3HY4A

Structure of human mthfs with n5-iminium phosphate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
195
Chain Sequence
MAAAAVSSAKRSLRGELKQRLRMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
total genus 58
structure length 195
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy4A00
2G40A 1SBQA 1YDMA 2JCBA 3HXTA 1U3FA 3HY3A 1SOUA 3HY6A 3HY4A 1U3GA 1WKCA
chains in the Genus database with same CATH superfamily
3A2KA 3L7YA 3UN1A 4YPOA 1E5LA 3M1AA 2EW1A 4FX2A 3TFOA 1FQWA 3JYHA 3VMMA 4RD0A 2H29A 4GLLA 3K31A 4IDHA 2H1FA 2ZYDA 3LCVB 4KAJA 1I4DD 4KVFA 221PA 2FPRA 2W2LD 1SKAA 2W2OA 2QVGA 3K2BA 4ECAA 3NHUA 2H18A 3UMFA 2CF6A 4PYQA 3ZH2A 4EW2A 1CEYA 4CT4B 3F4BA 2JD1A 1ADBA 2RIRA 4LE0A 1FNBA 4AO7A 4LYAA 1I2CA 1CJCA 5TV2A 4DA4A 2M2IA 2Q1WA 2W2VA 3GT0A 4BVJA 1ZRNA 4I4TB 4X9XA 3VVBA 1BS2A 3ZHSA 3L8FA 2VAPA 2ZYHA 3FCAA 4G8CA 4FJ1A 5ALUA 1L5OA 1Q0SA 4RQAA 5GV8A 1Q74A 4OGGA 4BE9A 3U56A 5K8LA 1GNQA 2Q6KA 1V5EA 2JI7A 3DVAA 2VRWA 3QXSA 4M7OA 4F7WA 4OMUA 2R6AA 1LX7A 3COJA 3N8KA 4Q3LA 3R6DA 3HYNA 4M6WB 2D06A 9GPBA 2Z6QA 1ZO8A 4B7CA 4J90A 2Y1XA 1SOAA 2L19A 2ORYA 2PJDA 1X6VA 2QMZA 3GEEA 5LQJA 3AEZA 3VZCA 3ND5A 2PUDA 3F5FA 4ZHQB 2XITA 4WLOA 3JQ9C 4MHOA 1LNQA 1LK7A 1QBKC 1GG8A 1WZIA 1M66A 2IDMA 4EBFA 4OATA 5GONF 4PC3A 2I55A 3OFKA 1F12A 4RUKA 3EXEA 4ZTBA 4BO9A 4Q9KA 1ZH4A 2PSFA 5DMXA 2QNRA 4Y9SA 4KQIA 1AF4A 1YQWA 4C1NA 4QNRA 1EXVA 1JF8A 1EDOA 1RIFA 1NUTA 3EXHC 4N8EA 5L6LB 2WNSA 1H2BA 1UZLA 3GF4A 1V4VA 4BC0A 1Z5NA 5JJBA 4X66B 4F2PA 3AUKA 2PL9A 2V7PA 5TMEA 3SQDA 3WIVA 5KQPA 1D6SA 1ORDA 4CKCB 3DOEA 5L4LA 4Q1EA 5K5EA 5C52B 4FWBA 2WPDA 2DVMA 3E4CA 3ESRA 4CM7A 5IF3A 1TLFA 4QUDA 1ZIPA 2RC5A 3GNTA 3B1XA 2XNDD 5FL3A 3RJMA 3SM3A 3QEMB 3VA7A 4B47A 2RGBA 1NM5C 4DV7B 1YDGA 1KY5A 2OHGA 1U04A 3HKCB 3O9ZA 3ZCUA 3NHPA 3DMRA 4RACA 1SUIA 1IZ0A 1T3LA 5ALVA 3LUPA 2XQFA 3COPA 3C8ZA 2O0MA 4F2GA 4ZEVA 1RYFA 5DN6D 5KX5A 2QBYA 1T2FA 2Z6AA 4O8ZA 2R44A 1Q16A 4RWEA 1JDJA 1JS1X 5BSMA 2ZB4A 1IPHA 4NY1A 3D3NA 4EJSC 5A06A 5TLSA 4V2UA 1DCFA 3N86A 1Y1QA 2CVZA 2GX6A 2M1ZA 4LK3A 2ZLBA 2BBOA 1PR4A 3SJAA 3KHKA 4C2BA 1DDGA 1CQJB 3Q1LA 2A5JA 1WSBA 2K6GA 3FKSD 4RLHA 3FPAA 3HV0A 5FWXB 5DSXA 3H1GA 1ISFA 1PZGA 5K8UA 1OLSA 2ZYAA 2C9ZA 4GMDA 1NXPA 3QTTA 4IDGA 4TXHA 4KR6A 1E1MA 3NC4A 4Q3NA 4D79A 1LLCA 1NVTA 4S12A 2CT8A 3BERA 4NK5A 1Z2OX 5FX2A 2Z2YA 3TLJA 1YD7A 3NHBA 3QGMA 4FLFA 4RIHA 3LA6A 2A3NA 1DO2A 2IQ5A 4FCTA 4AO8A 4IWNA 2JHCA 5IBRA 1YDEA 2DAPA 5ECWA 1V9CA 1AVTA 1KSHA 2F8LA 3K35A 1E1QD 1XZQA 3NTQA 3PUIA 4DNXA 4W9NA 1PO7A 4F4FA 3GJQA 5B6IA 3TYXA 3AY7A 1V5FA 2VCHA 4LSWA 4NIMA 1OX5A 2CLOB 3LC2O 1AY0A 1E1CB 1KZ9A 4ESEA 1SQGA 1C7IA 2ARKA 3RVBA 1TKBA 4YMLA 3B52X 3L82B 5CVDA 4B32A 4TKVB 1LJLA 1DQNA 1R0RE 1PR5A 2PPLA 3BSFA 4CLEA 1E79A 1DJNA 1F2DA 2YCBA 3U7IA 4MHTA 3AKZA 3IBFA 2O5RA 2E55A 2QM3A 2YJ4A 3CTMA 3EC2A 1QJ4A 2BEJA 2ZTHA 1JLLA 4G9BA 2Q5EA 2RBEA 3CEAA 2FV8A 3I61A 1Y7IA 1JPJA 3BRWA 1U1IA 5HQTA 4XGNA 1TQ8A 2G6TA 3M70A 3QUBA 3V8PA 1UZMA 2P2SA 4I6GA 2PLRA 1GAWA 2ZM6B 3KBBA 1YR2A 2G1JA 2C3OA 2PJUA 2DPGA 3ZKWB 2NU7A 3MFYA 4JUIA 5I8PA 5LZ4A 3BULA 4WIAA 4G0PA 1WHSB 3MQFA 2PL3A 3PUKA 3W6UA 3OMWA 4R71A 5B1EA 1JXMA 2O3RA 3GJSA 3JQEA 4V03A 4YIHA 4QAQA 3NH6A 4TRJA 1T2DA 5FWYB 2PBZA 1PNRA 3P0IA 1E9DA 3UTDA 1HNXB 1RM3A 2C1EA 4L5JA 4ZI3A 4IGAA 1U3CA 4BBZA 4RX1A 3K1TA 2J9FB 3TTSA 2BFEA 4YN3A 1T1RA 3TE6A 5B36A 5AHKA 1K7CA 1ZN8A 2E2WA 2XWQA 5K3OA 2VUHB 3DTVB 3C45A 3K8QA 5EZYA 1EVQA 4DOMA 2QORA 2RHTA 1CUBA 2PSHA 1XD2A 2PKYX 4MVJI 5KB3A 1FJXA 3KOZA 2YOGA 3CE6A 2F00A 2WZBA 2ZDHA 2VCYA 3R2JA 4U5QA 4WOJA 3UFBA 3RROA 1YC5A 2GPJA 2HA6A 3IPYA 3TM5A 2C4TA 2VUIB 4BZXA 3NHFA 3ZGYA 1QK4A 2OK7A 1H2XA 3EFEA 1ZIOA 2PS3A 2CEAA 4BNJA 1IEQA 4WKOA 5JRDS 4LKOA 2D7JA 2P30A 4DBLE 1A8SA 2BCJQ 3FTDA 3BA6A 2H0RA 1KSGA 3GLIA 4GUAA 3G1WA 1OXVA 1NXVA 4P31A 1A4XA 4MP3A 3KELA 2ZDQA 4BQOA 1BRMA 1RXYA 2ZBFA 3QYJA 3ZVLA 3DUFB 4LJKA 3SLGA 3IIIA 3SYTA 3A6EA 1Y42X 5A9RA 5A3QA 1I6WA 4LQCA 1N4DA 4MP6A 2JAWA 4J94A 2QROA 4IIJB 4X8MA 5EL0A 3CEMA 1XTZA 2F59A 3U4QB 4PO9A 4CIXA 5ITVA 1PYDA 2VNKA 3PWZA 5AMXA 3ZDFA 2C5HA 1CFZA 1M1NB 1T9BA 5DBFA 1KK0A 2YC4C 3ITDA 4QGFA 1U7HA 3OZCA 1ZM9A 5CNIA 5A9TA 3VX4A 2AUTA 5AM3A 3HGTA 4Y1EA 1AQNA 2PZFA 1A4RA 1Q1ZA 3FCCA 4CTMA 2CDRA 1CR6A 3FZGA 4CL3A 1VHWA 1G66A 4RESA 1RC1A 1THZA 2HYDA 3W6ZA 1A27A 1DAGA 5HDQA 4O4LF 4YDRA 2W42A 3FRHA 3M5CA 4KGDA 4N03A 2GWRA 5ENDA 4OYRA 2HTEA 2WAAA 4OUDA 2VK1A 3VSBA 1COZA 2FR0A 3RUPA 5IVPA 5LPNA 1ZRHA 4AUEA 2SCUB 1XOIA 5H02A 4MVXA 3VC2A 2IDJA 4BBAA 1XRJA 3JW8A 3H0CA 4XD7D 2P69A 5EXXA 2JH3A 4TTSA 3T7SA 4EB6B 5HA5A 1E3SA 5JADA 5LQNA 1ZXBA 4MUIA 4LDAA 1Z36A 3K9WA 1B26A 1LRJA 1USVA 3DBLB 5H3LA 2H0AA 2XUAA 1V6AA 4PHHA 1CC1S 5JS6A 4R7TA 1IN7A 2GVNA 2QVXX 4BEVA 4YV1A 2BSXA 2QW0X 1K7YA 1RQXA 3ASVA 1L4UA 4JLJA 4O3FA 4WJKB 5I9BA 3TQCA 1BVRA 3UJNA 1CY2A 2WHXA 1JTFA 4JKYA 4L9SA 4V0ME 3K2QA 1FW8A 1CUYA 5ALDA 3RK4A 2H1LA 2AMVA 3OZTA 1C8VB 4DCPA 2VTEA 4XX1A 4KX5A 3NYQA 2XNJA 2Z0MA 3FPLA 4DQ0A 3FCUB 5DBGA 1MFPA 2FFHA 2BMJA 5AVXA 3DD5A 1U0OC 4NH0A 1G1AA 3VZRA 5IX8A 4IDEA 2QOEA 4R05A 3NBYC 3FTEA 3WIBA 1HZJA 3EWNA 2V1UA 1B93A 3Q88A 1KU0A 1QQTA 2Z2ZA 1ENZA 1T5LA 2FSGA 3BSSA 4RCVA 3HXMA 2ZUSA 3U4MA 1XFDA 2CB0A 4MVYA 5BN4B 1RWMA 1GTRA 3K8OE 2VATA 1CY0A 1AUXA 4HH0A 5ALNA 4YQFA 1SVIA 1PWEA 4MW6A 3CURA 1MN6A 1JLMA 1EVIA 2OV1A 2RGNC 2WU3A 3A9SA 4MV1A 5F7JA 2WFLA 4B75A 1VPLA 3N75A 1CTQA 4ZYLA 4HQ0A 1AUQA 4JLSA 5E2IA 5JYBA 5JH7F 4KV9A 1I5OA 1G17A 2W22A 3BPSA 4NZNA 1ONBA 2OHJA 7GPBA 3CLRC 4PXSA 4DJJA 1HK7A 3KSUA 1FYVA 3WBFA 3MINB 5ED4A 2ZRNA 1YIAA 1H5NA 2QR2A 3C3YA 5AHWA 3MTAA 4MW2A 1JB9A 4L02A 2P62A 1Z45A 2R6R1 1AUVA 3SX4A 2OSVA 2FFJA 4JD5A 2RH5A 1J90A 2AF3C 3LW8A 2ZRQA 3HY6A 2V58A 3MHPA 4M9QA 1FSZA 1FA9A 3WTCA 1QHFA 3CLVA 3O8OA 3CJQA 3AJRA 1G20A 2DWPA 3N8DA 4H7PA 4HYTA 4XDHA 1X8LA 5JQWA 4UHJA 3BMCB 2C95A 4UAGA 3E5MA 3WNVA 3U80A 1U4NA 2ASVA 3FNQA 3OD5A 3K6KA 4X7MA 3UWKA 5B5SA 2AG1A 3WIDA 3WO0A 1XRRA 1EEXB 1U0LA 2GCGA 2Y99A 3SP1A 3BCUA 1ZOIA 3BIFA 2E4UA 3OIDA 1QP4A 1B3BA 2DFNA 1T9CA 2C3UA 4UDXX 1G8YA 3RJ5A 3D6UA 1Q1EA 3PX7A 4QT4A 5SYMA 3EXAA 1T35A 4NKRA 4FDAA 4K3VA 4N3CA 4YALA 5T67A 3SJ7A 3KZXA 3WA7A 1O0BA 2ZTVA 4QXQA 5IDQA 4PHFA 2FE1A 3D59A 4ONEA 5DJ5A 4DT1B 5KKCA 1GQOA 1DKMA 1J4AA 2J3QA 4WBSA 1E61A 4D43A 3H75A 1U90A 4ESVA 4PYOA 1I3MA 1XPUA 3CPJB 4RZHA 1CQXA 2OBFA 2ZRLA 1F2UA 5FPYA 2ZRIA 2V7BA 5CU7A 1NXOA 2JC3A 1MT0A 3KYDA 4X71A 2H2FA 5EIOA 3W6NA 1T26A 2FZLA 4ANFA 4AVYA 1PTJA 1Z29A 1SN7A 2ERYA 3AP1A 2O54A 1UJNA 1NMZA 5COAA 3OKCA 4ZVUA 1KP2A 3U4AA 4CMEA 1OZGA 4B9AA 3A1CA 1SUSA 4O4JA 1W44A 1L8XA 1BH6A 1FP4B 1QSGA 2C2KA 1ONSA 2W2KA 3LT0A 1SHKA 4P5EA 1QHNA 3TRIA 1F06A 3VR0A 1GKKA 2QUZA 4L27A 1FDIA 3ZE9A 5DTJA 1G6OA 3U4DA 2RHBA 5BWMA 3PX2A 3CU5A 3O74A 4ALKA 3VNVA 1GLGA 2Y76A 1CR2A 1K66A 3PFGA 5HSGA 2FF5A 3CRNA 4N18A 3RR2A 3AF2A 3Q3GE 4QYSA 2WM9B 4R8SA 4P4GA 1H9BA 4LWZA 4YVFA 1NBAA 1BCRA 4HSEA 3WAJA 3UC9A 1Y4SA 3ET4A 5F64A 3EODA 3MBIA 4UM7A 3BMNA 2HIGA 5DN6A 1KJIA 5FOUA 1G98A 2C4VA 1JH8A 1VJ0A 4OOFA 4NBRA 3IPXA 1DAIA 1S9HA 1LWNA 1FJGB 4L0MA 1BMFD 3KBOA 4HDMB 4R6WA 2MYUA 4HXGA 121PA 1Z56C 1QO0A 3LXXA 4NYIR 4YASA 3UJHA 1GVNB 4C14A 4DIDA 4EJ2A 3E9DA 3TRFA 4BJ1A 1G21A 2WQ7A 3B53X 4J2TA 5L3RA 1JQBA 4ND7A 1E2BA 4W8GA 1NZFA 4TMTA 1Q83A 1SBYA 1VRCA 2DQSA 3MGCA 3JQDA 4JC8A 3S99A 5BV1A 3R0VA 1C8LA 1J25A 1WCYA 1CUAA 4RKYA 2E4ZA 2OQ2A 2P6PA 3GA0A 4MPPA 4Y2HA 1OH8A 3AETA 1DBSA 3CMMA 2CK3D 5DNVA 5EXDA 3TIXB 2R84A 3UPDA 2PUJA 3U9LA 5K0SA 2XKKA 3DWFA 2F8SA 4BAZA 4OHYA 1V9SA 1W4AA 2IELA 1XB2A 1Y3FE 5ES3A 4YYZA 2IPOA 4M49A 3MJRA 5IDVA 3GBSA 4D6PA 2VTBA 4R7GA 3N0WA 5GONB 1DP4A 1JVNA 2OG1A 1HYHA 1NW6A 4H3VA 1YR8A 3EVBA 3USCS 5HJ5A 1RC0A 3EPLA 2BZSA 1UJ6A 5E4FA 3GLUA 1XWFA 3RJTA 4Q01A 3SXJA 3TINA 1X13A 2CF5A 3CRMA 3FMVA 4PC2A 4DDVA 1RP1A 3O4IA 3VISA 1KR2A 1DTWA 2RGCA 4XSVA 5HF8A 3TTXA 1XRPA 5J40A 1S01A 1JIUA 3U9TA 4JYMA 1UMBB 3OLXA 1AKYA 3AB3A 3JRNA 4OHXA 1MAWA 3GZNB 2ZW9A 3TAHA 1JPVA 3QE9Y 4DIUA 3S2SA 4NV3A 2ACVA 4TWZA 4ASUD 4OKNA 3GPLA 1Z26A 2HWWA 4U7PB 1C4KA 2NXEA 4PTZA 4CM9A 2I67A 5F5XA 5ITWA 4A3SA 3BIJA 1JE0A 1M2VA 3C70A 3QYPA 3BBLA 2HUNA 3MJTA 1M2GA 5IFKA 4L1KA 1NNUA 4YO8A 3TKLA 2I8AA 2C0QA 3PVCA 5MN6A 3AB7A 3KSAC 4YUXA 3QFTA 4TS3A 5KWEA 1QP0A 2V4MA 4AZ3A 1CNMA 3KLPX 4V38A 3MLBA 3HCWA 4NABA 1TAHA 2H17A 1TW2A 2OD9A 5FLEX 1WETA 3DDZX 4CDNA 2QUIA 1IBSA 2GPTA 1R0CA 4MR9B 2YN0A 4GOLD 2HLNA 2XDQA 3KL4A 1RRFA 1EYZA 1SBIA 3AL2A 4V2IA 1OZAA 4EI2A 3UJDA 4BGVA 4PAOA 2YFYA 3KQOA 3LHDA 1LW6E 4PG5A 2W6IA 3HXPA 2HQRA 3IQFA 4UQOA 1WMAA 3TECE 1T24A 1G64A 2PBFA 3MJ4A 4B76A 2UUBB 2NP6A 4Z9YA 2K2QB 1JDNA 3AHGA 3COYA 3IKLA 4GRAA 1P4SA 2OHXA 4KKXB 4CV1A 1IZ7A 5AKLA 4W5WA 3STTA 3PEUA 1EWRA 2B7BA 4QGBA 2DKOA 1J9GA 3PI7A 5GMOA 1KYWA 1Y0BA 3DKVA 3LDUA 1V3VA 1ECJA 1XDDA 3OQBA 1Z13A 3ZD9A 4DR7B 3IVMA 2QE7A 1DKQA 3P9ZA 3DHWC 3U2QA 1YTUA 2LP4Y 4WNIA 4BB0A 1ZGJA 2BW0A 2GEDA 2GSWA 2BT4A 2HIAA 2RBKA 3A4IA 3MCVA 4BVFA 1FFAA 2C4UA 2P7HA 5BSHA 4FI3C 1AH2A 3AEKB 1Z75A 3FOCA 3VDXA 3ZI4A 4GLJA 4DLVA 2HXSA 2WK1A 1IQ0A 1XA4A 2JLZA 1FDUA 3K6JA 4JBXA 4LXTA 5KYNA 2B9EA 2RARA 3WMFA 5KQLA 1PHRA 2W2NA 3JQAD 3NAQA 5EIFA 3GAAA 3RARA 4RD4A 3UAZA 1YB7A 1EFHA 2GM9A 2GA8A 1E8MA 1E5TA 1VKHA 1G5RA 1KOJA 4WD3A 1BXZA 1VGVA 1KSJA 5EIBC 3RLFA 4C21A 16PKA 4MIEA 1SCBA 4P3PA 3KB2A 1JQJC 3WOHA 3K8YA 4HFRA 5AOBA 2ECQA 3AIKA 3ZHOA 3NHRA 2B7CA 5ETJA 4K6OA 1L2TA 1GYRA 1PP4A 1B8NA 1XROA 2OFXA 1KGDA 1Q6ZA 3IURA 4G3XA 1XRMA 2X0JA 4OHVA 3G2KA 1C3OA 2UVDA 3D7SA 4IDPA 4A6XA 1GZSA 4PSCA 4BX0A 1EFVA 2NXNA 3U3ZA 2FETA 4B43A 5ICEA 4IXWA 3FZNA 3D3KA 4RDCA 5ESRA 1M0EA 4F71A 3H5TA 1IWPB 4KDFA 4FOLA 4R8VA 3C3CA 5E4TA 2QMOA 5HNKA 1J0DA 2QKYA 1EXNA 2OAEA 2NUPA 4FFNA 3TIGA 4QODA 2OB2A 1QIEA 4IPTA 4KV7A 3R9XA 1F2VA 4NU8X 2EFYA 2C3YA 4R2LA 3Q9LA 4F1KA 1NT4A 2XODA 4G36A 4HDKB 1XMVA 3BK1A 3ICEA 3L41A 4UDYX 3TLAA 4MGZR 2BUAA 3PHHA 2CCKA 2JFQA 4KBFA 3R7SA 1QPZA 3IT0A 4KQKA 3U7EB 5LXTA 1VMAA 2BDTA 3TKYA 1N25A 3RS3A 2OKGA 1M0TA 3T5PA 2PXXA 3W2IA 3W8EA 3ZG6A 4EUFA 2WDPA 2XUPA 5JLJA 4DPMA 1XAHA 3W7BA 1W36D 1QCCA 3CSUA 3MIIA 3E9MA 4JUAA 4R31A 3B1WA 5JDIC 3ZX4A 4BO7A 4CCYA 3FG9A 3ONEA 1JZTA 3RVKA 3CJRA 4CG2A 5K4HA 4J0CA 1EJ0A 1RABA 1UC8A 2X9GA 2IHYA 4LJSA 4RTQA 1NI3A 2HJRA 1N2ZA 3KXKA 3NEYA 3NBFA 1NC3A 2GERA 4W8HA 1MB9A 2ID9A 4YLYA 3S8EA 1VPWA 3F9IA 1KH2A 2JG3A 5EJEA 2JA1A 1DAEA 1Q7BA 2IE8A 2PV0A 2XKAA 2YHIB 2PANA 4MS4B 4IFEA 3OHPA 4NBNA 2OECA 2E49A 3OZRA 2ACEA 2D54A 4E70A 2OM6A 3MS2A 5JDIA 5KX5F 2GTPA 1SA0B 4LGYA 1MNAA 5A5GA 1T8SA 3W5VA 1FW6A 4C89A 3CIFA 1D2AA 3KIPA 1MJGM 3GJZA 1NDQA 3SQMA 4BDTA 2J7PD 3INRA 4RS4A 1VECA 4B0PA 3H7IA 1WUIS 2FUKA 1Y4ZA 3HYLA 1NZJA 3BJZA 1LTQA 2ZRBA 5KHOC 5LKRA 4PX5A 4XIFA 1AKNA 3MD9A 2O50A 5DLPA 2DXIA 2Z9BA 4WXRA 5CDFA 4DRXA 4JOCA 1X3SA 2REOA 4AQYB 4WDRA 4I5IA 1QHHB 2UVPB 4JC4A 3I1JA 1GPWB 4G0NA 1NSFA 1POXA 3DKIA 4P0TA 3T9BA 3ZOKA 4MW0A 4AO6A 2ZSBA 3EOAI 1NM5A 2AG6A 2Q7XA 3ZXYA 5JD4A 4D3SA 4X20A 4D9FA 2WU1A 3PX3A 3V4LA 1EZ1A 4HAUA 3AHEA 3QHPA 3G49A 4HAYA 1O96A 1ZVKA 2P1ZA 3OG9A 5BQXA 4PZ9A 3M8KA 1Z62A 5LYJA 1ZUIA 4OAPA 3IAS6 2IUYA 3NUZA 1T43A 3PFCA 2C3PA 4ZVMA 1YR3A 1M8PA 3T99A 4M99A 4KLZA 2C04A 2H48A 1X14A 3B6ZA 3QLTA 1ZI9A 4MRAA 1P4HA 5FJJA 3E18A 2J1LA 1TFUA 3S5JA 4IOJA 4ZQGA 3QY9A 3CEJA 2FMUA 2J6BA 4F4CA 5K3FA 3IODA 3N2GA 3VC1A 1SXJB 4XH9B 4D9BA 3OWOA 5DHRA 1H66A 2NG1A 5FFMA 3P9XA 3UB3A 2F6RA 2IVFA 4CQMA 1ILEA 2WG0A 3U26A 5BR1A 3ILHA 2HLDA 4RM3A 4Q16A 2OHOA 1UBSB 2WU8A 4MGEA 4TLEA 3UCXA 4IBOA 4TTIA 3NBQA 4EUHA 2ZVDA 1L5SA 2B5VA 3TLBA 1QG6A 2QJOA 3P2EA 4CM1A 1TW3A 3ZI0A 3ZNNA 3LPMA 3AEUA 4XM2A 3RFVA 3QELA 3BGSA 5EE9A 5C1DA 1J0EA 1YSCA 2CLDX 3QE0A 5T4BA 3VKVA 2GGSA 2WQ6A 3PXXA 3I64A 1TL7C 1FK8A 3NASA 2AEFA 3A32A 4W9RA 5BRJA 4A03A 5KSWB 1AHHA 1UPCA 5K8JB 1E3WB 2QN8A 1FNMA 5A0VA 3GRAA 4XQCA 4FB4A 2J0UB 4J4BA 3FYUC 4GOKA 1P4JA 3OZAA 2L18A 4ZCIA 1TLLA 4QQ8A 4KR7A 4LFBB 1NPTO 1SKQA 5LWQA 5IRCD 1NYTA 1W85B 4LOJA 1GXSA 2X0RA 3RYHA 3BT7A 5I7HA 4FPXA 2YWHA 1Y9JA 3U7RA 3HBFA 4N5LA 1U2GC 5LKAA 1LDBA 5IJ9B 2QD1A 4QUHA 5F1KA 4E32A 1TD9A 4NBVA 4D99A 5JBQA 3X1XA 5L6MB 3KEQA 4KH1A 1U8EA 2PK3A 5FB3A 3VFDA 3RU3A 4M1KA 4B8WA 2F43A 1E89A 2FMHA 3A04A 3JAKB 4JT4A 2H00A 1JTVA 3LPNA 4L6IA 2UZ3A 4GBJA 4L0QA 4GW3A 4KXWA 4LHYA 1WSDA 1UJBA 2ZUBA 3DP9A 4OXNA 3R7WB 2BVNA 2WAYA 4C0WA 2VDPB 1J0CA 1PR3A 4LJ4A 5AVJA 3T4XA 4AC9A 2PLNA 5K0ZA 1IBLB 1HGXA 2Z04A 4FNMA 4YI5A 4XVRA 2JBWA 3ZLBA 4EB3A 4OQDA 3BWVA 4MINA 3QI7A 2RIPA 3WB0A 2A5GA 3CRQA 2P8SA 4GHWA 1C1DA 1JFVA 2PZGA 5FO0A 1TAQA 1T3GA 1XJQA 4XWYA 1MX3A 4UARA 4X41A 1NAHA 2Q4RA 3Q15C 3R0ZA 3AI1A 3FMIA 1PJBA 1DRKA 5ALKA 1Z5VA 5CIQA 3ZBTA 4D81A 1Z73A 4PRLA 4UMDA 2NADA 3GCXA 3L40A 1ZHFA 2GSDA 2P2CA 3DZBA 3LZDA 1YOBA 3KOYA 2R8XA 2PS0A 1XQ9A 5LVAA 1KJJA 5IMBA 4BQNA 5D2CA 2NO7A 3VAZA 4OQZA 4UPVA 4M0CA 4O1MA 3NTXA 2VK4A 4EW1A 3ICPA 3ZUGA 2DB3A 3P27A 4L51A 5DNEA 4YJKA 1TA9A 2OV8A 2TECE 1R15A 4LVUA 1A8HA 3AM1A 2HDNB 4OX9B 4X3PA 1B76A 2DULA 2GCOA 1PZHA 1TPZA 4E11A 4OCZA 2B2NA 2BFCA 4KDCA 4RGYA 4UFOA 1SPBS 1EFDN 1NG1A 1PBNA 2FW1A 2FSVA 2ZP1A 2O8DA 1JHDA 2R7LA 5DOVA 4FLEA 4L95C 4KR0A 4EKEA 2AZMA 3G0CA 1D8AA 4R81A 1HDCA 5F3RA 4ND8B 3D8UA 2HJGA 3UMSA 1Z33A 5I7FA 1ZS9A 2QN9A 3EZNA 1ID1A 3FAZA 2RJNA 4JB0A 3S2EA 4DLZA 3PK0A 2VHTA 3DAHA 2BMAA 1A96A 2XKBA 1UXOA 1W0JA 3CB4A 5LWHA 1IVNA 1SVSA 3KALA 4J0GA 1WXIA 3TWOA 5JMTA 4JUDX 3PHBE 3FOBA 4MQEA 1BTOA 1DFHA 1NSYA 1NI4B 1TKAA 3DVSX 4QDTA 4U3JA 4WOCA 4D2IA 1Z6AA 4M1YA 1WOMA 3ESYA 3NQ41 2XPCA 3B85A 4L4UA 5D51S 5TSDA 4ZZ1A 1ILWA 3MTJA 2BGKA 1TX4B 3H5OA 4HKTA 4ZVPA 4UU1A 1E7WA 2NSYA 3ZEIA 1JG4A 2C99A 3ZBQA 1ITZA 4WN3A 1QQ6A 2J59A 2VDJA 2E4WA 3BJEA 4Y30A 1XXHB 3P96A 2ZBEA 2CV2A 2F48A 3IUEA 3D5QA 1EGHA 4MR8B 1FFXA 3BX1A 1H8ED 3LF1A 4P7FA 4O2BF 3UWSA 3VH3A 1L4MA 1EESA 1VJCA 2X8WA 3CX7A 3BQ9A 3DAYA 2CFRA 4Y2QA 1VI2A 3BWMA 5C1OA 2OC9A 2YZMA 4CM6A 2QZSA 5TX7A 1JHQA 4PBSA 3WL8A 4NCXA 4DNFA 1EFTA 2YJNA 4TM8A 4IV0A 1BA2A 1G3IA 1I1NA 2OP1A 4MK4A 4WLFA 3DMHA 2J5QA 3DFUA 4XIYA 1Y6QA 1W4BA 3D8SA 4EMSA 4BTLA 3HO1A 3M49A 4HK4A 1C4OA 3DMDA 4MVJF 4LF9B 3AHFA 1RACA 4TTPA 8ABPA 1R74A 3RYCA 3QE3A 4N54A 2AC2A 5E8RA 2PHZA 4J0QA 1A4UA 1BFKA 3VSDA 3SSAA 1MFZA 3LSTA 3JWPA 1Q7EA 5H80A 4P3YA 4EUSA 4CV3A 1XTJA 3G68A 4MLPA 4D74A 4MROA 2ACKA 2ZYVX 4P5DA 4RF4A 5C32A 4B4OA 1L1FA 4L4RA 1KORA 1AK2A 2I7CA 5BWCA 3ZZNA 4CCSA 4CIAA 3CT6A 1CY4A 3QNWA 4J4HA 3L4KA 4ZC8A 4HVAA 1U0GA 1EUQA 1IBMB 3EGIA 3MOGA 3WNDA 2YJGA 4I55B 2GZRA 2D2EA 3FJYA 1JEOA 3A1VA 4K9LA 1E1DA 4YJGA 1BG6A 5FAXA 3AUJB 1CJMA 1PS0A 1Y5RA 2VA8A 3X1JA 1EI9A 3S29A 2VZLA 2WP0A 3K96A 3ETLA 4Q9AA 5F7ZA 5FYDA 1OYOA 1RBYA 2PUCA 4W99A 4EG5A 2KWIA 1U81A 3N7AA 1CIJA 3V3TA 3SKXA 1T6XA 4BL5A 1JHYA 4RPJA 5FBVB 2B3DA 2NO1A 4IIXA 4O2BB 4EGSA 4QJIA 3O8RA 4XJXA 1ZX1A 4HFNA 1Q0PA 4ZJZA 2BFOA 4KVGA 3TOZA 2N1BA 4DC1A 2C5FA 5A5EA 4CEIA 4HV4A 2GBPA 1FDRA 3C8UA 3NONA 3BHMA 4ARVA 3LY5A 5HEKA 1PE0A 3IKJA 4DWJA 3C1TA 1SB9A 2W93A 1A7UA 4JI1B 1G20E 1WA5A 3G88A 1SEVA 3GBPA 3W05A 4L6AA 1WSAA 4RIIA 4P81A 3N74A 1GQSA 5C1PA 3DOUA 4ETIA 3BD7A 1NX6A 5AVUA 2RAPA 3L92A 4BFSA 3AJDA 2L69A 4ETMA 2AE2A 3JY6A 1JX6A 5CVVA 1HRDA 1M9NA 3HG7A 3PGA1 4DGSA 5BQPA 4IILA 3HV2A 4BFTA 5GVRA 2VLBA 4G56A 2JVKA 5F73A 3NOXA 4X54A 4M8SA 1JDVA 1SWWA 1YZHA 2I6TA 3FYCA 1RC8A 5G1NA 1B42A 4Q3DA 4QARA 1XQYA 3FKSA 1MIOB 1J2YA 3ROXA 3GCGA 5I9IA 3NGMA 4DABA 2Q6OA 4LJYA 4AFNA 1QF9A 4UE2A 1EK0A 2EZ9A 2QV0A 4IDQA 2WBLC 3NXKA 1RRMA 1R4NB 3QF4B 4NG5A 4WHMA 4F0JA 1YCHA 4MB6A 1Z4KA 2XGMA 5EE3A 3R1IA 1C29B 3WV5A 4GH5A 1IYZA 4X6LA 4EY5A 2J9GA 2WD8A 4FKBA 2KS6A 3BIOA 3S5UA 1RXWA 5A3VA 1U3DA 1XD9A 3QKRB 7REQA 4RFSA 5EZ6B 2HSZA 4Z3KA 2YCLA 4WW0A 2WNIA 2QUHA 4KPUA 4TVSA 1W96A 3IUJA 3SIPA 5TJ9A 2WJAA 3HEAA 4EGJA 3D6VA 3JQ7A 5AOVA 2FPWA 3H11B 5ELXA 3G2QA 1EA5A 2ZK7A 5JNSA 4OEHA 4L72A 3VHXB 4ND5A 5IYZA 4C6RA 1N75A 2ZB7A 2VSQA 5FLXA 1NU6A 5LA6F 2YZNA 3GEPA 4P38A 3SJUA 4CLDA 5ADHA 4Z9XA 3M3PA 4CBVA 3EIFA 2PT7A 3MAAC 3MWKA 2WTUA 4KIUA 1FB5A 1LPNA 1SO8A 3PVSA 1WWKA 4XCVA 5ALTA 5TVGA 1O97C 3DV2A 4HTFA 3SDZA 2P27A 3U3XA 4X6UA 1EX6A 3D6FA 4V0KA 4TZ0A 4GMFA 1Z5OA 2PCJA 4QLAA 2Z1NA 2Q46A 4YGYA 5TQVA 2O2EA 1JHAA 2ONZA 4FWTA 1SUAA 1RLJA 5KWVA 2OBBA 2F3UA 4FEYA 4OOEA 2UZ0A 3LOPA 1WKVA 3A05A 1ZC3A 4BB5A 4B31A 1NN3A 3C48A 4RZ2A 3S3TA 3G0IA 4BV2A 1N0UA 4HTAA 2XT6A 4WLUA 1ZZGA 1S4MA 1TZCA 1CRWG 4ZAWA 4ZK6A 5KJ1A 2V0GA 4TUYF 4WN9B 4TWAA 2LPMA 3F78A 421PA 4A8PA 3OEYA 2UV8A 2REXB 5HOEA 3EGDB 4DR1B 4HDNB 5EWMA 1ID8A 4HL6A 2VNIA 4MRSA 4A7PA 3NWBA 3BTVA 3WB2A 3TD2A 5KNDH 1WAMA 3RSCA 3FPCA 5BNWA 4B83A 2NSLA 4DZZA 3IKTA 5SZJA 4YPFA 5AJHA 4BPBA 3K72B 5G0UA 3EDQA 4MVJM 1GT91 1UC5B 2Y1DA 3LAWA 3QHAA 1D1QA 1Y3CE 1STOA 1OD6A 4KXFB 1Z6GA 4BU1A 2F3PA 2I71A 5CLQA 1GRVA 2GA9A 1W46A 1XCBA 3KFLA 1EU1A 3ECAA 3KZOA 1H6AA 1HL7A 2YW9A 3OZUA 5BSWA 1MP0A 3I0ZA 1M1YE 5CT8A 3AIIA 3GZJA 1DOHA 3PKJA 4KFSA 4JHXA 4R83A 4ZO6A 2CVHA 4QD3A 4Z4GA 1YOVA 3O2JA 3QXHA 3BH7A 2Y0PA 4DCTA 4OQPA 2JFUA 3AUUA 4JP3A 1JYFA 1OI7A 2BN4A 1AOXA 4KGVA 3GPBA 5JH7A 3T5DA 4DR4B 4Q34A 4NARA 1GKIA 1ZWKA 1XNJA 4LWQA 4ML3A 1VXRA 1B1AA 5JSUA 3VKWA 5EXPA 4DNQA 2JNWA 2PV7A 4JEHA 2E9SA 2WUWE 4AL4A 3F5MA 1U1GA 1U9IC 2QE7D 2P9BA 4MCHA 1A9OA 1U2DC 2VCEA 3SFVA 2D6FA 4HGOA 1PEAA 4WZAA 5DLDA 5CFLA 4PSDA 1ISGA 2CLMB 5TPZD 1RYYA 4M0MA 5BT8A 4BVEA 1B4DA 1YVEI 3MRVA 4G07A 4NOMA 3VR6H 2VAMA 2PD6A 2FPIB 2G5PA 3GFQA 4NC9A 2RDMA 3OWHA 1EHCA 1OIWA 3Q2KA 3ETEA 2GDZA 4HWPA 4JJ6A 2O1EA 3OC0A 1O5TA 2XAAA 4JQCA 4LOHA 1M2WA 3LRPA 1OROA 2QNIA 3ABQB 3PPWA 5J43A 5KPDA 1MLDA 3D64A 3K9BA 4FOPA 4C0JA 1XDUA 2JF0A 2QX9A 4H31A 2Q21A 3G2IA 3SR4A 3H2BA 2LD4A 4MMXB 4UZSA 4IDAA 2Y2UA 3VC3A 3REQB 2QWXA 1T8UA 4JXKA 5MDHA 2W6NA 1KPIA 4DMCA 1U9JA 2WJHA 4R2MA 5HRAA 3AI3A 5LFAA 4QG3A 2GFIA 3CBGA 5KYGA 1NF9A 5K8VA 5HJ7A 2F17A 4X92A 2BHLA 1NONA 1KZ6A 1VFPA 1OWMA 2VWQA 3F1LA 3L9XA 1XJWA 4PAWA 1R4AA 1ZCBA 3ZK8A 3VYRB 3T7KA 4EQ6A 2JKVA 3C3BA 2D1SA 2WSLA 4N1AA 2VHJA 2X9NA 3RHFA 2VPXA 4WACA 2ECPA 3GCZA 3OZSA 3WRYA 4PLTA 2I4MA 2VDQB 4QDUA 4O4IB 3PQCA 4PGMA 3VTKA 3F6PA 4L8VA 5NLLA 1Y7PA 3CLUC 3ZH9B 4EG0A 1E9AA 1GG5A 2OWDA 2PGJA 3E82A 3FF4A 4BX9A 4YAGA 5LP6F 4ZODA 1MJGA 4JB2A 3DB2A 1BS9A 2PAFA 3FPHA 5HCNA 4R1SA 4BQSA 2XT0A 2C9MA 1H6CA 4LCEA 1PEKE 1C81A 2GKGA 3B6KA 1U8XX 3D7MA 2B6HA 3GFOA 4KP7A 5JO0A 4QYIB 2WV7A 3G6KA 4LAFA 3FDZB 3ET5A 3WSVA 2X2PA 1LWOA 4OFZA 3UUGA 1US8A 1X7HA 4ARAA 4EW3A 4DRYA 1HNNA 4ZYYA 5KYXA 5C8YF 4BU0A 1KZGB 2A59A 3HP7A 4K40A 2IYTA 4BUCA 1PR1A 2JIQA 4GQBA 3PNBA 5HGJA 5IT5A 2A88A 3LLMA 3UJ7A 3EZ2A 3GRPA 5BPHA 5JPDA 4ZXFA 1GGMA 1UEIA 3BOSA 3MPUA 3SX0A 4B6JA 4DV5B 2A58A 1E1NA 2B4TO 4D98A 2O8BB 3NHKA 3K5PA 4NPAA 1GU0A 1ZW1A 2OCAA 1CFJA 5CJPA 4Y6PA 4LF8B 4L4ZA 4ZI2A 4J7XA 4Q6BA 1N78A 1OXSC 3FD8A 5E6UA 3UQZA 4F3CA 1LDGA 3NBAA 2QW1A 4NBTA 3WSWA 5JCJA 3S4YA 4E5PA 5KNDD 1M76A 3P2YA 2QZJA 3K0FA 4AIRA 1A9RA 2Y1OA 4RV9A 4HT3B 3HRKA 2AW5A 1NFRA 2FB9A 1DKPA 2F1OA 4GYJA 3MUNA 1PFYA 2VYVA 2IIQA 2W7TA 1UPTA 5F1YA 2AMJA 2HPHA 2X6TA 3DMFA 1GSHA 4ZOCA 3HLKA 3THWA 2DCMA 3CKYA 3E1GA 1PBTA 3PDIB 5KUTA 4QASA 2BRUC 3TTWA 3E9NA 3W2GA 4BY9E 2WYUA 3EIUA 4X1KA 3EISA 4YCNA 3A25A 5L3SA 2YY5A 4PGHA 3BM5A 2CDAA 4BVLA 1PWYE 3SBXA 3D8NA 2VH2A 3NIBA 1PJQA 4FIZA 2C9DA 3TVYA 2NTJA 5D84A 3RUEA 4MV6A 3NI2A 2G7ZA 2RHHA 3O9VA 4QBKA 4DE5A 2CVQA 1YF3A 1ODCA 4B3DA 4IDDA 2HU7A 2BFAA 3GFTA 5K01A 5KAPA 2DJIA 2DTDA 4GI3A 4XCQA 4ARSA 1Z7GA 3IVAA 2HV8A 4FJ2A 3INYA 3EVCA 5EESA 3QTBA 1C1HA 1OV4A 3E22B 1GAXA 4LJAA 3H1TA 3QM1A 1U1CA 3HXKA 3O8QB 4GE3A 5F2EA 3LCUA 2COUA 4FBMA 4RTJA 1DSSG 1Y98A 4MGYR 3WVNA 1L7OA 3DE2X 3PF8A 3GCWA 2XYVA 1YHYA 2AD5A 1PF7E 3B38A 4KAXA 1W2GA 2GTHA 3I12A 3H4IA 4RJ2A 1P8JA 1Z37A 3ANLA 1OU4A 4YJ2F 4YAWA 4F12A 5DGXA 5JT1A 1N3IA 1SCUB 5ALLA 1KRXA 4YAIA 1LPOA 1N2GA 4QUBA 1R8QA 5B1DA 3DEYX 5ADWA 4Z0HO 5ARCA 4DLWA 4W5RA 1F8GA 4B46A 3WYNA 4IHKA 2J4CA 3ZKAA 5KIAA 4CTNA 4ZT3A 5KU7A 2C4MA 5SY9A 3TXYA 1J33A 1U2TA 4MOWA 1YZNA 3INGA 2JL1A 3NHAA 3FOWA 4QOJA 2XB9A 2BF7A 3BKWA 4GPEA 4MR7A 2H8KA 1X7WB 2ZANA 5AKJA 3C6QA 3T5BA 1XN1A 1MG0A 4E12A 5JW6A 2FR8A 2JJ8A 1N36B 2P9HA 3CUEF 2OMEA 2XIQA 2OVBA 1GG2A 3LHKA 1N5JA 1H0KA 1PGJA 4F85A 2C8KA 5H3CA 2ZI5A 3TFWA 3D5EA 4FR0A 3N2IA 3PT9A 4XWAA 3TI9A 3CKKA 3QKTA 2WKWA 5G0SA 2Q7DA 4ZPXA 1CRZA 2HBRA 3FYTA 3GUHA 2HIHA 2J5XA 3JQAA 3TVDA 1C41A 1U2SA 1MO4A 3TR0A 2P6NA 2GYVA 4JYCA 1YZYA 2YWDA 4JGBA 4PQEA 3G2LA 2NTVA 5JQGA 4HNTA 2W4IA 1A2OA 4O08A 1E3JA 2Z43A 3QPDA 2EIXA 5I7WA 5LCXA 5BPFA 2OVFA 3BMOB 4GMGA 4O4IF 1Y48E 2CNLA 2X9VA 1Z08A 3H17A 2CHEA 3N0XA 3TTVA 2JJ2D 5KKNB 3DT6A 2UU9B 4LHEA 3UT5A 4LV6A 3GOQA 1WG8A 4R84A 1GCUA 4TYPA 5A7HA 4YYEA 2GK7A 5K6TA 4WRRA 4JUCA 4RANA 2Y4OA 1F6DA 3OU7A 1Z6YA 4UBIA 3ZLJA 4YCAA 1UK6A 5A4MS 3JWHA 2V6FA 3JR3A 3LBIA 2G1UA 1YXMA 2ZPAA 5NULA 2QA5A 1G8FA 3BDAA 3L4BA 4L0CA 2O8EB 5ABPA 2QPTA 2D00A 1ZL0A 4YB8A 3RHSA 2FOIA 3I30X 3PRYA 4XYGA 5A5FA 2BR3A 2IOFK 3TLCA 1DG3A 1VHDA 1ENOA 2W8BB 4REQA 4Q3BA 1NL3A 1B23P 5DSTA 3GPIA 5FUVA 4AJOA 2JI4A 5CLLA 5P21A 3B3AA 1EFKA 2HUPA 2WU4A 3S6JA 1QP7A 1QE0A 1KZHA 3TPFA 1UFOA 2CJYA 2NIPA 2GF0A 4QYWA 2G08A 4JLNA 1T2CA 2ZTSA 1NJSA 4R9UC 2NV2B 1RZRA 3O4FA 1M2FA 1U2EA 2OUKA 3H16A 3M6VA 1UDRA 4LXGA 3THYB 4B4KA 1YVRA 1GTSA 3FN4A 4KUHA 4B4WA 3H8WA 4CF4A 3ORQA 3MS7A 3DDSA 4YRLA 4YV0A 2UAGA 3K0AB 4YJ2A 1I36A 2VXOA 1MZVA 3DCYA 3GA5A 4Q3KA 3LUCA 4HGQA 3RK0A 1C1YA 1AB5A 1VE5A 4HMOA 1HG1A 3WGGA 4Z4CA 4O3MA 3UJCA 2V9ZA 4LQ4A 1NUQA 2QLFA 4F06A 8OHMA 1D4FA 1QH8A 3DL4A 2CXXA 2X3FA 4OSOA 4UUBA 1L5LA 4ZMSA 2HJSA 1QTQA 3D02A 5EUMA 2FY8A 2XCTB 1P9OA 2YXBA 4XLTA 4YTEA 2YFHA 5DF1A 3TM4A 3LK6A 4ZAFA 3WHIA 1YZLA 3B7WA 4MUGA 1X7XB 1UT6A 4IJMA 4B3RB 1CEEA 4EF4A 2FN8A 1EG2A 3DVRX 1QPGA 1DXHA 1SC1A 2AR0A 4KIJA 3VNQA 5EA2A 4BNWA 1SC4A 5H5JA 3K0SA 1Y1RA 5LBIA 4BLQA 1BXGB 3OC6A 4OQ4A 3TEMA 1KFJB 1N2CB 4BLOA 5ALSA 4JP5A 2XB8A 3EXHA 1GGHA 1H6BA 3P9SA 4IF6A 4ENQA 1Y5LA 1PU2A 2HWUA 3NNNA 2NUAA 1HOXA 2JGRA 1BHJA 5FBKA 3TX2A 3X1ZA 1VE3A 2DU8A 2PGOA 1MHTA 3ZDEA 1T5HX 3NBKA 2YWEA 1KZ1A 4LX0A 3EXG2 5DTEA 2O23A 3RC2A 4UNQA 2JFNA 3B8EA 1RJFA 4GLOA 4IOMA 1ISPA 3JVEA 5AOCA 5B6PA 6NULA 4FOSA 3I3OA 5HBRA 2ZG6A 3IB3A 4FP9A 4G65A 4TV8A 3TCNA 3O94A 3DEKA 1LH0A 4PHGA 1Q12A 4JY7A 1HF3A 4E5VA 2ZJAA 4PLFA 1GFWA 3U44B 4IIJF 1NC1A 1ORRA 4JT8A 3SQLA 4BP1A 4Q19A 5HHTA 4AAYA 3ZWCA 1WMDA 4UUPA 5C46F 3E1KA 3R7DA 3N53A 2B83A 2W83A 3R3JA 5K4GA 3HMQA 3B6MA 2CFIA 4L73A 5C5DA 1W75A 4G5HA 3VDQA 4F21A 4A8JB 3NGLA 4HXFB 4YRKA 1A9SA 2EWWA 3IP6A 3UJ3X 3A9VA 3WWYA 3N05A 5HQ3B 1VJTA 2MYPA 4HI0E 3NWJA 2O0HA 2Q6LA 5HGXA 3ESBA 2NOAA 1NZDA 3UMVA 1X1BA 4L7QA 1L9KA 4ZA2A 4ZKDA 1GV0A 2H1HA 1GA6A 2C96A 1Z5PA 3R3YA 4KQEA 4MUNA 1IK6A 4WDQA 2OZEA 2NNLD 3IDSA 8AT1A 4EY8A 1G7SA 1JWBB 1PL6A 2WP8J 4M2LA 1GQQA 4TLBA 2OGSA 3W9BA 3ZUPA 2G9UA 4GFDA 4ZU6X 3E3MA 3GRUA 3DE1X 3UAOA 2B8WA 1CS0A 1BEUB 1V26A 2GHTA 1KK1A 2B8JA 3KCQA 4M53A 4QFCA 4F4HA 1G7CA 1Y3DE 4P34A 2WOOA 2V9CA 3MD0A 4IJKA 1GN8A 3C6MA 1XCLA 2G4VA 1C9KA 1EVKA 1O3YA 3GN2A 3W5AA 5AVQA 3UHAA 4G23A 4JJEA 3L0SA 3HK2A 4UCQA 3LE8A 4P1ZA 3AR2A 1GLNA 1EA7A 3FSEA 4ZT5A 2IEZA 5CB4F 3GRZA 3MJDA 1V7PC 2QL6A 1C7ZA 1DAFA 2CXUA 2WYOA 1NBEA 4JV5B 1E66A 4DEYA 1B16A 4HQ6A 1KJQA 1CVLA 3KR9A 3I6BA 4X61A 1Y8RB 2BGLA 3PGKA 4RGBA 5HE8A 2MINA 3N8HA 3DBHA 5BNZA 2ZJFA 4YRNA 4BIMA 3DO8A 1A95A 1MRSA 1RYDA 2CXOA 1PL8A 2FGKA 2II6A 1KL7A 4H2DA 2KHZA 4E94A 1A3CA 4EX7A 5H4HA 3VR1A 5EZSA 3JD4A 3FFWA 2DY0A 3FHTA 2R2AA 4IZHA 5EMLA 1TUIA 3P0EA 2XMRA 2VIIA 1X9GA 2JATA 4PYKA 4AY3A 3D1LA 1NNEA 1G2IA 2C5BA 4OBXA 3EEYA 1W48A 2R0QC 2C94A 1UBEA 1GTVA 2VJYA 2H5IA 2I6SA 1J0XO 3HRIA 4HQKA 2IXGA 4OY3A 3RTGA 4EDHA 5A6SA 1E94E 1BMQA 4ROSA 4FS8A 2J48A 3L7JA 1VSUA 2OO7A 4U9IS 1P2FA 3KD3A 1NW5A 3OZIA 1OHHA 4Q47A 3TLMA 2OORA 1E5QA 4EHNA 1SZDA 1D2MA 3BH6A 1CY8A 4LRTB 4X94A 3O4VA 4KQJA 2I3AA 3UCEA 3TLGB 4ZEWA 2ETVA 2GM3A 5AJZA 5DCLA 2BFDB 3NHLA 5GGYA 4W5HA 1EFPA 4B09A 3A9CA 2W58A 4I4NA 4DIEA 5LP6A 3A6JA 4S0ZA 5DMHA 1FSGA 5F2KA 1OX4A 4DIBA 5AW3A 2CKDA 2VHXA 3GV0A 3PNSA 2EJWA 4FE7A 4QBFA 3UVEA 4Y2TA 3MRSA 1HYQA 4LZNA 4L8GA 3K20A 3R8FA 2O3SA 2O8NA 1ZKMA 4XYLA 4JJGA 4ZV9A 1TEXA 5I6DA 2LDXA 1O0SA 2Z2XA 4LWOA 1W0CA 1GAJA 1P5FA 1JFFB 3H1FA 4PZEA 4Q48A 3JQ8A 3I9LA 2JLBA 4MQUA 3WMRA 1F7UA 3QE2A 3QJYA 3LYUA 1SQ0A 1BS1A 3Q7PA 4BMPB 3TZBA 5JCJD 4UNSA 2BSAA 4H1TA 1TU3A 2EEZA 1FP2A 2H2WA 1G4AE 1XZHA 5E9JA 1XTIA 5BWLA 2NU8B 2OO5A 4IV8A 4OHOA 4A2CA 3JSXA 4YP5A 2AYZA 1FFCA 1RKUA 2AOTB 4ACAA 3P45A 3HU1A 4Q1AA 1OFGA 4IHJF 4A0SA 2A30A 3RSHA 2ZB2A 4GO1A 4CIWA 1D2CA 1TJNA 2YYYA 4UQPA 3FMGA 1OFTA 1UFRA 1J8VA 1C9JA 4ND1A 1PG0A 2B4AA 4JVSB 4DCVA 3C1OA 3F6YA 3ASUA 1BU8A 2QQGA 3H04A 3HKEB 1G5TA 4JIMA 4R1MA 4HWTA 1VMEA 2J4FA 2WHEA 1L4LA 2F9MA 3ZDBA 2Y6VA 1GTMA 3TGWA 2Z5LA 3PLRA 2ZWVA 3ZV4A 3TPZA 2GZAA 1JT9A 4WV3A 4UREA 3VR6A 1JIVA 3BMQA 1ZOOA 2BF4A 3QFRA 3QYFA 3GZTB 3LWDA 4BCBA 5JSHA 2NW6A 1JU3A 3P0FA 2NGRA 3W3AA 5BN3A 1GILA 2M6SA 4LXYA 4JZKA 3SZGA 2GS9A 4HGNA 5ALYA 3A06A 4X8LA 2UZ4A 5HF9A 4QGSA 3P9RA 3UWOA 1IN1A 4CIYA 4UUNA 5K0EA 1N1GA 2EHJA 3WLRA 2O5EA 4AJ1A 1FLNA 1FMTA 3EMBA 3K8ZA 3PRHA 3LLUA 5J4VA 3BXEA 4COOA 2AS0A 4L2IA 4GI1A 4NEQA 1GPLA 5IDYA 4ZEMA 4WADA 1DVRA 3DVQX 1P0IA 3GPCA 3ZWKA 4AXXA 4MO9A 3RRJA 1T5IA 3TCKA 2FZ5A 3V7NA 2YHBA 4LY6A 1QANA 1N0VC 1ZU5A 4L4YA 4DNOA 1RXSA 5G1OA 3HLYA 4K9RA 3F9CA 4RAQA 2ID4A 1AB6A 4X44A 5J9FA 4ATNA 4CLRB 4CEJA 4JI6B 1K0FA 4L7VA 4C4OA 5BP7A 3OT1A 1M1YB 3CR3C 4ERNA 5AESA 1I0LA 5CXQA 1IJFA 1V1MB 1NF8A 4I4TA 2I78A 5TF0A 2OXEA 1ZIXA 3OBBA 4BPRA 5CVTA 3C6ZA 2OA0A 2WJYA 4WK2B 3BHIA 4GKAA 1E1LA 4EFMA 2ZIXA 3DEJA 2FEMA 5IASA 1M2JA 4Y7CA 3FDFA 3DVAB 3ODPA 1VKJA 1FFBA 2I2DA 4Z3DA 2H31A 4OX9Y 4N6NA 2OBXA 3IQHX 1UK8A 2X15A 3KKOA 3G82C 2YVUA 2F62A 3MWJA 1Y82A 3L43A 5IXYA 1KETA 2VHQA 3OLQA 5KMGA 3JZFA 2VRBA 2QUAA 4CDMA 1N5MA 3ESAA 1A82A 3DV9A 5HIKA 1X1DA 4XR9A 2NO5A 3GD5A 3DZGA 4M36A 2B1IA 4GBGA 2D59A 4RVHA 2FZWA 2OCBA 3IAM1 3RABA 2QAGC 2VJQA 2ZUFA 2RG7A 3O1IC 1EVJA 3OTWA 2PTGA 4C5AA 2AD1A 2NVOA 2FW6A 4KTTE 5FPQA 1KO7A 3TOCA 1RRGA 2Z3WA 4PAMA 5C5CA 3IA2A 2R4UA 1XEXB 4QXRA 4M55A 3MTDA 3A58B 3EG9A 1AZTA 1CY1A 1UC4B 3BB4A 2H8GA 3C39A 3JQBA 3QVJA 1X86B 5CRIA 3SBOA 1BGXT 2UXDB 4EJ6A 3VX3A 1ZCZA 2ZTMA 1IEVA 1T36B 4RADA 3A36A 4RH0A 5JSFA 1Z0JA 1QQAA 2GJSA 2AZ4A 1LZLA 2BFPA 3JYOA 4F92B 1O95C 2CXPA 2H65A 3DOJA 3K9CA 4J7CA 4F4UA 5K45A 2BBWA 2O06A 2VT2A 2XF2A 1Y89A 3ZHXA 1DPGA 1FVHA 2Q07A 5KQMA 2HT1A 3PE4A 3QFHA 5I9MA 5JZMA 4LGMA 3LDGA 1QRUA 4H1WA 4LMPA 5A62A 4F96A 3GAZA 2GAIA 3PV0A 3TAXA 3FXAA 3N7TA 1IB0A 1ZCFA 4HAZA 4YROA 1JEQB 1XZFA 1W0KA 1OR8A 1ZHHA 3OIGA 2Q2QA 2PKWA 3NM4A 2DFTA 2EFGA 4J29A 4OHPA 4EPYA 5DN9A 5B53A 3UFXB 5KX5B 1FNNA 3D6HA 5CFZA 1H1LB 2XZTA 5AW6A 3PUJA 5D8DA 1B15A 3KT0A 2VBIA 2YV5A 4PO1A 1YIDA 3BCSA 2IHKA 3JS5A 2O8FB 2ZWOA 5DRYA 1MC4A 3M4ZA 4IGFA 3M81A 3C7DB 2PSDA 3DKRA 4WVFA 5CCXA 1E1YA 3O83A 2DQYA 3BL6A 3R3XA 1EAMA 5G0WA 4NYMQ 2BDEA 2H85A 3IP1A 5IXSA 3TJMA 2J45A 4Z8XA 3U09A 3R0IA 1CJBA 4PFKA 3K0CA 1T2UA 2JZCA 1EH5A 3KZKA 4YV7A 3TGLA 4X5OA 3PJRA 2FFAA 3FSGA 4BQRA 5JOQA 5JXWA 5DT9A 1JHPA 1ZMRA 2LCFA 3DGEC 3LC0A 3DYIA 2FG6C 4G24A 1P3JA 1XEAA 2OT3B 1WB9A 4CT5A 1ZMTA 4O2AB 3CY6A 3ZW8A 4ZCMA 4P7BA 4RY9A 3ZDXB 1MHPA 2PUHA 3G0HA 3LGXA 2CB9A 3H3JA 4Q39A 3RQSA 1D2NA 1NSTA 3NDIA 3OP1A 4MIYA 3ONFA 5E6RB 4B73A 3ER9A 2TRSB 4RHFA 4BNGA 4CLOB 4D0GA 1R6AA 1UJ2A 1Q2XA 2CK3A 3JAWB 3QNUA 4G4GA 3DKKA 3IOBA 1V37A 2QPAA 4KN9S 3GK3A 3VNSA 3ZE2B 3L4SO 3D3WB 1HL3A 1TADA 1WO8A 1V5GA 5E7JA 3EX7C 2X6QA 2R66A 2YRWA 3KSZO 4K86A 3S40A 3A7EA 3ZWWA 1I3LA 5EJ6A 2QQFA 5AUNB 2AB0A 3C6YA 3QWHA 2QPOA 3PUHA 3AWDA 3GJRA 4GPIB 5BQ3A 1X19A 3HYSA 4QFMA 2XRZA 5IWCA 3BRSA 1HYEA 3OE4A 3R3SA 1QXSA 5T3UA 2IU3A 2J5RA 5B37A 3UV3A 1GGKA 5ITZB 2FCRA 2YN2A 2OCPA 2V8OA 3WK4A 3PC7A 5ILOA 5DB4A 1J20A 1ESEA 3EQ8A 2QTVA 4JASB 4B7XA 3UUWA 4AQ7A 3OKPA 2ATVA 3ZLVA 5EEGA 3FE2A 4UNIA 4AWBA 1YJ8A 3M4XA 2J3EA 4EGQA 1BGWA 3V55A 3BFKA 2OHFA 4HO1X 2NU7B 4U0KA 4A26A 5CA1B 3NHZA 4BLVA 1ZESA 3LO5A 2XW6A 4MWTA 1H3EA 5J2TB 2H07A 1ATIA 1HMPA 3VC7A 2AA3A 5DM60 2JFBA 1VLZA 4I19A 4RV5A 4EA7A 1HQYE 4DUZB 5IP5A 4X97A 2XVXA 4CTOA 1OI3A 2YWFA 5E9QA 4MQLA 3V8QA 3R5TA 3FMPB 3L18A 1J0AA 2YWXA 4IDCA 5HM8A 2VZ9A 2BTEA 2O9JA 1FBNA 4YBRA 2QRLA 4ZYZA 1K6XA 1OLXA 3I53A 3OZFA 4FQ5A 5JWHA 4I50B 2O59A 3UMMA 5ADUS 2RFLA 4Y8VA 3E8SA 1G5HA 5CK4A 1QFMA 4EUKA 1M73E 5AFSA 3PD7A 1DWPA 4KAAA 5EJIA 4N9QA 4M8IA 5FBZA 5I7EA 5H68A 2OXIA 2PBRA 4XLZA 5DM70 1CQZA 1SC9A 3PDUA 4JBGA 2PRKA 1PT5A 2JD0A 4GVLA 2FG5A 3U39A 2BV3A 2YS6A 3AM3A 1C30A 1TU4A 3G9UA 3NNSA 4QGGA 1P1JA 3SXUA 3KC2A 1KA9H 3IMFA 4RTKA 4YJHB 1O2DA 3BTUA 3EBPA 1CETA 4KXVA 2OQRA 1RZRD 1PX2A 2CLKB 2GJ9A 2R1TA 2V6MA 3FI9A 5D3KA 4ZQBA 3OZVA 4AZVA 3VPBA 5ICSA 4BV3A 4ETNA 4Z2AA 3L0OA 1IEXA 1JIIA 1GSAA 2BLLA 3AILA 3DMYA 1UXKA 3PDJA 4H08A 4W7SA 5JE8A 3VMFA 1YCDA 2JAOA 1RKVA 2VTVA 3AG5A 4X6XA 3OJEA 3C98A 3MILA 3U4QA 3JQ9A 4PZCA 4CJXA 1RHMA 1H3NA 3SVLA 3AR4A 1D03A 4KNWA 3UMGA 1L7NA 1MVOA 2IITA 3C5EA 3DHVA 1ACMA 1JLRA 4GSKA 1G4UR 1Z4LA 3LPCA 1KH1A 2R6FA 3K4PA 5GJBA 3OM1A 1J1IA 2FEWB 1GPDG 3RFFA 2H6EA 2QRJA 2YC2C 3CGWA 3HU2A 3ID6C 4NZZA 5C4GB 1L7PA 1UKYA 1AGPA 3PQ2A 4L9WA 4AZWA 1B43A 1F0PA 1LPPA 1UP7A 3AOEA 3KJEA 3NOVA 4QOHA 4DBZA 4TLDA 4KPGA 3E70C 3UATA 4BATA 1DARA 2W6PA 4UM9D 1R37A 3GJXC 4OI1A 2B4RO 1GZUA 4C7MA 5LMNB 3H2HA 4K88A 4PN7A 4JXZA 1M83A 4PZAA 4Q3OA 3OFSA 2VT7A 4R69A 1GGNA 1JHOA 4PO3X 3IE1A 1O6BA 4JJ8A 3QTLA 3CGGA 4B3BA 2BFWA 1MMFB 1Z6PA 1TCUA 2Z3VA 4XTCS 3G2HA 2OPBA 4OL9A 1NDHA 1PZEA 5KYKA 4ZYVA 3AF6A 4BNNA 3TXAA 1GR0A 3WICA 4R9NA 4D0NA 4PN3A 2GASA 3G0DA 3V2HA 2E3JA 2X8JB 2CXTA 2CCGA 2FLKA 4LYEA 1U5BA 1Z74A 2I54A 2ZI4A 4CMCA 4K2AA 4OGLA 3D43A 4B8YA 4HWRA 1KFBB 2H11A 1L8OA 4BRWA 3KZMA 1FDSA 4D0LB 1F4LA 3A6GA 4DCUA 5I9LA 1DUSA 1VLQA 2JGDB 2NZWA 3LL7A 4WGGA 2JFHA 1UBRS 3B36A 5AHXA 1BOFA 4D42A 4X8HA 3X2SA 4FHZA 5ALZA 4IEEA 4MCAA 3HDTA 4S04A 3PJGA 2OQIA 4OFBA 4C7KA 1L8AA 3GJTA 1CZRA 2K7ZA 3UHOA 4IUBS 2QN3A 1YAHA 3SHTA 3T35A 4IDOA 3I76A 4FXPA 1I4TD 1TEZA 1E0DA 3JVUA 4Q1VA 2JLWA 2O8VA 4TWBA 4GF5A 4URFA 5EE5B 1DGQA 2PPVA 5E4YA 4KO3S 1HTWA 1IHOA 3WMEA 2Z09A 2XWSA 3KSRA 3L4BC 1AN0A 1K5GA 3NU1A 3H97A 1SY7A 2ICAA 3QEKA 4HATA 2ZJ7A 4J1QA 4ZYUA 1PGPA 1QUFA 2CWDA 3P4UA 1ZVJA 3W8RA 4EKDA 4EAQA 3ADKA 5HKAA 3KG2A 4FS3A 2XB2A 3VR2A 4Z4IA 5EQJB 4P4SB 4WFIA 1E5VA 2PKEA 3BXHA 1VLJA 4DA9A 1P7CA 2WTNA 4LJ6A 5SYNA 2L42A 2H9IA 2FZVA 4TRNA 3H9QA 2EKPA 2W48A 4HNAB 5IM5A 3V4PB 4MKRA 4NI5A 3N3BC 3EVZA 2CNWD 2C7VA 2ZIZA 3FGNA 3HO6A 1ZOLA 3STWA 3AM4A 3E3AA 4YLEA 3PR1A 3QJ5A 3EZGA 1DV1A 4XR4A 1V6CA 3EW9A 3HUTA 3DOCA 4Z9BA 5I7SA 2J9YB 3G2MA 4PG7A 4CKXA 4Y0NA 4I66A 2QPLA 2J3KA 4YA6A 2I7VA 2WWGA 3G89A 1P17A 4IFBA 3TR5A 4PYJA 2O19A 4GM1A 2YWCA 1OMOA 3BIWA 1S1CA 1U0RA 4MGHA 1OH6A 3BHJA 4CL2A 2HK8A 3GLFA 2BCEA 4ZO4A 2WMNB 3AX6A 2GXAA 3AZOA 2G1KA 2G5CA 3O0DA 1CDOA 5REQB 2VPWA 3PXCX 1MJFA 1QYIA 3DCIA 3EC1A 4J16A 3RWMB 1ESZA 5EJ8A 1GT6A 2QIPA 4FCCA 4JL8A 7YASA 5DH9A 3E03A 1AKWA 1GFIA 4IEFB 1Z0SA 1A5TA 2CXNA 3DHNA 1JQ5A 3JARA 2BHTA 3RK1A 3ZNOA 5CLFA 2VL7A 4U2CA 5L53A 2H4WA 5IK2D 1NJ6A 4F2HA 2P11A 3UHFA 3D6JA 3KVYA 4HEA6 2VBCA 4V1CA 1YUMA 4IMRA 1TRKA 5F76A 1WW2A 3BE4A 4X7PA 4Z8YA 3X0DA 1U28A 2F9FA 4V02A 2LCQA 4QPJC 1SKYE 2C9CA 2P6OA 2QP3A 3PC6A 1CUZA 4XDYA 4EABA 3AF3A 3SOZA 3BWYA 4IUDS 1FXUA 1MV5A 1W19A 1ZM3A 2ZCUA 3HZOA 2E6UX 2FDRA 3A0UA 2QHXA 3IVRA 4D9JA 3ETJA 4KQHA 1Z7EA 1XCGB 4C03A 2DLNA 2QUJA 2QLLA 2G77B 2ZQZA 5K0TA 4RMHA 3L7NA 3RJ9A 1P91A 1HT3A 5C8ZA 2VJMB 2RK4A 1BJRE 3PWKA 4KL8S 3FLAA 1JJ7A 4N3BA 3LQ4A 3S2ZA 2WIDA 1A9TA 2A78A 3GMTA 4OB7A 3ZW9A 4EL0A 2C8JA 2WU0A 3SM9A 2FPSA 1NR5A 1DXQA 1YR1A 1HSOA 2HA7A 2I4NA 3RC7A 4UNNA 4CMAA 4ZT2A 3DH0A 2OESA 1AK1A 2JRLA 4UEKA 2UYCA 1BCRB 2X2OA 2Q1YA 3NJRA 4YIKA 4V0RA 5JVDA 3HNRA 3NDJA 4D02A 4R41A 3ZHYA 4KI0A 2I2XB 3D3QA 5LDHA 1ULAA 3Q7IA 1Z68A 4NL4H 2YXPX 2IZ0A 2C77A 2FZEA 4BFVA 4M98A 5AK3A 3SAJA 4KWIA 5CBPA 3BFJA 3ENNA 4U2KA 4CI0B 1NJFA 2Q5CA 1Z06A 4ISCA 2ZWMA 5L9AA 3LDFA 3D31A 1CZKA 2GB4A 3ZTYA 2HJVA 3TDMA 4N7JA 4BN4A 2ZSIA 3ADOA 4QQRA 3ENZA 3I2GA 1TQ6A 3I83A 3S2YA 1W6RA 2NXWA 1NF3A 3G7UA 4IS3A 1ISJA 1XJ0A 5EIHA 4C4TA 2ZRKA 1WSWA 6AT1A 3V4RA 1QRSA 1ZSYA 4DLKA 2PM8A 4PCVA 1LVUA 4GX0A 2RAUA 1OI4A 1PW7A 1PI3A 3ZE8A 2C7BA 4H6VA 2CFTA 1G3RA 1N9ZA 4BX3A 3ER8A 2QQ0A 1K98A 2V7XA 5KOIA 1L4GA 1CZUA 1JR3D 1TM1E 1ULSA 2XQGA 3A8TA 5KOHA 3HWX1 2PY6A 4J1TC 4HRAA 2HDOA 4Z9AA 5DTMA 1EUDB 4BGUA 1RPZA 2YV4A 3I42A 4KXQA 2IKSA 4E1BA 3SZOA 4KSBA 3W5SA 1NBIA 3BRQA 1N3YA 3ZVNA 1PZNA 4P7GA 5BY2A 1K89A 3OT5A 1Y6GA 3EZ7A 4DTIA 1VG1A 4C7BA 3KCNA 1ZPDA 3WIUA 3K6RA 4DWWA 5M04A 2JKZA 2ZUCA 1WMSA 4LKRA 3X44A 3L7OA 3WGZA 3WJ1A 2VHVA 1QAOA 2AEEA 2D0IA 1YRAA 3NVDA 3E61A 3O4GA 4A8HA 4Z1MD 5IM4F 2ZUEA 4FYYA 1U7TA 1FNDA 3M7IA 2G80A 3F6EX 4I4LA 1KE2A 4JKIA 3DW1X 2W11A 4IWYA 4UAVA 2H5EA 1QQBA 2E37A 4WCFA 2GAFA 2PH7A 1EBBA 4OQLA 2E5FA 4XQ0A 2HI0A 4YRQA 4DSZA 4YCCA 5HOQA 1VL5A 2PYDA 2LR0A 2AEMA 2PZEA 2ZETA 3EDCA 3FZQA 1WVMA 3LBYA 4LI3X 1YU9A 2IFTA 1ZUNA 2GBFA 2JAXA 3Q0TA 4MKFA 5BRNA 3T1HB 3AESA 4TMXA 3ZZMA 3OQVA 5A3SA 1A76A 1OXUA 1DHRA 3GQBB 3I05A 1KDVA 4MVJH 3W0LB 4K1XA 1VA5A 4GXTA 4LYHA 4MJ7A 2GNAA 1U7ZA 4RY0A 4C6HA 1SUDA 1BQ4A 5JC8A 4R2HA 2JJ1A 3HH8A 4AK9A 1UOOA 2JAQA 2X13A 2XCQA 3T3EA 1IBRA 2PG3A 1W2HA 3HY3A 1CKEA 3UMCA 3IDOA 4FDUA 4BNDA 4CMHA 1QGDA 4DDMA 4LYGA 5ESWA 3QVGA 5EMNA 3DKPA 3ONDA 2NV6A 3GJ3A 1BZYA 4QEDA 1ZNXA 4S35A 4RTOA 4B6OA 1E2UA 1Q0UA 2JFXA 3LQQA 3TLYA 4C6TA 4UMVA 4B84A 4JNCA 3ESQA 1NP6A 4QWWA 4CM9D 4M76B 1PAUA 4U9HS 1WP9A 2HWKA 2AH5A 2G04A 2LBPA 2FHPA 1P1KA 2Z98A 4LJ5A 1KJWA 4OYLA 5DWVA 5ER6A 4GR9A 5FFNA 3EVTA 3W4JA 3KQWA 3MAGA 1A4IA 2QSUA 3DYVA 1MZPA 2ILTA 3WJ7A 2IOQA 3NAGA 5L51A 3O5AA 3GZ4A 4B3SB 1ORHA 2GF2A 4H1VA 4W6QA 5CP8A 4DQVA 5HZHA 1CWUA 4O2RA 1DBRA 2OOSA 3KX2A 3CLHA 1T0UA 1HEYA 3BF7A 4R9SA 4F86A 2I4IA 2YDXA 3IV6A 3Q6NA 3EWIA 1SELA 5ESDA 4NYMR 2ODAA 1NOJA 1XDSA 4P53A 4OYYA 4GM0A 7AT1A 2IUSA 2ZR9A 4L5IA 4NYIQ 3RTCA 3VBEA 2O8CB 1QF7A 5LDDC 2VP3A 4ZAYA 3FHLA 1JT2A 3SMVA 1JALA 4K46A 2WJZB 2ZUVA 4B3TB 4UW9A 1GYQA 1GFZA 1KDTA 1RI3A 2BFBA 2IHUA 3FTQA 4MYDA 3BE6A 3ND7A 1X0XA 4M88A 3DLHA 3LKBA 3IIMA 3LOUA 5CB0A 1ODSA 3GT4A 1RWOA 4L8LA 1N0IA 4PVDA 4QICA 1W5TA 2ZDGA 4H7JA 3BAFA 4EZIA 1UXHA 1NQAO 4LY3A 2P1DA 4XASA 1NVEA 2AXEA 2V7WA 1Y5IA 3OQHA 5B4VA 5HZGA 5L95A 2Q9BA 3CX6A 3MOIA 5IYZF 3IS3A 5DPMA 1XAGA 2HJHA 1PG2A 2WMOB 1RD4A 2Q50A 1E2LA 1L7AA 1WU7A 3W6OA 4G85A 1GGFA 3E8MA 1KEVA 3RANA 4IZ6A 1NBHA 3ANMA 2NU6B 4WQMA 3ER6A 1UDWA 3DFIA 4JQSA 3LUBA 1DG1G 1T4CA 4PLHA 1UJ4A 1XHEA 2P5SA 2V8BA 3P9CA 4KODA 5H9WA 1Z88A 3A3KA 2H63A 2Q1UA 3WLNA 4M87A 4X0EA 4OK5A 4OKIA 5AM1A 1WHTB 3AFGA 2JJ2A 3EQ9A 5CT9A 1YBVA 3N8IA 4MAMA 2O4UX 2KLBA 1T6ZA 2CL7X 1SCAA 3E7FA 3RQIA 3VPGA 5DGHA 1TCAA 1LD3A 1ARZA 2ZAGA 2G70A 3I5UA 4O4LB 4H77A 3VYWA 3H2ZA 4S2EA 3A2LA 3FMFA 3U1TA 1U63A 4EH1A 5CT6A 3ZYZA 3A6HA 4Q15A 1NOIA 2OOKA 1V1RB 4DJDC 4UUQA 1XTKA 2BEUB 1II8B 3G2OA 4HDKA 2D3TA 5HFAA 5JZVA 3PTZA 3NRBA 4ZU1X 3F98A 3V4VB 1SBCA 3OPXA 4HUQB 5A7FA 3RVMA 2Z95A 1DRUA 4I3HA 3KKZA 1I5EA 3WNQA 3WWCA 4XRGA 4AN4A 3FVWA 1B8PA 2XA9A 3O75A 3UG7A 1VDZA 2XUZA 1YJ5A 1JB1A 2JH8A 4J76A 3WQQA 1XZIA 1YB1A 1R6DA 3ROKA 4D80A 3HL4A 1IG3A 4FONA 4E21A 5BW4A 1JEAA 1U6JA 3G7SA 3H0EA 1I1QB 3AVOA 4N65A 2PAAA 4OPMA 3AK4A 5ICCA 3AHDA 2QMHA 4QA9A 4WCVA 3GNSA 4G4SP 1MJ5A 4C3UA 2RI6A 3V4OA 4CCYB 1UAAA 2HHHB 4URZR 2GAAA 2WFMA 4G4JA 1QIGA 3IP7A 4GI7A 3ZNPA 1YRQA 3UWDA 2DG2A 4BCCA 4F7DA 2NUBA 4I4TF 5EXTA 3WQRA 4XVCA 2Y77A 4KK4A 3GLQA 3R5KA 4M38A 4S3MA 1UM8A 1UMCA 2ZE7A 2FSSA 2P3OA 1HETA 4PEVA 3MWDB 3ZU4A 2XECA 1QHYA 2ODTX 4PGAA 3L6CA 3NBMA 5TS2A 1KYIA 2EQ5A 1ZXXA 5J3JA 1KOLA 2XTMA 5A6VA 2YY6A 3M6UA 3FSRA 1UUFA 3A11A 3NHMA 1DO0A 1CUFA 2EP5A 4OUKX 3AJ8A 4A36A 4QVIA 1U0JA 1SUBA 4FFLA 2ZVQX 2H1RA 5I7RA 1UH5A 2VH1A 5CM9C 1K3UB 4TXJA 1C3EA 3F49S 2ATEA 3BREA 5ENZA 4QIHA 1W6UA 2V54A 5CXUA 1EM6A 1OLUA 1MPXA 1KHTA 2XUDA 4IAOA 4R2JA 1IG0A 1B6GA 2JEYA 1QHHA 1T9KA 2QZ9A 2UVPA 3MFQA 3TTYA 4A82A 1F3OA 3ZZ0A 2G25A 4CQLA 2EWVA 3B78A 2VFAA 3OEWA 4L5AA 1SBTA 5GZ1A 2JFGA 4LMRA 3NIWA 4D8WA 3R9KA 4B6FA 3I37X 2W37A 2B36A 2ZJ1A 5JZOA 4EPRA 1I2DA 3Q8MA 3JXEA 5AD1A 2EZ8A 2NO9A 2Z6VA 5B1IA 1BFDA 1GTG1 3Q5EA 5ARBA 3ZBPA 2YW2A 3GPDG 3QUSA 1LBSA 4L16A 3S2FA 3EPPA 8ADHA 5LJLA 1YQUA 2OQVA 2D8AA 2DWQA 4ZHQF 3B6JA 4DA7A 4QM7A 1JFLA 3IOEA 4BFXA 1IVSA 5L3ZA 4G09A 2VQEB 1UDXA 3MYYA 1HYBA 5KDLA 3UAWA 2J31A 2R5FA 3AEQA 3FDJA 3HKDA 4UTXA 2NU9B 5M34A 5CX1B 4OQNA 1Y3BE 3JPYA 5KNDA 1KMHB 1JYSA 3RIYA 1NLFA 3NKLA 3OAAA 4JCCA 1BQ3A 2RHMA 3N6VA 5TGTA 1RVDA 1D2HA 3AP2A 1KP3A 1GTZA 1OWNA 2YMLA 1K8XB 4IH9A 4ZAXA 1KKMA 5DYNA 4ARZA 1RJDA 3HA5A 5CB4A 3FUXA 3C14C 1E6EA 4NEGA 5CLHA 4F93B 1A8IA 1RQ7A 1W52X 3AXSA 3GY0A 1X77A 4S1OA 1S3FA 3D8BA 3LPAA 3CRZA 1O7JA 4RU1A 4WK4B 5KYTA 3MK31 4N4AA 3S7TA 5KKAA 1LPBB 1S8OA 1XMPA 4GI2A 4P58A 2PH3A 2ONJA 4HGYA 1OXTA 5KDDA 2AWOA 4I5EA 2QXTA 2VQ6A 5BN5B 5IM4A 4FMDF 1ZI8A 1NLYA 1IE3A 2HM7A 2VF2A 4ZD6A 3RC9A 5EHZA 1IIRA 1HG0A 3IKVA 4DR2B 3FFXA 1B8VA 3PXGA 1GJRA 2VDKB 1XCJA 3ZDDA 1ZZEA 1EP9A 1N6KA 3A6LA 3TIVA 3WL5A 1VYUA 3CWCA 4MS3A 1QPBA 1LTKA 3GFRA 2GWHA 2AFIE 4H4CA 1M7GA 1GXSB 2XE4A 3CMCO 1JVBA 1XZEA 2PX4A 2P40A 4UHBA 1P2SA 3IP8A 3HBLA 3LDAA 4R8LA 2H2IA 4ZRDA 2B21A 3CYFA 1NKSA 2G71A 1GQYA 4XCXA 3WMWA 5BXYA 3AVTA 3VU9B 4NMMA 5H59A 1IHYA 4M9SA 2CHVA 1KERA 4PLPA 5LDGA 4A8JC 3DPUA 2O5VA 4GI5A 3ZWOA 2BEWB 1T4GA 1KJYA 1VI5A 1XQVA 3R9WA 3JZIA 2J0SA 2WYVA 3IEMA 1QVZA 1GUZA 3UW3A 2FP4B 1CB0A 4K9OA 3VHRA 1OYVA 2R1VB 4WNAB 1MR3F 5I5EA 5DW3A 1R8SA 4KQWA 3M4JA 1KDOA 3KOWA 4PTYA 3ADCA 3ZGVA 2ALJA 2CXQA 2A1UA 5EIEA 5D7NA 4S24A 3RUAA 3ORFA 4NBWA 4QYMA 1QFXA 3L8ZA 3J81A 2HBQA 3RYFA 1JP7A 4GICA 4GOXA 3ZWNA 4BMNA 2FW7A 2XLCA 3QKSA 4W1PA 3ETDA 3RVQA 4MUEA 2WJPA 4BVBA 1ZLXA 2EATA 1PFGA 3DM5A 3ZIDA 3HR8A 1S3SA 1G2PA 4D26A 4E14A 4JVNA 1WEKA 2IU6A 2V74B 4O2AF 2D5BA 2PFKA 1PQYA 4G86A 4MQFA 1QO7A 5D3MA 1UANA 5ERGB 5F21A 2IYEA 4KR2A 1RMYA 1TJYA 2JHAA 3QFSA 1FMLA 1GITA 4QDJA 4C3VA 5I4IA 5AKIA 2GJ8A 3AONB 1OWOA 3M6AA 4YRGA 1VQ1A 4GG1A 4NK4A 4KQ2A 3I6IA 3A2NA 4YDHB 2V0NA 4XSHA 1YIOA 2R1UA 5TJHA 4CFYA 2BUBA 4XWTA 3T1NA 5KTNA 3ISJA 3QLVA 2GCOB 3EFBA 4OAQA 4BQQA 3ZY6A 1CB7A 2YBDA 1V11A 3IELA 2BAGA 2B1RA 4HBZA 3ONWA 2G8LA 5K51A 2ZVPX 4RPHA 3F71A 3OCUA 2ORVA 4QKQA 2G4CA 2DHQA 3GEDA 5BSUA 4DJTA 2RGGA 4UTOA 4HWSA 2ZJYA 5EP4A 5J2TF 3RS4A 3CA8A 3JAMA 3U7QB 2WUDA 3KKEA 3LP6A 4Q0MA 5B64A 3B7GA 1NGSA 4IXTA 3BFXA 1WDWB 3JD0A 1N2XA 1K6IA 4L8WB 3V1TC 4C5CA 4ZFNA 4C05A 1MTZA 1PWXA 1HNWB 4JA2A 1UC9A 1MORA 2IEIA 1LC3A 4MUBA 3OCVA 4QULA 4F2WA 1FF9A 3STYA 2CLCX 2W6ZA 5DW0A 4ENPA 5F4ZA 1PSZA 1AJEA 3GCDA 3WXMA 4EJ0A 5JSKA 2IH5A 4BXOA 3HJNA 1HQKA 2HQSA 5DBHX 5K8CA 1IY0A 2C5LA 2R79A 3K2IA 3EGEA 3R5HA 1W87A 4M7RA 4DXDA 1PDOA 3BEOA 1JA0A 2GZDA 3KB8A 3AFOA 4G9EA 4IHJB 5BT9A 2OZVA 5TE9A 4D5GA 3MLAA 2FK7A 2AJ8A 3E15A 3U7GA 4CDGA 2BKAA 2YIMA 2E89A 4NESA 1CULC 3OZDA 4V24A 1JXAA 2A9OA 4BLTA 3FZEA 1Y8ZA 2BEVB 1V45E 1WDMA 3PDCA 1IQRA 4NHEA 2GF9A 5L45A 2WSSD 5KSYA 1YE5A 5F5NA 3UICA 1TLTA 3I1IA 3JQGB 4GGOA 2BFFB 4P86A 3WBBA 3REFA 4YRRA 4LYFA 1EFLA 4M0PA 4Q6WA 3UHPA 5JCZA 4W4TA 3DTTA 5TRTA 4WLEA 4YAKA 4CEHB 4WUVA 4U8GA 4YLGA 4YAUA 4IVPA 2PUBA 4EJSB 2YMQA 1CQIA 4DC0A 2JCXA 4FMDB 1D0SA 3MEQA 1GPYA 2OGUA 2QI9F 2ZBRA 3FNGA 2A5FA 3IA7A 3P0RA 4XGRA 3SHQA 4YRCA 2XTZA 4LTNA 3TMKA 4D41A 4QECA 3DFKA 2DTXA 3NPAA 5J4KA 4Q4DA 4EHLA 3IMGA 4IDFA 1LLFA 2DR3A 4HLCA 1BN7A 2GR9A 3DDWA 4FFOA 4JITA 3RIEA 4BFZA 4BLWA 3IQIX 4TV9A 1G42A 4TQ9A 3VU0A 2ZSDA 1UM9A 1WUHS 3L1UA 3EUEA 1I32A 3HBNA 1DADA 3IEXA 4ZARA 5U4QA 2WZQA 4YRBA 5FOQA 1GKLA 2DR2A 1SZJG 4H0FA 1DT5A 5JHGB 2XUKA 4G37A 1PL7A 1R0LA 1PZXA 1QC5A 1V5WA 2PKQO 3HFRA 4I55A 4LS3A 3RCBA 1R50A 1G3QA 3JALA 1WULS 1MA3A 1R0WA 2AOXA 1CG6A 1Q7RA 4GQAA 4Z99A 1ZN7A 4GOOD 1Z83A 3QENA 1WXFA 4TMKA 2OR3A 5B57C 1II0A 2ZRGA 1VPVA 4Z54A 1BDIA 2ZATA 2LIVA 3RSFA 5J23A 1CY7A 2Z3ZA 5SYAA 5CFNA 1A9XA 1KAOA 4X3OA 2XTNA 1Y1PA 2R68A 2A7XA 2DUWA 1G63A 4PYNA 1J9EA 3QX7A 1KI6B 1H5QA 1AHIA 5DHFA 1YT5A 1U8UA 4KH0A 4GYYA 2GN4A 2WEKA 3VPXA 3IEIA 4D97A 3IVXA 1BO6A 5BMVA 1JEYA 2CV1A 2EWMA 3C2QA 3H87A 5ARDA 3MCUA 1QO0D 2QM7A 3C3MA 4DY6A 1WPGA 5TT1A 1AS2A 1IK4A 1IB6A 1PJLA 2YTZA 3H2GA 3KKQA 4O4HB 3T5TA 5A4JA 4NXMB 2NYUA 1JR2A 2QX7A 4GVXA 1Q11A 3L1JA 1IHPA 1JJFA 1FVOA 1M34E 3E9EA 4MA4A 4C4PA 5JXHA 2FPUA 2NSHA 3CW8X 3H1AA 1FRFS 3LUJA 1JILA 4LNUB 4XM1A 4PLYA 4B1FA 1IN8A 2A0WA 2PIDA 1QRRA 2HLHA 3I8SA 3JATB 2AFHA 3GIWA 1NBME 1YFLA 3ILXA 4CR8A 2P7IA 3ELWA 2PUTA 4URHA 1TVKB 4WBNB 5IVHA 3PI6A 1XN4A 2CBZA 2WT4A 2Y68A 3HO8A 4CR6A 3GYBA 1QG2A 2CNNA 4E0BA 3RC8A 4F4JA 5BORA 3FSGD 1IM2A 2GZSA 1S2DA 4WECA 3IQDB 2G3YA 2QAIA 2CUKA