3HY4A

Structure of human mthfs with n5-iminium phosphate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
195
Chain Sequence
b'MAAAAVSSAKRSLRGELKQRLRMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
molecule tags Ligase
source organism Homo sapiens
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
total genus 58
structure length 195
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy4A00
2JCBA 3HXTA 1U3FA 1SOUA 3HY4A 1SBQA 1YDMA 3HY3A 3HY6A 1WKCA 2G40A 1U3GA
chains in the Genus database with same CATH superfamily
1FMTA 3BWEA 3VR4H 3OOHA 1V5IA 4RZ2A 3SQLA 3E1GA 4YUAA 1YQEA 3VPCA 2QKYA 1UKVY 3WI7A 2X19A 4AJEA 4WESB 4EHHA 5JZVA 2C0CA 1TCCA 3AP2A 4RE5A 4F4CA 1OLXB 4RIEA 3KVYA 3URMA 4RTQA 1N32B 4HZGA 2GPYA 5U4QA 3M1IA 5K3BA 1ZGGA 3K0BA 1UMDA 3LQKA 3QX7A 4YXWD 4M1EA 3L8YA 1SZCA 2JVIA 1NUPA 3PXGA 1Z35A 2P2DA 2AQIA 3LBIA 3JQFA 1DDOA 2DB3A 3AFHA 1NF8A 1BE1A 1ITZA 1YI0A 2GVDC 1IN5A 1L4GA 1NZFA 1EJ6A 4LYEA 3IP6A 4JVSB 2GA8A 2QRHA 4BKOA 2V55B 4PRZA 1RWKA 5C1IA 2J0EA 3RHFA 1VHJA 4KFCA 1MU0A 1Z4LA 2Y0BA 4LC9A 3TQTA 1O9GA 5AK5A 1L1EA 4YJFA 1N6OA 2XTNA 3RG8A 1Q0TA 3DDOA 2O5RA 4LDRA 4Y7CA 1X1TA 4B47A 1HE4A 2Q5IA 3MWEB 4H7JA 2C04A 5H4HA 4U0KA 4J8PA 4N5HX 3NHUA 4ZALA 4F7WA 4F4HA 1VLMA 3G5AA 4UDNA 3L79A 2VQEB 1LS6A 1YONA 2Z09A 3PKIA 3ZQUA 2IIPA 4JLUA 4Q4CA 3I6IA 2XMCA 1CT9A 1Q91A 3K9WA 1WW3A 1FFXB 3W8RA 3OFSA 1T2CA 4X1IB 4LZWA 1FNCA 2QTCA 5F77A 4EG0A 4S1VA 3B38A 1CU1A 2KYRA 2D7CA 2GNPA 1AURA 2E48A 3T06B 1XPJA 1OUMA 1EB8A 4W8OA 4UM8B 3IFSA 3QSYA 3L9XA 3MOGA 2WI8A 2OILA 5DHQA 2PSFA 1XEFA 3CN9A 3BWVA 3WDMA 3WIVA 2A2ZA 2EHJA 4GRDA 4W1SA 3GNLA 3OJCA 3BJRA 3PHCA 4M38A 1IBMB 4E15A 2KWIA 5DIZA 4F92B 4PC1A 4DCJA 5ITVA 2WKQA 3DOOA 1JX6A 4HAYA 1TTQB 1IVSA 3P26A 1GR1A 3PF9A 1VPLA 3TSOA 4YAIA 1F5SA 3DAGA 3N53A 4CF3A 1TJNA 1PBTA 1TTHA 3HRHA 4PO3X 2DQZA 1DG3A 2IXBA 4NQRA 2IQIA 4KK4A 4I1UA 2GRUA 4RJKA 4YROA 4BMCA 4Z4CA 3UMMA 5FRDA 3CIOA 3EEOA 4MJLA 2M9MA 2J5BA 3U3ZA 3TQHA 2V7VA 4J0IA 5JAHA 4KRFA 3GI1A 5LZ5A 1QIEA 3C6KA 4PYRA 4MA5A 1YHNA 2IYNA 3E2IA 3CW8X 1HH4A 3W3AA 3I9V6 5CURA 1EFTA 1PJ3A 1YB1A 3JAKA 3O9MA 2NV0A 5E9WA 3KETA 3LG2A 4MYSA 1WL8A 3E0QA 1DHRA 2FZKA 4JI0B 4Q12A 3WHLA 1FQOA 4B87A 5HGXA 3PT5A 1QQ5A 5CTAA 2HAEA 1GGFA 1LPAB 3ESRA 2VEDA 1BH6A 1G20B 2F64A 1E89A 1YBHA 2W6QA 4I9HA 2RHMA 3WGVA 4DV7B 3L5OA 3CB2A 2Y9PB 4QEZA 1YDMA 5G4LA 1A9TA 1OQAA 1T0PA 2XQGA 1Z2PX 1R4MA 2WEKA 2X3UA 2XITA 4JJIA 3JD4A 3P2EA 3UJ7A 2AGVA 4IPTA 3UICA 5DCLA 4BMVA 3NIBA 1U2GA 1RAEA 2PMCA 2ZIFA 3OA0A 5K0ZA 3MRXA 4ENWA 2F43B 5I7EA 2W0MA 5JBQA 2AYYA 4DUYB 2P7IA 3F6BX 1GKUB 1G9SA 4FCCA 4DWOA 3S81A 2CXUA 2QMOA 3CGWA 4Q16A 2I6TA 1TMGE 1YRAA 3OOWA 3HXOA 2DR3A 3UWKA 3QPUA 1ID1A 1NNI1 2OO3A 1NUQA 1ZUD1 5KPDA 5HS6A 1QX3A 1R5OA 4N6NA 4CM6A 1P81A 4IQFA 1DBVO 3CPHA 1JVBA 1LI4A 4Q1CA 5LP6C 4DV5B 1PNQA 2W83A 1DQRA 1N5MA 3L93A 2O8BB 1MT3A 1U9ZA 1S96A 2ZOSA 4N0MA 1C1DB 1GTL1 3F6RA 3OEHD 4LUCA 4PO9A 3W04A 3O83A 8ATCA 2A9FA 4UEJA 1W35A 1JJ7A 1PAUA 5E7MA 4WN9A 4F46A 5D00A 1JSZA 1QRSA 5B53A 1DEAA 5HS4A 2OHHA 3DBRA 4JB0A 3ZHUA 2VA8A 3QUSA 5E4TA 2UYHA 1NL3A 4KFSA 5FUVA 4DLPA 3NNNA 1RNLA 1UBEA 1I2ZA 1PSDA 1QZUA 3ZGNA 4ARVA 1PFWA 4EF4A 2GBLC 4ZEWA 5I51A 2R7AA 3EH2A 3THOA 3BBPA 3UMSA 1QAQA 2CBZA 2EL7A 3GMSA 5H3CA 4BWFB 4WAUA 3W4KA 4C4YA 1EVIA 1GLVA 4JC0A 3N8IA 3TSWA 5A7FA 1LK7A 3OFKA 5FO0A 3P0IA 1FBNA 5IUKC 3G82C 3JQBA 5T67A 1W2HA 2O0MA 1L5HA 1YUBA 5CK5A 1JDUA 5K0LA 1OH6A 5TPZD 4J94A 4AS3A 5CDUA 3D9QX 4US1R 3IODA 5JHHB 1N8TA 2O6LA 2D74A 4JR1A 4EHJA 1M1YE 2DFDA 4WFJA 4N6OA 4HGNA 3OKAA 4S1TA 2X86A 2MSLA 5E4JA 1P2FA 3NIGB 3SX4A 3SC6A 1FW8A 5I45A 3JQRA 1JR4A 1RRMA 1UDXA 3L1IA 4DF3A 2GSDA 3EXHC 5IABA 4TXHA 1OPRA 2BGKA 2Q46A 4DREA 4M46A 4Q4LA 5CCEA 5HF5A 5IJ0A 3QKSA 3Q3IA 1L4HA 2GFQA 3QVOA 3T41A 2B94A 3PUWA 2ADOA 2R1TB 4L22A 4NF2A 1NYLA 5D3ZA 3MINB 3JAMA 1A4IA 2XZLA 5DI3A 2R7NA 2RK4A 2ZDHA 1WXGA 4HB0A 4IH4A 3CUVA 3UCXA 2BFCA 2DWCA 3M7IA 3OJ0A 3QEMA 3W6UA 3WY9A 4BLSA 2XXAB 2FR1A 3KLNA 1HYQA 3DR5A 1CYDA 2EFGA 3NTLA 4Q82A 1FVOA 1NSYA 1O95C 2A35A 2GN1A 2WIDA 4IL5A 5TQJA 1WR8A 3TZBA 4DE5A 5JSHA 5K0GA 4PG7A 2BUBA 2VF4X 3BPSA 4UC0A 1GN9A 4AUNA 1ZL0A 4BOYA 1OBOA 4WV3A 4Y0VA 3UQYS 3BXPA 1G18A 2YN4A 1HOTA 1G6OA 3DOHA 4RS3A 1D2NA 4XVQA 5DHPA 1CWUA 2LXNA 4MRSA 2J3HA 3WAKA 4Z1OA 4KR2A 2QL5A 5FP0A 3GLGA 1I51A 1RRKA 3Q12A 4KHPB 1WXWA 2AK2A 3R3JA 2XF8A 3ICVA 1L7PA 4OA8A 5L7WA 1Z17A 2GAAA 5ICFA 4LHZA 5JD3A 2EERA 3UK2A 3ZE7A 4H1WA 1G8KA 5JD5A 5LBTA 1ZUNB 2GXSA 3HWWA 2O59A 3N8GA 3X1ZA 2N1MA 2WIFA 2UUBB 1T26A 3CTPA 4W6ZA 4K46A 4MRMA 5ER9A 2LKDA 4E07A 2XCSB 4CG2A 2AKEA 2YR0A 1P72A 2R5NA 3EPRA 1YRQA 3BOSA 4KLAA 4B2YA 1QHXA 5HPYB 3WB0A 3KRTA 3QHPA 2W6JD 2Z04A 4OGFA 1XTRA 2CV1A 2QU8A 2LP4Y 3U19A 3C1UA 3E03A 4V2IA 1Q77A 1P2DA 2FRDA 3INYA 2VA9A 1Y7IA 4MS3A 3OQHA 3L0BA 5GV8A 4P33A 4PZYA 4G5HA 1TLFA 3HBMA 3HTXA 4K6OA 4ZRMA 5EP4A 1CJVC 5HWSA 3P7MA 1EFRD 2ZKLA 4HH3C 2JI9A 4YPFA 4UQLA 3ZU5A 5JV5A 5I7OA 2XCTB 1YS4A 3GROA 2IYRA 3C5HA 3B60A 3EFEA 3KT8A 1OXUA 3PITA 4RVCA 3W78A 2VUUA 2QDXA 2O0HA 4HAWA 1QB8A 1NURA 1CETA 1DKNA 4KR3A 3HXPA 3IDFA 1H2FA 4DTCA 1JUDA 3WLLA 4ZI2A 1NDUA 2G70A 4N54A 4URHA 2OK8A 4YREA 3ZTWA 2UXDB 2QM7A 2UZ3A 2RGAA 3CCCA 4HEJA 4ADSG 4C0LA 3BREA 1W85A 5JWRA 3ZNQA 1H6BA 1ZJ6A 2CWWA 2ZROA 3QHAA 4WMLA 5B2EA 1BVUA 3M9WA 1USWA 2O2CA 1VRVA 2FJUA 1YOBA 1YRHA 5T3UA 1POWA 2FWAA 2YZ2A 2RSLA 1EUZA 1N0IA 2JGMA 3PU6A 2AA3A 2YVAA 4OY3A 3I39X 4ERXA 1YSCA 3GJ5A 2YS6A 3K0FA 1JLMA 2XCIA 3ZW9A 3G0CA 4M0KA 3UAYA 1FP6A 3HEAA 4YNBA 2JFFA 3ROTA 4ESOA 1QFYA 1PL8A 2KE5A 3TW8B 5JXHA 4KYUA 1O6FA 3A27A 1UL1X 3G17A 3T3GA 1I4DD 2QV7A 2JFXA 2V8BA 3KSUA 5FI3A 1CUJA 3EXFB 3F5FA 3ENKA 3G0DA 3LPLA 4MXDA 4N4AA 4R9VA 4X95A 5TC4A 2AG1A 3PNPA 4JJZA 4K87A 4A0FA 1SXJB 1PNOA 5DNAA 5FBVB 1MB9A 2IEZA 4CMHA 3V3KA 1OZAA 3EXIA 5AW1A 1PR3A 2PTHA 3RT9A 4EHNA 2BR5A 2HK6A 2ID7A 4G0PA 1EWRA 6NULA 3C6MA 3QLUA 3EFHA 3C74A 3SHQA 2WSBA 5JWHA 2JLAA 2FHSA 4FR0A 1OTHA 4HLCA 4IQGA 1N5JA 3EK2A 5DEIA 4YI3A 2XUOA 3ZK8A 1SBQA 1UXJA 3OT4A 6REQB 2IE0A 3V5NA 1GRQA 3QW2A 5DHFA 1U8TA 2G71A 1SUDA 3RRBA 5BURA 3AL3A 4JA0A 4W1PA 3EWIA 3HYCA 1H1LA 4JP1A 1E2MA 2H5LA 1ICEA 1XRPA 3T9FA 4CV3A 5BQOA 4PLFA 3W5SA 5HF8A 2IP2A 5JEEA 1X8XA 2RCYA 4Q6BA 4TS4A 4BWGA 2A57A 1L7VC 3OA2A 3LU1A 4D9CA 5E4YA 5EA2A 3TQQA 4XZ3A 4YRTA 3EMVA 3TZQA 3ESDA 2YBEA 2WD7B 2HCTA 3EUFA 3M1LA 2XYPA 2ATVA 3H2JA 3R5JA 4NPAA 3TINA 4JAVC 4ARZA 2CDRA 1O8BA 2EJUA 2GD2A 3JCZA 3UAXA 3BGOS 1J00A 1UKAA 5TSDA 1EEHA 3ZIDA 1EGHA 2PT6A 4X1YB 5H81A 1H2BA 4TZTA 4PPFA 1AV7A 2X4IA 3CJQA 4MDEA 2B7CA 2J30A 3SK0A 2YXNA 4FZVA 5CLQA 5T6BA 3WL8A 5ENZA 4AN0A 4JGIA 1R3DA 4XJVA 2B2XA 5JH7A 1ZJ5A 3JRXA 3LUAA 4MWDA 5EIOA 2ZIXA 3GLSA 1TMOA 3AILA 3X3HA 2IPLA 4U2CA 3CVOA 4RJLA 1YULA 2VTBA 4BLUA 1PGNA 2J4CA 3ICWA 4RJTA 3S8YA 2R66A 4EDFA 1LPNA 3ICPA 3RKUA 3HA7A 1D2CA 3C3XA 5IT5A 1J90A 1Z9BA 2GI4A 2YH2A 1G291 2IOFK 1QONA 4MPJA 1AOXA 1IZ9A 1ZMXA 5BN1A 2IYWA 3TCNA 3OIUA 4MVWA 3GK3A 3SU8A 4KUGA 1KGDA 1RLUA 1VE7A 2XECA 4AS2A 1FVXA 3Q0TA 3H9BA 1JQJC 1WZCA 2O2GA 3CNHA 4FD2A 4G5RA 4P82A 5JXGA 2VJKA 1GUBA 4QWWA 2LUOA 3DOUA 4PQYA 3SSAA 3U9SA 5HFAA 3S6JA 3I62A 1IHUA 2UZ1A 4G5GA 5I4IA 2VR1A 2FDCA 3DEZA 4A2CA 3FHOA 3RFCA 2HFKA 1GCIA 1GPLA 1YMVA 1NIJA 4MR9A 1YA4A 2QPLA 4TTTS 5A4JA 1VRCA 3EBPA 4I7EA 5IXJA 3PYLA 4HGZA 4DARA 3MIZA 1KFEB 2E89A 1Z15A 2GBFA 4X94A 3TQFA 3WGGA 4AY5A 3U44B 3ZDBA 4GP9A 1UDBA 2WU1A 1PVVA 4F2HA 1CUAA 1X7WB 4DPMA 4ZK6A 1Q6ZA 1N7JA 4FUTA 2P4EA 3KB2A 1PFKA 3MJRA 4GMGA 4N39A 1G2OA 2H1HA 2QP9X 1JLHA 1GXSA 2FP4B 3E15A 1M67A 1ZA1A 1XCGB 3A6FA 4G1BA 4EECA 1IHXA 1TUBB 5FFMA 3WP0A 1CD5A 3QE2A 1E2LA 1G9XA 3S3TA 3PEVA 2B8WA 3ME5A 2J5RA 3G7UA 2HU5A 2JHPA 4G1UC 1BSVA 5DNWA 4WCFC 3NHYA 4UAVA 3A1WA 5D1NA 1T2FA 2XVZA 1LF5A 3FTPA 2GTHA 3OQMA 4CKWB 2ZTLA 3BMQB 3UBMA 1QH9A 3FPSA 4AJOA 1YVRA 2DR0A 4ZAFA 2O8EB 2UZ0A 3S2UA 1PR9A 4K9DA 1EJBA 1XKQA 1EHYA 4Q1BA 2V45A 5TJHA 2IU6A 3RUHA 3V48A 5I7WA 4G6ZA 1QF6A 2FSIA 3OTHA 1F5NA 1KEVA 5DJ5A 2J9ZB 3B52X 3LE8A 1USGA 3GYBA 1SUCA 5AKZA 2C3UA 5EPUA 1SBZA 3OPYA 5JYCA 2JIBA 3SHFA 3P52A 4FT4A 1OXTA 4LHYA 5GOZA 4K9NA 2A88A 3NVMB 4Q3BA 5JJKA 1WOYA 4ENUA 4P93A 2IGBA 3FVQA 5ALDA 2QNRA 2VHZA 2REXB 4B8ZA 2QRJA 1BVRA 7REQA 2VEOA 1ZISA 5FORA 4FGKA 1OWNA 2DZDA 5LMCA 4QKQA 1CJTC 3WIBA 4BO9A 1NN5A 4HD8A 1CW2B 3VR3A 1TEHA 1G63A 1I4EB 1TF5A 1USVA 1G5TA 3AI3A 4FKZA 3EVAA 1CJUC 2UYOA 3D31A 4RD2A 3KXPA 4E11A 3MS2A 3KUDA 5HTOA 1XZKA 1DZ3A 1V9LA 1SOUA 3WLSA 1KVQA 4GLBA 3N8NA 4PFJA 1GL6A 1F48A 1A8UA 3E3AA 4FXOA 5BR4A 1NBEA 1JAZA 2OG2A 2W4MA 2QENA 3EF0A 1QIHA 3PD1A 4JJFA 4WKCA 4ZCPA 1XWIA 3WX0A 1U2QA 3JQ8B 3ZCRA 4C1BA 3K6SA 2YIJA 4MV4A 4H7KA 3HR4A 2IVFA 4U9IS 5TQ2A 2W9XA 3C6YA 2Q3DA 4GXNA 2V54A 1XPOA 2XWSA 3ED1A 1CE8A 2NTJA 3LUFA 3ITDA 1TYDE 2XMRA 9ATCA 1CVLA 1TXGA 1LWOA 4C2TA 3HLYA 1Q3KA 2UUPA 3WO1A 2FI1A 4L5AA 4TL7A 3FVWA 5AVTA 1ACMA 3AY3A 4MI9A 2PH3A 1SHJA 1Z6TA 1ESMA 1P60A 1L4MA 2GF9A 4RC9A 1KDOA 3S2GA 3UG6A 3WNCA 4CKCB 2WZBA 2E49A 5FL7A 1M8JA 1P91A 4NLLA 4BP1A 1O5OA 1Z8NA 4Q1FA 1PGQA 3X44A 4NFSA 1F4LA 4PONA 4HWSA 5E0OA 4ZDKA 1SNYA 4ZJPA 1Z36A 1OU0A 2IZOA 3CNEA 3COSA 3SI7A 2CBGA 1NX9A 3RVNA 2XUZA 1ZVMA 3BRSA 3U40A 1PX2A 1H4SA 2ZR8A 1RWXA 4E22A 1EM8A 3LCJA 4DV0B 3RBZA 4Y2RA 4GQBA 4R68A 3Q5EA 5L53A 5FOSA 1XQYA 4ZREA 5BN4B 3AYXB 3DLHA 1ISFA 4HDRB 4PAGA 3FNGA 4DIKA 1ZQ1A 4LCEA 1P9RA 3NIFB 5THKA 1Z34A 1U0HC 2E4UA 5L8VA 1RAFA 3LOPA 4CN8A 4D0GA 2R6GA 4EOGA 4GI5A 4AI6A 2INGX 4AU1A 1E3JA 1XZNA 2C97A 3RAGA 2IP1A 3SLGA 5CB4F 1QP7A 5FPYA 1G8MA 1M83A 4JUCA 1NW5A 2IC5A 1FTWA 4G5SA 3GLFB 3ZQKA 4ENSA 3T15A 1ISPA 3G59A 1R9GA 4ZO6A 1EVQA 1Z63A 2EBWA 1FNBA 1E4EB 3STVA 4LVOA 4DLNA 1F60A 2ZVPX 3B7WA 1CEXA 4NOLA 3KB8A 4K2AA 1R4NA 1OKKD 2JDIA 2VTDA 4BRSA 4S04A 2F8LA 4LJYA 4CKZA 4UKDA 4YCLA 3CIFA 3LVQE 3WIDA 4ILKA 4Q00A 2G82A 3VU0A 1J0BA 3MW8A 1GV1A 3UC9A 4PQFA 4L9SA 2XYHA 4B7CA 1RZRA 2O8DB 2A0FA 2FR8C 3KXIA 2C00A 3JQBC 3RD5A 1NN3A 2PT9A 3IP8A 5AOCA 1CYEA 4CR6A 4D02A 1BKYA 2NM0A 2VKQA 1B8VA 1QH8A 4F8JA 3V4RA 2ZTSA 3ZKWB 2EXXA 2FFRA 4N5DA 5FPKA 2RJOA 2JK0A 2CXOA 3B2QA 3EEQA 3M6VA 3MBIA 3MXOA 4KQXA 4PF1A 3P4YA 1N57A 5LZ8A 2E6KA 3OX3A 3ONNA 3U9TA 4HT3B 5REQA 3WB1A 1TJ3A 1FDTA 1KI6B 4H7IA 1BYIA 3ICQB 2B4TO 2RBKA 3QBTA 1V4VA 1BJRE 3UWSA 3INGA 2QAIA 2XOKD 1Z0FA 2RFLA 4RDHA 3SX2A 3VKGA 3UAZA 2UUOA 4NK5A 1LQUA 3BX1A 3WSTA 1AG9A 2F9FA 1D03A 3I0ZA 3T5BA 2P5TB 1V7CA 2PXHA 3ZWWA 3DD1A 1B1AA 1Z4NA 2COUA 3E7WA 3AEQA 3RGGA 1IZ8A 3HN7A 2XUQA 4MQEA 3K7EA 2R1VB 3CPEA 1WV1A 3KKQA 3JW8A 4RTJA 4NABA 3CKYA 2J32A 1XU7A 4Y6OA 4HFJA 4OQNA 4D4MA 4QVIA 2LIPA 2J3DA 5CLLA 4MAFA 2PS0A 1CSEE 1E3SA 3PQCA 2ZVJA 3NHLA 3WYCA 2JIQA 3VPAA 4M0PA 4KN8A 1ZUNA 3CBQA 5AI0A 3ITEA 3DKIA 5KTYA 4R7TA 4OSPA 4MPPA 3LQQA 4P86A 4DMHA 4NOMA 3WGMA 4UOZA 4DLVA 4FGUA 4DXHA 1K3TA 1N33B 4YFYA 3GBVA 1E58A 4J07A 2RMKA 4LI3X 1DC7A 4MQUA 2XVYA 4G37A 1W88B 3ER8A 4RGQA 2O8BA 1KI8A 2YWFA 4L4RA 3KXLA 4BVFA 1EAMA 2RHTA 3E7FA 4K9RA 1DKUA 4JJ4A 2QSJA 1EX6A 2HQSA 1ZIPA 3MELA 3PC2A 4PLGA 5TPWA 3KT0A 2WC1A 4MUAA 1WZNA 1ZS9A 5JTTA 1Z13A 1M66A 1V8BA 1QCCA 2C9ZA 3U3RA 3WFZA 2B20A 1KPGA 3SYNA 1O08A 2X8AA 4PBSA 1KOLA 2H4HA 2VP0A 1RXSA 2OCDA 1OH7A 1S2DA 1FXWA 3N59A 1E3LA 4KW7A 4G3XA 1T29A 4GYKA 5ALUA 2I6UA 2ESRA 3ESYA 3MUEA 5D87A 3PQ3A 5FTNA 5I4KA 3PDCA 1W0KD 3JQAA 2F1JA 4YCDA 2W4QA 3FGOA 3WLHA 2UUCB 1D6MA 2FRDC 3OM8A 2YQ4A 3CE9A 1AS0A 4BEJA 5JW6A 4H35A 2QE6A 3U1BA 3T3NA 3ISJA 3N2KB 1P9NA 1JKMA 2Y8EA 1WW8A 4NK4A 3OSUA 4HYTA 5F51A 4K5QA 2PIAA 2R8BA 3K0KA 3KWLA 5FTLA 3ZTYA 1NOJA 2X8WA 1KAQA 1TUIA 1LC0A 3IHLA 2NPFA 3ZQ6A 3FYTA 4TM8A 4BGVA 4EKGA 4MHTA 4EYOA 3CC8A 3MGGA 4FQ8A 4PO1A 3BSYA 4WBXC 5TGDA 2POQX 2PL5A 3G1UA 1WY7A 4IR7A 4X3CA 1UDWA 3O3CA 5FPHA 4M1MA 2Y66A 4D5EA 4QSHA 1XZBA 2WPNA 3HN2A 2DPGA 1XUOA 1LDBA 2AZXA 1AGNA 2AXQA 3C6BA 4LHVA 1E6WA 1NM5C 1PO7A 2EU8A 2FZ5A 3WOHA 4BUZA 1WKVA 4DMMA 5FWXB 1D5WA 2OHGA 2QN7A 1YCGA 4M1TA 5ALFA 3Q7RA 1FC0A 2I5PO 3TVDA 1E6CA 1EHCA 3NIWA 3QRWA 3RKSA 4JMPA 4WEQA 5H9WA 4YJGB 1Z7GA 1M3SA 3DLPX 5KNDA 3DEJA 3LFUA 2B1JA 1YZHA 1QGUA 4GICA 1JIQA 3DAPA 3DF7A 3DM9B 4GRAA 4HQLA 4V0KA 5EG5A 1G42A 3BXEA 4BQEA 5KNDH 4FYWA 3H4VA 3GPCA 5JU6A 5CDTA 1KDZA 1QQ6A 1U28A 1KI3A 2AOXA 3VPXA 4XVHA 4POAA 1JG3A 3ZD6A 3JWJA 3NTQA 4NJOA 4YP7A 1K0FA 1BW9A 5CK4A 4XKJA 2UUAB 5IM5A 2OSVA 1TZCA 1VJCA 3PRYA 4Y1RA 1E0JA 2DULA 1QFZA 1N6RA 2VYQA 4UDXX 2P30A 1WB9A 2VSYA 4P7GA 4MO9A 1AE1A 5KMGB 1JHVA 2IY9A 4UM7A 1TQ6A 2QOEA 4HSGA 4A9AA 2J0UB 3VVBA 2YHSA 5K8UA 1JDSA 2CVPA 2FSGA 3ABOB 1ZX1A 4DMCA 3ZW7A 2CLSA 5EMHA 2GAFA 1LFAA 4ZT2A 4II7A 2HWYA 5DYYA 1Q16A 1ZJJA 5TQVA 1GPBA 1TC2A 3IV7A 2OAGA 4GG1A 3FG9A 3VR6A 5D7NA 2XV1A 4L9AA 4U3JA 1HKUA 2IXFA 3NYIA 4R3UC 4ND7A 3GRUA 5B4VA 3EW9A 4M1OA 4H17A 4DB4A 4QFCA 4URXR 2W6NA 5IRCD 4OHRA 2VF5X 3V7WA 1XOIA 2XSZD 1WEHA 4P92A 2GTPA 3CX6A 4XTRA 3CHYA 4TKUB 4QZVA 2PO5A 2XQVA 1Y5NA 1EI9A 3QI7A 4Y2UA 2A0UA 4QUHA 3D6UA 4BAZA 3IBCA 5DI9A 5CJJA 3E8SA 1ULTA 3NDPA 4EI8A 2H1VA 2Q3JA 4ML3A 3SYRA 3DWFA 2Q5QA 4RXTA 4EY4A 1FYDA 3P9ZA 1CC1S 4BO0A 5AVYA 3VZRA 2ONYA 4Q4HB 5JRJA 3TJZA 3HB5X 1YDEA 4NENA 1E1KA 2CL5A 4MLCA 1P2VA 2FE4A 1QIKA 4LAFA 2BYTA 4LSGA 1OGIA 1GTMA 3ZDZB 2FUCA 3LCMA 2XNJA 3D1LA 4LY9A 3HPQA 3PGVA 3EQZA 4HATA 1E3WA 2NVWA 2X9GA 3VZBA 2RJ3A 1EQAA 4N82A 3ZE1B 1VXRA 4ZTZB 5TB5A 2IS4A 3TZCA 4L76A 3FWNA 1T5LA 4HADA 3AF4A 4ZT5A 4C6HA 1MCZA 5K6AA 1OXVA 1ECPA 4V0ME 1CR2A 1LSJA 1JR3E 1N9GA 3O47A 1AKWA 4X64B 5ALTA 1UK9A 1M0WA 4CTMA 3A6PC 1CQXA 1C2YA 2JBHA 4C4PA 1REQA 2BEVB 1JIVA 3HZRA 3KZVA 2I7TA 4TT3D 1KAGA 2YJGA 3CNLA 2Q0SA 4R2KA 1W9MA 2FDRA 2VHCA 4EW6A 3UQZA 1K5GA 2C7BA 3C8HA 4LXIA 3EUEA 4F9GA 5HIAA 4TPKA 4BO8A 2D0IA 2J5QA 1EUCB 1FDUA 3L0IB 4YFVA 4W5HA 4BLVA 3V3TA 1PKEA 2P91A 2C4HA 1BDHA 3BMCA 2X6RA 4PCVA 3IPLA 4EO7A 9GPBA 1AQYA 1QNLA 4QAJA 1NG1A 4J4TA 4DR1B 4WXMA 3S7TA 3MWYW 3A70A 3DV0A 1BA3A 3RAFC 3Q7IA 4RACA 3EE6A 2J9FB 4AYWA 1GARA 3H2KA 3X1WA 1IEQA 2VK1A 3FIUA 4DUPA 3LYAA 4ZYZA 3IP3A 1IHOA 3IAS1 4L7VA 4UUBA 4W7SA 1Q3TA 2DFVA 2NO6A 1FK8A 1ZUHA 2QW8A 4WLUA 5BW6B 1U28C 4ZVQA 1L8XA 4G4SP 1ODKA 3T7EA 4TT3A 5JBNA 4WIAA 4Q66C 3ROPA 5CB6A 4HVTA 1ZIDA 4K0KB 2ZJ3A 3N5CA 5JEDA 5L51A 4LJ4A 4ABTA 3EEBA 4I0WB 4EGJA 4YRNA 4W5NA 5DDIP 5JBIA 1GTRA 1FS4A 1N3IA 2Z8XA 1J5EB 3QI2A 3CZMA 2XBMA 3C3MA 2RHGB 4QHTA 4XRRA 4DM4A 3R9XB 2AC4A 2QIPA 2ZBUA 3FDFA 3DE2X 5F2EA 2E4WA 2VIIA 1WBBA 1DKMA 1YNSA 2C4UA 2QJOA 5KKAA 3SPXA 1J1UA 1E6EA 3FOBA 2YZMA 2C57A 2RI6A 4K3UA 4NU0A 1JHOA 1N3LA 3IIEA 3TL6A 4O02B 1OFHA 4HOYA 1L5ZA 2G88A 1U2TA 2QTGA 5BN5B 3AVWA 5LNK6 1K3FA 1PRYA 4DQ0A 1PG5A 3ZVLA 2FX2A 1PJ8A 4R40A 4CIYA 3PPXA 3HJBA 1EBUA 1SRQA 2RH9B 3C6QA 1WMBA 1J0AA 1KJWA 1P61B 1Z6PA 2EIHA 4FHFA 4RLHA 5AI6A 5EUCA 3WL3A 1CP3A 2WF8A 5F3WB 2FOXA 4LS3A 3LUJA 4QOJA 2F90A 1ZH4A 2C2OA 2WSSA 5DN6A 1ZQ9A 4X65B 1OF1A 2GMWA 4UAGA 2XSZA 1TF2A 4XUDA 4S05A 3N2ZB 1TCUA 4QTYA 1P4AA 4OUDB 2JEYA 2PZMA 1F3LA 5F12A 3SF0A 5IZCA 3L8CA 3KSZO 4UDOA 3MG9A 3SJBA 3THYB 4M4SA 1DCKA 2HZ7A 3WLPA 4BNIA 4MWTA 3SDZA 4MUGA 3GJ8A 1KQ3A 1KJIA 1PQUA 4PGFA 1SVIA 4RAOA 1E92A 2BI7A 3KALA 4HEA6 4TS9A 2UYQA 3QFCA 1L1QA 4OQXA 4W7IA 1SJ9A 2IOFA 4Y2XA 5K0SA 3E9EA 4Q1EA 1VP9A 2BTQA 1HWYA 2GPWA 4LF7B 1PHPA 4PYQA 5A9TA 1XZJA 1J33A 4EKDA 3MMZA 1J70A 4HN2A 1E32A 4CMIA 2IQ5A 4Y98A 4P5EA 2O2HA 1HA3A 4WK6A 3K73O 4A92A 4BLQA 1LB1B 5FA6A 4EB8A 5L45A 4AKHA 1UAYA 3K0HA 3CSDA 2XB6A 4WXYB 3TOCA 4JJAA 4ZU1X 3DTVA 4YMVA 1AS3A 2BI4A 5MGNA 4FOOA 1GJRA 2QZ4A 1GYRA 2FSVA 2B2NA 5KWIA 2QLNA 3WGJA 3SQWA 4KKVA 3L04A 2WM3A 3SC2A 4U7TB 4ACAA 3G2HA 4GPAA 3OPQA 2K7ZA 1XVVA 4JYPA 4XCQA 2AOVA 3M3DA 1RBMA 2E1RA 1FUIA 1GNSA 3FTCA 3QVJA 4YLYA 3C4JA 2IYSA 1EK0A 1YS1X 4OK5A 2ZVDA 3L3BA 2C99A 1U63A 1YQUA 3DNFA 1Y5MA 4FGJA 3GRAA 1N6LA 2PJZA 3BGWA 3A4LA 3DB1A 2XODA 4O4JB 1GRVA 1QTRA 3MFYA 2O3QA 1W0JD 2CCKA 1HLGA 5CXXA 4AXBA 4DIMA 3PDIA 3LZDA 1BW9B 4RETA 3VOAA 3SS8A 3U56A 1GIAA 3QVGA 5BV1A 2NNLD 3OTIA 5ECYA 1P77A 3IAEA 3ANSA 2OV8A 2RB4A 1XU4A 3GAFA 5A0VA 1YKSA 2ZYTX 2F3UA 1CUDA 3B3GA 1WNTA 4WZ6A 3ETHA 4DRZA 3WK6A 5GZ6A 4CEHB 4WQMA 3TD9A 2N46A 4KRGA 3IIMA 3U26A 4URWR 1XRSB 3DA8A 4DWVA 3F73A 5LOVB 3U7QB 3BFKA 4KO2S 4BO3A 3B13B 2QRLA 3V4SA 2WIKA 4P84A 2JKVA 4EY5A 2VZ9A 3E4CA 2Z4SA 1LPMA 5B1IA 3PIRA 1PSZA 4I1IA 3WQSB 1EBFA 1E2PA 5HNKA 1E1MA 1F8UA 1XZDA 3SICE 1IUOA 1S3FA 4BX9A 4DCUA 2O5CA 1YT5A 3IIJA 3MLEA 3PUVA 4ZO4A 3W1VA 4HXFB 521PA 3E6AA 1L5KA 4YRZA 1H0KA 4E5KA 3V7NA 1R0LA 2DCUA 1KOJA 1B74A 1LI7A 2I2CA 1ORTA 2FHPA 3IMEA 3DTNA 3LUKA 3DMGA 2RGUA 4NNOA 3QLVA 3R8CA 1X15A 4OJTA 1E94E 4TS3A 3V7YA 3VA7A 1OIWA 1AM4D 5G0WA 2HCJB 5BSUA 2CBXA 1UDRA 2O2XA 3IR7A 3IURA 1GPYA 4J3FA 3ELWA 1CRZA 4UUOA 5AKJA 2IGTA 3QEJA 2XMPA 5CX1B 3O4RA 3A9UA 4A2QA 4EPTA 2B4YA 1QWSA 4S2UA 3VZPA 2FN3A 1QDLB 1DAOA 1ESCA 3R3ZA 3AHHA 4QOSA 1JKXA 1PFUA 2FWBA 1ECJA 3KQHA 5DZSA 4BFCA 2NG1A 3M8KA 3X0DA 4FFPA 2C7OA 2YDYA 1JWLA 2R2GA 3TRIA 3C7TA 3TFQA 5HJ7A 1DAFA 3FYSA 1DG9A 4L27A 4GP7A 2FPSA 4HCJA 3CX7A 2JGLA 4HN9A 5IDWA 3W8NA 4ODIA 1CDEA 3JQEA 3DVLA 1OWLA 3H3XA 4RDIA 1KDRA 1OFTA 4UBIA 4IKEA 2QX4A 3O84A 1N25A 5KVQA 2V6MA 1OE0A 1GA1A 4GX2A 3VYVA 1NSTA 3HLKA 1REQB 3Q9NA 1ODIA 1MD9A 4Q01A 4LWZA 1DINA 1YS2X 3FRJA 4EKIA 5K5EA 1Y98A 1R16A 4EGCB 4Z7OB 1IQUA 2LW7A 4ILEA 1YJAA 4TTQA 4B6GA 1T8RA 5HIMA 2ZRPA 3VC3A 6CHYA 2IF0A 4X6LA 1ZRNA 4RQTA 3T0GA 3WB9A 2YBDA 1DIAA 2DTDA 2D5CA 3S68A 1QK4A 4JLNA 5IYZB 2YL2A 3DV2A 2OESA 1LLCA 2AUNA 3FFWA 1P2TA 3VX4A 4WJKB 4ZHQA 1NVTA 3VV3A 3FSJX 1NKSA 1KPIA 1ZVVA 1AQ6A 1DXQA 5A5FA 3O8NA 5L3ZA 1HK7A 4OKNA 4NZOA 1JR6A 5DBOA 4V1CA 2GD1O 3G6KA 1PL6A 1OBCA 3U62A 2G36A 4O2LA 4B31A 3I1JA 3I1IA 1P5ZB 2ZI4A 3ZVRA 1BCSA 2DF8A 1E9AA 1J8YF 1MVNA 1N6HA 1BHSA 1MRSA 2IEGA 3L82B 4C7BA 4ESVA 4WHMA 1Z5UA 5TX7A 3GXBA 4FSHA 4H7HA 5J4LA 4FW9A 4HAXA 5K0CA 2VHWA 1EG2A 1VJ0A 4JWKA 3WYAA 3IVMA 1VLJA 1UQRA 1PR4A 1WDTA 2E6UX 2XXBA 4MA4A 5JZSA 3I01A 3IVAA 3D8HA 4F2WA 2O50A 3L8GA 2QTMA 3I6ZA 3KOZA 4F0JA 1HDIA 1ECLA 1NUAA 4HVLA 4PNEA 4FFOA 1EMDA 2G9VA 2IT1A 3QG5A 3T4PA 1KYZA 2YQZA 2Z9CA 3HVUA 4K8RB 3D4LA 5M5BA 1N0VC 4B3JA 1X0VA 2JGAA 3ZV3A 3OFND 5KYUA 2FSUA 5I48A 3CPJB 3L05A 3D8TA 1DUIA 1QCYA 4D99A 4Y2QA 2JLWA 5DTMA 1SHUX 2C83A 4PAQA 5G53C 1WE2A 5HRAA 4FZ5A 4GXQA 1N2EA 3EBOA 4R1SA 3T9BA 3LT0A 3RHSA 1ILEA 3C8UA 3CEPB 4I4LA 5TPZA 3WWCA 2WIGA 4RKWA 3ZE6A 1J4AA 2ZUUA 3PKZA 1W9HA 3G2PA 1VKNA 3HJUA 4QVGA 5ALLA 1KWKA 3MQ4A 4JYAB 2O4UX 3P5BA 1SCNE 4L08A 1GU0A 1V25A 3O1IC 4C4OA 3OCJA 5BNTA 5GJCA 2Q6KA 3ZLTA 1TQ8A 2I4LA 2QMHA 4BP8A 1S0UA 1K3UB 1U3TA 2QPTA 3AQIA 4TGLA 5IUJC 2QY9A 2RJNA 3W1EA 2Z1NA 1NV9A 3O8LA 4RK4A 4H1UA 4G01B 2VK8A 3BE6A 2O8DA 2VLIA 2X8BA 2A67A 1Q0HA 1UR5A 2PSHA 2TYSB 2XI4A 1Y3CE 3KELA 3NETA 3WBFA 3BEOA 1GN8A 1FF9A 4YAFA 3K0CA 1TKCA 4NE7A 4BYMA 5IPFA 4NE9A 3WFIA 3KAPA 2JBWA 1A1VA 3BORA 1WKBA 1PS9A 2IOQA 2HDOA 2AYXA 4KQ1A 1AKUA 2AN3A 4BGEA 1QE3A 2OGZA 3C4VA 5FPPA 5LBIA 4FPXA 3MUNA 5JXJA 2WNSA 3AG5A 4B4OA 3HBFA 2YTZA 3UHPA 4Y6QA 3HDJA 3U4GA 5KQGA 1E1CA 1EPUA 1N8NA 1S5PA 1DVRA 2PMKA 3RUDA 4CMAA 2AKAB 1I6LA 1VFPA 1ZD3A 2XMZA 2EZ4A 4FYYA 3HC7A 4IIFA 4LNUB 2CL7X 1NXPA 5FFFA 4P2BA 2PUTA 4KODA 1T0JB 3CVWA 4CF5A 2XAUA 4HLNA 3QK7A 1T4GA 2ZDGA 3NNDA 2OORC 1K98A 4U02A 3G9TA 5B64A 5EHIA 1UJNA 3UMGA 3VDXA 4C14A 4JB8A 2NZXA 1YC5A 4AF6A 2BE7A 7MDHA 5JS1A 1W94A 2I76A 1Z16A 3FUXA 3IQEA 5AJZA 3TGPA 3K70B 3P71T 2BCEA 2V8OA 3Q88A 2D5AA 3TR5A 2D8AA 5JNSA 4R9UC 1RRVA 4G2TA 4OGKA 1S9DA 2LE0A 1TU3A 1GKLA 3E1KA 3OHSX 2G17A 1I2MA 1YBMA 3OIFA 5TR9A 1PT6A 1J2UA 1TVMA 5AOVA 4CF4A 1NR7A 4WT7A 1JMKC 3IEUA 4CLRB 2JHFA 3UH0A 2ZIWB 4B4DA 3D0OA 4P8RA 1E6UA 2NV2B 4DXDA 1CIJA 1JDBB 2J67A 5JAZA 1E9VA 3PNBA 1H2XA 1PTJC 2AUMA 2ERXA 5DIFA 5IT9A 1FUKA 2WZDA 3RVMA 1WZUA 2ZSDA 5LL6P 3IP7A 3RTBA 2O3SA 4HF7A 2HYIC 3ZHVA 2R62A 4FT2A 2Z6UA 3RREA 1EGVB 1K6MA 2A59A 2IU3A 2XNDD 3FUVA 1VE3A 4RGVA 3F6EX 1RW4A 4CIBA 4GLLA 5JALA 2DT8A 3TL2A 2ZZNA 2HCBA 2QP4A 1Y9EA 2CNNA 1CEYA 1FTYA 2PBLA 3IBTA 2GO7A 3LXUX 3N05A 5JSUA 2AFIE 4D9GA 2XBUA 2IEDA 1FFAA 3OP1A 4LQCA 2Y1XA 4PYNA 3A6HA 4AULA 4FWTA 1XEWX 4XD7A 3BMOB 4QJIA 1JWAB 4X45A 4D4GA 2KQUA 1AGXA 3OBBA 4ED9A 5LJIA 3LC1O 2RONA 3HKDB 1QJCA 2Q9BA 1D7AA 2JB9A 3ROZA 1FY2A 1Z75A 2YVLA 4BP3A 1LWNA 1M6EX 4MQEB 3CH4B 5FL3A 1NJ1A 5KVCA 1Y37A 4YJ3F 1EFLA 2HI0A 1AKYA 1K7XB 4TTJA 1QCZA 5CIYA 4E1VA 3O4VA 1P31A 3AEKA 2YRXA 2H16A 2QTWB 2WUEA 3M6MD 5K20A 1WUTA 1PJCA 3NYWA 2Q5CA 1FP2A 2QX6A 1DCTA 1K66A 5JDCA 3D64A 1G20E 1NF9A 3GWZA 2BR3A 3DPUA 5LR6A 2QTLA 3B6KA 1DRUA 2HK9A 4LJ9A 5M7EA 3NTRA 1V1JA 4TV8B 3ULKA 2PE5A 1M0SA 1MT0A 3CCFA 4YJFB 3GCWA 4GQAA 5YASA 4U2DA 3GBSA 2H7YA 1WY5A 1V35A 1C3LA 2NTYC 3GJSA 1XNJA 4P53A 1GA6A 1TUBA 2WUDA 1SQ0A 1RZUA 4YUZA 1K88A 3ZDFA 3BHMA 4M60A 5HIJA 1NVXQ 5TPWB 1JQEA 4B43A 4A8TA 3IPCA 1WHTA 1BIFA 3P0JA 5J4YA 1XPUA 4MI1A 1JHZA 3ETCA 5KYGA 1CUSA 1U0RA 4A8PA 1KYTA 1XZEA 1EB9A 1PBNA 2Q5FA 2EJBA 2WU4A 4JELA 5AM2A 3PXAA 1W0JA 3A1FA 3FCOA 2YJ5A 3GEHA 2WVAA 4FYHA 2V9PA 1U1CA 1CUVA 2GBCA 2IZZA 2GVNA 4ETNA 4UEQA 5ITZA 1JQLB 3G7NA 5AVQA 1P0CA 1M2HA 2N9UA 3NBKA 1O96A 5FAXA 4B3CA 2B0JA 1C7EA 4MVCA 4LRUA 2ZJ2A 2IHKA 4EB0A 4JEHA 3PCRB 1G19A 5CB0A 5AW0A 2UDPA 2Y1DA 4IDBA 1SWVA 3ZWDA 1Z2OX 4B40A 2ZJBA 1HDEA 2QB5A 4N65A 3TI9A 1Y8CA 2FOIA 1V2HE 4OFXA 3RK1A 3WMEA 1BD3A 3RVPA 3G2QA 1LSUA 1NXTA 2AKYA 2H17A 3OPMA 1D07A 3AP3A 1U4OA 2KX7A 2OFFA 4PQRA 1XL1A 4DA9A 2A9RA 2UYYA 2WABA 3F9IA 2IBTA 4W9RA 1GSIA 1ML4A 4Y6SA 1J0CA 1RLOA 2FW1A 5DK4A 1L2TA 3K8OE 4J4HA 4B7ZA 3HL4A 3MWDA 3OWOA 3EQ2A 2QUKA 2I3AA 3H1EA 3BN3A 3E3NA 3UMVA 4JK3A 2QVCA 1GYQA 1RE0A 2H1RA 4NCJA 1A5TA 3M9LA 5EIHA 3VR5A 2J3KA 3HJTA 1VSBA 3WHIA 5KNLA 1WA5A 3GUHA 4L4UA 3F7OA 2NU9B 1EK2A 2WKPA 2QRMA 1QZ3A 2QQFA 1SBHA 4IMJB 2KPOA 1ZJZA 5GIOE 4HGPA 1YS7A 3LKZA 5BVGB 1R9NA 2VPZA 1OI7A 4Y9RA 4D3FA 3RC3A 1Q84A 2PL9A 1KGSA 2E0IA 2YV2A 3FA2A 2G07A 3ZY6A 3PXCX 4GKAA 1UXKA 4JQOA 2GXQA 1BWSA 3CUEF 3GIWA 2QDKA 4IDQA 4CCWA 3RSOA 3FDZA 3V1YA 1KNXA 1YRYE 4LGYA 3PQ2A 4FCVA 5CU7A 1UPUA 1YI8A 2I1WA 3GGCA 4MRAA 2DAPA 1DOZA 3TMKA 3ENQA 1WU8A 2JCXA 3HXKA 2Z3WA 1I10A 2DHRA 1I3NA 2Q8QA 4UZEA 2D2FA 3HVKA 2FTKE 1G7CA 4QFDA 2AN9A 3KJEA 3DYVA 4JY7A 3ZHBA 4PYJA 3UJ6A 3X1XA 1ZR4A 2Z2ZA 2CNWD 1R9JA 4RTRA 3AKDA 2R7MA 4YJ2B 1KR2A 2GCEA 3GW8A 4D0LB 3P9RA 1F3OA 3A9SA 3ETEA 1CY6A 3L0OA 5EIEA 5AUPB 2BMEA 1C4KA 1X9IA 3KZNA 3BRWD 1R0BA 3I73A 1MC5A 2BEWA 4MGKR 1OV4A 1RMQA 3OOJA 5FNVB 1B0AA 1OA0A 1R6DA 4QQRA 5C1PA 3CEHA 3DHVA 4CBVA 1FZQA 4QEKA 5IW8A 3E53A 3OLCX 5D84A 4V03A 1E7YA 1J7KA 3RS9A 1ETUA 5IVKA 3ZJVA 4Y3UA 4RYLA 4EAQA 5ES4B 2J3QA 4D46A 3TZKA 4JYCA 1VLVA 3C5WP 4MPRA 5J2TA 3OCWA 1VJDA 3AZOA 2QROA 2JI6A 2PR2A 3UG7A 2I2WA 1GZSA 3JRNA 2PZGA 3LQ4A 4Z3DA 3RVLA 3KJQA 1KQPA 1X3LA 2IE8A 1XTIA 4DIUA 1FMLA 1I4TD 2GOYA 1MX9A 4FS3A 4KP7A 2D7DA 3KKPA 1MB3A 2CJPA 4IIYA 1KJJA 4LX0A 2H2IA 2HSJA 4GZMA 1SXGA 2KI5A 2D54A 3EZYA 4OP3A 4GVPA 2XNCA 4I8IA 3WJ1A 4A27A 1ID8A 1DT5A 1A50B 1JAIA 2X2PA 3T7KA 4FDMA 2PMEA 1KY4A 1LA2A 1BCRA 2AJTA 4J1SA 3TZEA 4PBTA 3HNPA 4JZKA 3ZCQA 1TYBE 1CE8B 2EJVA 4RZIA 2X14A 2Y68A 3UM9A 2FUNB 1C7ZA 4QJBA 1L5WA 5GIPE 3UT5B 3GGJA 3ROXA 1TK9A 1BJTA 3ACBA 3MAJA 1OD6A 3OJFA 4IDHA 1LXCA 4WOPA 5CFRA 5K6TA 3D7NA 1FDVA 3EOAI 4ZDIA 1JV2B 4FU0A 4N5NA 3OQNA 2GZRA 3U7GA 5H3HA 1QAOA 1CZOA 1L7OA 2Q6IA 5LQNA 3AHIA 1GZHB 1B14A 3DV0B 3L7KA 1X87A 4WESA 5B57C 4TKLA 3I2KA 3K2IA 5J43A 4PR3A 1W1WA 2HSZA 3SQOA 1YK1A 4D9EA 2WG2A 1TT5A 5DM1A 3QU4A 3BERA 3A3NA 3QJGA 3LBYA 1QOZA 2A5LA 5LLTA 1WHTB 1O2DA 4RD6A 3PCXA 2B83A 1X3SA 8ABPA 5GPBA 2I1VB 2HL6A 1QQTA 4K0RA 3ITKA 1CJMA 1ZBDA 2GZAA 3HCEA 3RC8A 1PR0A 1G21A 3E0XA 3JQ7B 1LS1A 4MLZA 3THRA 1R6BX 4IJ6A 4BQOA 1UM8A 3BMOA 3EZ9A 3NHWA 2NGRA 2HUNA 3MCAA 4DWJA 4ZVOA 2JJQA 3OZTA 4LJLA 3PDJA 4QBKA 1KYVA 1PGPA 1GZVA 3VTKA 4E5YA 1J5XA 3T52A 5TRTA 4CRWB 2XGOA 1NE2A 4QC2A 4MOWA 5TMBA 1VKRA 4EG1A 2PY6A 1ZCFA 4AO8A 3SNKA 2P75A 3S2SA 2P3SA 4DJEC 1V48A 3Q5DA 4IJKA 3KKOA 4E70A 4F3KA 1LVUA 3N6VA 1C8LA 2JS7A 2G5CA 1JQBA 1EIWA 1WU7A 4OXIA 3FLAA 5FWYA 4ZICA 4G26A 4UAJA 3O73A 3VC2A 4IRUB 2CLKB 1ZJ4A 4B6JA 4Z49A 4AKIA 3BICA 1JAYA 3GFTA 3NT5A 1PEDA 2AFVA 2QXUA 1J09A 1U3GA 1ZNYA 3RAPR 5BWLA 4BV9A 1R6XA 1TRHA 3DNPA 4E30A 3AU8A 2WF9A 2JLQA 3DAHA 3SS9X 4B6QA 3K9BA 1XXHE 1V1RA 3GGGA 1H1LB 4RKQA 5KNDD 4QTUB 4OF4A 5HM6A 4LFAB 3NTOA 1LNQA 3DFKA 3SKXA 1D0VA 4H3KB 1F8FA 1AF7A 3KOOA 3M4NA 4DCSA 1E1RA 1A4RA 2WFZA 4D8WA 3IUYA 5IDXA 3F6CA 2Y1CA 3O4IA 4C0XA 1C4XA 1J39A 1QLJA 3O3MB 2W0SA 4ANFA 4US2R 1R0RE 3Q0EA 4F12A 5GGXA 1TEVA 2E5LB 3F71A 1E7SA 2XNHA 3JQ9A 4KIUA 4MW0A 1SZPA 2FZVA 3IAM6 4N0PA 4OQMA 5EVCA 1P45A 2H31A 5EWLA 1R5NA 2OM2A 4F91B 5LQRA 1ZAKA 1T6NA 4Y1RB 1RAIA 3LOQA 4R2LA 4E3ZA 1FTGA 3ADPA 2YNMC 4D3XA 4D56A 3IP9A 2FFBA 3UOWA 1CVRA 1AQJA 2Q41A 2BN4A 2FMKA 2HH9A 2QS9A 3BWBA 2FEAA 3K09C 3HJHA 4TT8A 1UJ2A 1U9JA 1JHYA 2QYSA 3LYUA 3OE1A 2IXDA 4GMHA 4H59A 4MKGA 4HNAA 1J24A 2CZQA 2NO7A 2VNKA 2VN8A 2B25A 3HH8A 3M83A 4GM1A 2YWEA 3EEFA 2I2XB 3D3WB 4PRLA 4CM1A 5HW0A 5REQB 2UYCA 1WQ1R 4HRAA 2QGZA 1ZM2A 2QUAA 1JZQA 2ACVA 4AJ2A 5L40A 2FEXA 1ZC3A 3BL5A 5L6LB 2QA5A 5HDQA 2W2KA 1ZGHA 1V5WA 2Z98A 3QA3E 5ITZB 4JVLA 3NV7A 4M9UA 4HGYA 1WMSA 2QL9A 3AQ4A 3E9MA 4Z9BA 4J2OA 2B5OA 1A77A 1AD2A 1P4RA 1UFVA 2Q2VA 4IFIA 3JQCA 3EZFA 4TTSA 4ROSA 5DRYA 4WK2B 4DUGA 1GVNB 3H7IA 1DKPA 1Z2CA 2ZYWX 4C08A 1O95D 5ICGA 4ND8B 4FOLA 2EV9A 5THXA 3QNUA 1JXOA 1WXFA 3B2EA 3JYLA 3L92A 4C06A 2A78A 4LPKA 5BSWA 4F93B 5JVDA 2PVSA 4EJMA 2FPKA 3NBYC 4FI3F 4BTEA 5KYUB 1IXSB 3L1KA 4FHZA 3C70A 4Q0MA 1RCTE 2I66A 4RCZA 3GGDA 4IXDA 3RIMA 5BUSA 2QE7A 5GADl 5HK8A 2P3LA 4EPWA 1V11B 1Z3IX 3UWDA 2NP6A 3I8OA 1NVAA 5DHTA 1CIVA 4EATA 3H4IA 8ADHA 5KVAA 2O3JA 1S02A 2IPMA 4BVEA 1GPAA 5DHSA 2BZGA 2ENWA 2BOVA 5DSTA 2RAUA 2QV0A 2BLNA 3WQBA 1N9GB 4JN6B 3I5AA 3EXIB 4B4KA 3EC1A 4LQDA 4XPZA 3SEZA 4G4GA 5C8YA 2EKZA 1NN0A 2B37A 2H4ZA 5JMOA 2AQHA 4MEAA 5IAEA 1EK6A 1LCIA 2VP3A 4YDRA 3VNVA 3E3LA 5HKBA 4YVFA 1JEOA 2P2NA 5E3IA 4KXUA 1RM4A 2W93A 1R74A 4Q4JA 2IH2A 4O5AA 1DOAA 4RIHA 3OLZA 1ULBA 5PNTA 5TGZA 4PZCA 3B48A 5GQSA 3UIEA 4XB6B 3VPFA 2AW3A 2E82A 2I7DA 3F6PA 4PE5B 2J45A 3EMBA 4GH5A 3RV4A 4B76A 4RL6A 4EZIA 3TZLA 3DLCA 3F4LA 3WGNA 2WYWA 2HMWA 1VG0B 4DIBA 5CB4A 3BGSA 3U4CA 3DW3X 2FW0A 1BN6A 3PE6A 1HE5A 4DT1A 5CIWA 4AJPA 5JJLA 5KOHB 3F47A 1KEPA 3SEQA 3KQLA 4GZ5A 2QLTA 4EA7A 2LVBA 2Z56A 4TUYB 2OP1A 4IVQA 4JR0A 2C92A 2FQ1A 3K1YA 4HH1A 3GLGE 1XRNA 3A2MA 4MJ7A 2XKJE 2ANBA 3OIWA 3QEMB 1F2TA 5I7AA 3AESB 3HABA 3F2IA 4P35A 3QLUC 4MWBA 4XGKA 3VU1A 4E2FA 1KMMA 1AS2A 3LY7A 4GS5A 5AD1A 1VMIA 4OSEA 5EWJB 1HFEL 3OICA 4IJMA 2R68A 3KKMA 2ZRIA 3MS4A 5SYNA 3DD5A 3CFYA 2Y71A 1YVPA 2YIMA 4EA8A 4ZZ0A 5IBQA 2A0XA 4N03A 2MR5A 3DB2A 5JMPA 3V4FA 2AG5A 4Y9DA 5K45A 4X00A 4OGGA 5CDYA 4CIAA 1F8YA 1CDDA 1M2KA 2E55A 1OKKA 1OYOA 2BGTA 1P62B 1YBVA 1YCHA 3LA6A 2XA2A 3CPSA 1ZSVA 5HCUA 3BFJA 1NWCA 3HUUA 4DDHA 2RAFA 4NAUA 2V0CA 5D3MB 2PKQO 2ZK7A 1RKVA 3PVSA 2QUIA 3UJ9A 3ZJ5A 2HRCA 3TXXA 2PRJA 4UULA 1SQGA 4ZQCB 5LD2C 1G3MA 1RP7A 1AXGA 1U3UA 1WSBA 3X2EA 3FPBA 4NEQA 2ZE7A 4E13A 1VE1A 3ZNPA 1MEEA 3O90A 4TRNA 2FZEA 4PSUA 3UK1A 3AM4A 5GTDA 1RBQA 1NYRA 1JDJA 4YACA 2QX9A 3EZNA 1NOIA 3N9IA 3RVRA 5KYWA 4O4LF 3T4XA 1E3EA 3R20A 4QHSA 5CAEB 2W8BA 4L73A 4MV1A 4TLCA 3HBJA 4BE9A 1QHYA 5CVDA 4DNXA 4KTVE 2OXTA 4C07A 4YJGA 1SU6A 1NC1A 2CJFA 3HFSA 4LV8B 4DCMA 2Z5LA 1LTHR 3C7CB 4JJKA 1KSJA 1G0OA 5BT9A 3ZXXA 5AW8A 3PGMA 2WMNB 3PX3A 4JIMA 2W43A 1Z8DA 3DH0A 3BMQA 3JATA 3KAKA 3ZDRA 1IAVA 2OBMA 1ZW6A 1J1IA 3BFPA 5CA1A 1Z82A 3LY8A 4RJ2A 1ESZA 3SVTA 2M6LA 4NBNA 2YWHA 2P0AA 4IGEA 2C5GA 2V0NA 1JG6A 2W8BB 2Y3IA 2P35A 5EWLB 3WLIA 3EPJA 4NBTA 2HA5A 2VJDA 5D5HA 2J4FA 4L5BA 1BXGB 1UJ5A 2OSBA 4NP6A 3VI3B 4E6PA 5KYWB 1VYVA 2HC9A 1UDCA 1ADFA 1MTOA 2C5EA 3M82A 4NBWA 5FBLB 1MUUA 1XAHA 3PDIB 3UJAA 4A0GA 4IDEA 4NV3A 5ADVA 6GPBA 3L0YA 2F4VB 4AF8A 1UZAA 2BFOA 2AZDA 1T0IA 2IX9A 2UYGA 4NMWA 4B5KA 5KHOC 2Q9UA 5ELMA 3EOBI 2PRYA 3ZU4A 1W4AA 4BATA 2ZKIA 3FZQA 5BSEA 4HNAB 3ZWQA 4BNKA 3OZCA 5BUQA 4YDQA 1CY2A 5CH5A 1ZN2A 5KTMA 1NY5A 4QNRA 1PLLA 4C04A 1LLUA 2B36A 2HA6A 2C9CA 3K0AA 5K4HA 1EFUA 4G65A 2B3TA 2OFOA 1VQ1A 2XKKA 1GDTA 3I01M 2TECE 4AJ9A 5I9TA 3H5NA 4DTIA 1SUFA 1FJGB 1Z4PX 1KI7A 4E2WA 4DDTA 4ZI7A 2ZT6A 4TYNA 4YK7A 4Z4HA 3QJYA 3B1KA 3H84A 3DMHA 4LNAA 2HRZA 4Q19A 1RWQA 3S0JA 1VJRA 3UGJA 3PVZA 5BQ3A 1BXRA 2CMKA 2Q3FA 3I1FA 3IALA 1E63A 3X1JA 1H93A 1DTWA 3G68A 4DBZA 2RGNC 1S2GA 1U1IA 3ETDA 4NDZA 2EP8A 4O2RA 2CFRA 4W8GA 2JRLA 3W34A 1M1YB 3WK4A 4URZR 5DLPA 3HRKA 5BUZA 1YDWA 2JIZA 3Q15C 1ZHFA 1GCOA 1VL0A 2HKIA 4CV2A 4F4JA 4B3SB 1QVZA 2Y1KA 1OHHA 4KIJA 1E1LA 1ORDA 2JAHA 2OCAA 1IUNA 2XA1A 3CNBA 4IOLA 5FWXA 3L7DA 1L1FA 4KXLA 4UVHA 4AZ3A 2FZWA 2HTFA 4E08A 2PZ8A 1KYYA 1MAAA 1U4SA 3O26A 3OJWA 4E46A 2IS2A 1IDOA 1DUSA 1M2JA 2FY8A 2AB0A 1U2DA 4YP5A 3R0JA 3DMTA 4FE4A 2PTGA 4GMFA 3CZ5A 4GYWA 3OQJA 3BE8A 3IESA 1NU8A 2E85A 3BF8A 2FUG1 2PLAA 1S4MA 1B73A 3GUYA 1EFAA 4YRGA 1HMPA 1DJQA 3GRVA 1CFJA 3MGBA 4I3FA 4YS6A 4E31A 1P1FA 1GY8A 4RVNA 2GA9A 3FWYA 1K7CA 1GFSA 5AK3A 3CF2A 4YP9A 2X8JB 3SEFA 1M6VA 2H2WA 4O08A 1OB5A 2QEQA 3Q9SA 4QYWA 3WIEA 1GU7A 2QZPA 1XV5A 1U0OC 3MSXA 3UHAA 4JIGA 3WL6A 4RZSA 4BNUA 3ZN2A 4ZOBA 1KO8A 4HG2A 4K03A 5ALSA 1ZITA 1NW9B 5E1MA 2HLDD 3IT0A 1ZD4A 1H6CA 3IXQA 1HORA 3HB0A 1EM6A 1R64A 2QUHA 1A2OA 3A6EA 3LDUA 2AZTA 2FKAA 4ZVMA 4LDAA 2C2BA 5EN4A 2IRWA 4D9JA 5LUAA 1LRLA 5BMVA 5AT1A 3X1DA 4B3IA 5HXAA 3QVKA 3TLXA 1JU3A 1KAOA 1YZ3A 4Q6WA 1IPHA 3NIDB 3AF1A 2VPTA 1IMOA 2FN9A 2GILA 3E2PA 4U0JA 1EFHA 1Y3FE 4QNNA 4Y2SA 3KV3O 4XEUA 4P3XA 2CVHA 4OLFA 4P3PA 3GFRA 3F97A 4K05A 2ORVA 5AW5A 2FK7A 3TBHA 5FTWA 3BEDA 3EXFA 1NOKA 1XZAA 1AKNA 2H5EA 1MW9X 1WCIA 4G0NA 5SV2A 4F7DA 5KVVA 3N3AC 1DTSA 1PS8A 2J09A 1M1UA 3DE7X 5WRFA 2WTMA 1U11A 2YHIB 1W4RA 4JT2A 3T5TA 3T3MB 4ARUA 3A0RB 2BJHA 2R5WA 2FMTA 3STWA 3PDHA 1X7WA 2GPAA 2OE2A 2YRWA 3M5CA 3MK31 1WBDA 1P33A 1G21E 5F7JA 1EXDA 4Y6PA 1P1KA 1FTQA 1Y3BE 2HBYA 4E21A 1EFPB 4V1CI 5JZ9A 3HK2A 4KI0A 5B12A 3RHTA 3GUZA 1KVSA 2CHFA 2I67A 2MINB 4C89A 2IWHA 1JLLB 2GM5A 5E2IA 3SC3A 1E2HA 4N0DA 4A1OA 4E03A 1NJ6A 4AG3A 3M3HA 1NQOA 2R1ZA 5LZ9A 1OWPA 4DLAA 1GNQA 3L7CA 4XGQA 1ZOLA 5FBWB 2H63A 3RU2A 3BXZA 1IRIA 2ZIXB 3PUXA 1YB4A 2B9EA 1LSOA 2C9DA 2R4TA 4J1NA 4GPEA 4EJSA 3HACA 1HFJA 4DZTA 4TV9A 1O8CA 1A2BA 2ORWA 2VRCD 1QOPB 1ZXXA 5CT6A 2XW6A 3CH6A 1WVIA 1UBUS 2P62A 3N7TA 4H1HA 3OZBA 4K40A 5AXAA 5GZ3A 1IJBA 2VL7A 2XUKA 1VPEA 1XMXA 4R51A 3SIXA 3ZLBA 3ZZ1A 5LXTB 4PG8A 4AZWA 2ZJ4A 1ZYUA 5DGXA 1Z62A 2C07A 5JJCA 1ELOA 3R74A 1X9HA 2OVBA 2YJ3A 2O7QA 4DDUA 3IVRA 4GZ3A 1TYAE 5ECDA 4HAUA 3G9QA 2F8MA 4YTEA 1MB0A 4LDQA 3KZ1E 4PLZA 4ND5A 4ENRA 1Y48E 2K7FA 2DEUA 1T2UA 1PR5A 4F8EA 1B0PA 2QXYA 5I3CA 2V7GA 2FQWA 1K27A 1RCUA 1X1CA 3C87A 2ES4A 4B4WA 5E6SB 1S2LA 4CLHA 5A0FA 2EOAA 1YE8A 1OX4A 1EFDN 3GEPA 4X71A 3SFTA 2XGJA 4Y0AA 5DLEA 3GEGA 5F2NA 3P9KA 2HXYA 4NTZA 4OXQA 5EZYB 3DGFC 4M8IA 3ZHQA 4EY6A 1ENPA 5LP6B 4D3DA 2QN8A 3FNIA 5DM4A 5KMGA 5CFMA 2AD5A 1A8QA 1QX4A 1JEAA 1Y7TA 1Q22A 4RVDA 1LLDA 2NZ2A 1XJWA 1M1XB 1E3QA 1G6KA 2O05A 3IJPA 3ZUGA 1JXMA 4C5BA 1YC2A 2PX2A 3PEUA 3PQ7A 1TQ4A 2IKQA 1A5BB 2YC2C 3P97A 3PDWA 3F1KA 5I7RA 4GNKA 4IZ6A 2ST1A 1YA8A 5SZKB 1MV8A 4KQIA 4UFNA 3IKLA 2ASEA 4DLUA 2W98A 5MDHA 4MB6A 5DSXA 1B6SA 2O8NA 3NRCA 4PGGA 5HJEA 1BO6A 3THWA 4LF8B 1CY7A 1E77A 1MABA 3KPYA 2JIZD 1RRFA 3PVCA 1UWVA 1E2JA 1PYDA 3AWDA 3KP1A 1JJIA 1NE7A 4MS1A 2A0KA 4P58A 2KW5A 3C39A 4TLDA 3WC4A 4B8WA 3UWPA 4DLZA 4JLBA 3L2OB 5BT8A 3DKKA 4UMFA 4NJMA 4KKXB 4Q9DA 1SOVA 1NWHA 1PW7A 4FJ1A 2HZBA 3QWAA 1GZUA 1Y6QA 2VZEA 3B1FA 3EZ6A 3O1JC 4GMKA 5HR5A 3HWRA 4CM3A 4B81A 3W2HA 2PO7A 3R3HA 4H0CA 3AHEA 1JYSA 1UBFA 2FEWB 1RHRA 1RSZA 3IDOA 3C16C 3DUFA 3G8YA 1MOSA 1PK9A 3FFTA 4NQZA 3GQBA 5SY9A 4C21A 1JJBA 5C3MA 5DYWA 4FD3A 5BVHB 2R25B 4NESA 3LFTA 2QY6A 4QODA 3TE7A 4W5RA 4L8FA 1IE3A 5HIKA 3BILA 5TQ2B 3OY7A 2VHQA 3Q1LA 1IZYA 2QAGA 2FPRA 3IEIA 1OA1A 4WJLA 5B37A 3IPAA 2VBIA 1R18A 2PX3A 4B8YA 4EJSC 1EDOA 1N3YA 1SXJE 4QUAA 2O8CA 5HZKA 3SXPA 4UCFA 1GGEA 1KFBB 4N9WA 2XQFA 4GW3A 3VU9A 1QIMA 1HNNA 2QJRA 2FJ0A 3FI9A 4QIHA 5DYNA 1PWZA 1VI6A 2OB1A 3GN2A 3IUSA 3IKMB 3SE0A 3UMYA 3ENVA 4TVBA 4UARA 2GCPA 4ZPXA 1ES9A 5AUQA 3JYQA 4JQSA 4MQ4A 5GOTA 1PJBA 1RT9A 4ER6A 4RMJA 1A82A 1EHIA 1CJCA 3GN1A 4OBBA 1L4KA 2B69A 3DAOA 5ELLA 4RTMA 1JBEA 3EASA 4Z51A 4BZXA 4F2GA 4ZD6A 2AEMA 1DC5A 2O1WA 4DJAA 1GAQA 2D1YA 2HM7A 1JS1X 1GU1A 3NTVA 2WWFA 5FULA 3ZQ4A 2HW8A 3FUUA 2ZI9A 5AW9A 1Y1KE 1CUFA 3J80A 1OH5A 3VR6D 5AHOA 1JG2A 1P7VA 2G63A 1XZIA 1YFZA 1PVOA 1BHQ1 2X4GA 3DOFA 1I4OA 1VM6A 2Z5GA 4XX0B 1FJHA 1T3GA 5B6PA 3TEJA 2IXTA 4ZVRA 1IHYA 3TLYA 4OJQA 5A6SA 3R9WA 1GUYA 3IIKA 1Z3CA 2QSUA 4DHEA 4AKGA 2XD4A 1VG8A 1XYVA 2Z2JA 3DFFA 2FH5B 4NENB 1DC6A 1TECE 2D2XA 2XPCA 4PVDA 6ADHA 3ZZNA 2JBAA 3MTIA 3KT6A 1CY4A 1NM5A 4I9GA 2WFLA 4BP9A 1MH1A 4CLDA 2WK1A 3NC4A 2AMJA 2W00A 4XM1A 1FPMA 1WB4A 2HPAA 4FFRA 4F5DA 4HLUA 2WAXA 1M7BA 4BQQA 2DR2A 1DEOA 3JZFA 4KVAA 5I6DA 5TMPA 4WZBB 4D4LA 4D1YA 4GLFA 3RADC 3TFOA 1KNQA 1I7DA 2VRCA 3J7TA 3M6WA 1G5HA 1OBFO 1WDMA 1X7ZA 1GG9A 3OEWA 4QQFA 5ALNA 5J40A 3V4ZA 2I6SA 3WK9A 3FIJA 3W8EA 4K28A 5HKAA 1PQYA 1JR3D 4KPUB 1S7CA 1KF0A 1QK5A 4UZFA 4QPZA 5E2AA 5EMMA 4UHHA 1RTTA 1F2VA 1VI2A 2CXRA 3VC1A 2OV2A 3IJEB 4K9OA 2VSOA 3IE0A 1KXJA 4HXGA 2QVXX 2ZI6A 4RA6A 4UHCA 5ANRB 1QIIA 4MVJP 4M89A 3ZQJA 5BMOA 1HZZC 1I33A 5DP2A 2Q3LA 3LTNC 2VQ3A 2JD0A 1E79D 2FPOA 1SM4A 3N1UA 1XA4A 1TVCA 2ID8A 2Y1GA 3FAKA 3KVRA 4E2XA 4EBBA 5C5IA 3IEKA 5HJ5A 3CX8A 1JFFB 2BH9A 2ZBRA 3KYCB 2OPBA 2E5WA 1DJPA 5DTEA 1AF4A 1IN4A 1AHHA 4QOGA 4RXUA 5CJPA 1PWYE 2H1CA 2PD4A 1T2VA 1B6TA 3PUKA 1I6KA 3BA6A 1YL7A 3KKZA 1M34E 2MTBA 4FINA 3C1TA 4HR7A 4MUIA 4YRJA 3WKEA 3GO4A 3EHEA 1UFRA 4BB0A 3EQ9A 4C0HA 4EW3A 4PLVA 2J6BA 3RQSA 1ZI8A 1XALA 4XYGA 3R7DA 4XIYA 2XNKA 3T3IA 1YO6A 1L7QA 3QOWA 3H0KA 1DBRA 3QF7A 3C1OA 3B8HA 3VJRA 1XP8A 3O93A 1CNMA 3BD6A 1K1EA 3VSEA 1K8XB 4R0VA 4Y9SA 4HAZA 4ARZB 1NQ5A 3K9FC 4F56A 4YJDA 4PM4A 3AMVA 3QELB 3V2HA 3I6MA 4NVRA 5TEWA 2EQ5A 4FVTA 4YAJA 3UPTA 4ZCIA 2PX5A 2H92A 3BFXA 4FMBB 2HA2A 1GPJA 5JTUA 4LJAA 4GQIA 4UBOA 3KTOA 5F9MA 2JG3A 4JDPA 3LV8A 4W5TA 1P1CA 2Q2WA 3DZIA 2Z30A 3ER6A 4OYYA 2QR3A 4RY8A 2IXAA 1Q1ZA 3EGXB 5BRAA 4MITA 3RNLA 3ETNA 3D2CA 5J5CA 1OI4A 2DWQA 2HQOA 2HUPA 3E3MA 2OK7A 5CBPB 2Q3EA 3R24A 4BNYA 2PUCA 3BC1A 2PAAA 3T7CA 2BH2A 3GJQA 1ZH2A 1J22A 2W2TA 4DCCA 2PFGA 1WJGA 1A0OA 1JQAA 2QG4A 3LRPA 2V74B 3LRXA 4QBHA 4U9HS 3JARA 4KV7A 5E1OA 3WBJA 3ZR4B 4H1VA 1Y9DA 2WM8A 3C6XA 2FETA 4R8SA 3ZGOA 3MOIA 5JC8A 2GDZA 1JBKA 3I0MA 1W581 3Q8KA 4ETMA 3T9AA 1R5JA 3SZLA 3C48A 4YMIA 1P5JA 3G49A 2J1LA 3LBHA 2DG2A 1PS0A 2ACWA 4FGWA 1MVLA 2WWHA 5CGZA 1CY0A 2WG1A 2RKBA 4OMFG 1DFIA 4P4GA 3UC5A 3GA7A 3STTA 2GH1A 3ASZA 3WRVA 4KR7A 3Q10A 4PYIA 1CUGA 4ITUA 1NUTA 3KD3A 1XTPA 3SYTA 2A7XA 2AJBA 1R12A 2BP7A 2ON6A 1U7DA 5K09A 4C05A 1SUBA 1NNLA 2GKSA 2N0SA 3KS9A 4IX9A 3RH0A 2W6ID 3LAWA 5AVKA 3NEAA 2Q5LA 2NQ8A 3ONVA 4R1NA 2IEBA 2SKEA 4J7CA 1YOVB 4NEHB 1L5SA 2ZB2A 5IJXA 4AJ1A 1N2SA 5EWMA 1JL3A 2HHAA 3QVWA 2NX2A 3ONWA 1FXWF 3RBXA 2PWBA 5BUCA 2F3PA 1SBCA 4YECA 3ANLA 4K6CA 4B3BA 5JQWA 1K7YA 1UP6A 1NR5A 3QXXA 4KFUA 5IAJA 4M54A 4E2YA 4XJSA 2VH2A 4LYHA 4HL6A 1GNPA 2G1UA 4TMKA 4MSUA 4L8VA 3LS2A 1SZDA 1L7MA 4DDKA 5A3JA 4PLPA 2ZJFA 4ZXFA 3HZZA 3K9NA 3M4ZA 3VKHA 4RDXA 1ZCBA 3USZA 3V6LA 1C8BA 1WSDA 3JSAA 4I50B 4LGMA 4CLXA 4F38A 1XJQA 2X5JO 4IZIA 2J5XA 2X0IA 4C3OB 1IAQA 1Y8RB 2ZBDA 1U9CA 2R48A 2IWRA 2WVHA 3NXSA 1HFKA 4OQEA 4AKEA 4X0EA 3P2KA 3E3OA 2XUHA 3V4OA 2DT5A 4YMHA 1UP7A 4JI5B 3TR0A 4MVJD 1RYYA 5GVSA 4F5EA 3KUCA 4LISA 5IYZA 5K0NA 1RLTA 5BYBA 3TG2A 3UY4A 2EWWA 4EO4A 1ZAYA 4KXNA 3H2GA 1IDN1 1RMYA 1R8YA 4MRMB 2GERA 3NT4A 3SAJA 4GE3A 5EINA 4L28A 2Y1EA 3L7JA 4L0QA 4ZYTA 2CNDA 3KQMA 4MGZR 4JLMA 4Q9IA 4MP6A 1A9SA 4UBNA 1RC0A 2XF2A 3LK6A 2AOTB 1NFQA 1RAGA 3KL4A 1J21A 4WZZA 5K1ZA 4CMGA 3T3OA 1KK3A 2VOJA 1C50A 2X5NA 1MDBA 4ZWNA 2XCUA 1Y6RA 3Q7TA 4D9NA 5EXXA 1H05A 2BCJQ 5IKMA 4ZI5A 2PAFA 1PJTA 4DN6A 1SG0A 1UPCA 3O8QB 3N0XA 4HRVA 4CCAA 4CM8B 3AETB 1BGWA 2HXSA 3HBAA 2PUAA 1ZCAA 2EJTA 4E5NA 4GLJA 2IYUA 1Q0UA 3WNQA 1X7GA 2JLYA 1ESEA 3FLEA 5DLDA 1SPBS 1YI1A 1Q0SA 5EMJA 1XLTA 2OA0A 1CRLA 4ZVUA 4NARA 4C9BA 2QAGB 2BKAA 4XOIA 2AQ8A 1P73A 3TAHA 3VR6H 3QG1A 1NRWA 1QQAA 4UQPA 4KR9A 2PGOA 3RU7A 2XMSA 5JS7A 5JAUA 3IP1A 4JYZA 4MYTA 2ROQA 4FN4A 5GM1A 3VQTA 4P36A 3KQUA 4E2ZA 1SO8A 2VP9A 3JWIA 4M55A 4EVQA 1IH8A 2ZYVX 4X44A 1Q1QA 1ZA2A 2VK2A 1EP1B 3ABQB 3AR4A 4CZ2A 2JJ1D 1XTVA 2Y0PA 4DBLE 1PJQA 1NUHA 2Y93A 1UXGA 4OEHA 4MGHA 4ZVSA 4GAEA 4IIHA 2ZSBA 4LBWA 4RVHA 3QU5A 1WXDA 4A8JB 2QTNA 4DW8A 2VQFB 4LCJA 3BVPA 4L1KA 2OTCA 4I2VA 3NDRA 1EM8B 3Q9UA 2TS1A 1Z07A 4WACA 1JQ5A 1WUKS 2W11A 4YAGA 1RLIA 1R0CA 4GOJA 1KFJB 3ERCA 1DELA 2LPMA 1RVDA 3RRZA 1XE3A 3HO6A 4CL2A 1YQQA 2CLEB 4ZOAA 4ES6A 1G3UA 3PZBA 3A9RA 3GJXC 1FYWA 1LKZA 1L5HB 1HT1E 3LCRA 4EI7A 2PK3A 1VA4A 2V7WA 2EWMA 1UEJA 1V71A 2R7LA 3HVIA 4KO1S 3AR5A 1F38A 3F3SA 1BU5A 1SCDA 3W2GA 4G0UA 3NWBA 4I1OA 4KQEA 1DCMA 4F3CA 3CVYA 3QKWA 1FQWA 4UBLA 2AMFA 2WHRA 1H6DA 3RSFA 4U2FA 4EFKA 2CNWA 3K70D 2PXCA 1O54A 3FCEA 4WLVA 4BLOA 4WY2A 1JEQA 1Y1TA 1DG1G 4V1CB 2R751 2Q4TA 2FW7A 2XWQA 1AXRA 1T3SA 5JC1A 4UXJA 4KL8S 1V2GA 2OV6A 2CLMB 4OBWA 4WWHA 3ROFA 2V6GA 4ZTBA 4LOLA 4ZCQA 1QVVA 1QAMA 2SHKA 3BHIA 5BVGA 1ODSA 4IJ5A 1QYDA 4RHCA 1BFKA 5E6SA 1CV2A 2P40A 3GLHA 5FLEX 5K2MA 4BFXA 3I8SA 5IMSA 2FWRA 4YGYA 2I6XA 2Q7OE 4GVLA 3DTYA 3M6IA 5I9NA 1NA5A 1OOEA 5C8XA 1PWXA 2NQTA 3P2JA 4NC9A 3ZX5A 5EIFA 1CQJB 4MUNA 1CRWG 4MH0R 1QHEA 2EP7A 3B51X 5KQMA 3ZD7A 3VM6A 1OFVA 2IS1A 5LFAA 3BDAA 2FPIA 4BGUA 2C03A 4RENA 2RC5A 5BSMA 3W2EA 2R65A 4LC0A 1H1DA 1KP2A 3WLFA 3QSGA 4ZYVA 3WMGA 3A6ZA 3MJCA 4OMUA 3CM0A 3IQIX 3QW4B 4P5DA 3DVQX 4DLSA 2PRZA 3FOZA 1XK7A 1J25A 3R41A 5KYXB 1M7GA 1DXOA 3O6VA 3O9ZA 2I91A 4RHXA 1KDYA 4JV5B 4DJFC 4ZANA 1XMPA 1H69A 5G3YA 1R6AA 3K5HA 4RYDA 3BHNA 1PGJA 1FVHA 3RLIA 3VYTB 1YTLA 3WLOA 1RYFA 2OHOA 1DQZA 1MJ5A 3P4XA 4EMUA 5K8IA 1THGA 1ZZEA 2XQKA 3GLUA 3IQDB 3DOEA 4YC7A 3EPKA 1RD4A 2MSWA 3HEMA 1UBHS 3ZDDA 4J0CA 2HF9A 2HEGA 3AVPA 3HYLA 4R0NA 3K70C 3SM9A 4D97A 1YJXA 2RK6A 4Q7KA 4LBVA 3PICA 16PKA 3LX5A 4RKFA 1DIRA 3PGLA 3RF6A 5FUQA 3MT9A 4MS1B 4HUQB 2G5PA 2OCXA 4LFBB 1JFRA 4W4TA 4EGAA 1YZYA 1VB3A 2QVYX 3KTFA 2YWRA 3L6CA 3TF5A 2MYPA 2CY0A 3BL8A 5H1YA 1JTFA 3Q8LA 3K2BA 1WAMA 3V00A 4B9EA 5ITWA 1XZQA 2V7XA 4NYIQ 4KNWA 4OHWA 2HMVA 2Q9CA 3GXOA 3DFZA 6AT1A 1M2FA 2VPWA 3D3JA 4FKMA 2HEIA 1GWNA 4F6RB 1O7JA 4TTRA 5KTKA 3DS8A 5TVKA 5EJ7A 2FPMA 4ZN6A 1CRPA 1Q57A 2C5AA 2HOQA 2ZSUA 4NOJA 2L19A 2IIQA 1DT3A 1VIVA 1MHPA 3EVZA 1RI5A 3HCAA 4JX8A 4V39A 3REFA 3VNSA 4K9LA 5BWNA 5M29A 4JLDA 4Y2TA 5FJIA 1I30A 4F96A 2AV6A 1YF3A 1RXUA 4RSMA 4M8KA 2OV1A 3AGPA 3RSHA 2QE7D 3GLHE 5BYKA 5CBPA 5T8KC 5B7QA 4I1PA 2OM6A 4MQ5A 5JASA 4FB4A 4GDMA 2QJFA 3N07A 1QYRA 5EKXA 3AKCA 3JZDA 4BU1A 1QV9A 1LQTA 1QFJA 2VZ8A 3LLVA 4IDOA 1KH3A 3GLQA 3TUIC 1OC4A 2FPIB 2NACA 2Y6UA 1Z88A 1COZA 1HE3A 4KO8A 1SEVA 4PPGA 2WB4A 1Y1RA 3KTAB 1T0BA 3QELA 4QQNA 5K0BA 4LOAA 3SNHA 4NXNB 1IN6A 4PU0A 3TEMA 3TTWA 1A1SA 4AWXA 6REQA 5HZGA 2K5UA 4YHBA 3MZ0A 4Z8XA 2XYVA 3ZDEA 3QEBZ 3UUGA 2WAOA 3GAMA 2MT9A 1KEWA 1W5AA 4X54A 1ISSA 4FCTA 1V7QA 5ESRA 2FMHA 4G81A 1V7ZA 4EVSA 1ABBA 2WMOB 3ZCSA 2C3PA 2I78A 2RGYA 3BKXA 3VNRA 2AFHA 2JGFA 3AKEA 4IOJA 3BTOA 4FEGA 5JWOA 5F9HA 1NYQA 3V7UA 2P0YA 3OE4A 3WWOA 4NBKA 3CVXA 2VSQA 2H1SA 4OQQA 5DMHA 5CHYA 1DJLA 2G0NA 2Y99A 2ZW9A 3AXSA 2IPAB 4UOEA 1JIKA 2G77B 1BMTA 1DHTA 1KYQA 2C59A 2Z8ZA 2DBQA 4MKXA 1XR3A 2ACEA 2FPGB 4U5QA 2ZT7A 3ZH2A 1P9LA 2JA2A 3KEFA 4N7BA 1Y8QB 4PC6A 1WF3A 4YMWA 3B6IA 3KSDO 4EF6A 1SHZA 4IJVA 3WLRA 2BGLA 3HMKA 1ZI9A 5DGTA 3T12A 1QB7A 4H6VA 4LOKA 1GTJ1 1P9WA 3IGFA 1OX6A 3KUUA 1SUAA 4OK3A 1QQBA 4HV4A 3SF8B 3CLTC 3L1VA 1I7SB 1SCJA 5FI0B 121PA 3L4BA 3HBNA 2P9ZA 1QR2A 1CY1A 2FEKA 4R2IA 4BO5A 3QXCA 3SVLA 3GDGA 1IBRA 4YRIA 3R40A 3QUCA 4Y30A 1ZINA 4PLWA 1LDEA 1T5SA 2OGUA 4C29A 2F8TA 2BI8A 2RDMA 4NHEA 1OFIA 1YZFA 2JATA 3FSGA 4UTZA 2FGKA 4Q7MB 2Q4EA 5FUYA 2RG1A 1W4CA 5B1HA 2NTVA 2W6JA 5AH0A 1EZ1A 4FYVA 4MR8B 2EYUA 4G2NA 4V3BA 2BUCA 2JW5A 2YN2A 1K2WA 1RFGE 2AN4A 1IOZA 4CF6A 4Z3OA 2A9JA 1OZHA 1X80B 4HMPA 5C31A 2A94A 3O0TA 3DBVO 1TPZA 3T6KA 2VUIB 5I7VA 2VDVE 3TD2A 1JEYA 2GZSA 1SVKA 2OFXA 3KKLA 3I61A 1L1RA 2GD0A 2CYAA 5KHAA 3CW9A 3V2UA 4G0OA 4JXJA 4AJKA 1CB0A 1XK6A 4JBLA 3LKDA 1VGVA 2W2QA 4PCLA 1T6ZA 4BN0A 1BAPA 2I22A 4MKZA 5F35A 1PFQA 2RGDA 1ECCA 1WIWA 4L4XA 3BTSA 5ER6A 3G5MA 4JS0A 2G76A 1CG6A 3OZIA 2HDNB 4PHGA 4UBJA 4AECA 3ZW8A 4FTWA 4UU1A 1BOOA 1X94A 4CEJB 3N7UA 4WN9B 3UFXB 3JS5A 2F59A 1RZVA 3OQIB 4XSHA 3U49A 2WTAA 4R7ZA 1J2RA 4YIKA 1VCMA 3O2JA 1CQIA 3UAGA 2QJWA 3Q98A 3ASUA 4R1LA 1TAQA 2FOLA 1AMNA 3N74A 2WW8A 5E6UB 2XDQA 3RC9A 3R7BA 1XKXA 4PCUA 5ITSA 1DAHA 5CFPA 2PLFA 4YO7A 3GX1A 1QF7A 1O9HA 4OHFA 4CDNA 1W4LA 4JXZA 1DAIA 2R5FA 3SZOA 4HAOA 2EGHA 1I2BA 4JKYA 4UNIA 3SFZA 3NOVA 3EXG2 4K7JA