2OO5C

Structure of transhydrogenase (di.h2nadh)2(diii.nadp+)1 asymmetric complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title Structures of the dI(2)dIII(1) Complex of Proton-Translocating Transhydrogenase with Bound, Inactive Analogues of NADH and NADPH Reveal Active Site Geometries
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 48
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2oo5C00
2AG1A 1U2DC 4GM1A 4MQ5A 4J1TC 4V1CB 4IAOA 4BN5A 3EA4A 3PKIA 2VBFA 2EZUA 3PKJA 5BWOA 2OD7A 4FZ3A 4UTRA 2FR8C 1Q1AA 3ZG6A 4MPJA 2IHUA 3GLSA 4HD8A 2JLAA 5MFZA 4X3OA 2QQFA 4JUBA 3CLTD 2WVHA 4QELA 2V3WA 2DJIA 3EYAA 4MZXA 2H4FA 4JUFA 4TWJA 4UUAA 1SZCA 2OORC 3FSJX 4BVFA 2C31A 3E9YA 4JD5A 4UU7A 4Y6LA 5BWLA 5MFPA 4C7BA 4FEGA 2VK1A 1E3TA 2W93A 2VK4A 2BRUC 1YHYA 4BUZA 4RJKA 3CLRD 1M2GA 1PTJC 3OE1A 2A1TR 4RMHA 4Y6OA 3U31A 5EJ6A 2JIBA 3JR3A 4K9NA 4Y6QA 1PVDA 1ICIA 5DGTA 4BN4A 2X7JA 5AHKA 5EJ4A 3FZNA 4BVBA 2EZ8A 1YNOA 2UZ1B 2Q28A 1Q17A 2Q5JA 5EJAA 4I5IA 2A1UA 1UPBA 4GPEA 5FYQA 2Q5OA 1BFDA 4FVTA 2B4YA 1M2HA 4Q9DA 2PANA 2WVGA 1YC5A 4BVEA 4JU9A 4GG1A 1Y9DA 4D5GA 2H4JA 4MPPA 4UU8A 4GP9A 4J16C 2WVAA 2Q29A 2JI8A 2H2HA 3CLUD 3F6EX 1UPAA 3EY9A 4K9QA 4QQ8A 3RIGA 3GLTA 1J8FA 3RIYA 4JUAA 4BV3A 4JUCA 3K35A 1M2NA 1U2GC 4JT9A 1Q14A 3CLSD 3GLUA 5EJ7A 2Q27A 2FSVC 4UTXA 3ZGVA 2Q5LA 1Z8NA 4JSRA 4GM4A 3U3DA 1U31A 1V5GA 5IMSA 4KGDA 1ZPDA 4F4UA 1N0HA 1DJLA 1EFVA 4ZZIA 1JSCA 4FEEA 1M2KA 2EZ9A 4K9MA 5BWNA 2FN3A 1O97D 4BVGA 1EFPA 4K9PA 1D4OA 1QPBA 1S5PA 4G1CA 2JI9A 5D7NA 2PGNA 4K9KA 4IG9A 3LQ1A 2NXWA 4UTZA 4JT8A 4O8ZA 2IHVA 5MGNA 2OO5C 5K6RA 4KXQA 1YBHA 2EZ4A 1M2JA 3F6BX 2H2GA 4JU8A 2AG0A 4D5EA 1PT9A 5EJ9A 2H2IA 2Q5QA 1T9BA 4ZP1A 1PNOA 3IAFA 1POXA 4V1CA 5FEMA 1V5FA 5EJ5A 4UTNA 1HZZC 2FRDC 4JUDX 4KPUA 2JLCA 1V5EA 3D81A 3HWX1 2HJHA 5DGDA 1OVMA 3IAEA 4L2IA 4QPZA 4V1CI 3PDHA 4RMIA 1U28C 2NYRA 2JI6A 4F56A 2JI7A 4UTVA 1XLTC 4COKA 1PO7A 5EJMA 1O96B 4K9OA 1UPCA 4RMJA 3ZGOA 4R8MA 1OZGA 1S7GA 1YHZA 3D7KA 2H4HA 2VBIA 2H2DA 2H59A 5EJ8A 5K6TA 2VBGA 1MA3A 2OD9A 4K9LA 4TWIA 3CF4G 1YI1A 2FWNA 2PGOA 4MPRA 1POWA 5MF6A 5K2OA 4BV2A 1T9CA 4HDAA 4RMGA 1MCZA 1PYDA 3D4BA 1OZHA 1Q6ZA 2IHTA 1NM5C 3GLRA 2UZ1A 4RJJA 1OZFA 2VK8A 3JWPA 5DEIA 4IF6A 2VJYA 2H2FA 3HWWA 4RJIA 3FLMA 1YC2A 2EZTA 4BVHA 1T9DA 1SZDA 4L3OA 4GM0A 4UUBA 1YTLA 1T9AA 2OD2A 4X3PA 5K3SA 1PI3A 4C78A 1PNQA 2QQGA 1YI0A
chains in the Genus database with same CATH superfamily
2P6UA 5E95A 3ITDA 1SHLA 1CUSA 5JO9A 4JJ4A 3UJ6A 3TLCA 5K8LA 4WACA 1U7OA 2J6HA 3V00A 4CLXA 5KSZA 3BKXA 1HPLA 4MQ5A 3FPAA 3ZK9A 1A9ZA 2WHXA 4Q48A 1NN5A 2FRVA 1Y4ZA 2V7GA 3CR7A 4D9HA 5CH8A 4B4VA 1YL7A 2ZAGA 4LV5B 4LF5B 2H63A 4RSMA 3T1HB 1OXKB 3M5DA 3AM5A 4JODA 5CRIA 2XZTA 2Z9DA 4QWMA 3ZHCA 2G8NA 3D4PA 1SKBA 1B7GO 4WLFA 2X23A 4JQOA 5I5GA 1OVGA 1PTKA 2I71A 3TVDA 1ZMXA 3KYDA 4RXMA 2XDQB 1G4AE 4XCXA 4ZYVA 3GGDA 2X9GA 4N49A 1AS3A 2FR8A 2BM8A 2HDHA 3RVJA 1YFLA 4OX9Y 1E9EA 5GADl 5LA6B 3DLBA 3HA7A 1WUKS 3CUKA 1JHDA 1G21E 4KO1S 1AKYA 3BQNB 1HWYA 3MN1A 5DW3A 4J3JA 4N0PA 1RYMA 2H8GA 3ORHA 2P9QA 2OZLA 2GARA 3IQEA 4M98A 3U3MA 2XQJA 2ZB4A 3F73A 1DJMA 1ZWKA 2PS3A 1L5QA 3DCIA 5JMTA 2HSGA 1JXAA 1MTZA 5FI0B 3RKUA 4J7XA 1IPHA 2FG5A 3OY7A 5CNJA 5ES4B 4S35A 1RMYA 2VXOA 4N7JA 4OJNA 3VJKA 1G5RA 5I3CA 1KMCA 1TC1A 2G0NA 1QV6A 3G9XA 3HY3A 3K8YA 3QXCA 3U3RA 3ZJTA 4MEJA 3OJLA 2ZI6A 1SCBA 3FJYA 4BV9A 4PM4A 4AS1A 1VJ1A 4CM7A 2X5XA 3L7LA 1NF3A 1ABBA 3WL5A 4N8SA 3YASA 1UOOA 2VNJA 2H4FA 3E5RA 3CIFA 2AW5A 1NDHA 2GZRA 3DO8A 4JA0A 4UUAA 3R3SA 2RB4A 1NYLA 1CJSA 2AFVA 4O4LA 3T3HA 3ZWCA 3OFND 2R5NA 1N2XA 2WTNA 3RUAA 1GPYA 2CYCA 2DR0A 4HLUA 2OV8A 4X1IB 5BOVA 5LWQA 4IRMA 3UAOA 1Z73A 4Y6LA 2H51A 2HB6A 3W5UA 2IEDA 4J1QA 1O95C 5ECDA 1NP6A 2XE4A 2DQSA 4HMQA 3NUGA 1JIJA 1QVRA 3VMFA 4EG7A 3VPCA 5JHGB 1W35A 3INNA 4OY3A 2FLVA 1IMOA 1KARA 4MS4A 3I9OA 4UNSA 4EUHA 5AUOB 3T0GA 3GQBA 2O2GA 3PQ4A 4RC9A 4EBFA 1OBVA 1P8AA 3FPKA 3GRKA 4M8LA 3ILHA 2ORVA 4TUYB 1RM0A 2WF6A 3QGMA 1ACMA 3SHVA 1JPUA 2ONJA 4B44A 3L0PA 3N05A 1T29A 2BRUC 4MYSA 5SY9A 1AA6A 2FN9A 1UK8A 1EX7A 1CHDA 1HDOA 3BDVA 1E7YA 1R4MB 3HYRA 1NSYA 4DW8A 4F6RB 3UENA 5T6MA 2IEBA 2NV6A 3EQ8A 3F4KA 1O94D 3DB2A 3JCZA 4X8OA 4TLAA 4Z0NA 5JQWA 5IT9A 2QY9A 4ER5A 4Q4CA 4CM4B 4M8IA 2VSQA 3D0QA 4NPAA 1T5DX 5MN4A 2F90A 1IBCA 2QLBA 4R1OA 4DR7B 3ZDAA 1GTRA 1ICIA 4GKVA 4QE3A 5DGTA 4IINA 2VPXA 4D5GA 3T3OA 3OF2A 5D6NA 3W8FA 2XWQA 1QMGA 1KJZA 5JISA 5DLPA 1H2YA 1YT5A 2PBZA 1XMSA 3RU7A 1Z4LA 4IVNA 4RHEA 1N34B 5DI3B 2OQRA 1U2PA 3UHJA 1AJEA 2R8OA 4FBMA 4G5OA 2HMUA 4GVXA 4F72A 4HXGA 4Y0AA 1FX0B 1QVWA 2WPNA 3QFFA 2WSMA 4AX4A 4MUAA 3GVCA 1T3GA 3R6WA 2ILTA 3NONA 1D4AA 2QPOA 1I6LA 4BLRA 5CFQA 2V6MA 3WGLA 1UJCA 5C1PA 5B3AA 4QAJA 5CVCA 1Z22A 3L7KA 4MUYA 5MGBA 4DHWA 4NE7A 2GN4A 4QZVA 1Q3TA 4OSEA 1C1XB 5I9TA 1T1SA 2DAPA 3ZH2A 4MUEA 2A5LA 3DHWC 4MLDA 4YMVA 4RDXA 4RNDB 2ZBUA 5BQPA 4HGNA 4FFVA 2H1OA 1M1YA 1A9XB 4DB4A 1Y48E 4G81A 1XPJA 1DBVO 4TTVA 4BRWA 2HSDA 2EP8A 4PS1A 1E1YA 2Q29A 4EELA 1UMCA 1QIMA 2QUZA 4KQJA 1PJQA 4FB4A 3CLUD 3ZDFA 2NU6A 3C3DA 2C54A 4DIMA 3P2OA 1OI4A 3JD4A 1C3OA 1HR0B 5HKLA 1DBQA 3COZA 1XBTA 2QMEA 4HWKA 4Z2AA 3BRSA 4OG2A 5TVGA 4FFOA 1RWMA 3K0CC 5FTJA 3MLEA 3CZQA 1AOXA 1Y37A 1ULTA 3A6HA 4P2GA 2OYCA 1EAYA 4CQJA 1OD6A 3REQB 5A04A 4EMUA 1E3JA 4B35A 4OGLA 4QBFA 5AOAA 2H54A 4FSXA 4UHDA 4ZVVA 4XQ9A 1FEZA 5C4GB 5DNYB 1IBKB 5I9IA 2ZJ6A 1E4EB 2WSBA 4JVMA 3KOWA 3T5CA 3R8CA 4AKHA 4XX0B 5KQLA 4J3NA 5CCXA 3O8CA 3PR1A 2AZXA 4QQNA 4F71A 1HYQA 1YMVA 2BSQA 2VEOA 3KFXA 2QX6A 2V7PA 1VB5A 4YYZA 2WFMA 1K5HA 1E5VA 2FSVC 4F04A 4ZEVA 3O74A 3RYFA 1W96A 3L4EA 3ESBA 1WDMA 2VO1A 3OQIA 1ECPA 3BYZA 2O52A 3SYLA 4BFUA 3MIIA 2AQ8A 1SY7A 3E1KA 1EGMB 4RVHA 2OG1A 3BULA 3PFGA 2YWGA 3GF4A 4B46A 5JNRA 1Q0PA 2RJ3A 3BGVA 3L0CA 2XOXA 1IPEA 2ACEA 3FDZA 1GRQA 3BJZA 3HR7A 3HFGA 4M0EA 2NUAA 1Z26A 3LSYA 3NHKA 4ZAVA 1CUBA 1KJQA 5CVTA 1VE7A 2OYSA 1HG1A 2V0CA 3PCTA 4L6CA 4A6DA 2VHEA 1AUPA 2QTGA 2XLCA 3FBTA 4N12A 1V2HE 5D87A 2QN3A 4COOA 2Z58A 3W90A 5G3YA 1CR1A 4OAOA 4WHMA 1DIHA 3AU8A 1GPWB 3NWJA 4LYJA 1RCTE 2AV6A 2MTBA 3L02A 3UWSA 1JHVA 1P44A 2Q2NA 1E6LA 1EUCA 1RWVA 3OWHA 1Q7CA 1VSUA 4HX5A 5K3AA 3HJFA 1YRHA 1IQUA 1XVTA 1K6XA 1CUXA 4GW3A 4IFEA 4OQDA 2HWKA 4RHYA 2HGSA 3I04A 4LDNA 1NJ2A 1FP4B 3MGCA 3TLJA 1PQYA 1XLVA 3T06B 4L8YA 3ONEA 3T5AA 5C53B 4FLFA 5J59A 4P4SA 3WG9A 1FSZA 5ALNA 3ICEA 3DQQA 2IYLD 1PJSA 3Q3CA 2AOWA 2R96A 3Q40A 4NMXB 5BURA 2DR2A 2C4KA 2OHXA 5DM0A 4K3UA 1L4UA 4J6EA 1NXXA 3NHWA 1RPTA 1U0SY 1NE7A 3PC8A 1C9DB 2IW3A 3QLEA 3EUFA 3C15C 5FFMA 3FYUA 1ADCA 4N5MA 1XUOA 1C8BA 1HC7A 1G5TA 3DCJA 1C0PA 4D8WA 3DBLA 2L69A 1N5JA 2I34A 2FETA 3GRUA 4KYIB 1P6XA 2KX7A 5DV9A 1KA9H 4MUXA 3ZK8A 3R6TA 4B83A 5AVXA 2FTKE 4WKBA 3CW2A 3TW8A 3R6LA 1RYFA 1XF1A 3BSYA 1ZNWA 4UHFA 1R0RE 1YRWA 3QBJA 3PNMA 4NJMA 1EG7A 3QG5A 3DDZX 1BD3A 2Y67A 2AOVA 5CDHA 4L4UA 1UM8A 2MR6A 2AG8A 1CUCA 2X0NA 3VI4B 2H2GA 3O21A 1EK1A 1SWWA 3TJZA 4D96A 4AU1A 1KBZA 2PFGA 1OXSC 4H1HA 3TPCA 2BDTA 5KTNA 1X1TA 1VMAA 3GCGA 4JLVA 1USUA 4C08A 5IN5A 4KACA 3U7QB 4HNSA 3SX4A 4Q3BA 2XQFA 5AXBA 2AMYA 3PFKA 4CV2A 4D82A 2IP1A 1XLUA 2IEGA 3EVAA 4IMRA 4E5VA 4PG8A 5I7RA 3EC7A 1XK7A 3OCVA 3NT4A 4R2XA 3A1FA 3UY4A 1R00A 1E1NA 2PXHA 2KB0A 2VPYA 2IZ7A 1V96A 4G0OA 3E6AA 1D8TA 5A1JA 5AICA 3LT5A 2TMKA 3CF2A 3MJCA 1ESEA 4ER3A 1OJ7A 4W9NA 2B78A 2BHRA 4YASA 5SZJA 3T4XA 1SU6A 5IZ4A 3RRZA 2YJ3A 2R6FA 2JLCA 4MMZB 3ZE6A 3QKRB 2I7DA 2FZGA 3C70A 5GP1A 4C14A 3V8EA 4MR8B 4DCVA 5LL6P 1DAKA 4IY1A 1IQPA 3BE5A 4Q4DA 2X41A 1N2CA 5HWSA 1RYDA 3W5DA 1NW5A 2DPXA 2X9LA 3L0IB 5HF8A 1RD4A 3VV2A 3FDIA 4NU8X 5ALKA 1Q2UA 1WM1A 2PZBA 3FUUA 2HCRA 3FPLA 1YH3A 2MSDB 4GKBA 4HX9A 5GM1A 3W8DA 3GT7A 4FZVA 4ZO9A 2Z8YM 1O0BA 2XNDA 1G66A 3VU8A 4CI0B 3KZCA 4F3NA 3P0HA 4WSOA 5FOWA 1DQRA 4YRGA 4YJKA 3TX2A 4FMBB 1CZRA 3HRKA 3P20A 1O96B 2CXTA 421PA 5AW3A 2GD6A 2O8VA 2IY7A 3QI7A 1NXOA 3O26A 3CF4A 1ZHFA 3Q5GA 1NR1A 4ZCMA 5JXWA 4DLVA 1L9XA 2MYUA 3T3GA 1QRUA 1LSSA 3SEFA 1B23P 5AVTA 3Q88A 2J4FA 3M2PA 3RRNA 1XLWA 1ISPA 1PG0A 2Z1NA 2JZCA 2JIMA 3OUUA 4ZAGA 2V6GA 1SQGA 4MB2A 3UBMA 2RGAA 2ZANA 4Q4HB 4TTAA 1KR5A 2FKNA 1Q84A 2H2DA 3WGUA 1XTUA 4OXNA 5EWLA 3ZHSA 4EYQA 3Q7QA 4G4GA 4ND8A 5JSZA 1ADBA 2B7BA 2Q3CA 4R9SA 2XXAA 3SOZA 1Y9JA 3BERA 5AI0A 3UKOA 1RAIA 4XB1A 3FLBA 3KJHA 3L7BA 2HMSA 3ZCUA 2CXHA 4DN6A 1LV8A 2A0YA 1Z0IA 3SQDA 1BROA 1GAWA 3KZMA 3UPDA 2G1AA 3GFSA 3PNVA 3FHOA 1GZ5A 4KWIA 4BMPB 4EF6A 2V7QA 3AMVA 5J5AA 4KVAA 4XUGB 4NCBA 1JFSA 2J9FB 5E2AA 4IIFA 1TYBE 1J7KA 1MKYA 1DEXA 1KQGA 1NY6A 2OO7A 2NXEA 2WKPA 3FCOA 1JP7A 1P9OA 2WU1A 2ZTUA 3N6RA 4WXYB 1N7JA 4HDRB 5NLLA 1SCNE 1YI1A 1O58A 1VKJA 3DE6X 3LZCA 3PFWO 3PSAA 2YS7A 2V7UA 2XGOA 4TVOA 1IEWA 3T3PB 3HB9A 4CL3A 2YUIA 5FUWA 3EGCA 3IA2A 4HFJA 4J4TA 1IEXA 2RCNA 2BKXA 3G9TA 1Q1EA 4LVNA 2Y99A 4LVUA 5CH5A 2JDID 2PKRA 1CK4A 4JB0A 3JWGA 4Q5IA 5AR1A 4YP9A 1E66A 2BM0A 1CE8A 2QZPA 3E3LA 1DKQA 3K4HA 3BCHA 3K9LA 5EZSA 5JCJA 3WIOA 2SBTA 2CL0X 4HWRA 1W1IA 1Z18A 1CWUA 1PX2A 4KC0A 4NH0A 3STYA 4RMGA 4R7GA 4ARBA 2J9GA 2JEOA 2ZVJA 4D6PA 3ZDDA 4CLOB 1OQAA 3HCEA 5CNMA 4LYGA 3WJ1A 1K8RA 5JYCA 1U6IA 3OCZA 5HIIA 2FEWB 3Q8LA 4UM9B 1MUUA 2G04A 4OQFA 4YRAA 5KYKA 1EJBA 3C4VA 1JF8A 3ZZUA 4HN9A 2HXGA 4RPJA 2WWIA 1ZG3A 3F74A 1PBTA 2BUCA 3BIWA 2CNDA 3HFRA 1GKKA 4Y6RA 2LRHA 4KI7A 4R0NA 4RY8A 1JE0A 5BNIA 5ERGB 2PSJA 4XGIA 4JSYA 3WNCA 3B5IA 1QX4A 3IP5A 1FS4A 2HK8A 2P78A 5JJBA 3PHCA 5L40A 4BQPA 5ENZA 3REOA 4Q1VA 3SE0A 3HB4X 3I76A 1VL8A 3R0VA 3TMYA 3UCEA 1EFPB 3K32A 2GZMA 3C3JA 1ZIXA 1RMQA 3OLZA 3NHAA 4NTZA 3TDNA 1K8ZB 1KJYA 2OD2A 2J3MA 1RYZA 3H9JA 2IK8A 4QFDA 1K88A 2GQ0A 2B7LA 3DKIA 3I12A 5CEJA 2F55A 1EZZA 1UT6A 2JGAA 2PSDA 4OHWA 2WAXA 3U4HA 1IBMB 5JZVA 3BCUA 1KWKA 1P72A 2NZJA 1OFIA 1Z0KA 5JVDB 3ER9A 3FRJA 3MAGA 5CJJA 3GT0A 3GCWA 3WIDA 5BN1A 1GY8A 1IEVA 5D3MB 2FDCA 2W70A 1R5OA 2WHYA 2QI9C 2YNMD 2LCFA 4ISBA 4UE2A 1UDRA 2CLOB 1WAMA 1O87A 4R41A 1H65A 3E82A 1IHXA 3TQIA 4MPTA 3H17A 2ZKLA 1WLYA 1RP7A 2DFDA 5LR6A 4J1TA 5FI3A 4HGPA 4ALLA 2ORWA 3DZFA 4KLZA 2XX3A 2DETA 4JEHA 2PJZA 4AJIA 4IILA 4A8PA 2ZRGA 4GC9A 4O4JB 1K3UB 2NQTA 5DHRA 4KE8A 4F4FA 2EBWA 4BN5A 5FPSA 1QH8B 4RORA 4U9UA 1MW8X 5L6MB 2JCSA 2L18A 5LU9A 3KZXA 5F4BA 2UDPA 3ZU2A 1TTPB 4OHXA 4DVJA 4HWSA 1NNLA 5D84A 1VDMA 2RB5A 3AFMA 3ZD6A 3LRTA 3AIOA 3U3XA 1IXKA 4FWTA 2G3YA 1FSGA 4X64B 3GFFA 3EXHA 1IWBB 1RM4A 1XMVA 3LQRA 4KOAA 4V0RA 1Z7WA 4F5DA 3HKCA 4BFTA 4B2YA 3BRQA 5LPNA 4OHYA 3USCS 3IIIA 3DR5A 3Q3GE 2GYWA 3LK7A 3V7YA 2PUGA 2RE8A 4F5EA 3NM5A 1IOLA 1E1RA 5IF9A 4RA9A 3PQ2A 4DV6B 1ADJA 3FRHA 1W94A 2XE7A 2ZYIA 3TW4A 3VR6H 1A9SA 1IAVA 2VDQB 4CQMD 4DMLA 1JFFA 2C9MA 2GTHA 4HEA6 5FP0A 1K1EA 1B93A 2Z8XA 1LX6A 1NZJA 4I9UA 3AF5A 4FD2A 1YFZA 2JFBA 2HMAA 3EVTA 1TPYA 3OZXA 5DF1A 3TOZA 4KHZA 3F8SA 3NHFA 1XC7A 4PLZA 2BF4A 5TMEA 1QR6A 2XNSA 2X0EA 3UATA 2WJJA 2P9YA 3URKA 3K15A 4PXYA 3DE1X 3WJ7A 3GFBA 1KSJA 3DOFA 1MDBA 3MINB 2P11A 5T8KA 2EBFX 3SXUA 4BMVA 5AW9A 1XJQA 1U0LA 4RCYA 4BO2A 5IJWA 1P2TA 1JLHA 5CM8B 4RABA 5EMHA 5B3LA 3RV4A 2Z95A 2CUNA 4CIXA 1JHPA 1D1TA 1TCUA 4G5QA 1A82A 4AVYA 4MV3A 1MHTA 4PC1A 4BTEA 2F9LA 221PA 3QX8A 2OQVA 2YMLA 1XZLA 1TFUA 3N07A 3LLVA 4X66B 3B5JA 4EHNA 5COQA 1TZCA 2YOHA 3AF0A 3HCFA 1KRXA 1N5MA 1KTIA 1JAZA 3O3MB 5FXMA 3OT4A 3AKYA 3DAPA 3P9ZA 5SZKB 3WWEA 4E1VA 1H69A 2CB9A 4LKRA 2W2TA 4L02A 1TIBA 3B1VA 4DUPA 4KQGA 4CR8A 4NX2A 4WN9B 3ZDZB 3TOCA 1ZSYA 3G2PA 3SN6A 3VJMA 4FHFA 5ALMA 3V4PB 5KQPA 3PF9A 4QO8A 1PTJC 1T0HB 5LD2B 3ZLUA 2JF0A 3E22A 4H35A 1BWPA 5KVSA 3E23A 4EG3A 3ANLA 4NU6A 5GINE 1E89A 1PUJA 4TGLA 4PPQA 3R5TA 2JIBA 5CIWA 1XQWA 2V54A 4JYAB 2I1WA 2O1XA 4PPGA 1H3EA 1PVDA 3BMQB 1Z47A 4U8HA 3P94A 4IDHA 3M6VA 3O4IA 3NHPA 2IEIA 4NYIQ 3VISA 2HCFA 4BTLA 4YR7A 2GDZA 3QVTA 5AHKA 1V3TA 2WAMA 5C5DA 4UQLA 1DO0A 4BVBA 1F3OA 3X2FA 2J1LA 3TLZA 2XUQA 3QEMB 3PGLA 2PUFA 1PU2A 1Q7BA 2WHPA 2FN4A 1AV7A 4J0EA 1FDOA 1NSTA 1OWPA 1SXJE 1NUPA 5JSUA 4PYJA 1LDGA 5E1DA 4INZA 2X7XA 1L7EA 1A9OA 3OWXA 1UPBA 1UBOS 3SFTA 3EXFB 4LQ4A 1W36D 4M46A 4XQEA 5BMOA 3RSZA 3IBGA 5K6AA 1X77A 4HYTA 4M1EA 3AKZA 1EK6A 1N3BA 3R3HA 2GVDC 1I2DA 4FOTA 4NDAA 5G0SA 1S96A 4ACAA 4F2PA 3NVKI 4ZQCB 2JA1A 3M5CA 1LX7A 1D6JA 2H17A 3RYHA 4JR0A 2TSYB 5DTEA 3I01M 3UWOA 3WFJA 1N9ZA 4QYXA 4O0LA 1WQ1R 3UGKA 3CZ4A 1GPAA 2FQQA 3BC1A 3QVXA 1YDFA 3DMFA 1JV2B 1EQ2A 4X97A 2H4JA 5M3BA 3UV7A 3FVVA 1N1MA 2EG5A 1TXGA 2PKXA 3AFGA 2Q4BA 3DV0A 3OOWA 3QUBA 4LVCA 2R1TB 2PCLA 3G2LA 1I9CA 3OZIA 2POQX 1TUIA 3P0RA 4OL9A 3PEEA 2P9TA 4CM5A 2A0WA 4PAOA 2D2EA 5IN4A 2NAPA 4E5YA 3BL6A 1JEYA 2D1SA 2IYFA 1M5UA 3IIMA 1XTIA 2DPYA 4HYQA 5ADWA 1EDZA 2NSJA 2XMRA 1K4YA 2ZAMA 2YMPA 3IIEA 3LFTA 5DWQA 4C3UA 1CRZA 1LWOA 3EZNA 1U2RA 2P4QA 4MIKA 4R1PA 4ZV9A 1ZIOA 3ZHBA 3GLTA 5LZ4A 1SHZA 3MWDB 1P1IA 1ZGCA 4OIMA 3RIYA 4XGNA 4JXZA 4H1VA 1P1FA 5BSUA 2HM7A 4CNBA 2ZSUA 1Y3IA 1J0BA 1SVLA 1SA0A 3GLGB 2QD3A 1X38A 1DCKA 2JANA 1N2OA 5F33A 3O2NA 3TFOA 4ALMA 1J5PA 4YXWA 1RXCA 2ECKA 3QMPA 5DNAA 4R7TA 3PNSA 5JU6A 4X9XA 2WU0A 3I2KA 3GLUA 1NUSA 4KMRA 4BX3A 1RZRD 3GUUA 1P5FA 4F91B 1OAOA 4NH4A 4IS3A 1XTJA 1RR6A 3K9CA 2ZRMA 1XQYA 2X2FA 4K2HA 5D6OA 2JIZA 3KXKA 4X54A 4ZI3A 4ZMRA 3M81A 3IMGA 1LBQA 1SVUA 4AJEA 1P7VA 4HQFA 1U8ZA 2OAQ1 4R31A 1CS0A 3ZGVA 3ETEA 721PA 3KAQA 1VP3A 4RK0A 5KNLA 1WQ4A 2HSEA 2FKAA 2W2VA 3E1SA 3EZ6A 3R5KA 3HA3A 3UUFA 2YYAA 4BC0A 3W2TA 1HLGA 1R3DA 3VU1A 3DDSA 4B6RA 2JHCA 4BWVA 5AVYA 2BI4A 3OQNA 2PKQO 3IEXA 2FZ5A 2OFXA 4AN4A 4CDGA 1BOFA 1ORRA 5FL7D 2K5UA 1SOAA 1HQYE 3BJRA 2C4TA 4M49A 2YMMA 1ORIA 5GGXA 3R9XB 5EWJB 1DWPA 1G1AA 1PR6A 1XMOB 2C4UA 3KHUA 3Q0TA 3RU3A 3V7NA 2VP6A 1OJLA 2DBYA 2GI4A 2VRCD 1K97A 4KDRA 4WOKA 1CY8A 2QTBA 2MCFA 5GONA 4AS2A 2H08A 3TLMA 1ZPDA 3EGIA 1ZIYA 2DG2A 1QG2A 5NULA 4G26A 3U7HB 1DZIA 3AR9A 4UU1A 5FUYA 3ZIAA 3HBNA 3N2NA 2IYWA 4JLUA 1ORDA 2FFBA 4EI7A 2X77A 4FKMA 3K8OE 4UASA 1SZJG 2FSGA 4OBWA 4FOPA 1ZK0A 2G7ZA 2J0VA 5CR9A 2WIKA 5GTDA 1PEKE 3HC7A 5K0SA 1NN0A 2EZ9A 4RK4A 4UVHA 3RH0A 3UT5A 3E05A 5BWNA 1JTFA 1VIAA 1JEAA 2XR1A 3CPJB 3V4VB 1DAIA 3CZRA 3JQQA 5AUPB 3K4PA 4AY6A 1Y6ZA 2W0SA 1HKHA 1V8OA 1RJWA 2ROQA 3A05A 3E48A 4IH9A 2EFGA 4DR4B 3H3FA 3SQMA 1HLFA 5AI6A 4C1NA 5JANA 1VC2A 4PIPA 3WB2A 1WZ2A 4XGQA 3SZMA 2VPTA 3RJ5A 4F6CA 5JRZA 1ZKDA 1GFWA 4IV0A 2Z4RA 3TRFA 1NU6A 3MWJA 3GAAA 4TM7A 2B37A 2PGNA 1EUQA 1MVOA 1G19A 4N1AA 1ECCA 4DF3A 1E5XA 4IQ0A 4PRLA 4DIDA 2O0KA 2WM8A 4O8ZA 3VR6A 4M0UA 3CNHA 5HUHA 1TYAE 3I61A 3DPUA 3P9CA 1BSVA 4TKMA 5EVJA 4UHCA 4YB8A 2W6PA 1Q6YA 2QDXA 1PW7A 4REOA 4QNNA 4U3JA 5BRJA 2GUGA 1FLDA 3WK4A 3WLRA 3QFRA 1J5XA 5KKCA 2EVWX 2PWBA 4JNKA 4OX9B 2F48A 1MVNA 1SOMA 1UMKA 1U5BA 1Y7LA 3HR4A 1MIOB 2W2MA 3N58A 4QG7A 4GZLA 5EIOA 3ZVLA 4JJZA 3B3AA 4MV0A 1GG5A 1YVEI 3K1JA 3PRYA 4EABA 1CUAA 5G0TA 5TSDA 1N7GA 3B6ZA 5CB0A 1FY2A 4C29A 1YQUA 4O02B 4IUBS 4L6IA 2WOOA 3LXMA 3HFJA 1O6GA 3K9BA 3SJ7A 4B80A 1N75A 1E9FA 3NAQA 1RYEA 1I4TD 1NU8A 3DO6A 3IE2A 3IPXA 4JOBA 4YP1A 5CB4F 1F0YA 1CU1A 3EGXB 4RVCA 5GJWC 4IDGA 1YR1A 1ZUWA 2WA2A 3IUJA 4FUTA 5REQB 4X3CA 4ZXPA 2XDQA 3ZHZA 3FWPA 1B3RA 2QQ5A 4OI0A 1CG6A 2FRDC 1P17A 2PBRA 2BGLA 3MB8A 2C95A 4KMMA 3ROQA 3RTAA 2B5WA 2CD7A 2CLIB 3GFTA 4C5AA 5K0EA 4C4YA 5JD4A 2FK8A 2GGSA 2X4LA 1SVKA 4LNAA 4AF8A 5CD9A 4C3ZA 2Q0XA 5LA6A 1A5BB 1FTYA 2I7XA 4GH5A 4TVBA 4YBRA 2XA9A 4WBNF 4ZKDA 4TN5A 1QANA 3AT1A 4YI3A 3NG1A 4RMIA 1WXWA 4M9SA 3TQTA 4J2HA 4S0XA 5EZQA 2AXPA 1EWQA 4J07A 2CBXA 3OPVA 1UPFA 4G6ZA 2CYBA 3VU9B 1MX9A 2C7QA 3HWSA 4WKCA 1DQYA 1C1HA 1DEOA 4FP9A 3W8RA 3GCZA 3WKAA 1DUIA 3HLYA 4PG4A 3OSZA 1JDZA 3N76A 3NIFB 2YWFA 4HDOB 1CYDA 2H7CA 4KR2A 2R4QA 2Y1OA 2Z5FA 2I2BA 1XQXA 3D8BA 3IIKA 1JEDA 2AF4C 2PX8A 4E46A 5M7EA 5TR9A 1KDPA 3DEFA 4FD3A 4JJKA 3ZNOA 2DWUA 1LK5A 4DNFA 1U2SA 2Q6LA 3UYLA 1C0EA 1M2VB 2WLTA 4UVEA 4KH1A 5JJKA 2D06A 3K8QA 1QC5B 1QJ4A 2MSNA 4L9RA 2GFQA 4AMVA 2QLNA 2C0PA 2QU7A 2YN4A 2ZXEA 3BTOA 3N2ZB 4YRDA 1A1VA 3NT5A 1L5VA 2CSXA 3C5HA 2EOAA 3BH6A 1I5RA 3G0IA 3H65A 2H16A 3I6BA 3KR9A 4JBHA 4LJAA 4URZR 4WY2A 5D1HA 5E38A 1DRKA 4KVGA 2AT1A 1M54A 2C4NA 3A4LA 3INTA 4K6FA 4HNAB 4X24A 3BWXA 3NYIA 1BAPA 2PM8A 1AMUA 1LBSA 1VJ5A 4YRIA 2BE7A 4X1IA 3FYTA 4BHTA 4DR1B 1H5QA 1WZIA 2VA8A 5IS2A 4JI4B 4C43A 1D6SA 2G9VA 2HKIA 3LLUA 4M83A 4QWWA 4X41A 2DB3A 3ULKA 2GUWA 3LC1O 4PLFA 2P3LA 1T2UA 4UBOA 4UU0A 3RFCA 1WNFA 1X8XA 2JS7A 3T1QA 1D7AA 3GEPA 3KZKA 4MMXB 1TVCA 1WXQA 3RRFA 2O59A 1G2QA 4K26A 4TUYA 3VYSB 5ADUS 1FRNA 1K6IA 3A36A 3N0TA 3HM9A 1Y8AA 2CYAA 4P83A 2W2NA 3AERB 4GXRA 3WY9A 1R4MA 1YRLA 4CUJA 4F6RA 1UDBA 4RGYA 2VKTA 4W1PA 1ZS9A 3K70D 4GKJB 4UHBA 1POWA 5B3JC 5DNCA 4LWQA 2PQ2A 4C2TA 4ND3A 3UYKA 5KNCH 1FLVA 1E9AA 4ZVSA 4A36A 1XN1A 2C07A 1K66A 4CM4A 3RS3A 4WCDA 1U65A 2C61A 1CDEA 2IPNA 4ZCRA 1H3NA 4UZFA 4TKUB 5HCIA 5HFJA 5ER6A 4IZHA 4UREA 5LXTB 2H4YA 5AM2A 5EP3A 2AOXA 2VYNA 3LVBA 3ZTWA 2Q7DA 1EDBA 1O1YA 4GPAA 3BPSA 4C4TA 3NC0C 2EU8A 2XMBA 1RBQA 3KDSE 3BWCA 4NECA 5DI3A 2GTIA 1D9XA 1A0OA 4XPIB 4C0JA 2H1SA 4ENTA 1KKLA 2XW6A 4ENSA 4C04A 2PTHA 5IULC 1QE5A 2DPMA 1FX0A 4JKYA 1OZFA 1RRGA 1YFJA 1N1EA 1Z5GA 1RIIA 1XRLA 3LNCA 1S1MA 1NV8A 3DTVB 5HP4A 2CNOA 3RVMA 4CIVA 3UXHA 4DNPA 3NVAA 3BSSA 3WGNA 2R6AA 4KR3A 1CY7A 4UBLA 3KK0A 5BR7A 1ZRMA 2HWYA 3TG2A 1VSBA 4E0BA 1AQ6A 1J2UA 1H8HD 1A8QA 1N2IA 1XXHB 3DEJA 1SZDA 3ENKA 3TMKA 3VZQA 3M4ZA 4PIMA 3DLAA 3N75A 1C1XA 1R4NB 3EIWA 4N54A 5GONF 4YMIA 3O95A 2DWCA 4OXIA 1E18A 1T9AA 1N0WA 5C7IO 3W9SA 2A2ZA 2I76A 1B41A 5E9QA 1A9XA 4QTYA 1EPUA 4GD3Q 5FF9A 4C2UA 4RZ3A 4OHZA 3Q0IA 4JI6B 3VNAA 1K75A 4N5IX 2XVAA 4G0UA 2DP4E 3MTBA 1GU7A 5FBWB 3CKMA 3LBAA 4D3SA 2XGSA 4Q9IA 3WTBA 1C8KA 2P3QA 4TZ6A 1CUFA 1EM6A 3ME5A 4F12A 2F7SA 4DSAA 1W52X 5FHQA 3ECAA 3ESAA 6REQB 3RSLA 3L4JA 1OXBB 4P3XA 3WLNA 2CJYA 3LHIA 1OSNA 1SXJC 1RTTA 2NVBA 4LJ8A 3GYBA 4HJRA 3REQA 2J87A 1NT2A 2IYTA 1D1PA 5LDDC 2I03A 3GRRA 5G4KB 5CT9A 1ZSVA 2IV7A 5G0WA 1O8CA 3DEZA 4JMLA 1E4EA 1H0RA 1YGYA 1A5SB 3GNQA 2I80A 3FTPA 3IOCA 3D4OA 4NPCA 4WK2B 5F1PA 2YY7A 1IM8A 2Z8YA 1A7UA 4QTTB 4XX0A 3X2SA 4JSTA 1PK8A 5IDWA 2HMYB 4JVSB 3VR5A 5E3HA 3EBPA 4PPFA 2ODEA 3U1BA 4G2NA 5M04A 3V55A 3RQIA 3IEPA 3UH1A 1QSGA 1Z68A 3MUFA 4R01A 1JKJB 1ZVJA 2VA9A 4Q3AA 1UPTA 1WMAA 2OD7A 4KPUB 4ZVQA 1TKCA 3NRJA 2R4TA 5EPEA 4Z8YA 1DJQA 5TB5A 4PZEA 3MWFA 2GPYA 5BWCA 1CX9B 1T2NA 3LF1A 3NC1C 5HRAA 1OIVA 4WKOA 1QH1B 3A1WA 3ONDA 1XQVA 2R4UA 2V5VA 2CUKA 5IDYA 3IUEA 4C5CA 1AH2A 5HUJA 2JW5A 4AECA 1NLFA 5A62A 1ZU4A 1CQZA 3PC6A 4M8KA 3CCFA 3P2EA 1A9TA 4IQFA 4ZAYA 2CL7X 1Q0UA 3CGWA 3EVGA 5ALXA 3EXIA 3CEHA 4B74A 1R8YA 4BNGA 3KYBA 2I3GA 5JV5A 4CMJA 2PL3A 2J3HA 1D9ZA 3WIUA 1VIYA 5BW5A 1XZDA 3CKYA 3N0XA 4A3SA 4W5HA 1ESZA 2WINI 4PSVA 1I7LA 1CDOA 2ZYUX 4O59O 1AHPA 1W85B 2OOKA 2PD3A 4EUKA 2ZAIA 3P5SA 4JUBA 2B34A 3LQFA 4WZAE 5K3OA 3TTYA 1NP3A 1XO1A 1UWKA 5LA6F 1NBEA 4QELA 3RV3A 3IJPA 4AIIA 3NBZC 5LQKA 2AN1A 1FP4A 2C77A 4JXXA 2HEIA 4EL0A 1MHPA 4RVNA 1X7YB 3BMCB 4TWJA 5EE5B 4HGZA 2OORC 2PV0A 3CJQA 4YGYA 5ALTA 6Q21A 2DVMA 1ACLA 1MV5A 3BAFA 3AY3A 1JFRA 1CVRA 2WAYA 3NOOA 2RK4A 3I9JA 3Q3VA 4I55B 2RG7A 2CLKB 4GLLA 2AZDA 3QTBA 1B3BA 3RVRA 1LDYA 1DMRA 1NMEA 3K1TA 3WV4A 1GGFA 1KU0A 1ZVKA 5EZ5A 3GVXA 2OCLA 3DH0A 5MFPA 3BD7A 5JATA 4N0EA 4H0NA 5EESA 2I6SA 1ORTA 3VHRA 5B6PA 1QAMA 2R5WA 5AHXA 1L9KA 1ODTC 3TPZA 3WAJA 3TDMA 1G8PA 3AUSA 3BL8A 3QLVC 1L7RA 2XUOA 3IT3A 1ZGBA 3T5DA 1YGPA 1QYIA 2N3ZA 2VJAA 3AUAA 3CNQS 3FUWA 4LYFA 5JD3A 3LZDA 3T9BA 5C52B 1YJBA 4M1WA 4M7WA 2YFKA 3Q9LA 1A4RA 1UBGA 5ILOA 1E3EA 3FPEA 3O1HB 4DREA 4I4CA 3HZOA 4BN0A 4Z9BA 3UMMA 1TA4A 2FZWA 4H16A 3KE9A 5IXYA 4GL2A 2A88A 3UJBA 1Z6YA 2DFNA 3U7QA 4L8GA 3NKLA 2CVFA 3QYFA 2HA0A 4WIAA 3EXEB 4A82A 2PRIA 4K9NA 3EBOA 3L84A 4Y6QA 4RESA 3EYWA 2K6GA 4HQRA 4TZKA 5LQNA 3DVQX 2FPIB 3WWYA 1GZUA 2HWUA 4JLPA 4C5BA 3UCXA 4Q24A 2PT9A 4CMAA 3GCXA 4WGFA 3FRIA 1JBEA 2E7ZA 1JU9A 4NU0A 1FYWA 2NTEA 3I73A 4M53A 1UPXA 3D6FA 2X19A 4HDKB 4BGIA 4F9TA 3IQFA 4QUHA 1Z88A 3NWBA 9GPBA 4L51A 3DPIA 2NG1A 1O6FA 3QUCA 1Z33A 3F7OA 2IITA 1V8FA 2Y1LA 3CZCA 3H13A 3QKRA 8ATCA 4YBZA 4MR8A 4A2WA 4I5IA 1Z7BA 2Y2VA 2XB4A 2RHRA 1QS0B 4BKOA 4RSHA 5KKAA 3WIEA 3FMFA 4EUFA 3QKSA 2JFGA 4BFYA 1I0LA 5CLJA 4AMBA 5EHZA 2D1QA 1QPZA 1N6OA 1JRLA 2YXNA 1W30A 1NNI1 4ZO4A 5E4YA 5EE9A 5K9ZA 4ZAFA 3WQBA 4B6SA 4E11A 4K28A 1GZHB 1GZ3A 1NC1A 2BMVA 5DTJA 3RF6A 4ZVUA 2P9EA 3DVAB 3PIDA 3VZPA 1EFRD 4HH0A 5WRFA 1L4YA 4P4TA 5HIMA 4HI0E 1QB7A 1PGPA 1R0BA 2I2AA 3E53A 1NV9A 1X0VA 3HE3A 4NARA 1O96A 5HOQA 4YT4A 3C6KA 2W8ZA 3T9AA 3E5HA 2DZDA 4G86A 2NU8B 5IASA 2I0FA 3RG2A 4KXLA 3L6UA 5DNVA 2GBPA 3W04A 4MYCA 3ZY2A 3PDIB 3GAZA 1RBZA 4PO1A 4DEYA 1S4QA 4IRUB 5EMMA 1ADYA 5INTA 4Q4HA 1NVVR 4A0QA 2ZRNA 5CIQA 3ND8A 5BPHA 4MWOA 1PG5A 3EF1A 1G8HA 4P34A 4PNPA 4Y98A 4BV3A 4O5OA 5J2UB 2CVQA 2FW6A 4HGYA 3K31A 4EB3A 4XYLA 5KU7A 1ULAA 4Q6BA 3QX7A 3Q8WA 4JJIA 1HDXA 5EZYB 2ASVA 2O8NA 2AMLA 3CSSA 3DONA 5IM4A 2QIPA 4HWTA 1CUIA 3ORFA 2ENWA 2VH1A 3A0RB 4LK3A 4PZYA 3RW9A 3IHLA 5EKTA 3S3TA 1NG1A 2IPOA 4PZ0A 3OH8A 3CSDA 5CVVA 2YZNA 3LUAA 4YQYA 2HHCA 3MWKA 5J58A 3P0FA 4L08A 4JXKA 4A8JB 2J9FA 3DF9A 4HR7A 1P77A 3O8BA 4NHOA 4CLDA 1KXZA 1P2BA 1OXTA 4HAUA 1L1RA 4RHCA 5EJ7A 1XEXA 2QV7A 4UMVA 5EFZA 1O5TA 1M7GA 1AZSC 4F9EA 5BORA 1E2MA 4HDRA 2ZVPX 3AR4A 4Q02A 3B7PA 2GPJA 2UYOA 1Q0ZA 3EZXA 1PZHA 2HRDA 1L3CA 4FIDA 1A97A 5J5CA 3WIBA 4JBNA 4N82A 3HCBA 5H3HA 5FUMA 3FOZA 4CFYA 2PSEA 2PMFA 3B2EA 3M1LA 5E8JA 3AEKB 4MCHA 3MJRA 4PNZA 2OPHA 4YUWA 2W2QA 2P6PA 1Z0UA 3DFFA 3EXG1 3BHIA 3HV0A 3NBQA 4K9DA 4YCJA 3CH5A 4IM7A 1W2WB 3QENA 3OKFA 3AUXA 4BE7B 5ITZB 1J9ZA 4B3HA 3IBCA 3DNFA 1KJ8A 1FP6A 1OASA 1O95A 4V3CA 3FG9A 3OOSA 4QNRA 1GCAA 3GLFB 2W5UA 5BV2P 2XVZA 3I2FA 5DM1A 1WVIA 1DHTA 2UUPA 4PTLA 4CLOA 3JTMA 4NOMA 4II3A 3NETA 2WFLB 1RWNA 4F4UA 3TS1A 3A26A 2WMOB 3MVEA 6LDHA 4NAHA 4LX8A 3K0KA 3MGGA 3STWA 3DSRA 2BRUA 1EUZA 1UJMA 1E62A 1OCEA 3PJDA 2ODPA 4HGQA 4FEEA 5EIHA 4ZT5A 3NQ41 2WG0A 4F0JA 4LMPA 3KOYA 3RSSA 3CBGA 1H2AS 4AJ4A 2Y0CA 1USIA 1A95A 1JLSA 1GL6A 4LOJA 1T2VA 4YNBA 4KO8A 4I3GA 4C7VA 4M7OA 4R9UC 3Q2IA 2G7MC 2OBMA 2C3YA 2IYSA 3RLFA 5KSYA 2QG9A 3AX6A 3OZFA 2PS9A 1EFPA 1U94A 3PXDA 1L5OA 4ILKA 3BSFA 1ZQ1A 2Q49A 2ZLBA 3DVRX 4FQ8A 4YRJA 3SYKA 1N6LA 1YRYE 4FB5A 4W8GA 1Z2CA 4LMBA 8MHTA 4GO1A 4DXDA 2OYRA 4LJRA 1DC4A 2A6PA 4KWHA 1QGUB 3MRTA 3LC7O 1U7PA 4D6YA 1RWQA 1MC1A 2H0AA 2YFYA 2C7RA 2AXQA 1G2OA 5H81A 1K4MA 3INYA 4P93A 5D00A 5JVDA 1LRJA 3ZCXA 5ALEA 1C7IA 2GZDA 5D3MA 5DCYA 5EXPA 1HE5A 4R1UA 1DP4A 4OGFA 3OEWA 1WP9A 5HOEA 2V6FA 2X40A 1G3QA 2CBZA 2RHJA 4FWIB 3ZDXB 1FFSA 2ODQA 2Q0SA 1T0BA 3OLCX 1A8PA 4N39A 1DEHA 4CM6A 1JR3E 2GZ3A 1E9DA 1QQ5A 4NBVA 5FOSA 1FJHA 1FMLA 1AUOA 2OT3B 4JDPA 2PGIA 4MWZA 5D3KA 5E7QA 1NTOA 1QCYA 3I01A 5I7AA 3T38A 4E13A 3UMCA 2XCRB 5HFAA 4MHOA 4O4JA 2OXTA 1ZRHA 1T24A 1AUXA 3BORA 4U5XA 4HVAA 1HT0A 3BE8A 4MCJA 4EPXA 3P2JA 3JQFC 2ZAOA 1MB3A 2FMIA 3RYTC 2ZJBA 1XJCA 3EG9B 4ZCQA 1UAAA 4CT5A 3IURA 1BGWA 3JQ7B 3KZ1E 3KKEA 2WUEA 3HSKA 3LE8A 1B0UA 4LK2A 1DKLA 1ODJA 5AJVB 5KEIA 1KIMA 3CE9A 1DOHA 2J3EA 4JUDX 4P3KA 1MENA 1QRRA 2P1ZA 2QSUA 2YTZA 4ZN6A 5T4EA 2QSJA 4DCUA 2ACWA 3K5PA 1KEPA 4B2LA 4YT5A 5FR1A 3VVLA 1KYWA 1C9YA 1G2PA 1OVMA 3DYBA 3X1WA 1OUMA 3I5UA 3K0CA 1VFPA 4FKZA 1FSPA 2K2QB 4WNIA 3H05A 1KQPA 3RRYA 1VMDA 3D5TA 4W6QA 4JN6B 3UVEA 4BDTA 4WKGA 2NYRA 4WX2B 1KMMA 1E92A 2C9BA 4UUMA 3ZDRA 4F56A 1PCXA 3ECCA 3AHGA 3IHTA 2QLFA 4HX2A 4PLTA 2NU9B 5KWJA 3UAGA 2AFIE 4I99A 3TZLA 4QM7A 4Q7LA 5IKEA 2VAMA 5E8RA 3E2IA 3FVTA 2CFSA 2NT4A 3SDSA 5KNDD 3MRXA 1Q20A 4FE7A 2N1BA 1RYNA 1ZNYA 3I8SA 3L43A 4K6GA 4OBBA 4COKA 5ADHA 3GGOA 4YX9A 2FSVA 4W5RA 2O7RA 3NC4A 4CM1A 1NX6A 3F3MA 3U37A 1S7GA 3HHEA 5KVVA 2OGZA 2O0LA 2VJOA 4M3NA 4R8KA 4DQXA 3RTDA 4RTSA 1Z34A 1LXCA 4LYYA 4ZIRB 4YA6A 4C3VA 2NZXA 3AG5A 4U1RA 1GHTA 2ALJA 3MINA 5DJ5A 3R5FA 1OLXB 1JAHA 1JQJC 1TI7A 4BE9A 3H1AA 3Q0EA 1F8FA 1UPUA 1Y4AE 2EDCA 1BW9B 3A4YA 1M8FA 2RAPA 1WIWA 3LUDA 1FSFA 4W7IA 2HLPA 4QX6A 5CDFE 2ZRLA 4J9UE 2BKUA 3FIJA 5LQMA 2AJTA 4RPLA 4C03A 1GPUA 3SXPA 4W5WA 5DISB 3HCRA 4MRRA 2OV2A 1DTEA 1PRYA 3KP1A 1AGRA 2ZR8A 1YQGA 2PWPA 3VR3A 1L4BA 3N7UA 3FHJA 1U1IA 2X8BA 1V8BA 3FY4A 4EY4A 4FYKA 2QAGC 4IPTA 1ETHA 1R37A 1YOVB 1YZTA 2NOAA 2PIDA 2V45A 3FAKA 3KC2A 4E6PA 2VQ6A 1ZOLA 3OTGA 3R0IA 4PAQA 1QAQA 2JKYA 4B33A 3U16A 5IYZF 3UTDA 8LDHA 2X8WA 5AWFC 5F78A 1MGOA 3IESA 2IH4A 1M5TA 4KIUA 3ZDCA 5IM4F 3SE7A 4A0FA 5AW5A 5TEWA 1EZ1A 2BKVA 3D6AA 4HY3A 3BMQA 3CKLA 5EKUA 3ZV5A 5JAMA 3ROMA 3A1VA 1T9CA 3BWMA 2HFKA 1CZHA 2JEYA 1JR4A 1SBCA 2OP1A 1JXMA 1IJBA 2PMDA 4GLJA 1MB0A 3H4MA 2EJBA 3M3HA 4FEYA 5EMJA 3WP0A 1QWSA 1Z2EA 1N92A 3GMDA 1ZK1A 4UNPA 1ZI6A 3QEMA 4HMOA 4DDTA 3PG5A 4XEHA 5J2TB 1U80A 2IBMA 2JH8A 2XTNA 3RANA 4JJFA 5FNZA 1B1CA 4WLNA 3V8VA 4DLTA 3MERA 4AJJA 1LLDA 3KD3A 2DFLA 5IAAA 5TNXA 3D59A 3EEFA 5TV2A 3WK7A 2J9ZB 2WM9B 2C94A 1FMFA 1QH0A 3N0WA 1QM5A 3EGVA 4BNJA 3EXFA 1W4RA 2H3EA 3QFCA 1ZL2A 5AM1A 4UOZA 2CJPA 4CKCB 1R8JA 1PZMA 1QRDA 2J5RA 4OOFA 1YC2A 3UGJA 1NPTO 2WTEA 2EFEB 3S8EA 4GOXA 5K3FB 5BR1A 2JNWA 2BGRA 3EHEA 5FUVA 1K7FB 3H18A 1E8NA 4M0DA 1TO6A 1ND6A 2JIQA 1CJTC 3GI1A 1RTKA 4X3PA 5I7FA 3W3ZB 3CVUA 2CXSA 2FRXA 4EG0A 2N1MA 1NQ5A 2PUTA 3H42B 4L8WB 3VYRB 4EHBA 2R1TA 4L9WA 2PPVA 4KEAA 4FGUA 2OBNA 3FKSA 4ZRMA 2ZIZA 3LBYA 4W8HA 1FNDA 1DT3A 3H4IA 3LUKA 3U81A 3G8YA 1PWHA 2C20A 2I4LA 4PY2A 5HJ7A 1KOGA 1JIIA 1QE0A 2BM9A 4CTMA 1C80A 3DMTC 4IJVA 4Y2VA 3BWEA 1UZLA 5B7NA 3CNEA 3C3CA 5FBRB 2YY5A 1G9SA 2ZSHA 3MWDA 4RJLA 4BO8A 2XOKD 4I6JA 3SZUA 3B8HA 5H59A 3KEOA 2RC5A 3FVQA 3GLGA 3KYCB 1X7GA 1C0KA 3IOEA 1SXGA 4PFKA 4L5AA 3CRRA 2VN8A 1DO8A 5DM60 3VA7A 4E1BA 5AI9A 4OH7A 4QGAA 5JS8A 5FV7A 4XWWA 2OM2A 4GKKB 2ATCA 2MWMA 3S29A 4Q19A 5JVDF 3HGQA 4KQ6A 3BFXA 1Z45A 4C4RA 3FAZA 4G01B 5AKXA 2I7CA 4YMTA 4YUYA 3V7UA 4Y67A 1WCIA 4RMNA 4ZCLA 3R44A 1SUDA 5TPZA 1UEJA 4JELA 3DFKA 5DHAA 1H2FA 4H4DA 5A0FA 3KUXA 5DHQA 4MO9A 3DMDA 3GAFA 2QE7D 2BW0A 5FX2A 4RAQA 4AICA 1V43A 5BRNA 1K6JA 1YZGA 1QB8A 1L5FA 1VHTA 4PCLA 5T57A 3W5IA 4BKRA 5HKBA 3IPYA 4RKWA 1S2DA 2XE6A 4O1MA 4RD0A 1O5IA 3WVNA 4B8WA 1SHUX 1UP7A 2QPLA 4O4JF 3RVPA 3T54A 3ZS9A 5TLSA 2WF5A 1L5HB 5EWJA 2P2CA 4EQ6B 1Y42X 2JJQA 3H8VA 3IEMA 3IEKA 5KAMA 1SC3A 3KQWA 3TKLA 4PWYA 1ZW1A 3RS2A 3J7TA 1PDOA 4HG2A 4IOLA 3NASA 3BCRA 1YXMA 2WUDA 4PU0A 4Y2UA 1NVGA 5G3ZA 4D9GA 4PLHA 2JFQA 3FFXA 4J7UA 1JI0A 5KQGA 5G41A 4ZC8A 2ZUDA 2WB4A 2XH8A 4X3OA 2QTTA 2P91A 1FMTA 1RXWA 4I1YA 1L5SA 1G5QA 2D2FA 5HE8A 5F1OA 3GDFA 1FDVA 1ZEMA 4HPJB 4MA0A 1S3IA 5F76A 5IH3A 1LNQA 2OAP1 3BXGA 1C9JA 3E9EA 4P31A 1PJRA 5DASA 2DJIA 5G1NA 1IAQA 2FFRA 1MT0A 1VSTA 4DIOA 1DQSA 1K0FA 2EKQA 1QO0A 2HHHB 1BRTA 5DBFA 3S2IA 1J0CA 1U3VA 1T0UA 4DSTA 4MR9B 5FAKA 1N32B 5MN5A 4WK4B 3JRWA 2VYVD 3AM3A 4X6XA 3LX8A 5EP2A 2FFJA 3CMCO 4YUVA 1VPVA 4UAJA 4C0WA 4DEVA 1GUDA 2A9QA 5FTLA 3VDQA 2Z3WA 1TLLA 4Y9UA 4DWOA 2J3DA 3Q7SA 2FUKA 1P74A 1DWUA 2XMGA 2QLLA 1HYEA 2FGJA 3RJMA 2P90A 1GZ7A 3HP4A 5K8UA 1ZGHA 1J42A 2ZBGA 4AZSA 3KCNA 4G0WA 3OCYA 5B1EA 1EJ0A 2PH3A 2HC9A 4K0RA 4B45A 3WZLA 3N39C 4I3FA 1W19A 4NE9A 4HUQB 4BFXA 3HUDA 5KSOA 5ESDA 2VDVE 2WWXA 1QDLB 1UKAA 3DULA 3SDZA 4RMHA 3ZKWB 3V9PA 5ICSA 2C9YA 3EEQA 1ELOA 2QBYA 1UBEA 3MPOA 1WUTA 1MIOA 1NASA 4NZNA 1QIEA 1QORA 4Q03A 1R9JA 2XTJA 4MEAA 1P4JA 1XJ5A 2W2OA 1Y1KE 4KDCA 4PXAA 3UMGA 1IYZA 4QU9A 4OQYA 3FH0A 4MIOA 1Y63A 1COWA 2HL6A 2Q9UA 2QJRA 1ZXXA 4MINA 3DJYA 5F2KA 5LZ5A 4E30A 2JLUA 4ZVKA 3F5DA 4J0IA 3P5BA 2EZ8A 3M6IA 3FYSA 4FFLA 3KPUA 3DCYA 3EGXA 1ABFA 4URYR 1EMDA 1ES9A 1RT9A 3G8CA 2X2EA 1KY2A 3R7WB 1XA3A 5REQA 3BDAA 4FHEA 4KNVA 1G18A 4KRFA 4PQEA 3DCNA 4LQDA 4WDRA 2DT8A 3TSOA 1QU3A 2Y0BA 5SZIA 2D0PB 3BCSA 3E9ZA 4MZDA 4ZK2A 5J23A 3LT4A 3HJGA 2B5VA 3H99A 3TR0A 5DBEX 1X94A 2ATEA 2H9AA 4NMMA 2GCNA 1WV1A 2I78A 5C7OO 3TWOA 1M34B 5ESXA 1PGJA 5I9SA 3ZY4A 2PX4A 3L4BC 5HIJA 1E3LA 2E6UX 2OMKA 4PC3A 2PANA 4UHKA 3VU9A 1GSOA 5BXYA 4L0MA 4Y2SA 4HV4A 3U4QB 1IHOA 1F7UA 2VTDA 3L6BA 2REOA 2WUFA 2OECA 3CLTC 1AQLA 2EHDA 3NTLA 4KFUA 1XVIA 3RFUA 5C18A 3FOWA 4N8EA 3PGMA 2FV8A 1KL7A 2LPMA 4AWXA 5KVAA 4NNPA 3FB4A 2HF9A 1F3LA 1Z0AA 5LUBA 2XYHA 3ZQ4A 2AGVA 2CXRA 3KYIB 5KQRA 1I7DA 3IAXA 4MW5A 4AB1A 1M2VA 5I7EA 5AIBA 5FH9A 1PJ2A 3OX4A 3MB5A 1QC5A 1PWZA 3T12A 1HF3A 4QVIA 1GILA 1PHRA 2Y6VA 3F3KA 1RXEA 4LKOA 1ODLA 1VTKA 4XWOA 1NAIA 1C5KA 1X9GA 4DDMA 3S1SA 3T6KA 1E6WA 1WVMA 3O90A 2FP3A 3GELA 3G88A 4JZKA 3JYQA 1KPGA 2VP2A 2WF7A 4HNAA 3MILA 3DDCA 1SC1A 2HCJB 2L82A 3SIPA 4DCPA 4ZO7A 4YREA 3ZU5A 1SM4A 4DV2B 3OJFA 2NW6A 4BQIA 2ZWVA 3R0QA 3JVDA 5ETJA 3VX4A 5CLGA 4ND4A 1GD1O 1FZTA 4DRYA 2NLOA 5ALYA 1V6AA 4WOJA 1P7ZA 3AHDA 1V1MB 4LY9A 4ZOQI 4KQWA 4EY7A 3KSZO 4YLGA 1NBWB 4PGAA 3CVYA 3P4XA 4MVJM 1F8XA 1KEEB 2GPSA 4AJHA 1WUHS 1KO5A 2OXEA 2GXUA 3NOXA 3OSUA 4LJKA 4LJSA 3AERA 3U60B 3DZ8A 4KQ2A 1N5DA 2CB0A 4G5GA 2FJ0A 3A3PA 1P7WA 1NOKA 1M75A 2NU7B 2ZZKA 3H83A 3HYSA 2K7ZA 1IZ8A 3LH5A 3QHAA 3B20A 3QG1A 4GZ3A 1EESA 3JZIA 1PJ8A 2GVZC 1H93A 1E96A 1KI4A 3OIUA 5HILA 5A1TA 5JC8A 1T1JA 3EIXA 3T15A 4LCJA 1Z08A 3JQCA 4PRKA 4BO1A 4H7KA 1SJ9A 4DADA 1K98A 2ZS8A 2I55A 1U31A 2JCXA 4PINA 4TKUA 5DYNA 2H1FA 3FMIA 5E2BA 2YBEA 5LXTA 4Y2YA 2ZVDA 1MEJA 1W88B 2QK4A 2W6JD 3JAWB 3QLUC 5DNWA 3W4KA 4BP8A 3IE0A 1DXQA 3P9SA 3T5TA 3AI7A 4P5PA 5EQFA 5TX7A 2F1HA 2ZS9A 4P3PA 3HKBB 1OR8A 3U19A 3TQQA 4OYYA 4MWTA 3U40A 1CQPA 1I3LA 4XPIA 1NFQA 4C4XA 4CIAA 2D74A 2W4MA 2FMUA 1CUUA 1WOYA 4H0CA 1Z2AA 4FONA 4UAUA 3WQHA 2O7QA 5G40A 3B9PA 3PD1A 4WFQA 4DM7A 3DTVA 3AR6A 1PTJA 5BNWA 2WKSA 2R79A 4J4BA 2MSKA 1AZWA 1BVUA 4ZOEA 1GQQA 1TW3A 2CMFA 1QO9A 3P27A 1XFAA 5AKHA 4QM6A 3QVUA 1EFKA 1VGRA 3BMOB 1V41E 4P22A 4C7XA 5JS6A 2J0SA 1XXHA 1GQ2A 2ZEJA 3KUCA 4M55A 1J0XO 5BV8A 3AK4A 1TJ4A 2OFFA 2C42A 1D4FA 1DRWA 4MW2A 2ET6A 1R4NA 2VUTA 1DXOA 3KDAA 1PLJA 1XNRB 4R9VA 1S5PA 2G40A 1CB7A 4U2GA 2R68A 2E5WA 4EUEA 1XMJA 4YI5A 3FHTA 2PZ8A 4H27A 4WOBA 2KLBA 4PG5A 3RNLA 5J43A 1KAQA 3FWZA 1SKMA 4B40A 2Q6KA 1XA0A 2VSNA 2AQHA 3KXLA 2JIOA 5LNK1 3OMXA 1TYZA 3DT9A 3CURA 2O1WA 3KQYA 3MJHA 1UMDB 1VYTA 1L4GA 6REQA 4JYMA 2FEMA 1RC8A 4QOSA 2PT5A 3QBEA 1X19A 3UAYA 2C2MA 1M1UA 1L8LA 2Y0PA 4RFSB 3PV0A 2XCSB 4KO2S 4C22A 4IS2A 1QQTA 4KLNA 4C4OA 2YVLA 1B14A 1FTSA 3IGFA 1T0IA 4RXUA 3CLSC 1A2KC 4XR9A 2JAPA 4MYHA 1KYYA 1Z6ZA 1HTTA 3HVRA 2I8AA 3OZRA 4GWLA 1YJQA 4BWFB 4B75A 2WOJA 3D3EA 2W42A 4EX6A 4ZTUB 2RKOA 1FFBA 1UOPA 4CUKA 3UJNA 3BVPA 3NHJA 3O5AA 4D79A 4TLEA 3NP9A 1JHQA 5CFRA 4LBZA 1PL8A 4C01A 1FFYA 3FCUB 4BBJA 2V0NA 3A37A 3CT4A 4NCXA 3L77A 1Q7GA 4DLXA 3EMVA 4ENVA 2PAAA 2AI1A 1JKJA 4EUSA 2VUIB 4KPUA 1JQLB 4G41A 5BR4A 3NKFA 4DUZB 2ECFA 5J4VA 3W6OA 3WL8A 1E2LA 2PKYX 1RLMA 1NP7A 3MUOA 2J46A 3DW3X 5GWXA 1PHPA 2ERXA 3KZNA 2O2HA 1QH1A 3HVHA 3N8NA 3P9KA 1HSOA 3W1VA 5KJFA 4W5NA 1CDZA 3EA0A 3DBVO 4PHGA 5LBIA 3HVIA 1AGPA 4LCEA 1KAEA 1EX1A 1QYCA 2PL9A 5AIAA 1FFGA 2W00A 4ENPA 1F5SA 1QOPB 3U5TA 2B2CA 1U0NA 2D1TA 1N5IA 3D0OA 3LKBA 4EAAA 3NTQA 1RE0A 1V71A 2JZOA 3O2SB 1LF0A 3PXEA 4O4IB 4WLVA 4QLBA 5IU6A 1GAJA 5CCEA 3CX3A 4AX8A 1VKNA 5HS4A 2C0QA 3EHDA 5A6VA 2PMKA 1XP5A 4HWPA 2GK6A 4RPGA 3KCQA 2HMWA 4J0QA 5H8WA 3TIFA 1XEFA 5CXSA 5AVQA 1G17A 1W46A 4X7PA 4QUDA 1W85A 3LBFA 4XUEA 1GQYA 1DDIA 2W6OA 3L8DA 3I3OA 2QI9F 2BCGY 1G0NA 5ESWA 3TFQA 3QPUA 2HPAA 4RY2A 4X7BA 4KMSA 1II8A 1UT8A 3CN7A 5FPKA 3FYCA 2VDKB 1L5MA 4PNHA 1WDLA 3BMCA 2VHUA 1XRMA 1PT5A 1FL9A 3PXBA 1WMBA 3SBDA 3BK1A 2PT7A 4G65A 4DC1A 4D0SA 1QQBA 2J3KA 2H11A 3QEOA 4BB5A 4DNOA 4DMFA 3ZQUA 5I3ZA 4MROA 1JYFA 3AF3A 4I55A 1RKXA 1U98A 2MYNA 3LPCA 2NVOA 3ESZA 2J6BA 3DB1A 1ND5A 3M4NA 3EMKA 3P1JA 3QE2A 2G4LA 4QJIA 5LP1A 1D04A 2PXCA 1ECBA 2IX3A 3A27A 3G9QA 3RVDA 1VG9B 2QYSA 4EG8A 1PKEA 3KR0A 3NBKA 2Z1MA 1FNBA 4JYBA 3I0NA 3E5NA 5JAQA 1E6MA 2N9UA 3LHDA 4G36A 1RU3A 3PHJA 1KFBB 4PAGA 3V6MA 1ZJZA 3P2IA 3SZGA 3OE7A 4MVJG 3RRBA 1FS6A 1UDCA 2X5OA 4QTZA 1ZWLA 2IT1A 4BNFA 4LFCB 4WMLA 1UKZA 3M1IA 3M8KA 3UJCA 5EIBC 4MUMA 2HA6A 2GLXA 2XEDA 2N46A 4QLOA 5IW8A 4BCCA 4Q1DA 5K4GA 5CVDA 1YB2A 2O06A 1TT7A 3S2UA 1NIPA 5H4HA 3EXEA 5K2OA 2Y77A 2G0AA 4CPDA 2C0CA 1TX4B 1U9IC 4R3UC 2WUGA 2FPIA 2AC4A 1CIVA 2Z8ZA 4HDAA 4M8SA 2QUHA 5I9BA 4DNXA 3CF0A 2P2GA 3AHCA 4HRVA 4Q18A 1WSAA 1SELA 2ZE6A 4HDKA 2SCUB 4WKNA 2C2HA 2QWXA 1CD5A 3RR2A 3FCAA 1NMZA 1H6AA 2Z9CA 3IR5A 1UC8A 1H66A 2QGZA 1F9AA 4EMTA 1PZFA 2MSEB 1EFVB 4YRMA 1HNXB 4IQ8A 2ZSKA 1NXWA 3C43A 4RJJA 4X6YA 4RIHA 1ZBQA 1D0VA 3Q72A 5EHIA 5K3BA 1O0CA 5AMXA 1VRCA 5EQTA 1VL1A 1EQUA 2IIPA 1GUZA 1QS0A 2EWWA 3D6UA 4YJ3B 5EZ6B 3OM0A 4CKBB 1Y98A 1MC8A 2QR2A 4J0GA 2NSHA 2RHHA 2BN4A 4LZNA 3R40A 3G82C 1K7XB 4U7PB 1PJCA 1ZK3A 4A10A 1U4OA 5LXTF 1XB2A 1WB4A 3ESCA 4UUOA 5ALSA 2WWHA 3CTMA 4PLYA 5KOHB 3OIGA 4PBSA 1T3ZA 1JHXA 3DVAA 1TKAA 3B3JA 1II9A 2DCUA 1NW4A 2VDOB 3QVWA 5K3SA 3TD9A 3ZE0B 5H4GA 2F1IA 4V03A 1U0GA 3BFVA 4OYHA 4CM3A 1ESCA 1YKSA 1YF3A 2GPBA 2R8EA 2Z0MA 2WE7A 4ER6A 5HK9A 4D9EA 2NU8A 2FRDA 3H1PA 3OJWA 2QQGA 2H1WA 3OP1A 4J0HA 1IK4A 1R5BA 2WAAA 1M8PA 3PDIA 10MHA 1OU4A 3ZU4A 4RS4A 5F98A 3QE9Y 3WNDA 1SC9A 2Q2VA 3STUA 3FCCA 4BJ3A 4F1KA 4POOA 4J91A 1KMQA 4CIYA 1CF4A 1XL0A 2COEA 3D6MA 1CJUC 4AS3A 5J2UA 2GLUA 4XTRA 2E6KA 5EP1A 2J8ZA 3HFSA 5EMLA 2C83A 2RHTA 3L6OO 5EZYA 5DHUA 3O0TA 3GIDA 2KI5A 3QLTA 4HAXA 5C37A 1I2BA 1K5GA 4UD6A 6ADHA 1CQJB 3B5EA 1GQOA 2E82A 2I54A 3B51X 3HS3A 3B8EA 4FKBA 1TL7C 1TU4A 3M6MD 4HTAA 3WC4A 3GN2A 4A8JA 5H1YA 2C2BA 4HZIA 3UK6A 5I9NA 3T3IA 5BRAA 2QN6A 2QD4A 1I4EB 2RGDA 1KNQA 2DUNA 2VBFA 2YHUA 5EQJB 4Z3DA 3VO8A 4ARZB 3WOVA 2XB6A 4TXJA 3PEFA 3I2HA 4GQAA 3TAXA 1Z0FA 3FGPA 1AKNA 3GZJA 2BFMA 2QYHA 5B6JA 1UFQA 5IABA 1QIJA 2KWIA 2O7SA 2IU3A 1GAQA 4MV4A 4C4PA 5JNVA 4YWHA 2XKKA 3AEKA 2R5FA 3KV3O 3GLSA 3GV0A 1F60A 5COAA 1J1IA 4MQUA 4NULA 1THMA 4PZUA 2Q1YA 3AR2A 4ZU6X 1I32A 1KEKA 1Z3IX 1EXMA 3PPIA 4N7MA 1Q57A 3GPLA 2P5UA 4Y1EA 2Q5EA 5DB4A 3S5JA 1J2TA 4B87A 5ITZA 2C3OA 5A7FA 3EAFA 1Q7RA 5A3RA 1R0LA 3O8OB 1GM5A 2C97A 1UC5B 2RBKA 2GN1A 3GLFA 2RKBA 1C0IA 2ID4A 3KLOA 4FJ0A 3ELYA 3WLJA 3EWAA 4EPRA 3VKFA 1PR5A 3D3KA 4GXTA 3GUVA 3OTIA 3I6ZA 3O3OB 2WFLA 1KAMA 1IN8A 1TEXA 2QQFA 3FTQA 4HB0A 4ZQFA 1T5TA 1XAJA 3KQVA 3C6ZA 5EFOA 4C3OB 2YWRA 3M3DA 1JDVA 1DTWB 1OTYA 2EYQA 1JA9A 1XMIA 2VT3A 2WLSA 3ELBA 2W9XA 4LY3A 4TRRA 2WJAA 3ZE2B 3CUVA 2DUUA 3EYAA 1MX1A 4EG6A 1ZONA 4UAGA 3T4PA 1XXLA 1W0KA 1OHHD 1NVDA 1STOA 1SUFA 2EQ5A 4MW1A 4Y6SA 1DIAA 1KY4A 2YRFA 3H2ZA 4Q15A 4TT3A 4YJGB 3WMFA 4A0RA 4B71A 4EF5A 1EX9A 1ZM2A 3R1IA 2I4RA 3HN6A 4FM9A 4JBXA 4JLSA 1LPMA 4HAVA 4O2AB 1BN6A 3QYPA 2P8SA 1R1DA 3L8GA 1YBAA 4B2IA 1NVXQ 1ENPA 1ECJA 1SO8A 2HMVA 4LW8A 1GRVA 2RAUA 4OYRA 5AJTA 2GBFA 4WNYA 4KB5A 3NHBA 3CEAA 3NEJA 3UK7A 4B6FA 3OQBA 1SIBE 4Q7KA 1QGUA 5A4MS 4YALA 1D2AA 2QX4A 4RX1A 2XT0A 5JPDA 3S2SA 4BX0A 1PR2A 4UOEA 4CIDA 2X4DA 1QGAA 2NNLD 3R7AA 4B31A 4ETWA 4A7PA 5AQEA 5KYYB 2X5NA 3CM0A 1MG0A 3F98A 3KS9A 1JEEA 4WZBB 5H02A 3KKLA 3M6XA 3KL4A 3Q2OA 4GGPA 1FQJA 5DXAA 1CZUA 3CRZA 4ETNA 2OHHA 1OIWA 3OQ1A 2R6R1 4QYMA 5THXA 1Z3CA 2V4UA 4I55F 2XEXA 3ZY6A 3RKRA 4FINA 1VA5A 3JAMA 4X1YB 3EQ7A 1TEVA 1O5OA 3W1WA 1RI4A 4I6EA 5CPFA 3SOPA 1WMDA 2BDUA 3IXQA 4LUCA 1FZQA 2IYAA 1UF9A 1YUMA 1U8YA 3I39X 3WMXA 5KSPA 2BF7A 4K87A 1SHTX 4QSMA 4V0NA 2UYYA 4RKQA 4CKXA 3EG9A 1N36B 3CRVA 3FB1A 1Z37A 1FDSA 3MTAA 3JQ7A 2BBSA 2AN9A 3ZHOA 1VHWA 3EFEA 3EJ6A 4J94A 3MCUA 1UH5A 5EJAA 4DV3B 4CQLB 4LSGA 4ED9A 3EA5A 3QRWA 2WG2A 3FTNA 4BEWA 4YP6A 3V1MA 2BI8A 2Q5OA 1N6HA 2C98A 2ZETA 3D2AA 2OP0A 5CW1A 3C48A 3W1EA 1XAHA 4BBPA 4B3RB 3LO8A 2XT9A 1CKEA 4UM9D 2AB0A 2Z1DA 2WJPA 1B8OA 3THWB 2I9PA 4Y8VA 1OT3A 2HU5A 3FNFA 2C3UA 4J6FA 4YRPA 1PWXA 3RYIB 3WL3A 1ULHA 4I14A 3LP6A 4NXMB 3ETDA 3TIVA 2R2GA 3VSAA 4A92A 1H3FA 3GPIA 3SZ3A 1WXGA 1M2OB 5AW4A 1XV5A 2BFEB 1CVIA 1LV7A 1N5LA 3AXTA 4NQRA 4NCHA 2EJUA 2SECE 1UCFA 4C88A 4JS0A 4EA7A 4RU1A 3V3TA 3W0LB 2YIJA 3RO7A 3PNBA 3GGCA 5FO0A 3ZCSA 4D2IA 3F3SA 3E3NA 2HXYA 3LUBA 1BS9A 1PZEA 2B1QA 4NEGA 4O6VA 4ZIRA 1QZZA 1ZZGA 4MDYA 3S2FA 3BXEA 3I34X 4H7JA 1OLXA 2F00A 3GP5A 4V0MA 5A9RA 2NQ8A 3V4SA 5K09A 2X4GA 1J8FA 4WBXC 3STTA 1ZUD1 3DOEA 4R3NA 3JWHA 5JAIA 1BW9A 4LN1A 4GFDA 4LHYA 4OLBA 3RSFA 3QJYA 2DFPA 3U3OA 2QJWA 4B4OA 2GBCA 4ERNA 1IMJA 1JPVA 5AKLA 5EXSA 3RC9A 3DT8A 5HSGA 4QICA 4QREA 3LVRE 3UOWA 4GXQA 3GGPA 3QBVA 4HXEB 5FQOA 3R9KA 4DM3A 3RADC 2XB2A 1KI3A 3TSYA 2IHKA 4LHEA 2I66A 1E1QA 4ABTA 4F1WA 3JAKB 1F8YA 1WMFA 1GO2A 2Q27A 1SKYE 4IBOA 4JIGA 1EXWA 1JQ5A 4WV3A 1JZSA 2GFHA 3TCKA 1UT5A 5EXTA 2DUWA 4HXFB 4W5OA 4G0NA 1YOVA 4ID9A 2VJDA 1P2UA 2PR2A 2Q1XA 3CBQA 3DMNA 4HQLA 5DSZA 5T4FA 4FHGA 3AG6A 3HUTA 4P3NA 2QXUA 3VNSA 1FFAA 1FRZA 4B3JA 1JMVA 2OORA 5J2UF 2HLHA 2R6HA 5ALOA 3CXUA 5E7MA 3RVQA 3D1LA 3MTQA 3OA0A 4WBSA 1J8MF 4B81A 2ZIXB 2ID9A 4YP0A 5KTTA 1PG2A 1NOIA 3L49A 3V1NA 4YP7A 4C20A 5KZMB 2IX9A 2R8XA 3SF8B 5KVCA 1OLSB 5FPYA 4RHFA 1ZCFA 2JFOA 3GW8A 4MI6A 3GJ5A 1B8NA 2PZKA 3HJBA 5LFAA 2FMTA 1TM5E 4JOCA 2GYVA 1HH4A 4P98A 1UQTA 3G0DA 3SG0A 2JBAB 4QEZA 1C2TA 1PEAA 1Z75A 3DEKA 2D0OB 4OQZA 1MB2A 3FW1A 1S8OA 3ZXUB 5J2TA 1F2VA 3JD3A 3QLVA 4EJFA 4OLJA 1QDUA 4ALKA 1XD9A 3E03A 3VR2D 1U9YA 3GLIB 2FZ4A 4G9BA 4D4KA 1LEHA 1U8FO 1IBSA 2E9SA 2XSZA 5HIKA 3KOXA 4PLPA 1OH7A 2G5TA 3EZ7A 1K63A 4QUAA 5IARA 4LRXA 3SBOA 2Q5CA 4B7UA 4AP9A 4CKCA 5CITA 5CD1A 3M1YA 3V2IA 4D8XA 4CM9A 3JPYA 1AXEA 1KJWA 1XTQA 3IDFA 1RCUA 3B3GA 1JDBC 3IKMB 3PJGA 4IX1A 4NY1A 4ZU3A 5K3FA 3HYLA 3W2GA 4E4YA 1H2RS 3JR7A 5JDIA 3TR6A 4A8HA 1C50A 1AY0A 3FVRA 1WY5A 3N87A 1H2XA 1UAYA 4LZLA 2CCGA 5K0FA 2YBDA 5DTRA 4HGOA 4EM6A 1VE1A 5HF9A 3AUJB 4JKIA 1PIWA 1R6VA 1ZD4A 4K8OA 1EEXB 5KS2A 1YVPA 2R3SA 3ZY5A 2LV8A 4C07A 3FPGA 3BUSA 4EKDA 4RPIA 4PN7A 4J2TA 4IJ5A 2HLDA 4CHGA 5T4HA 4M0CA 4Z3KA 3QVGB 4RUKA 2DERA 5MGNA 3DMRA 3FX2A 4KXQA 4RYDA 3T5MA 3I9FA 2FJUA 1AGYA 3BMXA 4PONA 4UDNA 5K0JA 1KQNA 2OKGA 5IK2A 3TUJC 5KYUB 2D2VA 1PT7A 4GXNA 4RSGA 4D99A 3OKPA 3EQ2A 4CF7A 5LMCA 3TRKA 2AG0A 1XCLA 1KK0A 3RSHA 2XT6A 1TZBA 4TQAA 3U3JA 2AEFA 3SSNA 1Z12A 3WXBA 3VU3A 4CT4B 4D46A 1FVHA 1T4MA 1SFRA 1EHIA 1U5CA 1UDXA 3ENZA 2GNOA 1LNSA 2PLWA 3INGA 3KYCA 3IALA 4IW3B 4HAOA 4GE3A 5DM2A 1Y1LA 3WK6A 5ALVA 2ONKA 2YUTA 5JFTA 4TTQA 2CLCX 2FPUA 3QU2A 1D3AA 1AF7A 3C6QA 1IN5A 1FVFA 2A59A 1ISIA 1VZ3A 3ABZA 4GKAA 5TY0A 3IJEB 1VSQA 4U7HA 1R18A 5DLEA 1EVJA 3RVBA 4CMIB 3VPHA 3VKWA 3DUWA 4ECEA 1L7XA 1M72A 1SPXA 4KUEA 4BNMA 3O8NA 3HPQA 3LKVA 1BYUA 3FGOA 1ZW6A 1DKRA 4F6LA 2H3HA 4GP7A 4CQNA 2H1IA 4B48A 5AM4A 1QKJA 3UANA 1U28A 3DV9A 1NLZA 1MRZA 2JCGA 1J9GA 1Z5WA 4ME6A 3PDHA 4JLMA 3K0AB 2FWIA 2GRAA 5I9LA 2CNLA 2H29A 3RM3A 2PBLA 4IOMA 4QJ3A 2G71A 5FLKA 4IDNA 3I9LA 4NBKA 1SD1A 1SCJA 2V97A 1IRXA 4RDCA 1I4DD 1UDAA 2QL6A 1SK8A 3GFVA 4HH1A 4RENA 4XVQA 1L5HA 3TLYA 3UMRA 4Z4IA 4YJDA 4EQ6A 2ZJ5A 1TM1E 2QAIA 1KMIY 1N7IA 5FO1A 3TB6A 3TZEA 3MJFA 1MEOA 5E1MA 4AL4A 3NOVA 2R6ZA 3JQPA 3GGJA 1QFSA 3K2EA 1U4SA 1VFNA 2OHVA 3KKMA 4O0MA 3TSWA 3L7YA 4K9OA 4RTKA 4L27A 1NQAO 4UHHA 3A2KA 3RUEA 3A70A 4P7JA 4ZAZA 3PC4A 4MVJA 4JAVC 5FOUA 1BE6A 2YYSA 3QF4B 2R1UA 3UXYA 1ZINA 3C8ZA 1MW9X 1WETA 3KB6A 1O97C 5DT2A 2I5PO 3DW1X 2I2WA 2IF0A 4FWBA 4CG1A 4N3AA 3DBHB 1ZLYA 4R6WA 5EHGA 2B9EA 1HY3A 3D5EA 1J09A 2G25A 2RAVA 1XYVA 3EVDA 3KB1A 2B0JA 4MR9A 1F2TB 3OTWA 2AR9A 1CEQA 1IN4A 2QA5A 2WSLA 4LMRA 3AH8A 4YRKA 4B3SB 3MF4A 1T4DA 3QVOA 2HJRA 3SICE 3PA6A 4FT4A 3SIRA 4I7EA 4QTXA 1GYPA 3MLAA 1JVBA 3OF5A 3H2SA 4H7IA 4N01A 4KPEC 1N5KA 4NP6A 4S1NA 3X1KA 1KE2A 4Z4GA 2IUYA 2O5VA 2WZDA 3G0OA 2WA1A 3KQMA 4IJ6A 4IVRA 3EGOA 3NRBA 5IT4A 1QP7A 4GYYA 5DH9A 1B8UA 1MH1A 3CRNA 1U3WA 3DAFA 3K09A 2YDYA 3OZWA 4JC8A 4YXWD 3K1AB 4J7AA 5A05A 3FTEA 2BMDA 2DQYA 2HNBA 3KT3A 5GM2A 4EHFA 3RODA 2PG3A 1V3UA 2R62A 1O4VA 4TV9F 1T4BA 4HUQA 1IXYA 3TM5A 1VLZA 2XODA 1E0DA 3AETB 5DGXA 3GO4A 5ITWA 3T7JA 2YOFA 2X6QA 5AESA 3L8FA 3NGXA 1Y34E 2XGGA 1NPDA 1P1CA 2CDCA 3HNRA 4LPKA 1N2EA 2NUBA 2GEKA 5U1PA 1F0NA 3OZEA 4NRDA 3A58B 3H4VA 4JITA 4FEAA 1W2GA 3KSDO 3ZN2A 4PFJA 4ZJUA 1NLMA 2NTNA 4EJSC 2IXFA 1CRWG 3QU7A 3ZOZA 4E2WA 3HJNA 5E3IA 1DHRA 5HQJA 2XGJA 2YICA 1Z35A 1LK7A 1PYDA 4B6QA 1KHHA 1ZJJA 1AHIA 2F1OA 1JAIA 3OAAD 3GJ6A 5DGCA 4FQ7A 1F0PA 4H3SA 1P1KA 3R7WA 5FB3A 5BN5B 3RVLA 1W49A 1VBNA 2Z6QA 4UBIA 5IAOA 3SXJA 2HJSA 3RU2A 3ELUA 1U5AA 2ZUTA 1VPEA 3UMJA 3O91A 3PB3A 1IZ7A 1M6NA 1T3SA 3PR2B 3Q7EA 4ZT6A 4YCNA 1RADA 4CTKA 2X2OA 2H2FA 2J7PA 1OA1A 5CK5A 3FLMA 2B82A 4N5LA 5CLQA 1M34A 1ONPA 3F2IA 1J20A 1VE5A 1ZGAA 2WJHA 4DL9A 1T9DA 2IHBA 1L1EA 4KK3A 3SDBA 3I64A 2IUUA 4R3WA 4GM0A 2XF2A 3HJRA 5JEDA 2ZTSA 2RBEA 3D3NA 4DNQA 1SUBA 5FLEX 3WQQA 2FF5A 4FFPA 3PQEA 1Z07A 3AU9A 3HU1A 5BSHA 3FHLA 4ZICA 1ZVMA 4YO8A 3K2BA 3GP8A 1RLUA 1B6SA 1P7PA 3JQFA 4IGKA 5J2TF 3HO8A 1QLWA 3BGIA 521PA 1BEUB 1VJ0A 3A1UA 3OQOA 4AMGA 1WMSA 2CV1A 1FPMA 2ZBRA 3ICOA 4V0OA 1T9KA 2XCIA 3OPYI 1X8LA 1ZC3A 2RCYA 4IHAA 4LZWA 3TFWA 1ST3A 4DA9A 5C8DA 4ZU1X 5BWBA 2GSDA 4TKVB 4Y1GA 4JGIA 1UBRS 3SZLA 3T52A 1GT6A 3G6WA 3L8HA 4CCSA 4ETIA 4QUBA 1CTQA 1YI0A 5CVUA 5DX8A 1N78A 2WQ7A 1A8UA 1PSWA 4MVCA 4QDOA 3EE6A 4E15A 4EB6B 3HZRA 1PN3A 3LT1A 3OCUA 3OX2A 4Q66C 4TTTS 3VKUA 4DLSA 5D51S 4H0FA 4DE5A 5ALHA 3VR4D 3OLVA 2B4TO 3CIOA 3FGNA 3ZY3A 9LDTA 1K3TA 1C81A 1OPXA 2NX2A 1Z7YA