3HY4A

Structure of human mthfs with n5-iminium phosphate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
195
Chain Sequence
MAAAAVSSAKRSLRGELKQRLRMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 58
structure length 195
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy4A00
3HY4A 2G40A 3HXTA 1SOUA 1WKCA 1YDMA 2JCBA 3HY3A 1U3GA 3HY6A 1U3FA 1SBQA
chains in the Genus database with same CATH superfamily
4BWYA 3LIIA 1EJ6A 1RWWA 3EHEA 4G5OA 4F1JA 2BMDA 2JIPA 4QQNA 5FWXB 1I7DA 1MAUA 4X1OA 4X1KB 2ZIGA 3FNGA 1C30B 5D5PA 2CFCA 4M98A 4ND4A 2J7KA 3WLAA 2XODA 4Z0TA 1T2CA 3HKEB 1C3XA 3FE2A 2IVFA 3C6XA 1RLIA 1DBRA 3DE1X 1JHVA 1N7HA 1T0JB 4CM9A 1XROA 5BR8B 3OTWA 4C78A 3RGWS 3RT7A 2AIRA 2O3SA 3MGGA 1SUEA 1NJ1A 3JZFA 1XMQB 4BUCA 4C3ZA 4IDCA 1XPRA 4INPA 4KQFA 2P8SA 1E69A 1ACLA 1T10A 2DFKB 2NADA 1PR6A 4AS3A 2JFBA 3CXUA 4BBPA 5IM5A 1QB7A 2Z3WA 3CV3A 4WESA 1DEAA 2CFOA 1FFDA 3CLHA 5E7MA 4BJHB 4J90A 1QRAA 3IS3A 3HLTA 4XCQA 5JT1A 3GG9A 2O54A 1W5SA 5HIJA 4Z4FA 1BMFA 3MJRA 1N6LA 1SVSA 4UQOA 2C4TA 1QH1A 1EX7A 3RC7A 4AROA 3MHPA 3WHKA 3GG2A 1A7JA 1IWBB 3V5NA 1WMSA 2O07A 4MUXA 5CA1B 1U28C 1ODJA 1KZ4A 2WMNB 3BE5A 3LQQA 1DXHA 4E5KA 2C9MA 1YBMA 2WT8A 3UXHA 5A05A 1USWA 3PXXA 5K1ZA 3CN9A 3JSAA 1GCGA 4G5GA 1NBEA 1O03A 4FWTA 3MRSA 1WBDA 1KI6B 3EOBI 1KZ9A 5IAJA 1H6BA 1Y8RA 2A33A 3GZNB 3C98A 3LFUA 3U09A 4DR6B 1ZUIA 1V0JA 3VOAA 4LF8B 4EKEA 1V26A 4XARA 1Z08A 4Y7DA 2YRWA 4EW6A 3ND9A 5GOZA 4LNAA 5LU8A 2P2GA 4DPLA 2W6JA 3LAWA 2C7GA 2GZAA 3JQBC 4XUEA 5HMMA 3SJ7A 1WDMA 3DEHA 4BQRA 4KWIA 4KIJA 1EGHA 1IONA 2LKDA 3C3KA 3E1SA 3FKSA 3GCXA 4B35A 2BBOA 5KNBH 2PJRA 4K9OA 3CQ9A 3IIEA 5I8ZA 1FRFS 2G70A 4Q4AA 1U6KA 4ZQBA 2H48A 2X0RA 5EXEA 3VH1A 4WI1A 4ZARA 1CZHA 5I9MA 4DA9A 3EVBA 1OT3A 4IQ8A 4XDYA 1U0LA 3EXEA 4E22A 2IYVA 3SLGA 1S3IA 1C7RA 2C9CA 1FU7A 4JN6B 5LZ4A 1U90A 2HRBA 3NHPA 4MI9A 4R1QA 2BRUA 1VPWA 1KDRA 1XNGA 4CDGA 2ZIFA 1XTPA 2FP4B 4RD3A 3RU2A 3QBEA 3LA6A 1UAAA 1GM5A 1OT5A 1TYCA 2GZ3A 3V8RA 2JGMA 1VYTA 3I9NA 5ALMA 1AA9A 3THYB 3L7IA 1S2MA 2C96A 2POQX 3QTLA 1NDUA 4Y7CA 3B82A 1E1MA 1RXIA 2RB4A 4S1NA 2XR1A 4RYLA 4XDZA 4K8RB 1RCUA 1VKJA 1UJ2A 2I6FA 3L4SO 3FPLA 3LNTA 3VH4A 3WGGA 4KHZA 2P69A 1UOOA 2H3EA 3IE0A 4EKIA 3OTOB 2AMFA 5DP2A 1YASA 4DQKA 1YBVA 1ZEMA 2WK1A 3KWMA 2WPDA 3OCCA 3QVSA 5G4LA 1E66A 3BCRA 3JQFA 5KKAA 4DMFA 3QITA 1E4EA 3IIKA 3NJ8A 4NOJA 4D82A 2C4MA 3EQ8A 4UM9D 5DTQA 3TDKA 1RWVA 4QC2A 3EQ2A 4X8HA 4AMUA 4Y2QA 1PWYE 3RNLA 2I03A 3GEPA 3OY7A 4LXTA 3WNVA 4XWWA 1PZMA 2H2FA 4C30A 1CD5A 2H1WA 4BVKA 4DJAA 4KDFA 3I6BA 1PV2A 3AEQB 2VBFA 1IZ7A 1ZGAA 2WNSA 3KQKA 2FCAA 1NVKA 1CJBA 4L0QA 1NBWB 4Y6RA 1OY1A 3ZDRA 1MPTA 3QVGA 5LMZA 3U7FB 4TLAA 2X86A 4TWIA 1JLLA 1P4GA 2Q3LA 1Y6RA 3QHQA 4GX5A 2CEAA 4RIEA 4URFA 4B8WA 4QXRA 4E5PA 2Q4RA 3HZHA 1HX7A 4MPJA 2I55A 4BZWA 3B38A 2VS1A 4R5MA 1E3WB 3FZEA 3HU5A 4LI0A 4B3IA 4Y1EA 2J0EA 4H77A 4ENVA 3PS9A 4TGLA 1U8AA 2JFYA 2PS0A 4HP8A 3P19A 3PV0A 4GW3A 3SHFA 1N25A 2OV2A 3D59A 3LW8A 1NW7A 1FNMA 1RWNA 2JJ2A 4I2NA 4MW7A 3W8NA 4ZV4A 1OTHA 1XA0A 3AIMA 3G2QA 3GPDG 4YXFA 3SWWA 3D7MA 2CLSA 2C9OA 4INOA 1I3MA 1PTKA 1BO6A 2QMEA 2WTNA 1WXFA 3FB1A 1IY2A 3O47A 4WINA 1PEKE 2AQHA 1UZNA 4YRRA 3L8YA 2R11A 3NGMA 3QVVA 4OK3A 1ESNA 1WLSA 1HDXA 3TLJA 3VDRA 4X64B 1UJ6A 1DKQA 1Y1PA 1T8SA 2WF6A 4JJZA 2QX6A 4ER6A 2DBZA 2FB9A 1RC8A 1KO4A 4ZYZA 5L4LA 2P6MA 3ZCTA 2V7VA 3N5KA 4F2GA 4I4TB 4ER7A 2HHJA 1NJ2A 2Z0MA 1L4KA 1JFFA 1H2RS 2VSYA 3CX4A 3I09A 4FI3C 1LC0A 1IN4A 3I2FA 3FOEC 4Z99A 1VC2A 4RU1A 4DBLC 4W1RA 1YACA 2I2CA 1EG2A 1R8JA 1F2TA 3RVMA 5ICSA 5KTNA 5CIYA 2W6CX 4UDXX 1ULHA 1BHSA 4S12A 4UKDA 5DXJA 4B3JA 1YU9A 3KZCA 3RC3A 1GG8A 3BL8A 1X70A 1NDQA 3K0BA 2WR8A 4EQ6B 2ZPAA 3BQMB 1GRVA 2VWPA 2VJLA 5CD1A 2WG0A 4GQAA 1SBHA 4GU5A 2W42A 3NBKA 2YFYA 5L4SA 4CLDA 2B6HA 2EQBA 2IYTA 5GIOE 4EKDA 2HYDA 4MVJI 4P98A 1I30A 1UIRA 2R48A 1RC1A 2VK8A 2DWQA 2N75A 4HK4A 4P7BA 2Z9DA 3GVPA 4F4HA 2MU1A 4K03A 2V98A 3LFHA 3OTIA 4OYRA 3X3HA 3ZCUA 4DPMA 2B1JA 5JNLA 2WFZA 3T3IA 4NQZA 4LZJA 1ETHA 3B1JA 3NDPA 4I4TF 1EK2A 3SOPA 5DLYA 2WY2D 3FOFC 2A0WA 1E3QA 1F9EA 1FJ2A 1PF7E 4F7WA 4F9FA 4BNNA 1WHSB 3RVKA 1Q3TA 1NXXA 3AEYA 3PHGA 4IKOA 4AQDA 1OVGA 3K9HA 4JBIA 1CJCA 5KTPA 3LO5A 4Z3DA 1GSIA 4CV2A 4L7VA 3ZJVA 1MIHA 5DHAA 4FYJA 1TQ2A 1ADGA 3GU3A 2WE8A 2IBTA 3GRKA 1CEYA 1G3UA 1X9IA 1DJNA 4IOMA 3UAVA 1NM5A 1THTA 3FPBA 1FVXA 3B13B 4ON9A 1MA3A 4XWOA 3K8OE 3CA8A 1HQDA 5KTOA 3B9PA 4HUQA 1J8YF 1P7CA 3EXG2 4TYMA 3RTEA 3R9XA 3CZ5A 2Q9UA 5FO0A 4XQCA 1IYZA 1GGKA 3NJ4A 1E1RA 4TTSA 3AF4A 4GI3A 2DXIA 3PLRA 3LUJA 5D87A 2VH2A 3HZRA 5DRYA 2ONCA 3HY6A 4F6LA 3PXAA 4PY2A 1L5ZA 4RLQA 5J5VA 1P5ZB 1G41A 3UF0A 3PE3A 4K5QA 2JIZD 3BRCA 3AR9A 5T8KA 3UPUA 4LF7B 1N2SA 1N0HA 3LZCA 1DAOA 2C9YA 2W37A 2VTBA 4EAAA 1EYZA 4UTRA 4CIBA 2PBFA 3FWNA 1DKMA 4ALKA 3HPQA 2NSJA 2H18A 1WUHS 1XTBA 1FXSA 3BGWA 1OGJA 1E9SA 1FFAA 2EBHX 4HYTA 4O4LF 5D51S 5GPBA 4AKTA 3U4DA 5J4KA 2NZUG 2HBRA 1GNVA 2J41A 4KYIB 1OU4A 4ETWA 4HATA 2IE0A 4BMCA 1VSTA 5HKAA 2F1JA 1X74A 1ISMA 2BFDB 4QREA 3QIAA 4NCXA 1DUVG 1XXHA 4I36A 4ARVA 1NOJA 1RZRD 3KFVA 4BNDB 2Q3HA 3TTYA 3DYVA 1G21A 4O6VA 5EJ2A 1G55A 2FETA 3SIXA 1R0BA 5FBZA 3E8SA 1GZ7A 2TMDA 4GVXA 3DJYA 4NK4A 4BDSA 4ZZ2A 4E94A 4CF4A 4CR8A 4XYBA 3JQDA 1NBMD 2PR7A 3ZQKA 3QGMA 1NX6A 3QJGA 4Q02A 1CP3A 1KR5A 3AR8A 2XI4A 4IHQA 1NMSA 4XVQA 1JDSA 1A4UA 2W6QA 1TM4E 2ZS8A 2QRZA 4D43A 2O8EB 1EA5A 1W0KA 2FWNA 4GWGA 4YCJA 4U6QA 5JRJA 3BUSA 2GTPA 1Q5PA 5CT8A 1EJ2A 3MVEA 2O2CA 1HDCA 3L5KA 2JG3A 1QK3A 1JAHA 5ABPA 4KFCA 2R4TA 5DASA 3IP8A 3I3OA 3B6JA 4IDAA 4AIRA 2EC5A 4YCAA 3S55A 1GLGA 1KZ6A 3I9JA 3W8EA 2ZCUA 3K96A 4HO1X 4HSGA 3THOA 4A10A 4KBGA 1B42A 4CETA 1ZHOA 2ET6A 2QE7A 1NQVA 2C59A 3WQBA 1N57A 4P4SA 1PTJA 3ND8A 1FRNA 1ULTA 3E9DA 4S1VA 4P0PB 4EA6A 4X20B 4HQ0A 4YA6A 3L8FA 1H2YA 1S2LA 5EXTA 2VSNA 4CQLA 7ABPA 4DJ5X 1KO7A 4OP1A 3L0SA 3I0MA 3VI4B 4Z51A 4RTKA 1URPA 1KGDA 1KAEA 3GAZA 1YE5A 3V9AA 3X1KA 3KEGA 2XGMA 5KBYA 2Q2QA 2I3AA 2ZI5A 4DW8A 3B8EA 1G1MA 3EEFA 2GJSA 1Y4DE 2WTBA 3UWOA 3UNXA 3I5XA 5LXTB 1P0IA 3NBXX 1YCDA 4KG7A 4PQFA 1GPNA 1P1CA 2WA1A 3NYIA 4I08A 4NZPA 4RZIA 1BD3A 5FV7A 4D79A 3GRAA 2GTIA 2XH8A 3QBJA 4C4RA 4EHFA 2PYZA 4H0NA 4H0FA 1UMCA 4PNZA 3UMBA 5MFZA 1OZ0A 4XLZA 4BLPA 4FJ0A 3D7SA 4OQNA 4HVTA 3Q0TA 2GPTA 1E2NA 2O1SA 3D8HA 4H7PA 4Q15A 3HFGA 3T52A 3UBTA 5BUQA 4WKCA 2PSJA 5JHGB 4I2VA 2GM5A 3GMSA 421PA 1UF9A 2FDCA 2DHRA 2QAGA 1TM2A 2AL7A 1DZIA 3I1JA 2JI4A 5LA6B 1FNSA 4DV5B 4KPUA 1CJSA 4QEKA 3WKAA 1CZLA 1V5IA 2FMKA 1Z4OA 1UKVY 4PG6A 1BA2A 3LO8A 4V0ME 3O4VA 2H4XA 3CUKA 4JKYA 4OH1A 5FO1A 2X4DA 1N2EA 2JNWA 1AK1A 1M34E 1NFFA 3O3NB 4Q4DA 3GVCA 4OK5A 1T2NA 5LXTF 1H4SA 2PUVA 3VR3D 2E5LB 3PFNA 4MYTA 4CE6A 3C4VA 3S81A 2GNPA 3P9NA 3LVFO 4WLUA 3RAJA 3L7NA 3SHWA 3W5VA 3CLKA 4JC8A 4ZMRA 2HJSA 2P91A 3S1AA 1X77A 3OZVA 4BV9A 1F7UA 4R16A 1HT3A 1FXWF 4R2XA 5TMPA 1R0YA 3QVTA 2N47A 2YIDA 4KN8A 3ADDA 4EPYA 2QD1A 3ZXIA 3MUNA 5KU1A 3WNCA 4PW0A 4G8DA 3ZHZA 1V4NA 2VPTA 3N8KA 4ZQHA 3OLQA 2VP9A 4P5PA 1NT4A 2XGOA 3N28A 3GMDA 1KSJA 4CMBA 5LA6F 3HG7A 4UVEA 3V1TC 3PG5A 4EI2A 3KM0A 1TNDA 2V7QD 1QANA 3JARA 2JHGA 1JAYA 3KZKA 3P2OA 4NBNA 1KXZA 1TVKB 1X8KA 2VF2A 5IW8A 4A2QA 1LPPA 1GFIA 5C31A 4ZAWA 1KE2A 4CGYA 3IJ5A 2DT8A 1KIAA 4X9XA 1OC4A 3TOSA 5DN9A 1RP1A 1U02A 3GVIA 3HDYA 4FP9A 4UQLA 1GAQA 5LOVA 1X0VA 4TRNA 2A94A 4H7JA 1F4PA 3RIYA 2C2BA 3Q5DA 1DWPA 4PE5B 3RK0A 2MR5A 5JBNA 2IPAB 1Q1QA 2FMFA 2P7IA 3DAPA 3KCNA 1HOXA 1OXBB 2F1OA 1FNCA 4X3OA 2B0CA 4FJ1A 5A6SB 4BJ5A 2VYCA 1SA0B 2QJRA 1YO6A 3NETA 1IPFA 1UFQA 2B4AA 2P2DA 3ITDA 5JCOC 2IYLD 5THQA 5LZ2A 1MT3A 5EKUA 1DS6A 4K46A 2X6TA 3TE6A 1BRTA 3L04A 4AF7A 4CM5A 1AHPA 4JSTA 3WRYA 1ZI6A 3KT8A 4NDZA 4HF7A 3TNDA 2WE7A 3ESXA 3DNFA 2ZR9A 2WABA 4JQZA 1SIOA 3HCPA 2ALJA 1H42A 5IKOA 1IBKB 1DLJA 4RK4A 3BVPA 1N2ZA 2B8NA 3R5KA 3O4HA 3TRDA 1KP3A 4BC1A 4RYDA 2FJ0A 4Q47A 4LWQA 5FTJA 1NP6A 1LX7A 1EP3B 1Q95A 1B6SA 2XNDA 2Y1DA 3PSHA 4HGOA 4B87A 4IIXA 2ZZMA 2MTBA 2AFHE 4Q82A 1NYQA 4NONA 1RKUA 4ODIA 1YT5A 3TI7A 4L0MA 5EZQA 2NO0A 2A4KA 1UJNA 3DMTA 3NAQA 2R1TB 3ETLA 4R05A 1N3BA 1S2OA 4NYJQ 3T6KA 2J7PA 2ACKA 1Q2UA 2CNBA 3DV2A 3GMTA 1N0UA 3I64A 2EG9A 3EHDA 3QE0A 3KHTA 4PBSA 2IZOA 1T2EA 5IC6A 2Y9PB 1Z0SA 4X1YB 4MW9A 4X71A 2WF5A 4XJXA 4WECA 3U2QA 1PHPA 3N7TA 4DBZA 1EX6A 3E3MA 1LW7A 1O58A 4CG2A 1XALA 2B25A 4CFZA 1SCIA 3TW8B 1U3VA 1NLYA 4B4KA 4AKEA 4F84A 5ITSA 2VDVE 5EMNA 1YGPA 2GPNA 1VL8A 1T1SA 2QVLA 2R2GA 3KTDA 5IHXA 1KBOA 3BFVA 2EWWA 3HR8A 1MH1A 4FU0A 4TM7A 3LECA 1HV8A 1U0OC 3OT1B 4AW9A 1N33B 4Q7KA 1NYTA 3NHJA 2DQKA 1U1GA 1PVDA 3QMWA 4M6WA 5IEBA 5HJ5A 1C3OB 2Q4OA 2CHVA 3NHUA 1CNFA 4H6VA 1XKXA 2AN9A 2QPOA 4KHPB 4PINA 1Q7GA 1EP1B 4B43A 4DGQA 1IXSB 4WVLA 4HYYA 1ODIA 1V9LA 5ADHA 3MIZA 5K3AA 3SC2B 2CUKA 1ZBQA 4NAUA 1YJXA 4FFPA 3A4YA 2QTMA 1L5OA 1KJWA 3DWFA 1GRCA 1C50A 1ZCAA 1PFGA 2XLCA 1RAGA 2YN2A 3KWFA 3L84A 4HNSA 3O1LA 1QWSA 3W9BA 1LBHA 5I7WA 4QGAA 5EERA 4F4IA 2PBRA 2W2LA 4JVLA 5DU2A 1QR6A 2DBQA 4NFLA 3ROMA 2HJ9A 4NHEA 3U7HB 4ZO4A 1THMA 1P6QA 1EWTA 3NPAA 1KQNA 2NVUB 1FNNA 3WV5A 1TCVA 3B9BA 4ZDJA 3I92A 4P4GA 5DI3A 5IXYA 1YB7A 2PSFA 2FUG6 3M1YA 3NOQA 4B6FA 5THKA 1UM9B 2FWBA 2XUIA 4NZYA 4O5AA 4PQEA 4M1QA 1JWAB 1RWQA 2BHRA 3ISTA 3H1AA 1LS1A 2WJVA 5L4NA 1E8DA 4LHWA 4LHZA 5CBPA 1HE8B 3EODA 1QZZA 3VPCA 4EGJA 2HV9A 4MP3A 1ZDMA 3F7TA 4BP9A 1SZDA 2IP1A 1UAGA 2UVDA 1FYWA 3ZLJA 5CLQA 2XSZA 3RTDA 5CB4A 1O1YA 4NMXB 3KFXA 2Z1NA 1HYHA 4IKEA 4RVNA 3EFOB 4XJSA 2ATCA 1C4WA 3HWSA 2VNAA 4HEJA 4IDOA 2AB0A 5CMLA 4NABA 2V3WA 1IL0A 3HVHA 1U2PA 4WT7A 5EZYA 5FNVF 1YS2X 4OHPA 2XBUA 3EZYA 4B6EA 1TIPA 5PNTA 1Z74A 5B3LA 1ZINA 2AKAB 3CE9A 1KH1A 3QJYA 2AC2A 3H6KA 1H5QA 1BMFD 4G41A 1WW3A 1CXZA 5LZ8A 4UVHA 2Q8NA 4ZREA 5BUZA 1KC3A 4FFBA 1ORRA 4RPHA 3LCCA 1IHXA 4KX3A 3KOOA 2FR8A 2ZKLA 2HHCA 3ZE9A 4QU5A 4DSZA 3EGEA 4BO2A 5C1IA 4HFMA 4D0LB 1XVVA 3VHLB 1TLTA 2FPRA 2JHAA 1O8BA 1GVNB 2F3UA 2K2QB 5KYWB 1JEJA 4B40A 3TI9A 4U2GA 1PZXA 4ALLA 3DBHA 4JITA 2P2LA 4X0EA 5ALQA 5J5AA 4RS4A 4AUEA 4CL2A 3QKSA 4I1VA 4R1NA 1T1EA 1KQFA 5JJLA 5E3JA 2G5GX 1NN1A 4C4SA 1FZTA 4CTKA 3U4MA 1BHJA 4KQJA 5JBIA 1M5TA 4Q24A 1W4ZA 1JTVA 1JG3A 1S2IA 2QP3A 4XVHA 4ABYA 3FTDA 1HDOA 1HUQA 2A35A 2W2KA 4DDMA 2PUEA 1PN3A 1DIOB 2TMKA 1YTLA 2IEGA 2Z09A 3B1YA 3O90A 3VNVA 2WVJA 1UIMA 3GX1A 1WXDA 1M73E 1TQ6A 2DWCA 3JQFC 1KVSA 3FKSD 1A77A 1NAHA 1NW9B 3V6LA 4AM8A 2OFXA 5CURA 3ZWYA 4GGMX 4NE9A 4XPZA 2EFEB 4DARA 4QGSA 1D9ZA 2WNHA 3M6XA 4JBNA 5B64A 1OH6A 3O9ZA 5BUCA 4F97A 1YOVA 4QJ5A 2XV1A 3K9BA 2FMHA 3T95A 5DX8A 1J5EB 2Q46A 3FPFA 3UHOA 3PX7A 2OB2A 1EVYA 4TYNA 3NHWA 2OHVA 4FDMA 4K1XA 3FCOA 5BO5A 1EDZA 1T8WA 5EN4A 3TX2A 2IODA 4D92A 4YAEA 1VHWA 3GEEA 4D9HA 2XTJA 2VDLB 3AVOA 4HB2A 4JLVA 4BB0A 5BSWA 2VHXA 5EPUA 3KSAC 4PTZA 2PKYX 3IV6A 4TXHA 4H6WA 2XRYA 3IAS1 4R8KA 3UOAB 4W1PA 3K5IA 2P79A 1Q17A 4IDNA 5A02A 4WK0B 5BN4B 1YE3A 1ZONA 3IHWA 3TNLA 2VTEA 4HGZA 1YXMA 1JDZA 3IHKA 2WWXA 4BGDA 3OCJA 3ZD7A 1UMKA 4U4AA 1K0UA 1Q0SA 3PC2A 2HQOA 2VP5A 2VJMA 4QODA 1OYOA 1Z6GA 2W83A 2JGDA 3VZSA 4WGGA 3UMYA 1A5BB 2JGAA 4U2FA 3S3TA 3ABZA 3S5JA 3LQKA 3TH5A 4QUJA 2OESA 2OGWA 2PZ8A 3CR7A 3L0YA 1QCCA 3M4NA 1FLVA 4PLTA 1TAHA 2FH5B 4RIGA 5F52A 5CNMA 1ZEJA 1HFJA 2J30A 1LV8A 2NZYA 2XZLA 4PX5A 4MCIA 4DLTA 3R0VA 3T12A 1V9SA 1OFHA 1UXKA 4JCOA 5L3SA 2HPVA 1WTCA 1UODA 4RMJA 1JLRA 1G98A 4CQNA 1BMDA 2CMGA 4U9HS 1D3AA 1U7PA 3OPXA 4PC1A 1TJ5A 4ZAGA 1JAZA 2FE4A 2FPSA 3PL1A 3GLRA 3PITA 5JADA 3ZU5A 4KAAA 3THXB 1D0IA 5BN5A 3IBTA 4QTZA 4XSVA 4TZ6A 1IDN1 3DO5A 4BFUA 4I55F 4YMIA 4MS4A 3I34X 1JIVA 4Y30A 5E3HA 2XY4A 1JSLA 4RSRA 4KE9A 4DSNA 4D4HA 3CUTA 5LMNB 3VDXA 3K2EA 1AQNA 1H8HD 4G07A 1I8TA 3T4PA 4L76A 3G88A 2JLWA 2C7VA 1J09A 1JWBB 1LLDA 2ZQYA 3Q1LA 4JI0B 5A1JA 4MVJD 2ST1A 4IJUA 2FP4A 2WOOA 3NANA 1P7WA 1GEGA 4G3XA 4DSOA 2BMVA 2VP3A 3FR8A 4GBJA 4RPGA 3OC0A 4FLEA 5F2EA 3W8FA 5HXAA 4BOYA 1ND5A 4G5XA 4QRDA 3KHKA 2A5FA 2FEPA 4LY0A 3I42A 5DHQA 1WB9A 1DC4A 4TZTA 5EWMB 5C1BA 1NM5C 4X7PA 1QIEA 3MERA 2G06A 4TMXA 3MLEA 2PK3A 4YCMA 2D3TA 3PR3A 1V35A 3P2KA 1B4DA 1QXSA 3LDAA 1UPXA 1YUMA 4ER5A 4RH1A 3PFGA 4JODA 3CZPA 3RVRA 1PSWA 2XECA 2IZ5A 2WMDA 3NU1A 1U0GA 4HQFA 2JI7A 4LI3X 1C9JA 4LZZA 4A2WA 2JGRA 4N6OA 5GM1A 3GA0A 1PT5A 3TLYA 3D4BA 1OXSC 4FUQA 3O1HB 4OATA 5CTAA 1H4TA 3T41A 1YS7A 4EF4A 2EJCA 3SS8A 1Z75A 3KJQA 3WO1A 2CF5A 3QEKA 5JJCA 4N41A 2VH5R 3LCMA 4HH3C 4QATA 1OYWA 2QAJA 4H0CA 3W1WA 2GYUA 4QICA 1DINA 3VZPA 1NKTA 3AYXB 1VXRA 3ER9A 4MV6A 3RBZA 1EXVA 1T26A 2V74B 1BC5A 4GX0A 4TTVA 3LC0A 4IHKA 5AK6A 5E0OA 4Z1MA 2C4KA 3C45A 3ESDA 3V4PB 3VM6A 5MN5A 2ONKA 1KI2A 2I33A 2V4UA 2V5VA 4JP2A 3SNKA 3I6YA 1B00A 3N70A 4EGAA 2I80A 3G59A 4I8IA 4KXXA 1WF3A 3RLFA 5KSWB 1D7OA 4ARIA 3EZ2A 1QC5B 1DWOA 4QJIA 4YP0A 3G7UA 4UHJA 5DNWA 3ZV3A 5BRAA 4YYZA 5AW6A 2O2GA 1Y1QA 3C5CA 4L07A 1GPLA 2LZ0A 5IZCA 5JWOA 4CVNA 4LOJA 4MWTA 1GZSA 1JKJA 3ZXUB 3EVCA 3HCBA 4WZAB 5IWCA 3ZGOA 3I6QA 3FCXA 1ZY2A 1IUPA 3EMVA 1CRQA 1KDOA 3O3CA 5KQSA 5DK4A 1SUWA 3BG5A 3PCRB 4BNFA 4D44A 3VH2A 1AV6A 1MC4A 2A6PA 1TD1A 5F2KA 4XI9A 3HSSA 3EPHA 2VHUA 4DYVA 1U7DA 2CJWB 3DA8A 1LNQA 3PFCA 2DZDA 4B6PA 5I4IA 2VHWA 1A0OA 4ZA2A 4KN5A 2OVFA 4JT4A 2F4VB 1J0XO 5FUMA 5FL7A 1Y5IA 1E7SA 1JZSA 1NZDA 2YWCA 3EFHA 1DAPA 1P0MA 1YR3A 1O9GA 4DMCA 4EHKA 1EZ4A 3H4MA 5COQA 2G25A 3W7VA 3ABOB 3GUYA 1ULBA 1X14A 3A2KA 2FE1A 2VNIA 3GK3A 5DISB 4DBLE 2JZOA 2C9BA 1QBGA 2G67A 2PWPA 1PJZA 1M7HA 1YZ3A 2OBMA 3KJFA 3MUOA 4E13A 1DWUA 3OCXA 3FD8A 1EK6A 1RHUA 2AXQA 3FJYA 1PTJC 2Y6UA 4NEHB 4DC1A 3AESB 3A3PA 3C87A 4KPEC 1T13A 1M5UA 2Y1OA 2IYZA 5HF8A 1SBYA 3U3ZA 2YV4A 1KO8A 1P5RA 2OPBA 2PVPA 1UDAA 4M60A 3GC6A 5ECWA 2HSDA 2D1RA 2X42A 2FZGA 3P20A 4MO9A 3NGXA 1ESEA 2A3RA 1GN9A 4RSMA 5FWAA 3DXXA 2XMSA 5SZIA 3D7KA 5EE3A 3PRHA 2QWXA 4ETNA 1KDPA 1RJ9A 2EXXA 4IY1A 3ANYB 1U9YA 2R00A 4JFRA 5HIMA 4F9EA 2PLAA 1NG9A 4MA5A 1NI3A 2WIJA 4O4LA 1EP9A 1V7CA 2R6DA 3NTXA 4EFMA 5F7ZA 3TN7A 5ENDA 5E6SA 1NQXA 4EY3A 2UU9B 1ZOOA 2Y93A 4UVGA 3JAMA 5CXUA 4A15A 3OZ7A 2O19A 3NOXA 4KODA 1X7XA 5IKXA 2R9VA 4K0KB 4O0MA 5H80A 1HK7A 1GGJA 1RU3A 3IJEB 4PF1A 1H2WA 3E18A 2BIFA 3MQ2A 3IHTA 4G37A 3ZK9A 2R2AA 2TECE 1KMHB 5LDGA 1M1YA 1N6OA 1D5WA 4G5FA 3PBKA 4QYIA 2IS4A 3RJMA 3LT0A 5T3YA 2WZCA 3HO6A 2I4TA 1PT8A 3H11B 4JY7A 5COBA 2UXCB 3PRYA 3LX6A 4PAQA 4DEXA 3JWIA 3HK2A 1GDHA 1ISPA 1Q77A 4KFSA 2NVBA 4Z9XA 5G3ZA 5CDGA 5KTKA 1YH3A 1GUDA 3LQFA 4OHYA 3T06B 1US8B 3T4XA 3ZHOA 4Z5XA 4G0PA 3MFQA 2BFDA 2SECE 3VHXB 2VQEB 3A31A 4RGBA 1T4GA 4ZQEA 8GPBA 3V46A 1ONNA 1PT9A 4KFTA 4BQQA 1INLA 1KAHA 4BNZA 1MRZA 5LYJA 3P2YA 2WAYA 3V2HA 1EU1A 2WKRA 3C8HA 4NOMA 3DUFB 5TGZA 1KOLA 3ZVLA 2YQ5A 1WNTA 3EVAA 3OFND 3UMSA 5CCEA 1IOWA 2CKMA 4EKGA 1Z7YA 2BKAA 4BMNA 4CKBA 5DLPA 1TUEA 2IIBA 3R0QA 4WGFA 1O94C 1A9TA 4S3MA 3WBFA 4P3YA 2G5CA 3D02A 3Q6NA 4BBZA 3JR7A 2QZPA 3GJ5A 1XTIA 5FF9A 2O8EA 2WJAA 2A57A 2I76A 2W0MA 3COWA 3FGPA 1K5HA 2DWUA 3G7NA 3H97A 3E0XA 2QW0X 1RXSA 2X6QA 4YP7A 5C0OE 4G1CA 2WW8A 1U5CA 2QGNA 4PRLA 3RFFA 1WNFA 1IJEA 3EY9A 4EI9A 3SBDA 1RAFA 4OJTA 2W4QA 2G08A 4IGFA 2HXSA 3ORQA 3JTEA 4M76B 1C1XA 1YQTA 2LDXA 4O33A 3TAUA 4DIKA 1IH8A 4EDFA 3OH8A 3RRZA 1QZUA 3V42A 3MFYA 4DUYB 1JHXA 1GZ3A 2P78A 1OLXA 3PHHA 4MRVA 1QCYA 2X1VA 3IAAA 4K9PA 1DEKA 3GLQA 4GXRA 2ZT6A 3O4FA 5C1PA 1G8GA 1O94D 3COYA 2MDTA 1Q16A 3WISA 4BVEA 4PZCA 2I3BA 1ESZA 2VPXA 1OFIA 3FNHA 1RYZA 1E1DA 2LPMA 1JDNA 2BGUA 3PQ7A 4XQGA 3WJ1A 4YI5A 3ZNNA 4DRXB 4EW3A 4ESVA 5IXJA 4WDQA 1CP2A 4I3FA 5L51A 4DJTA 4RTLA 4OA8A 1Z26A 4HGQA 1A2KC 3TFWA 1E1KA 4DSAA 4RVDA 4TT8A 2B99A 5CNJA 2EHDA 1CUSA 4ZMBA 5I7OA 2O8BB 2PRIA 3LTNC 2HJGA 2C5EA 4UEQA 3M3PA 1CRWG 3FOBA 7REQA 1ML3A 1QMGA 5AFSA 1G2OA 2D8MA 4J9UE 1AV7A 3K5WA 2WYWA 4F4CA 2ZETA 1QG4A 1DDOA 4RL4A 1XMJA 4EO7A 2BI8A 1CZOA 1YRLA 1E1CB 3JYLA 1S89A 4XJVA 5TS2A 2VYVA 4XH9B 4YAJA 5EJ8A 3BMNB 3BMXA 2H7YA 3ZHYA 4NNOA 4MVJG 1RQXA 2ZE8A 3T9BA 2Q5FA 4E5VA 1JILA 1U2DA 1V1JA 3MCZA 3RBAA 1Z0DA 2P5UA 3E2MA 2GEKA 4IUDS 2G72A 3F78A 2P3SA 1G5RA 3AUXA 3PUIA 2NACA 4JASB 5HG0A 1BRMA 4RQTA 1J7KA 4KO8A 3K3PA 4PFKA 3TTXA 4DEYA 2YHSA 1KJIA 3EF0A 4NU0A 4A8TA 2ZR0A 5ALUA 3FX2A 1XCMA 3VQTA 1YDGA 3S2EA 4OGWA 2YFKA 1U31A 2DFDA 2GMWA 1NHWA 2OUIA 2J7PD 2QF7A 2ZAOA 4IIGA 4R98A 4C7KA 3QLTA 3PB3A 5A5GA 2FOXA 5AK0A 1QX3A 5BOSA 4QJBA 1LTHR 3D81A 4ZHQA 1YR6A 2P65A 5D3KA 3RSHA 1CIJA 1MQ9A 2JHFA 3L0IB 4OI2A 3T7SA 3NHZA 2JGFA 4RM2A 5TQ0A 4OXKA 4BFWA 3VTZA 1AM4D 4WCFB 3VPHA 2IYAA 4CPDA 3A58B 3CY6A 3EB9A 3QQ5A 3IVGA 4JZYA 1E58A 1ZWLA 5GJWC 1GSAA 1OREA 2OD9A 1ZR2A 1RKVA 5JZOA 2DWOA 2OY0A 2PT7A 5FOVA 5K8TA 5K3SA 2GXQA 1JMVA 2IXBA 3P97A 1YB1A 2X5XA 2WILA 4Q5IA 4OLHA 1QIHA 1ZD2P 2PQMA 1TLFA 3R3HA 4FYVA 3UH1A 5FL3A 5HNKA 4AKGA 2NYAA 5HILA 3HLKA 4L6CA 3AUUA 4OHBA 2OV4A 3KKMA 4NTZA 1TM5E 4KW7A 3H5WA 1HTTA 5CYGA 1JQEA 1KOJA 3W79A 3KAPA 1FLAA 2PRJA 1BN6A 3KOZA 4ZGWA 1ECLA 3PX2A 1SA0A 4CL3A 1KU0A 2AN1A 4IDHA 3GBPA 4N12A 1U98A 4GBMA 2VVTA 2INGX 3I2GA 2W2LD 3KXPA 1FJHA 3MMPA 1MO2A 1U6JA 4K88A 5AM5A 4DL9A 2I1WA 1QVRA 4XTCS 1JX6A 2CFTA 1XPUA 2F9FA 4X61A 3SBXA 5KQMA 2FR8C 1SQFA 1Y4UA 4M0CA 3TRKA 1NF3A 2ESRA 5DI9A 1IBSA 1VP3A 1W5AA 2C98A 4JDPA 2BBSA 1X7YA 4PGMA 3OSZA 1TW3A 1QQTA 5DDIP 2P9BA 4F92B 3WKDA 4D8WA 1QV9A 3L7DA 3QUQA 2BGJA 1OI4A 1QFXA 2X76A 1Y4AE 3MMSA 4Z0NA 1NT2A 1NQ5A 3KTOA 2AOTA 1OBHA 4UBNA 1YB5A 1KI7A 1ZK2A 5HX7A 3B5IA 5CBPB 3WSTA 2BBTA 1I2DA 2R8BA 2MJLA 3F3YA 2GF9A 1EQUA 4CEIA 1VDMA 1DTEA 3HCRA 3QY9A 1I3NA 4U2EA 2NGRA 4D8TA 3NM5A 1K8XB 3TR0A 4N65A 2ZRBA 3G9UA 1MOPA 4EO9A 1CIVA 1ZW1A 5DM2A 3KKKA 1PWEA 1SQ6A 3Q40A 1CVIA 2WINI 3EQ7A 3PQDA 5G1OA 1XLWA 2H7XA 3UUWA 1H65A 4JB8A 4CCYB 2B92A 4KITB 2BEVB 2ZULA 4L5AA 4XB1A 3VYTB 3T8YA 3E9RA 1Z7EA 2Y1LA 3C74A 3PQ6A 3UTDA 4M8IA 2QM3A 2AF3C 2WI8A 4ARZA 4IXTA 4CDRA 5HIKA 3RT1A 3B7WA 4J49A 3ER8A 3HBLA 4GI5A 1ZD8A 5KWJA 1E2IA 2R6CA 5CCXA 4DA7A 2VJQA 1RM0A 1DMSA 3STTA 2H2WA 4FC6A 1A8SA 4LDZA 3CKMA 1XN4A 3CVOA 4K6KA 4H1UA 1WB6A 3RNOA 3PX3A 3OETA 1YGYA 1U9JA 1FS6A 5EJ4A 4BKQA 1FB5A 1WE2A 2E4ZA 4JJIA 3CNBA 1KKUA 2YS7A 2QKYA 3IEKA 4MR8B 3MMNA 3T7EA 2IUFA 3NFRA 2XCUA 4LE1A 2PMCA 1T2UA 4NJEA 1VP9A 1SQGA 2ZIWB 3NTRA 3HWRA 4MYHA 4RPIA 3IOCA 1P1BA 4CLRA 2P2ZA 1FQJA 3ONWA 1QYIA 4OUKX 2R8RA 3L2OB 5FNVA 5FOXA 1ZD3A 2BHTA 3ANSA 5KVCA 3GLIE 3DE3X 4HDRB 4PYLA 4KYTA 1SBTA 1JALA 3CUYA 4Q3KA 4DWVA 3W6OA 1KBZA 2WT4A 2BELA 2R8YA 2NXNA 3M70A 4OXQA 3OU6A 4YRCA 4AZ0B 3VBEA 2VZLA 5A0FA 2PSEA 3UXMA 4ND7A 1M2EA 2B8WA 4BIMA 5K4GA 1J8DA 2BT4A 2Q29A 1FU4A 1CS0A 5KO2A 3S4YA 4XIYA 2ZQ5A 4W5HA 3BWCA 1JDVA 3HABA 3QLJA 4EX6A 4GOND 4DJFC 3LDHA 4UCQA 1ZC4A 5DSZA 2GRUA 3PWSA 1EGMB 2Q5OA 4K6FA 3U26A 3TSAA 3JQPA 4FGWA 4YJFB 3EN0A 1WL8A 1YQDA 3FAKA 3PUZA 5GVSA 2HT1A 4K6MA 4PQRA 1WUKS 5JYCA 1QTIA 4JP3A 1G18A 3A27A 3VVLA 1Q0RA 3L6BA 1ZN2A 4NYJR 5T4FA 3ET5A 4I1UA 1JGTA 1VMIA 1OQAA 3REQB 2HZ7A 4Q3OA 4DNPA 5FPKA 3PRJA 2EFHB 3QMMA 4TS1A 1HL7A 4LZOA 1SOMA 4DDUA 1W0JD 2HADA 2IYEA 1XYVA 1C14A 5DNVA 3AP1A 3DE0X 5TDHA 3TD2A 1UDWA 2AFIE 5DNDA 3CF6R 4LKRA 3AKYA 3B7PA 5AOVA 2H2IA 3FGZA 4NXMB 3H0CA 1COWA 2GKOA 3NHYA 1UEXC 3C7CB 1FTNA 1YHNA 2BN4A 2JBAB 3IPXA 1KYZA 2YW2A 3PDCA 1EFUA 1UMDA 5C2JB 4N0QA 2PNJA 4MRNA 1TB4A 3B85A 2YQZA 4K2HA 1ZI9A 3GR6A 4YIKA 1ONBA 2QPLA 3IPCA 4IJ5A 1M9NA 3HZZA 4GYWA 3VZRA 3MJTA 4JLMA 3RVQA 3DDUA 5C5DA 5K0TA 1I7SB 1AOXA 1SR8A 3W5JA 5EP2A 1SFRA 1T0IA 1T1IA 2PLWA 4DZZA 4HEA6 4OTZA 4ITVA 1R0ZA 4R1UA 4FE4A 1GEEA 2DWPA 2D5BA 4IIFA 5KVQA 3L6DA 4ZFNA 3ZI0A 5I5EA 4K6HA 2WICA 2O2DA 4UHFA 3LLSA 4LJ7A 3UWDA 4C43A 5A5VA 5AVWA 4NCNA 2ZYHA 3NUGA 1TDJA 1YAHA 2ZAMA 4BO5A 5C7IO 1Y5LA 1JYEA 3H9BA 5EIFA 4F56A 3ES9A 4KV7A 4JSRA 2JGEA 1AX9A 3MCUA 4H6XA 1YR7A 1R0CA 1EWVA 5EIWA 1I2ZA 1XEXA 2A58A 3VO8A 5KKCA 1FNDA 2B4QA 4WA8A 5FR2A 4BS9A 1SXJB 1XHLA 1SQSA 4D9CA 3BPSA 4RSHA 5LBUA 1F06A 4H7IA 3K0HA 1U6IA 1USIA 2GCOB 1UFKA 3R5XA 3V34A 1CUDA 1EQ2A 1G9TA 1WPQA 4BVFA 4C5AA 4P34A 1NHGA 1G3MA 1R6TA 2RG1A 1BE8A 4KQKA 1E7RA 1I6MA 4Q1AA 3TQFA 3V1NA 2PH1A 4UBJA 3AQ4A 1GILA 4D7AA 2EWMA 1JFRA 3UAGA 4LQLA 4EGFA 3OIYA 1W5TA 5DXFA 1CV2A 3ZEAA 2OHXA 2QJWA 5J3JA 3QXHA 2ZSIA 4OI4A 3RE1A 1IPHA 1Z7WA 1T0BA 5CAEA 3NCHA 2WWWA 1FMFA 2D4HA 2IE8A 2OHGA 2I2DA 1RBQA 2DBYA 3ZC3A 3NHSA 1PD1A 4CHTA 4PG4A 1IPEA 2NV2B 3KSRA 4FT2A 3RI3A 4AP5A 2WPNA 3PNBA 4I55A 5CLJA 4UTXA 1PJCA 3THWA 2H2GA 3H05A 2YZKA 1QGUA 3TOVA 3UFXA 1TT5B 2GNAA 4AYTA 2AW3A 4OUDB 1KEKA 2H63A 2R7LA 4LZLA 6AT1A 1JEDA 1FUUA 2GQ0A 2DPHA 1N75A 2GARA 2GSDA 5BVHA 3G2PA 3BIJA 1BXGB 2VDUE 2XGJA 5EP3A 5HQ3B 4ME6A 1P1FA 5CRIA 3WAGA 4H15A 3U4AA 5D3MA 1QFMA 3PJFA 4YV0A 1HSZA 2ZWOA 4U3JB 2CXPA 4MVJE 1PFKA 2PV0A 5AJWA 3UJCA 1WY5A 2CMKA 2WYHA 1W94A 1RIIA 2BI7A 4Y67A 3V97A 2Q6TA 4ERXA 5KYNA 2QUKA 2H1CA 2RHDA 5CDFE 1MEJA 1N3IA 2IDKA 5AO9A 3JQ8B 3Q87B 5ALLA 2M1ZA 4W63A 2O59A 4RMHA 2NYUA 4R0VA 2Q1YA 1KWKA 3LC7O 4Y2XA 4AJPA 5ADWA 3H2IA 1FQOA 3N74A 4HQKA 1NULA 1S7CA 2J31A 1J20A 4NP6A 1XJ5A 3K71B 3EGIA 1O96B 5EG5A 5HM8A 1G7CA 3SSAA 4JJ8A 4RVCA 3LQYA 5K8IA 4FFDA 1U0EA 2GAIA 3NGLA 3IP7A 1XSEA 4WFQA 5BWCA 3EQ6A 4E5DA 1ZMOA 2GJ8A 3B3FA 3RIGA 1TADA 1VB5A 2IU4A 2V54A 3ACCA 1WETA 3QWIA 4COOA 2JCSA 2GH1A 2XUJA 5DMXA 5T41A 1M2OB 3HGTA 2RGNC 4X8LA 2DFLA 4QGFA 1XKQA 1CQJB 2CHQA 1L4MA 3NHRA 2ZQZA 1JEOA 3BXHA 5FL7D 4DT1A 3DBLA 1Y5MA 4TT3A 1NQAO 4WA7A 1XB2A 3BGDA 1RLUA 5AYVA 5DWQA 2CJFA 2I7CA 3GH3A 3L01A 3HA3A 3I1FA 1U8EA 1TJYA 4GLFA 4Y98A 5IUKC 3QU5A 1J90A 1QGDA 4JKIA 4L08A 4O29A 1ZK4A 2XD9A 2BKUA 5FI1B 1TO1E 3LCUA 1U8UA 1SZCA 2O8FA 1JT9A 4J7UA 4DKXA 4YRNA 2REXB 2QGFA 1RXCA 3WLMA 4CXMA 4FN4A 4R8LA 1MG0A 1J5XA 4YJ2F 1WSWA 2G4LA 3DAFA 2OBBA 4S1PA 4BFYA 2WJGA 5K20A 2VK4A 1UINA 2XOEA 3E23A 5GADl 2PNFA 3DMYA 2XE4A 3GLHE 2QIPA 3QU7A 5AM4A 1VIYA 3Q2OA 4CLOB 5FUBA 1GL6A 1PJ2A 1P0QA 1M1NA 3VSEA 1U8TA 1XEWX 4UNNA 3RRNA 2FA9A 3SLRA 3WI7A 3K6SB 2I4LA 1FJGB 3IALA 3SJUA 4L5JA 4I1IA 1P72A 5E4FA 3GEDA 1I9CA 3ZTYA 1T3TA 3T7IA 3LBAA 4EOGA 5CVTA 2GXUA 4DMRA 3NG1A 3CG4A 4WXRA 1ODFA 1XYYA 5FOSA 4J9VA 4CWAA 1E4YA 1KYQA 2AN3A 1VLHA 5F4BA 3OAAD 3B12A 2PKQO 4DCPA 3MIIA 1GTJ1 3MF4A 4OMCA 5EKTA 2NU6A 4ZI3A 4BTVA 4JT9A 1HDGO 1P77A 1PJ4A 1TMOA 2O9JA 1QO0A 1Y9JA 4LJ9A 5F21A 5EJEA 4L3VA 4YIHA 3VC3A 4OM8A 3HVIA 1QHIA 3LI2A 4HFJA 1T6XA 1OFGA 1AZWA 2CSUA 2D0PB 4QLOA 4RZHA 1Z82A 2R7AA 2I2XB 3D4NA 2L69A 4MYDA 4JUBA 3O6VA 2AI2A 1F0NA 2WVAA 3AF1A 2HTEA 1ZD4A 2VTDA 1I7NA 1YBAA 4RFVA 4RHFA 4CMGA 3BJEA 1H23A 1LJLA 3EIXA 4BEBA 1MF7A 4ZOBA 3G9XA 2AZMA 5ALVA 1ZN8A 4ZRNA 1X39A 1A50B 2IYFA 3SD7A 2AYXA 1SCJA 3AFIA 4M9SA 3TVYA 2CJWA 4OY3A 3ND6A 4V3CA 4ED9A 4PXSA 1OA0A 1W1IA 2BM1A 3GDWA 4DDKA 2WWTA 4G85A 4Y1RB 4RTMA 1XAJA 5EIOA 3SQLA 4BP3A 3ORYA 3ZE8A 2FSHA 2V5AA 1X15A 3A9UA 4KIWA 4JP1A 4DLWA 2PX4A 3AILA 1QOQB 1WSDA 3OP4A 3ZGLA 4JHXA 5THXA 5TQVA 3C6ZA 1LGYA 1TQDA 3REGA 5AXCA 3RV3A 3V4VB 4ZI7F 5JCJD 1QIKA 3F6CA 5EHXA 2P30A 3NEJA 4ZKEA 3HYNA 4URHA 1Z38A 3JYHA 5WRFA 4G8BA 5JQWA 1ECJA 4KXLA 5EC8A 2KPOA 1MO3A 1PG2A 2NZWA 2PQ2A 2XYQA 5TVGA 3LE8A 5ERGB 2RKOA 2JIQA 1QOZA 2DCMA 1BQEA 5L45A 4M22A 3R3UA 1NR5A 4UHBA 1O2DA 5TSDA 3ABSB 3TZHA 4Y6PA 4BFCA 2I7TA 4CT0A 2MSWA 2XWPA 1H6AA 1F2UB 1M76A 1MX5A 1U65A 3E05A 1L4UA 4RA9B 4CUZA 3G0GA 1GPBA 5F51A 4PXAA 4IIUA 3OLWA 3P5BA 3D6FA 3MPOA 3KJNA 2VT2A 4F5WA 3CUSA 4RQAA 3A7EA 4PSKA 1RZVA 1UWVA 4MJXA 2PIAA 1JG2A 4DUGD 2IIQA 1FFBA 2I6UA 1UPBA 3T5GA 4L16A 1O5OA 1PDWA 4UU0A 1MDBA 3O91A 1T6ZA 1WP9A 2ADOA 1FK8A 2OEPA 5TQ2A 4DNFA 4CMJA 2IA5A 2JIOA 4GKKB 3LG2A 5HA5A 1NMQA 2Q6OA 5BRNA 8LDHA 2FUNB 1CUBA 4W9MC 1D2MA 3AJRA 5LP6F 4OHOA 3NIBA 2FUG1 1G16A 3KJEA 2RK3A 4KDEA 1CETA 5CM2Z 1D1TA 3G1TA 2ZWPA 2IHYA 3GDHA 3Q3VA 4HNAB 5TARA 2XCQA 4YAKA 4M4SA 3QW4B 4DPKA 3WADA 3WB0A 1FFCA 2BI4A 2K2WA 5DNCA 2JJYA 6GPBA 4BV3A 1HETA 4PLGA 2ZI3A 1SPXA 3E2PA 4D98A 5FPSA 1AKEA 4TTJA 3O8CA 4Y9RA 1I1OA 3QE3A 1ZVVA 1OX4B 1K8QA 4ZICA 4QGBA 1NPTO 4X5OA 3K8YA 3V32A 1G6Q1 5JSFA 2R751 1ZYUA 3OUUA 3PHIA 4GZ6A 1KK3A 4GUDA 4QUIA 4TMZA 1QK5A 4BEJA 1T5DX 4OQXA 4XFKA 3ZHSA 3FYCA 1O6CA 3IJRA 4AY5A 2J5XA 1W0CA 2Q4EA 4BUZA 3E9QA 5K0FA 1US8A 3QNUA 5BT8A 1UKZA 2D74A 2ZB3A 3L7JA 5JFGA 3U40A 1PW7A 4MMYB 4JV5B 2C31A 3ZGVA 2XRFA 3AR7A 2GN2A 2QTHA 3M1IA 4IMIB 4OSOA 4Y9SA 1P0PA 1GRRA 3C3MA 3UMGA 2RHOA 4Q9AA 1ZAKA 2GN8A 1XRSB 2D2FA 2YXNA 4XWGA 3C97A 1M6WA 4LYAA 2D1SA 4ROTA 4OJYA 2ZZKA 3D6HA 4C1NA 5DLQC 4BB9A 1U0BB 3UHPA 1GKUB 2Q1WA 1THZA 5A9SB 1QG0A 1SCBA 3ZKWA 2F62A 4LXYA 2AS0A 1DFIA 4QDKA 3UJDA 1REQB 4XSHA 1Q7TA 2DKOA 1XYGA 2P2YA 3EXHB 4GMXA 3F3MA 4JU8A 5JI2E 4G0XA 3HXQA 1FUKA 3QI7A 4TKLA 1A97A 1S02A 2CB9A 2Z4RA 2IEIA 2PZJA 5I9NA 2QVZX 1XTQA 4MKRA 1V11A 2KYRA 3OFVA 3OTHA 4FMPA 1RD4A 2CLLB 1TCBA 5LBIA 4GVPA 4YT2A 2C5LA 2CV0A 1OJ7A 3KQVA 3R3SA 2CMDA 3BTSA 1NXPA 3I45A 1E6KA 4YP1A 3ZV5A 3IUMA 3CF2A 1JJIA 4BMYA 4BMOB 2Q1UA 4MW2A 3QX8A 1Z7GA 1NVXQ 2JJMA 2R79A 5CJ2A 2II6A 5CYOA 4JD5A 4M89A 2I91A 5JMOA 3U7IA 1JE1A 5JZBA 5DX0A 3HO1A 3NT4A 5JAOA 5KX5A 1JIIA 3TW6A 4F86A 3ROFA 1IG3A 2X15A 1E77A 2WJ3A 4LQDA 2AZDA 2ROQA 3OE5A 2HHAA 5KWVA 1B2LA 1C0EA 3QEAZ 4GDMA 3PF8A 3WMRA 2VK1A 1B43A 1RI5A 2GGSA 1BMTA 1PYGA 3BTOA 3CR3C 4LZAA 2RHCA 4P7GA 4XVCA 5FTLA 3P9KA 2CDRA 5ITZA 4M46A 1PK8A 1N77A 5ALIA 4LX8A 1XELA 3FAZA 1M6EX 1R4NB 2EW2A 3FPCA 1L7NA 5EJIA 4WX2B 5BMVB 2CJYA 4Z0PA 4FWBA 4FYKA 3LYAA 3K20A 2QRVB 4QUKA 1QYCA 1CTQA 4NZMA 4D9EA 1V16B 2BDTA 2PGJA 5AJHA 3R5TA 1NLMA 1Z34A 4MS3B 4EG1A 1ND6A 1L1EA 1T24A 1USKA 2FLKA 3HKDB 3LSTA 4MIEA 3ZHRA 5BQ3A 2HREA 4PIPA 1U3UA 2O50A 4U8GA 1HYBA 4LY3A 1T5OA 2ZB4A 2NXWA 5LZ7A 5KYYB 2NSLA 2MINB 3TCNA 4OQEA 3EFEA 1BE6A 5AQEA 4CIXA 4YHBA 4YJ3F 5JSZA 2EG5A 5HF5A 2Y0CA 5CX1A 4LRSB 4B3XA 3AWDA 2HK6A 4H2DA 4EVSA 2HWKA 3ZPXA 1NWHA 5DEIA 1C0KA 4M9XA 3BRWA 4AZVA 2O20A 3SCZA 2RIRA 2XAAA 5JC8A 3AVXA 3RAFC 2C3OA 5EIHA 4IQ4A 3T7KA 3OJWA 3ZI4A 5BVGB 3QKRB 1X1BA 2C84A 3AH8A 4IGEA 4P53A 4V0LA 3ZWXA 3B1WA 4MQBA 4PZAA 3EVEA 3BWMA 1R0RE 2CGEA 4MK4A 4HZUA 2F17A 2CDCA 1Z5NA 3HWX1 5BMVF 4KDCA 3W3AH 4D81A 3U4QA 1P18A 2XXJA 2ZJ4A 4CUKA 4EB0A 2QV0A 2C99A 3BD8A 5L3ZA 5HZMA 2C0QA 2QR2A 3DFIA 3H87A 2L0XA 4DAOA 2BKXA 5LZ9A 2PYDA 2C8KA 4UNQA 2QMUA 3SX0A 2W6PA 3ZDZB 4ENTA 2GK6A 2VSOA 3IAEA 3PC6A 3W0LB 2RBEA 2REQA 4KBFA 3I4FA 1CUCA 2RHBA 4AY2A 3GCDA 4Q1DA 4MUIA 1X1RA 2ASEA 2JH9A 1W44A 2XB9A 4ZQIA 1XEFA 3QK7A 2R62A 1VPDA 5FAKA 3ZQ4A 4Q05A 1RBMA 2W2MA 2OO5C 5GONB 3E7WA 2J9FA 5A4JA 3K0CA 3SM9A 4Y2UA 1Q19A 1OWPA 4DTCA 1PLLA 4YHHB 5D85A 3CZ9A 2R5NA 4DG9A 2HDOA 2FFQA 2VYFA 3E9MA 4HAUA 3V7UA 2W6MA 4NG5A 5KOJB 2X1HA 3QVKA 1HDZA 1TTQB 4G25A 4DNOA 1UJ5A 4LRUA 2HX1A 5IASA 1P80A 5DEOA 3P9PA 2QPTA 4Z9AA 3SEQA 3WXBA 2EHJA 3R6WA 3EZLA 3Q85A 4JVOA 3SXUA 5TIIA 2QD4A 2HXGA 1DX6A 2CHFA 4XJTA 5K3FB 3WK4A 4E11A 1JA1A 4XIIA 1SHZA 4QKQA 3EVFA 4GP7A 1MXFA 1KGSA 1RIFA 1TF5A 4NNPA 3CMMA 3P7MA 3ZWDA 1VRVA 2GCEA 3GW8A 2AI1A 2GM4A 4IDGA 4MRAA 1ZSYA 1DIHA 4S04A 5G41A 4NFHA 2W9XA 4N7BA 3HBJA 3N2GA 5GONF 3K4PA 3L43A 2P6RA 3L93A 3D43A 3SHTA 1ZGJA 4O1HA 1RLMA 2PXXA 4IFEA 1WB4A 1A95A 2YNMA 5CIQA 1TJNA 1E0AA 2JCXA 5DB4A 4WJLA 4V1CB 2VPWA 4OB6A 5BSTA 1VMEA 3P4YA 3KALA 3QXGA 3GEHA 4RACA 4W1SA 3QQPA 4UMEA 2GYVA 2QDXA 221PA 3F3KA 3FVVA 3LVRE 4PGFA 4BPRA 1PUXA 2JDID 5DCLA 1S01A 4XQEA 5AW8A 3V1UA 4D3DA 2Z2ZA 3DFZA 3RYCA 2JI6A 3DTYA 3CH5A 1YD7A 3KP1A 3GGGA 3NR2A 2F1IA 1QPGA 4PV7A 4BGEA 5KYGA 1EUCA 4MTLA 3L1UA 1Q1GA 1SNYA 3PC7A 1XZHA 3PUHA 1UANA 1DEOA 4KO4S 5AW9A 1J70A 3BXXA 1F3OA 2JS7A 1QIJA 1HL3A 5K09A 1EAMA 1WCWA 4N1AA 2WUFA 2VJOA 1ZR4A 3JQGB 4JXJA 2YY7A 1MTZA 5KJ6A 1COWD 1B0ZA 1CVRA 2PIDA 4UAJA 2ZDGA 4IIVA 1H3FA 2PGNA 1YBHA 3C7TA 1ZUHA 2GILA 1I2MA 2GD0A 1OD6A 2RGBA 3K9GA 4REQA 1WKVA 4RTRA 4LJYA 4RLHA 5GY7A 1KSFX 5AJZA 1U80A 4CBVA 1U7TA 2QNRA 4GOXA 2F59A 2NQ2C 3UWKA 1YDFA 3HYRA 4PO1A 3R0JA 3FNIA 2IKQA 3SE0A 1IOVA 1JHQA 4LISA 1TZ2A 1VL1A 4MULA 1C2YA 2QTZA 4EENA 1W88B 2CDBA 1EXWA 3A4TA 4M0MA 4D4KA 1PJRA 3PF9A 2CWDA 3GFFA 1N2CA 4I50B 5LIRA 5C53B 4HWPA 2G9RA 3TRHA 1GJRA 1NKVA 3ABRB 3BM5A 1IDOA 3G5MA 4B4DA 4IV0A 2F3TA 5EUCA 5AI5A 3KYDB 4IOLA 3IMEA 4XX1A 3IKMB 5AD1A 3MRXA 2DH6A 3FIJA 4DLYA 4ZK6A 1S8NA 1F3LA 4PG7A 4C14A 3DMNA 3JWEA 2XCOA 4AZ0A 4E6EA 4RKRA 4QFDA 3RAGA 1WPRA 3KLNA 4ROSA 5KOHA 4NENB 1U0FA 2W98A 4UOQA 1KRWA 5BXYA 2AWOA 5CU7A 2I62A 3PGLA 5EXXA 5I7AA 3MTAA 2J3DA 2E6KA 4G65A 4H7HA 4XUGB 1MD9A 1GKLA 2RG7A 4JKOA 3HHPA 4D6YA 3K31A 1R10A 2JI8A 4M8NE 2YVLA 1SRQA 3H5NA 1YJCA 1ZRNA 4DZTA 1X8LA 3R7BA 2UUPA 3ESQA 3MBOA 3D0OA 4OVKA 4PC7A 4EO4A 3TZLA 4A8PA 2PSDA 1SC6A 1XEWY 1HDIA 5C4IA 2XUPA 2IFTA 2VP4A 5JU6A 3OTGA 3HZOA 4RUKA 1KR2A 2B69A 1J1IA 2HNAA 3CRQA 1A2QA 1DXYA 4QULA 2HSEA 5BXQC 4CIYA 3HEAA 1W2HA 3P9ZA 2F43B 3N05A 2YJNA 2ZDQA 4Q4HB 3T34A 1GR0A 2ZRGA 3GGSA 3O2NA 5JASA 3GP5A 1MH9A 1YDHA 2H92A 1QAMA 1RAIA 3GCGA 3RKSA 3U16A 5J4YA 3T3OA 1QRRA 1KQGA 4JOCA 3MJEA 5TF0A 3I39X 4U39A 3AW9A 1DKNA 4BE9A 4KR7A 3ADCA 2ZIXB 4DWOA 4N4AA 3AM5A 1Y3BE 1AHHA 3KSDO 1VOTA 3STXA 4C6TB 4G36A 3L8GA 5BYAA 2D7CA 2JHPA 3AX6A 1QE0A 4XM0A 2IC5A 4PC6A 1V43A 4BN4A 2O0MA 1I6WA 3L82B 5TE9A 1I1NA 4MRMA 2ZTMA 4Q37A 2GKSA 1L5SA 1TAQA 3X2EA 1XZFA 3SEAA 2C4VA 3OIFA 2Q1TA 2YJ6A 4UUOA 2YV5A 3WA7A 3L49A 1JQAA 2VHVA 5B6PA 3VRHA 1U5AA 3EZXA 1T91A 1V6AA 3FKJA 4BY9E 3A4LA 3FFAA 1P17A 2B4RO 1ID1A 3F6SA 3DVLA 3GJZA 3HFJA 4QDJA 4Z9YA 3VR6H 3WHLA 2YZ2A 4LZNA 4RK5A 1G3IA 3BQNB 4UE6A 1R3DA 4C4TA 4E32A 1SOWA 2IU6A 4YRFA 1TO2E 3LDFA 1XDDA 2J07A 4YMGA 3PHBE 4DA6A 2FYTA 4P36A 4QTYA 2PZKA 2R7KA 3QVMA 3WX0A 3HS3A 1NVMB 2AJCA 2ODAA 2IOFK 3EH2A 4LYEA 4I4IA 4J2HA 1R27A 5FYDA 5DM0A 3MSCA 4TVSA 1VE9A 1NMZA 1KAGA 4IRXA 3SZLA 1Z63A 2MIIA 1QG2A 1BWRA 1JHYA 2ERCA 1CVLA 1ATIA 4GOMD 3G68A 4EY4A 3AFGA 4Q1BA 5IYZB 1WS6A 3LUHA 2EDCA 3INTA 4PPFA 3WWEA 1B1AA 2HAEA 4AMVA 2W2PA 1F0PA 3S2YA 4AZ3B 3W5SA 4RMIA 2ZIZA 2UZ1A 3VSAA 4AG5A 1FA9A 3SY8A 1DEXA 4MQFB 4RPCA 4DS3A 4FYPA 3EGXA 1SKQA 2XOXA 2Q2WA 4MUMA 1N6RA 2V45A 4QBHA 4MRPA 4URZR 3VNAA 1ABEA 2MWMA 4WH0A 3EIEA 2Q21A 4OUDA 2IP4A 2JL1A 1L8LA 1N5MA 2AQ8A 3EE6A 3ENVA 4BJ1A 5AQ1A 4DR3B 2H9YA 3H8SA 2AFRA 5BSKA 2WJ4A 5FB3A 1RXEA 3IAXA 3AR5A 2O0LA 1ZGBA 1WJGA 2XMCA 2PD4A 3KOMA 1BXGA 3LPAA 4GPIB 4LMBA 3UV7A 5F2NA 5IM4A 1RXVA 1TUBB 1G4AE 1W4BA 4OPMA 4XLLA 5HEKA 1WXQA 2HD4A 3WJ7A 4CM8A 1T9DA 3HA7A 3ZZTA 4ZZ0A 1T25A 1E9BA 2NQ8A 3HI4A 4RV9A 4P5DA 5I51A 1E5TA 3O92A 3PT5A 5IYZF 3FA2A 4FKMA 2CF6A 4RORA 3GRUA 1NLUA 5AJTA 5I4KA 4MI3A 2PWYA 4GZ3A 1ZO8A 3OCZA 1YBFA 4O8CA 3EPJA 1ISJA 4KP7A 2M6RA 3GWGA 1Q15A 1QIIA 1Y1TA 2BCGY 3F0TA 4OFXA 1T9ZA 2AC4A 3OFKA 4LJKA 3D2AA 4XCVA 1CC1S 4MB2A 1U3DA 1DKRA 2TS1A 3NP7A 4DB4A 1KY4A 1X7DA 4YJ2A 4IS3A 1L1QA 1OA1A 1CF9A 4EJ6A 4BC0A 3LT5A 4Z49A 3V8QA 1UDCA 1Y8QA 4KQXA 5IKPA 4P4UA 4DLXA 4DUZB 4B1FA 1Y1KE 4B3RB 4K3VA 1EGQA 1G8YA 2A3NA 3EXFA 1RDFA 3LWNA 4LQ4A 4ZO9A 3VO9A 1IWPB 4US2R 2I2FA 3SICE 1C0IA 1IN7A 2YY5A 3HCFA 1BW9A 2VZEA 3FSEA 1N6PA 3OF5A 5DTRA 5AUNB 4I19A 2CJXA 1HEIA 5HKKD 3HR7A 4FB4A 2MYNA 3FLEA 2VRCA 3GXBA 1P2GA 3PENA 4P58A 2WU3A 3U1BA 4AKSA 2RKWA 4CKWB 2Q3DA 3DGEC 4FDUA 3I2JA 4J3JA 1WDWB 4X8MA 5AOBA 2ZRCA 3KXIA 1MB2A 3KXDA 1GUAA 1S7GA 5EE1A 3B6EA 2YDXA 4X7MA 5HK8A 4JP8A 2ZYRA 3ZD9A 1V47A 5L3QB 4Z53A 3GUZA 4MGYR 2CLDX 1T5IA 4J1SA 1MAAA 1BNCA 1KF0A 2W2NA 3D6MA 2LTAA 1D2GA 4ZVNA 4I1RA 4YXWD 3EBPA 3HBNA 1A9QA 3K1AA 3O38A 2FFHA 4EHIA 3G5TA 3SZ3A 5DE3A 3A1CA 1BWSA 3WK6A 1B8VA 1YA8A 3FTQA 2CNWA 5LWQA 1MEOA 1JPNA 1VYUA 1AO3A 3F8SA 3DDSA 3LBYA 1QLWA 3MUEA 4HBZA 4QX6A 4QO8A 3TIVA 1DFGA 3OOWA 3U3RA 4YLEA 2GA8A 4ZDWA 1ACJA 4QAQA 4BUJA 4YUVA 3HKCA 2X9NA 4QYMA 3QEMB 4LMRA 3RUIA 3KUKA 3I76A 3GLGB 1HPLA 3D1JA 3L6UA 1EEXB 4MB6A 4J0HA 3UJ6A 1JS1X 3QOYA 2E4WA 4A1FA 3OQPA 5EUQB 2FPPB 4G9EA 3QE4A 1D7AA 3LGSA 1G7RA 1L0BA 1RXYA 2ID9A 1SIWA 3C24A 3HDQA 3K16A 3LZDA 4LZWA 5FP0A 1Y82A 5BV2P 1I51A 5HFAA 2X58A 4DMHA 1R4AA 1R18A 2A86A 2JGJA 4YUYA 3MCVA 1BS1A 4MUYA 2WM8A 2FWJA 1JPVA 1RSZA 2VF8A 3ZGZA 4FGKA 4LC0A 3TDNA 4ZI7A 1P5FA 1AXGA 4IIEA 4BQFA 2H06A 4JJKA 3AVTA 4LY9A 3WRVA 3B1ZA 1H6DA 2YCBA 1NUPA 4U7DA 2F1HA 4F2WA 2UZ3A 1A4XA 2FOLA 3LUPA 1CLUA 5HTKA 5BR7A 1NW5A 4Q9JA 3BBPA 5DX1A 3RDPA 2FZ5A 3KELA 3IPYA 1XTKA 3AM3A 5HS6A 1CFJA 1NYLA 1EM6A 4EPRA 2O05A 1BGVA 3UHJA 3VX4A 3DZBA 1CK4A 4KXYA 1WDTA 1ORHA 3GHYA 1KFJB 5IANA 3NS7A 1ZCFA 2WMOB 2YHBA 3BWXA 4PZDA 2D2XA 5K3DA 2OFOA 3WWCA 4DZRA 4HKTA 1AHIA 3CUVA 4FEAA 3CYFA 4MPTA 4BLTA 3ZUPA 1ZI8A 3OPQA 2BUAA 4F6RB 4M9ZA 4MRRA 4WXYB 1CYDA 3CVWA 2Q0SA 4QO7A 4QPCA 5FLXA 3H9EO 3BOSA 4EEKA 1X3LA 1RM3A 3GJTA 4PSCA 5DOZA 3T0GA 3P2MA 3WIEA 2EIXA 5FLEX 4BLUA 3H0KA 1N2JA 2ZI9A 5LP6A 9ATCA 5E9WA 4MUGA 5K3CA 4BO7A 2Y9MB 2B98A 3QBTA 4KQCA 4LXQA 3EAGA 5KI6A 1HQCA 3WLKX 4YVFA 5AKLA 5AW1A 2BFMA 4P9NA 2DKNA 2ZYTX 1V1RA 1E8NA 5I9TA 3HB1A 4I3GA 3WB2A 2E2WA 2IXTA 3UK0A 2Z58A 2BSQA 1LDMA 5IBRA 3LU1A 1DDIA 3OJOA 2R68A 1KAQA 3DOIA 2B37A 3P1JA 4LPSA 1SHJA 4QJ3A 2AC7A 4WXMA 4R9VA 3F1LA 3DL2A 4NCHA 3ZBUA 3OX2A 2C78A 3RARA 1H0SA 3VAAA 5AVOA 3AGQA 1PEAA 5FR1A 3ZCXA 2ZTHA 2IPLA 4LBYA 3VVBA 1L7OA 1F4LA 1GZHB 1GZUA 3UKOA 2G71A 2NZ2A 2XT6A 2NUTB 4KSBA 4BQEA 3K7EA 4P6VF 1WB5A 4A2PA 2JH8A 3N07A 1OXUA 2BFNA 1RYDA 4ETMA 2X8AA 1ULSA 3QPDA 4ASUA 3M5DA 5EVCA 2J3LA 1L7XA 1NFQA 1IRIA 1PSDA 1T0PA 2UYYA 3AP3A 3GQBA 3HU2A 3IQZA 4PXYA 3X1MA 4EY8A 3I61A 1QGZA 2QZ9A 3KU1A 2ZE6A 1CKEA 3OO1A 4LSMA 1W75A 4M1TA 3AKCA 4X6YA 4ACAA 4DDWA 2H07A 3AVYA 2OYSA 2VYNA 3UMFA 3UPDA 1N0VC 1T43A 1HDYA 4MW5A 2PBLA 4WERA 3T7JA 1ZITA 3OZGA 4N5NA 2HHHB 5LJIA 1F8UA 5F5NA 2BV3A 2DB3A 1R9MA 3UJ9A 5A4KA 4N01A 4RTQA 4OFWA 4P31A 1AD2A 3ZGXA 1ORTA 1DIRA 2PL1A 2VFAA 1WW8A 1DBWA 3CLSC 3NAMA 1G5TA 2D0OB 4FEGA 5ERXA 4D9BA 1SB8A 4C4YA 1FDTA 5SY6A 1HGXA 3WMWA 5D3QA 2VYQA 1WCIB 3BCSA 3FNEA 3AXTA 4HUJA 3DTVB 1IEWA 1PW5A 2HDNB 1F1BA 3CSDA 3DXYA 1KJNA 3FRHA 1BVYF 3KPYA 4A27A 3DVSX 3G9ZA 2Q62A 3ABQB 4NMMA 4A0HA 2XUOA 4WCFC 1SQ0A 2AR9A 4ZTBA 4PQGA 5B1HA 1FQKA 3PEEA 4DMUB 4C4AA 3AU9A 3JV7A 3RYFA 3SBEA 3K0CC 3ZKAA 1FP2A 4ALJA 4D4JA 1VG0B 3AHDA 2XQVA 4NMHA 4R41A 1SC3A 3QP9A 4YMHA 4MLCA 4R4JA 1X2EA 1YRYE 1YZHA 2C5BA 3BRWD 1QSGA 3UHFA 2YWJA 4BO0A 4DLPA 5BNZA 5TMDA 3ZIDA 2OAP1 4MVJP 1FFGA 4A16A 2GVNA 1JTFA 1E6CA 5CEJA 1X92A 5JD6A 4LRXA 5DTMA 1IZYA 1KEPA 4YO7A 3IO3A 3ZDDA 2O2ZA 3DQQA 4LYDA 3E7XA 1VJTA 3CLSD 4Z9BA 2X7HA 1BWQA 4M9UA 1OWNA 2FMIA 4OMFG 4L8WB 3EEBA 4RETA 3TQIA 2V9CA 3OT5A 4ZOCA 4B6QA 1N6KA 2OHIA 2AG6A 4FR2A 3TAXA 5F76A 2HH9A 1GXSB 1EIZA 1ENOA 5IWAB 3ZXXA 3TM4A 4M0KA 5HSGA 4HQ6A 1SXQA 3U3OA 1RPZA 2XPCA 4Z7NB 1G8SA 1PGNA 1LZLA 2RDMA 3DUWA 4FD2A 4YC7A 2FW0A 1V8DA 3GJRA 4TKZA 5ALRA 2X4GA 3L06A 1B3RA 4R2IA 5BN3B 2PGLA 4PZ9A 1XRLA 4YJ3A 1M75A 5CR9A 1BSVA 1IN6A 3R4CA 4HLUC 4YWHA 4YY3B 2O6HA 3OE7A 4X94A 4FYIA 3M9WA 4OAPA 4QBKA 1QFJA 4PFSA 1XFAA 4YFYA 3UQZA 4BBAA 2WHQA 4MV8A 4NR0A 5K0NA 2NIPA 1MJHA 4DLZA 1CR1A 2X6RA 4YAUA 4RV4A 3VJLA 2V6IA 2ORYA 4TKMA 1TCCA 1Z73A 1AKUA 4J76A 1F2VA 1WZ2A 2X0JA 1OFTA 3NFYA 1UJCA 4ZDKA 1ZM2A 2C9DA 2ONZA 3I04A 4WOCA 3VKUA 3N8DA 3PC8A 5BSGA 1CHNA 1E2HA 1EFCA 3GA7A 1X42A 3LXXA 4KCGA 1TQHA 2B8TA 2PMKA 3R7WB 1HNXB 2NUBA 3CGWA 4IR7A 2R6JA 5HKLA 4BWGA 2R60A 3FY4A 4WIAA 3FLAA 1WA5A 3UGKA 1CZUA 1FPMA 1LXCA 3LPCA 3AG5A 3LBNA 2EYUA 4HGPA 4KPFC 1O08A 2C7BA 2MINA 2FN3A 2GZRA 2G07A 2YS6A 3KJZA 4J4TA 1YQUA 2NTVA 3V8NA 2C97A 4FK8A 3PYMA 3C48A 2B5OA 4MARA 3BZBA 5BSHA 4Z8YA 3WLRA 5K8JB 3KTAA 1GU0A 5IFLA 1XD2A 1B26A 3VVMA 2N3ZA 3GELA 4MHTA 1WXGA 3B52X 3BMCA 1KPHA 3WZ2A 4D45A 1XTRA 3LK6A 2FGKA 4WZZA 3UPTA 4TZ0A 1HE1C 4OOEA 2YTZA 5DH9A 3V4ZA 5LLSA 2BFFA 2XDAA 4ZEOA 1ETUA 1O5IA 2X77A 1V1MB 4BFZA 2JAPA 5IAKA 1UP4A 2W2QA 1JTEA 2GZSA 1EDEA 4ITRC 2ZDHA 3DEIA 2H7CA 1ZH2A 1QMPA 1TOAA 1UQRA 3AEZA 4Q4JB 1QU3A 4HAVA 3VR5H 2GEDA 2W0SA 3BREA 4GR5A 2XDQB 1OHHA 3QOXA 2JGKA 2YHIB 3AQIA 4X1IA 5EQJB 1FFWA 3WL5A 4D96A 2UYHA 3EUWA 3GARA 3Q7EA 4FJ2A 3ZDEA 4I99A 2Z30A 3F96A 1O0SA 1M33A 1W6RA 2WSMA 3NALA 4DV2B 3T3NA 2HGSA 2BZ1A 4D4MA 2OG2A 3COPA 3KS9A 4PVDA 2BP7B 2WUGA 4WJKB 5A7GA 1J8FA 2QUBA 1N0IA 4Q9NA 3DBVO 3RS0A 1QH8B 5F78A 1RAAA 3JQ9C 1XQVA 4OBWA 1SBNE 3N2EA 4LK2A 2JW5A 4PZUA 4D9GA 4LCBA 1GL3A 4ND3A 2IYNA 4LA4A 5TC4A 3I9LA 5AVZA 4BNGA 2P6PA 1HZJA 2XAUA 3MTEA 3PIRA 3ZXSA 2JFZA 5HIIA 4RJLA 1TTTA 3C8ZA 1OFVA 1GADO 1K7XB 4RZSA 1J42A 3KAKA 3VU9A 1DIAA 3CUWA 1PQWA 3WSWA 1FSZA 4RH0A 1MOQA 3NXSA 4R01A 4Z1OA 4JDUA 4UBMA 5CM9C 2Q9CA 2XNJA 4P7JA 1WHTA 4EA8A 3MA0A 2CXQA 4RIFA 3QOWA 2IYRA 2RHJA 3FPSA 3VISA 621PA 3DXFA 2BFPA 4B33A 2YBDA 1IXKA 1T9BA 3E2IA 3QIVA 4KWHA 1ILEA 2WV9A 4U0KA 4YAIA 3RLIA 3O9MA 3WAJA 3TVTA 2KQUA 2SCUA 3GDOA 4TLBA 2AOUA 3HUUA 3HCAA 5ENZA 2RGRA 3FNFA 3D9QX 1FFEA 1QDLB 1T2DA 3C6BA 4RKFA 3F47A 3GOHA 3ISVA 4MWEA 1VMAA 4PFQA 2IW1A 2RHLA 3EVGA 4M1MA 2OWEA 5FBQB 3WGTA 4BLSA 1JU4A 1OYVA 3BXEA 3LA8A 3DWGA 5I9BA 4RJ2A 1UC5B 3JQRA 1K5GA 3DNPA 3ETDA 4HNRA 2G1JA 1AQIA 3PIIA 3AEUB 1JAIA 3VHRA 3AVPA 1HF3A 1EE2A 1F1JA 2PKCA 3GO4A 1QGYA 4CM4A 2I7XA 4MW1A 1LWOA 1SHUX 1K3TA 3AI2A 4PZ0A 4U2CA 3SZRA 3ECAA 3W8RA 1OLUA 1P7YA 2CUZA 2W5UA 1L2TA 1JSRA 1YULA 1GHTA 3KQSA 5YASA 3H9GA 3CZ4A 2LNDA 2WUWE 1I3KA 1G8PA 1Z68A 4WY5A 2VHJA 1I4WA 2WF8A 2Q8PA 4GPTA 3Q7RA 4BVHA 4F3NA 1MRSA 2AJLI 4K9NA 4AD8A 1SXJC 2IEYA 1J1ZA 1DHTA 1XAIA 1YZNA 4ZALA 1QVZA 4GS5A 1YZFA 1VE7A 4HYEA 3EGDA 5IVKA 5J58A 3C3CA 2Q5CA 3ZBQA 2PPVA 4BZPA 2O1XA 1K75A 4PAWA 3ROKA 1JEQA 5DSTA 4TL6A 1ZC3A 2LW7A 3F6EX 4LRQA 1OE0A 1V3VA 4MV4A 1QQAA 1Z88A 2ZBVA 4YCSA 3VYUB 5K05A 1M8FA 2NUPA 3OVMA 2HUPA 2XVAA 2AMYA 3E5NA 2IDJA 2RH4A 4L0DA 2ONJA 1B14A 3DMHA 4ZTUB 3BSFA 2AUMA 4OH7A 4F1KA 4ABTA 1W8DA 3CS3A 3ROQA 2ISCA 2G88A 2JKZA 5IVPA 1YRBA 3WYDA 1Q0LA 3SVZA 4D0SA 3RS5A 4QQ8A 3KDAA 3SHVA 3MSXA 3TEFA 4UD6A 3VMFA 1EFVA 5JATA 2V4ZA 1K7YA 1ZMXA 4PLYA 3QX3A 4GNKA 1BA3A 1QGOA 2C5SA 1ISRA 2QXYA 2FSIA 2RJNA 3DCJA 3UKJA 1EG7A 3KIPA 4E5YA 3AFNA 3NRJA 1ICIA 3P9XA 4N49A 3RHTA 2I7DA 1U2SA 1O7JA 1NRXA 1FP4A 2XDYA 4IHJB 1SXJD 5CJPA 1MGPA 1NQOA 1I4OA 1CR6A 1NSTA 3KL4A 5HRUA 2HO5A 4MP6A 2YYZA 4TSFD 1WMFA 3TM5A 3U81A 2IPMA 3GOQA 1JMKC 4E21A 1CJTC 2N9UA 2V55B 4I81A 1SBIA 4HAYA 1QIDA 3HY3A 3CBQA 2FP3A 3TTWA 3UIEA 3ZS8A 4GFDA 1M1UA 1AKNA 2A84A 2O3QA 3KAJA 3N2KA 1R4ZA 3BA1A 4WNYA 1EDOA 1DXQA 2DPXA 3QPBA 4LDQA 4GLOA 3QF7A 1K68A 3KEFA 1AUOA 2XKKA 1DPGA 2PEZA 3CZAA 5JAPA 4BRZA 2MT9A 2ZUFA 3CF0A 3KZNA 2DR2A 1BH2A 4XD2A 1HE3A 5LLDA 4YRPA 1KZ1A 5E2IA 3JYNA 2YOGA 2ZRJA 3A1SA 2VHCA 1EGAA 3GT0A 4LGVA 5TX7A 1L5RA 4YPOA 5E7QA 4GOLD 4EKNB 2P9EA 4ARUA 1TA0A 3VU3A 4GSYA 4IHJF 1H2AS 2AEJA 2W6NA 2X2EA 4GI2A 3DHNA 3HB5X 4ESOA 3CJQA 5AW3A 4NFSA 1PWZA 1DO8A 2WTEA 4R9SA 3UZUA 5JEDA 3RFVA 2QN6A 2ZB2A 3JQAB 1ORVA 1QFZA 2HA0A 2WWFA 4Y2JA 2CHUA 3QU4A 1XJ0A 1CFZA 2X0FA 1ZLYA 2QXUA 3HYLA 1Z2PX 5GAJA 3ELDA 3FM9A 1E3SA 4Q3AA 5DCWA 2BE9A 3V9PA 3HCWA 4WN9B 3PQCA 1JG6A 4NAHA 1YDEA 2OCBA 2AEMA 1BS2A 4W8HA 4AMYA 3ZWKA 3CX3A 3WRXC 1AN9A 4MI6A 2O8CB 1RYYA 2R4UA 4QVIA 4C2TA 1FTQA 1KYVA 2Y6VA 4ZP1A 2XNHA 2RH9B 2Z98A 3HYTA 2YASA 3AVVA 2GD6A 4QVGA 4DSUA 2XA2A 4CKEA 2R6GA 4ACBA 4B75A 4D0NA 1V7ZA 1TTPB 4HB0A 5FD8A 2OD2A 4XRGA 2WDZA 3KPWA 3C15C 1U0NA 3GV0A 1ZJWA 5MFPA 1CUHA 4FSDA 4MS1B 3GFOA 3R9IA 4A8JB 1FBNA 1Z2CA 1TRHA 4MQEB 4MLPA 5CPBA 3WHIA 4XXHA 2ZE5A 4HVAA 2PTHA 3U3JA 5JCXA 5LM3A 2Z3VA 4JZKA 2XKBA 4UNSA 1PX2A 1GTMA 5IMBA 2V6GA 1PJLA 3DS8A 2V0NA 1DPFA 2IV7A 3VGPA 2GVDC 5AW5A 5E6UA 3WYAA 2VRCD 4AN4A 3FGNA 4NF2A 1QRTA 1Q6ZA 4QSHA 1ISIA 1H6CA 2EL7A 1W6UA 4HS9A 5DJ5A 1A72A 5EE5B 2WSLA 2VJKA 5E1MA 3OEED 1YDMA 1QVAA 4V02A 1CUWA 5HIAA 2M6KA 1EE1A 2B3TA 4MWSA 2HR1A 5L7WA 3INYA 4JEIA 2ZJ0A 2LVBA 2OC4A 4MHSA 4WK2B 5TXGA 3IIJA 4QUGA 3RANA 4UOZA 1TEXA 1H2ZA 1Z6TA 2ZFUA 4GGPA 1ZOIA 4URYR 3WFIA 3ILVA 2FXIA 1X7ZB 2Q4TA 1E60A 3PICA 5FEMA 4CL8A 1MO6A 1NXTA 2G28A 4UUQA 2YWDA 2CNWD 2QTBA 2RSLA 5EKXA 1A2OA 4EI8A 1PQUA 1CQXA 2NT3A 3FPKA 2KHZA 4WZAE 3H04A 1RM5A 5DTJA 2LGJA 3OU2A 1N9ZA 5KNLA 4RELA 4KQEA 3RRJA 1P7PA 1W4LA 2V4MA 1EJ0A 3RVPA 5AKGA 1I2CA 2QPAA 3OJ0A 2IU0A 3SF8B 1M6VB 1MJNA 2ZYVX 3QUBA 3WB9A 3K0SA 2XB2A 2A9PA 1TU3A 2C54A 1QF6A 1RQNA 5HDQA 3EGVA 2CWWA 1XAHA 2EAUA 2ONYA 4CTOA 4ETIA 3VH3A 2O23A 1IHYA 1LI7A 5AKHA 1TECE 2P68A 2ZAIA 2IUSA 5LQRA 1Q6YA 1EWKA 4V3BA 2VDPB 2NUAA 1GNLA 1DC6A 2D3WA 5LP6C 4EA7A 3FI9A 2AKEA 3LUDA 4D9JA 3RVJA 2HF7A 5LWHA 1H2BA 3H2KA 2QLTA 1KDVA 4CMIB 1OXTA 1TA9A 4BCCA 1K7FB 1ZM7A 3GLSA 1EHYA 2FWIA 2HCJB 1JSCA 4BN0A 4EGQA 5IK2D 4DV6B 3KXKA 3U7QA 1SVMA 2VQFB 3A10A 2BDUA 2H00A 3KSMA 3HY4A 1FRVA 4ND1A 4D2IA 3WIBA 2WHPB 4NDAA 4R3NA 3HV2A 2OM2A 5A71A 3VR4A 3PJEA 3CKYA 1Z6XA 4GQIA 4H7DA 4O2BA 4ZVSA 3IEVA 4DNQA 4Q6WA 3NTQA 1H69A 1JQKA 1ARZA 3MB5A 3OZSA 4HX9A 1Y7IA 4M49A 2AXEA 4OJMX 3WZLA 3LUKA 2OENG 1PI3A 1NR1A 2OBNA 3BH7A 1MO4A 2A9RA 3VAYA 1SOUA 4O4IF 1F6BA 4MYSA 4P80A 3CB2A 4R71A 5C8ZA 3QX7A 3Q7SA 3AFOA 3OLZA 1VSQA 2DPYA 2Y71A 1TK9A 3EGOA 2Z3ZA 3MWDB 2FVYA 3U7JA 4EGSA 2V8OA 1VG8A 3Q8MA 1N8KA 3DZCA 5JS8A 4PNPA 4TMVA 1LD3A 1HWYA 4K9SA 1CY2A 2ZUCA 2IWRA 1AA6A 2Q99A 3NP9A 3PPYA 3CZRA 4LGYA 4CF3A 4AJKA 1KMNA 4UDOA 3OD1A 5AVYA 121PA