2OO5C

Structure of transhydrogenase (di.h2nadh)2(diii.nadp+)1 asymmetric complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the dI(2)dIII(1) Complex of Proton-Translocating Transhydrogenase with Bound, Inactive Analogues of NADH and NADPH Reveal Active Site Geometries
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
total genus 48
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2oo5C00
2DJIA 2H2DA 3JWPA 1PO7A 3PKJA 3CLUD 4RMHA 1POXA 4BVHA 4UTRA 1U2DC 2QQGA 1PT9A 1Q14A 1Q6ZA 2Q29A 2JI7A 3FLMA 3HWWA 5DGTA 1XLTC 3ZGVA 4BN4A 3CLRD 5MGNA 5AHKA 1Z8NA 2C31A 1YBHA 4J16C 4RJJA 4JUBA 5K3SA 2JLAA 2Q5QA 1EFVA 2OO5C 2EZTA 2H4FA 4JT9A 5K2OA 4D5GA 1S5PA 2NYRA 2JLCA 3IAFA 5DGDA 4JUDX 2QQFA 3U31A 1D4OA 1S7GA 4MPRA 1QPBA 1M2JA 1SZCA 4R8MA 5EJMA 2Q27A 1O96B 1Q17A 1YNOA 1BFDA 1YHYA 2IHUA 4GPEA 3ZG6A 4K9QA 1OVMA 1POWA 1MA3A 5EJ4A 2AG0A 3K35A 2AG1A 4JSRA 4HDAA 4KGDA 4F4UA 5FYQA 1E3TA 1MCZA 4MZXA 2OD9A 4GP9A 5DEIA 4BVGA 4COKA 4K9NA 3D7KA 3CLSD 4Y6QA 4BN5A 1YC5A 4FVTA 3CLTD 2EZ4A 4TWJA 4GM4A 4Q9DA 1M2HA 1UPAA 1YI1A 2H2FA 1V5GA 3E9YA 1DJLA 2BRUC 5EJ9A 2UZ1A 3GLUA 4G1CA 1ZPDA 4RMIA 4K9KA 1M2GA 1NM5C 3ZGOA 5IMSA 1Y9DA 5BWOA 4BVEA 5EJ7A 2VBFA 4QELA 2EZ9A 2IHTA 4UUAA 5MF6A 4KXQA 2EZUA 1T9DA 2FR8C 2EZ8A 2HJHA 4JUAA 4K9LA 2VK1A 3FZNA 4L2IA 2OORC 4UTNA 4JU9A 1M2NA 2WVGA 4BVBA 5FEMA 2X7JA 4IAOA 4UTZA 4TWIA 4MPPA 4X3OA 4JD5A 3OE1A 1EFPA 2VBIA 4MQ5A 5EJ6A 2V3WA 4J1TC 3EY9A 1YTLA 4L3OA 4BV2A 4KPUA 1PNQA 1T9BA 5EJAA 1OZGA 2H4HA 2OD2A 4ZZIA 5EJ5A 1N0HA 3D81A 1T9CA 4X3PA 2WVAA 3F6BX 4JU8A 1OZHA 1PYDA 1OZFA 3PDHA 1V5EA 2JI6A 4IF6A 3FSJX 1ICIA 2IHVA 2OD7A 3EYAA 4I5IA 4JUCA 4K9PA 4RMJA 4C7BA 1UPCA 2H2HA 4FZ3A 4O8ZA 1SZDA 4V1CI 1U31A 4RJKA 1YHZA 4BV3A 4C78A 5D7NA 3F6EX 4Y6OA 4RMGA 4UU8A 1PI3A 3IAEA 3CF4G 3D4BA 4JUFA 2FSVC 4HD8A 4GM1A 5K6TA 4FEEA 1T9AA 1YI0A 2H2IA 3EA4A 4Y6LA 1V5FA 2FRDC 2H2GA 4GG1A 3HWX1 5BWNA 4IG9A 1HZZC 2WVHA 1JSCA 4UUBA 1PVDA 3JR3A 2H59A 2Q5JA 2NXWA 4ZP1A 2VBGA 2W93A 4RJIA 2JI9A 4GM0A 4BUZA 1U2GC 4JT8A 4QQ8A 5EJ8A 5BWLA 2JI8A 3RIGA 2UZ1B 3GLRA 3RIYA 5K6RA 1YC2A 2H4JA 4BVFA 4K9MA 1Q1AA 2Q28A 4V1CB 2PGOA 4UTXA 1O97D 3GLTA 4D5EA 2VK8A 3PKIA 2FWNA 1PTJC 2Q5OA 4UU7A 4K9OA 3GLSA 2Q5LA 3LQ1A 4F56A 2VK4A 1PNOA 2VJYA 2B4YA 4MPJA 2FN3A 1U28C 2A1UA 3U3DA 5MFPA 1UPBA 5MFZA 4V1CA 4UTVA 2PGNA 1M2KA 2A1TR 4FEGA 4QPZA 2JIBA 2PANA 1J8FA
chains in the Genus database with same CATH superfamily
1IVNA 1N2IA 1XMVA 2WA1A 3M5DA 2XXAB 3JASA 3K6RA 2AQKA 1THMA 3SJAA 4HAXA 5FJIA 4F8YA 4FFPA 2EJVA 2CFRA 4QYIA 5IC4A 3LOPA 2OZLA 4EUHA 5KDOA 1BTOA 1E66A 1P4JA 1Q0PA 1UQUA 3PI7A 4LRQA 4ZODA 1N2CA 5F98A 4Z9BA 4GF5A 3TBFA 2XB2A 2WTEA 4G4GA 3UPUA 1JZQA 4B6PA 4RKYA 4PG6A 2A2ZA 4LDZA 2UUBB 2FPKA 3X0DA 1NBMD 4UULA 4B3MB 4IWXA 1GAXA 2A92A 4MIYA 3H86A 4YRPA 2PJZA 2IVZA 4KYUA 1R74A 1IY8A 5HUHA 3AFOA 5A4JA 3TRIA 1QYDA 5DP1A 3B1FA 2EJUA 3CNOA 1OTHA 1Z8HA 3P94A 1PJRA 3PRJA 1C1DB 4QUGA 4X61A 2OY0A 3G8AA 4XYEA 3TQIA 1V8BA 3CJRA 3OOYA 1U7WA 2CZCA 2HK6A 4MZXA 1KR5A 5E3IA 3RI3A 3ZGYA 1QMPA 4DA9A 5LMCA 4TMZA 3CLSD 4I3GA 4D8VA 3RSCA 1EFCA 4BNFA 1RIIA 4ZI3A 4Q9DA 4P58A 1DDOA 4UBLA 3LBIA 4KYIB 1VMEA 1JL3A 4CODB 1DV2A 4YROA 2CVOA 1NF8A 2F2TA 3H13A 1XZKA 3A9RA 1H65A 3L7LA 1T25A 1XK7A 2C4WA 3C3MA 1MAWA 4GKBA 3I61A 5CT9A 3BMQA 2G9RA 4D26A 2IXAA 3C3XA 3C43A 4TMFA 2VN8A 5H16A 2YQ5A 1BQ3A 3S5JA 4A92A 2O7NA 1R6UA 4PBRA 4IAOA 1YACA 3V46A 4V3BA 3KAQA 5AOVA 4PZ0A 2V3WA 4G1FA 5B1YA 3NHRA 4BO1A 1K4MA 4FDTA 4AG3A 5TIIA 4K2HA 2ZR9A 1F12A 2HK7A 5ELLA 1P81A 1A5TA 4MQEA 4DSOA 3K9FC 1E64A 1JFFB 4DA8A 4WOJA 1B8UA 3ITDA 1M9NA 4G0NA 4O8ZA 4P4TA 3CZ9A 3VV3A 3W8NA 1GEGA 2FW8A 4AX8A 3BXEA 2YZ7A 3MWEB 2CV0A 1PYGA 2BLLA 1ZLXA 5CR9A 5FAKA 1ZL0A 4JJIA 2XMDA 3SK0A 2PJRA 2XVZA 4NECA 1R27A 1HLPA 4CN8A 1LDGA 3A3OA 3D4BA 3NKFA 3QEMB 3PB3A 3L41A 4YMLA 2BKEA 1ZLYA 3K94A 1SKQA 2FRDC 4CM1A 1J97A 3GFBA 1L7BA 2XNJA 3LHDA 4GDFA 1GTRA 5THKA 1SCUA 3F46A 4Z6KA 1DWOA 2GGSA 4U8HA 1H3NA 4EGFA 2GZDA 4OA5A 2JCVA 4TTTS 3VGPA 3WGIA 4DANA 3C8DA 3ABQB 1XEAA 1UK8A 3OLWA 4ZQCB 1H0SA 2PBZA 3N53A 1IRXA 3B3GA 5J4LA 1Z2EA 4KH0A 1YBFA 3LX6A 4ZCPA 5HMMA 4CKXA 1BQEA 4DNXA 1I4OA 4XDGA 3PTAA 3B6EA 2J45A 1KMQA 121PA 1UMCB 2P91A 2FSFA 4H7IA 4G86A 3DEFA 4HDMB 4MVXA 3CPJB 1JJVA 1JU9A 1QCYA 4UREA 3VDRA 3PUIA 1MH9A 4BX3A 2DFKB 2H06A 2XVXA 2I8CA 4B3CA 2R6R1 1GGMA 4EHIA 2A0KA 3ZQUA 3NWPA 4CJXA 3P19A 1M2OA 5GZ1A 4TN5A 3CLUD 2VJMA 2J3MA 2XHEA 3D6UA 1YOBA 3A6PC 1C41A 5LZ8A 4IVNA 4AO7A 4CQJA 1AQJA 1FVXA 2HDOA 5EG5A 5ESDA 5MGNA 1TUBB 1NVTA 2WKWA 1RS0A 1TIPA 3HABA 3R5TA 5IBPA 3G9UA 2WZCA 1KQNA 1XNRB 5LBUA 4ER0A 4BLVA 3JX9A 2JAQA 4HRYA 4O4JA 1ZJJA 4JP2A 3UXHA 5AVZA 2QXUA 4J6EA 4UHCA 2ZZMA 2R4TA 2G25A 4RH0A 4NF2A 1UIMA 2SCUB 1XWIA 3KQSA 4AQDA 3RAFC 1V5WA 1YZKA 4KPFC 4DV5B 1C7IA 1CUUA 4R16A 4DLUA 1EM8A 1EH5A 1VXRA 1D9XA 3HR8A 5BORA 1QRSA 1TPYA 2J0UA 4BLUA 4IMJB 3Q7IA 4PRKA 5FBRB 1X7HA 4F2HA 4L8FA 4HUQB 4M36A 2NTJA 3ZE8A 2OG1A 4WESB 4OHRA 2ZTMA 5H8WA 3H3XA 2CXNA 4K26A 2YHAA 1P1JA 4FYJA 4FDLA 2F9FA 5EQDA 4AYWA 3K0SA 1EBBA 2AMFA 1V6CA 1ZX1A 2B6HA 1UXGA 3CCCA 4E4TA 1Q21A 3A0UA 4DAOA 3OZGA 3MQ2A 4DS3A 3SIXA 2F7SA 2OHIA 1QFMA 4HCJA 3AIMA 4BNWA 1B6SA 3JAKA 5ESRA 2C96A 2ZM5A 2WF6A 2R1TA 3BB3A 1FBNA 5M3BA 2A5LA 3ICEA 1C50A 1I3CA 1G7TA 3HR4A 1ML4A 4BV2A 4FLFA 2I91A 4N5IX 4OL0A 3TTTA 2G28A 3TOSA 1AGNA 3L6DA 2B8NA 1CTQA 4TSRA 1DSSG 3D59A 3F5QA 5ALNA 3ASUA 1J9ZA 4LTDA 4EGQA 4G25A 3LG2A 1A2KC 4ZGBA 2QTNA 2C7PA 1FP2A 1CY0A 1S2IA 3CY6A 4BJ3A 5HRCA 3HZRA 2P62A 4HPWA 4PHCA 5E0KB 4UNIA 5DYGA 5K9ZA 3LT2A 4RJ2A 1DC5A 1H5QA 1M72A 3E2PA 3RROA 3RSHA 1I9GA 1A7UA 5KTPA 5F5NA 3ELDA 1UT8A 1QAOA 4QARA 1EUZA 1DIGA 1G0OA 4Y2GA 2XGSA 4Q66C 3IEUA 3MILA 1NLUA 1R4ZA 4C7VA 1Y80A 3WJAA 5KYXB 4ZO8A 3AV3A 1H2XA 3CT4A 3GEPA 1PGPA 3IBSA 1GNLA 3GCGA 3HO8A 1OWOA 3QVVA 4KFRA 1XRMA 1Q1ZA 3PIIA 2O0KA 4M88A 1LZKA 2CC2A 4IZ6A 4I1PA 2JRCA 4A23A 2P5UA 3ZQ6A 2FWBA 3GJQA 5LZ2A 3OPMA 4OHKA 3R8CA 2A5YB 1I1OA 1ZNQO 2V7XA 3E7WA 3PCXA 3VU8A 1MDFA 1XPJA 4GYWA 2I80A 2IX3A 4JWTA 4BU1A 3VKUA 4C2AA 4EHHA 1KF0A 2Q1XA 1KI3A 3C74A 5PNTA 3FOFC 4H27A 4MW5A 4BQEA 1VJDA 1JRLA 3HCBA 2HLHA 4EI2A 2IBMA 1OC2A 2MDTA 3R5JA 2A1UA 4OK3A 1RP7A 1C9MA 2HRRA 3BRWA 3Q15C 3AHFA 3GI1A 3U6KA 1H2YA 2O9JA 3PL1A 1V3QE 5CDFE 5LIRA 4Z9AA 2TECE 1KHHA 2WABA 1XPRA 2I0FA 3ZNPA 2D1FA 1WXWA 1QK4A 3GCZA 3JQPA 4FFWA 4URYR 5CTJA 3FKJA 1UMBA 2P2CA 4JYBA 2FWJA 3PNOA 3DFKA 1WZCA 1KSHA 5BR8B 4OP2A 4ZVLA 3VR4H 1U0BB 1ACMA 2PV7A 3OQPA 1NN1A 5FFNA 3VJLA 1RACA 3C6MA 2EFHB 1JEYA 3LZ6A 5AIAA 1YU6A 1LLDA 1ODIA 1X8XA 2OO5C 4Q3CA 4LC0A 3Q98A 4QATA 4RVHA 4PZAA 2V96A 4D5GA 4F6RA 4MKHA 4NYIR 2UYYA 1Y3FE 3QG5A 1H6CA 1CS0A 1PZMA 3LBNA 1WM1A 2QSUA 1JR4A 1MPTA 1TAGA 4S35A 4EAAA 4XDYA 4UOQA 3EHDA 1G6KA 3RF6A 4C03A 1YZLA 4QEKA 1P39A 4PXYA 3JRNA 4H1HA 2B7CA 3TZQA 3NOQA 3V48A 3FBGA 3AYXB 1UIRA 4F4UA 1Z3CA 3I1FA 4KH1A 2WV9A 2IHZA 5DCUA 4TTVA 2GM4A 5CM2Z 5I9NA 3L0OA 2XTAA 1FJXA 1XLWA 1YD7A 5TGTA 4YJGA 4LOIA 4RJLA 3JARB 3TLKA 1PNTA 1USIA 2P2ZA 4GQIA 4IOKA 1NXOA 4YYEA 4B84A 5JNLA 4UNNA 1YMVA 2WUEA 3VSEA 1QO7A 4CCYA 4U7TB 1BGXT 5DDIP 2C5BA 4M7WA 3LPLA 2XCIA 3OESA 3BGVA 2P6NA 2FPXA 1U02A 5CA0F 2DPYA 5TB5A 2RHWA 4O1MA 4YT5A 4MPPA 4M1TA 2BFDA 1ZVJA 1XDGA 4ESEA 2PRZA 4F71A 3DO8A 1U0SY 1YS1X 4F0JA 1CVIA 2GLUA 4KIFA 3I45A 4R7ZA 1EFVB 4JJ6A 2YBDA 5HBRA 5CPBA 1DARA 4I14A 4A6EA 4ASUD 2JFUA 3R0QA 5DM2A 4B80A 3MWKA 4G84A 4B3IA 4KP7A 1GAJA 2QIOA 1YE3A 2YIJA 3V5NA 3FPJA 4MIOA 4B79A 2CXXA 1QV6A 3JQCA 1TUBA 2GFIA 4O4LF 3H5OA 2E1RA 3EAQA 2GXAA 5EWLB 4EG1A 3NETA 3UAOA 3E70C 5DM4A 4WUVA 5CUQA 3UANA 1QFXA 4XGRA 1U8ZA 3R20A 2QU7A 4RTKA 4QXPA 2AFRA 1SCAA 1SNYA 3HJAA 4H0FA 4X54A 3ZCUA 4ZFNA 5BWNA 4HQFA 3L4JA 1FTNA 1SIOA 1RPZA 5A9SA 2DB3A 2VA8A 3FIUA 3FVRA 4I1SA 5BQ3A 4PAWA 5CA0B 3BE5A 1O4WA 3CUEF 2P2GA 3BRSA 2WTAA 3ENWA 4HGQA 2W6IA 4N7RA 4P7JA 3P5BA 4L50A 3V9AA 1XVLA 5J3JA 2J0UB 3QLVA 4RTPA 1ZJ4A 4MR7B 5TQ0A 1NOIA 2VWGA 2H7VA 3C5HA 2RBGA 3T38A 1PV2A 4YY3B 2P1ZA 3DUFA 3W5AA 2AJ8A 3BMNA 1L5WA 4GMGA 2EBHX 4GSYA 4R68A 3HEMA 4UU7A 3RJ9A 4FI3F 1I6MA 4GMHA 2WLSA 1T4CB 1P0IA 1ZD8A 2PX5A 3JD1A 1TB4A 4MYCA 3WWZA 4LJ6A 1YZYA 4R1SA 5FI3A 3NPMA 5FBWB 4BNUA 4EG7A 4OX9B 2PGLA 1USWA 2SBTA 3JQ8B 2ZSHA 1GUYA 1HT0A 1U2DC 5E7JA 3TTXA 2C9DA 2R66A 5HKOA 4JI0B 1MFPA 3O4FA 5DGTA 4R9RA 4NENA 4YCBA 1H5UA 3UH1A 3CXRA 2DYKA 4KQJA 5AHKA 3ENNA 3RAEC 2E4YA 3PHCA 5AJWA 3GDHA 4HDNB 4FBLA 3DKIA 4CDRA 1WD7A 1CR2A 3KR1A 5IEBA 3VFDA 1IOWA 5K2OA 3V4OA 4S04A 2QJTA 3TSCA 2OBBA 4QLAA 4ML3A 5CAEA 1KYYA 4UVIA 4MQEB 1KMIY 1R0BA 4QXAA 1YQXA 3R6DA 1E1CA 4BGEA 2BSXA 1N0VC 5FI1B 4TL7A 4QO8A 1ZUD1 1T2AA 2FEAA 5DX0A 2PL1A 4G97A 3LCUA 4XW2A 2RGUA 4MVJI 2QVLA 1NA5A 1RXYA 4Q1BA 3WWPA 5KTRA 3SQWA 1KYVA 3IUPA 1XCGB 4Q5IA 4N7MA 2R7LA 3ZWWA 4ER5A 3FLAA 1VDZA 1JZTA 4D4LA 3RSLA 3HBLA 5ALUA 1PJSA 1YDGA 1OXBB 2L2QA 2ZWAA 3OMLA 3IP5A 5EFZA 3DMYA 4QXOA 3WNCA 2PZGA 4C89A 2C2KA 4P33A 2YWCA 4CRWB 5AVJA 4A4DA 2WJWA 3OLXA 4HGYA 5IM4F 3MTQA 4KVAA 3AIIA 1YKFA 1ZY2A 2POCA 1TC1A 2QGFA 4XE5A 5KVQA 3SEFA 4MYUA 1R4NA 4O29A 4I9GA 4J0FA 4FE7A 1P60A 3AFNA 2KMLA 2YWGA 1FFGA 3A4IA 3P9KA 5F1YA 3WYDA 2IH2A 2EL9A 1T8RA 4OOEA 4FP9A 4LQLA 4Y98A 4ZJYA 4Z0HO 1GD1O 2GSDA 3VO1A 1B23P 5JYCA 1P91A 1NVVR 3BD6A 4YQEA 1Z0FA 2XAAA 3IAM1 2X41A 2I67A 3WMXA 2WP8J 1ECLA 3D3KA 3V2IA 5KSWB 4CEIA 4QA9A 2ZDQA 1X92A 1TLFA 4UOEA 4ZXPA 5I01A 1GUBA 4Y0VA 1EX6A 4A73A 4DABA 4BQQA 1Z73A 1XFAA 4BFVA 4KAXA 4BB5A 5E7MA 2C5EA 4KRFA 3ZW9A 4QPPA 1EFTA 2CUKA 3WZ2A 5E0OA 3GLGB 3L8HA 2GFQA 3C1UA 2JIDA 3BX1A 5FQNA 3CUKA 3LY5A 2OO5A 5KAPA 4DSNA 5AUQA 4FB4A 4OXXA 1JZSA 3F3MA 3SICE 3GEHA 1U9ZA 3IJPA 1X1DA 2R1TB 2VDWB 4Q4JB 4Y30A 2GDZA 4EHDA 6NULA 1IN7A 4EELA 1W4RA 3N0VA 5L40A 5KO2A 2BHSA 1H93A 3LP5A 3VR6H 1ZCAA 1C0KA 1KZ4A 1M1NB 3ORSA 3T1YB 2IGTA 1QDEA 3VUEA 2BFPA 3I2YX 2HZ7A 4MPDA 3CF0A 3L4SO 4F5EA 3OTOB 3GJ5A 4ZO6A 1EJ0A 1R0XA 1O8BA 4EHAA 3P0JA 4F9FA 1J0BA 1BE0A 4XM0A 3WQHA 4H60A 3EC7A 5EXDA 1ZKMA 3UJ8A 2C8VA 4JELA 4BVKA 3BE8A 2HUPA 4HUQA 1GUZA 4DM7A 4LFAB 4X65B 1N1DA 1V9SA 5DBHX 1QUEA 3T52A 4ZEVA 4B3GA 1A1SA 2HWXA 3NPAA 3PHGA 4G65A 3ZY4A 2CLDX 5D51S 2FA9A 2ZIAA 4PGHA 1MC8A 2UVPA 3H5TA 5H59A 1WJGA 4FFMA 5D6OA 5EZ6B 5J9FA 2GXUA 4ACBA 4OJQA 3A3YA 4EQ6B 4EMSA 1UJNA 4HYYA 1OLUB 5B55A 2BP7B 1KZ7B 2AG5A 1WXGA 4LYJA 4O4JB 1TA0A 1E6EA 2EZTA 2ST1A 1XHLA 1HT1E 1HPLA 3DA8A 3DDCA 3ESAA 4KIWA 4DCCA 4UCXA 4YI3A 2BHRA 5K0FA 2QR3A 4S1NA 3GVIA 5T4BA 3ET5A 3HPRA 1JFTA 1DRUA 5FWXB 4RKWA 5CBPB 3A1FA 2PZBA 1ZC3A 3U4DA 1BFDA 2WSBA 5CLHA 3VYWA 5HRUA 1YRAA 1N5LA 4MDHA 1FFWA 4O4IA 3ZIUA 5B30A 4DLBA 1ONSA 4RADA 1MRZA 3F0TA 1MJ5A 3DTVB 4K8OA 3F97A 4ND6A 3IQWA 4M3NA 1U7XA 3FCOA 4GVXA 4HLDA 3R9IA 3V1NA 2H1OA 1J8VA 1QH1A 5F2EA 1Z4QA 3U3XA 2X6TA 3K9LA 1YBAA 5J1SB 3A6HA 4TVBA 4YRSA 3DBRA 2ZE8A 1PV1A 2DPLA 2NSJA 3DYVA 3F3YA 3G0BA 1W75A 1AQ6A 2RB4A 3PTZA 2J0VA 3HBFA 5H82A 5IHPA 4MRVA 1IJBA 3VDMA 1J49A 1PTKA 1T2DA 3NH6A 1G3RA 2ZJ7A 1JECA 3OJFA 1M2NA 1C9JA 3SLKA 1VJGA 1Z4KA 1XELA 4S2UA 4Y7DA 3ZS8A 1OASA 2A78A 2XWSA 5ALGA 3QVWA 2HV8A 4LDJA 3R3WA 2WK1A 2WW8A 3EVAA 3EIFA 3EXFA 1H2ZA 3IKMB 2ZRMA 2ID8A 4HX5A 2OXCA 2LP4Y 1XJ0A 5J5AA 3QMWA 2E6UX 4X1IB 3MAAC 1APBA 5B5SA 2OD7A 4IG4A 3RSZA 5K20A 3DAHA 1EWVA 2OWDA 3FUVA 3HY6A 3IP7A 4QOSA 5C32A 3M6XA 4BC0A 4ZPXA 3QMMA 4TMWA 1NI4B 2VDUE 4DJFC 2E6KA 1AUQA 4IIFA 1T6NA 3RPEA 2QLTA 4B3HA 3FSGD 4DEYA 5HUJA 1W73A 3DE2X 4JLVA 4E1AA 4AMVA 1Y6GA 2GAAA 3A10A 4X62B 5TRTA 2GEBA 1D4FA 4U9IS 1HOXA 3O4GA 2YRWA 1RHJA 3PUZA 1VPVA 1JLKA 2NU9A 3OZUA 3TSOA 2V6MA 1ELOA 4N03A 2H3EA 2TRSB 2WTMA 3W5UA 5EHXA 1SK8A 1CFJA 4A5OA 2NXWA 3COYA 4BO8A 2X2PA 3M4ZA 1JHAA 1DLJA 2JKZA 2OILA 2BFNA 4GVPA 4KAJA 4UNPA 1TQ6A 4I1YA 4BKOA 4TLMB 3BQNB 5LUBA 3VYUB 4CZ2A 1HXHA 1TUEA 3L1JA 4CLEA 3ECAA 1T0JB 3QELA 4JJ4A 2C5HA 4NMLA 5EXTA 4C29A 1PW7A 1S3IA 2HSGA 4KN6A 3B60A 3TNJA 2QRVA 1PJZA 3WLFA 3QPUA 2EQBA 3AF6A 1FTWA 3DEIA 3G2NA 4L8GA 3AI3A 4JA2A 2O7VA 4O59O 3OOHA 1D2HA 1T0IA 2IEAA 1KY4A 2QTBA 4GZ3A 4PPFA 3R76A 4LOJA 1WQ4A 3WL8A 1BSVA 4RL4A 1U3UA 1DFHA 1CRZA 1GQRA 1NRIA 1CLUA 1PQUA 1K66A 4DMHA 3TECE 1DHRA 3F5DA 4DMUB 3FI0A 3AM3A 3B1YA 4BZXA 1O97C 3BXFA 3TRKA 1VJ0A 4LYFA 2WIKA 3S70A 3NHAA 3FSEA 4OHBA 1PV4A 2RG7A 4ZMRA 1BG6A 1IN5A 1ZQ9A 4E2YA 5JMWA 3NV7A 2CJWB 3CUYA 1DBQA 3GP3A 3HB0A 2Q1YA 3BWBA 4XM2A 4MRRA 1JIIA 2FV8A 2D54A 1LPSA 2YYSA 4X1KB 1DEXA 3AUSA 4C05A 5I7OA 1FSSA 1NY5A 3QY9A 4KQ2A 1OX4A 3PHJA 2CXQA 3ADPA 4FBMA 4QUHA 1XYVA 1Y3BE 1V9CA 2A4KA 4GOLD 3QWHA 5EKDA 1W52X 2FDRA 3C4QA 1ZGAA 4A8JA 2KM1A 4F92B 2G4VA 4FD3A 4KQ6A 4YLGA 4M7RA 1CEEA 4NBWA 4MMYB 1KZ9A 4RLQA 4DWVA 2LE0A 4OBXA 4N3NA 4XM1A 1FRQA 1NBAA 2ZQ5A 3ANXA 3UG6A 2C42A 1Z0ZA 1YB7A 3UT5B 4DKJA 1QRAA 2Z58A 3LQQA 1D3AA 3OCWA 4V02A 2JPDA 4K6CA 3R3UA 3RRJA 4X90A 4E70A 3NM6B 4OGFA 4DLYA 3GW8A 4S1VA 1ZOPA 3TPFA 3RS5A 3ZQJA 1BMFD 1JQAA 3A9SA 2PS3A 2I2CA 4OQYA 4E14A 2JVJA 3D8SA 2NU7A 2AQ8A 1NMQA 3I6MA 3KQHA 1Z5PA 1IY2A 4G5HA 4BVEA 4C0LA 1Q7BA 4R5HA 1WBDA 1ILWA 4D6PA 2YVQA 4ECEA 1MB4A 3O8OB 3VOBA 3H2HA 2GEJA 2D5LA 4MCAA 4PYJA 1LF0A 2CBZA 4F7DA 3QUCA 3M6AA 2WIJA 1Z5VA 2IT1A 1M8GA 3DB1A 4OGWA 2SECE 1GFSA 3UXYA 4NBVA 2GPSA 3I4FA 2GS9A 5CURA 4B31A 3IKVA 5K3FB 5ADHA 3PQCA 3U7JA 2CB9A 4EFDA 5LD2C 2ZUDA 1HLDA 5LQKA 4UBMA 2WVAA 3UMVA 3OG9A 4B32A 3LRPA 1E0JA 4YMVA 4KO4S 1RRVA 2YBEA 1MFZA 4MWOA 4X20A 3EVTA 3GO4A 1ZMBA 4MVWA 4YJHA 2GKSA 8AT1A 1O95D 4HDSB 4GGMX 3AVQA 4O25A 5CIYA 2X1HA 3RKUA 1H0KA 4OSOA 1DS6A 1XJCA 1FTQA 2RGNC 3BDVA 4UM5A 2ORED 1JDBB 1XJWA 1FRNA 4LZJA 4M4SA 1ZH2A 4Z54A 1ANKA 1BW9A 2J08A 4TV9F 5F7ZA 4FXPA 5A5VA 4MGZR 1HEYA 1ZD2P 1GR0A 5SZIA 1Q1GA 4CQMB 5DBOA 1VJRA 1V0JA 4K3VA 3KZCA 5LZ7A 3WISA 2O2GA 5CW2A 1P19A 4S1TA 3KOZA 1UXKA 3MTDA 2Y8EA 3T3GA 1V3TA 3AR9A 1CT9A 4MCHA 3NVDA 2E49A 2QAGC 2OGZA 4O33A 4I4IA 4JYAB 3I53A 4QC2A 1H2RS 1FUKA 1LH0A 3PPIA 1VKJA 3RAGA 3M4XA 2XJ9A 2C3MA 1AB6A 4G23A 3WHLA 1EE1A 2Q3HA 4J49A 4L51A 1JHYA 4UHEA 3CHYA 3OZSA 2VK4A 2P41A 3HY3A 4JLKA 1UWLA 1Z6AA 2HIGA 2X15A 2AXPA 3KHKA 4ZVTA 5AVYA 1WWKA 1TVKB 3EODA 3DOIA 4KE8A 1E2LA 4C6SA 3NKVA 2GBLC 2VOJA 3QK7A 1NVKA 4BP9A 2Q1TA 1IM8A 4FB5A 3NU1A 2V7BA 4BVHA 4EITA 4NI5A 4PHFA 4JQYA 2ECOA 3DOHA 3E4DA 1JGTA 1YE8A 221PA 2ZCJA 3WOHA 2DUUA 2NP7A 3PNKA 3FHTA 2RGEA 1HKUA 3KKNA 4KEAA 4EQ6A 3OIFA 2QP4A 3GN2A 3F5FA 4BEJA 3QEAZ 4Z1MA 1E3WB 3WLOA 5AJUA 4LNAA 3AMVA 3LBAA 4GLOA 3BCRA 3ZXSA 3BK7A 3Q2KA 4P08A 3DKRA 2ZVJA 3W5HA 2Z6AA 1JJAA 2CUTA 3KPWA 1M2JA 2WZDA 3OUUA 4XTRA 1Z3IX 5GAJA 2VFAA 5IH3A 2LCQA 2H11A 4FNMA 2ZI6A 3TLZA 3S2ZA 1S2NA 3FOCA 1N4DA 4JX9A 2WJ6A 4HY3A 3A6KA 5ENVA 5DYWA 2Y1CA 2RHMA 3V97A 3UMRA 4G4JA 5JS8A 3T95A 3QJGA 1RPNA 3JYQA 3Q6IA 5ENDA 4AB1A 1O6GA 4W9NA 3C4JA 2IEBA 1W93A 4M83A 5IBRA 2B8EA 4I8XA 1UKCA 1YZFA 3ZV7A 1GRQA 3GA7A 2ZBDA 2C2MA 1SIWA 2V54A 1T5HX 2VDWA 4Q4JA 3Q12A 5E9JA 4QJ4A 2AZMA 1VB5A 4NDZA 4N3BA 3REFA 3H2KA 1OX5A 1KAGA 2G1KA 4R0VA 3SX4A 3UMFA 4MWZA 4KNVA 3C7TA 4Q02A 1GU1A 3S1AA 4C4AA 1L7OA 5HKLA 5BN3A 1U11A 2HF9A 3OE4A 2ZR0A 3HWRA 3QOFA 2D5CA 3FWHA 4S0ZA 4DMFA 2V6GA 2XWJI 4HH0A 4PLHA 3TWOA 3EVEA 4CIYA 3GGPA 4IDGA 3RQSA 4RA9B 1IN8A 2TMKA 1R00A 4JLMA 2Q49A 4RDHA 1U1FA 3PC8C 4GI5A 3A6FA 4CEIB 4W99A 1X39A 3WQBA 1RAAA 2FQYA 3COZA 2C92A 2OP1A 1TTPB 2YJGA 1NF2A 2PWZA 3I8OA 3OWHA 2MIIA 4H6XA 3RO7A 5KWJA 1YS2X 2MSWA 1EFPB 2E0IA 1Y48E 2WMNB 2VHZA 4ZI5A 1UODA 1DBVO 2PV0A 5TJ9A 4DYDA 5TT1A 2O1SA 1P62B 3ETNA 3FPEA 3REQB 4E4YA 2GILA 2V7PA 3HU2A 3BIXA 1NG9A 1GKUB 4RDIA 3THRA 4MUEA 1E3IA 1SRQA 4IDHA 2DF8A 3G9XA 5AKZA 5ITWA 1LK5A 5A71A 1Z34A 1JDTA 1R18A 3K09A 4RSMA 5JMPA 4ND2A 1VE1A 2H4JA 1RSZA 4ZOQI 2LCIA 4PZDA 5J2TB 1UKBA 3PLRA 1TJ5A 3IESA 1IEQA 3NDBB 2FI1A 5K09A 3C5EA 3AEQA 4Z53A 4M9SA 2XMCA 3GFOA 4G36A 3MWDA 2XB9A 5FWDA 5BNWA 4YUWA 4ZVSA 1A8QA 1H2FA 2JFBA 2OEPA 1U3CA 3MELA 3NHWA 5MFPA 4WLVA 2H17A 3HHPA 3NR2A 4EZEA 4NU0A 421PA 4KGZA 2NPFA 1I1HA 4IHAA 3ZZTA 3GJ8A 4IJVA 1S9DA 2RHDA 2W22A 2ZS7A 5LLDA 3W5BA 2QSYA 5U4XA 3WA6A 1D4AA 4JODA 4X8OA 3F67A 3JWIA 1NVXQ 4ARUA 5I51A 3H2IA 2I2AA 3EW7A 4C6RA 3S0JA 3ISVA 5JC1A 1A8IA 2WA2A 4J2TA 5COAA 2DPHA 3KLPX 3PWSA 4MUIA 1MUUA 4JT9A 1LPOA 2YXNA 4REMA 4DUZB 3D2AA 1Q84A 3ANMA 4HX2A 5I9IA 2R5NA 3TMAA 1N1MA 2HWKA 4JI3B 1KK0A 2B0CA 2HK9A 3PEUA 2UXBB 3GEGA 3UVEA 3FTFA 3A1WA 3GLKA 4CLOB 5JMOA 2F4NA 2GVZC 4DZZA 5F9MA 3BXHA 2XRMA 4GQAA 4Y1RB 2A3RA 3AU9A 1R8XA 1C3OB 3D0RA 4RPIA 4TVOA 4F8JA 3KT3A 2IDKA 2EWWA 3OZBA 2NXEA 4RZ2A 3ANNA 3QSGA 3V4LA 3ESXA 2GF9A 5IAAA 4U39A 3BXZA 5IT9A 2AX3A 4QM7A 3K70D 1SG0A 2WWRA 2OCDA 3EEIA 3UM9A 1LFDB 4MS3B 2RBEA 1DAFA 3UXEA 3QSYA 1KIFA 2DY1A 5BWOA 4QELA 2AW3A 2Q6LA 4GE0A 3FFXA 4CQLB 2I5PO 5KVSA 2BWJA 1UPTA 2QUBA 5BW5A 2GPJA 2Q0SA 2UUAB 3H17A 2IKSA 1B8NA 4OBEA 1BCRA 4QDXA 2OCIA 4DLAA 4O8CA 2JGNA 4BEWA 4DR4B 1MG0A 1X1AA 2PZMA 2EP8A 3CZQA 4BPBA 3PPVA 4J7UA 3S1LA 4UXJA 4MA0A 4E32A 1DX4A 5C5IA 1WP9A 3EEQA 2HQSA 3SM9A 2BZ1A 2COUA 3SC3A 5FWAA 3U3RA 2IEDA 1PNVA 4FZRA 5KC8A 5L6LB 2FQWA 2V03A 2WKQA 4PXSA 5EPUA 2DWPA 1M0SA 1S2GA 3Q2OA 5HBGA 5FR1A 3ND8A 3PNQA 3PFHA 3ZOZA 4RV9A 1S3FA 1V8OA 2C7VA 3CNBA 5JE8A 3T4UA 1PRYA 3K6KA 1V71A 1LSUA 4ADSG 4XWWA 2QJRA 2FW6A 3TZEA 1NW4A 1YI0A 2P9CA 3PQ4A 4HWSA 3WDMA 3KJQA 5AJTA 5LQMA 4LFBB 2PXHA 4OEHA 4Q7JB 2QI9F 5B1EA 3TKLA 1A5ZA 2NU8B 1NF3A 3DLCA 1VIVA 3TTYA 1OIXA 1OI7A 3E3AA 3N6RA 4KQ9A 3EPKA 1UBNA 4IQ0A 4QECA 2X3UA 3MS7A 3FTQA 1T0BA 3C4VA 1H1DA 2YN2A 2UVDA 4EY4A 4YRKA 4FE3A 4RMNA 1Z45A 5BPFA 4GMFA 1AQLA 4X84A 3TTWA 3OHPA 1JDSA 3DZCA 2A0XA 3M34A 5D3MB 3RSFA 4YV7A 3P2EA 1C30B 1YK1A 2B35A 2QX9A 2DBRA 2FSHA 2XXBA 3IAS6 4JXJA 4E30A 3K1YA 4XSHA 1Y1PA 2J33A 4IUBS 5LA6A 4YP6A 2REOA 2G63A 2J1LA 4E07A 3EN0A 4RSGA 5CM8B 4Y18A 1FS4A 3NBKA 1UBFA 2OVBA 2QYSA 1OPRA 4RNDB 3S81A 1LBIA 4R51A 3O21A 4B7AA 3ZXYA 4RTJA 3DDOA 4WZAB 3R7DA 1BXGA 1EFDN 1JT2A 4UOZA 5JDIA 2G5TA 1GTL1 2AL7A 3ELYA 3N75A 3ICCA 1E9VA 1F0YA 1Z5ZA 3GFFA 4H3HB 3MJCA 5IM5A 1I6LA 3FW1A 1N6LA 2XNHA 1RYNA 4NXMB 3OQVA 5FNVB 4GR9A 1SO8A 4RAOA 3KSZO 2IOFK 3KVNA 2AC2A 2F6RA 4O2BB 4UU0A 1DELA 1BXKA 1CNFA 5ULLA 3TM5A 4HQ0A 5C81A 3TB6A 3VR6A 3O3CA 3PNVA 5JSHA 3OCJA 1A7AA 3SKVA 2DTXA 1T9ZA 2ZJ8A 1QM5A 2X0FA 1JH9A 3OCXA 2QQ0A 2Y1EA 1EK5A 3CGWA 4G5FA 2F9LA 4J3NA 3NEYA 4LMPA 1S02A 1ST2A 5EA2A 1KJ8A 5JXWA 1S4MA 3UH0A 4KKVA 2Q7DA 4GP9A 5AM4A 3P97A 2W71A 1PKEA 2B4RO 1XG5A 4IXMA 1QHYA 1P2TA 1WDTA 3HVIA 1UL1X 3H8WA 1G7CA 2GMWA 4RTOA 3Q11A 4TSFD 1HZZA 3I0NA 2BUCA 3E03A 4MPTA 1A4UA 1IH8A 3TLCA 5FBVB 3NRCA 3P8ZA 4AUMA 3HB5X 1ULSA 3IT1A 3NIDB 4HUJA 1Z39A 2POQX 6ABPA 5BR4A 4FGLA 2XKAA 3ZNQA 2FDCA 4F72A 4EHKA 3L4BA 4Z3KA 5U9CA 2Q3CA 2WWIA 3AWIA 4LPSA 1AMOA 4RIGA 1OBFO 4U4AA 5I5GA 4ERNA 3L01A 3ACCA 1E9BA 4FYPA 1GPNA 3LC1O 1JDNA 4LX0A 3L8EA 4LXTA 4KQFA 3QW4B 2VYVA 5JO9A 2PTHA 2OD2A 2VZ0A 3DZFA 4MVCA 3MCUA 1JYFA 4YBRA 5EWLA 4EUNA 4BXOB 3QVUA 3LK7A 1P7WA 2QTVA 1B0UA 1GAEO 1V7ZA 3OIGA 2PKRA 1AMNA 3DH0A 4L8LA 1NW6A 1D0IA 2APJA 3OOSA 1DXOA 3DPIA 4KW7A 2VJDA 4TKLA 2UAGA 1OTXA 4LHEA 4XWGA 3SOPA 4BKMA 2V65A 2AI1A 4MVJF 1ZUNA 2MMCA 3KCNA 2BFFA 2BT4A 3LD9A 4WT7A 1UKVY 1WBJB 3ES9A 4BWGA 1MB2A 4DJDC 1UPFA 3LC0A 3U7QA 1S6YA 1AKTA 1XOIA 3ED5A 4I66A 3WIBA 3WX0A 1E5QA 2BOVA 2D00A 2EKQA 5ELXA 2G82A 1YJBA 1T3HA 3OM1A 5G4LA 5J63A 3RSGA 2N42A 2EJBA 5L3ZA 3G0IA 3VR2D 1YA6A 3PUXA 4XSVA 1JPUA 3H0EA 3TIFA 3H9JA 3ZDZB 1KKUA 1K6EA 4L9WA 1PJ2A 2B4TO 4DEXA 4DXDA 1FDSA 1H9AA 3OD1A 4ENUA 2W5UA 4BVFA 1DCFA 2II6A 1QGOA 2XUQA 3EQZA 3FOAA 1VCIA 2BY4A 2WBLC 2ZROA 3LIIA 4XWAA 2G8LA 3N2GB 4XDHA 5EWJB 3HJTA 4BCBA 2P2LA 4IEEA 1TXGA 3FCEA 4V0ME 2FEPA 3Q7EA 2CLIB 5CNMA 1P9WA 1D9ZA 1VJ1A 2BI7A 2NQ2C 3H1PA 1ORWA 4LIPD 1L4GA 5DBFA 3LSYA 4HK4A 4UEKA 3SZRA 3NBAA 5B3AA 3VZDA 5H70A 4URXR 4L6CA 4DADA 621PA 2VTKA 2YNMA 5GMOA 3TMYA 3FUCA 4P38A 4M9RA 4IHJA 2YMQA 1Q3HA 5LKAA 1GYQA 2W2TA 1IM5A 3PFGA 5F2NA 5DRTA 2AKYA 3ELUA 1UEXC 5KNDD 1GDDA 3VYRB 2EFCB 4X71A 2YOHA 4BMNA 1GILA 4R7GA 1HZJA 3NMUF 3LVBA 3EVDA 4ZREA 3VV2A 4EW6A 1UMBB 3DEAA 2JIQA 5BV8A 3JD4A 1ID1A 1XXHE 2R6GA 1CZHA 4DMKA 2IJGX 1C4OA 2HA7A 1KDVA 3GPCA 3OSUA 2PH7A 2FH5B 1HYBA 3TIIA 1VMDA 3AVPA 4RSRA 2DLCX 4OGGA 5IG2A 1D7OA 4MWBA 3BGSA 2AHOA 2C9ZA 4ND1A 4S3MA 1FYDA 1CRLA 5DIZA 2V7GA 2IZ0A 3AB8A 2IYPA 4QU9A 1Z9BA 1NQXA 1TO6A 3IQFA 2O1EA 4UVDA 3JQBA 4K05A 1MLDA 2CNWA 2BF4A 4QYWA 4R9NA 1A9PA 2VQDA 4XARA 1WZ2A 1TO2E 1MQ9A 3EF0A 2I3AA 2A9QA 3GD5A 3H1TA 3UTCA 4BO5A 4BX8A 4DRXA 1ZI9A 4KREA 1FBTA 2VCEA 4LI3X 3DFMA 2W6JD 2IODA 2VDNB 1NM5C 2ANCA 3T35A 4ZYVA 5FOTA 5TS3A 4L22A 4ALJA 2EZ9A 4E7OA 2BONA 2OBFA 3FA2A 1KJZA 1EVKA 4OK5A 4RO0A 4TKVA 4DUGD 3UIEA 3KEOA 4A82A 4OCZA 1UP4A 5GJCA 3UW1A 1K7CA 1X80A 1VTKA 1I0LA 1HQYE 1YGYA 3A32A 3IR5A 1ZI6A 5EZYA 3DLAA 5A3SA 5T6MA 3SVZA 1YGPA 4BYGA 4RK4A 2Z9BA 4QLOA 5DM1A 4EB3A 3OO1A 2HU5A 3LXXA 1ZIDA 3O2SB 4P1ZA 4UFNA 4D4IA 2GD2A 3N7TA 4G8DA 3NBYC 5EKTA 4Z4FA 3ZWKA 1RFGE 5CLIA 4ZHQA 5L4SA 4EGCB 1Z4MA 1W0KA 3G1UA 4RDCA 1VBKA 2R65A 4FOOA 1U8AA 1KOLA 4XVRA 3Q4GA 4MV7A 2I3GA 3TZCA 3EPJA 1N2ZA 2YWXA 3ZJVA 1H22A 1IPFA 4X92A 5CG1A 1GQOA 4R9SA 4HD8A 1USGA 821PA 2H00A 1RJEA 1O94A 1V3UA 4R2WA 1RLOA 1NZDA 2WYVA 3FDIA 2XX3A 3QVOA 1WD5A 3U62A 3AO0B 4Q7QA 3BK2A 1KY2A 3DMTC 4K86A 4IOMA 3PQ5A 1JWAB 4MVJM 5L3SB 4H18A 2UUPA 1GZ5A 2HRDA 2HXYA 3CO5A 1L5HA 2JEZA 1IHXA 1OB5A 3EGVA 2IYFA 1E2HA 1JV2B 3BMOA 1CJKC 1BU8A 1A2BA 1BHSA 1I4WA 4AWAA 2C2ZA 1HETA 3TNYA 4ARAA 5HIMA 3QOYA 1KQOA 2SHKA 2QN1A 4QWMA 1C7QA 1NX9A 2VK8A 1MC5A 1V11B 4LZOA 5F9HA 1N33B 4JJ7A 2GCIA 2ZJ0A 3T5CA 1Y82A 2P5TB 4ROSA 1VL8A 2FG6C 2QLFA 3RQIA 3BD8A 4I8DA 3ZIAA 2IFTA 2BF7A 1Z6YA 3LV8A 1KSGA 3WJ2A 4D4JA 4ZYLA 3GMDA 3KSMA 1E6KA 1K6IA 4QQRA 3GFVA 1TO1E 4C04A 1NDQA 4N40A 3FYCA 3FYDA 4O1IA 5FL3A 3VVMA 2NYUA 2FWRA 3MBIA 4GUDA 3OQJA 2CW5A 1GVNB 1RAHA 3GRKA 4Y1RA 3LHIA 3INGA 3GRRA 2G1JA 4U2EA 3OLCX 3ENVA 5CCDA 1YB4A 2OWEA 3ROKA 3SHFA 1E0SA 5EP1A 2E4ZA 2YIDA 3GDWA 3L4BC 2ODEA 5AI5A 1GM5A 2CGEA 3ZTWA 1Y6RA 3EVBA 1LBHA 2X1LA 2HMAA 2DEUA 2RGDA 4JUBA 2VJPA 3H1AA 2GEKA 4JZKA 1XT6A 2J5QA 5ALQA 2PXAA 4H7JA 2XMZA 4HP8A 5CXSA 1BCRB 3E7FA 3H6HA 1JTFA 5ALDA 3RHTA 1K9VF 1VE3A 3SYTA 6CHYA 5I7UA 1ULHA 2HLDD 3AEKB 1HNWB 1L7EA 3TN7A 4S05A 3HDYA 1W6UA 2ROQA 1LRJA 2BCEA 4P4LA 4E5PA 5IYZB 3HMQA 2FRXA 3RBAA 3IERA 3K35A 3SHTA 1IVSA 1KI8A 1VKRA 3E6AA 5BYBA 2X19A 4CGZA 1QIEA 4WQMA 4DTIA 4W5WA 1U3VA 4LWPA 1RRCA 4R9VA 1JF8A 1NRJB 3Q72A 1X7ZB 3V8VA 1RQPA 4JA0A 1AKEA 1NYTA 3N8HA 5CFOA 3RTEA 1VYHA 4F4JA 4MAAA 2J32A 3X1JA 5J23A 1TZKA 2X9QA 1QK3A 3H5RA 1ISRA 1FK8A 4GRAA 3OM8A 4D8TA 2CMFA 5KQGA 1COWA 1OHHD 4LYAA 4U00A 1CF9A 4XEUA 5JH7B 4LF8B 5IU6A 2J85A 1DIRA 3U7FB 1GTG1 3ASYA 4FMDF 5DLPA 3ETDA 3VAZA 2XBLA 4FCCA 1PNQA 1J2YA 1PG0A 2DTEA 4NZNA 1XTPA 4CG0A 1L4YA 4YX9A 3D3WA 1FU4A 3KOUA 3NP7A 4F97A 5AVWA 1BDBA 1CERA 1JBKA 2AK2A 3L04A 1OU4A 2XECA 1Z4OA 5H3HA 3DM9B 5EZQA 1E1LA 4QEDA 4DQXA 1PVOA 3P9NA 3R1IA 4ENSA 3W7VA 1OBVA 1XTZA 3GRPA 4Q34A 5CNKA 4IO1A 5GPBA 3K71B 1CHNA 4TQAA 3UHJA 1JJBA 2HOQA 1ZOSA 2Z04A 4CLRB 4NTZA 5EIOA 3TOZA 4YRNA 4B74A 1IG0A 3BFJA 1OWPA 2PX6A 4CUZA 4EPWA 3PNBA 2VXYA 3MLAA 1P4SA 2P3LA 1W5BA 3KYBA 3VHXA 2WUVA 1X0VA 1XKQA 1FU7A 3C7CB 1IWBB 5LOVF 1YK0A 3K1ZA 4JVLA 4M1WA 3ON5A 3G49A 1S0UA 5LMUB 1WHSB 3F3SA 4GM0A 4QQ8A 3IL2A 1KMHA 3QFHA 5F23A 3JQ7B 1WY7A 2PKWA 3CM0A 2QB5A 1W2HA 1IN6A 2FZCA 2WINI 2ID9A 3KUXA 4QBGB 3DNPA 2ZULA 5E4YA 1SUAA 2ZIEA 3LUHA 1WB5A 2B36A 3FZYA 5FP0A 4HNAB 1EK0A 1G9TA 3FMGA 4MRMA 3ZU2A 1Q1QA 1BD3A 2JFYA 2Q8PA 3VISA 1ZGGA 3OJEA 3VH4A 2ZIXA 5JJBA 4W6ZA 1WHTB 3BGDA 1EWKA 3IDSA 2WYIA 2VJAA 3DV0A 4E1BA 4LF4B 4EIWA 1LNZA 1ST3A 3HFGA 1JDVA 4GPIB 4GW3A 1IVYA 2I76A 2ZJ5A 4ZDKA 1F2UB 3T7TA 3P9RA 4QBFA 2JCXA 1UMDA 5D3ZA 1KORA 2VZEA 3L05A 5KQMA 3ITEA 1WU8A 4B46A 3SS7X 1TTQB 1ZEMA 3F7NA 2GZ3A 3N0WA 1PT9A 1ZW6A 3GGCA 1E8MA 3PGKA 4UJ3A 4CF6A 1JHZA 3QH4A 4EPRA 5B2ZA 3SE0A 1JSLA 1T5SA 1EFUA 1XLUA 4AYTA 3H05A 2H48A 1SHLA 4IX1A 4C4TA 4RL6A 2HL6A 3H8VA 2JGLA 3QBVA 3A1NA 2P3OA 3LVRE 3KTDA 3OI7A 4HYEA 2UZ3A 4GBGA 4L57A 2OOSA 1YIDA 1CR6A 2C2HA 1HOTA 2IEZA 4FSDA 4JJZA 3VPFA 3AERB 3WL7A 2AYYA 1ABFA 1S4QA 2IPAB 1VLJA 1NW8A 2X4LA 2YS7A 2XD4A 2XMPA 1CYDA 2AOTB 1RE1A 4N5NA 1XU7A 5KJ6A 4IEFB 4RKRA 3HBJA 3E5NA 1G8YA 4G85A 5AHRA 4QT4A 1HMPA 3HDTA 5CDFA 4JASB 4KL8S 4BMPB 4F4DA 5F2OA 5H3CA 3FWNA 4RJTA 1T5OA 2LRHA 4E5YA 2PSEA 4K9KA 1AKYA 4P4SB 1UK9A 3V7YA 3SHWA 4K0RA 4FFSA 4DSZA 1ZR2A 4FNOA 3ZWYA 3EYWA 1NC3A 2Y68A 2GCPA 1I3OA 1XCJA 3G1TA 4JOBA 3H7IA 2BAGA 3QE4A 4E21A 4AKTA 1EP3B 5AK4A 1RRFA 4IIXA 4BWYA 1Z7GA 4TKUB 1Y4DE 3VSDA 4YV1A 2QZSA 1KPHA 2GCEA 2NLOA 3GEDA 3S29A 4D8YA 3HYNA 4CIAA 1HL7A 4KPUA 5KYUB 3TUJC 3DJFA 1JQBA 2X5OA 4N3CA 3WYGA 3F4BA 5BVGA 2XVAA 4GOXA 2ZB8A 2VQFB 3C70A 1F7UA 3HTXA 3TR5A 1JHRA 1V1RA 2D1YA 3GNQA 5CYGA 2ZWVA 4OU4A 2B1IA 5ILGA 3TQQA 1IEXA 3C1TA 3HNOA 3H7AA 1ZMTA 4UM8B 2UU9B 2GK3A 2KJQA 1A95A 1RWNA 3DZGA 4J0JA 4N7JA 3MT0A 4P32A 4RMGA 1MABB 4TTRA 5TS2A 5AD1A 1E7RA 5CD9A 1ZSYA 2AJTA 2J4CA 3AONB 2FWAA 1AO0A 2C9MA 5L4LA 3L8FA 5F3RA 1V5FA 1X1RA 4US0R 2J41A 1XD9A 3R8FA 3KNZA 2ZRDA 1I3NA 3H4IA 4DLWA 2DULA 4L02A 1OH8A 3KQYA 4GLFA 1GG5A 1QB8A 3QWFA 5HMLA 2DHRA 2H0QA 2P0YA 1PBTA 4XEHA 3B9PA 3P45A 5E1BA 2ZJ6A 5AOBA 2OL4A 4AO6A 3QPDA 1DIAA 5K01A 3GLRA 1PJAA 4WK2B 4OYRA 4R05A 1IEWA 2PLWA 3ZHTA 3BTOA 2PFSA 1BA3A 1R10A 1RPAA 1TJ3A 3CRVA 3CX4A 3BFKA 1W5FA 4GLBA 5CVCA 4X6XA 4EJ6A 4CLRA 4BRSA 2ZM6B 3GZNA 1H3FA 1U99A 3W8FA 5K4GA 3IKLA 4XGIA 3X3HA 3A4LA 1PNOA 5IFLA 1VIYA 1RQRA 1K8ZB 4TXLA 5IXYA 2V7WA 5I9SA 1B8PA 1XDUA 1Y1SA 4UAVA 5KNBH 2V1UA 4QM6A 2AOUA 2Z98A 3GR6A 3IULA 5J2TA 1UM9B 2AZTA 1AZLA 2J31A 2PG3A 1JDJA 2EKBA 4FC7A 2Y67A 3IPAA 4DMGA 4LISA 4LHWA 4I4TA 2QYHA 1I5RA 1TCAA 4J0HA 3KJFA 1NJ5A 1QJCA 1E5VA 2C8JA 3BHNA 1FS5A 2E4VA 4TQ9A 3ST7A 5CCXA 4XCXA 1PJLA 2EJTA 4ABTA 3VO2A 1GPKA 4KQWA 1JKJB 1K7FB 2RHLA 1J9GA 3JSXA 3ZIDA 1KEEB 3CWZA 3E27A 5HKAA 5KWIA 2ONCA 4JI7B 3QBJA 1ZNZA 1O96B 5L3QA 1WE2A 4CM9D 1PN3A 2JIPA 4AZ0B 5JW6A 4JLPA 2XGJA 1O95C 2P9GA 4QL3A 3GT0A 4W9RA 4KDCA 4C7KA 4LG1A 5BQPA 3LC2O 2FQQA 4DMMA 1A96A 2Q7XA 1KP2A 3ITKA 1GKYA 5H1YA 3ZDRA 4MWDA 2R00A 2W43A 5JZBA 2CLHB 1Q2UA 1UJ6A 2AIRA 4OD0A 2V5UA 3S1AB 3UMJA 5A5EA 4DUPA 1M8KA 2GUWA 3THOA 1X13A 3KAJA 2UZIR 3I2IA 1SBTA 2YWDA 4GI7A 4LDNA 5AXCA 1YASA 1AXGA 2EZUA 3OPYI 4NPHA 5IMBA 4G0PA 3VVCA 1E2QA 2FZWA 4PNZA 5G0SA 3D8BA 3QLVC 3CUVA 1BHQ1 1QBGA 5EMNA 4E33A 5LFAA 4O6VA 4AJKA 3SI7A 5JD6A 3OE1A 1Q0QA 4DT1A 1O7JA 4A26A 3RU7A 1UDAA 5JCJA 2ETXA 1UF9A 1QHHA 1M5RA 2GAIA 2PSSA 2YVKA 4JBLA 4R84A 2FPGB 3U4HA 1IQPA 3QXSA 4P0QB 1TRKA 3MT9A 3RNLA 1NONA 2QRUA 4GMDA 4FMCF 2HPAA 4YGYA 2WI8A 2QTGA 5AOCA 3IUBA 4G81A 3KQKA 4RM2A 1W1UA 1RHUA 1CXZA 5KWSA 4WERA 2LCFA 1K8QA 1YULA 1NI4A 1EBUA 3HB4X 1O87A 1GSAA 1I80A 2NGRA 4DNOA 4WBNB 5BW4A 3ICVA 5K8CA 1JR3E 5TARA 3UMSA 4DL9A 3U60B 1FUUA 1HE5A 1YQDA 3FGOA 3RUIA 4IRMA 1NVAA 3H2YA 3QVKA 3TKYA 2WVHA 4BRUA 4DLLA 4C7JA 1AD2A 5TY0A 5ALEA 1JQLB 1SUDA 4Y2QA 3E9DA 2R87A 3BFPA 4MX8A 4ZP1A 4AG5A 5EN4A 2NXNA 3IR7A 3C3EA 4LECA 3CZ5A 4M8NE 4RGBA 5DVZA 1QGUA 3T5TA 4DQVA 2CJFA 4DR6B 2QLNA 4N47A 3SS8A 4MRMB 2ZDHA 4C1BA 2ZRNA 2XCOA 3JQ9A 4MS4B 1DGQA 4H6VA 2FWNA 4D56A 1WUKS 3RTGA 1KRHA 3UK7A 2R8BA 1DO2A 1W36D 2XR1A 2IKQA 3OY2A 4B45A 3P20A 4J1SA 4DZRA 1A0OA 4FT4A 3JVVA 1YDFA 1IJKA 4OXYA 3GFSA 4RHTA 4QRDA 4XD7D 2C4TA 5DM0A 2VHXA 5A05A 5CGZA 1JIVA 2Z2KA 1Z0SA 2KS6A 4HAOA 4DA6A 3H19A 3EVCA 1QK5A 1DIOB 1PO7A 1DV1A 1P1IA 1R0CA 1T3ZA 2WJPA 3PKJA 4YRDA 3TZHA 5AT1A 1UEJA 1S8NA 2DPXA 2NZWA 3GJ6A 2Q29A 4MKRA 4V0QA 4QNNA 3G6WA 1XLTC 2Z9DA 3O5AA 3ZI7A 5SYNA 2IS1A 2P9HA 3FSRA 4N6OA 2M6LA 1VHDA 4IL5A 4BFUA 3KG2A 2X40A 3UK2A 2O5CA 3ZZ0A 5KYYA 1R8SA 3RARA 2P6OA 2WMOB 2FZ4A 4ND4A 2QRZA 2N1BA 4XYLA 1ENPA 2QMYA 2QW8A 2G06A 4GXQA 4D3DA 1V37A 1VKOA 2OG2A 2YHIA 4X63A 1Z7YA 1DKOA 2Q4DA 5EJEA 1NWCA 4I4TF 3I30X 5MHTA 2D4AA 4HEA6 3O3MB 3O4RA 5LB4A 1WDMA 4P53A 3L4KA 3QIAA 1OAOC 3KOXA 9ATCA 1FS6A 3AR7A 3ZXXA 1Y7TA 2C2YA 2QUZA 5LYYA 4E5MA 4HH1A 3D3EA 2ZJ1A 4DB4A 3NX4A 3IEVA 1EE2A 3EBOA 4XUGB 3CRRA 4IHQA 3LDFA 5JNWA 3HKEA 2NQTA 5HJ2A 3KDPA 4X85A 5J4HA 3OQNA 1BWQA 1XZLA 2QRQA 1QHXA 1PQWA 1X7ZA 4L0MA 2I4MA 5IMSA 3LVQE 3SQXA 1UC4B 4MW7A 2C83A 3ZBTA 3DAFA 5F3DA 5LXTB 3OZAA 3TLMA 3DQZA 5FBQB 2PNJA 3FBTA 2O59A 1UBCA 4JI6B 4M0PA 1V4VA 2GTIA 3TD9A 1XZQA 2Y27A 4F8EA 5BSWA 4MGYR 4FGWA 4ID9A 4RH3A 3T4XA 1VCHA 3BMCA 4HR7A 4RA6A 4XIYA 3D2BA 1NUSA 2X9GA 1PZNA 4EM6A 1Y8AA 4F4IA 2H31A 4GT1A 2O5RA 1U1GA 4RQUA 1C9NA 1RQXA 2DR2A 3A8TA 3GVCA 4JB2A 4LWQA 2CDBA 1O0BA 3W79A 1F6DA 1RBQA 4HZUA 1VC2A 1GFZA 1TZBA 1Z15A 5KYWB 3MCTA 2PWYA 4CTNA 3OEED 3KDSE 4M0CA 5IUJC 2R85A 1EUCA 5AJZA 3ZE9A 1EXNA 1H8ED 5HIIA 2HR1A 1T4DA 4PVDA 4EA7A 1IATA 1RRPA 2NZYA 5JYEA 1J7KA 2AF3C 2C5FA 2AKEA 2VT3A 2FKAA 3B6KA 4YJGB 5G1OA 3ZJ4A 2G7ZA 3WHPA 4Z2AA 2RKOA 4UHKA 4KQ1A 3TFQA 1LK0A 3RODA 1JLLA 2ZSEA 3RRMA 1B73A 3WRYA 1FPQA 1EKXA 1ZL2A 4LVOA 4I46A 1JPVA 3OZIA 1PJ3A 3QVTA 4HRXA 4H3SA 5TF0A 2I03A 1U2PA 5IYZF 1KO1A 1U9YA 4FKZA 1M1XB 1T8UA 2KE5A 2VNAA 4Z0PA 1WUJS 2RHBA 5JANA 3IAUA 4PIPA 5TVGA 4MDEA 2BJVA 3JU3A 5T67A 4ODIA 2OFOA 1EUYA 3A1EA 3OLVA 4P92A 1RDFA 3GUYA 2A57A 1ZMRA 1B41A 1J8FA 5JQGF 1R37A 1EJ6A 3OP1A 2BGJA 3U48A 2ES4A 4JBGA 3N8NA 1O6ZA 2D0PB 2BSQA 1NT2A 5C8VA 2BFCB 1E99A 3RWBA 3EUEA 4RHUA 4KMOA 4R83A 4HWTA 2A7XA 2RAVA 2WJJA 1E18A 2Q5QA 5ITVA 1VSQA 5I9MA 4W8GA 3LTEA 5L45A 3EGEA 2Y76A 5KEIA 1NFFA 1IHDA 2E18A 3LJKA 4IQ8A 5FQOA 3SC2A 4QG3A 2CSXA 2X58A 3L7KA 3T5DA 4LUCA 4DT1B 2X0DA 2ASVA 1ORTA 4MI3A 2HBYA 4NHOA 1SCQA 4M1YA 2QK4A 5KYGA 1T2UA 1SCIA 5DLQC 2PKQO 4L4XA 2P7IA 3NHZA 4I50F 1CQJA 1SOWA 2AJLI 5EUQB 5KKCA 2D7JA 3OECA 1YMUA 2WMDA 3HCRA 4GBMA 4D9EA 1LPMA 5GIPE 4BN0A 3UPTA 2XRZA 1RRGA 5BNTA 1X3SA 5DT9A 1I33A 5CMLA 3VPAA 2EZ4A 1Y3CE 1Y5IA 4OHVA 2JF0A 2J5BA 1G5RA 2BBTA 2HPZA 3K4PA 4NCNA 1L7MA 3M8KA 5IK2A 4U7DA 3D02A 3RJ5A 4YRGA 3RBZA 1HRDA 2AUMA 3ZHUA 5JAIA 1MT0A 3PX3A 1Q0SA 3A2MA 2G76A 5C3UA 5K05A 5C31A 3RS9A 2GJKA 1YF3A 3KJZA 4PONA 4DCJA 1MOQA 3L07A 2WSMA 4IMRA 2G36A 4MQBA 1TE2A 3IUJA 3MIZA 2JZCA 1QC5A 3G7NA 3UMMA 1JAYA 2CLFB 3IPLA 3J7TA 2OM2A 5DX8A 3RWOA 3IOEA 3JV7A 3ILSA 4FOLA 4Q3BA 4AX4A 1V8PA 5AI9A 2O2JA 4U63A 4HN9A 4E12A 5C3MA 4B5LA 3B6MA 2ZE6A 2DAPA 4MA5A 1W4BA 3HP7A 3LLSA 2CK3A 3QLUA 1ZM4A 1K3UB 2IPMA 3A06A 4XOUA 3U2QA 4D82A 3PVZA 2PH5A 1JEQA 5SYAA 4ZVUA 3CN9A 3EX7C 3TZ6A 2X42A 3A70A 2XT6A 3MCAA 3NQ41 4TV9B 1RADA 2QWXA 3KJIA 4E31A 4YUYA 4RTNA 3WI7A 2XTMA 3TZLA 2QXYA 3OM0A 1JR6A 4MB0A 5JSFA 1Y81A 2EKDA 2MSKA 3PQ3A 3B3AA 3EW9A 4WJZA 3OEYA 3NANA 1P5FA 1Y6FA 1N0IA 3KYCA 4LJLA 3GL9A 1BVRA 4XUEA 2OYRA 1RKBA 3GDGA 5EFOA 1DBRA 1YV9A 4PEVA 3WGJA 1LI5A 2AOVA 5JWHA 3AF5A 1X74A 1ZD9A 2H1VA 4IUCS 4MYDA 1W34A 2H9IA 4J75A 1S8FA 3INYA 3OJOA 3CKLA 4ZV9A 1EEHA 2MINB 3ZQKA 1ZIXA 3HYTA 4AKSA 1B16A 5C8YB 1CC1S 4PAMA 4I3FA 3N2KA 4YV0A 5K0LA 1TAUA 3T7DA 3Q87B 1MRSA 1OKKD 4UZSA 1OWLA 5K8IA 2BC9A 3NBMA 3RKSA 3UB4A 1UKYA 1K3TA 1X86B 1X15A 4BNLA 2ZYRA 4FDMA 2IWRA 3THWB 1LD3A 3CINA 1Q0TA 3S8EA 1V2GA 2EBUA 2P77A 1MRNA 2ZP1A 2BKAA 2RGWA 4IQ4A 2JFQA 5G0UA 1ZWLA 4KHPB 2NP6A 3R2JA 2FPOA 1WPXA 1LBQA 3WJ1A 1LKZA 5A02A 2SKDA 5BV2P 4LJ8A 4I8IA 3I2GA 2GASA 2XEDA 3W5DA 4TMXA 1B00A 1CS0B 2AMVA 3ZCRA 3UFBA 3G7UA 4MTCA 4JQOA 4DM3A 3IVAA 2FQXA 1EFVA 4FUTA 4J7XA 4OREX 3BA6A 1XRJA 4OXRA 3S44A 1XTKA 1TM1E 1LVGA 2BFDB 1OAKA 4NU6A 5A62A 3BAFA 3ONNA 1QF7A 4JBHA 4B2LA 3DBLA 4H7DA 3EY4A 3EXHB 4FS3A 2PZ8A 3NDPA 1XI2A 4URFA 4HQLA 3ZG6A 1K98A 4CMKA 1CEYA 2H1HA 1D6MA 1PFVA 4IIGA 3FGZA 1XRPA 3KXLA 5FPYA 5KUTA 2AWOA 1EQAA 2UYQA 2FHPA 3N0RA 4MITA 4RXTA 1M1YE 5U4QA 4BO9A 1NW7A 4DIFA 1C3OA 3TDKA 5IT4A 3AEQB 3FR8A 3ZHOA 1L6IA 4QICA 5J47A 1DCMA 4DDUA 4MQ4A 1OGIA 4EUEA 5ESWA 3FHCB 1JP7A 5BURA 3W2EA 1JSXA 1MC1A 1P9RA 1W4CA 3I05A 2M2IA 2FP4A 3D4NA 3EE6A 3FFAA 1ICEA 4PYLA 4JGIA 1WB4A 2GFHA 3GIDA 3O93A 3RK0A 5JAUA 1MIOA 3UJBA 4QNRA 1SHKA 2BMVA 3QTTA 2IHTA 2J30A 2FEOA 1F17A 3T5AA 1JA1A 3VU3A 3PGA1 1PE0A 2ADMA 2WJIA 3REQA 3I76A 1RJDA 2UUCB 5JY6A 2QRLA 3N8DA 3I2JA 4AKGA 3EULA 2YQZA 1DU4A 1GL6A 1XTIA 1U3GA 2FEMA 2IYTA 2P9QA 2YXPX 2DJ5A 2XCUA 3TGWA 4PCVA 4C3VA 3BYZA 1HA3A 1VBMA 3JQEA 1UP6A 4XJSA 1GPDG 5CB0A 2PFGA 1S3SA 4WHMA 3I01A 5AI0A 4PLFA 1RXWA 1N77A 3RRNA 1Z74A 2FZVA 3A1CA 3WWCA 2QG9A 1C14A 4KRYA 4JXZA 3LZCA 4LJRA 4AECA 1XQ9A 4DQ0A 1VECA 1I6WA 3IAEA 3K0EA 2H1SA 1RXEA 4AS2A 1M34A 1FF9A 1E2UA 2FSVC 2HJGA 1CPYA 2PPVA 2YV2A 2ZAMA 4G26A 5F33A 2YN0A 2LTAA 1ZNXA 2BM9A 3E48A 3EIWA 3HDGA 3KZ1E 3K0CC 4WXYB 4EL0A 4WINA 2ECPA 1Z2AA 2Q6IA 3DZKA 4REQB 3K70C 3V2GA 2HIAA 4NNJA 3WK7A 1Y5LA 1ESNA 1QE0A 3IIJA 4FKMA 4A16A 4AAYA 2OPHA 3WQRA 1IBSA 5DW3A 4YXWD 1A71A 3JWHA 4CMEC 1FMLA 1IBRA 2RC6A 4Q6WA 2Y1LA 4Z3DA 4Q82A 1T4CA 3CZPA 3WFIA 2PRYA 4D3XA 1IK4A 2C1XA 5EYPA 1JAZA 1KS2A 3QXCA 1QH8A 3IQEA 1GKLA 5C35A 1ISFA 3EGWA 1ACLA 4CKWB 4F91B 4HZGA 1QF9A 4GHWA 4UDXX 5HTKA 4MWTA 2GD6A 2ZT5A 2VP2A 3T3DA 1K89A 3AVVA 3TSWA 3UAXA 1RPTA 5JQGA 3CONA 4G0OA 1LTKA 4RZXA 5F7XA 3OTHA 1VHLA 3HBNA 3EG5A 3U5TA 4PG5A 5HPYB 1OY1A 1I2CA 4NS1A 4X41A 2ET6A 2WNHA 2R6JA 3DQQA 3SDZA 2BMFA 2VQ3A 2OXEA 3UENA 2WWTA 4LMRA 4PHHA 4QDUA 4P7GA 4BNZA 4DLTA 3O91A 2KI5A 1RYMA 2VNIA 4K9SA 3OFSA 3RT7A 4B6GA 3WZMA 2MSEB 1XKLA 2OQIA 4U6SA 3B13B 3OCUA 2I4LA 1E4OA 3GFGA 4FFBB 4I4CA 5IZCC 4L0DA 1MVLA 2JH9A 1T5BA 4CM4B 2NIPA 4YLEA 4R8MA 3MUOA 3UHOA 3HHEA 3CF6R 3MM4A 5KMGB 2WD7B 2P2DA 1Z6XA 3L18A 1SPXA 2F4VB 1OVMA 4O4LA 4IHJF 4P7BA 4XVQA 3WFJA 1NMZA 2JGRA 4PF1A 5FNZA 5FA5A 3UCFA 2DH6A 2C2GA 1RYHA 3L3BA 5CK5A 4UHBA 5I8WA 2VQEB 1YB6A 4GSKA 1K0FA 1W29A 3N5KA 4RS3A 3FNRA 3KAPA 4HJXA 1CZRA 1F5SA 2JGFA 2X0KA 3N7UA 4FGZA 3A4NA 3PU6A 3V8EA 3ZU3A 1S8OA 1EVJA 2Y4OA 1KJQA 1V16B 4OGLA 3W2IA 2HDWA 1BXRA 5AQ1A 2A6PA 3L8GA 4TRNA 2ZSDA 3RS4A 1JHVA 1P7PA 4JL5A 4CCYB 2JBAB 4D4KA 2HJHA 1A9YA 1TKRA 4GNKA 2DOKA 2QN9A 3ROFA 4B7ZA 1SELA 1DC3A 1CQZA 2VF5X 4TXMA 3GBSA 1G21B 1OCEA 3EXHC 1SCUB 3OPQA 5AW9A 5FLXA 2CCGA 3T5BA 4AN0A 2GPNA 5KTTA 4NBNA 2DFVA 1YUBA 5G3YA 1A50B 1NMEA 2GB4A 2GT1A 1MX9A 1SR8A 1QTNA 2SKCA 3WXBA 1RE0A 1CR1A 1VZ3A 2QTWB 4NEQA 4RGYA 1KP3A 3M9WA 3SXUA 2QHXA 3F6EX 4TKZA 4IWNA 1AKNA 1CF2O 2JGDB 1W30A 4R4JA 4D4HA 2Y92A 2JAHA 3ND9A 4CMEA 1SXJB 2AGVA 1Y6ZA 2F3RA 2JAPA 4G4SP 4ZVRA 4HL6A 1Y4UA 3I28A 4J76A 5LQJA 3S27A 1NZJA 1NWHA 5JEEA 3PRKE 1U9JA 2FSGA 1KFEB 1LFAA 2A33A 2QZ4A 4HT3B 5JD3A 4N5HX 2CNNA 4XVUA 1YI8A 2XIJA 13PKA 3N6VA 3WLIA 4WNCA 3WXMA 3FMVA 3CR8A 4ON9A 4D8XA 3NC0C 2IDZA 3AP1A 4UC0A 3CIFA 2XCLA 3MFYA 3RS2A 3RYIA 1IQRA 1EESA 1BW9B 4QPDA 1UZLA 3D2LA 3ZDXB 1DJNA 4YJDA 4MA4A 3U9TA 2X0IA 4EG6A 4J3FA 1KI4A 1NVBA 4NJMA 1U3DA 3UOAB 3HSSA 3Q5EA 3AG6A 1TYZA 2XRFA 3BOSA 2Y1GA 2XY4A 1JXMA 3FN4A 3LX4A 4OHXA 1B2RA 2DLNA 4K2AA 5F5XA 3M6VA 2GO7A 3GAAA 4EX6A 5K0BA 2ZU0C 3PLNA 3WGTA 5JH7F 3L40A 2J9YB 1E4YA 1F60A 3Q7QA 5CYOA 5K3FA 5FUYA 5C7YA 1CE8A 1AQUA 3DNMA 3O75A 1XQ1A 3V7NA 1CZOA 3N8GA 3N2LA 3KELA 4MIKA 5JJCA 2ZYUX 3Q7TA 3OA2A 3TUZC 4B3FX 3UK1A 2HRQA 2AFVA 1UZAA 5DF1A 4NU5A 5C7IO 2J9FB 5DZSA 4LF7B 3EXEB 3ELWA 5IZ4A 4HATA 2CE2X 5CDHA 1R5OA 3CUWA 3QKWA 4K6MA 5TMBA 3DO6A 1O08A 4GI1A 1DNPA 1TU0A 1YSCA 4P9NA 4EX7A 4K6HA 3VR3A 2XXAA 2AG0A 2AG1A 1L5ZA 4PQYA 2D2FA 1Y4ZA 3NGLA 4KODA 2I34A 3IUSA 2A0WA 2R5FA 3HVJA 3SPXA 4B48A 2TMGA 3RFVA 3G2MA 1MCZA 2QR2A 4EJMA 1UBGA 3TQCA 4D9GA 1WW2A 3B7WA 3CLVA 5KYTA 4ZIRA 1JA0A 5A7GA 2PWBA 3LU1A 2O0JA 4FWIB 1KC1A 2F48A 3A11A 4KLRA 4QTZA 3AW9A 5EGNA 1V8ZA 3RSOA 3T3NA 5IVIA 2KQUA 2SICE 2ODBA 3GP5A 1MJFA 1NW5A 4DV7B 2QPTA 3CUUA 4NCJA 2PNFA 3CTPA 1WB9A 3DHWC 3DBOB 3KYDA 4CNQA 3N0TA 1N0HA 4KVFA 3RASA 3FCCA 4JBNA 7YASA 4YP0A 2CF6A 1MX5A 4HVAA 3V34A 5CJ2A 1O4VA 1P1CA 3E9MA 2VZLA 2J3QA 2BH2A 3TL6A 5HIAA 3I09A 4GC9A 4MUBA 3B6ZA 2WF5A 3D6VA 4Q3KA 3RJZA 1KQGA 1NQ5A 1G8AA 1OVGA 2HC9A 3TLGB 4AIRA 3P2YA 4ZGGA 4CFYA 5EPOA 3T9EA 2NSLA 3VPSA 4WN3A 3DVLA 3CZ4A 1L7VC 2NVWA 3DKPA 4DR5B 2CNKA 3RYIB 1CJMA 1O54A 3LX8A 3Q6MA 4GRDA 1AS3A 4JB0A 4Q4LA 1WCIB 1DBWA 1ZD4A 1F0NA 2OE2A 1KDYA 1TVKA 2A7QA 3FF4A 521PA 3UUWA 4CKCA 5F7OA 2V6IA 2RH4A 2X86A 1ND6A 3QA9A 3M82A 2VJMB 1F2TA 2OK8A 3OFJA 1U81A 1EZ4A 2OSVA 2RHJA 3HN7A 5A4DA 4U6QA 2QP3A 3BJEA 4W4TA 4KXNA 4F45A 2IZOA 3H87A 4KXVA 3RYCA 1F5NA 4EB8A 5B1IA 1HTBA 3BG5A 2DUMA 3GLSA 3K31A 4XGNA 1Z37A 4P3PA 3QUAA 4EFLA 3IRVA 3ZE7A 1RVV1 2QG4A 3IDZA 1UOEA 4F5YA 3DAOA 2OKGA 1N6OA 4R2LA 5CFLA 1N78A 3VYSB 2QMQA 3LY8A 2XSZD 3R6LA 5E7IA 1P4AA 5BSKA 3LGAA 3NIWA 4JSYA 4I1IA 8ADHA 1W85A 2XLCA 3U37A 4D98A 3MJTA 3OPXA 4J0IA 3HCWA 3SXPA 3EZ6A 1FZTA 3KXIA 3CLRD 2I7CA 4H16A 5BVGB 4WBXC 1VQ1A 1O94C 2LDBA 1NI5A 3N70A 4LXYA 2AOXA 3OPVA 3VZCA 3IUNA 3THXA 1H85A 3MUFA 3O7WA 5JCZA 1Y8RA 1GQQA 1JXAA 4M1ZA 1ZYUA 3AJAA 4LGMA 3MWEA 2O3TA 2VSXA 1PR6A 1AZWA 4M0EA 2KB0A 3RIHA 3TIVA 3FUTA 5IJZA 2C4MA 3ZY5A 4PBSA 3T3MB 2UYCA 2J4FA 4US2R 4I55B 4Z5XA 4BTEA 2I2FA 3P1JA 2FLVA 5CK4A 4E5SA 3DTVA 2OZKA 1UOOA 3C41J 1VRVA 4EKNB 4JV5B 1NKSA 1TM3E 3NT5A 3HXLA 3FMOB 2O2HA 4RULA 3RAJA 3EDYA 3H2GA 5F64A 2R9VA 4HNHA 4YCJA 3TJRA 4AJPA 4P31A 5FPKA 1DO8A 3RT9A 3BPSA 3QF4A 3RB8A 4A1FA 4BGVA 1Y8CA 3JTEA 3KHSA 4H77A 4JBIA 4UDNA 4S2EA 1ZOIA 4GP7A 5AVXA 1JG1A 4CTOA 4UBKA 5I7VA 2O5VA 1EE9A 1F0KA 3OZFA 3UJPA 4L5AA 3NALA 1P2VA 3T7EA 5JXGA 1L1RA 1XC7A 3AERA 4KO1S 4UXHA 2X5KO 4CM7A 3HDJA 2H5IA 3NUQA 5AVTA 2EX4A 5CEJA 1K1EA 1MO5A 1JPJA 3M0EA 2ZTUA 3UKOA 4A8JB 4G9GA 3QEKA 4D97A 3VKFA 1C3EA 1AX9A 5HFJA 1XMXA 2QI9C 3QU9A 4DLNA 4RQTA 4BJ1A 1C4KA 1U8TA 3MINA 3PXAA 4TS9A 4C5BA 3D0KA 1WXQA 5ALJA 1IBLB 1TD9A 2MYUA 2QZJA 4MOWA 1E9SA 4M1MA 4V0SA 3ZDBA 1SJ9A 1UBEA 2Q3EA 2WJAA 3LT1A 5I5EA 5IFKA 5M34A 1LSJA 1UMDB 2I1VB 3THYB 1F2UA 3G68A 5EMMA 4F9EA 4M60A 4JUFA 4NZ9A 2ZTLA 1P4HA 1SXJE 5ALRA 1LDNA 3DG9A 2CFTA 4HMQA 2OBMA 3TLAA 4C14A 1NJSA 2Z4SA 2I87A 3I32A 5LQRA 1ZQ1A 4BAUA 2QKYA 3ZY6A 5JARA 2WYWA 3QV1A 5I6DA 4QFCA 4UVEA 5EKSA 1C9YA 4RD6A 4EFMA 1NAHA 1QR2A 3M4NA 3PWZA 3J7AC 1QH0A 1RRMA 3QFSA 4LMAA 2YDXA 1QRRA 3AVUA 3ZE2B 5HA5A 5K8JB 1GN8A 2HMTA 1US8B 3BSWA 3I9JA 1A69A 1HDCA 2P9FA 3O92A 4DLPA 4E22A 3FNIA 4LFCB 4C9BA 3DEJA 4DCPA 4KZKA 2QJWA 3AVWA 3Q3IA 4RK0A 3FPBA 1JR2A 1NTRA 1D1PA 1J07A 2CMHA 2XH8A 5LWQA 1ETUA 4ZVOA 2CD7A 4RF2A 2EKZA 4F06A 3PDIA 3EXEA 1VBNA 4IIBA 2A5FA 5HDQA 5J1TB 4BS9A 5BMOA 2D4HA 2W2OA 2C88A 2O2IA 5CVVA 1C4XA 3WWOA 2QORA 4QQNA 1P33A 3PGLA 3UHPA 4BQPA 3SR0A 5JFTA 1GDHA 3AESB 2TSYB 3BXXA 1U3WA 3QOXA 2JB9A 1R6DA 3L43A 4IR7A 4TKMA 1W94A 4UAGA 3OFKA 4HDNA 3B1VA 1RAIA 3SBEA 3CBQA 1MIHA 3FMFA 3NLLA 4R1PA 2EAUA 3EC2A 4ZI7F 4IFBA 4OA8A 4HMPA 2WNSA 5K1ZA 2CL0X 1UWKA 2PBFA 3ZW7A 2AN9A 4LY3A 1D4OA 1NQVA 1SHZA 2FJUA 1KS9A 4G5YA 3DPUA 1RKUA 3T7CA 3E1SA 3CEAA 1HYEA 2F43B 1W0JD 3X2EA 4EG4A 1N0WA 4GGPA 1A77A 3IOCA 3EMVA 4PFKA 1H4QA 3HBMA 1YA4A 1VA4A 2I1LA 4JSRA 5KNBD 2X13A 4R8RA 4ME6A 3ANTA 3FUUA 3INTA 3ADCA 5IUKC 2R47A 1KFCB 3ZWPA 3A26A 1LLQA 3MFQA 1N5MA 4DV2B 5KNCH 1PZFA 4P5DA 4A6DA 3CLTD 4EI9A 2EFGA 3C6YA 5HZGA 4AF6A 2HRZA 2Q62A 3QZUA 4PQRA 5L7YA 4GOND 4QX6A 1GYRA 2I3BA 1JVSA 5ERGB 1NBMA 3DT8A 1UQTA 2CLKB 1DRKA 3HO6A 3L8ZA 4UDOA 3TVYA 4EGSA 4Y2PA 3O4JA 3SQLA 2X8JB 3NHJA 2XMRA 4WOPA 1NQUA 4Y6RA 1YL7A 1N7GA 3DHNA 5FOSA 2QX7A 3GLIE 2NOAA 5LZ5A 4D3ZA 1XO1A 3V3TA 2Y77A 1JQ3A 4BIMA 1QVRA 4QD3A 4YONB 3FPKA 3LWZA 2BZGA 2AUNA 5K5EA 2IYRA 4CM4A 1XYGA 1JB9A 3RDPA 3UUFA 4WCDA 4IVPA 2OCYC 4FFBA 4YN3A 3NFYA 2IXTA 3EYAA 4C20A 1PHRA 3IHWA 2R60A 2QNRA 2Y0CA 5GOZA 1NLZA 3WYEA 1G20B 5BSHA 3NC4A 1Z5UA 4L78A 4FMCB 4I5EA 4LEIA 4Q39A 1QP7A 3BFVA 2CHFA 2E5LB 4KNYA 3PEEA 3RC1A 1MVOA 2BE7A 4AZWA 1ZA2A 2C04A 3AGQA 4QTUB 4RETA 1N1EA 3W9UA 4YRZA 3W2HA 3MSXA 4LJYA 3R9XA 4JJKA 1R50A 1T6XA 3I9KA 4LOHA 4Q1CA 3OLYA 2PLAA 1GCAA 1KPIA 721PA 3DPSA 3DJYA 1PR2A 4BZWA 3OTIA 2JL1A 5KNDH 1U7UA 1O58A 5CDTA 3RUAA 4P4SA 5KTOA 3CXUA 5AVVA 2OV1A 2DBZA 1PLLA 2IU6A 3T8YA 3ZPXA 1MJNA 2P75A 3TE7A 3E35A 5ALPA 5LJIA 4QRHA 4F11A 2CBXA 2RHGB 2JD2A 2HF7A 1RI5A 3W77A 4WUTA 2QPAA 4ZAVA 4TLDA 2Q46A 1AGPA 2GPTA 5C53B 5JTTA 3KZNA 5K6AA 4C4PA 1CIPA 5CVTA 1EDEA 2VNJA 5EVJA 5EIEA 3GCWA 4OQEA 3F49S 3SJBA 4JDUA 3V4FA 3MG9A 3LO5A 2VHCA 3LM8A 2VAMA 2O8BA 1NG1A 1IFXA 2J0EA 2NUAA 5JROA 4R1TA 4YI5A 3WJ7A 2R97A 2R6AA 1CUFA 2ZETA 1E6UA 3HUDA 4I1OA 1JIQA 1X2EA 2J46A 1DI0A 3LZDA 2HCTA 4LJ5A 4YNBA 1X1SA 4TLAA 4QPNA 1BX3A 3DR5A 3S2IA 4X7MA 4CTKA 3ZZ1A 4W5QA 1W36C 4CT4B 3R3VA 4WXRA 3LKBA 3CE6A 2A84A 3BZUA 2C5GA 2W4MA 2JLAA 2FJ0A 2PLFA 1DWPA 2VTVA 4QDJA 1QWOA 4LC1A 1Y1RA 3Q3EA 3PF8A 1YQ9A 2F3TA 1Y7PA 2J9FA 2OBXA 2HYDA 2W6ZA 3CT6A 4LSMA 3DLIA 2Q3DA 2J7KA 1D04A 1M6VA 2ZI9A 1WUIS 2ZIVB 3DFIA 4Y2JA 1E3QA 4YACA 4ZZ2A 1E4EA 1KDZA 3RYTC 1T15A 3ZWQA 4ZYZA 3PENA 1HSOA 3WGYA 2XTJA 3KUDA 3X1XA 2PUAA 3V00A 5DU2A 1PWHA 3D64A 3IQXA 1CU1A 2IYSA 3EA5A 2V1XA 3EF3A 4KO3S 3DBHA 3SR4A 3L0CA 3MRTA 3ZD9A 3Q1LA 3OQIA 3M4JA 1ZM3A 5HKKA 4KIUA 2YDYA 3ZLBA 3IDOA 4WH0A 4NJMB 2QTMA 1MR3F 1WXHA 2R6CA 3IOYA 3Q3CA 3CRZA 2ONKA 3PD7A 3AZQA 1XQWA 1L7AA 4QPJC 1KK1A 1V5IA 2BEUB 3K4HA 3UK0A 4L76A 2DGDA 1W46A 1VIDA 2R86A 2WAMA 3GF4A 1N6IA 4G0QA 4HAUA 4OHMA 3TRJA 3T3OA 4DR1B 2YIVX 2ZYVX 1NMSA