3HY4A

Structure of human mthfs with n5-iminium phosphate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
195
Chain Sequence
MAAAAVSSAKRSLRGELKQRLRMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 195
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy4A00
3HY4A 3HY6A 1WKCA 1SBQA 3HXTA 2JCBA 1YDMA 1U3GA 3HY3A 2G40A 1SOUA 1U3FA
chains in the Genus database with same CATH superfamily
3RBVA 1YIOA 1DI0A 3B3GA 1COWA 1FX0A 1IDOA 1SBQA 4WLOA 3GGJA 5A5FA 2ETVA 5J4VA 4W9MC 1OTXA 3TLXA 1ZGZA 3SDSA 1ZN9A 2X3FA 2J4CA 3BRQA 4NQRA 1OASA 4RMHA 1SWVA 1E2UA 2P91A 4W5QA 1DS6A 1DRJA 4OIFA 3I5XA 1K0FA 3BSSA 4MW4A 2PGOA 3DV0B 3H5WA 3CMMA 4GI1A 1PV2A 3A9UA 1V1MB 4RKQA 1QH1A 4L57A 1WUKS 5G4KA 4BV2A 1GSHA 1CY7A 2KJQA 4P92A 3KXIA 3QM1A 2IW1A 3VH4A 2P67A 1YOVA 5U9CA 2RK6A 2V0CA 1EUCB 2PZKA 1FQWA 2WUDA 1VSVA 3PL5A 4UHHA 4U6QA 5C1PA 3KTFA 2XB4A 1I7QB 1E94E 3O21A 2V4ZA 3PQ2A 3NHSA 1N7JA 1Z18A 3KFVA 4OQNA 4XDYA 3VC2A 5JASA 2R4UA 3NORA 4RZUA 1ODSA 2OLKA 3C1OA 3I32A 2QN9A 5K3BA 1T43A 4E4YA 1I2DA 3AY3A 4RKYA 3SD7A 3RK0A 1JPJA 2FFQA 5DM0A 4B6GA 2JVKA 2WFLB 1QRSA 2CY0A 3CNQS 4LHWA 1DAFA 1E0SA 2ATVA 2YFQA 4O0LA 3ETJA 1B1CA 1MJNA 4G97A 4JJIA 1LSSA 3EC7A 4JP1A 1QANA 4OXKA 1OZFA 2NU6A 2ZTVA 3GVIA 4RIFA 3VBCA 3KHKA 4ARUA 1WSDA 5KWIA 1U1CA 3L7YA 2GTHA 1OWNA 1LLQA 2WWFA 3CFYA 1DFHA 1EKXA 3IE1A 4N3CA 2EF1A 4FEAA 1P6UA 2E82A 1K8QA 1BE0A 3QUSA 3DWEX 1Z2DA 1ZGAA 4LHZA 4RMIA 5BYAA 2YR0A 1Z2AA 4RTKA 4NBLA 5CPFA 3ZW8A 4HDCA 1JHOA 4FFBA 5U1PA 1JJAA 3EDCA 1KMIY 2Q9BA 1UFQA 1F8UA 2Z9DA 3WBJA 3C7AA 4YRPA 1AF7A 4H7IA 1DHRA 1QP8A 2AYZA 3M2PA 4NG5A 5KBYA 4PSKA 3PRKE 4ITRC 2YMLA 4JJZA 4LVNA 3RS0A 4Q1FA 4J1SA 1KQ3A 1TX4B 2QRLA 1PZFA 1CQJB 3OZBA 2VWQA 4OKNA 4F3NA 5FUQA 1QGZA 2JGDB 2YCLA 1CULC 4KC0A 4RY9A 4HGRA 1KE1A 3HFGA 3CVUA 4MSUA 1E79D 2WFAA 4Z1OA 1T0UA 2Z2YA 3MJEA 1QNLA 1T4DA 2BHSA 3A1NA 2CB9A 4N5DA 5H4GA 3A4TA 3LUPA 4IMIB 1F2TA 3N39C 4LVCA 4HPWA 2XGOA 1KU0A 4WEOA 4CKCB 1A9YA 1BE1A 4TMVA 1XU4A 1NMEA 3FAKA 5D1NA 3WBFA 4EDFA 1LC0A 4EG7A 3NO4A 3WAKA 1QV6A 3PC6A 1K8RA 3D3EA 4QNMA 3DE0X 1RE0A 2WZBA 3PQ7A 4R7GA 2QRGA 4LMBA 1OZ0A 1IMOA 1ZWLA 4GIBA 4IG9A 4V0LA 2YV2A 5E6UB 3BQNB 3WWCA 4JX9A 5FFMA 2J4DA 2XUPA 3I1YA 4IIHA 3FDZA 1X8LA 2D1FA 4HFNA 4JB3A 3BK1A 4OXQA 3SM9A 2RJOA 1Y3HA 2ONKA 2NMVA 2Q1UA 1Z0JA 3PFGA 3QYJA 2J9RA 1G6Q1 1Q84A 2I76A 2J5QA 2OD2A 3P19A 5DHTA 5EP2A 4F9EA 2WQ7A 2YV3A 4A3SA 3ZW7A 3E6AA 1U2QA 3K1AA 3JALB 4MVJG 3ZVRA 3CF0A 1LQ2A 5DDIP 5KQLA 1G2QA 2VDUE 2GYVA 2W43A 1NN3A 4MWCA 3TFQA 1BN6A 3X1WA 1J0BA 4MDEA 1KU6A 2H18A 2Y0EA 3LYAA 5K3OA 4CQNA 4ASUD 1Y4UA 2QVCA 3EVTA 1PTKA 3FUWA 2XNHA 4ALMA 1EJBA 1G3RA 3BICA 1TZKA 3QWFA 2OMEA 2Q9CA 3CLTD 3T9FA 4C7MA 4LZZA 4DLRA 4ZHQF 3OZCA 3H19A 1OC2A 1FDUA 1PR6A 3QOWA 4TKUA 1POWA 1X70A 4K3UA 4ED9A 4B3RB 5F51A 4RXUA 3IPXA 1NJFA 1PZXA 2JLRA 3UK0A 5JY6A 4DUGD 2C4TA 3PDJA 5HS6A 3H2JA 3OFKA 5CD9A 1C7JA 3FOEC 1OT3A 3VAZA 1GT6A 3ZZMA 3DAPA 1D0SA 3ROFA 3AI7A 1X7ZA 3ZWVA 1IONA 1A98A 1X15A 2NLOA 4XVRA 4A26A 1TTQB 4B5LA 1KYQA 4YDQA 1G16A 1JXQA 1TT5B 2EZ9A 3EY4A 3HK2A 2PSFA 4G0UA 2XQVA 2BP7B 3LHSA 2IH5A 3KD2A 4JIGA 3N5CA 5A62A 3SXUA 4MDHA 4C22A 5BMVF 4MX8A 1P9RA 4MLZA 4ZGBA 5ALZA 2ZM5A 1B2RA 5G53C 1VG1A 2JFOA 4BFVA 4OMFG 4IDOA 4ZAYA 1YC2A 2RKBA 3FKQA 2PDAA 3TLKA 3H2SA 4EA6A 3RT9A 1Z0DA 4GPIB 1GZ3A 2R65A 4O5OA 3GRUA 1IDN1 1VBMA 3OHMA 4MAAA 1SCNE 3C45A 4MP6A 4AJEA 1ZR4A 2QR3A 2ZSAA 3NHJA 3OTIA 3SSOA 4GE3A 1BA2A 5DOVA 1SD5A 3STYA 1C4WA 3HJCA 2Q5CA 4AG6A 4B32A 4DCTA 1U1DA 4NCKA 4Q7QA 5BNIA 4DRZA 1ZRSA 3B8HA 3JZAA 4IH9A 3BZWA 4BVAA 4GLOA 1QHGA 1SXIA 4CMEA 4FHGA 3A06A 3LX6A 5HOQA 1LF0A 3C39A 1JG6A 2CNNA 4P4GA 3KWJA 3WRWA 5L3SB 2VF5X 5DEIA 2PLAA 5E2AA 2P69A 3VR4H 1ESMA 1Y3CE 3ASVA 5BXQC 2XKKA 1S7GA 4HYEA 2BBWA 1IZZA 3TQOA 1XQ9A 4BTLA 4FFVA 1R0ZA 5H59A 1XCBA 2CXXA 4FC7A 5KSZA 4U39A 1GUYA 4PBSA 1WXXA 4LOIA 3MT8A 2BDUA 2NVOA 1OTHA 1D2RA 4XGRA 4KITB 1USVA 1SNYA 2ABWA 4QSHA 1E2MA 5FI5A 1EESA 2C78A 3T12A 3KE9A 1XE3A 1V5IA 3TLJA 1UMCA 4Y0AA 4UNRA 1E69A 5KDDA 1SWWA 3ETGA 4IRMA 2QRMA 2DC1A 4Y2HA 5ETJA 2PZFA 4MRVA 3ZV6A 3R9XB 1XTBA 1TZMA 4LJ8A 4S35A 3GEBA 4C0LA 4QPCA 2OD9A 5FT9A 4FR2A 1QYIA 2EFYA 5EP1A 3U3OA 1M0EA 3JZIA 2AKEA 5EZSA 1ECFA 3CNBA 4Z7JA 1H5NA 221PA 2OM6A 2Y0CA 4X8HA 4C3ZA 2PR2A 3KZMA 2WG0A 1HLPA 4DDUA 1D4ZA 1L8XA 1V3UA 4RZ3A 5IYZB 2HMTA 2VTKA 2YCBA 3D6VA 4Z0PA 4MB6A 1MIOA 5F2OA 1T10A 5FUWA 1E3TA 4HEA1 3KKQA 5LZ7A 3DAGA 2AVDA 4I5IA 5HZMA 1YK1A 2PHZA 3AOEA 4KAXA 1A9PA 1VIDA 2H4FA 3EK2A 3VR5A 4YUZA 5I7UA 5IKEA 5JADA 2M9MA 2XJ4A 1M2OA 2QTCA 1V3TA 2VLIA 4QYMA 1W59A 3LUFA 4IYJA 1V8ZA 3RAGA 1R0CA 3Q0IA 4NU5A 5AKZA 3WLTA 3I6ZA 2J0SA 2R1VA 3G17A 3P2JA 4FFOA 2IFTA 1X1BA 4QQKA 4EX6A 4JP3A 2CYAA 5FL7D 4ECEA 2H48A 3OHSX 2WNSA 4RF3A 4B73A 3USZA 4L5JA 4BMYA 4CBVA 2I0FA 1EE1A 2UZIR 3TIFA 4GEKA 3VVBA 2I3DA 1UINA 2GAAA 5EWLA 4B4WA 4FKZA 5JQWA 3PLRA 5FNVF 4RACA 2B2XA 4RJJA 3RCBA 3HV2A 1R6TA 3Q87B 3FGNA 2CEKA 1ULUA 3NHAA 1KOGA 4D6XA 1IN8A 5FTKA 4MHTA 1EJ2A 1W88B 2X14A 3NTRA 3AVWA 4F06A 3WK4A 5BV2P 4V1CB 1E58A 1EFVB 4JJ7A 3AKCA 2X9QA 3NFRA 2O8DA 1PR3A 5KZMB 3UA3A 5CEFA 4HPJB 1L5LA 2XY4A 3ROPA 3TKAA 3CVVA 1KEZA 4K2AA 4X1KB 4NDNE 4OAQA 4WLVA 3H5OA 3DOFA 3QEBZ 2C5LA 3G2LA 3TR6A 1KAMA 3QUBA 4MW6A 1FY2A 2BELA 3T1QA 4BN4A 4EJ6A 2RK3A 3KLPX 5K8TA 1C3VA 1QIFA 3CF6R 3OUZA 3I83A 2AOTB 3BXZA 3DE7X 5D85A 2JCBA 3K0KA 5FWXA 1LSJA 1Q16A 4HXGA 5BURA 1XTRA 3WNQA 3E23A 5GY7A 3U7QB 3AFMA 3UKDA 4HV4A 5CFPA 4HAIA 3X43A 4QODA 5KI6A 1YJQA 1UOQA 4B79A 1NNSA 1Y6ZA 4I9HA 3FWPA 2O3SA 2MHCA 2Z9BA 3V1UA 1SCAA 4PQEA 1E7RA 1D0IA 1CE8A 2ET6A 1JDNA 3E70C 3SQDA 3ZV4A 4ABYA 2ZUCA 2QVLA 2WNIA 4RPCA 1R4MA 5BSFA 1XFAA 4HYYA 4QDZA 3R3SA 1IJEA 1S3SA 3RFXA 5KQRA 1N2OA 3Q9LA 4BLSA 3IV7A 4EG0A 3HCNA 2IPLA 1O4WA 3SYRA 1FYDA 3I0ZA 5JIBA 1ZUHA 3LVFO 5CA1F 4GI7A 4F7WA 3GC6A 2NSLA 2PMDA 3OOWA 3OZFA 1LDYA 3DR3A 4RA9A 4JSTA 2C84A 1XEWY 2P62A 2JGJA 1WDLA 4K0RA 2CT8A 1Z4NA 2WSYB 2BGWA 2HCTA 4OQXA 3LK6A 4MA4A 1NW8A 2HMYB 3A0UA 3OF2A 4C21A 2G06A 4CG1A 4B3HA 4I08A 1XL0A 3C0KA 8ADHA 1YR6A 1T6XA 2WHPA 4HDAA 2HW8A 1NJ5A 4S1VA 1F2DA 4G1CA 1E4EA 2NUAB 5FRDA 1F2UA 1TMYA 1R5JA 2WSIA 1BMTA 4F4FA 3KWFA 2DY0A 1GQQA 4ZVRA 4UAJA 3U7GA 2FQYA 2ON6A 2BV3A 3HY6A 2BFOA 4L4XA 2IP2A 1HYBA 2CEAA 1YVUA 1KOJA 2HC9A 1KDOA 1KY2A 2A1UA 1DJMA 5HJ5A 1D2MA 4J07A 3TEJA 4CKBB 2AJCA 4NS1A 1G4HA 3AETA 4A9AA 1CZLA 3GP3A 5JJKA 2CUZA 2R96A 3D7SA 2K2QB 5AT1A 2X1LA 1LSUA 3LPMA 2W93A 2G9QA 4C6TA 3ZD7A 1Y5RA 3G1UA 3HKBB 5AUNB 1AKQA 4KEAA 4CM9D 2DTEA 1TI7A 2QMUA 5DKFA 1KOLA 3RBXA 2QVXX 1PWYE 3PJEA 1I13A 1VLLA 4B6SA 1NBAA 4UTOA 4DMHA 2V4UA 3WAGA 2FFBA 3IAHA 3AQIA 4QRIA 2VSNA 4MRSA 4QNRA 3AF0A 4JN6B 4Z5XA 2DBVO 2PK3A 4G0XA 1JR6A 4EG5A 4REQB 5HX7A 4KTTE 3BGSA 1Q7GA 2DU8A 4JVSB 4Q7EA 3ZWMA 4F93B 4MHSA 2JFPA 2BGLA 1ZCBA 3AJEA 2I55A 3GGCA 3LW8A 4V39A 4BNNA 2XADA 4OHOA 2IOFK 1T5BA 5I9SA 5HE8A 1LLUA 5ESWA 1XCJA 4JA0A 4G0YA 2XJ9A 4H6PA 1DFGA 1K6JA 1A9SA 4YLGA 5JO9A 3U39A 2I8LA 2B8TA 3GMDA 2BGRA 5LMUB 2QZJA 3IAXA 4N3AA 2CNDA 1FTSA 2FPWA 1ZI9A 3GJ5A 2EP5A 5EXTA 4YRBA 2HNAA 2HU2A 3Q6MA 4WXEA 4ER3A 1RMQA 2PFKA 2HZ7A 3NMUF 5KHAA 2CLOB 3H05A 3QY0A 1DO8A 1MDFA 1JEDA 1TD1A 1GHTA 3HY4A 3PC8A 3V7YA 3VPCA 1EH5A 2UV8A 3WS7A 4MGHA 3R77A 4CHGA 5KJ1A 2XA9A 3GUCA 4JBWA 4NZYA 2DKNA 4X6LA 3VO8A 4BVFA 2DULA 1AZTA 3TLGB 3ILSA 1SXPA 1E2QA 3PKZA 3MB5A 4FWIB 5CYPA 2C9MA 5CB0A 3ADCA 1IHYA 2OUIA 4YRFA 1CR2A 2GKSA 3HCFA 2GYWA 3ME5A 4PAWA 3WYGA 1YJ8A 2GJKA 5B4VA 1F17A 1ENYA 3O8NA 4MVYA 2Y4NA 2WWTA 3L5KA 2YASA 4G0PA 4WK6A 3MPUA 2NZ2A 4UEKA 2KSQA 4DRXB 4J75A 2AKAB 3V6MA 1RYBA 1VLVA 5KX5A 1QSGA 2PCJA 2PMBA 4WX2B 1R0SA 2XUOA 2EHDA 2Q7DA 3PC3A 2XZDA 5DTJA 3SEQA 4BIMA 1GGKA 2FWMX 1I7LA 2AWOA 4R31A 1KAOA 2R6JA 4F3RA 3ADDA 3LZDA 4YREA 1SU7A 2BL4A 2Q7XA 3HN2A 2KS6A 1QGYA 4Y9SA 2R4TA 5ARBA 4WFIA 5EE3A 5AVWA 3HE3A 1Q3HA 1Q74A 1TRKA 1MT3A 3RQSA 4DLKA 5HPYB 2P9JA 5IAOA 2PWBA 4B44A 2IQIA 4K81B 1ULSA 4WLFA 3KZKA 2BFMA 3HABA 5F5XA 4QJ4A 5JZBA 2RKWA 3R5KA 5FOTA 5TT1A 2E3JA 4N65A 1NQUA 5A9SA 5KTKA 2RGUA 1J2YA 3R44A 3W78A 4EZEA 5K0ZA 4N0DA 5HP4A 4RYDA 2QSUA 2FPOA 3FMPB 4WT7A 3SEFA 2DB3A 5JYCA 3PWTA 3CVJA 5JPDA 3WDSA 3G1TA 3AJRA 2J46A 2R8EA 1KO1A 2RGBA 4QJ3A 4S05A 4BNKA 2ZJ7A 1NUQA 4N0MA 2IQ5A 4Z1MD 5IH7A 1O94C 1B8VA 2EJVA 1YMVA 3IURA 4LSMA 4GG1A 2ZROA 1WSWA 4LMAA 2DQSA 2OK8A 2PD6A 2QTNA 3FMIA 4CQMD 1OPXA 4PAOA 1FFXB 4S0ZA 5A71A 3TCNA 4K9LA 2HR1A 1W76A 1WB6A 4DMKA 3DTVB 4F1KA 3RSQA 3DE3X 4GZ3A 1GCOA 1X80A 4KQ9A 1O0BA 1R0YA 1Q1QA 2EJCA 4B3FX 3TQTA 1GA1A 3F6BX 3VGPA 1EVIA 3WRYA 1V5WA 3HRHA 2ACKA 2C88A 3U4IA 9ATCA 2R5FA 4Z9BA 3AVYA 1HQDA 2FWAA 2GLTA 4BB9A 3ORYA 1VA5A 2ORWA 3E4CA 3BWBA 1XRJA 3WKBA 3L1JA 4G5OA 4CQLA 5I4CA 1JHPA 4M9QA 1CIJA 3GRCA 2ZJ5A 3EDYA 2PUFA 1SIOA 1YJ5A 2J3QA 4IMRA 3R74A 3UXYA 4JKYA 1Y8QA 4N49A 4CR7A 3X1ZA 2L19A 1X7YB 3MJRA 2LTAA 3P0EA 4MJLA 4ZT3A 1P1JA 5AKKA 3P94A 1F9EA 4JC4A 3C6BA 1FX0B 4GD3Q 4COOA 4W9NC 3VR6D 4MA5A 5B7QA 1YMQA 5FTNA 4L72A 3ORQA 3Q0TA 3HCWA 4LISA 4ZEVA 3O8CA 3OFNA 2G9ZA 1JQ3A 4B3DA 1IMJA 1P4HA 2A0YA 3B1KA 5E4JA 1QH1B 2WU0A 1RAHA 3W2EA 2R86A 4JLAA 5C1DA 1L5ZA 5AK4A 3RC9A 4YCSA 4RVSA 5KYYB 3IAM1 2GLUA 1YOVB 3ROGA 3TZHA 1NXPA 3ZZ0A 4BBJA 1MKYA 4LF7B 1G3QA 2YS7A 2QRVA 3BJZA 1M8JA 1UFKA 2IEAA 4KQWA 4XM2A 1MZPA 5ALXA 5FYQA 2LKDA 5IXJA 1OGIA 4G36A 2ZIFA 4DEVA 5KQGA 2W5UA 3GVPA 1Z2PX 2ZPUA 3MJSA 3C4QA 1CUSA 5EIOA 5CGZA 2UUAB 1MLDA 1CU1A 3H65A 3OLXA 3W6UA 4DM4A 1EFLA 4UFPA 3AO0B 4QGSA 2VA8A 5E2IA 4RYLA 3FTCA 2HNBA 1UOEA 1NVKA 1ISFA 2RHGB 4L4YA 3EQZA 1B76A 3O7MA 4EK9A 1GAQA 2G25A 4ND3A 4UD2A 1HV8A 4ZT2A 3P2EA 2UZ0A 1KR2A 2LD4A 3ZHUA 4E5DA 4JHLA 1T6YA 2WIFA 1AZSC 3KPYA 3VHLB 3K5WA 3M1AA 4AWXA 4PIMA 4YRKA 1S2DA 4NBWA 3QU5A 1GVNB 4FU0A 1KSFX 5FOUA 1QRTA 1SXJC 2MSNA 4GECA 4RD2A 5E7JA 4CKWA 2FSUA 1QYVA 2FDCA 4N0EA 5KVVA 1T1SA 2J9YB 3VQTA 2D2XA 4QIHA 5G0TA 4YJGB 2BKLA 2C2GA 3M0EA 5IM5A 3U49A 1R50A 2H07A 1CBUA 2J6IA 3HN7A 3T15A 3HU2A 1DWPA 4IYRA 4ZO7A 1UPAA 1FS5A 3IVGA 1J9ZA 2XDWA 4QRHA 4TXNA 2V9ZA 1LVHA 4AJHA 3QKSA 4MINA 1L3IA 4WN9A 5BPFA 3TNDA 2VDMB 1RD4A 3WV4A 1ZMOA 5L3QA 3R5JA 4G0ZA 3ZH9B 4CIDA 4HDKA 4P53A 2NO4A 2GHIA 4YROA 3ZE9A 1ZSNA 2ZXEA 3IO3A 3MTQA 4QHYA 4W1PA 3WJ7A 1KERA 2PO5A 1D2EA 1YI1A 1QO0D 1E2FA 1ADYA 3PJDA 5GM2A 1RC0A 3O9MA 1GA6A 4C4OA 3DF9A 4DLYA 3O2SB 3A3NA 1I32A 2J1LA 1SZDA 3EIHA 2CLHB 1ONSA 3F96A 2ZGVA 2G1UA 5BMVA 3UWDA 5J58A 1ZIDA 4AU1A 1XV5A 4FNGA 4EFKA 4ZYVA 4AYTA 1T1EA 2EIXA 3HUEA 4QBTA 2ZAOA 1PSZA 4JFRA 2YFHA 4TTAA 4O1HA 6GPBA 2ZUFA 3ZLVA 3TLMA 3C2QA 4LI0A 1S0UA 3L6OO 5SYMA 5EUMA 3OI7A 1EM8B 1N6IA 1UKVY 1ZS9A 4YX9A 3MWFA 3J80A 1NDHA 5TMDA 1JEYB 3HRKA 1NFQA 2BRUC 3JD1A 3T54A 2AJDA 5C46F 4RIEA 1NX9A 3RJTA 2VL7A 1Y5LA 4N5HX 3E9ZA 1JW9B 3A6GA 2QDXA 2PD4A 1XMSA 3CZAA 3NKLA 3RROA 1F0YA 1T0PA 4M22A 4Z49A 1JIIA 1V2HE 4M8IA 5IKXA 1FS4A 3EE6A 2F9FA 5BSVA 1O8CA 3NOVA 4YRSA 3JWGA 1FL9A 3D8BA 3EGXA 4WPGA 2G5CA 4P36A 3HBFA 4TKUB 1VCIA 1B26A 3T6KA 1W2WB 4F5ZA 3D3QA 1PR2A 2XH8A 1JKIA 4RDCA 5KNDH 2CMDA 3BIJA 3CRW1 2HIGA 4OEHA 5I7SA 2O14A 2GPNA 1W19A 5B30A 2H63A 2UZ1B 3V7NA 1UXJA 3RF6A 3T4EA 3O8QB 4R05A 4FFLA 4KX5A 1V9CA 4PHFA 4KNWA 4WZBB 3GLHB 1X7ZB 8AT1A 2P5UA 1JLLA 4KSBA 3NEPX 2RI1A 3D0KA 4FLMA 3L8HA 4W6QA 1EGMB 2LW7A 1AKYA 1X1DA 4LF9B 4H17A 4DSOA 1SHKA 3KKZA 2VYVD 4W8OA 3PHGA 1C4XA 5B4TA 1UQTA 3SXUB 4JJ6A 4MRNA 2HWXA 2PKYX 1R8SA 4HQOA 5ALWA 2ZUVA 1ZINA 5AVQA 1IEVA 4OK5A 3F90A 1FZTA 3SOZA 1DAGA 4US2R 1R7RA 5ALSA 3OURA 3U4MA 2D5CA 1YU6A 3WBBA 3ZCSA 2QT1A 4DSAA 3PDUA 1B0ZA 2IITA 4X44A 3UJPA 2RC5A 2OA0A 1GPMA 2BUBA 2JANA 3TRIA 4GKAA 4B6RA 5CITA 2ZSJA 1WAMA 4LZOA 2F1OA 2QRHA 1PF7E 1USIA 2X0JA 4M9XA 2PH1A 1CFZA 2C20A 1AA6A 2NXJA 2WLTA 2HSDA 4GL4A 1RAEA 1FRZA 3F2IA 3TRFA 1L3BA 5KOHA 2AC2A 2GN9A 3KM0A 1RPNA 2OCIA 1E1YA 4NU6A 5EQTA 4FT4A 1Q0HA 2X5KO 1H4VB 3BXHA 2FPUA 1NR5A 1ATZA 3CX4A 1AURA 4NH0A 1APBA 4TQUS 1Z6XA 2GUWA 5DXAA 4HT3B 2ECOA 4GNRA 3FSJX 2FDXA 1AIPA 4K46A 3O9VA 2WD9A 5CJJA 3LWNA 4EYOA 3D2CA 3VR5D 1NHWA 4R8SA 4L0MA 3RSLA 1PT7A 1YU9A 1A4RA 3BVPA 3HS3A 3CZCA 4WKCA 1BKYA 4GXNA 2H57A 3DHEA 1I51A 3ND9A 5HKOA 1G59A 1GGMA 4H7PA 1H85A 2G77B 2X6QA 1ZOOA 5IULC 4TTQA 1P0FA 1A69A 1JH8A 4QULA 3GLHE 3CPJB 4WZBE 5K3EA 1E6UA 1F0KA 3S1LA 3HXOA 5DNEA 3OJCA 2R2AA 1S8OA 3NTLA 2DHDA 3O4HA 1BH2A 1Z7BA 3IALA 1P6QA 5JS8A 3NH9A 1CYDA 4OUDA 3OCJA 1KO8A 2AT1A 5HGJA 1P9OA 3BSFA 3DLTA 1T9ZA 4D41A 2GUGA 4B6QA 4BNXA 3H6KA 3EDMA 1QHNA 5AJHA 1Y3FE 1F38A 2V6GA 2CFRA 2FPPA 3K8QA 3JSXA 3SU8A 1NASA 4OY3A 3CCBA 1CWUA 3WXMA 4IMJB 1KI4A 2JBWA 3QX8A 4JYZA 2D6FA 1O95C 1RM3A 5TT0A 1FP7A 1M2OB 2V5UA 3QSGA 3EQ2A 2OG1A 3ZI7A 3JQBC 5LBUA 1CS0B 3LPCA 4JI3B 2DTXA 4BO0A 5EPOA 4A6DA 3E3NA 5K2MA 3ZDYB 1D5CA 1SC6A 2C3YA 3N0TA 2FU5C 1JQDA 3OO1A 3PR1A 2E4YA 1IUKA 1DBWA 4XH9B 1XJQA 5EI5A 4XD2A 4LMPA 2AA3A 3HGTA 2FMXA 4OKSA 2OGUA 4Q02A 1G18A 4Q00A 4CQJA 4M86A 5LZ4A 2I66A 4HLQB 2AX4A 2V8BA 3CSSA 3D6TB 2V6BA 4JCOA 5EWLB 2CNWA 5AXCA 4HEHA 5E6RA 4ZYLA 3RSOA 3QE0A 2H2HA 2GD0A 4G8BA 3IESA 4IL5A 5CA1A 3HM2A 2GO7A 4X3PA 4LYJA 5HFJA 3JWEA 1AY0A 4D9EA 2C29D 4G0WA 2VP2A 4PHHA 1TAGA 4C29A 3DS8A 4OL9A 3VPAA 1FJHA 2GPTA 4IS2A 3NT5A 5LU8A 1H69A 4G0VA 3AM3A 2C97A 2CGEA 1I80A 4FMCB 5F7ZA 4D79A 721PA 2Z6AA 2PGAA 5BW6B 4D0GA 4FKMA 3C8MA 3RM3A 2C42A 4QX6A 3Q72A 1CUXA 2QSJA 2VF2A 3C5EA 4QDJA 4YRDA 3GD7A 1FFAA 2Q0SA 4KQIA 3RNOA 1ZR2A 5JD5A 2DJIA 1HGXA 1K63A 2NVWA 1P91A 3OMWA 4LPKA 3RUCA 4EJSA 3TECE 3STTA 1T0HB 3D9QX 3DMPA 2QZPA 4KOAA 3TAXA 5SZKB 1GNRA 4BAZA 2GZSA 1BXZA 5FWXB 1G9SA 3QG1A 3VOAA 4TRNA 5AOCA 1NMQA 1VLZA 1X14A 1M2JA 4JBHA 4N7BA 4XSVA 1Q0QA 3NNDA 5E8JA 3RRFA 4TLBA 3FJYA 1MABB 2AQKA 3ACDA 4BO7A 4DAOA 5AXDA 5BT9A 3PD0A 1IXYA 1LX6A 2O23A 3KHUA 3TIIA 3EXFA 1YGPA 3GUZA 5MDHA 4R8RA 1XLVA 4QOFA 4BEJA 3T5AA 1R4MB 4YPFA 4EHKA 1IH8A 1IY2A 4XI9A 1EEHA 2BSQA 1PQ4A 1HEIA 3BJRA 2FPGA 2G40A 1TJ3A 4OXRA 4X5OA 2XVXA 3TD9A 4YV0A 1QHHA 4EB8A 1MX3A 2YC4C 1I3LA 4OPMA 4KFUA 1ONOA 1CQIA 2EWVA 3TQRA 1GADO 5IAKA 5AQEA 3EA5A 3LY9A 5ITSA 3BWXA 3VDRA 4FSHA 3EWIA 4Q18A 3KFXA 4DA0A 3KYDB 3EUAA 5DYNA 5HNKA 3VKGA 3TZKA 1WMSA 4F4IA 2O2JA 1LGYA 3HWRA 5JTTA 2VF7A 1SO8A 2CXTA 2AQ8A 2A86A 1U5BB 1P0CA 2JI7A 1QMGA 3HZZA 4LHSA 4Z7QB 5JS1A 3GRAA 3I72A 3EF0A 2I2AA 2RHWA 3B7GA 1XAHA 3BCHA 3DEJA 2AK3A 1C41A 1F2UB 1CLEA 1OQAA 3KUKA 4OBXA 4PBRA 3WGVA 1E9DA 4YCNA 3AV3A 1PFVA 3LX8A 1BS2A 3TPCA 3D6NB 1PL7A 2AXNA 4C7KA 3TSCA 5IXYA 1ZPDA 4YC7A 3UA4A 2BSXA 1OXMA 3V1TC 4UBJA 3PJGA 4XTRA 3I58A 4WCFC 2C4WA 3CF4A 1CEEA 3IBTA 4YGXB 4XJVA 4FX2A 2D5AA 2HN9A 3PXDA 2GT1A 4S1WA 3UMCA 4QL3A 2ZTHA 3GRKA 2WUVA 1E77A 3TSAA 4EFDA 4MS4B 3S70A 4RQAA 1HZZC 2ZJ6A 4N0QA 5DSZA 1N5JA 1T9GS 1U3VA 4BNYA 2WMOB 4LWQA 1XU7A 3VYUB 1UM8A 2FRDC 4M9CA 5AVYA 2FMHA 3VPDA 2G7MC 3TUZC 3DE5X 2B6HA 5I7OA 3HI6A 3ZY3A 3MCAA 1NVGA 4GFDA 2XF8A 2YZNA 2I67A 2RI6A 4EGSA 1YZVA 2OHGA 2O3UA 3WJ2A 4DEXA 5DMXA 2ZSEA 5ARCA 4WFQA 2D5BA 3NTQA 2K2WA 3AIKA 4WY5A 1U94A 1AQYA 1SBIA 1ZCAA 2EEZA 3D3JA 3GVCA 5F1KA 3TQIA 1USWA 5JMTA 4YYEA 1L6RA 2R87A 3EH1A 3KAQA 4IXWA 3PXEA 4B7CA 1E9FA 3WMGA 3JY6A 3RWBA 4LVUA 1Z13A 5DIZA 3ZUGA 2WV7A 1Z7YA 4TL9A 4WESB 5IARA 3WDLA 2PUWA 1RAGA 1NVXQ 3KR2A 3UPUA 2FUKA 3ADKA 1VE9A 1W4AA 1Z6GA 4J03A 1T1IA 4R7ZA 3T9AA 2EP7A 3IB3A 3MCZA 2DUUA 2HSJA 3A6EA 3N76A 1PLKA 1G1MA 2XWBF 5KTMA 4PZLA 4UZEA 4D4LA 5K3SA 2Y0DA 2B1QA 3NDPA 5AFSA 2ATIA 3D0OA 4J1TC 4PPGA 2O9JA 1Z5WA 1M54A 4I9NA 3I92A 2WM9B 3B6EA 1XLUA 3GPIA 5DASA 5TXGA 4B0PA 3NXKA 4UDXX 3I2IA 5IAEA 3O93A 5JYEA 4UREA 3OAAD 4IIDA 1J0XO 2R6FA 2WJ4A 4M38A 1IBLB 1B0UA 4RMGA 5DWVA 4OXNA 2G6TA 4IEFB 4PCVA 1MAVA 2ZYTX 2ZUUA 4CEIB 4FP9A 1N3YA 3FBTA 3GAAA 1D7OA 4P86A 5D2CA 3L7JA 4F2PA 4EY8A 5BVGB 1ATIA 2BHTA 1TJYA 2CC2A 3OICA 2WDPA 4U7WA 2APJA 3I8OA 1RI1A 5FDFA 3OQPA 1DQZA 5LP6A 1D03A 1JQKA 2QDKA 4CM3A 1YR2A 2PT5A 5A5GA 2NTVA 2ZJFA 2VDOB 3FYUA 3KZOA 4HAZA 1QF7A 4I5DA 3ZK7A 4LF5B 2CWDA 4MKGA 4CPDA 2FN3A 1O87A 3S7TA 4YP6A 1M2KA 2FCRA 4FINA 4OGLA 3LPDA 2O7QA 4ITVA 4PRKA 4X60A 5E3JA 4FOPA 3T1NA 1HH4A 1QS0B 5F3WB 3KELA 5AQ1A 1NM5C 2OSBA 2J9FA 2XNDA 1EJ0A 3K3PA 2DT5A 1KH1A 3MUEA 4I6JA 1X9IA 1BJTA 2OFXA 4KXNA 1NXQA 4AVYA 1E9RA 2KQUA 4IOLA 5J4HA 1HK7A 2WWGA 3CNNA 4HYTA 5ELLA 3GJQA 1KI2A 1U1EA 1WEKA 2CJYA 3IOCA 4LJ9A 1N7HA 1EJ6A 4HOYA 2QTVB 2G4CA 1JSRA 1MAHA 4D9HA 3PD7A 1BAPA 4TZ0A 1XI2A 4J0JA 3G0IA 1KP2A 5AP9A 1RWKA 5F7JA 1DKOA 5EHIA 3MXTA 2HDHA 4EVSA 2BI4A 2CLKB 1B23P 5GJBA 1GNSA 2D5IA 3FR7A 5K6TA 3DSRA 4PM4A 1R15A 4FC6A 5I8ZA 1ISMA 3NYWA 4S2UA 3EQ8A 1U0BB 2GWRA 2V58A 3IP3A 1DZIA 4C0SA 4TLEA 1N2JA 1R66A 4P84A 1WVGA 3WSTA 1NF8A 4F6RA 5JZ9A 3HXTA 4D5EA 4E6PA 4W4TA 3DA8A 1G60A 5FR2A 4KNYA 2BTEA 1N2CB 1JUDA 1NNI1 2F43A 1QV9A 4DWWA 4WINA 1PT8A 4HMQA 4QDOA 4MQ5A 3JXEA 4MVJI 2VHZA 1JFFB 1PUXA 3SBEA 4BMCA 3IP6A 2IP1A 2CD9A 3MNFA 3ZDRA 4C08A 3P2YA 2ZIAA 1T5DX 3L0ZA 1O96A 4H15A 1OF1A 1PG2A 2DETA 1RAFA 3S99A 1K27A 3TSOA 4FS3A 1GYRA 2JZNA 3SC6A 1DUVG 2Y8EA 3QI2A 4ND6A 3AFHA 2VBFA 3AUXA 1KAEA 1Y8QB 3ISVA 3PENA 3EGEA 2AS0A 3IVAA 3BRWA 4KUEA 3I9FA 5AVUA 5FOVA 3G0OA 1YZNA 1NOIA 4QQ8A 4TMYA 4U5XA 4CCWA 2P6PA 2OP1A 4I1UA 3CWQA 1YQQA 3JWIA 2QI9F 2DR2A 2IXDA 3B5IA 3SQMA 5F7OA 1YNSA 3K53A 5C31A 1IXRC 1OXTA 4FD2A 5LYJA 1UBUS 2O5VA 4Z7OB 4UU7A 1QTRA 4FEEA 4GC5A 1ZOLA 2GCPA 2TYSB 1EK2A 2OO3A 2ZB7A 2NU8A 3Q9NA 1P4SA 1HT2E 2QMZA 3T3OA 4I55F 4K9DA 3LC2O 1WXQA 2OHVA 4E08A 5EQFA 3OY7A 1OXVA 3KUUA 4EPXA 5LQJA 3GA7A 1N34B 4B40A 4QWMA 2KM1A 1YDMA 5CR9A 4HZUB 2BZ1A 2J3LA 4HXYA 3U6BA 5AUPB 2CNBA 4EAAA 2GK7A 3H13A 2EZ4A 3E7XA 1T26A 4LOLA 2OYRA 2OC4A 3ISTA 3I5UA 1IJBA 1D2HA 1GZ5A 1K92A 1PQUA 1Z0ZA 2JBAB 5FO1A 4P5DA 1E2NA 2NZUG 3ENZA 3QA3E 4H1UA 4RBNA 1DAMA 4AX4A 4OYHA 1S1MA 4DLUA 1BO6A 5JRZA 1XL1A 3VTAA 1DEXA 3PDWA 1J8QA 3GRVA 1U7OA 4PSUA 1CY0A 1AK1A 1KVQA 1N2CE 1P2DA 4JYBA 1L7DA 5K8LA 2YWBA 5L6LB 2VPPA 2LXNA 4TWAA 4GKKB 1WP4A 1J23A 2JIDA 4EF4A 2JASA 4D02A 2PQ6A 1SOMA 4POOA 2Y2UA 2ZRQA 1MOZA 3FCOA 5ELMA 4YHBA 4HH3C 4LRQA 2AF3C 4F2GA 4A6XA 8ATCA 1RHRA 4GMKA 5HDQA 5THKA 3V3TA 2IP4A 5KTSA 3E9MA 3L7IA 1Z83A 5J2UA 2H1OA 2VTVA 2FEXA 1V16A 2HIMA 2Q41A 1U6JA 3P32A 4CW7A 5IN4A 4K6CA 4OI0A 3RYCB 4Y6LA 2B8NA 5JQGA 2MOKA 2G4VA 3D64A 2ANCA 3GOQA 3GJRA 5J63A 1JB9A 3Q11A 4ZHQB 3LUAA 1IM8A 1W0JA 3HHEA 4EPYA 3UWKA 4WN9B 5EIWA 5KNLA 5KYXA 2AXQA 4QFBA 3EPKA 1ORHA 3JQ8B 3O4VA 4RTJA 4HDKB 3QJ5A 1WQ4A 1TQ6A 1F2VA 3G7UA 1XHEA 5EHQA 3KLOA 1NF2A 5EL0A 1YZFA 2W8BA 1G5PA 1YRBA 4DG8A 2Y66A 3GN1A 5AJWA 2X0IA 2YRFA 3O75A 3QVGB 4ERXA 3N7AA 3NH6A 2I7TA 1KK2A 1ADJA 3OJLA 4JYCA 4MVXA 1YJAA 5DJ5A 2R1TB 5FNZA 2O7VA 2C7OA 3WIOA 1O95D 3CSUA 3BJEA 4JLVA 3IMCA 2GK3A 3CO0S 2WT4A 5BMVB 2VAWA 1ZMXA 3JAMA 4DLLA 4YMUA 1VYTA 4BYMA 2O8BB 1WF3A 2V0GA 3Q3IA 2EFJA 7ADHA 2R47A 4MUGA 1N92A 3ENKA 1GPH1 3AW9A 2QN8A 4NPHA 4X45A 3SC4A 2CXHA 3VZBA 3PXGA 3SC2A 2NZJA 3KQQA 1IBKB 5A0VA 4M7PA 3ZCTA 2MSEB 2ZRPA 2PX2A 3GJ3A 4RKRA 4E14A 2M98A 2WA1A 3PK0A 4A4DA 1UK7A 1V37A 1DPFA 2H4HA 5CMLA 3VGJA 4OOFA 4X6XA 4EHFA 1L2TA 2E37A 1C7EA 1OB2A 1X77A 3AL3A 3ZGYA 4JU9A 6ADHA 3ID6C 4XJTA 3UJAA 1QF6A 2MINB 3OC0A 1WWKA 3QLVA 4UJ3A 2NN3C 2NPIA 2Q7OE 4Y2SA 5CB4A 3HGQA 5K01A 5PNTA 1FQJA 3EGXB 2PH3A 4WKOA 2IV7A 4RU1A 3IULA 4X7PA 3UTDA 3PGLA 5B57C 1QP0A 2AR9A 2IV2X 4F4UA 1P0IA 1OHHD 1QC5B 3P71T 1L4FA 4Q47A 4F21A 3DTYA 4C6HA 4DCVA 4BGVA 1JYEA 1DBQA 1QIIA 1NF9A 1PJZA 4Q3OA 3G8DA 3I3SR 4GPTA 4BVJA 4DYDA 4P3PA 1FNDA 1P0MA 4HLCA 4X1OA 1W36D 4W5OA 4TZ6A 1WPRA 1BROA 3MT9A 4P3OA 621PA 4ENPA 3AR8A 3M6IA 3P0IA 1B15A 2DH6A 1X1SA 3ZWBA 1R4ZA 1UZUA 2HIHA 3DWGA 2H2DA 1CUGA 1H2WA 3M34A 1QFZA 3PHCA 4KWEA 2OCXA 4DQUA 3NCTA 5BR7A 1L1EA 2JLBA 3BFVA 1VJCA 4IDDA 3TQHA 4PYRA 3B1FA 4C4AA 4RWZA 3U19A 1CUEA 1YFZA 3KOWA 5C53B 2R6AA 5T3UA 2ZIWB 4YRCA 2P9CA 3SIXA 3I2GA 3J81A 4X9XA 1LXCA 4GQIA 3KQYA 3K9QO 4N3GA 1FLNA 1P5RA 4V3BA 3RS4A 2C3MA 1PE0A 3MJCA 1GN9A 3I2FA 3KB1A 3N75A 4OCZA 2XQJA 5A3RA 3GLIA 1TUBB 1ZSVA 3ENNA 2QE7D 3GAFA 5HBGA 3DMDA 3TYXA 2EWWA 3HI4A 4BEVA 2VDJA 2W8ZA 5SV2A 1OU4A 4ML3A 1A96A 1TLLA 5EEHA 3TW8A 4RPJA 5FXMA 3LUCA 4FHDA 1IIBA 2Q2OA 4AQYB 1ZHOA 4D1YA 1KZYC 3ZDXB 3EXHC 4IIFA 1OXSC 5CFLA 5KNBA 2GB4A 1O1YA 4O4JA 2H3HA 2DP4E 1YFJA 5A06A 1YR8A 3M5WA 4Z7NB 2Z4SA 5EMNA 1OBHA 2Y71A 3KV3O 2OB2A 1ZD3A 1SXGA 1N2GA 2ZR8A 3I05A 2WY2D 4ANFA 3PKIA 3D8TA 5AM2A 5ITVA 5C1OA 2E85A 2OV2A 2B4TO 2HMUA 2C04A 5H02A 2G1KA 2Q2WA 5FNVB 2CLMB 1MC1A 2IHVA 5DYYA 3G2MA 2GPWA 2HU8A 3A3OA 3B82A 5JEEA 5LNK6 4YXFA 3H2IA 1DC7A 4FFRA 3UAGA 4BZWA 5J9FA 3EPHA 3UJNA 1UEIA 3K1YA 3URMA 1DZ3A 5A5VA 2Z98A 2P2ZA 4R8VA 3U9LA 1O5IA 2QX6A 3LY5A 3MJTA 3I42A 4GICA 2QZ9A 4L4ZA 4DDVA 2Q1XA 4FKBA 3PEYA 1TAHA 1PJSA 4XLTA 1F3LA 1SEPA 3CXUA 3FX2A 3OZTA 2P9EA 4KXWA 1MPXA 2FFHA 2CZCA 4DE5A 1UDRA 4OUDB 1RJDA 1U9JA 2A58A 4YAJA 1TQ4A 3VHQA 5NLLA 1PFYA 3FZGA 5L4NA 2CHGA 2FSFA 4JP5A 4CKEB 1XEAA 2C2ZA 3GG9A 2FPPB 3G1WA 2DOKA 1YB6A 5GIPE 1NV9A 3HBJA 3GGOA 4ILEA 3ZW9A 5A0TA 1Z16A 2CL5A 3PXCX 1NUPA 1KS2A 3UGQA 2E6KA 1PTJC 2BMEA 5THXA 2XGMA 4BV9A 3K70C 1NZDA 3MG9A 4Q4AB 3U7JA 1I7NA 3D3KA 3A3KA 3JRWA 1RFLA 1UANA 3RVBA 3TZLA 2H1FA 3A04A 1NVDA 2QUHA 4C6RA 1E9CA 1ADFA 1Q7TA 3AVUA 2ZRCA 5GP1A 3BMNA 4KO4S 4WBSA 1FP6A 3I9V1 1L0BA 1QH8A 1VLQA 4LZPA 4WLEA 3G23A 4OSPA 2NZYA 3GJ4A 5IC6A 3DLHA 3T4UA 3KPJA 2RKOA 4HNVA 1J90A 5E6RB 5F9HA 1XFDA 2F3PA 2OL4A 2WTEA 3GGDA 5FOSA 5CA1B 2PRYA 3MJ4A 5CM2Z 1KDZA 2O3JA 4MYRA 1RCUA 1YQDA 2D8AA 4A8JA 3O4JA 3WB2A 4RLQA 3PT5A 3W2IA 2HA5A 3KALA 1EVYA 1ZC3A 2X8JB 4AF7A 2QJTA 5HRCA 5JROA 2J0VA 4BQRA 4I14A 3L46A 4FDLA 1E79A 2WJJA 5BN4B 4QKQA 2GBGA 5J23A 4IJVA 4MAMA 4OHXA 5JD4A 4MHOA 4HDOB 3TTYA 1U3CA 3A8TA 2GPAA 5FA6A 2NW6A 1Y7TA 3K5IA 3Q5DA 2R6GA 2DYKA 5J1SB 4MW1A 1SQFA 3X2EA 5HJ7A 2XKBA 4CDRA 4LOJA 2Z58A 2QLTA 3CKLA 1RRKA 2XNJA 4R69A 4RHFA 1UC5B 3UM9A 4EJSB 3DT6A 3OJXA 4ZJZA 1W4BA 1IFXA 4XGNA 4AICA 4ZN6A 5F2NA 2PV7A 1R0XA 2VPQA 2G28A 1JHAA 4YASA 1DGQA 4ZYTA 3HA2A 4I2VA 2IOYA 1EK5A 4BCCA 2P0AA 4KO8A 4Y2XA 1W1WA 1SKBA 2Z8YM 2JH8A 3LHFA 2DBQA 4RPIA 1E63A 2RGEA 3BFPA 1U0GA 5ER9A 4IH4A 2IH2A 1GG9A 2JC3A 3IXLA 5EFZA 1Z29A 2GYUA 2ZRMA 5E4TA 5H16A 5LMZA 4PYNA 3DOOA 2BFBA 3OLVA 5ABPA 2AZDA 2QAGA 1CS4C 2EQBA 2YW9A 1F5SA 1P5HA 4JUDX 4BFCA 5ICFA 3SS9X 4ASUA 5HZHA 4HGZA 5E2BA 5F77A 2ZI5A 4DLXA 4U7DA 1AM4D 2HO5A 3OESA 2VDQB 3D7NA 3N70A 3GLUA 3FGOA 3WGLA 1U81A 5KYVA 3NBZC 2AW5A 3GBVA 3ZE1B 3B8EA 3TDNA 1OH5A 1K89A 2IZOA 1GPAA 1FNMA 1R8QA 2L82A 3CVOA 3OE7A 4DUGA 1DDIA 2PTHA 4CTNA 4M8NE 4UUOA 4Y9UA 1T25A 2AH5A 3LVQE 2HRCA 1RHQA 2VZEA 3WWZA 4RSMA 3NHYA 1L8LA 5JRJA 1K7EB 3K9GA 4WIAA 1MC4A 3QOYA 5KSWB 3Q12A 4CEJB 4I9FA 2GSDA 5AJYA 1J0CA 3ZKWA 1KJ8A 1NVTA 1XU9A 4RESA 2JGEA 5CPBA 3N2YA 1I24A 3PPIA 2FH5B 1SCDA 4ZVQA 2RC6A 4AN4A 4IQFA 5CXQA 3OSUA 5BSGA 3K5PA 2VUUA 1CNFA 1U8EA 3O8OA 4H2DA 3RU9A 1US8A 1WKVA 3UAZA 3KYIB 3DWFA 3OKCA 2GK6A 4MKXA 5T6MA 3JQCA 4JLUA 1PDOA 5K6AA 1T4CB 3HRIA 4A23A 1H4QA 3P0RA 4JZKA 4GSYA 3I5YA 3WK8A 2ECKA 4OQFA 3TVTA 2X6RA 5H7XA 5C8ZA 1XKTA 1RJWA 1AS3A 1Z0AA 2ZK7A 3NTVA 1R0WA 1TIKA 2GR9A 2HU7A 4L15A 3ZVLA 4F3CA 3BGIA 5JXJA 1DO0A 1P4GA 1MXFA 5KAPA 5B7GA 4AUMA 1CX9B 3LT4A 4OI1A 1O89A 4G4JA 4IJQA 3I37X 1NP7A 2YHSA 4KFRA 4TMFA 3ZHRA 4TYNA 2CLFB 2OECA 3KVRA 1OWPA 2C2YA 2VHJA 3Q7QA 2DKOA 4JIMA 3UUWA 5ICSA 2AUMA 1U90A 3NOXA 4GPBA 3SF8A 4Z9AA 3V8EA 1QPGA 2IE0A 3NHBA 1HDRA 2G1JA 5KYUA 1WA5A 5DNWA 1AXGA 3M1YA 3QKIA 2ZE8A 1VE7A 2JI4A 4KW7A 1N1DA 1P0QA 3E2PA 1V1RA 4DPMA 2GPSA 2IODA 2IUTA 5A4DA 2XXBA 3CPSA 1G291 4TXLA 3SQWA 1LK7A 1NUSA 3LGXA 2DERA 1KP3A 1EGVB 3B12A 2GNAA 3AF1A 4KO2S 2GBLC 2JKZA 1X9GA 1KVUA 3FSGD 3V42A 3THXA 4F6LA 5EIXA 4BY9E 4AW9A 5CDHA 4HN2A 2B8EA 4JJ4A 1KYXA 3QVVA 4URYR 3WQQA 5D1HA 3G2JA 2SKDA 3K0HA 4O2AF 3EAGA 1M67A 1Q95A 2C54A 2QU7A 5HIIA 2XCRB 4J1QA 1PT5A 1A2OA 2F1RA 2Z8XA 2NUPB 2CDBA 2H08A 3MJDA 4FYJA 4ZCQA 2YW2A 2E89A 4WACA 1XMXA 1J5PA 1F4LA 3PTZA 2FTKE 2NVBA 4U2KA 3WL8A 3ZZUA 1O7JA 4UKDA 5DISB 1PJ2A 1CUWA 5CT9A 2G9NA 1Z26A 1KEWA 4HB2A 3JARA 4PPFA 1XDDA 1VHQA 2XUJA 1SC3A 1FTNA 3GJSA 3PA6A 2B8JA 1UDAA 1VYVA 4TZTA 5CIWA 5FTWA 3E84A 4FFMA 4RHEA 1V5EA 5FP0A 3WA6A 2IHTA 3S5UA 4UU0A 5DH9A 1HYEA 2P3LA 1LBIA 2FJ0A 3AKZA 4XYEA 4PLCA 5K2OA 1ETHA 1TUEA 2EX0A 1LS6A 1P45A 2YDXA 2ZAMA 1JR4A 4PZEA 3M9XA 2HHCA 1QGUB 1W9MA 2DHCA 2HREA 3E05A 5ERYA 3I45A 3NT2A 1P60A 3F73A 2SCUA 2ZTLA 3C70A 1THMA 4EKDA 3Q2IA 4M1OA 2VF4X 1TKBA 2J9FB 1QQ7A 3G8YA 4J3NA 2G7ZA 4FFDA 1JKXA 1KHTA 2A59A 3PP8A 1DC5A 3T7DA 4JR1A 4PANA 4BWGA 3PQ8A 2VDWA 1ISPA 1RADA 4AMUA 2Z95A 5IABA 3BMOA 3TFWA 3GDHA 1D6NA 1GKUB 1PG0A 2QX7A 3L0IB 1ACJA 3LF2A 4QPZA 5FV4A 4FBMA 4E07A 3MHPA 3V1KA 2AC4A 5IF9A 4ZPJA 2QT0A 3O1HB 5B6IA 3S1SA 4N4AA 3ET5A 3PHHA 4TS1A 4XR9A 3FG9A 1GU7A 1H5QA 3PSAA 3SQOA 3BIWA 4BMSA 4QOIA 4M3NA 5A03A 1DRVA 4RJLA 4ZV9A 1P1CA 2H9IA 3F0TA 3KXLA 3FPKA 5DYIA 4EW6A 1N2ZA 5G41A 3N6XA 3OIYA 3LNTA 2VQDA 5K4AA 4ARBA 2ACWA 1AUOA 1G3MA 3ABQB 3PNLA 4BLOA 2O0HA 3LG2A 1DKRA 1TUGA 4BE7B 3KSBC 3MQFA 2IYLD 1MB3A 1RYZA 2FP4A 3WNVA 4B81A 4X7RA 4GNKA 1Y7HA 2RAUA 3C6KA 4ZXPA 2JNWA 2KLBA 3P9PA 4PV7A 4W5NA 3WHIA 4IQ0A 4O4IA 3MOIA 4BNUA 4P3NA 3PNOA 4NDZA 1X0VA 2ZU6A 1MJGA 1TZCA 1GPBA 3FZEA 2P6MA 4IFBA 4CIBA 3SHQA 4NYJQ 3KYBA 4JBGA 4TS9A 1DJOA 3WYCA 4AG3A 1F6WA 1K7YA 1REQA 3VKFA 1HORA 3TBKA 4F1JA 4Z2YA 4IFEA 1CETA 1RBQA 5CU7A 1BXKA 1ND5A 4WL0A 1GGHA 3AOGA 1JEJA 1R16A 4MPTA 4O4LA 5T67A 4LCBA 4R0VA 3OC6A 2YJNA 5LYJB 3DLIA 1L5OA 4DC9A 4UTXA 2PX4A 2IYZA 3NPMA 4YJHB 1P81A 4KHPB 5CT6A 3UK6A 4PFKA 4ZCRA 4PC3A 3HR4A 3WGYA 4EA7A 4HR7A 4UJ5A 4OHWA 1SKAA 2HQBA 1LQUA 2C9ZA 1SUFA 4FMDF 5JALA 3UAWA 4KO3S 1BKDR 4AKIA 1YULA 3KK0A 1NPYA 1R74A 1O9BA 1R0LA 3QH4A 4G5SA 2H11A 1UDBA 1EE2A 2QWXA 2WM8A 5EWMB 2DUNA 1EA5A 1GRCA 1PFQA 4K9OA 4XD7D 5GOTA 2P35A 4JR0A 4BFYA 4XIGS 1FNSA 1S02A 4EA8A 3L0OA 4N7RA 3DV2A 3ROTA 4RLFA 1MC8A 1L7RA 2WB4A 5EHXA 2FEWB 1V6CA 3EZLA 2O1EA 3PNBA 2C2OA 3BBPA 4DR1B 1NMZA 4OHVA 1D1PA 5A05A 5T8KC 3SMQA 1I1OA 5HM6A 3DHYA 4J0FA 4BGEA 3W04A 1JRLA 4IQGA 4EY5A 5ALOA 3O91A 3DXYA 1PJ4A 4L73A 2OENG 4DJJA 4PGMA 3SZOA 2AI1A 1X2BA 4NL4H 5GJWC 4K9KA 1T9AA 3FCYA 4A8HA 3LIPA 2IDJA 3G5LA 3V33A 2OXEA 3PNMA 2Y3IA 4LRUA 3WK6A 4FXPA 1BTOA 1HQYE 4CM9A 4MTLA 3EYAA 4FVTA 3W5JA 2DFTA 1RYNA 2PG3A 4IDEA 3ZG6A 4IHJF 4RD6A 2EL9A 2F1KA 3AYZB 3IILA 1BGVA 1ZXLA 3LCMA 2QSZA 4MYDA 5J2UB 2I5PO 2VK1A 1FUIA 3D5TA 2BGNA 2AXEA 2BJWA 3GEPA 2C0PA 3RADC 1YV9A 3KPWA 1QFXA 4KJXA 3VAAA 2HUNA 2IXFA 4WJZA 1VHJA 4DCPA 2O4UX 3HMKA 5JW6A 3OM9A 1WBJB 1TFUA 2MYTA 2VQSA 5JSYA 3VR3D 4C01A 4ZK2A 5KYXB 2GJ9A 2Y4OA 2Q5LA 2KYRA 2VLBA 2R8ZA 2IZ6A 4R40A 3ZZTA 5IJ0B 1UMKA 5JSKA 4D8VA 5JI3E 4DZZA 3IKVA 3ZVNA 4X92A 3H1GA 2SKCA 4EG1A 4ZRNA 4MRMB 2W8BB 2PGNA 1BJRE 2VXYA 3FW1A 3GUHA 3VMFA 3N8IA 1ZITA 3VAYA 3GEEA 4YJFB 2PD3A 1TPZA 2XNCA 1KFEB 2RHDA 3CF4G 4DSZA 2J3IA 1QVZA 4WVLA 4EKIA 3NRCA 2ZYDA 4PRZA 5FF9A 1UKYA 1PI3A 2ZDQA 4FJ0A 3DV9A 2O8CA 2TECE 4QDKA 2FRXA 5BOSB 1I8TA 2JZOA 1T9CA 4QUHA 5FWYA 3OQ1A 1JIQA 5I8WA 5M7EA 4D92A 1QIGA 4IIBA 4MYUA 3EZ9A 4YR7A 1RAIA 2W98A 3QFCA 5JWHA 4XA8A 4P4LA 2BY4A 2ZIVB 4AKSA 3SC2B 4WH0A 1SVOA 1X6VA 4LY0A 4JJEA 3T99A 2PUVA 4E2YA 2FJUA 3G9TA 1E6CA 4XCVA 1YH3A 2WYHA 3DEHA 3QOFA 1MOPA 1J8DA 1HRDA 1NW3A 4O33A 1EWKA 2XECA 3QNUA 4LUCA 3LBNA 4X20A 4ZEXA 4A2CA 3LCJA 2Z09A 1QG6A 5F98A 4P98A 1T2AA 3WKDA 1QE3A 3QV1A 3ESCA 2BFWA 4M1KA 5DM4A 2DUJA 3CUYA 3BB4A 1II0A 5AI8A 5B1IA 2V6FA 1MMFB 3NTXA 3HSSA 4LRTB 4BIIA 4WLUA 1HYHA 4LHEA 5GM1A 1JA9A 4AD8A 8OHMA 1VM6A 2GX6A 1UMDA 1GVHA 3LLSA 1EDOA 4A15A 4D9FA 3ZQ4A 4CG2A 3MUNA 1P9NA 1QK4A 1P8JA 4PYMA 5U4QA 3PTLA 2ZG6A 3WHLA 4BJ1A 4OHRA 1GRQA 1JG3A 1NAIA 2WDZA 3DB2A 5BSHA 2AJ8A 2D74A 2W2OA 2PLNA 2JEOA 4X93A 4HADA 1BNCA 3IUPA 3RSCA 2IHJA 3ZN2A 3EG5A 1W8IA 3D6FA 1LV7A 1SKUA 1ZGGA 5AKJA 3PITA 1JKJA 1E1QD 3PF9A 3F8SA 4GZ5A 4OGWA 4PY2A 1UJ2A 4NEGA 1YHYA 1PKXA 3QWIA 4BN0A 1J42A 4TRMA 4Z1MA 4IOMA 1CIPA 4CNBA 3BN3A 1H9CA 1H2FA 4D9KA 2XKJE 1UDCA 1J99A 1XJ0A 2QTWB 4CQMA 3EF1A 1UBGA 1BG6A 5BNFA 1YASA 5J4YA 3CU5A 3SBDA 4RGQA 3WL5A 2WPDD 4BJ3A 2W2KB 5FI3A 2C8JA 3QMWA 3IUNA 3QKWA 5IP5A 5ED4A 1I94B 2ZRFA 5CNJA 3GRYA 4F9FA 2X4GA 1WKCA 5BQ5A 5JDCA 2NGRA 2OGTA 4KFSA 1J2EA 5DLPA 4GF5A 1XA3A 2G82A 3BWVA 5HEKA 2P4QA 4BWFB 4H60A 1MV5A 1ODFA 1M2NA 2ZYIA 4HWRA 1E18A 3L0PA 4HDSB 1LBQA 4Z99A 1KZHA 3W4IA 1U7HA 4L8WB 1G1AA 1Z74A 5H8WA 2GH1A 1KDVA 4V0OA 4URHA 2IV3A 1BMQA 1T0BA 3PT9A 2BN4A 2EERA 5CX1A 1SQGA 1KYTA 2QEQA 1DX6A 1ZMRA 4ILKA 2ADFA 1KNQA 4M21A 4URXR 3NANA 2CHVA 3HPRA 4LSGA 5FWDA 1M2HA 1WHTA 1YA4A 4HEJA 2COUA 4Q1EA 1RT9A 2ZRDA 4KNVA 2JB9A 4AX8A 2KWIA 2RJ3A 3L92A 1FVHA 3OO0A 1YRQA 3PA8A 3O26A 4HD8A 1IVNA 2X5NA 1GAXA 3JASA 3GGSA 1QRAA 3N0RA 2WTNA 3WIVA 1NVEA 2FQ1A 5KU1A 5DPMA 1DAHA 2XHZA 5DMHA 3RVLA 4OSEA 4WA7A 4XUCA 5M3BA 1U2DA 4GDMA 4FYWA 4NPCA 2VJMB 1FRNA 4DBLC 5JPIA 1KWKA 2ZRKA 3VPFA 4B2YA 1GKKA 1YT5A 1UOOA 1XRPA 1Z2CA 3H7IA 3WYBA 4C14A 4EH1A 4UHFA 1SVNA 3CW9A 3D8HA 3VBEA 1JHMA 1UT6A 4RD4A 3LQQA 1B41A 4HN4B 4IJMA 1DDGA 4DMUB 4B76A 2IYTA 2A30A 4CMEC 1IOZA 2YKGA 1ZBDA 2K87A 3NRBA 1TEHA 2IZ7A 3P0JA 4KODA 1V45E 3BMXA 2QLJA 3NV7A 1ESEA 3TKLA 3IIMA 3PQ6A 1T4MA 3GLRA 1GOTA 2EKLA 1XBTA 4MUFA 4CDNA 3P9QA 4GGMX 3LZCA 3WP1B 4DM7A 2ZS9A 3K0CC 4UW9A 1K6EA 1YDEA 3KJHA 1QHSA 3NEAA 4AY3A 1T4GA 4M87A 4TL6A 4HF7A 1H2EA 4EPRA 3KZXA 2FWIA 1JG2A 3BMNB 3OBBA 1MP0A 1QH8B 2HPHA 4NNOA 5IPFA 2EAUA 1KTVA 2WJ6A 4EYEA 3C14C 4DMRA 3ADBA 1IY0A 3I8SA 4IXDA 4JBLA 4TS4A 4JB0A 4RWEA 5HUHA 2NYAA 3OT1B 1T36A 1Q1BA 4RZQA 4YT2A 4HGOA 5CVJA 1XGKA 3VZSA 3G5TA 1SBYA 4A8JB 3BULA 4BO9A 3U4GA 1LC3A 5FEUA 1UZLA 4AJ1A 1QRDA 5CIYA 4YJ3A 2GZDA 4PX2A 3BMCA 3CRVA 2OQRA 2OZEA 4I5FA 1WMBA 3GQBA 4N8DA 2BDEA 2I4MA 3NIFB 2HTFA 5TQ0A 3U3ZA 4DR3B 3EBOA 1U7ZA 2W2QA 3HLKA 3WGUA 1TF5A 1J21A 5EP3A 3AOEC 4B2IA 1DVRA 4GR5A 3JTEA 3BKWA 4KP7A 4MI1A 3ELUA 4M0MA 4O4HF 1Y9EA 2I2CA 1UKEA 2Z2IA 1QO0A 1T3GA 4RC9A 3BE4A 1YB7A 4QYIB 4U9HS 2D0PB 4BMVA 3ZYCA 1XSEA 1WXGA 3DZBA 2QRUA 1OCEA 3LXXA 4RF4A 1JL3A 1QDEA 1X1RA 2QIOA 3VYVA 2I3BA 2Y0BA 2C4KA 3QLUA 3R7FA 3U3XA 1FDOA 1AKNA 1GD1O 5ANRB 1VMDA 4MPRA 3WMEA 2Q6IA 4FB5A 2BT4A 1EBBA 4MGIR 3TLAA 4PQYA 5EJAA 1RKQA 4X7MA 1AQUA 3SE7A 3WISA 1JAIA 1IQPA 1N2XA 2OP0A 2QY9A 2XT6A 2QRJA 2LNDA 4C4XA 4FOSA 5BWCA 6REQB 5HUJA 1PFKA 1FFGA 3BTOA 1ZWKA 2WG1A 2RONA 4ZVKA 2OVFA 3PNYA 1BWRA 4A1FA 2JCVA 4F96A 2WKWA 3EIOA 4R2IA 4M1WA 3TW4A 4F5YA 2CVPA 1FFSA 2H1HA 1T8YA 1BWQA 4LKOA 3ZUPA 1NW7A 3MWEA 1SOWA 1M0TA 2IVZA 4G56A 4MDYA 4YPVA 4UAVA 4Y2UA 2KBEA 1YTUA 3IDFA 4I46A 1PW7A 1HA3A 4Q3DA 2GF0A 4RY2A 1XVVA 2X9VA 1L5MA 4P5PA 4IW3B 2C0CA 4TUYF 3W4KA 3DL2A 2WABA 3G5AA 5DHUA 4MV4A 3TTWA 1W2GA 4E2WA 2LBPA 3R7NA 4EGAA 3LQRA 1GG2A 1IWOA 3EVBA 2I6XA 2Q3EA 3RVKA 3PRHA 3CIFA 5EHGA 4I1IA 4F56A 3JVUA 4GUDA 2GVNA 4KK4A 1ZJ6A 1L7XA 5GADl 4WGGA 5LQMA 1U2PA 3ZKWB 2GDZA 4UBNA 3O90A 1AQLA 3AVXA 2V03A 3N07A 4ZPXA 3VV3A 5K8JB 2VYVA 4FYXA 1H22A 1SIWA 3CUSA 3HZRA 1G7RA 3C4VA 4FFPA 3ED1A 5K0LA 4DLAA 1MG5A 1FLVA 2A5DA 2ZOSA 2XZPA 3B6KA 1B8OA 3FCEA 1VMIA 4FD3A 4W1RA 5ARDA 3QQ5A 2X22A 3HWWA 1W5AA 1U0OC 4LJRA 3T3HA 1J8FA 2OXFA 4NEHB 4KR2A 2VTEA 1QH9A 1V39A 1ODJA 2PVPA 2ZIUB 2D2VA 3KL2A 4K9NA 3PNPA 4Z2AA 5HCUA 4PU0A 4U1RA 4ZOLA 4XQ9A 4BP9A 1PNTA 1R5OA 3UQYS 4G89A 3FHCB 3WQRA 5KWSA 3RV3A 7REQA 5KWEA 2GAJA 1TC1A 4UE3S 2B0JA 1I3CA 5C8VA 2IZZA 4FGSA 4CRWB 2I3AA 4GO1A 4F97A 1DLIA 1PWHA 4NZZA 1PYGA 4GHWA 4ZEMA 2OV3A 4B4DA 2W2NA 5CTAA 3GH3A 3QU7A 3Q15C 5J40A 5J5AA 5L8VA 1GRRA 3IRUA 4B4OA 2GS9A 2QAJA 3EZXA 4AJIA 3IGFA 1S8AA 2DHQA 2IHYA 4KDEA 2KLHA 4YP0A 5JZMA 4HLNA 4URWR 3THYA 3EVNA 4DIBA 1V1RB 4M9ZA 5DGCA 1O77A 1NDUA 1KO5A 1VDMA 2FQXA 2JW5A 2YIJA 2ZSKA 3C41J 3ESDA 1EUDB 4MMXB 1U0TA 4X00A 5TX7A 4EUHA 2RAPA 3C8HA 2FZEA 4DCMA 3ESBA 4CUJA 2GO1A 3THXB 4C0QC 1RWQA 1UWVA 3KT8A 3G49A 1UWKA 3WKEA 5LDDC 3BXPA 1L1RA 2JGFA 2BFFB 3T1TA 5DI9A 5CB6A 2WF6A 2RG1A 1QQ6A 4BAUA 3AGQA 4GXQA 4R2LA 1HDYA 1AJEA 4A10A 3M3HA 1XCMA 3GFTA 4E88A 1RPZA 2A0KA 2ERCA 4MLPA 4MV7A 2CVZA 3I6YA 1Z37A 1VJGA 3MINA 4U6NA 5JJCA 4PLZA 4MQFA 2V74B 3SCZA 4AMYA 3BILA 4LGCA 1SFRA 3CEHA 4LDZA 1U0HC 4C4RA 4IIVA 3IIJA 5EXXA 2R6DA 5KOIA 1JQAA 4C7OB 3U1VA 3COSA 3JARB 4MUAA 1L7NA 4RA6B 4UCWA 1UFVA 2E4WA 4AN0A 3S8EA 3L6CA 3NALA 5JBNA 3SWWA 4I1OA 4TSFD 5JLJA 3A6LA 3GARA 3G8CA 4A91A 3I6BA 2PXXA 4OJYA 2AN3A 2UVQA 1GITA 2FZVA 5DW3A 4D80A 1KJNA 5HKLA 1N1MA 2C7QA 2REQB 3TQCA 4JLKA 4MO9A 1EK1A 1Q0PA 2FOLA 3OCCA 2C59A 3P26A 4LY3A 2B7LA 4Q9JA 1Y42X 1DC4A 1IM2A 2JLCA 4JQOA 1RXYA 3FPHA 2QZZA 3ERCA 4DQ0A 2KMLA 5KEIA 1RLUA 2SCUB 1A9XB 3EEBA 3O4GA 4DT1A 4AAYA 1B00A 3K09A 1N32B 1O5OA 4Z4EA 3F6EX 3DMRA 1RBZA 4DMLA 3HGMA 4BAGA 2P40A 4C4PA 1NKTA 2F3UA 2Z83A 3PXAA 2VDWB 3SHTA 1YIDA 2FW6A 4S1NA 3RLFA 3TD2A 1JHXA 4BNIA 4KREA 2Q5IA 2O2DA 3B6JA 1ECJA 1CEQA 3KDPA 3ROKA 5ITZA 1DJLA 1YBAA 3KQTA 2CHUA 3DO5A 3FVVA 3PICA 4I55B 2QIPA 2PCLA 1Z35A 4P38A 4MVJH 1OU0A 1NP3A 2Y1CA 1YHNA 3X0DA 2BTQB 2P9ZA 1S1CA 5C8DA 4H0CA 4ZZ1A 4DR6B 1OI3A 1SQSA 4I4TF 1JJFA 4PO9A 3N59A 5EPEA 3VPXA 3E9DA 5CBPA 2WHYA 3ELWA 4GOOD 5EJIA 5AD1A 3H5NA 1O54A 1JWAB 2PKCA 3DDNA 4UMEA 3TTTA 1R9NA 4DA9A 3URKA 4J6EA 2ZLBA 4IKOA 1SKQA 3D43A 3ICCA 4DRYA 2X0DA 2A88A 3VNSA 2CMGA 4HAOA 1EHCA 1OV6A 3AVTA 3HCRA 1EFKA 2ECPA 2WBLC 1QG0A 4FSDA 2H1CA 1BKSB 1XQVA 2EX4A 2GERA 3BHMA 3LUHA 3UWPA 4CKXA 4CWAA 1FJXA 5FPTA 2GOYA 2AYYA 1PJCA 3LOQA 3U26A 3NC1C 2JFFA 2DLCX 1JQEA 1JDZA 2Z1DA 3HUUA 4DWVA 3SEAA 1TF2A 3GVXA 1NG1A 4Y18A 3M4ZA 3CLVA 3DTNA 3MYYA 4ATNA 3IUSA 4CFZA 3E48A 1EEXB 4CMIA 1YJCA 4PGFA 3UC9A 3H5VA 2FEOA 4MQEA 4C3OB 4RCZA 2CFSA 1HL3A 2ZYRA 1E2PA 1ZMBA 2REOA 2OAEA 4OHBA 1PZNA 1WABA 2DPGA 4WZAA 1KEUA 1G8PA 3OTGA 2ZSFA 3UAXA 4BO8A 5KVAA 1WKBA 4FHZA 4KQCA 1KZ6A 2IXGA 1QV7A 2OBYA 5EZ6B 2WAOA 5GZ6A 4BC1A 4BZQA 3LV8A 3CZ5A 3IUMA 2DZDA 4Q16A 1W93A 1J2JA 4JJAA 2VZLA 3KQOA 4RZHA 5EQJB 2IX9A 3U4HA 2FYTA 3IDZA 4MVJF 4Q82A 1H3EA 4WASA 4YH1A 1ZRMA 3WRYC 3ZE6A 3BE8A 4BVEA 1Z17A 2IIPA 5BUZA 4MMZB 3RAJA 4DV7B 2IYYA 3VKVA 4BRZA 5JNLA 1YKFA 1EZ4A 2XQKA 2HEIA 1BHSA 1QUFA 5AM4A 4EHAA 5FUXA 1QKIA 4RLSA 4ALIA 4NATA 2H4YA 5F76A 3Q2OA 1KK1A 1XALA 4JUIA 1GKYA 3RTDA 1Q11A 4YCDA 4KGZA 2HRZA 4US1R 1SUEA 5CH5A 1ZH6A 3M70A 3DXZA 5CW2A 2WI8A 1E4VA 2ZVPX 3F47A 3I53A 3NGLA 1NWHA 3CWCA 3OIUA 4MPJA 4TKLA 5LM3A 4DV5B 1BMFD 2W4QA 3C6XA 2PBRA 3E8XA 3FMFA 4HX9A 1BE6A 4G5XA 1T2CA 2IF0A 4Y1GA 1TVKA 3OZSA 2Y93A 4I6GA 1G2IA 3S7ZA 2I54A 2IWHA 3N0VA 4KBGA 1TYDE 2J9ZB 3FRJA 4OQDA 2C99A 3PWZA 1HE8B 5AOAA 3TZEA 3V7FA 1XPUA 1CDEA 2W48A 3JSAA 3IVRA 1D1QA 1NT4A 2YJTD 2DAPA 3AUYA 1N2HA 2CXRA 2LUOA 1T3ZA 2BM8A 3BXOA 2J67A 1NJGA 1KTIA 1RHKA 4B75A 4YV7A 4MW0A 1N9GA 3LBFA 3W1VA 1ZQ1A 2PR7A 5FFFA 1HE1C 2A7XA 1JR3A 2YVQA 2PWYA 3QMMA 4RVHA 1UAYA 1VE3A 4XQEA 3S2EA 4IIJA 2OO7A 1L7QA 1Z88A 4OJNA 2CBZA 3ORSA 1T6NA 3OQBA 4M1TA 5D3QA 5DYTA 1R6BX 4B1FA 2CFIA 3VMMA 5K05A 3WVNA 3AVPA 3UHJA 4G3XA 3PUVA 3IEMA 2YQZA 3HACA 1VL8A 1E7YA 1Z8HA 1YI0A 4MA0A 5JCZA 3PI6A 4TXHA 3ZVKA 1W8DA 4Q12A 4EFMA 3SYKA 1X7GA 3ZHTA 2EKBA 1YZHA 2JVJA 4GLFA 3EEFA 4HLDA 4P08A 4PLWA 5FTJA 3TIXB 1NQTA 2RIPA 3MWKA 3WWOA 3NKFA 2VPWA 1HLGA 2BCGY 2PQMA 2YRWA 3BTVA 3G68A 4L0QA 2IYOA 3A1TA 4S1TA 4CFSA 2E5FA 5JBQA 3AESB 3DZDA 5HBRA 2AKYA 4OBEA 3LUJA 1FVOA 4TLMB 2W11A 1Y4AE 4V24A 4JLNA 4TV9F 3WYEA 3L4JA 2IHKA 1GCGA 4FZJA 1W34A 5G40A 1TK2A 4N82A 4Q37A 4RV9A 5IVIA 3NWPA 4C5CA 1EFRD 1SC9A 2C83A 2DQKA 4JDUA 3F6SA 4WOJA 2FLWA 1D6MA 3EXEB 2G4LA 2WMYA 3DT8A 3H83A 3G2IA 3OAAA 2BI7A 4L2IA 4NIMA 3LBYA 4P32A 1NQOA 4UBMA 2XTJA 1FX1A 1QGDA 3LD9A 3DJFA 4QGAA 1Y8AA 2W6MA 1CFJA 4LZJA 3JZFA 1YF3A 2IXAA 4AP5A 4YRJA 1VI2A 1I9CA 5BSKA 2DPLA 1IVYA 1NE7A 1H0RA 1PZMA 5DCLA 1EFCA 3EMDA 2HOQA 4CGYA 1RIIA 4B71A 8GPBA 2V55B 3HR8A 3VOBA 1EXWA 2QUJA 4H7HA 5E1BA 3WO0A 1K7FB 4MEBA 4YMVA 5C7IO 3RS2A 1P7VA 1I5EA 4IDGA 1UMDB 3ESYA 3PUWA 5A9TA 1N0HA 1EVQA 3LWDA 3WLLA 2VKTA 1QRUA 3W5VA 3TTXA 3C48A 2YWRA 3NG1A 1M7GA 1P1HA 1Q1GA 1TJ4A 1LJLA 2JKYA 2VJNA 3D3WA 3EMKA 3FBGA 2HFJA 3JQGA 3OLYA 3QLTA 4LTNA 2O57A 3EVDA 2ZS8A 4M0PA 5IJXA 3HJHA 5TGDA 1ODTC 3CS3A 3GR6A 2B98A 1ZD9A 1KIFA 3HXKA 2H52A 1U3WA 1UKBA 3ONEA 3O5AA 4YRZA 1PCXA 1EWVA 4Z4CA 3I23A 5C1BA 4BN5A 4IKEA 2JAUA 1PHPA 3Q8MA 3A6PC 2BM1A 2M1XA 4XVUA 3DL4A 5K8IA 2I2FA 4B3JA 4NMWA 1AUXA 1IY1A 1KYIA 4BKMA 1QGED 2DPMA 5DTQA 1LBTA 1Z0UA 3OLWA 4AZ3B 1N6NA 4J2OA 1M6EX 1ZJ5A 4RSHA 4HWPA 3FI9A 1H6CA 4MKFA 3K73O 4NU0A 3WIEA 1DQNA 3KZ1E 1ZIPA 3NNSA 4XYMA 3PNQA 1WDTA 2HNKA 3T0GA 5JSZB 3ZWQA 1K2VN 4DMGA 1RQ2A 2JLAA 3RUDA 3QQPA 2X5JO 1ZESA 2X86A 4MJXA 4OOEA 4ZDJA 2ZYAA 1M3SA 2BHLA 3QPWA 1OAAA 4EW2A 2PUAA 1PNOA 2BFDA 2YWEA 4TZKA 3NNNA 5JNUA 1KQNA 3RG8A 4BNDA 3DXFA 3P9YA 1JFSA 2Z5VA 4OHUA 1T8SA 1ZJZA 5T4HA 3GFOA 4MW2A 3T94A 4YALA 1DTWA 4HNAA 4HZIA 2CLLB 2GF2A 3OP1A 3TW6A 5HHTA 1YRWA 3KPVA 4M7WA 1ID8A 1DE0A 3OJFA 4CTOA 2FB9A 4B3SB 4Q4LA 3ZHBA 2EX1A 1H8ED 3HJGA 5AHXA 2NIPA 4JB2A 2NU9B 4CIAA 4ACBA 1QYRA 1CUCA 5TEWA 1AD2A 3HDHA 4R1SA 2IPAB 1HEYA 2WKRA 3EZ2A 5ALLA 1Q77A 2IELA 1WUJS 1P7WA 1ICIA 4KWCA 4YCJA 3KSRA 1KYWA 5CH3A 3WMWA 2TMKA 1QKKA 4I9GA 4L76A 2ENWA 5HF8A 2O6HA 4IWXA 1MQSA 3ONFA 2AGVA 5CM8B 4B9AA 3FIUA 4HATA 5CCEA 2O8VA 3AM1A 2N0SA 5EG5A 5JXGA 2N47A 2PKQP 3AHJA 4PXAA 5BRAA 2C7PA 1Z68A 4MGEA 1AUVA 4X8MA 2V6IA 1JFRA 3DLCA 4A5OA 5IJWA 4N01A 1Z7GA 4LJAA 3HP4A 3OTWA 3PHBE 3CTPA 3UVEA 2R0QC 4LCEA 5FULA 3H4TA 1W96A 2WRZA 2B30A 5L7YA 4FE4A 1UFRA 3P7MA 5BQPA 1C3EA 4P2GA 4P22A 2XQFA 4LYEA 1FXWA 4QU8A 4RTQA 4HDNA 4BPBA 1DT3A 5L40A 2AW3A 2WP0A 4FPXA 3WB1A 3VDXA 1KR5A 1JNXX 4U63A 1B1AA 1WS6A 4P7FA 3W1WA 3NHLA 3NETA 4JLJA 1W5TA 2B21A 3THWB 4QGFA 2RGNA 3UPDA 3O1LA 4B7UA 3NIGB 4HFMA 3FVQA 3GGPA 4QUIA 1ZJJA 3EEIA 3ETLA 3EXIB 3K6KA 3IP5A 3W3ZB 1P73A 3V00A 2BFEA 3RE1A 4ZAXA 2WHQA 4ZQGA 3G0GA 2J3DA 3BH7A 1D6JA 5CURA 4EI7A 2VHEA 3GXBA 1NBMD 5EJ6A 4LF6B 3GWGA 4DLSA 2V6MA 2W0MA 4N8EA 3MJFA 5ER6A 1WM1A 4YDSA 5BV0A 1DKPA 1MF7A 5B7NA 5HWSA 2FWRA 3H86A 1NXSA 3DFIA 4C9BA 3LWBA 1T2FA 1ZD2P 3N58A 3W7BA 1T36B 3MTAA 2GM3A 1VZ3A 1RABA 1XVTA 4JY7A 1IRXA 1J0AA 3AY7A 4JVNA 4KVAA 3CJTA 5L7TA 4CZ2A 4NR0A 5LWQA 1GRVA 4TUYA 1IJFA 5CYFA 3B51X 1W5FA 1X39A 3BMCB 2V3WA 2C7VA 4Q4DA 1T5OA 4K03A 3ZGVA 3MB8A 5ENVA 3GQBB 4YUVA 2VJAA 2JJ2D 3FOFC 2BM0A 2GDJA 4YP1A 1W0KD 3Q4GA 3UTCA 1OBVA 4F7DA 2JH3A 3DD5A 1CNMA 2G63A 4UHEA 5LDGA 2QM0A 1ZMTA 4N03A 5ES4B 3M9LA 3A9SA 5DSTA 4DV3B 2Z6QA 1TEVA 1QO9A 2P6NA 4JT2A 2CVQA 4JUFA 4BU1A 2WKSA 3V8QA 4UXJA 1DIBA 1O95A 2XVAA 3UFBA 3V3KA 4BYGA 5IHXA 1YQ9A 3QFTA 5BPHA 2PUEA 2O5EA 5BSWA 1DBRA 4HVLA 1SHZA 2BUCA 3HCOA 4LNAA 3R7DA 4ZYWA 2E87A 3QW2A 3U61B 2EJWA 2NYRA 4X3CA 3D8UA 1RCTE 4PTYA 5E4FA 3ZJTA 3JX9A 2VJKA 1G98A 5C37A 3ZNQA 3JWHA 4JLPA 5TJ9A 4OHYA 3AHIA 4HS9A 2GASA 5H0IA 2WMNB 1RKUA 3GF4A 3C8ZA 4Z4FA 1O5TA 3OE5A 1YB4A 5HF6A 4MPPA 1GDHA 1QM5A 1VJ0A 4ZOQI 2ZWAA 4Z4GA 4YRNA 2FSVA 2H4WA 1L5WA 2EHJA 4XPIA 2I6GA 4IUBS 4D6YA 4A73A 1UJ6A 3FTFA 1OC4A 4B8WA 4RY0A 4Q48A 5ALTA 3IIEA 3L7NA 4FW9A 1XCPA 3COYA 3NHZA 1MV8A 3ZD9A 3U81A 5DEOA 1XXHB 2P5SA 5E7MA 1KH2A 4NCAA 1C4OA 3P1JA 1KDPA 2NZ8A 3UMVA 4WOCA 3AX6A 3IHTA 4P93A 1OHHA 4Y9RA 1XD2B 1NMYA 3DDSA 3T9CA 3TOSA 1RS0A 2D5LA 2IHBA 4YBZA 1OMOA 1ZG3A 3ZHYA 4EFLA 1GNTA 3GPCA 5EE9A 1UBLS 3Q8KA 1J8VA 4EUFA 1GDDA 2CUKA 2EOAA 2Y6VA 1MEEA 4KZKA 5JD3A 3GYBA 2XYPA 4NY1A 1JPVA 4P4SB 5B1HA 4LG1A 4ESHA 10MHA 4NCBA 3PCTA 3DUFA 3VPGA 4AO8A 1P29A 3MT7A 4P83A 4N5LA 1D2CA 1SUSA 2R85A 4G1VA 2Z43A 3AI2A 2EF0A 4YT8A 3VO2A 2FSHA 2P3SA 1ZK2A 4XWWA 3I4FA 4O2AB 2CNLA 1YGYA 4FE3A 5E9QA 5CVCA 1J8YF 1ENOA 4MTCA 5ALDA 3REGA 5I6DA 2W7TA 1BVYF 5LOVF 1WOMA 2VHUA 1JYFA 2G0AA 2TMYA 2WUGA 4GOLD 4NJEB 5KYKA 1IHPA 1LFDB 2D2FA 1KYZA 2WM3A 3II6X 2HDNB 2QS9A 3KXDA 3HYNA 3TGLA 4EL5A 5A2QA 1T2EA 2PXCA 3WLFA 3D6JA 2QE7A 3FLBA 1BRTA 4MH0R 5IT5A 4HQKA 2Y1EA 5EE0A 3QW4B 2CJPA 2B4RO 4XQ0A 7REQB 4QBKA 1A7KA 2P0EA 4H59A 1OX5A 2QXTA 4UM7A 4X91A 2JZCA 4QDXA 4LOKA 3H6HA 4ENUA 2I8CA 3GL9A 1E2EA 5I7WA 1IU9A 1COZA 5E9WA 1NW6A 3ZIUA 4EKYA 1E3DA 5LQRA 3VI3B 2H59A 4EELA 4ES6A 3R7WB 3HUFA 3OIDA 2H0RA 3RLIA 5JCPA 2ZIXA 2YX1A 5DX1A 3MT0A 4ZOAA 4U8GA 1JJ7A 1XXHE 2QXUA 3ACCA 4LV5B 5IKOA 3WQHA 5JEDA 5FX2A 3TAHA 1FZQA 4O8ZA 4ROSA 5HJEA 1RC1A 2MYPA 4TV8F 3VJRA 2DKFA 3Q7PA 3PLNA 4D8YA 1QB7A 4FLFA 4LDRA 2IEGA 3IPCA 3LUGA 1DADA 1PAUA 2O7RA 3A7EA 2R3SA 2VJPA 3DLAA 2UYCA 2W0SA 1E1CA 1H0HA 4QBIA 5MN5A 1B8UA 2GRUA 3WLAA 5EJEA 3HO1A 1XNGA 3GK3A 3HA7A 1AZLA 3HSKA 1K9VF 2EGGA 3QBVA 1G2OA 1HZZA 2RGDA 1MJHA 3DO6A 4ZRDA 3E9QA 1JU4A 4G09A 3OCXA 4MQFB 3P2KA 5JHGB 3DP7A 5DHPA 1AXEA 2ZATA 2BONA 4IFTA 5A6SB 4DN6A 3J7TA 2Q6KA 3NFYA 3RUIA 3CLKA 1USUA 1UBOS 4RZSA 1DT5A 3FCCA 1OZGA 3WC4A 5KB3A 1JZSA 1UK6A 3JCZA 2A78A 4MVWA 1NAHA 1CHNA 3HWSA 1VJDA 4DMMA 1V71A 5I4BA 4C3VA 3L6RA 2QQGA 5FB3A 4EI9A 4KLNA 4B7ZA 1UIMA 2FRVA 2JJMA 1BXGA 3NHWA 2AOWA 3OZAA 3RTBA 5ICEA 3PEVA 5KS2A 4DTIA 1CUHA 5T64A 3DKIA 3MWGA 4L74A 3DAFA 1NXWA 3SSMA 3OIVA 3TPFA