2OO5C

Structure of transhydrogenase (di.h2nadh)2(diii.nadp+)1 asymmetric complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title Structures of the dI(2)dIII(1) Complex of Proton-Translocating Transhydrogenase with Bound, Inactive Analogues of NADH and NADPH Reveal Active Site Geometries
pubmed doi rcsb
source organism Rhodospirillum rubrum
total genus 48
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2007-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2oo5C00
1QPBA 4GM4A 4QPZA 4RMGA 4IF6A 3LQ1A 2EZTA 1POXA 4FVTA 1OZGA 4K9KA 2VJYA 1DJLA 4GP9A 4UU8A 5BWOA 2AG1A 5BWLA 2VBIA 4BVEA 2FWNA 1M2GA 2QQFA 1SZDA 2FN3A 1YHYA 4JUAA 1YC5A 1OZFA 5EJ5A 3GLUA 4UU7A 3HWX1 4RMHA 1M2JA 4KXQA 2H4HA 4J16C 4BV3A 1M2NA 4D5EA 5MFZA 5FYQA 1HZZC 3RIGA 4GM1A 1PNOA 4K9MA 4JD5A 2JI6A 5IMSA 1U2GC 3D7KA 4KPUA 2OD9A 2X7JA 2VBGA 2EZ8A 1YBHA 2VBFA 3JWPA 4MPPA 1JSCA 3IAEA 3CF4G 1MA3A 4F4UA 3CLSD 3EY9A 4ZP1A 2FR8C 3CLUD 1T9AA 4TWIA 4JT9A 4TWJA 1YC2A 2IHTA 2BRUC 2JLCA 2W93A 1PNQA 2FRDC 3FLMA 4BVBA 2VK1A 2A1UA 3PKIA 3F6EX 2AG0A 3F6BX 2V3WA 1V5EA 1YHZA 5EJ9A 4MPRA 1M2HA 3U3DA 5K6TA 1T9BA 2A1TR 4FEEA 4V1CI 2IHVA 5EJ6A 2JLAA 3GLRA 4X3OA 2H2FA 3ZG6A 2PGNA 4JUCA 3HWWA 4G1CA 1T9DA 5DEIA 2H4JA 4BUZA 4GG1A 5DGTA 4JUBA 2EZ9A 4UTZA 1U28C 4L3OA 2WVHA 4R8MA 2OD7A 4J1TC 2WVGA 2Q27A 4COKA 1PO7A 3IAFA 4K9PA 2PGOA 4RJKA 4I5IA 2JI9A 1XLTC 4MQ5A 5K3SA 4JU8A 1E3TA 4JUFA 3PDHA 1POWA 2QQGA 4JUDX 1S5PA 5EJMA 1N0HA 4RJJA 1PVDA 4BVFA 4Y6QA 3D81A 4FZ3A 5MF6A 5DGDA 4RJIA 5FEMA 2IHUA 1D4OA 2VK8A 2H59A 1O97D 3OE1A 3GLTA 1YI0A 1UPBA 1OVMA 4K9LA 2OORC 2Q28A 2DJIA 1S7GA 4BN4A 4IAOA 5EJAA 2NXWA 1Q1AA 3GLSA 2OO5C 1MCZA 4IG9A 4HDAA 4UTVA 1U2DC 2UZ1A 4D5GA 4BVHA 4K9OA 1YNOA 1Q6ZA 3EYAA 4JT8A 4RMIA 1Y9DA 3RIYA 1M2KA 4HD8A 5EJ8A 5MFPA 2H2GA 5EJ7A 5AHKA 2HJHA 2FSVC 4L2IA 2Q29A 3FSJX 1U31A 4MZXA 3E9YA 3JR3A 2PANA 2H2DA 2EZ4A 4QELA 4F56A 4MPJA 4Q9DA 1NM5C 2JI8A 2H4FA 1UPAA 1PI3A 2Q5JA 1O96B 4UTXA 4O8ZA 1EFPA 3EA4A 3ZGVA 1ICIA 2EZUA 5D7NA 2VK4A 1Z8NA 3PKJA 1V5GA 4GM0A 3CLTD 2NYRA 2WVAA 3K35A 4C7BA 1YTLA 4QQ8A 4ZZIA 1J8FA 4RMJA 1T9CA 4K9QA 2Q5QA 4V1CA 4UTRA 4JU9A 1UPCA 1PYDA 3D4BA 5MGNA 3U31A 1BFDA 2H2HA 1SZCA 4BV2A 4V1CB 1OZHA 3ZGOA 1PT9A 2Q5LA 4UTNA 4UUAA 1YI1A 4UUBA 3FZNA 4Y6LA 1EFVA 5EJ4A 2Q5OA 1PTJC 5K2OA 2OD2A 4C78A 1ZPDA 1Q17A 4BN5A 3CLRD 5K6RA 4GPEA 4X3PA 4FEGA 2JIBA 1Q14A 4JSRA 5BWNA 1V5FA 2JI7A 4Y6OA 2UZ1B 2C31A 4BVGA 4KGDA 2H2IA 2B4YA 4K9NA
chains in the Genus database with same CATH superfamily
5K3EA 1H8ED 5H16A 4JS0A 3JALA 2H0AA 2H52A 4Q9NA 5TPZA 4TRNA 1RXSA 3F9RA 1VCNA 3QQ5A 4OKIA 4EUFA 4B8ZA 1P1CA 2BKUA 2QD2A 2QE7A 2QYHA 3QBJA 1OZGA 4DDKA 5IDQA 1XMVA 2P4QA 2GEBA 5T3YA 2A4KA 3CX3A 5HTKA 3UMJA 4M49A 1PF7E 5HIKA 1B16A 1N2IA 2WSBA 4YPFA 1BNCA 3OCYA 3W2GA 1FSPA 3EWSA 5ENVA 1ZOPA 5JSFA 4AYWA 1DJLA 2GS9A 2ZT8A 4WAUA 3ASYA 2QRLA 1Q21A 1RRKA 5LYJF 3RRYA 3HRHA 3UCFA 1GTL1 3Q5DA 2XMCA 2KMLA 2CK3D 4I55A 1J8DA 1UWCA 3TF5A 1KH1A 1WOMA 2FWNA 3H5IA 4MAFA 4OBWA 2GZ2A 3I09A 1WCIB 1KGDA 5INTA 3O2JA 3KSMA 3ANSA 3T5PA 2WZQA 4P7GA 3PNMA 1QFJA 1WXXA 3EEQA 1R5NA 5LJIA 1VJ5A 2FQYA 2PSHA 4LVUA 5JSZA 1E1QA 3KBBA 4ZT3A 5KTPA 3KEQA 4N0EA 2YOFA 4KPYA 1XF9A 2R7MA 4H4EA 4BVLA 1SBIA 3VJMA 4BBPA 4IDBA 4QDZA 5K0SA 5EEHA 1W25A 2UVPA 3BREA 1VYHA 1M34A 2O2SA 1WMSA 2X8JA 4GMKA 5JG7A 3RVJA 1VXRA 3MTEA 2YUIA 1SHZA 2OO7A 1A5TA 1AGPA 5JSZB 2XNHA 3C2QA 1ULUA 4QTXA 3UUGA 3PNVA 1MBZA 2APJA 4JNCA 1N2JA 4YDQA 1YZKA 5JZMA 4C5AA 2QM7A 1QYRA 1M9NA 4KWIA 2WLTA 1BCRA 1OLXB 5AI0A 3FX2A 3MWLA 4EKYA 2UVPB 3DEIA 2QU8A 1M34B 4M0EA 4G63A 3HUDA 3IT2A 3EHDA 3K31A 3L1KA 4EF4A 5DM0A 2ZR8A 2NTEA 5I9LA 1DVRA 2W2KA 3GRUA 3ORRA 3K70B 5AI6A 5F3DA 3OJXA 3QKSA 4UBKA 3BQNB 1OWMA 2Q50A 3B20A 1BCRB 3NDJA 2IDJA 4B46A 1EG2A 1E0KA 1P5JA 1QDLB 4L08A 5F64A 5AVKA 5FULA 1KDYA 1NLUA 2PUJA 2VH1A 1EVJA 3O4FA 4OFZA 4Y2HA 1NU8A 2J0UB 2ABWA 4LDPA 3RAPR 1NBMD 2M6RA 4FU0A 1N5MA 3GZJA 3KQKA 1GU1A 2HSZA 1AZTA 3CHYA 1JHUA 3RUIA 2G63A 2PUVA 3SWWA 3DMPA 4TMYA 1Z39A 3ZHZA 3PJDA 3V2UA 3QKSB 2Q6TA 2NUAB 4D82A 2YWCA 2G4LA 4HBGA 2VBFA 4PF1A 2BEWB 4G0XA 5IF9A 4FOOA 1IJFA 4L3VA 1EEXB 3ELUA 5EMMA 2V7WA 4BNXA 1DGQA 2VP9A 3HL0A 4NPAA 4PQYA 2DHDA 2X23A 3AHJA 3V55A 3A6FA 4LISA 4TS1A 5L3RA 3T9CA 3VR4A 3V8QA 4X41A 3BB4A 4ZP1A 2OKGA 1HH4A 4G1FA 1WSWA 1W1UA 3NKLA 1E3DA 1OI4A 4TTIA 4R84A 4BFVA 3ZD9A 1YTUA 1KEVA 2FQQA 2Z2KA 4Q3LA 3UWKA 4MW6A 3PIDA 1DEKA 5ADHA 5JD6A 4GUAA 4G4SO 2Z6QA 1GHTA 3TW0A 2YNMD 1KNQA 3DEJA 3ONFA 3BH6A 1E3WA 2P30A 2H0RA 4G1BA 4EPYA 1ONSA 4PPYA 2H48A 4ZTUB 1JG7A 1WPXA 1X39A 2Z2ZA 4FDUA 3V80A 1DV1A 2WHYA 4FOSA 3ZHRA 4ZCQA 5TVGA 3W6ZA 4F4FA 2PSEA 5LJLA 1D1PA 2RB4A 4MR8A 2B35A 1H6BA 3HN7A 4RTLA 3E8SA 1Y6GA 4RZ2A 4B3XA 3NC1C 3V1LA 4QO8A 1NF8A 1SVKA 1YHZA 3ZZMA 4IILA 1VMEA 1UT5A 1EBFA 3ITKA 4WBSA 4JQZA 1DAFA 2NU7A 2XCOA 3L6EA 3MMZA 2GA8A 2ZS9A 1EK2A 1Q0LA 4OAPA 2BH9A 3NXSA 4HAUA 1NVMB 1Z0SA 3C74A 4NVRA 2QJOA 2P4SA 3RBVA 1TMYA 4IL5A 3HYLA 2FZWA 5ALYA 1PE0A 4Z2AA 1Z88A 2VHQA 3E0XA 1WUJS 4MR9A 5GZ3A 4QDUA 2I33A 1QRUA 2NU7B 2JLWA 3OICA 4PTYA 5JBIA 1PHRA 2VF5X 2ZZMA 2XADA 1JDPA 3A36A 1WMBA 4M76B 1GL7A 1CQPA 1JZQA 5B1SA 4NNJA 2JGJA 4RTMA 1IM5A 2V6BA 2O2CA 4KV7A 2OCDA 3D3NA 2VYNA 4A27A 4DSAA 3IPXA 2H31A 1F5SA 3PXXA 1U2RA 3KZMA 1KQOA 1IPHA 4WXHA 4MR9B 4B1FA 1B0UA 2H4JA 4NFYA 2Y1FA 4NEHB 1MC8A 1HLFA 1ENYA 1EDZA 3EULA 4WVLA 5LZ5A 5LZ9A 1G41A 1EP9A 1GRRA 4JA2A 2GTHA 3WYCA 4RDHA 5ALNA 3S5UA 1ISGA 1VHTA 4UZEA 3E4CA 4YRTA 4J94A 2QTNA 4B82A 5BV1A 2PVPA 3PFWO 2QJWA 2OLEA 2X2EA 4ZO4A 5ALUA 2RARA 2IKQA 4RYLA 3PUWA 1IK6A 4B4VA 2YOHA 3HPQA 1CETA 1YKSA 3G2OA 4G26A 1P6UA 4IFBA 2ZSIA 3EGWA 1X3SA 2R5NA 3G8YA 4LV6A 3B82A 4NYJQ 4COKA 4LVCA 5BUZA 1FP6A 4QQKA 2WDPA 3I6QA 5J3JA 3LQRA 4FYPA 1WTAA 2FK7A 4LZNA 3O95A 4ZKDA 1ZRSA 5KOJA 4JAVC 1NATA 2REXB 4K9SA 1CW2B 4P9NA 4OV6B 1QH1A 1B2RA 3D9QX 1Z63A 1U65A 1XDWA 3B8EA 4KOEC 3ESDA 1OASA 4HQOA 1XZKA 3OOJA 3L1VA 5ALOA 2AFIB 5CYPA 1JXAA 5ARDA 3HA2A 4J1SA 4WLNA 2YJ4A 1A3CA 3O26A 3AERB 1WXIA 1V5IA 4ZDWA 1L8QA 2QRPA 3NAGA 5A71A 1L1FA 3F74A 3KVNA 1BH6A 2XKAA 3DH0A 1Z7YA 1GPWB 3T1OA 2HIHA 3OCVA 3V1UA 1QH1B 4F97A 1LWOA 3SVTA 4UHJA 2RGDA 3AEZA 3I6BA 3QBEA 3O6VA 1NTOA 3GRVA 2PD4A 3H5WA 3MFQA 2D2FA 3DZHA 1NDQA 4ZI3A 3I32A 1CUZA 1T5TA 5AFSA 1NW7A 2GZAA 4W5NA 2HJSA 3KUXA 4B6EA 2R1VA 4JOQA 3HZOA 4PX2A 2OXTA 4BTVA 1OE0A 4DSOA 4RTQA 5JSUA 1FDIA 4UVDA 3V4ZA 3JAKB 3VM6A 4LZOA 5DGDA 4FE3A 3R5XA 4K6OA 3WYNA 5ENDA 1WHTB 1LV8A 1XQ9A 4K81B 5JARA 4PLZA 1SCDA 3OTOB 5KYWA 3NANA 4NOJA 1WUYA 2QSZA 4BRSA 3VGJA 1QH0A 2R1VB 3AVUA 4KZKA 5CFQA 4V0LA 5CVTA 2F6RA 3WAJA 5LD2B 2HPAA 3JTMA 1QORA 4TXJA 1T35A 1QIMA 3QMPA 3T5DA 1C0KA 4EJFA 1AA6A 3QX9A 5D6NA 3CLRC 1GG8A 3G0BA 2JIQA 5HF6A 4CDGA 4OHBA 3KVRA 5KTOA 2HDHA 2QL7A 1OFVA 3D6FA 3E1KA 5AK6A 5EQDA 5KYWB 5LQNA 2D0DA 4HO1X 4WBXC 1J39A 2VF7A 1DT5A 3L82B 3N2LA 3Q4GA 4HH3C 4TSFA 5I9TA 3UWDA 4KQMA 4GS5A 3KOUA 4YFVA 3LDHA 2YN4A 4DV3B 4YUWA 1VKJA 4KXMA 3B7GA 5AM1A 1KSFX 2JLSA 1L4NA 1M6NA 3AF2A 2A78A 2FVYA 3G0CA 4R3UC 4HWSA 3SHOA 3TTTA 1PQYA 3S2FA 4A82A 5JWHA 4Q7KA 4LZWA 5DP2A 1AQLA 2WYUA 3TCXB 3LUHA 3X2FA 3WLJA 3AJAA 1FJGB 3RUCA 4R9NA 2E85A 4Y0AA 1JGTA 3H2JA 4JVLA 1E1KA 1OFGA 3NHWA 2KQUA 1LY1A 3OOYA 2IUYA 5HK8A 4AKSA 4X44A 3L1IA 2CZCA 2XRZA 4S0XA 1P72A 3A9VA 3ZTWA 1PGQA 4RHTA 3D8TA 3B85A 3IOBA 1W46A 4TTPA 3ZY3A 1VRWA 2WG0A 2YXLA 2O8FA 3OQVA 5E6RA 1A4XA 4RE6A 3QNMA 3WLOA 3DFFA 1EINA 3UO8B 3LT5A 1WKCA 2EF0A 2YN2A 3PGXA 3UV3A 2H65A 2ZYUX 5HM6A 4FD3A 3PCTA 2PUCA 3ICOA 4EHLA 2WJHA 3QVUA 3TKLA 2BCEA 3OIVA 4PY2A 4X8MA 3HVRA 1I3NA 5G4LA 5JS8A 3IE1A 3K1AA 5A4IS 2O8FB 3ESCA 4P2BA 5E6RB 2ZJZA 1G7TA 1MD9A 1L8AA 1NMZA 2J9XB 5TC4A 1T6XA 3FFXA 2JFYA 3SZLA 2C7QA 4CKBA 3VPFA 1GUFA 1FDVA 2WM3A 3QJYA 4RGVA 1AKUA 3NYWA 4XIGS 1IN8A 1YDFA 4DMMA 1RRMA 3OO0A 1E1DA 2B30A 2PKWA 3A1FA 2VHCA 1PJRA 3DM9B 3LBFA 1BJTA 3JXEA 4KQKA 3KJEA 1THGA 5EVJA 2CDAA 2Q29A 4QUGA 5JSHA 3CCCA 4M0DA 3FOAA 4N12A 5FWDA 1N9GA 3VC2A 3TAUA 3KEFA 1C7QA 1EVKA 3SBXA 1LLFA 3QKUA 2JRCA 1R27A 4QFDA 1C7JA 3KHTA 1BVHA 3GYBA 3KZNA 3I72A 2VUHB 3BXGA 1CVRA 1SD2A 2AKYA 2FPOA 2JH8A 4LDQA 1EXDA 1DUVG 2VWQA 4PHGA 5IEJA 2ACKA 1CF4A 4QOGA 4D3SA 2WUFA 2GERA 4ZQBA 4NBSA 1BU8A 2IHNA 3ICEA 3MGKA 4XLZA 3C14C 2CXUA 3WFZA 5E9JA 1XXHA 3MUOA 2CLEB 4PTLA 5AESA 2DFNA 1DC3A 3NH6A 2H18A 1W0KA 3AIIA 2FHPA 4UMFA 2L69A 4OJNA 3DL4A 4AJPA 4F1KA 1EWRA 1N25A 2OBXA 4TWAA 2BM0A 3OQHA 3UH0A 2KYRA 2P5UA 3W4IA 4YGXB 1LVHA 3BORA 5ER6A 4C0AC 4BLWA 4DCOA 1B0PA 1RLIA 1TYAE 3QYPA 3IJRA 4TYMA 1L4LA 1NMXA 1XXHB 2CWWA 4Z4EA 2QOEA 4JITA 4MGZR 5AVZA 1NW5A 1ZUWA 4NOMA 4RMNA 3RUAA 2PBLA 1E62A 3GJ0A 4MVWA 3L6RA 4BLOA 1SK9A 4FYJA 2H7CA 1D03A 4C01A 1FVXA 1L5HB 1Y5RA 2I0FA 1DRUA 2QVYX 4JJGA 1PFYA 4GWLA 4MITA 2UXCB 1FF9A 2VUIB 3IBFA 3PF8A 3AJ8A 4YRRA 1HEIA 1RXEA 2WVAA 4HQNA 3THYB 4U6SA 3LLMA 2AUMA 3PUXA 1ECFA 2HHLA 3PI7A 3R3WA 1ILWA 5CFLA 4MUXA 1E2NA 4KQJA 4LKOA 4QAQA 4IIEA 5ELMA 4P3NA 3JQ7B 1XRPA 3IV6A 5F7JA 1UBKS 1PZNA 1JKJB 4G0MA 5CX1A 4W8HA 3FTQA 4BQQA 4EG3A 3QPCA 3R3HA 4UHFA 2X0EA 6ADHA 3PE6A 2Q3FA 4ZDJA 4NHEA 4EEZA 1MTOA 3M5DA 2XDYA 2ZSHA 4HDSB 4LEIA 1QRSA 3WHPA 4EHAA 2WBLC 6ABPA 2DFKB 2FG7C 4PXAA 2FLWA 1MAUA 3DBLA 3O8BA 5LXTB 5JZSA 1NNI1 2Z1DA 1WUTA 2WT8A 3AHDA 4PZAA 4PLPA 1SBQA 4X0EA 5EZ6B 4IUYA 4A2QA 4DY6A 5AQ1A 2JGLA 1O0BA 1DT3A 1ZWKA 3F5MA 4DCTA 1OHHD 3O1LA 1O94C 2VUSA 3GX1A 4B6FA 5EP3A 4W9NA 3AXTA 4MVJD 3I2HA 1D09A 4WINA 3EBPA 1MXHA 1SNYA 1E61A 2HHJA 2AS0A 2WHEA 3A2LA 1GGFA 3CB4A 4IZHA 1SMKA 1KI2A 3QUSA 4IDOA 4KG7A 4QOSA 1ZICA 3HDHA 5EIAA 2P6UA 4EECA 3E7PA 3DDHA 5TQJA 4ZAVA 5JDIA 2DRIA 1JFSA 1I3OA 1NVVQ 1Q17A 1Y9EA 3E61A 3RVNA 3RG8A 5BMVA 3JARA 4KVZA 4ZCLA 3L5OA 1RJGA 3ZXYA 3L0IB 1PQPA 3NHYA 3HA5A 1ODKA 3FZQA 2XI4A 3G8AA 5F7ZA 3BL8A 1H3FA 3FG9A 3AVXA 4NX2A 1QHIA 4UHKA 2YIDA 1GA1A 521PA 3ZHUA 4IUCS 3KYIB 2WI8A 3HB4X 3Q11A 1JMVA 2MIIA 3CSSA 1QOPB 4QIHA 3I9MA 3IAS1 3Q7PA 4JR1A 4JLVA 2QL6A 1K89A 3IKJA 4JKOA 4Y18A 4Z9YA 5AYVA 1FJ2A 1XA3A 2E2WA 2I7XA 3D4IA 1S8AA 2AZ4A 3IVGA 1LKZA 4LECA 4TS4A 4XEUA 1PHPA 5LBIA 1AC5A 1FDOA 2PXAA 3NHMA 1GPMA 1MIOB 5LLSA 1Z56C 3BGOS 4Y1RB 2HFJA 2I87A 5DNDA 1IHPA 2ZE8A 3KTAA 1CR2A 2XRFA 3E5NA 1A9TA 5DLQC 3PRJA 2ECPA 3FRHA 5C1IA 3N0VA 3WKBA 2EXXA 1JA0A 1LVGA 2JK1A 4H3VA 4E15A 2E21A 1DXQA 1DCKA 3LW8A 3OTWA 4FP9A 2RCNA 1RBMA 2RGRA 1XMSA 4QL3A 3DAYA 1E2UA 3D5TA 3I6IA 2HLHA 4BGIA 4X65B 3A6LA 4AURA 2W6IA 3F96A 3BRQA 4BTEA 5EL0A 3HC7A 5JUWA 3CW9A 3WMFA 1W34A 2O14A 2QD5A 1I4OA 3R23A 3IPAA 4XYGA 2QMEA 2XE6A 3G89A 4OHCA 4RWZA 5LL6P 4X6LA 1SA0A 1KK1A 1SG0A 3OT4A 5CYOA 2XCRB 3S28A 2PX8A 4U4AA 4FGKA 4X00A 4PFSA 4JUIA 1GQSA 2O2ZA 1CYDA 4C4AA 4H1HA 1VG9B 2HCRA 2RHLA 5ADUS 5CDUA 2B1JA 4LXYA 4ZVTA 4OHMA 2HWXA 3HVHA 1SA0B 1KY4A 4HWGA 4LNUA 2FMIA 4I9UA 3WGYA 5BN5A 5IASA 1NQVA 3UG6A 1I0IA 2DHQA 1V47A 2W90A 1FU8A 1JDZA 1V35A 3FCOA 4WLUA 1NVGA 1NZDA 2AF3C 2ZTSA 3K2EA 2BEKA 4IAOA 1AKTA 3VR6A 4OL0A 4Z7JA 4KLCA 1VJTA 1B8UA 4XI9A 4IVRA 1YGYA 1X7HA 3MOIA 4A15A 5EINA 3WLRA 4GHWA 3KJQA 4X8HA 1YQWA 2PZBA 3SC3A 2M98A 3EHEA 4EQ6A 1XDSA 2J6CA 3O91A 3HP7A 1VCOA 4AK9A 3K70D 1V2HE 2WAAA 4BRZA 4WUVA 1C80A 3SQLA 3MJHA 2XCUA 2ZRDA 4MZDA 3B5EA 2QLBA 4UPEA 5EE3A 1Z12A 4QBKA 4WKOA 4DLSA 2OTCA 3DHEA 3CNNA 4KDEA 4X9XA 3RASA 1H3EA 1PDWA 3AW9A 3LXXA 2PZJA 3LWNA 3ROTA 2Q2NA 3ZCTA 3HP1A 3V8PA 4D96A 2DC1A 1BDIA 3PNLA 1VIVA 2CFIA 1D6NA 4PZ9A 4DNQA 3A8TA 3ZK8A 3TGPA 3HTXA 2UYYA 1K75A 3RYHB 1IOLA 2BBSA 2JLQA 3PTAA 4N0QA 1QRAA 4JP1A 4OF4A 3HEMA 5ES3A 3WGOA 3H84A 3AEXA 1KE2A 2JJ2D 3TJZA 2YHIB 4HB3A 3PUKA 3U16A 4KPUA 5JJBA 1ZK2A 5JECA 4N0DA 2VPXA 2WB4A 3DQZA 3UBMA 1G5FA 4DPKA 2B1RA 1NXVA 3L1HA 4QOIA 4TMKA 4F38A 2FPIA 2VHXA 2BI8A 3P9IA 5DJ5A 2PGAA 4B40A 4B84A 1LI4A 4DMHA 1OB5A 4KMOA 1YACA 3N8IA 4KPUB 5REQB 1QV7A 4KW7A 3EIOA 4F4UA 3RB8A 1S8OA 5COBA 4BPBA 1EGMB 5CLGA 5BP7A 4YJGA 1ISFA 3NVDA 1P33A 4MVJF 4N7RA 3VYWA 3ONVA 2HZ7A 4B3BA 2HJVA 3KSAC 3IIEA 2GQ0A 4JT9A 1VIAA 1YC2A 2FPIB 1GPKA 4L7QA 2FB9A 4DXDA 5CCBA 1M67A 2XGGA 4M7WA 4RJLA 3CJQA 4BB0A 2J08A 3QF4B 3D4PA 4O4JA 2FRDC 4V3CA 3RYIB 4EGAA 1ORHA 5KDDA 3A6KA 3LFHA 5FBWB 1EP1B 3W4KA 4O5AA 2HA7A 2R25B 3M70A 3Q15C 4R1TA 4UDXX 4WUTA 3VH3A 3WDSA 1DINA 3WLMA 5LZ2A 2BGWA 1AD2A 3DXFA 1GM5A 2GBLC 1NXQA 4M0LA 2IH5A 2RHTA 1U7OA 3F6EX 1PL7A 3SYRA 3H8WA 1AK9A 4WFKA 3TTSA 3MVEA 3A3NA 1XHEA 4LJ4A 2ZUEA 3GDWA 1ZN7A 2H4XA 3NHKA 1F1JA 4ZOBA 4I3HA 2PUBA 3NVKI 1XNHA 3DVQX 5ED0A 4P35A 2C7VA 1P8AA 5F5NA 4E4TA 2C7OA 2GNOA 1Y5NA 4ETMA 1TLFA 4JQCA 3O3CA 1TKBA 4A9AA 2Z43A 1R10A 5EJ6A 3B36A 4S1VA 1GN9A 3FWNA 3GMTA 3JQBA 3TMKA 1WD7A 3TW8B 1N32B 4BKOA 1TIPA 2NP7A 5ALZA 1BRMA 4C03A 4D0GA 1C30A 2GUWA 4QLBA 1K0FA 1QIFA 4NCJA 2XNDA 5GPBA 1BS9A 2AX3A 4LRQA 3RCBA 2K2QB 1IFXA 4NCHA 1YQDA 2GJ8A 1DKNA 4P36A 2ASEA 1ZGAA 1QGOA 2DUWA 2GCPA 5KX5F 5KOIA 1W581 2X1VA 1UPTA 4Z49A 1CK4A 1XHLA 1FRVA 2XHEA 3PEVA 1C30B 1CR4A 1QFMA 1QIKA 1ZZEA 3KCQA 3OM1A 1EM8B 4LQLA 3UB4A 4JUBA 5JPIA 1H69A 2VZ9A 1H0KA 4HVAA 2BR3A 2XPCA 5FOUA 2WTBA 1Y8AA 4LMBA 4QOJA 3FRJA 3ANYB 4G8BA 4J0KA 5ALEA 1VSUA 4NPHA 3O4RA 1U28C 2GKGA 5EFOA 3OA2A 2VRBA 3T1QA 5EZYB 1CUDA 3VHXA 2YWJA 2DR3A 3ROQA 1I9GA 1W30A 1H0RA 3K5HA 1C1XA 1N2OA 4MRPA 1QVAA 2PT7A 4TKMA 4F46A 4BLRA 3PWKA 4UPDA 5C8YB 5LQJA 5D7BA 4AJJA 4DCSA 1QHGA 1VE5A 2P3LA 4A6XA 2PD6A 1ULAA 3T1YB 2B5OA 1MFPA 2X22A 1TCAA 1JTVA 1W4ZA 2PZAA 4LXIA 5DK6A 3W5VA 4DMUB 5LOVF 2ID4A 3LRPA 4NH0A 1PO7A 1JDVA 1YR1A 5PNTA 1Q1BA 5FBLB 1HDYA 2UUCB 1ZGBA 3ZWAA 1G16A 3ZWXA 1EJ6A 1Q0UA 2V7TA 4LCEA 1AUVA 2CY0A 1JL3A 2ZB7A 1FRZA 1T91A 1B6GA 3UG7A 3GRAA 1UK6A 3HCRA 5B3JA 2IK8A 3QKWA 3F67A 3JD1A 1DAPA 4RFVA 2NZXA 2V8BA 2JLXA 4H1UA 2C9YA 3M83A 1WY7A 1R5OA 5EP1A 2GK4A 4TL9A 3SMVA 2DFPA 1PWXA 4URUR 5T4HA 3E9MA 2BE7A 3C7DB 1U1FA 4CCSA 4UMVA 7MHTA 2J6HA 1US8B 3CE9A 1RWPA 2ZJ5A 2VNHA 2OZKA 3GVPA 5E4FA 3UWOA 4B87A 4LJLA 4QPJC 3F6YA 1VC2A 3PLRA 5D5PA 4B4UA 1BWRA 2VPYA 5F12A 4RF5A 2GVZC 4KXWA 3NJ4A 4DM3A 4GOXA 1KL7A 1USUA 1MDFA 4G81A 1UDWA 1RCUA 5F78A 3U5TA 1XQYA 2J5XA 3IB3A 1K7SN 2V55B 3RUFA 1JLMA 3K6JA 2CUKA 2LIPA 1XLTA 2WJYA 4KKVA 3ZBPA 1UKAA 1NUTA 4HMOA 1FTQA 1SM4A 2OHIA 1Y5LA 2F3QA 2FFBA 2X1HA 2ZAGA 4R8RA 4Y1EA 4XWKA 5TGTA 4ZO6A 5AM5A 1RXIA 4IQ4A 1U7WA 3K1ZA 4ZK2A 3GLTA 2GARA 4WKNA 3W8EA 3IVMA 4OEHA 2WP0A 4CNQA 2P2LA 4HSGA 6CHYA 1X1EA 4YRGA 2PCLA 2RH8A 1O89A 1X80B 2ZRIA 3BL6A 3EUAA 3L7LA 2HDOA 3HABA 2REOA 2WIFA 4OA5A 2B8JA 4BZWA 1BS2A 1J33A 1OX4A 2ZUUA 1U2SA 3AB8A 3ICWA 4HAOA 2IT1A 3KQYA 1E69A 5IZCC 3OLVA 1K08A 3K4PA 4IZOA 1SK8A 4MB2A 1W85A 4I4IA 5A1TA 5AKHA 3UGQA 5C8ZA 2QRHA 2VAVA 2OQ2A 3BFXA 3BXEA 3DVRX 3N87A 1FSSA 4N65A 2WICA 1IYZA 4N54A 2QTAA 3EXG1 4KP7A 1Z07A 3CVYA 1DQYA 1XK7A 3U3OA 4IH4A 4C3OB 4D25A 3HP4A 1LLQA 4NBTA 3DCNA 3STYA 3SZOA 4ABTA 4QLAA 3DHYA 1W85B 4AZWA 2FPWA 4OK3A 5HTOA 4BLVA 4M0PA 1ICEA 4D8VA 1MCZA 2VYCA 3AOEC 2Q0HA 2EATA 2J6BA 3JY6A 1JG4A 1W4AA 2BTQA 1QTQA 3GL9A 3SSNA 3RC7A 1OIXA 4FFWA 4RTOA 2RHMA 4UNQA 5EYPB 3QA9A 4FJ0A 3NATA 4XQGA 3WYBA 3ZE1B 2H54A 1QHFA 3RWMB 3NONA 1GA6A 4RPJA 1RQRA 2WYWA 3E15A 4GOLD 4K9OA 4NYJR 3ROXA 2OV6A 2BFBA 2G9UA 2GDZA 3NU1A 4A92A 2G77B 2QRKA 4QTZA 2BTQB 1MJHA 2HA0A 4PGFA 4XGIA 3K6SA 1Z5NA 1IBLB 2BGLA 4IIDA 3UK7A 3H2KA 3ZYZA 4BO0A 4LG1A 1ZCJA 5F35A 4ETNA 3O2SB 3DKPA 3C8HA 4ZGGA 1M0WA 2AC2A 5LQKA 1OTXA 3IDZA 3QQPA 2K6GA 1KQ3A 3LY8A 1JQDA 5C31A 4L07A 3MTBA 2HAEA 3W5DA 2QGNA 2I3DA 2ZG6A 3CF6R 3MUEA 4UE6A 5EMKA 1XNQB 1N77A 4R2IA 4B09A 4HK4A 1NVUQ 3AWIA 4LI3X 4M54A 3CKYA 4MA4A 2YRXA 3K6SB 3STTA 1J90A 3ZY2A 3LK6A 1Y3IA 5DU2A 3S2GA 3JD2A 4UU0A 5I4CA 3MXOA 2GAIA 4H60A 3U7HB 2B8WA 1GKLA 1E9RA 2HRRA 1FBNA 2M9MA 3P9NA 1UODA 2FF5A 1RI4A 4N7MA 3SAJA 3X43A 2LD4A 2QU7A 4M88A 4PWYA 2N46A 4OXRA 1ADFA 3L0ZA 3RFCA 3PEEA 4DLNA 1ST3A 2IXGA 2JJ1A 3UMFA 3ZKWA 2KI5A 3GVHA 1GV1A 3QLUA 1UPAA 2XECA 5HIAA 1O95C 1T0UA 1XVTA 1TQDA 1U2EA 1ATIA 2IYWA 1ZITA 4LF5B 1FSGA 2FQWA 4IJKA 4UNSA 6REQA 1JJVA 3C85A 4GLFA 2O0MA 3MWFA 2WAOA 3ZKWB 4G1EB 3PFGA 1LF5A 4RPIA 1YS4A 1NBIA 1UFQA 1L5FA 1YL7A 3MT9A 3IR6A 4OHXA 1X1QA 4INZA 1PJZA 4ZMSA 4KC0A 2QXUA 2PRKA 3SNKA 4JSTA 4LRSB 1Z7WA 3N9IA 3R74A 3VR1A 2B8NA 5BSGA 2AQHA 3D54D 4BNJA 2GN4A 3KDAA 4MMZB 1O8CA 1VLVA 1G3MA 1AKRA 1R8XA 1Z4JA 3B13B 2QGFA 3SPXA 4B9EA 4MYHA 3N59A 5AKEA 1IATA 1PJ4A 2B8TA 2Y99A 3DZ8A 3HKEA 2HMYB 3LNCA 1DKMA 1NGSA 4WKBA 4YN3A 3IKVA 4HB0A 2IS1A 5K4GA 1C29B 1CE8B 1XTZA 3A4MA 4JLAA 4AWBA 1GDTA 2HT6A 4O59O 3ZQ4A 2YYZA 1TMOA 3GPDG 3ZJ4A 6PFKA 4QQ8A 1DWQA 2UAGA 4CLOB 1ZNZA 1GWNA 2HXYA 3D2LA 3UT5B 3F7OA 2QN9A 2AXEA 3V7UA 4FN5A 2BKVA 3HKEB 4G0PA 1L2TA 2CZGA 5EI5A 4EO7A 3PXAA 3UT0A 5IEBA 4Q3OA 5J2UA 1SPBS 2PTGA 3QFSA 1M3SA 4PEVA 2PSFA 3TRJA 4PG5A 1SQ0A 1XC7A 2CCJA 4IIVA 5BRNA 1NZJA 2FPGA 1JH8A 2VYVA 3C6BA 4XB6B 4AU1A 4UVIA 4CMEC 4BE9A 3WIOA 4GPD1 3IUSA 2RH5A 5B7GA 1YFLA 3WKCA 2EARA 1BDBA 4OQDA 3G0HA 3DBRB 4YXWA 3EBOA 4H18A 2R96A 3L0YA 1R0WA 4IWYA 4LHVA 4E2WA 5J2UB 1LPOA 1OZHA 3OTGA 4F6RA 1KK2A 2JGDA 2RAUA 2UV8A 5DZSA 3OX3A 4O2AA 2FPGB 3KOMA 3RABA 5D3MA 2Q5LA 4HNHA 4J0QA 4FKBA 3QU9A 4I36A 3IUYA 5M34A 1SXPA 3BMCA 3U4HA 3CEJA 1ODFA 1RT9A 2AFHE 3FZNA 4KTVE 1Z4OA 4U8GA 2EAUA 1EFVA 4P6VF 3SF8B 5EJ4A 1PTJC 2OD2A 1RPZA 3RVKA 5KO2A 3F5DA 1ZG3A 4MQFA 1STOA 2PT5A 3CUWA 1YJXA 4H1WA 2GYWA 3I05A 1H94A 1K8QA 4UREA 3PC3A 4E2ZA 3PVCA 4O2AB 3ENWA 3K9LA 3P2OA 4X1KA 5B6IA 2VTDA 4F9GA 3AUAA 1XVAA 3A9CA 1FLAA 2XE8A 3T8YA 3G8DA 3VPAA 1EFVB 1KU0A 4Q02A 4CMIA 1PLJA 1IE3A 3LT4A 1G8FA 2CJPA 4YI3A 4XQCA 1XZDA 1ZVQA 3PDIA 3KWMA 3A0RB 2CB9A 1G21E 2IYZA 3BILA 3G0OA 3LUPA 1PZGA 4KHZA 3T7SA 3O92A 3D6UA 1I24A 4X1KB 3T5CA 2DWOA 4L1KA 4Q3BA 5FTNA 2IHBA 2XR1A 1WMAA 3ZGXA 5AW5A 1XTJA 2DBQA 5AQEA 1ZJ6A 4N9QA 4D42A 1XB2A 4PICA 4XRRA 4RHFA 5I7EA 4ENQA 4HAVA 1JQJC 3PDIB 1GFIA 3I2GA 4RSHA 3TLCA 1IQUA 2B2NA 1UT6A 2B37A 1E3MA 1PD0A 4X1OA 3NAZA 1QPBA 1FNSA 2NV6A 4PANA 2Y77A 3PNQA 4GM4A 3RWOA 3WWDA 1NBHA 3MIIA 3GUZA 4Y67A 4K0KB 4JLWA 2PZKA 4X6YA 3LX4A 4CE6A 3L4KA 1G8SA 2H11A 3O47A 1P7WA 3UENA 4CCWA 4CEHA 3L5KA 4D0RA 1U2DA 1FBTA 1ONBA 2YY7A 2Z6UA 4C08A 5B6JA 5DI9A 2FWMX 4L16A 4FFNA 1F4LA 3ACBA 3A3YA 2IP2A 2R5WA 1URPA 3MSCA 3DEZA 2YQ4A 3HGTA 3RSZA 1NBEA 3WLSA 1L9KA 2FQXA 4K0RA 4CEHB 3LHIA 4GGOA 3MMNA 1AQNA 4NE2A 2W0SA 2C2HA 1GL9B 2BKXA 1EWQA 2X40A 4REMA 5DRYA 4BOYA 1BHJA 3K7EA 3GXBA 2F4NA 4PTZA 5LNK1 1I1NA 2OK8A 2VVTA 3EDQA 4EHJA 3LL4A 2KSQA 4ARZB 5ICCA 1F60A 1YC5A 4N6OA 4ZVVA 1ZD2P 3QK7A 1MV5A 5AT1A 4F2GA 3BE6A 1DPFA 1B0AA 1PWYE 2A1IA 4WSOA 2F3RA 2QZJA 3TZKA 4ENSA 5JRDS 4F5WA 5I9NA 1IZYA 1QYVA 3LXMA 1UMDA 2YHBA 4RMHA 2VHVA 5CXSA 4ZCMA 4YJ3B 2JEZA 1BN7A 3QZUA 4RSGA 1NRXA 1HWYA 1U0JA 4OI2A 1FDTA 2PKQP 5KNCH 3ITDA 1Y0BA 4MULA 4FWIB 4GXQA 3K53A 1A1SA 1G8YA 1DUSA 3ZU2A 1PS0A 2V9CA 2RE8A 1XTVA 2P5YA 4IIFA 1O6BA 1H1TA 1HZZC 3DMRA 4FHCA 4PHTA 2LV8A 1SCBA 3O9VA 3DLPX 3PJFA 1G9XA 3MUNA 1JDTA 4I6GA 4U0KA 4UU1A 1C9YA 1ARZA 3G5AA 3H5RA 3DNPA 1D6JA 4OM7A 4G4GA 1U5CA 4ZAFA 4QQFA 5JBQA 4IY1A 3AF4A 2VHWA 3UAOA 1A82A 5TQ0B 2PFKA 3VR0A 1D9ZA 1H0HA 1PKXA 1OREA 2PX4A 5CLHA 1LSOA 5EIFA 3SKYA 3VH4A 1BMTA 2AB0A 4IXDA 3L8FA 4FYWA 2IDMA 4D97A 1QO9A 5BSUA 3WLKX 3DUFB 4J9UE 2P27A 2XB9A 3EYWA 1QSGA 5IF3A 1YWGO 5A9SA 2C7RA 2WDZA 4E5KA 4NDZA 1IBCA 3PNBA 3W06A 1SVSA 5JZOA 1KJWA 4QU9A 3THOA 1NOKA 3R77A 1RWXA 5K9ZA 1WJGA 5JYDA 4ALLA 2NYVA 3LRXA 5EG5A 4PGMA 4I50F 3NLLA 4DB4A 2AJTA 4LSZA 5G1PA 1R6TA 4OQYA 2I2XB 1V4BA 5K0JA 4CIXA 2BF4A 2OKCA 2Q8QA 5A9SB 2Q07A 1J1UA 1EVYA 3ICPA 3P9RA 2LBPA 3DOUA 4Z9FA 1XRMA 1QR6A 3EF1A 3IDQA 4RULA 4JJZA 1Q7BA 4GSYA 5FOSA 3AUFA 4R1OA 5C3MA 4GNKA 1GEGA 4P22A 1Z0ZA 1EVQA 3B5JA 1A5BB 4N8SA 1ZSVA 1G8HA 2BRUC 2HW8A 1FYDA 2GVDC 4HY3A 3VTKA 3NP7A 4S04A 4QAJA 5AUPB 3VZSA 2DMRA 3QUCA 5I5GA 5IXSA 4JI1B 5LZ4A 1T3HA 3ECSA 1DO8A 2Q6OA 5T5QA 4QM6A 1PT6A 5DWVA 2VOJA 1K66A 4UJ3A 3PC8C 4QATA 3U3XA 3DDWA 1GNSA 3KKNA 4NQZA 5DX0A 2HR1A 1CS0A 2CJXA 1FZQA 2ECKA 3DFIA 3LD9A 4Y2GA 1DLIA 4ZEOA 2VKQA 1PEDA 3UPTA 3ED1A 1LBEA 1RXCA 1YUBA 2YY6A 4E4YA 3ODGA 4MDHA 4LFBB 1A77A 2OCPA 2XBMA 1MR3F 1P5ZB 4ZHQA 3J7TA 1RPJA 1CS0B 5JI2E 5A5GA 4K88A 1YE3A 2C9MA 1TTHA 5IUKC 1VJGA 1N4AA 1MG5A 3PKZA 4FX5A 5ALJA 2X4LA 4O29A 4C05A 3IQEA 1HV8A 2OCBA 1J9GA 1Z8DA 2H00A 5JEEA 1SB9A 2WM9B 4ZMRA 1DQZA 2PUWA 1CUHA 1ZXXA 2V8OA 2NSYA 4ZHQB 3W3ZB 1PW5A 1H85A 1VIDA 2RGEA 5GZ6A 3QNUA 5K0CA 4DV6B 3BFPA 1Y3FE 3I6ZA 3MXTA 4B81A 1D4AA 2ZIWB 5K6AC 1XZ8A 2F7SA 3V34A 3ZQUA 3DDOA 3AXSA 1E6KA 1XCOA 1A0OA 3GWGA 3GNSA 4GYJA 5K2MA 1JDJA 1LZLA 4LV8B 1DSSG 2HGSA 4NWIA 1CJSA 5HCUA 2BFFB 5B58T 1T0JB 4YEDA 2EWVA 3LQFA 2PM8A 2XQGA 1JF8A 4P93A 5IKOA 2Q6KA 4BJHB 4F7WA 1GDDA 4PX5A 1H4QA 1CLUA 2VA9A 3RE1A 1T1SA 5FAKA 1U8CB 1WDWB 3CVJA 1O6CA 3PSAA 4LDAA 5MN5A 2IZ6A 4BNFA 3GROA 1WMDA 2JFOA 3D0QA 4JX8A 1HF3A 1Z74A 1QK3A 2PEZA 3Q98A 4PFJA 3K70C 1YCFA 2QZSA 3RFFA 1BWQA 2Y1GA 3OZFA 3ZE6A 4IOJA 4BS9A 3AKZA 1EFRD 3PC4A 3F6CA 2ASVA 2YN0A 3BGDA 4YB8A 4RJKA 1TZCA 4RGQA 3P5SA 4NCXA 3DZBA 1CJTC 2HXSA 5TQVA 5E1DA 3VBCA 4M99A 3F7NA 3P2YA 4YRIA 4JUFA 2KB0A 5FUXA 1EGQA 1Q0PA 5JSYA 3B1YA 3QPAA 4EAAA 1B8OA 4B2LA 5L3VA 3R0JA 1NJ5A 1RS0A 4BIIA 4BP9A 2VPZA 5FLXA 3EIHA 3F8TA 2Q2WA 4B7CA 4YUXA 1KTIA 3ZR4B 4AZ3A 3BG5A 5IK2A 4CLXA 1B8VA 4O0LA 5AI9A 1B0ZA 5FNVB 3TQHA 3F47A 5K45A 1PVDA 2QMHA 2WMDA 1E8MA 2VS1A 4LXQA 2QORA 5IJZA 3I3OA 2W6CX 3LYAA 1PDVA 2FWRA 4TZTA 5ALHA 4A1FA 4DLBA 1GA4A 4F4HA 4KE9A 1RPAA 5DCUA 1FIUA 1JEAA 4J0HA 4MX8A 5J5CA 4CI0B 3V3KA 4XFJA 1JAHA 1ZEMA 2ATIA 1NAHA 1YDGA 4OLBA 4TSRA 1LK5A 3DGFC 4G2TA 2H9AA 3QUAA 2P9JA 3P2JA 5E6UB 2HADA 3BZBA 1QKJA 1R4AA 3EZ7A 1RLMA 3PWTA 4LOKA 1ZVMA 1O58A 2VK8A 2TYSB 5A5EA 4H59A 5KCMA 2GRJA 3FKSD 1O97D 4WXRA 3BD7A 4BEJA 3ORYA 4B7XA 3UB3A 4FMCF 1V37A 4F3KA 2OV3A 3R24A 2R7AA 1JHRA 3MA0A 4EI7A 2O8CA 3DKKA 2HA3A 1ONOA 1U2TA 2VDWA 4YPOA 5L3SA 4C7OB 1A72A 2E87A 3PQ4A 3ZV5A 4D9EA 2VAPA 3O4JA 3KCNA 1CZNA 1BVRA 2IJGX 4F3TA 5HGJA 1DG3A 2VL7A 4LNAA 4P4GA 4MKZA 2OORC 1ZO8A 4D26A 1E77A 1NASA 1DJNA 2O8CB 2J7PD 2RAVA 2R7LA 2LRHA 4QDJA 4OP2A 4F96A 1SELA 2IH4A 2A14A 2ZSKA 3CV3A 4MSUA 1NLYA 1R0YA 1FNMA 2C4MA 4HPWA 1VPLA 2V0NA 2ZR7A 5I7AA 3CF2A 4BKMA 3EVZA 1WCXA 4AY2A 4BQOA 1RNLA 3R3XA 1OBHA 4TLAA 4IVNA 2SBTA 4ZZ2A 3R9KA 4KLNA 3M4XA 5AKZA 4U7GA 3K05A 5ESWA 3TE6A 2JFQA 4C4XA 2B8EA 2ZIZA 5BSHA 1ZISA 4QODA 1THMA 3KC2A 4AX4A 2XYVA 4RU1A 5A7GA 2DULA 4QBGB 4UE3S 3TINA 3RTDA 3CMMA 2VNKA 4KO8A 1T5LA 2FR8A 2WD8A 3BKWA 3IQXA 1DAHA 1Q1QA 1G66A 2P65A 4NTZA 4X8LA 2IXAA 5KOHA 4PNEA 2UVDA 5FQOA 3VR2D 2IBMA 1ECGA 3SBDA 4QYIB 3ME5A 3DOCA 3A1TA 4IV0A 5COAA 2O1EA 5KJ6A 2A58A 2XUPA 3FZGA 3PJEA 4KYUA 2Y0CA 4NKRA 3NZEA 2O20A 3ZU6A 5AW3A 3IUNA 4WA7A 3D3KA 2C94A 2ZSBA 1GCOA 3TBFA 3OC6A 4FYXA 3EX7C 3W5UA 2QUBA 2WFLA 4M46A 4YCJA 4BO9A 4K6MA 3T3PB 5KOHB 3EZ6A 1L4GA 2CZQA 4IDHA 4KO3S 3COPA 3R7WA 2FEMA 3R6LA 4EY8A 3QOFA 4HB4A 1NXWA 5EZYF 2RHWA 3TIGA 2ZBQA 3D43A 1ABFA 2YJNA 3AP1A 4C89A 4B3GA 3X1JA 1G63A 4JGGA 3GUYA 4RK4A 1HQYE 1RHJA 3UK2A 4ZVRA 1JXQA 4GRAA 2W6MA 2C88A 3E9YA 5AM3A 1P2TA 4P4NA 4OQZA 1B93A 2G40A 4KB5A 3R7WB 1IJEA 3K9BA 2O2DA 2KLHA 1I7DA 5DBEX 1DAGA 4R8SA 4UVHA 5WRFA 1EGVB 1G3IA 3R20A 3W8FA 1LFDB 4URFA 3WYEA 3ZDXB 1NVFA 2YXDA 1KORA 2J59A 2UVQA 3DR3A 4WY5A 2A92A 3J81A 3KP1A 3W6NA 4TKUA 1TRHA 1EVEA 3MD9A 3TN7A 3SY8A 1NQTA 2QP4A 3ENNA 3W7BA 3E2PA 4UFOA 2R6ZA 4MWEA 1F06A 1R7RA 1YZUA 3E2IA 2PFGA 3QLVA 2G25A 3DT9A 4RD6A 4UEQA 4WNAA 1MTZA 5AI4A 4YUZA 1P5FA 1PI3A 3ETGA 4FHEA 4RTPA 1TF7A 1XL1A 4GOMD 4F1JA 1Q0RA 1RACA 3M2PA 4OQQA 4Y2XA 3RU2A 5LP6A 4TKUB 3CVXA 3P9PA 1J5PA 4EY3A 2PCJA 1Q0SA 1DS6A 3TKYA 2XQJA 4ZYZA 3UMMA 1T2FA 4QFCA 1KAMA 2ZI3A 4FXOA 5BR7A 1ZM7A 1YJQA 3TLXA 3JQ9C 2A0FA 1Z33A 1QZTA 2AH5A 4A03A 4AKGA 2Z3ZA 2D5CA 5DVZA 1T6YA 2ADOA 2ZS7A 3CKLA 5E0OA 1P7CA 4KU4A 3EEIA 5FUMA 1I7QB 2PV0A 1OH5A 2PY6A 4OI4A 3OAAA 5FPKA 4JLSA 3DLTA 3TEFA 5CK5A 2Q3JA 5FOTA 4BU0A 3Q7SA 5CGZA 1CC1S 3WL7A 2ODQA 3GNTA 4J8PA 4N5IX 1O1YA 3PG5A 2LKCA 1YZNA 4MRVA 4D8XA 5FUQA 2HF2A 2ICAA 5DEOA 2PS1A 1JQAA 2FN8A 3IS3A 4X60A 1XQXA 1SCAA 1F6WA 2FGKA 3L7YA 3A25A 1YTLA 3RS0A 4E1VA 3A7EA 5AJUA 1QX4A 4HGPA 4LBVA 3UN1A 4E21A 5BV7A 4QVIA 4MW9A 2ZRQA 5F1KA 1E58A 4LOAA 1UBEA 1BYUA 3ZZ1A 2ZT6A 1JIKA 3U80A 1XYVA 4IBOA 3ROFA 3OQBA 2W4QA 1X9GA 4TKLA 5CPBA 2GBIA 1A5ZA 4QDTA 1P18A 4JYMA 2ZTMA 3PDCA 3WDLA 3VUEA 4G0ZA 2FLKA 2PZLA 4YMVA 3LLVA 3TFWA 4N0MA 3PD7A 1BFDA 2R5FA 3HM9A 4HPXB 5KTKA 5HPYB 1U02A 2IY8A 3SJBA 3QMWA 1WNTA 5M5BA 1T10A 1OKKD 3ZGOA 2O8BA 3L6UA 1Q16A 3PLNA 1Z5GA 5FO1A 5IHPA 4WZ6A 1QLJA 2C2YA 2CD7A 3OSUA 4YRZA 2CLMB 3O0DA 4GP6A 3ROZA 2FX5A 4PRZA 1GRNA 4AZSA 1HT0A 3Q1LA 3OJFA 2KX7A 1TO1E 4KFTA 3NTQA 4YAGA 3DTYA 2C2MA 3I5UA 1ZOOA 5EP2A 3R1IA 3DE5X 1EXMA 2G3YA 2Z04A 3SHTA 3SS7X 1FNBA 4I1IA 3TSWA 2VP3A 2CE2X 1JVBA 1L1RA 2XUJA 1ZGGA 3GLQA 4M1TA 2Q3LA 4BVKA 1MB3A 2B0CA 3EN0A 4KX3A 5TXGA 2AMFA 3RIHA 1GLGA 3MN1A 1GL3A 1N8NA 3WLLA 2R7KA 4J6EA 4AJIA 4DWWA 2EKPA 2EFEB 2NADA 1ND5A 2GCIA 2JDIA 3EF3A 3USES 2WKPA 1LW7A 1IN7A 5LQAA 3OZXA 3HXOA 1R8QA 2VZ0A 4I5DA 4FPXA 5KYGA 3HY6A 1E4YA 5AVSA 2YVUA 5K3AA 1ZEJA 3VFDA 1QUFA 3GP3A 4EF5A 1ESEA 4CLRB 3ISTA 4M36A 4BVGA 3NMUF 3E9ZA 3W5JA 4BKQA 3FGNA 1Z5VA 2O52A 3O8OB 4XX1A 3CVVA 3KSUA 3QNWA 2GDJA 4YCBA 5BUQA 2AOVA 3HCOA 4MWDA 4AJ4A 5I4KA 2BGIA 1FFSA 1NU6A 4LSWA 1VBKA 4YJDA 3N75A 1DTWB 2R751 4H7JA 3CRRA 1E3IA 2WT4A 1TU3A 2OHVA 1ORIA 1KOLA 3R7FA 1OILA 3D6NB 4C0LA 2NVBA 3NTOA 4PLFA 2I1WA 4ICIA 1H8HD 1XFDA 4ENUA 1RKBA 1KTVA 5H82A 2H1RA 1XA4A 2QEQA 3F3KA 3WLAA 2C00A 1C14A 3G02A 1T9GR 2WTUA 3MZ0A 4LGCA 3H9UA 1OBVA 3IP7A 3NNDA 5JPDA 2QK4A 1IOVA 2BY4A 5E3IA 1UKYA 2ZB4A 5DX8A 4Z0NA 1TAUA 1WCWA 1LRKA 3ZNQA 1P9NA 4LZJA 1TMGE 4HN4B 1FQOA 4ZODA 1HMPA 1T5SA 3NT5A 1VP3A 1CG6A 3C3AA 5TJHA 3OCXA 3PP8A 1LUAA 2FAXA 1Z08A 4Q15A 1HDEA 3HR7A 2ID9A 1DBSA 1T2UA 1JDNA 1K8RA 4YMWA 1KMQA 4B73A 2ID7A 4BZXA 2NQTA 2OVFA 2VNIA 3WZ2A 1KXJA 3ZWCA 3KTFA 4UU7A 1V4NA 3D6TB 3FPLA 3ZU4A 4DRZA 4ZWNA 1SUBA 3CUYA 5ED4A 2AE1A 3J80A 1XMQB 2OWEA 1S2OA 5FTMA 2Y0EA 2AR9A 1WETA 4S0ZA 1NSYA 3DDZX 1FSZA 2QN3A 2W9XA 4WLVA 1JT9A 2BN4A 3CONA 4G9EA 4BNDA 4P3PA 5HXAA 3CBQA 4BNUA 1RJ9A 1AO3A 4TWBA 5JQGF 3FYDA 4RJTA 3KT0A 4YJHA 1SQFA 2IU3A 1A04A 3CEMA 3FCCA 4HRAA 3UTCA 1FQJA 4MUIA 1SC4A 3L7KA 4Y30A 3LHDA 3VUFA 2Y4NA 2XUDA 1R00A 1QIDA 2D74A 2QLMA 3N0RA 1BX0A 5ALKA 4CV2A 3RRXA 4BNDB 1SC9A 4UNIA 2HO4A 4A8JA 1C8BA 4DCNA 1IJBA 4M87A 1ISHA 4PLVA 1ZK1A 2WWFA 2GXAA 4AJNA 3RNOA 3W3AH 4JBWA 2GCGA 3OOWA 4YJHB 1Y7PA 4HDRA 2ERCA 1SQGA 4HZUA 8ATCA 3WC4A 4GNRA 2IU6A 1T26A 2QDXA 1E9SA 4NBUA 1NRIA 2WF9A 3E35A 4ATNA 3ZV3A 2QVZX 3P5BA 3GLHE 3C3BA 2HWKA 5JIBA 2XMQA 3O83A 2HRDA 1CDOA 1RFLA 3Q3VA 1WSAA 4Z54A 4HDRB 1DDOA 1UJ2A 4HZUB 3G1TA 3K0AA 3NTUA 1D0IA 3OSZA 1Z4PX 2IVFA 2C4NA 4YCNA 1OX6A 2R79A 2HGZA 2PSDA 5LQMA 2OC4A 1DBWA 4JZKA 2WWIA 4ZTZB 2ZS8A 3AR8A 3EWNA 3L8ZA 4NP6A 1U9CA 3AG6A 4WOBA 4Y2JA 1ZNYA 3BH7A 3TQFA 3EGDA 2DOKA 1SUEA 1V7ZA 2RI1A 1PEYA 4GQAA 2FUKA 4MA0A 4CETA 10MHA 4JDUA 2QUJA 3F2IA 5KHAA 3T1VA 3AR9A 3ZBUA 3D1JA 1GZVA 3J81k 4IQFA 2VHZA 3IIIA 3TLZA 4JXXA 5CLQA 1ZCFA 1DFGA 2XLCA 2QLTA 4KAAA 4U8HA 5C32A 2M32A 3TRDA 4OQFA 1C3XA 2A9QA 3P0RA 3EGDB 1AQ6A 4HFMA 4P2GA 3EIQA 2D3TA 3T7DA 2XVAA 4D81A 4LPSA 5JAHA 1EZ1A 1UMBA 4L8YA 3R7DA 3DLIA 5JH7B 1CB7A 2EJTA 5CA0F 3GPCA 3S4YA 4BP1A 3OPYA 3LLUA 2CYBA 3BJIC 2CXXA 1JJ7A 1NP7A 2ANBA 1BXGB 1RSZA 1C7ZA 2HZBA 3JYLA 3KR9A 2V0CA 4MRAA 4UPVA 3AP3A 4XWAA 4BQNA 2GESA 2C3MA 1UM9B 2PGLA 3CLKA 3K5PA 4YACA 4PC2A 3BOSA 3AMVA 4HWKA 2ODNA 1B8NA 1UMBB 3OQJA 4CDNA 3U4MA 2XJ4A 1JE1A 3OWXA 4FBMA 4BWYA 5KSOA 4OI1A 1ZBQA 1OSNA 3W5BA 2BM9A 2JLAA 1QIEA 3IEUA 1JAZA 2R65A 3UGKA 3OPYB 5KNDA 5EKSA 5KPDA 1NG9A 3NEPX 3WRWA 4MUYA 2CFOA 4YO8A 3TKAA 3NETA 2PE5A 4OHOA 2Q4DA 2Q5EA 2ZYIA 3OE7D 4FILA 4I2NA 5DNWA 4P0QB 3FYTA 3SFVA 1OXUA 4AJEA 2J3EA 4IOKA 5CDTA 5FA6A 4LRWA 3RS8A 4UAGA 1ADJA 1YCDA 2J7KA 2IIPA 4ID9A 1EYZA 1Q6YA 4QYXA 4G4IA 1ODSA 4QTYA 2BCGY 3TR0A 4JP2A 3MOSA 4CQLA 4KL8S 2GCOA 1XFAA 1F7VA 2FY8A 1QKKA 5CNKA 4WI1A 1XROA 4DGQA 3KDSE 2Y4OA 3EXEB 2GPAA 2WUWE 1PJ2A 5E4YA 1F5NA 4CN9A 2I3BA 4R4JA 5TQ2B 3DZDA 4G07A 4NDAA 3AEQA 4Q3EA 3SIXA 1OJLA 2FEWB 3OIGA 4EY4A 4CKZA 4FFPA 5UKDA 3OZVA 4UHDA 3RVBA 4BNMA 2J9FB 5HRUA 2VSNA 4YJ3F 1JG6A 2ARKA 5HBGA 2GCOB 3ZU3A 3HXMA 4JT2A 2OPBA 4CMBA 1KC1A 4YREA 3QXHA 1S7CA 4R98A 4DVJA 4PYIA 1NLZA 4YONB 2P0AA 3ZUGA 2Y0DA 3ZYCA 3LYUA 4EEXA 1UBHS 2G0TA 3AEQB 3F98A 2HJGA 1RWKA 5KWJA 5U4QA 4PZ0A 1P61B 3PT5A 4LXGA 4DIMA 4L7VA 2L0XA 4AWXA 3NORA 3OJCA 4I5IA 1QHNA 3M1YA 1B74A 4MV5A 3D3JA 2YICA 4PCUA 3C5HA 4IYRA 1P2UA 4U7FA 1DFHA 4V2UA 3K9FC 3MQ4A 3I30X 4GZ6A 2IW3A 1FNCA 4Y2RA 3PGMA 3G5MA 4W5QA 4OYRA 2R1ZA 3ESXA 5IAOA 1V48A 4MDFA 5A5DA 2BBWA 1TT5A 2X0RA 4LF6B 1IZ8A 1JEDA 2WJ3A 3G5LA 1NQXA 4WBNF 3U0VA 1DCMA 4CNBA 3W7VA 4J1TA 4I5FA 4JJ4A 4HC4A 5DIZA 2DWCA 3WK7A 4LYDA 1WDKA 3KM0A 1LDYA 4ZOLA 4A2WA 5A9RA 5IXJA 3OP1A 3UVEA 1JMKC 4R8LA 3NTVA 4QUDA 2JHGA 4RW0A 1WV0A 2C03A 3VR5D 1J8MF 1TT5B 3VPSA 5AW6A 4HBZA 3TIIA 1Y1RA 3WP1B 3N2IA 4UXHA 4ND1A 3OECA 4IJWA 1ZGJA 1F1BA 4XTRA 4FONA 2C5HA 3JD4A 1VPTA 3DFUA 4ZOLB 3DM5A 3UOAB 3LQKA 5AW0A 5JVDA 5AVYA 2JIMA 4LTMA 5H9VA 1L5OA 1I6KA 1SVWA 4IGAA 4Z4IA 9GPBA 2I03A 1M72A 4JLUA 5EHZA 1N7GA 3CX7A 4PZPA 2IPLA 4ZC1A 1B41A 1KSJA 1XF1A 3TTYA 3DYBA 3WL4A 3PCRB 1BZYA 1M75A 2NTJA 2FZEA 1PGJA 4XYMA 5H3CA 2ID8A 4PE5B 3FYHA 4EG7A 2YMQA 3G79A 5K09A 1SKMA 3QLJA 3I64A 3MRVA 5D01A 4E3WA 4DV4B 4K05A 1XRQA 2ZQ5A 3EW9A 5F2OA 3BYZA 3TLBA 5LWHA 4DDMA 1SIWA 3V42A 1QOZA 4FHGA 4P33A 5BW6B 4BMDA 2AFHA 3OT1A 2PL3A 1MAHA 2A9OA 2R60A 4JIMA 4TTRA 4I9HA 5JZBA 1U0TA 4UOEA 4R81A 5FPYA 4GYKA 1NN3A 1Q15A 2MMCA 1N5IA 2QAGA 3C0KA 1D8TA 1XNJA 1S01A 1O0SA 3REQA 2GX6A 2NVUA 1FVFA 4AG5A 3WGIA 2IRWA 2VEOA 1BRTA 2WJVA 4UAJA 1E6MA 5F4ZA 2FEKA 4H15A 4KO1S 3OT1B 1P4JA 1LQUA 4QJIA 4V0SA 5HBRA 2I55A 3N05A 3W78A 3GLSA 1QTNA 3WNVA 4IH1A 3OHSX 1I33A 1F3LA 2WJZB 1PWZA 1YXMA 5F2KA 3QOXA 4BBAA 2JKZA 3SJZA 5AW7A 1G21A 1VJ0A 3RUEA 2H1WA 3KYCA 5FUYA 3H86A 1LW6E 2B99A 2C9DA 1GUZA 2OLKA 3KO8A 1I2BA 5EJEA 4F5ZA 3QVKA 4ZQIA 4JDPA 1K3TA 1WXFA 1TGYA 2BDUA 2FW7A 2MINA 3ZCXA 2C5BA 3LFTA 3KNZA 4MS4B 1TKCA 3FMPB 4RVFA 3SJUA 4BBZA 5JCZA 1G21B 4LGYA 1M54A 2P3OA 3SQOA 4PWZA 4NV3A 1GADO 4U9UA 4UEJA 4TVKA 4H6WA 3SC6A 3NYIA 1KKUA 1PZXA 1IH8A 1X1RA 2RI6A 3HVIA 2ON6A 1PUJA 1FK8A 2V5VA 2VJCA 2Z0MA 3I8OA 2FW8A 5T64A 3DO6A 3RU7A 2VYQA 4YRDA 4HD8A 2EQ5A 2OM6A 3JW8A 3ROEA 4CM3A 3MGCA 3O5AA 4URVR 2OBLA 4F3CA 4O3MA 5FLYA 3FNEA 4MS1A 1QHXA 5BN3A 3HYTA 1P4GA 4P83A 5BVHA 4Y0NA 2G80A 5KSWB 4ZAYA 3UFXA 4LXHA 4OQLA 1XDUA 3E7DA 4WKPA 1BJRE 4P53A 2C4KA 2YV5A 3HYRA 4FGZA 3LBNA 5E7IA 5KOJB 2ZQYA 1XPOA 3ELDA 4IW3B 1RXYA 3DAFA 4NMXB 5AM4A 1QQBA 3AC0A 3DMTC 4MS1B 4QELA 2XYHA 2GPTA 4E30A 3AQ4A 3G7UA 4C6RA 5BVHB 3HVJA 5EJGA 3UFXB 2GN9A 2J6IA 3BXPA 1EVLA 4OXQA 3NIDB 1CEEA 1HGXA 3CR8A 4FK8A 4WZBE 3U3MA 3ZBTA 3BULA 1J07A 4RHCA 1SVNA 4WCFA 3TMAA 3W4JA 1WP9A 2FZ5A 4D56A 4BMZA 4CODB 1EFTA 4ZO7A 1F8YA 1SU8A 2VP5A 3E82A 1L4EA 3FAKA 3QTBA 4QICA 4JYPA 2WMNB 4WOJA 5LUAA 1WXGA 4HZIA 3HBAA 2H4YA 2OVBA 3AI1A 1ZJ4A 1SVUA 3TGLA 1TW2A 3FOBA 4MXDA 1R8SA 2C0CA 5E8RA 4ACBA 4WCFB 1KP2A 3EVEA 4JEIA 1EFPA 1NW6A 2C59A 2H2WA 4QGGA 3VSCA 5FNVF 3KFLA 3LTNC 1PDOA 4CEIB 2FOXA 3C5EA 1KMIY 4O0MA 4O6VA 3U48A 1JIXA 3DT6A 4UMDA 4ITVA 1MGOA 2ZANA 4WQMA 5J4KA 4FFBA 1ZUNB 4EJ0A 4FDTA 3R6GA 1USGA 5G1OA 3NBZC 2QTMA 5JFTA 4IKEA 2G5GX 1OXKB 1JG1A 4TRMA 2X0FA 2HWYA 5DW0A 1PJAA 2PXHA 2WFMA 1HE5A 5I4IA 3FTNA 2QUHA 5IVDA 1JTFA 2CE7A 1A9RA 3GLKA 1KEUA 4KX5A 1XKXA 3HY4A 2DAPA 2CUZA 3ABQB 3NVAA 1TECE 3NUGA 3W6OA 3KPUA 4C2BA 3IAXA 3EUFA 1B3RA 1K7CA 4X3CA 2AEFA 2ZDGA 3GA0A 5K3OA 2VDOB 2VZLA 2XE4A 5JDIC 3EXFA 2AF4C 3GCDA 3UXYA 4M8KA 4N3AA 4HX2A 5DRTA 3RNLA 3DL0A 2Q3HA 4D3YA 4P0PB 1UBUS 1FTWA 1NQUA 1SCUA 5K0LA 3CBGA 1UZNA 4IFTA 3MAAC 5KYNA 1WB9A 2RONA 4ZDKA 5I6DA 5JDCA 1VRCA 2GTIA 1UPCA 4RVUA 5IG2A 2Q9CA 4EG4A 4MVJG 4B34A 1RYYA 1PG5A 4GX5A 1R4NA 5JQWA 2I65A 4PQRA 2PS3A 1F8UA 2QXYA 4WLOA 4A2CA 1KVUA 1YB4A 2IHJA 2V6JA 3B1FA 3HHEA 4HHEA 1AHIA 1VHWA 5CT9A 4CDMA 4ER5A 3VX3A 1MF7A 4BV2A 1T8RA 4FMBB 5L3ZA 3V00A 3P9QA 4F6LA 2YBDA 5A5FA 1IDN1 3DD1A 1R4NB 2XZDA 3C41J 4IZIA 4QXOA 1PWHA 1Q74A 2JPDA 3SLGA 5K2OA 4FYYA 4Q4HA 3HJNA 2DY0A 5BVGA 1HTTA 1ZIXA 2PGXA 3NWOA 4IV5A 4J43A 4P4UA 4LF8B 3LJKA 3BMQA 1R88A 2L2QA 2R68A 3SIRA 1BVYF 2C2ZA 2ZRPA 4L0DA 2O5VA 4L8VA 3IMCA 4KYTA 3WSWA 4CF4A 3F3MA 4ZI7B 4HTFB 2HV8A 4BJ1A 4MVJP 3KXLA 4LZLA 3TR5A 2F3TA 3BWMA 4GOJA 1Z3IX 3DA8A 3IFSA 1XAIA 2ZJ7A 4KI7A 3UC9A 4I5EA 3OUTA 3GDOA 1AUOA 1NI4B 1ZK3A 2R4UA 2XMSA 1M1YB 4MIYA 5H70A 5BVGB 2CXOA 4A6DA 3IJPA 1VIMA 1JVNA 1VGQA 2Z56A 3BMQB 3M9WA 4GICA 4EMBA 3C3WA 1XEXA 3CYFA 4FD2A 4G5YA 1OIWA 2D59A 5JAMA 1J0DA 2PT6A 3OF5A 4RC9A 1YQEA 3H9EO 3NC4A 1WF3A 5JYCA 1HK7A 1LBIA 2BMWA 3GBVA 1C3EA 3G82C 2B1IA 3IVAA 2WPDD 3AT1A 3KQPA 3PNKA 4R1MA 3W79A 1Z2NX 1XNRB 2H2IA 1X19A 2BFMA 2XUAA 3DAPA 1I7PA 1CQWA 4DLTA 1XEXB 2RMKA 1R0CA 2WJ6A 3FJYA 3K09A 2IA5A 4R3NA 3VAAA 1JWBB 4QQRA 3D6MA 2ERYA 5ILOA 1K2WA 3ESQA 4N49A 4H9GA 4V0KA 3ZJ5A 4EW3A 3S7ZA 1E7RA 1OA0A 3G6WA 4JBIA 4V0ME 4XIFA 3T3NA 2CXRA 3O8LA 4MCHA 3QTTA 4YX9A 2F2TA 3TW6A 5A2QA 5DWDA 4FGJA 5CB6A 3W2FA 3S6JA 3HJAA 1Y1SA 2ZAMA 4MKGA 4AUEA 4UEKA 4JVSB 4S2UA 5AHXA 1YULA 3WIBA 1UDCA 5IJWA 4LVNA 1JV2B 1P45A 1JDBC 1OWOA 2IX3A 1WPRA 2W37A 2FFQA 4PZCA 4PGGA 3WGQA 1XMXA 2WIBA 4XZ3A 3NAMA 4GYYA 4ZDIA 2PLFA 3BE5A 1GQFA 4IDCA 2XNKA 4KQFA 3TOCA 1U8TA 4EYSA 5BWLA 3QX7A 1KBQA 3HKCA 1ORTA 5CFPA 4NYMQ 5CIQA 3MBIA 1VBFA 2DQ4A 2BFEA 2BW0A 3D8SA 3GV0A 2OCKA 3P4XA 1G0NA 3OEEA 2FNAA 3L8MA 2J3IA 2VQSA 1TJPB 1HLGA 1P74A 5IVPA 2BVNA 1OZFA 3G2MA 3GUCA 1ATZA 2CBZA 2G9QA 3HKCB 2FMTA 4DIUA 2Z2JA 3GLUA 4MUEA 5B3LA 1DIHA 2CC2A 3L8GA 3ROMA 3HWX1 1XWFA 1L1QA 2BFEB 3TLGA 3ROGA 4BFSA 1VL5A 4A1OA 4BO1A 4TTQA 1E92A 1U98A 3SQXA 4MVCA 1ML3A 2JCXA 3IV9A 3HB5X 1Y1LA 2YL2A 5IX8A 1H2YA 1FEZA 4BCDA 1EESA 4Q3NA 1YBFA 3QE3A 5LQSA 4AMVA 1W5AA 3HU2A 3SYLA 2XTJA 3N2NA 5F52A 5CB0A 2GN1A 4HAXA 5GGYA 1TO2E 3RIXA 3TLGB 1WTCA 3H6KA 4EPWA 3OZRA 4GM1A 1K4YA 1I5RA 1ZNQO 4URZR 1NN1A 3IXQA 2FETA 3Q72A 3UJ7A 4K9MA 4RQAA 1QM5A 1UEJA 3BFVA 3RLIA 4D4LA 2G36A 2JVIA 3JQRA 2BEVA 2WQZA 4CG2A 4MJ3A 3BWYA 3ZIAD 3ZH9B 5EPEA 1RQNA 3DKIA 2IYUA 4ENRA 4BIMA 2AZXA 1J20A 1TD1A 2IZ0A 1QP0A 3HR8A 3T0FA 3QE4A 4IMIB 2BMJA 4RIHA 2WTEA 2VQ3A 3S1SA 1PS8A 2EBHX 1NJ2A 3C1AA 5IRCD 1BHSA 3CUUA 2BEVB 4OHUA 2A5GA 1U2QA 2WAXA 1RYEA 1RI1A 2PBZA 2ZIXA 3JWPA 3KJZA 2X8BA 4ZN6A 3WICA 3DW1X 4JASB 1E63A 1U3TA 3PV0A 1NBME 2A59A 3BIOA 2LUOA 3C7TA 4YRNA 2G1UA 4QNMA 2AEMA 1NKSA 1JHQA 1RYDA 2YZMA 4QPDA 4F9TA 2WG1A 5L40A 2O5CA 4GWKA 5BRJA 2AWOA 2FJUA 4F4DA 2JCGA 4TTTS 1UDRA 2QVGA 1YFZA 2ZIXB 1JX6A 1T9AA 2C78A 3JQBC 4GMXA 1E6EA 3K8OE 3RGWS 3IT3A 3GEMA 1O87A 1IK4A 2TECE 3CTMA 4ER0A 1T1JA 4YV7A 1UKEA 5KHLB 5JCXA 4D4IA 2GBGA 4HDMB 4LJKA 4YWJA 3E23A 2VAWA 5DYWA 3TBHA 3K0SA 3D6HA 3JVEA 5GINE 2TMDA 3W7AA 2G4CA 5JXJA 1T4GA 3GEPA 3W3AA 3I62A 3BD8A 3VPHA 1UH5A 1W96A 1MO3A 3NRJA 4NFSA 4LJYA 1R50A 3OPNA 1V5EA 2PT9A 5CB4F 5KQSA 4ARBA 1WRBA 2B20A 4RCZA 5EA2A 2WWYA 3OFVA 1A96A 4LN1A 1EK1A 1JAXA 5CA1A 1ZL2A 3BBPA 5BSWA 4LJRA 2QN1A 2YV2A 3T34A 1J70A 1NX6A 3W6UA 1BE8A 1Z26A 3WA7A 2C0QA 2IF0A 4KE7A 4RFSB 2G9NA 1OB2A 4DW8A 3AWDA 1IG0A 4JJ7A 5DYGA 4Y2PA 1M2EA 1T43A 5G0TA 2WFAA 2OFPA 3FDXA 4RKQA 1IPFA 3CA8A 4QREA 2INGX 3IT1A 2WWVD 2PKXA 1EVZA 1RP1A 3OEHD 3M3HA 1TJ3A 1HTBA 1EFLA 5CURA 4D7AA 5CA1B 4FSDA 4PYLA 1Z82A 3A9SA 4HAIA 3ZDEA 1I4DD 3IQDB 2H85A 4JJ8A 4AG6A 3UW1A 1Z7BA 2YRWA 1FRFS 4UUNA 2PWAA 2AVNA 4UCQA 5AJXA 5ALMA 4BP8A 4HSEA 4R40A 1Z5ZA 4P3XA 1QFXA 5CM2Z 1ORDA 4Y9SA 5G4KA 2RAFA 1AMUA 1TI7A 3JZAA 2PQMA 1E2LA 2QR3A 3C3YA 1T8YA 3EGCA 4RVNA 1ZMTA 2YWDA 3AGQA 4ERXA 1VL8A 2XV1A 1QIHA 5HYVA 1MX3A 3T7EA 5FUWA 5B57C 1G7CA 3WMRA 1KFJB 5KC9A 4P4TA 4BXOB 2DG2A 4KXXA 4DKJA 3C6YA 1BAPA 3KUKA 5G0WA 4JBHA 2ORYA 3BT7A 1AGRA 4F6CA 1PG0A 1Z2EA 4DMGA 3L8DA 1UPFA 3WYGA 4HWPA 1ZC3A 2Q27A 2Q7OE 4DN6A 4PU0A 2GILA 3D0KA 2XB2A 3FMGA 2ZRJA 1U6IA 3HFRA 1UDXA 1KAQA 2UZ0A 1CLEA 1OFTA 2OP0A 1Y33E 4FJ2A 1GGEA 3IPCA 3VX4A 2P1DA 3INRA 3WDKA 3ZS8A 5C8XA 3EVTA 1T0PA 3AM5A 4K9PA 1FFCA 4AJ1A 3D3EA 4BJ6A 2G28A 3UC5A 4G1UC 2GN8A 4D8UA 4DJ5X 5B5SA 3LK7A 2DFTA 2XWJI 4OYHA 1XLTC 1Q7RA 2V58A 2CFCA 3PUHA 4PC1A 1B14A 5HDQA 1NX9A 1OT3A 3I5XA 3UK1A 1Z18A 3A1EA 4NFLA 1OMOA 1PKEA 1G3UA 4YH1A 2TMKA 3NV9A 2QIPA 1ODCA 1XZPA 4IQ0A 2G76A 1J23A 2NU6A 2XYGA 3NG1A 4KN8A 4MUKA 2Z95A 5EJMA 3O9MA 4ZCTA 4V0NA 5EE1A 5IMBA 3KSRA 16PKA 3VNUA 4YT2A 1VLHA 1XJQA 1XWIA 2Q2QA 1UK7A 4Y6QA 1TM3E 1WVIA 2IZ1A 1T6BY 3DOOA 3KRTA 3Q10A 5H83A 4YLYA 1QRDA 1Z4LA 3NIWA 5F1PA 2NU6B 3T9FA 2AN3A 1VGRA 2J85A 2VAMA 3KB6A 5HWSA 1TEXA 3M0EA 3HCEA 3EMVA 2IYPA 5CEJA 4LHXA 2ET6A 3VDMA 3DG9A 2AI1A 4K2HA 3PHLA 4UBMA 3LUJA 4X64B 3WQQA 1J06A 1U1GA 3N5KA 3UATA 3WK6A 5E1BA 3BTOA 3AINA 3RH0A 2JH9A 3SZGA 3ZU5A 2VPTA 3WFJA 3VYSB 2OHGA 2F90A 2I7VA 3CZAA 5CH8A 4RZXA 1GG9A 2WU3A 4M55A 4EK9A 1JU4A 1MAAA 3T38A 3K9GA 4PSVA 2XKBA 1EHIA 3HDGA 3REOA 4Q1EA 5I47A 4II7A 1FFYA 4BB5A 4C6HA 1XRLA 2VAXA 1U2GA 2Z9CA 5P21A 4M0CA 2XUZA 4CVNA 2WMOB 3GRPA 1ZMRA 2RHGB 4WWHA 1H5NA 2H57A 1ZNWA 4IIJF 1HT2E 3NT4A 3SYNA 1O54A 2CNNA 2YIVX 2OBFA 2XXJA 2D4HA 1SOUA 1VMKA 1Y63A 1Z0UA 2MYNA 3MGAA 4MUAA 3QMVA 1RKUA 3U3KA 5L53A 1FP4A 1AHPA 1GGKA 4BP3A 1H6CA 4J0DA 4Q7LA 4X6XA 2XH8A 4W7SA 1U2ZA 1V7CA 2DX7A 2YXEA 3G3EA 3EVFA 4GPAA 1EFUA 3SZ3A 1SBNE 2WJIA 3K2QA 3GAAA 3O4HA 3MILA 4L3WA 4Y2TA 5JXIA 3K0CA 1G5HA 3H0EA 5HUHA 1EK0A 1PT5A 2WF7A 5JS7A 3HJRA 3CRW1 4C6TA 1JG2A 3LUCA 4UULA 4EZIA 1FP4B 3CVOA 2WOOA 1GUYA 1CUXA 1FPMA 3HCAA 1QMGA 4KJZA 3ETNA 2EG9A 2WEKA 3EDMA 4WN3A 2FV8A 1CR1A 3DE6X 2FZGA 3EPPA 3K8QA 3NI2A 5JASA 3DMGA 3TZCA 2I22A 2NSJA 5CFZA 1KJYA 3QLUC 4C6TB 2V0GA 2CV2A 2OGSA 5IM4F 1LC3A 2WAYA 4OHFA 5FXMA 5SYNA 4UCWA 3M6FA 3V48A 2DYKA 4YGYA 3K9CA 1UP6A 5CDSA 1XU4A 5ANRB 1W76A 4BRWA 1XKLA 4KOAA 2CKDA 1UJBA 3GJ4A 2PUHA 4XSVA 1E5XA 3UJBA 1GPH1 3AFMA 3B12A 3B1WA 4IVQA 2OGZA 4LTNA 4Q4LA 3R7LA 3ZDDA 1QYCA 2F8LA 2VTBA 3LA6A 3DAOA 1AY0A 3TSAA 1UFRA 1J2RA 2MTBA 8GPBA 3TD2A 4M1QA 4BO3A 2LP4Y 1Q12A 3V46A 1N2EA 1CFZA 4IQGA 2XCTB 3GIWA 4FQ8A 2XA1A 2JGFA 5JOQA 1OTHA 2ZRFA 4H6XA 3SC4A 3GMSA 2PU5A 2IZ7A 2PX6A 2X6RA 2ZRGA 3PT9A 5HM8A 1JHVA 1T34A 3IKMB 1DQPA 4KRXA 4Y3UA 5F77A 2VTBB 4Q16A 1ORVA 2I9KA 1KDOA 4LCJA 1BEZA 3AF0A 5H1YA 4FQ7A 1XVVA 1Y81A 3OE5A 1J09A 4WD3A 1GPLA 4N4AA 4PAQA 1OW3B 4CEJA 3JCZA 4FBLA 4GLOA 1GCIA 2Q5CA 2VQEB 1A7JA 3OZAA 1E79A 1VHQA 4G3XA 4WECA 5JWRA 2IYEA 4FFDA 4FEYA 3U0BA 6YASA 3UMRA 1KEKA 3BRCA 3O4GA 1Z6ZA 3EIFA 2LIVA 1QAQA 1E3EA 2PVCA 5H3HA 3U7QB 3UXEA 4B6RA 1UEIA 4NBWA 5ESXA 4BASA 2AT1A 3U5ZB 1K63A 1CNFA 1LTQA 1EE1A 1V7QA 2GCNA 2LCFA 3JZMA 3QTLA 3LGAA 4KIJA 3JQ8A 4OMFG 3QV1A 4TX1A 1BQ4A 3SFTA 1XIVA 3P20A 1CJMA 4J4BA 4GEGA 3HZHA 4ZREA 3ZV6A 1KVRA 3WBFA 1WZEA 1H66A 2VEDA 4IPTA 4MRMA 5ICFA 3R41A 3G88A 2QL9A 4BMYA 4CQMD 5C46F 1DLJA 1GLNA 7REQA 2QPTA 2YXBA 3VKUA 3FTEA 4BMVA 4Q6WA 1I6WA 1RRVA 3QEOA 4GZMA 1UCFA 1S3SA 2QTWB 3OQPA 3HEBA 1DIGA 1U7ZA 1M83A 3T3GA 1HQDA 1L7RA 5JCJA 3JQ8B 3SEZA 2YV4A 4PZEA 3TLJA 2I91A 5CJ2A 2JG3A 1E9DA 1QFYA 2NP6A 121PA 1XZEA 1YVRA 3CLUC 3GCXA 3LQ2A 4MRMB 2FWIA 3KPJA 3GLHA 1TPZA 4MV9A 4DT1B 1T1IA 2P5SA 2VSFA 2B9VA 4HH1A 4HH0A 5KI6A 1CU1A 1YU6A 1YS2X 2C3YA 2RC5A 1P3DA 2ODTX 1H22A 2VHJA 3K72B 4M53A 3TE7A 4V1CA 2AGVA 2ZDQA 4JU9A 4BVAA 2O06A 3SICE 4C4RA 1D07A 1GQ2A 2VQ6A 4F7DA 2GNPA 5A4JA 3ZW9A 2DT5A 2VSOA 3DF7A 5EZSA 3U31A 5F2NA 1GRVA 3L6BA 3DGEC 3GRZA 4XX0A 1QHSA 1W0JA 1WLYA 1YRLA 3KQVA 3G0IA 4MV1A 4NCIA 3RC9A 3W1EA 5ISMA 4W1RA 4CR8A 4V1CB 3FCYA 2Q4EA 1ECPA 1T3SA 2BFNA 4FN4A 1IMJA 1K3UB 3HN2A 5AJTA 3V2HA 4YJ2A 4O5OA 4NK4A 1PT9A 2ZTLA 5E9QA 1PL6A 1SXJD 4FE7A 5HCIA 4JLMA 3KVYA 4UUAA 3O82A 3KTDA 1PU2A 2ETVA 5DN9A 1OOEA 5FHRA 5CG2A 5E38A 1NVKA 4XX0B 3A4NA 2Q5OA 3F78A 2A67A 3SDSA 1Y7TA 1L5NA 3WLFA 4EHFA 3DHWC 2JHPA 4Q82A 4WZAE 1FOEB 1KOGA 2AI2A 3FN4A 2BGNA 5FV4A 2OQVA 2ZUFA 2HUNA 5KYYB 4MVJE 1SBTA 1P0PA 2BGTA 1JYFA 1ZX1A 5F7XA 5JFOA 3LWZA 4F04A 1JPVA 5KEIA 2WZCA 4MICA 2WU1A 1TQ4A 2WKRA 2CYCA 5CHEA 4LRXA 1ZYUA 1ZM2A 1E59A 4Q7JB 1AUQA 4M0UA 1FFXA 2A9RA 1KERA 2C4TA 4WJZA 3CJTA 4W5JA 2R4TA 2AD1A 1J8YF 3S55A 1V5FA 4K9RA 2ISSD 3WNZA 4U7JA 3G7NA 4U1RA 3WIUA 1G3QA 4INJA 2NVOA 4MLPA 4NI5A 4U2DA 5JYEA 2FLVA 1MNAA 5EGSA 3R3YA 2GHRA 3GGGA 1FQKA 3SR3A 4BDSA 4AKTA 2ZYRA 4GIBA 2YJTD 3SE0A 1I30A 2B4YA 3ZZUA 2YMLA 5BQ5A 4MKXA 1UK8A 4EHHA 4DIFA 1FRNA 2JKYA 3VZDA 1G8PA 1M1NA 1PJLA 2O2YA 3EZGA 4J7UA 4WL0A 4ZYVA 5F7OA 2JGAA 4G0NA 4XD7A 3HJUA 4KWEA 1POXA 5EMJA 5TJ9A 3E0QA 1F9EA 1U1CA 2CW5A 4FVTA 4NK5A 3AUYA 4PFQA 4W1PA 2M6LA 2QIOA 1NJ8A 1P91A 4GKAA 4ZRNA 4W4TA 1P2VA 1RQPA 5MN6A 2I2AA 2E4XA 3WBBA 5DGXA 4W5WA 4R2XA 4MVJM 4OLJA 1JJBA 2QE6A 2DFDA 4YYEA 1K6JA 2ZRKA 4TN5A 1COWA 1PGNA 2I80A 2C4UA 2IXFA 1J21A 5L9AA 4QXPA 2BR4A 1RE1A 2XKKA 2VT3A 4MRSA 5BYJA 1JAIA 1O08A 1ODJA 2Z09A 3DDUA 2QNBA 4ZARA 3I9OA 3IHLA 4Z1MA 1BQ3A 3IEPA 3TAHA 3VR3D 1IQRA 4DOMA 3U40A 5JV5A 1AGXA 1H6AA 1RC0A 2QJFA 3AKYA 1JFFA 4K03A 3H16A 2A8YA 4J75A 4JUAA 4ZVPA