKGA 3L0IB 1A1SA 4J94A 4MLDA 4ZO8A 3NPMA 3ZI4A 1TTTA 1G8HA 1DJLA 5CFPA 1LY1A 2EV9A 1VFPA 2RK3A 2V0NA 2BEUB 3MERA 3LL7A 4KRYA 1W0CA 4RHEA 4AS3A 4IFEA 3ZY5A 2FEKA 4PIVA 1F0NA 1QNLA 3A26A 3SC2A 4EHHA 4CEIB 2W90A 1L8XA 1P75A 1SURA 3GBVA 3KE8A 1TJYA 4EVSA 5KTTA 1PVOA 3HGTA 2EFHB 1EWYA 5FV7A 5GWXA 4EA9A 2X77A 1Z0JA 2XXAA 1NZDA 2AYZA 2BBTA 4P53A 1OPRA 3VC7A 3DO6A 4YMSA 2YMMA 5DNAA 1PLKA 2YFKA 1HWYA 1E2MA 1NP7A 1CJVC 1Y7TA 3E9CA 4R1OA 2JCXA 1B6RA 1W59A 1OYVA 3M1LA 2VXYA 2G3YA 4RZ3A 5CXXA 3U1VA 5MN6A 3O93A 3KSMA 3R24A 3IE1A 3EOAI 1QVWA 4JI4B 1DIOB 1XZAA 2JHAA 4D9NA 5F12A 3EVNA 3NT2A 4J6FA 4A16A 1NX9A 1MZVA 3WL4A 2BKVA 2X6RA 4R0MA 4HFNA 4YCCA 1KKMA 3JW8A 1GYQA 4HLCA 4XUDA 5K45A 1P0FA 3G9XA 2Y0BA 4TT3A 1VPEA 4AMZA 1KH2A 4DZZA 4PSCA 3SR4A 1XN4A 5FOUA 3Q88A 2A5LA 5AW3A 3Q15C 1RIIA 3Q11A 4UNRA 2QRZA 3M1AA 2ANCA 1Y7HA 2I4RA 4J2OA 4RBNA 1CQJB 1V2GA 2JAUA 3KTFA 2CL0X 1HFJA 4YAFA 1XTUA 1NWHA 2NU9A 4DIUA 5HIKA 4KDRA 4TWZA 3O8QB 2VDOB 5DBOA 4YDHB 3WLPA 4TQAA 3X2EA 3ZCPA 3KKZA 4KCGA 1N6IA 4HYQA 3H6KA 1PF7E 3QFRA 4LNAA 2CSXA 4BNNA 1DB3A 1JIVA 2QW0X 3QSGA 3IBGA 2PT7A 2NVUA 1D0IA 1DQPA 3FPSA 2QS9A 1GJRA 2WHQA 4TSRA 4HXFB 3GOHA 1S2GA 3V9PA 4I4IA 3TRJA 4OSEA 3M89A 2F3TA 3G8BA 3I8OA 4B7CA 3DW1X 3FDXA 4LYYA 1EFRD 2DPMA 1USGA 3RT7A 1KRHA 1X39A 3DWIA 1YCFA 2FCRA 4UARA 4BMSA 5A0VA 3CINA 2PSSA 2FZLA 3GP5A 2VQ6A 4KN8A 1XLUA 1P18A 1BHJA 2K6GA 2QU8A 4MKZA 5K01A 1II8B 4PYIA 4B3FX 2GVNA 1NOKA 3OFND 3R0JA 5IC5A 3HA3A 2A78A 2CWWA 4Q6BA 5CFMA 5FI0B 3T61A 4MVJM 2D5CA 1ZKMA 4K6KA 3D6NB 5CIQA 3AHEA 3PHBE 2QMHA 1FE8A 2R751 3C8DA 1GRNA 4RD6A 2RHWA 1QGED 1UMCA 4CL0A 2GBIA 2LTAA 5ECYA 1SKYE 1Y5RA 2J0EA 3HYRA 3O94A 4MLCA 3H3FA 3NBXX 4TM7A 5TPZA 3I4CA 4IEFB 3VV3A 4KRFA 2ACVA 3B1XA 5ENZA 1LX7A 2CXXA 2WINI 4JBWA 1J0AA 1IY0A 3NIBA 3VHQA 1UPCA 2DXIA 1OFVA 2FEWB 2O2CA 3TRIA 1MMFB 3ZQJA 5H82A 4YT8A 3PRHA 1LDYA 2ZB3A 1WTCA 1N2EA 3PJEA 3ZGZA 1IQUA 1O95C 3WWOA 1JT9A 3K9BA 4FCVA 3RVQA 1ZITA 4GC9A 1ZK0A 4GE0A 5U9CA 1GRCA 1HG1A 4E30A 2YJ6A 3PGMA 2HV8A 3T3IA 1OKKA 5C4IA 3LG2A 3WDLA 4NLLA 3W1EA 4AO8A 1NOIA 3PIDA 3QVTA 3VZQA 4EPTA 3T1TA 4JL5A 4RUKA 4B6RA 3BMCB 2WD8A 4EEKA 1JJVA 3TSOA 5HF5A 4A8JA 2RI6A 5DBGA 1GIAA 2FJUA 2Y1CA 1I3CA 1WZEA 2H1IA 3PGXA 5DCYA 5J9FA 4ZMRA 4RMHA 1BCSB 2X13A 3FZEA 1TUEA 1FOEB 4O4IF 4AY3A 1Z8NA 2XBMA 4D42A 2J09A 4E3WA 2X4LA 3F71A 5JV5A 2Z30A 4URYR 4PONA 3V1UA 4S12A 4V38A 5JHGB 5KWVA 5DWDA 4M8LA 4GMKA 4JIGA 4EB0A 1SUIA 5FNVA 4NS1A 1QX3A 5E1DA 3DNPA 3JVUA 4XB1A 3VU1A 1IY8A 5BN1A 5IT4A 2ZUSA 3ZDDA 3ST7A 3KQSA 1KEVA 1T6NA 3L0OA 3KWLA 1DAMA 2H2IA 2O7RA 4DSNA 1Y7LA 4MOWA 3IBCA 3THWB 2H1OA 3DA8A 3ASUA 4YRIA 1HDZA 2GPSA 1NMQA 1H9AA 1NUPA 3ORHA 4FOOA 4QGGA 3V7WA 4NEHB 5AW0A 1RXUA 5BMVB 3G5MA 5JQGA 1P1CA 4KXWA 1NX6A 1U7DA 1S96A 1WB4A 4KSYA 4CKCB 3IELA 4DFDA 5JCOC 2QY9A 3DTVD 1E64A 4EK9A 4NG4A 5JNSA 2YJGA 2VZEA 5CDYA 3S28A 1JB9A 4HV4A 5JRDS 2Q3CA 4M99A 2WM8A 2ZFUA 4KMSA 4R40A 1YS2X 3AP3A 4KQ1A 5ALWA 5CDFE 1K7CA 1PL0A 5KVCA 2RCYA 4MICA 5IJ9A 5JYCA 4PAWA 5JATA 4GS5A 1E1NA 1Y4DE 2P2LA 5KI6A 2OO3A 3E61A 2G9UA 5YASA 1CUCA 3KVVA 5FBRB 3M6FA 2YJNA 3OC6A 2MSKA 1EWKA 2BGRA 3L18A 1YK0A 2JEYA 2QVCA 5DNUA 1KZGB 2JLWA 4EB6A 1KYYA 1DX4A 3LYAA 3N2KB 3CUEF 3MTDA 2AD1A 3W6UA 1D1TA 1YQEA 3LUJA 4EW3A 1KY3A 1E2NA 2JDIA 3GK3A 1PR9A 4ZVPA 1OBHA 3LHSA 4RS4A 4C0JA 1I10A 3P96A 2J7PA 5JW6A 2YIVX 4BU1A 1VCHA 2RFLA 1KARA 4G1MB 4DG9A 1JDVA 1ISJA 2GEBA 3EGDB 1XPUA 2O3JA 4FFBA 1EQ2A 1UFOA 1V26A 4D80A 2B0JA 4WBNB 2BMEA 3NHJA 3KPUA 3L1KA 1RXCA 2ZE5A 3CUKA 1I0ZA 3PUHA 4NTZA 4CLXA 2XT9A 2E37A 1GAXA 1U7XA 3REFA 2AJDA 1ZIOA 3OEWA 2O57A 1T9CA 5BYBA 2XCRB 8OHMA 1E9EA 4G0VA 1Z0UA 2WT9A 4HG2A 1KHHA 1ZGZA 4MVJA 1U98A 4EWLA 3NW9A 5B1IA 1UDWA 3GLHB 4GKBA 3HSYA 3DBHA 3LUAA 3IP8A 4OTZA 1RXWA 4MZXA 4AWBA 1V16A 1YB1A 3MOSA 4LG1A 5HQTA 1LU9A 3JZAA 4QPPA 4Y2QA 1QHXA 1I4EB 2VF7A 3A1TA 3Q3GE 2R97A 5AJZA 3WGJA 3ROMA 5HTKA 4DM3A 5JJ5A 1OFUA 2RHDA 3SNKA 3IUNA 3TEFA 3FB1A 1M67A 4UQOA 2FOLA 1CY8A 3IAAA 5IG2A 2G88A 3GRUA 4YYEA 3L3BA 2FMFA 2EX4A 1E32A 1A7AA 1BOOA 3OESA 4DILA 2ODEA 2SCUA 3PC8C 1SH7A 2GJSA 2YXNA 1P2BA 3K71B 3QX3A 3JV7A 4B3IA 2K7ZA 2JI7A 4DNQA 4EAAA 4I6EA 2P9YA 2XJ4A 2ZXEA 3SHVA 3KOZA 1A2BA 1FJGB 3JYOA 4XR9A 5HS6A 2BZSA 3JR7A 1BMFA 2J67A 1XZFA 4EYKA 2V6BA 4EAQA 2W83A 2J0UA 2PKRA 3K35A 3MUFA 3LVFO 2DM6A 2AC2A 2CY0A 2EC5A 3FNGA 2VN8A 3K30A 3KLBA 5CDGA 5EJ7A 3THYB 4FK8A 4C88A 5FOWA 3V2GA 1N0VC 4OQZA 1YL6A 1Y1TA 5L3SB 5TC4A 2Q6VA 3B70A 4PCUA 3QVVA 4FN4A 4IJ6A 4BE7B 5EFZA 4R1UA 3TPFA 3LQ4A 1NPTO 4HATA 5AVKA 3UY4A 5CCEA 2GXSA 3T7KA 1D5CA 4DCSA 3OMLA 2VPXA 3B1WA 3QFCA 4KV9A 3VC3A 1QG6A 5BV7A 3HCOA 4Q4JB 2OORA 4QRIA 3QKSA 3TTTA 4BMPB 4UFPA 4MMXB 2LIPA 4X1YB 3EIEA 2CL7X 4LXQA 5BVHB 4DR3B 5DCUA 1I6MA 1AUQA 1N5JA 2A5FA 2CXNA 2NX2A 3KOWA 4Q9HA 1VM6A 4TWRA 1JL3A 3RJZA 1L5LA 4J49A 5CB0A 4E5VA 2FMUA 1H2XA 4UEQA 1B1CA 4MUIA 1GAEO 2E55A 2IDMA 4ZU1X 4Y6GB 3S2GA 4AYXA 2EG9A 3FI9A 4G1BA 4JEUA 4K9MA 4F4FA 5FTLA 5FPHA 1KI2A 3IPLA 4BFXA 2WP8J 4C2AA 3PK0A 2VTDA 4DA6A 3QITA 3AFOA 2PWZA 4ZTZB 2NUBA 2ERCA 1TVEA 2K2WA 3AI7A 3FKQA 3GWGA 2PJRA 3IO3A 3UK1A 3WLOA 3VR5D 1I2DA 4RC9A 4KWEA 3VR6A 1Z45A 3P2IA 2WV7A 4JVLA 1JILA 2WLTA 3HC7A 1ECPA 5IBQA 5AKEA 1RLUA 1JZTA 2H16A 1UJ2A 5DNEA 5EYPB 1GZVA 2B94A 4A10A 1XNRB 1CQJA 3DLAA 2GNAA 1MOSA 1FFAA 3MINA 3TDKA 4CIDA 4IHKA 1TFUA 3T9DA 2FMHA 4TVKA 1SUWA 4BBJA 2BFBB 2NWQA 2HXSA 2DLCX 5DKFA 2EJWA 1YDFA 3H3XA 2VP5A 1EK0A 4WH0A 4E07A 3PJGA 4P32A 1KK2A 3IVRA 4PHCA 1Z4MA 5I4CA 5JCPA 2QZZA 1JLSA 4DABA 4TLAA 3OKFA 1YQTA 2QT1A 3GJRA 5IW8A 1C41A 4G84A 1OT5A 3ETEA 2JLBA 2IPXA 3PQ3A 3ZCSA 2PLAA 4PHTA 3RUCA 4CLRB 1ZUWA 2I1LA 2SKEA 4EOGA 4CF3A 2BTEA 2X9LA 4PR3A 2YHIB 2FW0A 3A9VA 4LJSA 1YB4A 1Q0PA 4KUHA 4PGMA 4N6NA 4OA5A 4YONB 3ZYCA 4ZYYA 1M75A 5HGXA 3TZQA 1YU9A 3WISA 3WMRA 2QSJA 4YI5A 1PV2A 4H6WA 4Y2YA 2GPNA 4LGCA 1M5TA 4B6SA 1XZQA 3ESRA 1TAHA 2AOWA 4PX5A 1N5IA 4BNFA 4XRGA 4XEUA 1XP5A 5BQXA 4NG5A 5DHUA 4F4HA 3A4IA 4Q1CA 1T3TA 4DMMA 1H3EA 3AZOA 4MUKA 4OM8A 1PX0A 3WC4A 1XL1A 1V6SA 3LUGA 3QGMA 3H8WA 4U2EA 2I29A 4X9XA 2Z1DA 4TXMA 1DEOA 5I8WA 1YOBA 3V4LA 1IMJA 3KWJA 1QJCA 3FFXA 5KX5A 2VTBB 2CUNA 2EX0A 4QKQA 5JMWA 3F49S 4NCIA 3F3SA 3W5JA 4RENA 4ZEXA 1QZXA 1SG6A 1RJWA 5TB5A 4CTJA 1P3DA 4NBRA 4FW8A 1A69A 1GA6A 1NQOA 1PYDA 3O0DA 4CQMD 2XKKA 1N0HA 1CEYA 1EYZA 3LHDA 2I7CA 1O4WA 1QOQB 1J24A 4ITRC 3W0LB 4LXGA 4B8WA 2ZI4A 4BIIA 4V1CI 2H29A 1QBKC 2I65A 1EDBA 3D5EA 4OHBA 4QO8A 3G0OA 1COZA 1GPH1 4OMCA 1E5VA 1N7HA 2BHNA 3S99A 2YV1A 3BMCA 5K0LA 2WMOB 4X45A 1QZUA 2D4AA 5LXTB 3Q7RA 1WB5A 1ZIPA 2AE2A 5EJMA 5LMCA 1E61A 3U7FB 1V7QA 4KVAA 1QIMA 3AU9A 1TJPB 1SVOA 3OQ1A 1P9NA 2HUNA 2IIPA 2XUQA 3F5QA 2EFJA 4UM8B 3SEQA 4AJHA 2AJTA 3KVNA 1E8MA 2JAQA 3EA5A 4P1ZA 3T99A 3ZCQA 2VAVA 3K32A 4N0PA 2OGTA 2JAHA 3F5MA 3T5AA 1OXXK 2HMUA 2P78A 1TVCA 2YQZA 1G1MA 2F9FA 1NJ8A 1PJAA 4PVDA 2KBEA 3EW7A 2QW8A 4ZXFA 1WWKA 3A70A 3PKJA 4OYHA 1ZSNA 4INPA 1VFNA 2OV3A 3JARA 4YJKA 1TZ2A 1DBIA 4AICA 3I6MA 4G9EA 3MWEB 1JR6A 2O1EA 3G2KA 3Q1LA 3STHA 3VKVA 2UYGA 1HYBA 2Z56A 4FHZA 2XX3A 4TRNA 3DTVB 3QTLA 2D3WA 5ADWA 4LHSA 2IPOA 1DWPA 1UJCA 1VPVA 2Y99A 2ZJAA 3PDIA 5K0EA 5BMVA 3RSOA 1U6KA 2D1YA 4IHAA 1AKVA 3TFQA 4CKCA 1KJZA 5KYKA 1MGPA 5D3MB 1FS4A 2ZB8A 4G8BA 1HR0B 1V1MB 3GT4A 1WKVA 3SX0A 4ZCTA 5FD8A 3C4QA 1DC8A 1JVBA 3I1IA 4TLMB 2F9LA 3CUWA 5L40A 1HNZB 2VNIA 1TYCA 3M6VA 1U0RA 1OVMA 2P9CA 3HNOA 4WBNF 3FVQA 3SYKA 1EM6A 4O2BB 3TEJA 3Q8MA 4Y18A 2WQ6A 3THOA 2RH9B 4A5OA 1O5IA 4AO7A 3SPXA 1QFYA 1ZMXA 3AUUA 4DV5B 3QYPA 4OU5A 4W6QA 1GWNA 3CEJA 3UMJA 2CFIA 4RLHA 3PFIA 2EKDA 1QFSA 4DIOA 1GLNA 1YRLA 2ZTVA 3HXQA 3VJMA 3O38A 2REBA 2UZ0A 1G6HA 3GVPA 4KFTA 1KXZA 3TSWA 3WXBA 3TVTA 4CM9A 4XVUA 5KTMA 1DDIA 2GUGA 4QXRA 4S24A 2Q4TA 5E7MA 3A6JA 1H85A 1K6JA 3R6DA 3JATB 4BQQA 1FQJA 4D97A 3VH3A 1L5FA 1NVWQ 3Q2IA 3RGWS 4YTEA 2ZR0A 3Q3EA 2WC1A 5E3HA 3C3AA 1FTQA 3IULA 2X7XA 3MTAA 4DC9A 1W9MA 3UWKA 3LZDA 1O94A 1UXGA 3EYWA 3P9NA 4DUYB 2FK8A 1U31A 2H06A 2R8ZA 3C6YA 3MPOA 4HRYA 1XRSB 2KLHA 1U90A 2X3FA 1N75A 2Z5LA 3LWNA 4I1IA 1VJ1A 3KD2A 1N77A 4R01A 4NCHA 1E3WB 3AWIA 2ZYTX 2XMCA 4R1QA 2NZ2A 4NJEB 4TGLA 2PMDA 4PSKA 5T3UA 2HZ7A 4JP8A 2C3UA 4FYPA 2AKEA 1GGEA 4NATA 4NRDA 4LDPA 3KWMA 3TH5A 2QF7A 1G2OA 1VLVA 4KE8A 2Z8ZA 2IUEA 1H5NA 1XHEA 1NBAA 2Q6KA 1ZM7A 2CN1A 2APJA 2C61A 2F62A 1ZUHA 2P9TA 2XMPA 4A4DA 2IRWA 5G1PA 4P4SA 3IOYA 4Y0NA 5DJ5A 4ZAWA 3A9TA 5JDCA 4PYJA 3KLMX 4Z1MD 1T5IA 3H1PA 5I7RA 3LW8A 3SXUB 1MCZA 3TB6A 2O59A 4XYEA 3VQTA 3SS8A 1R0WA 2EZ8A 8ATCA 2JFWA 2X76A 1VBNA 4EB8A 1H94A 1U2SA 5LLSA 4N48A 2CNLA 2H17A 2YUTA 3GGCA 4GR5A 3BIJA 3OUTA 5D5HA 2F90A 5LLDA 1GXSA 4DLPA 1JIIA 4B3HA 4OMDA 1JHYA 1WEKA 5AKZA 4QGBA 3RRXA 1A9XB 2VJYA 2AXPA 2O8NA 4YRNA 1Z8HA 5DBHX 1ZA1A 4E4TA 1KS9A 2HMWA 1GFZA 4DV7B 3THYA 2OE2A 3DJYA 4FKZA 3ZV4A 4G5XA 4AAYA 5L3SA 2X8BA 4ZGGA 4A92A 3MGAA 1YR7A 4UHEA 1FDRA 1Q1NA 2HREA 1TZMA 1NOJA 3MTBA 1A8UA 3C3XA 3QG5A 3H9GA 2BBWA 5BYAA 5IF3A 1KIAA 1DC7A 1EUZA 3B13B 4QEKA 2NQTA 1GSAA 1ZW6A 2XDAA 2F43B 4FD2A 1W2HA 3W79A 3IE2A 2D5AA 4H3SA 2R8RA 3D2AA 3CLUD 3GRZA 3BRWD 3N2LA 4J4HA 4X1YA 3EEBA 3RBXA 3H9UA 3DF7A 5BVHA 3BKWA 1T6XA 2V7PA 1XDSA 1WW2A 2Q5JA 4JLNA 2ES4A 2NAPA 5G0VA 3QUCA 5T4FA 5DU2A 5IABA 2QM3A 2P40A 4OG2A 4F5EA 3RBVA 3ENNA 4H6PA 1VRCA 1M1YB 4EY5A 4XQ9A 4KODA 4TTIA 4OOFA 4KMOA 1DAIA 1U0GA 4TKZA 5EZ6B 1BOFA 2AFHE 4BC1A 1KWGA 1V1JA 1XI2A 2GGSA 3NGXA 3LQYA 4B40A 2H1VA 2WKRA 4H1VA 4DIFA 1TCCA 4TN5A 1KAHA 2I4OA 3ZD6A 1YJ8A 1CY4A 4RIHA 1PS8A 4IIUA 4WY2A 4FHFA 3QBJA 2UUBB 3HS3A 2FN8A 2QTRA 3BWDD 1SUDA 1M74A 2FZCA 4DOMA 1PSZA 1ZWLA 3QOFA 4HCJA 1WMEA 4LZZA 5CLIA 1V5GA 5EYPA 5GOZA 3DZDA 3LBYA 4PC2A 4A2PA 2Q1UA 5E95A 1Y8AA 5IJXA 5KNBA 2WJ3A 3QLUC 2XRMA 1II9A 2GM9A 1YHNA 3L4BC 2BFBA 2C9YA 3H4MA 2UXDB 3NYRA 4FS8A 1ESNA 4DCGA 3L8HA 1C1DA 1J1ZA 2O5CA 3V8MA 5D6OA 1IXKA 3AO0B 1CP2A 2LDBA 2UUAB 1OPXA 3FDIA 5I9SA 2R6GA 3EHDA 5AHOA 1Z6GA 2GH1A 4JGIA 3T34A 3G6WA 3LBNA 1LBEA 2XE4A 4NU0A 4U2BA 3OQPA 2X0EA 1AK1A 2GHRA 1KWKA 1G8JA 3UB4A 1WHTA 3C85A 1QH9A 2VNHA 1UP4A 3E5MA 1XC7A 2XB4A 1AKMA 4AKHA 2WR8A 1S0UA 4RK0A 5SZJA 5ARCA 2FEAA 1JYFA 2YHIA 1TQHA 4AUEA 3NPAA 4NULA 1G8MA 1VYHA 1RC1A 2D1FA 1P81A 2NYUA 3OAAA 4Q1FA 4RNDB 4ARBA 5K8VA 3WQQA 2Y1KA 1FXWF 1I51A 3LPAA 4AKEA 4BX0A 3I0ZA 2CDRA 1OZ0A 2WNSA 1RKUA 2I7TA 4LJ7A 2QVXX 3SOZA 1MLDA 1SPXA 4MRVA 4TMWA 1SZCA 1T34A 5JSFA 3JQEA 5KWJA 2Z95A 3GU3A 2BR4A 4AG5A 4AX4A 2RGWA 2A4KA 4CF6A 1L8LA 2OFXA 4NYMR 4LECA 4RVGA 1X70A 1E2KA 2IXEA 3H42B 1KR5A 3CF0A 3H8SA 2CHEA 1WRBA 2FEPA 4GWKA 2ZBRA 1XMIA 1Q91A 3AR3A 5FBQB 2XODA 1W35A 3BH0A 3NTQA 4CQMB 3OCWA 4G9BA 3E4DA 5MGNA 1TK9A 2JAXA 2QQ0A 1HLGA 1XKXA 2OZVA 4BMNA 2HK9A 3HH8A 3FOWA 1CJBA 2DCUA 4MV0A 3N0WA 3R8XA 1NF8A 3UT5B 3UAGA 2JI9A 3D4PA 1W94A 1C7EA 2ZJOA 2AE1A 3DP9A 3ZVNA 1CIJA 5LJIA 4I1RA 2C2YA 3EF0A 1PJBA 3PHGA 2VH5R 3UWPA 5BR1A 4KIFA 1SPBS 1VYVA 4CN8A 2QUKA 1CQIA 1BDMA 2JZCA 3N2ZB 3F8WA 1I3KA 2BTQA 2WSYB 4BKRA 1QH8A 2D0PB 1EK5A 1UKAA 2H9IA 3HRIA 3NBYC 4X7PA 3ULKA 2KM1A 5LXTA 1KDPA 2F3UA 4C6SA 4G0QA 1NZJA 1ZONA 3BHIA 3FLAA 1PDVA 1K2VN 1L1FA 4IM7A 5I48A 5L3QB 2V6FA 2P9JA 2A9RA 4JI6B 3NEAA 4ETWA 1N9ZA 4CMKA 2H4WA 3NEPX 1A5TA 1V3VA 3I39X 3K16A 2WWVD 1BRMA 4PSUA 2PUBA 4UM9B 2Q9UA 2JGLA 3G2PA 1E9DA 4PRZA 3SMVA 4LZJA 1QP8A 3EE6A 1DC4A 2AF4C 1QMGA 4RYLA 1H5UA 2WJIA 4X8OA 2OV6A 1SCQA 4HADA 2OCYC 3WGQA 1NDQA 1C29B 4P4NA 1DKOA 2Z2YA 1U8YA 4KRGA 5LQJA 3I9NA 1VE3A 1KMCA 2AI1A 3PE6A 3BL8A 4H7JA 3S27A 4O2BF 1NVTA 2BFEB 2JGEA 2ILVA 2X0NA 1ZL2A 3IH5A 3RG8A 3MWEA 3ESBA 4TUYB 1EJ2A 1KAMA 4WERA 4ASUA 4Y2UA 4LQCA 5EMHA 3WQBA 4Q7MB 1EAMA 2ZCJA 5B4TA 2VDJA 3PXAA 2YYAA 4DB4A 3UAYA 1E2HA 1QG2A 1WX1A 1AKTA 4OKNA 5CVCA 2VRCD 1NRXA 4DQLA 2W6JA 3CKKA 3SM3A 4G5QA 2Y1EA 3H1TA 4A0GA 1TKCA 1PEKE 1ULAA 4ACBA 3C7CB 4F2PA 4F3NA 1R9JA 3PWTA 4HF7A 1EFKA 1V1MA 1D0VA 1CF2O 1EBUA 2I55A 2OG2A 1UZLA 3EAGA 4FN5A 2FN9A 4F5YA 1V96A 3BJRA 3I92A 4PLYA 1W96A 1G41A 5E9AA 4PLTA 4B5LA 3RJTA 4KZKA 4NOMA 1IBCA 3B6IA 4YRRA 5FA8A 1U2PA 4NC9A 1B43A 4LY9A 4DXAA 3AL2A 1SXQA 3EUAA 3MBKA 2ZRKA 1YRHA 3KFLA 3HY4A 2AB0A 4FTWA 4G23A 3HCNA 4REOA 2X8WA 5ULLA 3U49A 1G55A 1ZNXA 1C9YA 2EKZA 3KRTA 4MQFB 4NOKA 3PDUA 4JOCA 1AX9A 2RH8A 2BMDA 2JFBA 3E3MA 4PPFA 2Y68A 4JI3B 3IXQA 1EXDA 4C7OB 5EKSA 4CN9A 4KU4A 5ES3A 1Z4KA 3CONA 4JXKA 3GPIA 2JVIA 4OQPA 1Q12A 5ADUS 2BZGA 3HV2A 4LNUB 3X43A 2IV3A 3A28A 3JATA 3NU1A 2WJYA 3CRZA 2QG9A 4IIEA 5HCIA 2FGKA 4G9GA 4P34A 4YJFB 4EB3A 4AQDA 1E69A 5AD1A 1UEJA 3K70C 2ENUA 2P4QA 5FPTA 4TLCA 1DS6A 2CVOA 4ED9A 2RBKA 1OF1A 3AKDA 3M8KA 2Y4NA 4ZCSA 3E7DA 1RZVA 3HQ4O 4OBBA 4B31A 1QC5A 4G8CA 5HILA 3ICVA 3VR3D 3ZI7A 2OZLB 3KELA 5K4HA 3ZHZA 3J80A 4XD2A 4KHPB 3H2BA 1P7CA 4DLZA 1QMPA 2IYQA 3IQXA 3OZAA 1AXRA 4FDVA 1TMYA 4Q7KA 4UNSA 4F6RA 5LU9A 4CG1A 2WYOA 1YC2A 3EQZA 4FOTA 1L4YA 2GBLC 2Z58A 3N5KA 3FTNA 4UCQA 5EHNA 2OXIA 1EIWA 4Z7NB 3K8QA 5F73A 1RRVA 2IYSA 3CUTA 3OWOA 4KUGA 1ES9A 4GUAA 4CR6A 3GG9A 3OVMA 5ILQA 5JWHA 3VR4A 5AT1A 2BKLA 1S7GA 2IEGA 3KZNA 1EK6A 4L0DA 3H5WA 4JLMA 1FRZA 4PLVA 3UFXB 2ZKLA 2QVBA 4L78A 3LGAA 2H4JA 5EP2A 2Z1NA 1VYUA 2GNPA 1D2EA 4KR0A 1DAGA 4EP1A 4H15A 4KEAA 1U5BB 1S3FA 2A4MA 2OTCA 3KK0A 3M6UA 4OHXA 3TB4A 3ZK7A 3BULA 2O8FB 4I9GA 1ACJA 3N6VA 2E49A 1K75A 2AEMA 3X1ZA 4RANA 1GQSA 2CXOA 2YIDA 1Z7GA 3Q72A 4U6QA 2BEKA 3UNXA 1K3UB 2H2HA 1N8NA 3L4EA 1C0KA 4AKSA 5EQFA 1GRVA 2J9GA 3A4YA 1CRQA 1I0LA 2WUEA 4KDCA 3N07A 3A2LA 4LJKA 5A4FS 2O2YA 1KFEB 1N3BA 4EY6A 4GOKA 4KQFA 3VNBA 1RPTA 3QOXA 4HOYA 1F2UB 4KGZA 5IM4F 3QOWA 2JK1A 3UKJA 1FQWA 1P5ZB 2A5YB 3DQZA 2DH5A 2ZE7A 5GGYA 1NN1A 3G8YA 4GWLA 3VKWA 4BRWA 1H5QA 1J90A 3NTOA 4LSGA 4UPEA 5C8VA 5LZ4A 3E9QA 3GEGA 2FWPA 4BN4A 1NBMA 1N8TA 2GERA 3K4PA 1TM5E 2XYPA 1PGPA 1Y8RB 2DWQA 4IV5A 1Z6YA 3IPAA 3DOCA 1KPGA 2KHZA 2GBPA 3ED1A 3FRIA 4UTPA 1YASA 1YFKA 4OL9A 4E5YA 3AHIA 3ZGXA 2FG5A 3QWHA 1JBKA 5HCNA 3NCHA 3VPDA 1DDGA 2PX5A 3E6AA 2QD4A 1T8PA 2FWRA 3LDUA 4MIEA 5HFAA 4HP8A 3U4AA 3K9HA 3UC5A 3W6ZA 1Y8QB 2QX4A 3HJGA 5I4IA 3EMDA 5FBWB 2XOKD 3QU2A 1WBJB 4GO1A 3SSNA 1GNQA 2ZIVB 4DWWA 1ENZA 1G291 1LK5A 5ITSA 1IK4A 1U3TA 3DKRA 4FE3A 4X44A 2XV1A 3ZUPA 2IDKA 1NMEA 1SO8A 3KQNA 5CITA 1BGWA 4LYFA 1JXAA 5JG7A 2FX2A 3ORSA 1P6XA 4XQGA 2HKIA 5EJ4A 1L7PA 1QHSA 1Z5UA 3PFBA 2QVZX 1HKUA 5H7XA 1MKYA 5BQ3A 3MMNA 3KM0A 5ALEA 1JHAA 3ESQA 4MUAA 2G83A 3R8CA 3VKUA 3CX7A 3IEMA 2VXOA 4ZT2A 2PGNA 1G4UR 2WD7A 3D3EA 3ORFA 5EMMA 2V45A 1CE8A 2IWRA 3M1YA 3NM4A 1GGVA 1V9SA 4NXNB 2Z08A 3ZS9A 4F4CA 2ZPUA 1A2OA 4RZUA 2WE8A 4YUYA 2RAUA 4BQIA 2ZI9A 2J8ZA 2JJMA 1W5AA 4FINA 4UDYX 4RAQA 2JKYA 1QG0A 3DV0B 3FGOA 2HN9A 4DT1B 2C9MA 1DBSA 2XGGA 2RAFA 4UU7A 1WXQA 3H2YA 5EZ5A 3RU7A 1TFRA 1ETHA 3CW9A 3KAJA 5H0IA 4RCYA 4EKIA 3NKFA 3FTPA 1NUHA 5JU6A 3IDQA 3V2HA 2H1WA 4JLSA 2NT3A 3DQQA 4N3AA 4FC7A 4HQ0A 3LOPA 1RHRA 1F9AA 2CHQA 5HS4A 4KWTA 1NQVA 1RWVA 3CZCA 3UAZA 1KY5A 1FUIA 1A2QA 3DL0A 4OV6B 2HX1A 4Q16A 3IB6A 3SEZA 1U94A 2ORYA 1OGIA 3REOA 1OGJA 2G71A 2A9PA 4Q1AA 3D3WA 1ZH4A 3WIBA 1V1RA 2JJ8A 2WSBA 4GM4A 1FXSA 3WWYA 3O2QB 1Y5NA 1KP2A 4H1UA 1JXOA 1R5JA 2ZVQX 3NT4A 2G36A 3EUWA 2GT1A 1YKSA 1QIGA 1DFIA 1ZOSA 4U2DA 4XGIA 1K8YB 1MAUA 3ZDZB 1NUUA 3M6WA 4HSGA 3O75A 4MIOA 2Q3FA 2F1IA 2J31A 3MUOA 4J0FA 3P45A 1GVHA 3EC2A 4OHKA 4R2WA 5DH9A 4KR7A 3K94A 5AJWA 4HVCA 3M9LA 5DX1A 1Z0KA 3TLAA 4KQGA 1RJDA 2R48A 2PWBA 2G25A 1GUDA 4Q9KA 3EEFA 1AN0A 5JPIA 3RJ5A 4HUQB 1GU0A 4HDSA 3G59A 1KVRA 4LOAA 4PAOA 2DERA 2OYSA 1N33B 2IW1A 2VHTA 1SCBA 2XEXA 3DDWA 2O6LA 3V33A 2RKBA 5B4UA 3ZDAA 2WF5A 4DYVA 6YASA 2ID8A 3OJEA 2O7NA 4X63A 3EVFA 4E0BA 2NPFA 2YXEA 2DBYA 2TMGA 2BIFA 4HDKB 4NE9A 2Q2WA 3GYBA 3Q7SA 4NIMA 3V1MA 4D0NA 3U4MA 4W8GA 4I4NA 1B0AA 1YQDA 5GONB 2ZYWX 1AGPA 2AG5A 3PKZA 3EIOA 5DXAA 5EIHA 4TUYF 4D74A 4E5MA 2O2IA 5EXDA 5LN1A 4C78A 5IZCA 3KB1A 2QZJA 3VPCA 2XVMA 1JA0A 1DAHA 2PMFA 4B9EA 3GZTB 1E2DA 1Y80A 4V3CA 4NZMA 2A1UB 4DCCA 2VCYA 1CQPA 4YFVA 1HNWB 2JFGA 5B58C 1KDYA 1SUEA 4PIPA 4Q7LA 3IL2A 1Z15A 4JP2A 3T4UA 2W8BB 3ZTTA 1P4RA 2OV1A 3EC1A 1L9KA 1KFJB 2C2OA 2ZIWB 3EVTA 3R77A 2DP4E 3K5WA 1XYYA 3GJZA 4V2UA 3RNOA 3ZW8A 3HWWA 4CWAA 1L5HA 4DLKA 1HYHA 1QTNA 2BFEA 2IPMA 5CT4A 5GQSA 4CQLB 2CNWD 1MC8A 4QTYA 2H9YA 3ZNOA 4MV1A 3AZPA 5EMNA 4C0SA 1UOQA 1BU8A 1EX1A 4BLWA 5LZ7A 4IIYA 3NTRA 3PNLA 1Y1SA 5HRAA 1UIMA 1HQCA 2V54A 2QPLA 5E8RA 2KJQA 2HC9A 5DN6A 3R5JA 4V0LA 2B9VA 1G59A 4HN9A 3IUPA 3IXLA 4DM4A 3KB2A 1HE1C 2J07A 3M6MD 1A95A 2IOFK 2ZI7A 3JQGA 3TQHA