4FOPA

Crystal structure of peptidyl-trna hydrolase from acinetobacter baumannii at 1.86 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 65
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4fopA00
4FNOA 4QBKA 2Z2KA 4FOPA 4LWQA 5EKTA 3KJZA 3P2JA 4QD3A 2Z2JA 3TD6A 4DJJA 3TCKA 4FYJA 3OFVA 4IKOA 5IVPA 4ERXA 2JRCA 3VJRA 2NAFA 4HOYA 4DHWA 3NEAA 4OLJA 5IMBA 4YLYA 1RYMA 3TCNA 3KK0A 4FOTA 2Z2IA 4JC4A 4JX9A 4ZXPA 2PTHA 5IKEA 4P7BA 4JY7A 4QAJA 2LGJA 2MJLA 4JWKA 4Z86A 1RYBA 3V2IA 1RYNA 4QT4A 5B6JA 3TD2A
chains in the Genus database with same CATH superfamily
4C2AA 4QUAA 4KDEA 2KWIA 2E48A 5C18A 2AXQA 1TJ3A 2A67A 3D5EA 4EX6A 4O3MA 1Q83A 1YXMA 1DAFA 1I3MA 1ULTA 1TDJA 3FMIA 5F1KA 4PLVA 3ED5A 1NJ8A 4KWCA 5E6RA 3A1SA 3JQRA 2H63A 4HTAA 1XVUA 1WETA 2FEAA 5DM0A 3L8EA 1JZSA 5K3EA 3G9TA 1X1AA 4FFPA 3UWSA 1ACLA 3DT9A 1CDEA 4CLEA 3ML1A 1N6OA 1VB5A 3GHYA 3PBKA 4DRZA 2IS2A 2QDXA 3I1IA 2E5WA 2YTZA 1MGOA 5JLJA 2UVPB 3UNXA 3VO2A 2I2FA 1ECJA 1AKNA 5CFPA 3DHYA 4QO7A 1JFRA 1BW9A 1UUFA 1E2QA 1ODIA 3R3WA 4YFYA 2DFTA 1MLDA 1GPLA 1JXQA 4DMKA 3QV2A 4U9UA 1MB0A 1H2HA 3TZEA 1A5ZA 2IHBA 1DKNA 1HURA 1Z0FA 2MMCA 2P7HA 3EDOA 4II2A 3WTCA 4DNXA 3OZRA 1V16B 3RPEA 4OJNA 4N0DA 5LKRA 1BRMA 4D5GA 3D4BA 1HMPA 3EXAA 3OCXA 4UDYX 5HE8A 2WV7A 4KXNA 3TRHA 3VV3A 2JFGA 3MAGA 1H2EA 2JK1A 4P4GA 2XVMA 4ZAXA 3D7SA 4FOLA 1EJ6A 5DTJA 1M0EA 1T6XA 1TI7A 3VC2A 2IH4A 2IBMA 2IU4A 2R8ZA 4MS3A 2XDYA 4XJSA 2FMUA 2O57A 4RHEA 4PQEA 4WI1A 4WKCA 4F4HA 4MR9A 5I9BA 3ZDDA 3CRZA 2AZTA 3RVPA 1Y3AA 2J30A 4IY1A 4JEIA 2GPAA 4HNHA 4X20A 5DM4A 4G5FA 3RUCA 4TT3A 1IULA 1JHPA 4EECA 1USWA 3P9NA 1QS0A 2D5BA 2OV6A 2A58A 4JLOA 4RLFA 3JAKA 2YQ5A 1OMOA 4HTFB 4XIFA 3U49A 2LIVA 1UK8A 1P5RA 1EVLA 2MSWA 2HBZA 4ZYUA 4EPTA 4S04A 5B12A 1AGRA 2FUNB 4X6UA 3ZBUA 3FBTA 3WDLA 1XAJA 4BO1A 4OXYA 1E8MA 2AC4A 3A9SA 3LFHA 5FPPA 2YX1A 1OD6A 2WYWA 4FWBA 4AB1A 3I6QA 4CR8A 5CX1A 4LDNA 1IY9A 3R8CA 3NGMA 2Q5OA 2IYAA 2C92A 2CDNA 2H1VA 2HCRA 4JVMA 3ZU6A 5BV1A 3GFSA 3N05A 5IYZB 1GXSB 4E12A 1PJ4A 3OE4A 1GUDA 4F2DA 4Y9DA 2IY7A 1BWRA 3G0IA 4TV9F 3LW8A 1H9BA 1W9MA 3PKZA 5TMBA 1R6AA 4IDOA 1BXRB 3D7NA 3T9FA 3FPHA 4PN7A 3O8LA 3CLKA 3GB9A 4Y9TA 4FZ3A 2EFYA 4NLLA 4M49A 1O5IA 3GPIA 3KXKA 3VTKA 5GJWC 1WZ2A 4AECA 2FSVC 3AG6A 1RADA 1TW2A 1EM6A 4K0RA 4Y9UA 5IYZA 2P0AA 3CLTC 3E53A 3IIMA 1PKXA 1XN4A 2FX2A 1YJ8A 3AQ4A 3D0OA 1U90A 4LZLA 2PZ8A 3UO8B 3PNKA 4HWRA 4KIWA 4NOJA 2EW2A 3K72B 3TWOA 4B75A 1JNYA 5CA1F 1CQXA 2N1MA 3SJBA 4H3KB 1EP2B 2WD8A 3FMVA 2HU7A 3FGZA 4IMIB 3ZY6A 3HNOA 4Q1BA 1M3SA 1BA3A 1M76A 3GFGA 4DCVA 3ESRA 3ICEA 1G2OA 1URPA 2CLIB 4HTFA 4JOSA 1VLHA 5F73A 1ZJ4A 3PC4A 5ABPA 3SIXA 1D1PA 3KZXA 5H8WA 1IXSB 1XQ6A 2P77A 1JF8A 3NC1C 1J0XO 4P4UA 5L3QB 4O2BF 2J3LA 1YIDA 3FNGA 2H8KA 2X3FA 1UXJA 4XDYA 3L7NA 1ICIA 3RB8A 4AJPA 4EBBA 5D01A 4EL0A 2ZCVA 4YBRA 1D2CA 5DNAA 5DTEA 3L1VA 4DVGA 4MW2A 3DTTA 4RU1A 5I7RA 4FXPA 2XT9A 2UUOA 5A4KA 1DCKA 1PKEA 4L7QA 3L79A 3UA4A 1VA4A 2YASA 3BIFA 4W7SA 4BB5A 1WB9A 2Z43A 2Y9PB 5HUJA 1DG3A 1O87A 3EJWA 1REQA 1USUA 4C01A 4TMKA 2W2LA 3PD0A 3V7NA 1DKLA 2J3QA 1I36A 2VF4X 5FPYA 4UEWA 4N3CA 3D4IA 1Q15A 2F9LA 2PLWA 1W19A 1KI3A 2DHQA 5FAXA 3V1YA 3KFVA 1GTVA 3W04A 1SBHA 2X76A 1OTHA 5TSDA 4CKXA 2YHIB 3TNYA 3TRJA 4R9UC 3VAAA 1EVQA 3WRYC 2WF8A 5CDFE 3B3FA 4B3GA 2WA2A 5FLEX 4D3DA 1MC1A 3GQVA 2B37A 2D4AA 3C97A 3HDTA 2PK3A 3SR3A 3N86A 1I7PA 2FJUA 1GL6A 5JY1A 2PKQO 2I54A 5KQPA 3LK6A 4NDNE 5BWMA 1W36D 2P6NA 3HL0A 1GO2A 4CI0B 3C1UA 1DJQA 2G5PA 1CRLA 2QMEA 2PNFA 3Q1KA 4H7KA 5KQLA 1KRWA 1P5FA 3RAGA 2QMYA 3GF4A 4CZ2A 2VPTA 4KIFA 2XTMA 3FROA 2BCGY 3DUFA 4IDNA 4GM0A 5JADA 3DJFA 5AI4A 4DLRA 3TSWA 3V3KA 3SWWA 4N6NA 4YRNA 3AKZA 3OIFA 5KNBD 3PX7A 4JWTA 5JRDS 1E1NA 2ZAIA 1M8GA 2PXCA 4I55F 2OV4A 1BDHA 2QROA 3KKKA 1RAFA 3PSHA 4DDKA 4GBGA 5DTMA 4DIBA 3L0ZA 4YYZA 5L7WA 4B80A 4ZOEA 1UFKA 3ZW8A 2ADMA 2X2FA 1AQIA 1ISIA 4QL3A 3RT1A 1EXMA 3C3DA 4IDHA 1W76A 2O2SA 3DMDA 2DQKA 1Y1KE 3K1TA 1NR1A 1L7MA 1U28C 2P62A 4OFXA 5DP1A 2RCYA 5KCMA 3HVRA 2VHYA 3PUVA 3WZ2A 4HH4A 2ZRAA 3QG1A 4G5OA 4QYSA 1YBHA 3ZK8A 2GDJA 3OP1A 3RU3A 5FWYA 2ANCA 4RKYA 4BX2A 1IJFA 1OV4A 1O97D 2NO0A 2J4CA 2VT3A 2EBUA 3OC6A 1WXEA 1GY8A 1JQKA 2TMYA 3L8HA 4QXPA 4KSYA 4QFCA 5CJPA 2YWHA 3DE2X 2QPAA 3OH8A 4FXOA 5BOVA 2XMGA 3PHBE 4HXGA 1I6LA 1YVPA 4YALA 3IBTA 2ZTLA 1Z12A 3AEKB 3LQ4A 4YV0A 2WSMA 1W6UA 2AL7A 4INPA 4C6RA 4BNLA 4A15A 2Q28A 2QZ4A 3CV3A 3ECAA 2HMUA 2HRZA 2ROQA 1KO1A 4TPKA 3P96A 2Z83A 4MRMA 2VRCD 2ZSKA 4RJJA 5FUXA 4B2IA 2R62A 4CTNA 1GSHA 1AM4D 2VJMB 2XW6A 2QAJA 3VR0A 1RI1A 5LJLA 2EEZA 4P08A 4MR9B 1Q14A 2Y1DA 2ZBRA 4FHEA 2IYUA 2H2IA 2Y77A 3JYHA 2ZGVA 3QJ5A 1WP9A 1FFEA 3UV7A 3CTPA 1SZPA 4WN9A 1L1QA 1NI5A 3LIPA 3QFSA 1PWXA 3OJLA 3RSHA 3VYUB 2HYIC 3RHFA 1QIHA 4R0NA 2JIPA 4DLKA 1TMKA 1GM5A 2WKPA 3SQOA 1K6IA 4WACA 2QM0A 2RI1A 5IKMA 3RC8A 2BBSA 4L74A 4IKEA 1K7EB 4KQ6A 3ZY5A 4HWPA 1H4TA 3R3ZA 4N3BA 1PLKA 3MGCA 4KIGA 1YQXA 2E82A 3VR6H 5KVAA 4P54A 4WBSA 1B23P 2UZ1A 4LECA 3VC1A 4A0GA 2CC2A 4BNXA 5FO0A 5F4BA 3PEVA 3ITEA 4D02A 1U7DA 5J2UF 1JA9A 3TM5A 4R8SA 1L3CA 4K88A 3ODGA 2J6CA 4LJ8A 1Q20A 5T4HA 1HA3A 1K8RA 1XEWY 3C7TA 4Q18A 3IT3A 3JW8A 3ZD6A 3CVXA 2YVUA 4M8IA 3AC0A 1Z63A 3HSYA 4MB2A 1SC6A 1FPQA 3GX1A 4QYIA 1KK1A 4QSHA 4RULA 5ALGA 1T26A 4PC1A 1G4AE 1LRLA 3QOFA 4V02A 1THTA 1PJTA 2WV9A 6PFKA 1DIGA 2A86A 4QPZA 2H5JA 2AI3A 3PT9A 2G9UA 4ZEWA 3NPAA 4IX9A 3VX4A 1YRWA 3OT5A 4HH3C 4ZI7A 4JNKA 1XT6A 5G3YA 1GTRA 3KTOA 4YLEA 2WE8A 4ZC8A 3UFXA 3DV2A 1PSZA 4WESB 1L7NA 1QVVA 1Z5NA 2WU4A 3DTVA 3WBJA 5AW4A 3HYSA 1R3DA 5SV2A 3MUNA 3PP8A 4RIGA 3S8MA 2BKVA 5HZKA 4UMEA 1QOPB 4PNHA 1W4RA 3P94A 3KSDO 1D04A 5A7HA 1YQDA 1Z17A 1FSFA 1GCIA 1G5IA 1Z5WA 2SECE 2HEIA 2XSZD 3FNFA 4ESEA 4F1KA 2ZW9A 2D8MA 2NU7A 1YR7A 1W93A 4R8KA 2IIPA 4JCCA 2VJCA 4X1KB 3RRJA 3IVAA 4CYMA 5KSWB 3HBMA 4ALLA 4HCJA 1MV8A 1BWSA 1ENPA 2OGTA 3NW9A 4LQCA 4LZWA 4ZEVA 1QFSA 1RT9A 3UBMA 4WOJA 1HLDA 3REGA 4TZ0A 4W1SA 3OECA 3BFJA 1JQAA 4MWBA 5IYZF 1EAYA 3FYHA 3PNVA 4QM6A 3ESXA 2IRWA 4F9TA 4TMZA 1WUYA 4Y6QA 4UVEA 1M83A 3ES9A 5ITVA 1I7DA 4D8WA 3RVJA 1RZRD 4CKCA 4OV6B 3M7IA 1G4UR 1YNSA 4DLUA 1KBOA 4FCCA 4HQ0A 3INYA 3MHPA 1MRZA 2XYHA 1AKMA 3ZZTA 5ICCA 1NPDA 5G0TA 2P9QA 4MKRA 3QWIA 4QLAA 4MV5A 3OU2A 3RC7A 1TK3A 3A14A 3GT0A 3LHSA 4FR5A 3U60B 1CC1S 2BEWB 2GA9A 3E7FA 1S2NA 5AVRA 3IKJA 3FWZA 3TO5A 2V96A 2AYZA 5AXAA 5GOTA 4G5YA 3LX6A 4AMGA 4OX9Y 4FHDA 4HLDA 2O2DA 4ZVRA 5EIWA 2PVSA 1B8PA 1W6RA 1NXPA 1Y1RA 5IH3A 3ZIAA 4HEA6 3JD3A 5DSZA 1HRDA 3OJOA 5IAEA 5TE9A 4U7JA 4UREA 2JNWA 4IIEA 4QUBA 2QN8A 1YZ3A 1JS1X 1LEHA 2N3ZA 2Y3IA 3DG9A 3UM9A 4N3NA 2HI0A 1L8AA 5LKAA 4EHKA 3H9BA 2Z8YM 5EE9A 5K20A 2XBLA 2O2YA 3R5KA 1TD9A 1UM9B 4IPTA 1KMHB 4MUHA 1RYYA 2W0MA 3FNHA 1GYPA 1X7GA 2H4ZA 5E1MA 2VNKA 3ANXA 5DIZA 1HL3A 1QKIA 3PGA1 5HZHA 2Q4RA 1WMSA 4MI1A 1T9BA 3EF0A 1ZH6A 2QOEA 1Z68A 3GDGA 4BAZA 5JD3A 6Q21A 3CKYA 3ESZA 4UXHA 2PMKA 2WPNA 3P71T 3BGVA 3W6ZA 2FPWA 4JYPA 4H7IA 2FJ0A 2X0IA 1S7GA 1T3ZA 3QVKA 4OAOA 4XTRA 1P81A 2JF0A 4AURA 3BWDD 3DAFA 5LMUB 1MQSA 3T9AA 3G0DA 2CNWA 1IATA 4ZOQI 5AW8A 3KSAC 2JJQA 2ZU6A 1D4OA 5F7JA 3PUWA 1H2YA 1SHLA 2DH5A 4C08A 3JPYA 3PFKA 3NXSA 4E13A 2P27A 1RRCA 1E9EA 2JFVA 1S4QA 1ZEMA 1U8ZA 4OHKA 4FDAA 2QT9A 5FIUA 3A58B 1GVHA 1ZQ9A 3BE4A 2I78A 3EE6A 4YHHB 1F1JA 1P4GA 1UKVY 5L4SA 5DN6A 2YC4C 5ARBA 2KBFA 3QOWA 4G84A 1L4EA 1ECLA 4MWEA 2ZB2A 4JJZA 3C74A 5EN4A 2YZ2A 3JARA 1RWKA 3IUPA 4B6FA 2GCOA 4EB6A 4OP3A 4C2UA 2FW6A 1XTTA 3H5TA 2VYNA 2AW5A 3GV0A 2PZJA 1ZN9A 4JODA 1K8YB 1ISSA 1ZGBA 2Z9DA 4QBIA 3RLFA 4HAYA 4A92A 3IJ5A 1X2BA 3ZQUA 2VZ0A 2JEYA 3O4JA 3QF7A 1LPNA 4PSKA 2VJMA 3L0OA 2UUPA 2D4HA 1G5FA 2EL9A 2DM6A 4RY0A 1ZAYA 4ZANA 1SUAA 2HFJA 4CETA 1JFVA 5IFLA 1K2WA 1W8IA 5CFOA 4GBJA 4UAUA 5CRIA 2PX4A 2JGKA 2HMSA 1VM6A 2G76A 2FLVA 3PT5A 2QN6A 1XJQA 2KLBA 4G85A 3FTNA 1KQGA 3I6IA 1ZBDA 4YDSA 1VE9A 2GETA 1NYLA 4PIVA 3ZUPA 4B5KA 4H08A 4EABA 1SUEA 4PLPA 1G66A 2JDID 3UB2A 5D7BA 2FLKA 2QLLA 4EY8A 4HB0A 4DDWA 1JIQA 1NG1A 1S89A 2DTXA 1O95A 4YO7A 2AMJA 3TLCA 3ZE9A 1RLMA 5GZ3A 3P4UA 4V0NA 1MAWA 2G3YA 4D25A 4J4HA 2W0SA 3NHAA 3B51X 1EA5A 2V3WA 4P34A 3IDAA 4MV8A 4INAA 2EW1A 4ZTZB 2AI2A 3HCPA 3FYUC 2HLPA 3WI7A 4CT4B 4CIAA 3VJKA 1E9BA 2FSPA 5A1JA 5CYOA 3UK7A 2WTEA 1U4SA 5EOVA 4RKRA 4DV0B 4GBED 1DKPA 1HYBA 3W6UA 1TKCA 2VTBB 1TAUA 4K9KA 1NP6A 4YAJA 4LK3A 5JNVA 2CDRA 4NH4A 1BE0A 2XQIA 2QP9X 4M83A 5GQSA 1AZSC 1H2RS 4B8WA 3TW4A 5IZCC 4HAZA 1N2IA 4XEUA 2GN1A 5C3MA 3DQPA 3IMKA 2UUAB 3WWCA 3D0KA 3IQGX 1E1RA 1SQ0A 3KKNA 3PEWA 4GS5A 1QHYA 1XMIA 1GUYA 3OIDA 2XNKA 3UGQA 4E30A 1PYDA 1GGFA 4R5MA 4C0KA 5LQRA 2GZHA 3I6MA 5AM1A 3VVBA 3ZCTA 4AF6A 4F5YA 5I45A 3H2ZA 4RSHA 1PJLA 4Z4GA 3QUQA 4BFUA 2V5AA 3VR4D 4RJ2A 1OAOC 1V6CA 3W6NA 1SCBA 3QX9A 3ZNNA 1TT5B 4EITA 2QUAA 4ME6A 3MLEA 1I10A 4UDNA 5FV4A 2WJYA 2P75A 1DOAA 3KTFA 1RP1A 5DULA 2FMHA 5ESWA 1BVRA 4O0LA 3IBSA 2C9ZA 1KBQA 2OO5A 3ZS9A 3PG5A 3SC6A 3KJHA 1RQNA 4DLSA 2QTNA 1OH8A 1VHWA 2E4XA 1M34B 1Q7TA 1T10A 2VDLB 1VYUA 4H18A 4NRDA 1PT9A 2XZOA 1E2IA 2QF7A 2GCOB 2YUIA 4ZCTA 3U37A 3EIOA 4II3A 1Y5NA 2AIRA 4M76B 1RI5A 3M6AA 3KX2A 2C0QA 1J0BA 3G9UA 4IUYA 3AU8A 1DARA 2ZRJA 3MJHA 3P52A 4C14A 4XWTA 1F14A 4CXMA 2V1UA 3UG6A 5JD4A 2UU9B 4HNRA 2Y0EA 2VPZA 3E5HA 5IPFA 1TTQB 1UK7A 4B1FA 3PX2A 4P7KA 4CG0A 1DJOA 3PQFA 4L7VA 3AFGA 3IV7A 5T67A 3HK2A 5FLKA 5HKOA 1DTSA 3OICA 4OI0A 4G4SP 3C45A 3T1YB 3L8DA 5DX0A 1KVTA 1P3DA 1N0IA 1ORTA 3HB4X 1TAGA 1YASA 1J24A 1K6JA 1U1IA 4MV1A 4Q9KA 4ER0A 3AVXA 4MW0A 4D9MA 1W0JD 1R4NA 1SJ9A 3NC4A 3R5XA 1S96A 2RG7A 2VTEA 2OOSA 4CUZA 3EHEA 5AI9A 1MO6A 3IDQA 2POQX 3ZJ4A 1W36B 4K81B 5GAJA 1R0KA 1HYQA 5TMEA 4KCGA 1NXTA 4MYDA 1QYRA 4OHOA 1OZHA 5EWMA 4FBMA 1E2GA 4LJAA 4L9AA 1B8UA 4EZEA 5JT1A 2OVBA 2FQYA 1IFXA 1VI5A 2RK3A 1X13A 2DTDA 2WNHA 3BSYA 1JUDA 1KJZA 3DVAA 3OPVA 1B41A 1KQ3A 2X6QA 1JLHA 2RK6A 2Z6VA 3EXFA 3K5PA 3QBVA 4X64B 1DC4A 1NLUA 1T36A 1XP5A 2XYQA 3ZJ5A 5DM60 4RPJA 4RJKA 3VR1A 4CFYA 5BSEA 4MI3A 3MLAA 5EHXA 3G2OA 1G6OA 3GLIB 3GEIA 1EHCA 1JI3A 4DBLE 2R751 4MYRA 4YHBA 3E05A 2HBRA 3B2NA 3JQAD 4R1TA 3V6LA 2BTQB 1IVNA 2N46A 3Q7EA 3EEIA 1ST2A 2YR0A 1UMDA 2YRWA 1P7YA 2GO1A 4OKNA 3ROTA 4CPDA 2PTGA 5AK4A 2ZUBA 3CKLA 2PMFA 3RFXA 1FP4B 4NOKA 1ISFA 2VXCA 3PU6A 3QVLA 3FPGA 3KHKA 1WG8A 5EMHA 2I29A 2KYRA 1XEXA 1B2LA 4KVGA 4XDHA 1UMDB 2BMDA 2JAPA 1CY8A 3EIQA 3PRHA 4R6XA 4ARSA 2B34A 1E0KA 3D9QX 1ZY2A 2XNSA 3JVEA 4IDQA 5CA0A 3TRFA 4K6GA 4OHWA 1N4AA 3SE7A 1B3BA 1I2CA 5C1PA 3A9UA 3TS1A 4DS3A 2WZDA 5LDDC 2GASA 5HIJA 2YHBA 2AOTA 1XPJA 1ISHA 3UHFA 1ZSNA 3EXHB 1LF5A 1EYZA 3IVGA 5JAQA 4MKFA 4RPKA 1UQUA 3C41J 4O2AB 3GDWA 2OAQ1 1RBYA 3EOAI 4Y0VA 5ELMA 4UNNA 3UOWA 1ZI9A 4FLEA 5K5EA 3KV1A 3NOVA 1SNYA 5TR9A 3IUBA 2IF0A 1PGQA 3BRCA 1U7UA 3CLSC 1LWOA 3OE1A 1R9GA 3U9SA 2E1PA 5B1EA 3IXLA 4KH0A 5BPHA 5PGMA 2A9PA 1VL2A 3FLAA 4AG6A 3W1EA 4MVCA 1BVUA 1QQ6A 2XR1A 4TSKA 3WLLA 3L7KA 3AZPA 5LDGA 2JRLA 2BSXA 3EXHA 2VQEB 4WTOA 3C7KA 5B1DA 2PYDA 3FWHA 3DBOB 1M6EX 1GPJA 4MR7A 3ROMA 3TOVA 5GY7A 4KSBA 5P21A 2EKZA 3C3XA 3IP5A 4YRCA 4DC0A 5EUBA 2W8BA 3RJTA 3OT4A 1X7XB 3TTTA 5AVSA 2CFRA 1E3TA 1QHXA 4QIHA 1NDUA 2ZI6A 2ZIGA 1M9NA 1QANA 3VYVA 4P7GA 1EUDA 3O8NA 4DL9A 2BISA 2ZBDA 3CNQS 4XFKA 1YRQA 1QGZA 1GPBA 4MR7B 5HCNA 4OGFA 2QSYA 3JQFA 1QYIA 1AB6A 2J4DA 1OOEA 3E48A 4RJIA 1KGSA 4MS3B 3K0FA 3LUGA 4X91A 1Z6TA 4F9GA 5CA0B 5JCJA 3USES 4QASA 1DELA 4TWAA 2O4UX 1X7ZB 3KJQA 4RVOA 1YVDA 1L5RA 4TRNA 2WWGA 3SICE 1TQ8A 4ES6A 1AS0A 3V7UA 3NBXX 1CJVC 4MVJP 1IVSA 3NHFA 4OXXA 3RO7A 3WNQA 4P7JA 5CITA 5F9MA 2DERA 3KUDA 1ZM9A 3KDPA 5LQCA 3FHTA 1IXKA 3O2QB 4FGSA 1NMYA 3AHIA 4EVIA 2IU0A 3K9WA 3U7GA 3IUSA 5B30A 4LTNA 3FUTA 3TLEA 1IONA 4H0CA 2ZJ1A 3G85A 2J0QA 3SM9A 4AKIA 2G04A 1NG9A 2AEJA 1SVLA 4PAOA 4N5IX 4DLNA 4EFMA 1H6DA 2ID9A 3FGNA 4J3FA 3WIBA 2HY7A 4FYKA 3QFRA 3RBVA 3H8SA 2WAOA 1J2YA 2OECA 4IEIA 4DADA 1U8CB 5DRTA 4HGYA 1OWOA 1O0CA 2Y2UA 3ZGZA 4EWLA 4A6DA 3KVVA 3UMMA 1ID8A 1EDBA 2GM5A 3A0RB 4GWGA 2EBFX 1L5ZA 1XWWA 3O8OB 5HTKA 4FHGA 1N1GA 2L19A 4MQUA 5DW3A 3JQCA 3REOA 4ND4A 2YL2A 1ZLYA 4TZKA 4MEBA 3OCJA 5L53A 3DE6X 4A4DA 2DLNA 4O4HF 4BQEA 4F5WA 1WWKA 2BDTA 1AD2A 1I4TD 4PXSA 5C81A 1XPUA 2OHFA 3O0DA 2PXXA 2YJ4A 1A7JA 1ZXXA 1P72A 2QJFA 4CEIB 3MS2A 3ZTWA 4EW2A 3GN1A 4TTJA 4XX0A 4HK4A 4EPXA 3CX3A 2AVNA 4FSDA 2O5RA 4K6CA 1N8SA 2LIPA 4RA9B 2ZQZA 1TM1E 2X1VA 3TQTA 2DECA 3FRIA 4U6NA 4X1OA 2IPAB 1DKMA 2OFFA 2BGWA 1D1SA 4DDTA 2VWPA 4R1UA 1VLZA 1E1QA 2IYWA 2Z1NA 1HT2E 1W29A 4NONA 2YDXA 2Y71A 3I4LA 3LPCA 4DYVA 2FOXA 3BMCA 4EGJA 1KZ7B 4HDQB 2WWXA 2O5CA 3H9GA 1A9ZA 5J40A 5AHOA 1V96A 1H1TA 4Q01A 2O3JA 2WNSA 3NHJA 5AM5A 3M6FA 4HWSA 3DLIA 3WYDA 2FW9A 4JLDA 2ZRLA 4OXKA 3JU3A 5J5CA 4BNHA 5JC8A 1W0CA 4LNUB 3IEVA 3QIAA 2BY4A 2GBIA 2H92A 2Y0BA 4CQJA 1KDVA 3KPVA 1B2RA 4DT1A 1U8YA 4GUDA 2L69A 1GXSA 1OREA 4AP5A 3RTGA 3V8PA 1N5LA 5DGHA 4DE5A 3NNDA 4QHTA 2A35A 3H1GA 4XYBA 2Q6VA 5D1NA 2G80A 3V4SA 3DUFB 4IHQA 5AM0A 5JR3A 4QWMA 3VPCA 1PJQA 2R85A 3FHLA 4A0SA 3WL6A 1GGVA 1L5LA 3K05A 3G0HA 2OXRA 3AEXA 4G3XA 4P58A 4RPIA 3F67A 2FWNA 2G70A 5TQJA 1PDWA 3GROA 5TC4A 1YDWA 3PXBA 2X9NA 3LO8A 3FH0A 2OP0A 3VU8A 2GCNA 3FFBA 2A3RA 3KLOA 3UQYS 1YZGA 1GU7A 2F67A 3V55A 5CFZA 1ULBA 4FFOA 4XWWA 5EZYB 4RZXA 4ENRA 4RO0A 4U1RA 1LJLA 3A6LA 1BOOA 1WXIA 4V03A 5H80A 4B09A 3PEYA 3T15A 2YV2A 3KRTA 2B69A 2Q2QA 3MNFA 3U3KA 4J16C 2AD1A 4D4JA 4A0RA 5G02A 2UXDB 3D6HA 3G2IA 3KJEA 2IHNA 2F1JA 3AF6A 4DIUA 1AX9A 3CVJA 2VFAA 3NZEA 3BICA 3QELB 1G16A 4A03A 1L5HA 4B7CA 3V4LA 5GP1A 2NQTA 3VZCA 2WOOA 1NN3A 2XJ4A 4BFWA 3TZ6A 1J9GA 4QJ3A 1KYVA 1TKRA 1KZ1A 3WNDA 4OVKA 4MQEA 1SVSA 4IILA 3WB1A 2V6JA 2NLOA 3GBSA 1TQ2A 3WK5A 2VHXA 2AI1A 4OQLA 3NUQA 1E2FA 3AILA 1LQUA 3K0AB 4YWJA 2AH5A 3RV3A 2R7MA 4F3CA 4Q15A 2HHHB 5FCDA 3F6CA 1WKCA 3EGXA 1GR1A 3ETNA 3IP1A 1L7PA 4RETA 5LXTB 3GD5A 5KMGA 4RD6A 2I4IA 4GE0A 4H60A 1PYGA 3IT1A 3C3JA 1W5AA 2IX9A 3EQ7A 2QXUA 3VR6A 3B60A 4ARCA 4Q3OA 4TWRA 2R7LA 5H02A 2IP4A 3MCTA 2YYSA 1OLXB 1KL7A 3LCUA 1GRNA 2XB2A 1HOXA 2DHCA 2HJWA 2Y6UA 5H16A 2P0YA 2VPWA 3R7AA 3AOEC 4M55A 4NZ9A 3Q7IA 2ILVA 1VOTA 5IULC 2OO7A 3N58A 1ABEA 1H05A 2NUPB 3NUZA 3HXQA 5G4KB 4OREX 1PJZA 3KXIA 4MUNA 4O3FA 4IZOA 1XLTA 5SY9A 2XCQA 5EJ6A 4B2YA 2EP8A 2FR8C 4WXRA 1G21B 3O8DA 4W8HA 1ZIYA 2CHGA 3BA6A 3IOYA 3TLAA 3IOEA 1K9SA 4A16A 2EQBA 4QUHA 1K7CA 1Y6QA 2PZLA 5AK6A 3EPKA 3LM8A 1HFJA 4FYJA 2R96A 4CE6A 1LK0A 3DUWA 1D4AA 5TVGA 2VQ3A 2XF2A 4EHFA 5F3DA 3VU0A 2HTEA 4ZDJA 1YQ9A 3O31A 4HV4A 1W4BA 1QYWA 2OV3A 1I80A 1P1RA 3DLPX 4B5LA 2A59A 3C4JA 1CUIA 4KI7A 1E9CA 4C6TB 4CKWA 3ZXXA 1DVRA 3CRVA 4IO1A 4CR6A 5LLTA 3I62A 4ZOLB 4CHTA 3D8NA 5FYQA 4U0KA 4CFZA 3VQTA 1PR3A 4N5HX 1QRSA 3EVGA 3A37A 1DGQA 2JKYA 3PDHA 1OLUA 2ZZNA 3RTDA 1XG5A 1G20E 3A3KA 3SEZA 3KJZA 3JD2A 1IJEA 5EJFA 2IKSA 5AWFC 4M37A 4QODA 4PPYA 5BNWA 4ZO6A 1FW6A 3DP7A 3WKEA 1LX7A 2J8ZA 1F06A 4JVNA 5C8YB 3FJYA 3K32A 4RQBA 4DRXB 1RLJA 3IQFA 3W4JA 1E63A 3D7MA 3OP4A 3HCCA 4QARA 1L7RA 4LYGA 1MB3A 4J0QA 1FNNA 2JAOA 5EY5B 2RD2A 4D4LA 4S1WA 1GNPA 3UMFA 4BVBA 2A9RA 1QG4A 2B8EA 2JGEA 3L93A 1RBZA 3NDPA 2B2XA 3AHDA 3CXUA 3OPNA 4ZQEA 4A0QA 2CYCA 3RTAA 4XWAA 4UHHA 4AJ1A 1E58A 1JQLB 4DFDA 4EG7A 4EF5A 4LNHA 2VNSA 2IZ0A 1KIAA 3AG5A 1ESEA 4F85A 1XPRA 3AR3A 5JJKA 3D4LA 1PUIA 4KREA 3L02A 2YV4A 1ND5A 3N0VA 2IHKA 2XUKA 1T34A 2D00A 4PFJA 4H6VA 4LDPA 1OJ7A 3C0KA 4NABA 4YXWD 2RE8A 5T4BA 4Q37A 4Q7MB 3N5CA 2D62A 1PK7A 3FDJA 3BGOS 4KVFA 3RUAA 1QP7A 2QL6A 5FL7D 1UJ2A 3LBHA 2C20A 5TEWA 4MHTA 1CDZA 2DJIA 4MICA 4IMJB 1M2JA 1Q11A 1MMFB 1F4PA 3P0EA 4PG7A 3REQB 3JQFC 1ZA2A 2P0EA 4LK2A 4B4VA 2P3OA 2QMUA 5F3RA 1IM5A 3OQPA 4ALMA 3MTGA 1SXIA 2D5IA 2VAMA 3FFTA 4B83A 4C2BA 5JSHA 2QWXA 1NVVR 3BIJA 2I7CA 1F3LA 3FOFC 1OH5A 4LG1A 5GVSA 1CUWA 3LPAA 4B6EA 5JEEA 2QD1A 4ZKDA 4G5XA 1W1IA 3GRVA 4ZRNA 2RGEA 4CRWB 2V0GA 3EXHC 3DOEA 5G4KA 1J22A 1TYDE 1LZLA 1P5JA 4Y2RA 3T5TA 5LZ5A 4FOTA 1YUNA 3DR5A 1E2UA 4M0DA 3BXHA 4TL9A 5EUCA 3WLAA 5JDCA 4P7BA 3NBZC 4G5GA 2AOWA 5IUKC 2CFSA 4WY5A 1M72A 1J06A 1HDRA 2REQA 1ECFA 4Q9JA 4DCTA 1TE2A 4K5QA 5EA2A 1CJTC 4BKQA 1MH9A 1ZM4A 1E2DA 1OFIA 4JLUA 4U5QA 1SBIA 2NZYA 2OUKA 3ND9A 1P91A 1KJNA 2ENWA 5EFOA 1SXJC 5EIAA 1BD4A 1NQUA 2YWRA 1ONSA 3CF0A 1U8TA 1I14A 2J67A 2Y1GA 3FE2A 3GLHA 3PNBA 5CFRA 3TOZA 5JD5A 3SN6A 3RAJA 1E2KA 3UJ3X 1XZMA 1H6CA 4NYMQ 4XVUA 3MSXA 4RWZA 2WYVA 3T41A 3U3RA 1FMCA 1GTZA 4RAQA 1TEVA 1QCCA 2H29A 3HXLA 4W9MC 1ENYA 3J7AC 1CEEA 3VOSA 3CMCO 1KQOA 3CZMA 1T5DX 1OBHA 3NOOA 4MJLA 4TYWA 5I4IA 2G9NA 3D1VA 1PWHA 1HOTA 2PAFA 2D2EA 3O3MB 1DFHA 1P73A 1KP9A 4HYYA 4OIFA 3ZV6A 5JQGA 3KXDA 4NCHA 5GINE 1EUCA 1A8UA 1K66A 3L84A 1VLMA 1Q92A 3DM5A 1D6JA 1ZD3A 3COVA 3DL4A 3MN1A 5HA5A 1Q1QA 3SEAA 4BZQA 4BECA 5IT5A 2J5KA 3KOYA 1JMYA 3PFCA 4F2GA 5TLSA 1XTJA 2QQ5A 3FHOA 3HZZA 1P1IA 1KDTA 1WKVA 4BZWA 4W8OA 3V1UA 4Q1FA 4GH5A 3V6MA 2QB5A 4JUBA 3IKVA 3Q87B 4K9QA 2WB2A 2OC9A 4R9VA 3UV6A 3K71B 1OH7A 3E7WA 1AN9A 2JI8A 3RSLA 1VSUA 1QMPA 2MYPA 1QLJA 1JWAB 3DULA 3KYCB 5LIPA 1FSZA 1N9KA 1XA3A 5LQDA 3KOUA 1UWVA 4Y30A 3JWGA 4ETNA 4O2RA 1Z4PX 4EB0A 4C2TA 1ML4A 3QQPA 4UDXX 5HBRA 1MRSA 4TN1A 3WQRA 1JWLA 3KQNA 2Z3WA 3KD2A 3WGJA 4FFLA 2QMQA 3AIIA 1J2UA 3Q12A 4R9NA 3V4FA 2MYNA 2WUWE 1XQWA 3ZE6A 2WQ6A 4RA6B 4FE4A 3UGTA 1KFEB 3BQ9A 4HNSA 1WRBA 5EJGA 3H05A 4A7PA 3ZDRA 5CDHA 4KH1A 4IGAA 3NBYC 4L5CA 3SJZA 3FGOA 1E8DA 4CQMD 1V5WA 4OI4A 1UEIA 7MDHA 1VLLA 3UK2A 3WMRA 2PYIA 1LW7A 2W6MA 1K68A 4PCVA 2Y1KA 1P9OA 2PBRA 4MVJF 4DWWA 4OCZA 1LY1A 1HUQA 4NCNA 4KR2A 3K6SA 1XCMA 3AHGA 4D4GA 5D87A 1UADA 4ZN6A 1WVGA 5K45A 3ZDFA 5I4KA 1VG1A 3D3QA 3MB5A 2C5EA 4RD0A 1M6HA 2YZ7A 4WLEA 3LTNC 3IEPA 4GMKA 4H7PA 2NYAA 3NTVA 4KTTE 3L8ZA 4JUFA 3UJDA 3GRUA 4KR0A 2FF7A 1QH8A 5TS3A 4CIWA 1YU6A 3CH4B 3HC7A 4K9RA 2V0CA 3ZKWB 4BNFA 2UZIR 3D2BA 2AWNA 2PBZA 2ZQYA 1KGDA 4B81A 1J1UA 3VAZA 3MFYA 2JIZD 1Q6YA 1CEQA 1Y8QB 2YYYA 4H0FA 3NKLA 1RKUA 3ZDZB 1WULS 1I2MA 1NWCA 1DBIA 1YQEA 2YWXA 4GLLA 5KNDH 5FTLA 1H6AA 4Q5IA 1EPUA 4IIGA 4A5SA 1R4ZA 1CUFA 3AKDA 1VSQA 2DX7A 3DNPA 5BN1A 1OQAA 5C7OO 4WOCA 3C43A 1MEJA 3ITDA 5ADVA 3V4RA 3GAFA 4C7OB 4YBZA 1C9JA 5AVKA 3F5DA 3M6LA 1R6BX 2Q46A 1GSIA 2ZDQA 1KJIA 3AF5A 3HRKA 3LD9A 4I1RA 4P31A 1EZZA 4MKXA 5AKGA 2YXBA 5D51S 1DRVA 1UM8A 4M60A 4WNAB 5AKJA 4R2XA 1QO0D 2F4NA 5BORA 4KOAA 1J2TA 3AIOA 1I1OA 4N54A 4AAYA 3BRWD 3TF5A 1WD5A 5ELXA 3KWFA 1UWKA 3O1JC 3N9IA 5CD1A 2JLVA 1C29B 5DI3A 3TZHA 4GQIA 2X5NA 1F2DA 1VHDA 1R10A 2WR8A 1C7JA 3CYFA 4UAGA 2G77B 3G1WA 5ICFA 5JCOA 3VSEA 1DIAA 1T6BY 1A9XB 1TRKA 2WVAA 3GRYA 1FP2A 5CT9A 2AG6A 2H18A 4HVLA 1QZ3A 2GM9A 3ONEA 3U61B 1JR6A 4WINA 5JHGB 2RGRA 2VSYA 5BW8A 2IPXA 4ZOLF 4NBTA 4UHEA 5GJVC 3RU9A 3S2ZA 4YQFA 2O19A 4MKZA 5B3AA 1Y8CA 1QO7A 4ZYLA 3PPYA 1TZJA 4XUGB 5B7QA 3WGKA 2OL4A 8LDHA 1FDTA 4C05A 2FE1A 2RHMA 3PIDA 4NE2A 3NCTA 2DRIA 2IUEA 3QE0A 3AVQA 4ZXPA 1A5TA 3UMGA 1JFTA 4ZK6A 1JDVA 821PA 2XF8A 3VI3B 3PNOA 4QEKA 4MPPA 2FPIB 2OEPA 3FRHA 2OCXA 2C4HA 2G25A 4UHBA 3VNVA 2PGLA 4OP1A 2VXBA 5KREA 2IYSA 4O4LF 3BFXA 3ZE2B 3CKKA 2W8BB 2KW5A 4KX3A 4EKNB 3TZBA 2XADA 1BCSB 1GQ2A 1VHTA 4HS4A 4CN8A 4I4CA 1QCDA 3R7BA 4E88A 2DFVA 1O94D 4EJFA 3DBHA 4DR7B 1IZYA 2B35A 5DNVA 1T8UA 1U2GC 3QUAA 3EVAA 1SUBA 2WM9B 2XI4A 3IX7A 2AR0A 4I4LA 4EG5A 4BXOB 2BTEA 2PRSA 1I9GA 2SBTA 3ZBPA 7YASA 2I3GA 4D44A 1K5HA 2UXCB 3HADA 1XMQB 4JLMA 5ITWA 3M4NA 3KPYA 4IXNA 5CW1A 2A30A 3PWZA 4PZ0A 4WA7A 3T94A 4EGQA 4OYLA 4PLHA 4TSFA 3S1SA 2BW0A 2H3HA 4DYDA 3S2EA 3DBRB 4UFOA 1GQFA 1TOAA 2FQXA 3MK31 1F2VA 2ZR7A 3GGDA 4BRUA 5KTOA 1IN8A 5IVHA 3GO4A 4L0CA 2WBLC 4DJEC 2JGNA 2A88A 3R5HA 1DTEA 3AHHA 4J0EA 1RWMA 2R8RA 4JH0A 4PYLA 5IH7A 1P2FA 4BQNA 3RSZA 3PC8A 1NUAA 5LP6F 3KZNA 4C7MA 2FZEA 2GQ0A 2EAUA 3HP1A 1ZMOA 3M5PA 1SCJA 4HDCA 2P5YA 1F8YA 1UPTA 3DBLB 4NBUA 2P9EA 3ZEIA 1LLQA 4Y2QA 2GEKA 4R51A 3H1FA 1S3SA 2RAFA 3THYA 4MRNA 2GBGA 1E9RA 1CNFA 1EWTA 4RL6A 1OXBB 4Q82A 4ZZ2A 2PGJA 4MZXA 1JB1A 1EKXA 4QGGA 5AK0A 1OY1A 4OXIA 2BEKA 4Q4JA 4PBTA 5CYFA 1KMIY 2GGSA 5CB4F 4GYKA 3BWXA 2XUGA 4W63A 5BYKA 3ELBA 4L07A 2X23A 2G8NA 1EXDA 3CJRA 5F51A 1G3UA 2EFCB 2PH1A 2QKYA 2VP0A 3CY6A 3FY4A 3HWRA 5KYVA 4DB4A 1M0SA 4W5NA 1NHGA 4ZV7A 2O8EA 5D86A 5DRYA 2FQ1A 4YX9A 1G3QA 2RIPA 3IXMA 4YMSA 1SURA 3ADPA 2AFIE 3DQZA 2QGZA 3SQWA 2QG4A 1YGPA 1Q1ZA 3DVAB 1XB2A 1PZEA 4DA0A 1RYHA 1LC3A 3BGWA 5DBOA 2JFPA 5H3HA 2B4RO 1Q0UA 2O48X 2QM3A 2VLIA 3R4VA 2PUDA 1DDIA 1VMDA 2HF8A 2P2SA 4V0LA 1FS4A 1QFYA 5DSTA 4AI6A 1SCUA 1K4MA 2C5SA 3A25A 1E2PA 4JLBA 3V1KA 2GK3A 3NHUA 4LX8A 1H3NA 1T0UA 1Z0IA 3GG9A 1T9GS 2NSJA 3LXXA 3PX3A 2XVZA 4E21A 1ULZA 4OJQA 4QWWA 1G8GA 2XGJA 1J8YF 1G98A 1GNLA 2EL7A 4MVJA 3HZHA 3VR3A 4R71A 1QJCA 4OX9B 5J47A 2PUBA 1WCV1 1Z0DA 2CUTA 3FNIA 4N6GA 4P53A 2VJKA 1WHSB 5F2EA 1N0VC 1IRIA 1OWNA 3BRSA 3HJTA 1BMTA 4WT7A 3T9DA 1XI2A 2FU5C 2ZIEA 1RLTA 5HNKA 3C87A 3M49A 2K5UA 3RM3A 2QMZA 5IVIA 2XWQA 1ML3A 1R8QA 1VI2A 1QLWA 2X7HA 3IALA 3LDUA 4NG4A 2J09A 4R6WA 1JQDA 2HX1A 1DRKA 1ODJA 1RBMA 1E96A 3KEFA 5CGQB 1QQBA 3E1SA 2JLWA 1E1MA 1RKQA 3NH6A 3C85A 3COSA 2JI9A 5JSZA 5AVWA 3HZOA 4X71A 4L78A 2Z5VA 3ZWAA 4KOEC 3DO5A 2ZXFA 1BGVA 4NFLA 4CMBA 4COKA 3AETA 8ABPA 3HKEB 5FQOA 1LK7A 3G7SA 2OPHA 3QYPA 1C14A 2CUKA 1SPXA 2OXTA 3D1JA 3KQMA 2H52A 3MAAC 2BI4A 3OE7D 4YCJA 3TOCA 3W5IA 2GAFA 3GDFA 2G4VA 3SY8A 4F0JA 1V1RA 1G59A 1NN5A 1SZDA 4O2AA 4G1FA 3DE4X 3DFMA 1D1TA 4EFDA 2V3CC 3JALA 1PRYA 3O4IA 1DNPA 4TGLA 1C7QA 3PHLA 1UH5A 4P3XA 2BSAA 4RLQA 3R7DA 2RGGA 2YDYA 5HRUA 4HKTA 1KE1A 5FOSA 2O0JA 3GA7A 1T1RA 2A4MA 1J20A 2XD4A 2NNLD 2ZWOA 3M6MD 2VJLA 1M2NA 5NLLA 3ZV4A 3HUTA 5JH7A 2XB4A 4LXTA 5MGBA 4D3ZA 3B1YA 4X94A 4CEHA 4C0LA 4O8CA 3D5TA 3E23A 2J0UB 4L08A 5CXQA 4BV3A 2G9VA 1PK8A 2R8XA 2WM8A 4Q3KA 5EMLA 5LA6B 4A8HA 5AKIA 3K70C 3HUFA 4EUHA 3NWJA 1K1EA 2DF8A 2PLRA 2EQ5A 5ALTA 4CVNA 4KK3A 1BAPA 2OBMA 3PQ8A 3OAAD 1DV1A 1QHFA 4RK4A 4AZTA 4UBNA 5C35A 1OGJA 1KETA 3NM4A 4M1SA 2Y27A 3ZE1B 3LG2A 1VP3A 3HYLA 4RK0A 2C5LA 5EEGA 3TE6A 4FR0A 4F8YA 1UQRA 2QORA 4O2BB 2BBTA 4YAOA 3G68A 3BB4A 1COZA 3AFHA 2QUBA 4E2FA 2A0FA 2I2AA 3CGWA 1U8UA 5LA6A 1LX6A 2NXWA 4DEYA 2IYVA 1UK9A 2PSDA 4HDMA 1LWNA 1E9AA 1LI7A 3K92A 4IS2A 4K9PA 3QX8A 4I4TA 1VHLA 2G7ZA 2C2HA 3L46A 3N8NA 1YZLA 4HYQA 1O6CA 4UUOA 5JFOA 1GL7A 3N87A 4FMPA 1DBRA 3W79A 2AX4A 4BTEA 4KNYA 4I4NA 4QE3A 4QQFA 3C6QA 4PG5A 4DXDA 2HJGA 3INRA 1YMUA 3ID6C 3OZGA 5BQ5A 3R7LA 4TYNA 5TXGA 3K4QA 1XMJA 4HDOB 3S55A 3G82C 2OHIA 2AT1A 4PYJA 1WX1A 1CFJA 1BO6A 1MA0A 4CG1A 4BVEA 4JI0B 2GZ2A 4H16A 1UDCA 1QP0A 3RVLA 3AL3A 4FCTA 1UZMA 5I47A 1HTWA 1N2SA 4ZEXA 3VHXB 4NICA 1WM1A 3ZHQA 4GIBA 1UK6A 2JA1A 2NXEA 3AJAA 2WABA 4XWOA 3GG2A 4ZDKA 2QLJA 4OO3A 3KCNA 3AUXA 4MWCA 3G3EA 5J43A 2DZDA 2X9VA 4OMCA 4JBLA 4KQWA 1ZH0A 3EWAA 3NH9A 2ZUFA 2BD0A 3D2CA 1YS7A 5I4BA 2VSFA 3WK9A 5I7OA 1BJRE 4QREA 4RXTA 2VAXA 2X9LA 3IUEA 1X86B 4WN9B 1KI9A 1ZIDA 3ZK7A 3IERA 1XDBA 4O4IF 4WBXC 3DB1A 1T2EA 3NRCA 2WSLA 3DZHA 4FEEA 1ECGA 4MROA 3WRYA 2NP7A 4KXFB 3SMQA 4DSAA 2WWRA 1LVGA 2CCGA 4IRXA 1CY2A 5KAMA 5CB6A 4DVJA 1HPLA 1QFXA 2Z8YA 3LKZA 4JLWA 4QG7A 5BW4A 2I9PA 4EA7A 5KOIA 5JQWA 1ZGAA 2B1JA 3TW0A 1X6VA 2WTXA 3HDGA 1E3QA 4DDMA 4BFCA 1RJWA 3FFWA 4GGPA 4Q3BA 4BKMA 3CLRD 4L4RA 1ICEA 2Q1XA 2R1TB 6NULA 2P9HA 4UU1A 2QIPA 2OFPA 2IKQA 5BXYA 5CPBA 1O9GA 2OSBA 1ULAA 5DBEX 1XHLA 4HFJA 3ANTA 3U80A 3IQIX 1Y1SA 4A6PA 2O8BB 5BXQC 1C7IA 1LC0A 2QTTA 5CAEA 2P9ZA 1Y33E 3DONA 1IAVA 5HMLA 4QLBA 4DQDA 2CDBA 1U65A 3FCSB 2Q99A 3OF2A 1U02A 5KKCA 1FTQA 4EH1A 1RWNA 4TYPA 5EQFA 4IIDA 2O07A 4BUZA 1MOZA 1G21A 3I5YA 3NMUF 1VYTA 4COOA 1VP9A 3M1IA 3Q7PA 3HFJA 5EXSA 2C3PA 1H2FA 3HI4A 2VHWA 3NWBA 2ZS7A 1KK0A 3GUHA 3NALA 4U2KA 4LHXA 1JVSA 1MIHA 1EG2A 1I0ZA 4RIFA 3QKRA 4WE3A 3K5IA 4IQFA 2HDNB 4N18A 2GTIA 2O6LA 3BAZA 1JHQA 1ZITA 3E22A 4ND8B 4ZHQF 1P31A 1YO6A 4FW9A 2A78A 4HRXA 1T35A 1ZR4A 5DYNA 2HH9A 5ESXA 2NU7B 3IE0A 1EX1A 2HA3A 1PJ3A 3MPOA 2XKBA 2Q0XA 1DOHA 3KWJA 3WK6A 2QIOA 4KGXA 2PFSA 4BNGA 4LWZA 3RS2A 3BD6A 3CVYA 1MKYA 3HJBA 4FZRA 4GPEA 4ZHQB 4QBGB 4DIKA 1L5MA 3EMKA 2ZT5A 4YUAA 4DG9A 2AR9A 2B82A 1CUAA 1RQPA 2XWPA 3A6GA 3ZWXA 4E22A 5I8PA 1C3VA 4JI4B 2JHGA 3M81A 4K6KA 3HCEA 1UPBA 3R6GA 1ZRHA 2G1AA 3IVMA 3KSRA 2EERA 3TJMA 4UM5A 5LU8A 3L4JA 3I9NA 2G1PA 1EVKA 1GG5A 1Q5PA 2B0JA 3QUSA 4LHYA 4DV7B 1KZGB 4GQBA 4N0QA 2FR8A 3OTQA 3NOQA 3ZTTA 2WSSA 1KH2A 3L5KA 2FCAA 4KN9S 1N57A 5BOSB 5AHRA 1NNLA 5BQOA 4QU5A 4ER5A 4NDZA 1GCUA 1JU3A 5D3QA 3LY8A 4LCEA 3B6ZA 3B13B 5AOBA 5ER6A 3O92A 2JZCA 4GFDA 4OUKX 2G09A 2O7NA 4FHZA 4ZALA 5KKAA 1M1YB 2QD5A 3FHJA 1A9XA 1XOIA 2ZYDA 3OD1A 5D00A 2IE0A 4WX2B 3CE9A 4Q03A 3EFOA 3ENWA 3MOGA 5BSTA 2P9FA 1B6TA 3H1EA 1FRZA 5CDSA 2OXFA 5K0NA 4C3ZA 4E5UA 2UYCA 1CJMA 1SKBA 1H2BA 3LZ6A 1JLRA 2OORC 3OIWA 1WB4A 3TH5A 1XDSA 2H57A 1YF3A 2WWYA 2XMPA 1A8QA 1RVV1 1YQQA 1DBPA 2NU8A 4URXR 5KTNA 1SVMA 2DQZA 3GJTA 2Z2ZA 3T35A 1WU7A 4UMDA 2VK4A 3H8JA 3OBIA 3E3AA 4X54A 4OK5A 3LVFO 4XQ9A 3U4GA 3FWYA 4LPKA 2N42A 3NHYA 1MCZA 1AIPA 2YUTA 3M9WA 1VSVA 1Q3HA 3ON5A 1SBTA 4FYMA 3E3NA 1HRKA 2GS9A 3H4VA 2R8OA 4ZVNA 221PA 3TCKA 2FQWA 5JAIA 3K9HA 2B78A 2M32A 3OO1A 4QXOA 4Q39A 4BLTA 2IYYA 4KQCA 4P0QB 2C3YA 1S7CA 2IYLD 1FCJA 2R4TA 4LXGA 1OV6A 4BWGA 4YAKA 3CLUD 1JBKA 4DJFC 4JC5A 1BTOA 5JROA 5J5VA 3EF3A 5GMOA 2ZQ5A 3RS9A 1UBFA 2WILA 4GICA 4CHGA 4UM7A 4U5XA 1XX6A 4GDMA 1G2IA 3Q8XB 1RHQA 2IGBA 2K7ZA 4LX0A 3N8GA 4CMEC 1NFRA 4K3UA 3IEIA 5AHWA 2H85A 3G5UA 1Z4QA 4HGPA 5E6UA 4HMOA 1L6RA 1X7WB 3GVXA 5HZMA 3FI0A 4NJEA 1E0AA 2PMCA 1NYTA 1RJ9B 2J5QA 1NBAA 1ZVMA 3S44A 3I58A 5AVVA 4CN9A 1E98A 2C5AA 1J8VA 2HPAA 4KQ9A 1EESA 3NDIA 3NP9A 4B3FX 1W36C 5B53A 1SXPA 4K05A 3CR3C 1UBLS 3EWIA 2NSDA 3JVIA 3JQPA 1PJCA 3RBZA 3Q0EA 3ROEA 4YT8A 3GLSA 5FPQA 4RTMA 3R7NA 4WXMA 4G0WA 1I24A 1Y8QA 3DEKA 4DNQA 1AK1A 2V0NA 3G5AA 4J03A 4PIMA 1E3WB 5FI5A 5FLYA 1CX9B 4NJEB 1YR9A 3LUAA 1J25A 1TM4E 3ND6A 4HP8A 4S24A 1X1QA 2CDAA 2YXDA 3V4PB 4B2LA 3L9XA 5T5QA 4CF5A 5H9WA 2RI6A 3K2QA 3DD1A 4YS6A 3OBBA 1A9QA 2W70A 2KX7A 2HIHA 3O26A 3PDWA 3MC1A 1IDOA 3LCCA 2X0FA 4TLBA 3O84A 4Y6GB 4DLBA 1E2LA 1Q44A 3TKYA 4IL5A 5EWJA 4D43A 4ETMA 2X22A 4DCPA 4D6PA 4W6ZA 1ZJZA 5D2CA 2C94A 4CLOA 4NK5A 5T7BA 1HG0A 5E1DA 2JVKA 4IJWA 2Z04A 4G23A 4C9BA 1JSRA 1NIPA 2I99A 2QLBA 2PRIA 4TKUB 3V32A 3GLFB 2BJHA 1XKTA 3P0FA 2ZXUA 1MGPA 4ENTA 2V59A 3U6KA 1U6IA 2J0VA 5ALDA 4YRJA 5K3FB 5AW7A 3PE6A 4OPMA 4UPDA 1JIUA 4RH3A 4EP1A 3N2GB 2XQKA 2MSCB 2J1LA 4IEEA 3VHRA 3DLBA 3LYAA 4LBZA 1EBFA 3GLQA 4PSDA 4DCMA 2V9ZA 3E4DA 1UIRA 4M0UA 4OBEA 4RV9A 1YONA 3UB4A 4NEGA 1EI9A 3KU4A 1DIHA 2ZM5A 5EFZA 2ZKIA 5CDTA 1LBIA 5A62A 1NC3A 1KSJA 3AY7A 1SVKA 5CHYA 1WZUA 4I55B 4FYWA 1N34B 3R0ZA 1FSSA 1G8JA 4GOXA 2C7OA 2HPZA 2W58A 3BXGA 1DQZA 4L4YA 4XJXA 3RC1A 1HL7A 1SC3A 1BX1A 2BE9A 3DMTA 4PVDA 4EA8A 4EF6A 2XRFA 3MOIA 1RPJA 1YTUA 1E4VA 1SG9A 4KRYA 3G9XA 4NH0A 3Q7SA 1S6YA 3USCS 3C15C 3ONFA 4MW9A 1QH8B 3J81k 4KQHA 3EPLA 5IS2A 4PYRA 4BU0A 4PM4A 1YB4A 5DI3B 3Q5GA 3QBEA 3LC0A 1HDCA 3R3YA 2PSHA 1NC1A 4P7FA 5I4CA 1C9KA 1GR0A 4WLUA 5D1HA 1YCHA 2A5YB 2BM1A 2ZIVB 4M53A 1CQIA 2I67A 4J1TA 4DJ5X 5HJ5A 3Q3EA 3LZCA 2B5WA 3C1OA 4CF3A 4AY4A 1SOVA 3DEAA 1BFDA 3CUWA 1KH3A 1R5NA 1Q16A 5BV2P 3L4SO 3T3EA 2P2NA 4FZ5A 1E7SA 2YCLA 2I6FA 3TYXA 4LOAA 1PVOA 1H2XA 2WMNB 4MO9A 3V00A 2CB9A 1XVAA 1L5WA 2E7ZA 2Y4OA 1KJ8A 2Q49A 3BMOB 3MCZA 2A9VA 4Z8XA 3VKWA 3SQMA 3UZUA 2GYWA 1G8MA 1C9MA 1SN7A 1IUOA 2WMOB 3JVVA 1KC1A 2H5IA 5DK6A 1DBVO 2WWVD 4BU1A 3GCZA 1W85A 5E3HA 4YJKA 4C0SA 3JD0A 4PG6A 1Y6GA 2IV7A 3W3AH 5LYJF 3G2KA 4WASA 5AM3A 2JZOA 3RGWS 2PU5A 1SIBE 1H5UA 3USZA 4ZJYA 1YFJA 4I0WB 1XVLA 4MV6A 1J9EA 5AYVA 5CA0F 4MRRA 4YMHA 2IZOA 3MLBA 4YEDA 2XX3A 4XKJA 5HBGA 3S2SA 4R4JA 3QMPA 3OCCA 3ETGA 4FI3C 3UTCA 3VO1A 5IJ9B 3FWKA 1ECPA 1F12A 2B83A 1GUBA 1CQZA 2CNOA 4GE3A 4IKOA 5C8VA 3BWYA 3LHDA 3U7JA 2DQ4A 2YZNA 1BC5A 4HAXA 4YXFA 4KR7A 4BMNA 5A7FA 1QE3A 4LBVA 1UDRA 2DLCX 3G9QA 4ZVSA 3K4PA 3B3QA 2QAGC 1BA2A 4Q3CA 2JFFA 3LGXA 2XTAA 5JBQA 1HI9A 4UM8B 2TS1A 1JEOA 1GZHB 1ZISA 3GDHA 2P2LA 4Q1CA 2WF6A 4CQLA 4EZBA 5KCZA 3AK4A 2FFAA 2OUIA 3DZIA 4TL7A 4QYMA 3U48A 4B2PA 1FS5A 4BQIA 2ZJAA 4J2TA 4AKSA 4NBVA 2ZT6A 1UPFA 3NEYA 4GYWA 1DBWA 2QTCA 3W2GA 2ID8A 4TV8F 1FP7A 2XUOA 3OQVA 2D1FA 3HP7A 3I53A 3V97A 3VGPA 1WZIA 2RB5A 2Z4RA 4F45A 1JJAA 1FFGA 4WY8A 4IOLA 5ALQA 5COQA 1TF7A 2ZBPA 2WHPB 1HE4A 3GJRA 3Q40A 1KTVA 5FT9A 2W48A 3FOWA 1GGNA 1UOQA 1WSWA 1DWUA 4WGGA 2XT0A 4KITB 1VIDA 2O1EA 3CNEA 2ORIA 1RWPA 3AR5A 1ZW6A 2HK8A 2JLQA 4QDZA 1I5EA 1DKOA 1ILEA 5LLSA 2LCFA 1P0IA 3R3SA 2I66A 1US8A 3IBCA 3IHKA 4C0HA 1X87A 1NRWA 4URYR 3WYGA 2DMRA 3QPWA 1C3EA 2ZI7A 3A27A 1V16A 3ONVA 4Q4DA 3BFKA 3H84A 3QTTA 2VJDA 1E6CA 3RFFA 3TQCA 3NANA 4RSGA 4YRRA 1RQRA 1E2BA 3EXEA 2HNKA 3OWXA 4JC4A 4X8MA 4DCUA 4WBNB 3D7RA 5IKEA 1BQEA 1VFPA 2AHRA 4K26A 5BR1A 3KVOA 4YR7A 3CVVA 4OL9A 1N8TA 1NU8A 3LCMA 3W5HA 5KQGA 3PNPA 1E7YA 3GJ6A 1WABA 3PR3A 1CKEA 1M1YE 1H8ED 3O0TA 3RYIB 3M6WA 1P0FA 4JASB 1VC2A 1NR7A 4FNGA 1P2UA 5KTTA 2QTGA 5TGTA 4XH9B 1RWQA 3DFUA 5JLAA 2MDTA 1RWVA 4DQVA 4CKCB 1SY7A 3ZZNA 1SB8A 2E5LB 4AYWA 4A8JC 1Q3KA 5JI2E 2HCTA 3AOEA 5ALPA 3V8BA 4MYHA 4OB6A 4G0XA 3OZSA 1ECCA 2AZMA 2VPQA 3PQ7A 3S1AB 1HNNA 3JZIA 4MJ3A 1QR6A 2NVUA 3CONA 3GXOA 4FGLA 2VCEA 4HLCA 2V9PA 4HQKA 2OAP1 5EPOA 4WUVA 5JYCA 3SEQA 2DBZA 4UCFA 1T91A 3I30X 3N2KA 4XD7A 4U6QA 1XF1A 2NWQA 4QJ5A 4YCAA 4J76A 1ZK2A 1Z2AA 3CLSD 2YIDA 3FSRA 3GLIA 5BN4B 3U17A 2VDVE 2BM0A 4QRHA 2VP6A 3PUKA 4GMDA 4QU0A 4ND8A 1M6VA 1WHTB 3V8MA 1IEXA 1M1UA 4OGKA 3I0ZA 1MT3A 3OKCA 4LDJA 2GFQA 3ZHBA 5LZ4A 4LXHA 1GZ4A 1MX9A 5I5GA 5FTWA 4I1YA 4KI0A 4BFYA 3KQTA 5BURA 5ICGA 5L6MB 1KVQA 5LYYA 1I6KA 5ISMA 4NP6A 1SUCA 4AS2A 4W5RA 1IBCA 1L3BA 5FWXB 1VE7A 1N25A 2CLHB 4GXRA 3TBKA 3ZG6A 2YXLA 2FDXA 3F0TA 1K06A 1O03A 3IIJA 1I2BA 4JWKA 1J42A 4CCYA 2HQOA 4X1YB 1H69A 5LM3A 3DLHA 1L1EA 3DE7X 3OAAA 5LJIA 2D2XA 4PX3A 5IP5A 3VI4B 2NADA 2VQ6A 2PH5A 4IM7A 5C1IA 5F33A 1IHYA 2W6CX 1LTKA 5U4QA 3TDKA 1I7LA 1QDEA 4WVLA 2IQ5A 3PC7A 4UUPA 1BN6A 1P44A 2IHJA 3ICPA 5EP1A 2F8SA 3OEED 1MDBA 2ZRQA 1E1LA 4K2HA 3HY3A 3QRWA 1PK9A 3RSFA 3NKVA 1JPVA 1DT3A 2HLHA 1TM5E 3CW2A 2H2AA 2BZGA 5H5JA 3VPGA 3GRCA 5HQJA 4D9IA 5AUPB 1PT7A 3ILSA 3M6UA 5AK5A 2CWDA 3UC9A 2JJ2D 1H8HD 3U3XA 4EHAA 4BL5A 1ZJ5A 3EA5A 4Z9AA 2OCPA 2Z8ZA 3R5JA 1DXHA 4BGVA 3C8HA 5BN4A 4GT1A 2R1UA 4R69A 4KXXA 4C03A 4EFLA 1I2AA 3BE5A 5E9JA 3PYLA 1YMVA 2RK4A 4UE3S 1U3DA 1PEDA 1NUHA 4FT4A 5IARA 3WADA 2VP2A 3C5CA 3ZGVA 1WXDA 2X14A 4MUFA 4FMDF 3H42B 4LSWA 3KHTA 5LL6P 2V55B 5E0KB 1IRXA 3DMPA 3K9CA 3N8DA 3SYRA 1FLVA 2FPPB 3E84A 1FQJA 2HT6A 4UZFA 4XB6B 5E9AA 4JU9A 4NTZA 4A2PA 1V8BA 4N5DA 2BRUC 3G49A 1UEXC 1CZHA 2QTZA 1K92A 2JCGA 3T3IA 2ZWIA 1MNAA 4ITRC 5COBA 1BDJA 1Z28A 4X7BA 5JH7B 5FLXA 4KVZA 1L8OA 2CLCX 2IU6A 5KEIA 5KO2A 3LGSA 3P2YA 5CA1A 3UT5A 3LJKA 4JAVC 1Z39A 4MUIA 1TECE 3OZAA 4Z3KA 4CEJB 3ZUGA 4NYIR 5U9CA 4RE5A 3EPRA 1ESCA 1JPUA 4Z3DA 2FK7A 3C8MA 1YB6A 4PYNA 1U0LA 1R15A 2JIOA 3IESA 3R23A 5G4LA 3AVOA 1ZXLA 2R1TA 2JFUA 2YN4A 4L73A 5AT1A 3RBXA 1GTSA 2IXDA 3KNZA 2YOGA 3WLQA 5CT5A 4OBXA 4D7AA 3P26A 4RDHA 4BNDA 3TUZC 2G6TA 1UC5B 1IM2A 1YB2A 1AY0A 1KA9H 1N1DA 4I9NA 1POWA 3MHTA 2R6AA 1KMMA 1RTKA 3P0JA 3I72A 2BZ0A 3PGKA 4KR9A 4ER7A 1XZ8A 2FSSA 4NFSA 3A9VA 3GFPA 1L5HB 1GQQA 1BH2A 3E0XA 3B52X 1LBEA 4ICIA 4RH1A 4R7GA 4BBJA 4ENUA 1OB2A 2UUBB 1O57A 3PQ6A 5H82A 4ASUA 4G0MA 1ZJYA 1AXGA 3NV9A 1IY8A 1DWPA 3DBLA 1PBNA 3FNQA 5ETJA 5JJBA 1PZMA 4N7RA 2VWQA 4EHNA 3MJFA 3P9KA 3X1YA 4DCGA 4OLHA 5IDQA 1PR9A 3BVPA 5CH8A 5GPBA 4X85A 4HNUA 1CG6A 1R5BA 3AU9A 1IE3A 3G8DA 1OA1A 3OIUA 4JROA 3ZDEA 1RWOA 2VHCA 2ZP1A 2BHNA 4FHCA 5EVJA 1HLGA 4F4UA 1XTSA 3GMDA 4WBNA 1Z5PA 3DZDA 3IH5A 1C1XB 1M1ZA 2PQ0A 1YI0A 3CUVA 4R01A 1DFGA 4Z1MD 1OI3A 1L7VC 5FB3A 4MITA 2GXAA 2LDBA 2QTHA 3MF4A 1CW2B 1IY1A 1B1CA 1FDSA 1CVIA 4W1QA 4BRSA 2GAIA 4QFBA 3FG9A 5K0JA 1AOXA 2P1RA 4IDPA 4IH9A 1KK3A 3T52A 4D74A 4DR2B 1YS9A 3CH7A 3OURA 4LOLA 4X1IA 2BMWA 3LX5A 4EVSA 4UPVA 5EG5A 4LYJA 4UTZA 4JI1B 5JAMA 2YWDA 3TG2A 1DDOA 2J9RA 4MRVA 3JARB 3H3JA 4AKHA 4MV4A 3K53A 5FI3A 1DTWA 4GI5A 1B8OA 4WSOA 4YI5A 4EJSC 2RFLA 4UEJA 1PWYE 3ZV3A 1GA4A 4G56A 3T0GA 4XRGA 2C4VA 2XYGA 4FTWA 1E61A 3GFBA 1JIKA 4GX0A 1ZGZA 4HRAA 2GARA 4U00A 4Y2SA 1LTQA 1C8LA 1VL6A 3UCXA 1PCXA 2P5TB 3WMEA 4BBPA 3E8XA 4MSUA 1R4MB 1XRPA 3AESB 4RZUA 4AXXA 1IBKB 2I7TA 1L5NA 2BONA 2EQAA 3QE2A 1LGYA 1XRLA 3L07A 3UT0A 3RYHA 2EOAA 1GPNA 4FGKA 4D45A 1E79D 1YZUA 1M8KA 4P4LA 4HDAA 4FCWA 3WLMA 4O6VA 2M2IA 2Q1TA 4YAFA 3VVMA 3SAJA 4HF7A 3TXXA 5C0OE 4TKUA 1LCIA 4DQLA 3DOCA 4AUMA 4EI8A 3FHCB 1NBWB 4GI1A 3Q7TA 2HPVA 2VF5X 2VXOA 4FS3A 1GPYA 5KHLB 3CRMA 3TL3A 5KVCA 3GLUA 3WNVA 1P0MA 3JQQA 3WMFA 4URZR 3NAQA 1F8GA 4OL0A 1W2HA 3AKCA 4PRZA 3NHRA 3DV0A 2HSJA 2VJQA 2ONCA 2WC1A 2ZREA 4TKMA 2A0YA 2NTYC 4F9EA 5KOJA 2O8VA 2J7PD 2YWBA 5IC5A 1TF2A 2H6EA 1V8OA 3T7SA 5I6DA 4FFRA 1T4MA 3PJGA 5DCLA 3INNA 3BDVA 1RPTA 1VYVA 1IBLB 5ERYA 1VIAA 4QICA 4DWVA 3L4KA 1R0CA 1W7AA 4PAQA 4PX5A 5TT0A 4Q4LA 1YS4A 1FYWA 5GV8A 2IW1A 4DMFA 3M4JA 5JTUA 2A7QA 3R0IA 5LQMA 3GJ5A 4RY2A 5J2TF 4B34A 3IRVA 3NT5A 1U2ZA 3N28A 4AJHA 4QG3A 3VM6A 1WVIA 5C34B 3OMXA 1B4DA 2HJ9A 2KI5A 2N75A 5B5SA 4I99A 2Q29A 2H3EA 3NONA 1W87A 3EASA 2DCUA 2QMOA 4REMA 3ZXUB 2CT8A 4ZT6A 1KTIA 1XK7A 2OD9A 3FFAA 4HUQB 4JC0A 4CMKA 5KX5A 2ATEA 2BFDA 5C8YF 4BVGA 3B9BA 1QHEA 2REXB 2BKLA 1M5RA 5C7IO 3TNJA 5NULA 1HY3A 1Z2PX 1EHIA 1LDBA 1AQ6A 1XZHA 1XQ1A 2FYTA 2FZKA 2QL7A 3HDVA 3OSZA 4BFXA 4EO4A 2R97A 3CLRC 4QKQA 4CL2A 1D2GA 1CY6A 2UKDA 3RV4A 1OKKD 1F4LA 2LPMA 2Z98A 1ZGJA 3A4YA 2VT2A 4Z86A 2EKQA 1SPBS 4BO9A 5A4IS 3RYFA 3PWSA 4FFNA 1N6NA 4V0RA 1REQB 4TZTA 3KB6A 3AR4A 3HA3A 4BX0A 2H11A 1M1NA 2PA3A 2QN9A 2H51A 3U6BA 1N2CB 2A0KA 3QA3E 3V7FA 4PTZA 3PZBA 2E18A 3HVJA 1ZDMA 3VHQA 1V5IA 3CUUA 1SC9A 3L5OA 2QGFA 5BOSA 1EE1A 1FY2A 1NVBA 3I3SR 4KBFA 4US1R 1XHEA 2NV2B 3OCZA 4RCZA 4WECA 5J58A 5EAIA 3O2NA 1TYAE 3E1KA 3NM6B 4DUGD 4MDHA 4U9IS 3LOPA 4S1OA 4E11A 1P1CA 5I8ZA 2NPFA 3TCNA 4AULA 4V3BA 3DFFA 2CBGA 5DMXA 3LA6A 3WVNA 1O9BA 2WAXA 4TKVB 3HU3A 3ZWOA 1P9LA 1T6NA 2BEJA 3DB2A 3E2MA 1MO3A 5HKKD 2IF2A 3DNFA 1B93A 2WFZA 1YVEI 3KV3O 3LUHA 3FYDA 3SDZA 1U4NA 1Q1AA 2I4LA 4LZJA 3KKLA 2V98A 5AOVA 2I1WA 1J21A 1QE5A 1T1IA 1VPVA 2WI8A 2Z08A 2ZYIA 2AEMA 3I2HA 3ZS8A 4BQPA 2A7XA 2PUCA 3E03A 3CO5A 3QLTA 3ADDA 4XVQA 3WIOA 4RQAA 3CXRA 3A4TA 3QBDA 4G25A 3A2NA 2OHJA 4E1VA 2Q5FA 1DCMA 3U16A 1Q7GA 2HXSA 5E4YA 1YSCA 2G0AA 5DCUA 4RZ3A 1TCCA 1F8FA 5JNWA 1EDZA 2GTPA 2WWFA 1EB9A 1GRQA 3B6KA 2FKAA 1U7ZA 2GBLC 2CHQA 2YC2C 4CTMA 3HYRA 5K99A 1THZA 4M9ZA 2EBWA 1PJRA 2A5GA 2L2QA 2IXEA 4WCFC 4L8VA 3KT0A 5DHTA 4JXZA 3PC3A 1MJGM 1OZFA 1WCYA 3ELUA 3GJXC 4JMPA 2CL5A 2CXQA 2FUG1 4N82A 5PNTA 3WGMA 4JI8B 4FILA 1UAGA 2HZ7A 3T54A 4EA6A 3GRKA 3JWJA 3VBCA 3HKBA 1E5QA 1NXSA 4WNAA 2FW7A 5IHXA 1GZ3A 1NW6A 1DX4A 4REQA 4FYYA 2QL9A 2HA4A 4QJ4A 4W99A 5D84A 3UT6A 2OAGA 2QU7A 4UUAA 2PUGA 4Y2UA 2ONJA 1MJGA 2H2DA 4FUTA 3U40A 3Q85A 4RL4A 1N33B 1ADFA 3BDIA 2MSLA 4K3VA 4YIKA 1BXGB 4Q7JB 1SKQA 2AJTA 3AEUB 3BMOA 4OJYA 2H65A 2ZRFA 3M5WA 1GUAA 1P1FA 3TL2A 3HKBB 4XUEA 4YGXB 2SKEA 3A1WA 4L6AA 2O2JA 4ZAGA 3C1TA 2VUIB 3KQSA 3TRKA 4US0R 4EM6A 1IVYA 4YRZA 5CURA 1R4MA 1A95A 1A8PA 1NXQA 2NQ8A 3AESA 5IXJA 5LVAA 5LMCA 4CCWA 1GLGA 3RIXA 4DJTA 5HPYB 5EWMB 4GVXA 4MH0R 4A27A 4O1IA 4AJIA 4MX8A 2VNHA 1VGQA 2QP3A 1H8EA 2OESA 1XELA 3VYWA 3OOEA 2YRXA 1Z7GA 2DWOA 3IODA 3HGMA 2AVDA 3GUVA 2C98A 3HCAA 4M4SA 3JSAA 3SC4A 2RBGA 3LV8A 4G1MB 4M46A 3VZBA 1IHUA 4XSVA 1KKLA 1V26A 3D3NA 2Y0DA 3A7DA 3LZDA 4V1CA 3IQWA 3MB8A 5CH3A 5EWJB 1A96A 3LDFA 4CM8B 5JQGB 4QBHA 4EPVA 3UOAB 1ZQ1A 3SKVA 3AM1A 4DLLA 7AT1A 3HSKA 3K0CA 2VC2B 4JS0A 4E70A 5I7VA 1GKKA 5G0VA 2PA0A 1D0VA 1WAMA 4IHJF 3TW6A 3P9RA 4CMEA 1P74A 3MAJA 3PVZA 1UBCA 4HAUA 2BFCB 5LCXA 3C6ZA 1N7JA 1ZD5A 1Y80A 3A1CA 1DHRA 3L1HA 1RQ2A 4CCAA 2QJOA 1KC3A 5B1YA 2C7RA 2Q3EA 1JZQA 4J7CA 1SZCA 1QF7A 3N2GA 1UKCA 4URHA 5JARA 4KQEA 2CJYA 4UKDA 1R50A 3RRNA 3I92A 3SIWA 2PGIA 3N7AA 1TUIA 9LDBA 1U9JA 4G2TA 2NYUA 3KJFA 4GMGA 4ZI5A 4DV1B 2YV5A 2VTDA 2ZVJA 5B58C 3ESQA 2PUEA 3Q6NA 1AKYA 1X3SA 3DA8A 1XZLA 3WJ7A 2LE0A 1JJFA 3TN7A 4GC5A 3WL4A 1P6QA 3PA8A 2NN3C 5CB8A 1TYBE 4DMGA 2X1LA 3IBFA 5KBYA 2JG3A 1T5OA 2GF0A 5E6SB 5K8UA 3NOXA 2I91A 1M7BA 4LRXA 2C57A 2P5UA 2ZSIA 2J9XB 4C7JA 2ZJ7A 4PHFA 5F35A 1T1SA 3NHZA 3OQHA 2I3ZA 4HN9A 3TXAA 4OQEA 3GNSA 3JTEA 3KOXA 4BX8A 4AZ0B 5CUQA 3ASUA 1I4OA 4I3GA 3JQ9A 1UKZA 1B00A 4RADA 2FSGA 4BLUA 2CMKA 1U2SA 4OFBA 4YY3B 2J6IA 2HJRA 2ZJ8A 1N3LA 4MDYA 4J29A 3OUUA 3CSUA 1Y7TA 2WVJA 2C7GA 4XX1A 2B2NA 2VG8A 5T41A 3HNPA 3A7EA 3KEOA 3O3CA 4RF5A 3RWOA 2J9FB 4KE7A 1AGYA 2QSZA 2RHHA 2XAUA 3NTLA 5B58T 3ST7A 1HWYA 3G59A 1TM2A 2ETVA 3ETDA 3R5TA 4OQDA 3M2PA 2WU1A 4R2MA 3T5BA 4WOBA 4PHGA 4C29A 1G3IA 5GOZA 1R9MA 3QF4B 4OOEA 3RHTA 4DMCA 3EVTA 3VNQA 4EARA 4KPUA 5CCBA 2VHTA 1Z06A 2RARA 3AF3A 4HX5A 1L4YA 3DBIA 5IDYA 5HWSA 1BX0A 4PONA 4AKEA 1JDPA 4JQYA 2EGUA 5CM2Z 4GL2A 3RKUA 5IG2A 2JFOA 4QGAA 2XLBA 1ZJWA 3ADCA 1QG6A 1QBGA 1JBQA 3KYIB 3T7DA 1LRJA 2FUG6 1IPEA 1LD3A 1JVNA 3GLGB 1LNQA 3R09A 1L7BA 1LQTA 3QH4A 4FP9A 1V3VA 3HG7A 3LWNA 5ARCA 1ODTC 3BT7A 4US2R 1LNSA 1IOVA 2XMZA 1W9HA 2OV8A 1U5CA 4RK5A 4YR9A 2JGLA 2HXGA 1YFLA 3COZA 1ZMBA 1YJCA 3BXPA 3EFBA 1JKFA 4WKNA 3DL7A 3FF1A 1YD7A 1ADYA 3C3YA 4ARAA 4B32A 1JQ5A 1CY1A 3UAWA 3Q2KA 1MXFA 1M2OA 3FJ1A 1FEZA 3KQQA 5FWDA 1P45A 2YJTD 5AJXA 5DX1A 2BGJA 3RUDA 2Q2WA 4MDEA 3AETB 2Q5QA 1G8YA 4BHTA 4M87A 5LBUA 3EODA 4F60A 1E4OA 3G13A 1MFZA 3UJ9A 2NYVA 3WGVA 1HYHA 4OBBA 2GCEA 1C3OB 1XZPA 3TIFA 1XC7A 3NO4A 2WDPA 2Q4BA 3FKSA 4HR7A 4WHMA 2GDZA 1NVWQ 3C4QA 5FR2A 3TLGA 5KJ1A 2QI9C 4HMPA 2I65A 4I4TB 1XTZA 2BKXA 1VSBA 2GRJA 2HO5A 1VKNA 2ANBA 4L9WA 4NARA 4WXYB 4M9SA 3BEOA 1GAXA 2RHGB 2R87A 1OZAA 4WKOA 4ZU1X 1OU0A 4LY6A 3K9BA 1SHJA 2FG5A 3RRYA 3VUEA 3DHWC 2WTAA 3L7MA 4DSUA 2NSHA 2VF7A 1G8FA 1F0KA 4MA5A 1WBJB 4RY8A 1YDEA 4O33A 3UGJA 2PX2A 1JH9A 2B25A 3EMBA 3TRDA 1UXHA 4NJMA 1TJYA 3TNDA 2ON6A 2XH8A 3DYIA 1XNJA 3DO6A 5IVPA 1TJ5A 1T0PA 1IH8A 2CXXA 4JT4A 3HPRA 2F1HA 1W4ZA 1YJ5A 1OC4A 1UC4B 3GEHA 4CCYB 3OZIA 5JZOA 1APBA 3DHVA 3CMMA 3DMHA 1A1SA 4GLBA 1E0JA 3S1AA 4I1VA 2R4QA 4Q47A 1G3RA 5F9FA 1LA2A 3DZCA 4HXFB 1XU4A 3DFKA 4B0PA 4C6SA 1EFPB 4IHJA 1CIJA 2F00A 1KKMA 5J3JA 4B3RB 3FUCA 4MYTA 4NEQA 5BV7A 2AYXA 3IDZA 4RLSA 4WXEA 3ZHSA 3PLNA 3BCUA 3WJ2A 1NU6A 4G1EB 3CBQA 1PZGA 2Z6AA 3B2QA 2IE8A 2RJ3A 1JEQB 5J9FA 2IEDA 2EDAA 2H7VA 2O8EB 3FDIA 4EFNA 1NW3A 1MVOA 1TO1E 2HQBA 2VF2A 4OQYA 3VR6D 1JFLA 3LPLA 3R3JA 5AP9A 5K2MA 4ARZB 5BUSA 3VJRA 3B85A 2GRAA 3LP5A 1AE1A 2F3RA 4D1YA 3FMGA 3NB0A 1M2FA 5B1IA 3FPBA 3IUYA 3LVQE 4C87A 3PLAE 1LLCA 1D6MA 4Z0PA 1ZIXA 1JECA 1YHYA 4I2VA 4AICA 4AY2A 2V7BA 2GBCA 3TBFA 3QE9Y 2ZRPA 4BN0A 1RYNA 2J0UA 1ZHFA 2DUMA 3X1WA 4EJ6A 5J4HA 4JD5A 4G8CA 4RVFA 1FBNA 1VRVA 1PU2A 1JHUA 2OLEA 4RUKA 3JATB 3BWVA 2PYZA 2AD5A 1ZOSA 2FWJA 2GRUA 4JP8A 3TQSA 5K6TA 3TTXA 5IUNC 2DH6A 1O8CA 3EW9A 4FEGA 5JCXA 2VHVA 1KFKB 5B7PA 4C22A 3PJFA 3U3MA 1IXRC 1E77A 1X7XA 2FWIA 3HWX1 3K8YA 1UBJS 3FPFA 4R31A 1FRFS 3K6RA 4G2NA 4HFMA 5ALMA 4BO8A 4WFJA 2F3TA 4DCJA 4J2HA 5K3BA 4EFKA 3GVHA 1XQVA 4PZLA 3O1HB 4UBLA 2NUTB 4LHVA 1GVNB 3OX2A 1IJKA 2R6FA 2QTMA 5E6SA 1T5TA 2HMTA 4FX5A 1BGWA 1WEHA 3JZMA 1NMEA 3TSZA 2VUUA 2P79A 2ECKA 3Q3VA 2F8LA 3IMEA 3NHBA 4QATA 2MCFA 5KTKA 2C59A 2EX1A 5CVVA 1F5NA 4BTVA 4DLTA 2ZUCA 2WHEA 3LYHA 3RE1A 4TLEA 2EYUA 5L3ZA 3V80A 5FBKA 3EVDA 4LDAA 1CJSA 2JK0A 1NTOA 1CUHA 3AGQA 3SXUB 1C5KA 3I4CA 3PNLA 4AP6A 5AESA 1QP4A 2FEMA 3BCHA 4PE5B 4BMCA 1EVYA 3BM5A 4QOIA 2GHTA 4LI3X 3OQJA 3NAZA 4O2BA 4URFA 1W88A 3S2YA 5IT4A 1FDRA 3GMIA 5DPMA 2B99A 2ENUA 4K6FA 3EGWA 4PW0A 5EZYA 3K8OE 3WHPA 5H59A 5MFPA 1G7RA 1X8KA 3VA7A 3WHLA 4K0KB 1P1BA 4MP8A 3QF4A 3SVLA 3SQXA 1PX0A 4DBLC 2P78A 3PC8C 4QGHA 1GJRA 3WMWA 1DU4A 1NPTO 1GRVA 4CTOA 4GI2A 4O2LA 5EMNA 2OQIA 2VAPA 2XBUA 3GYGA 1FRVA 1T13A 4MHSA 3L4EA 1P9WA 1PQYA 3SZ3A 2EZTA 2ZB4A 2YJ3A 3TR5A 5KC8A 3K5HA 4BJ3A 3BDAA 1OX4A 2DP4E 1O3YA 3W5JA 3KLNA 3MJTA 5FA8A 2WMDA 4GP6A 1ZR2A 1KJYA 2GO7A 3GHHA 3L49A 4ZC1A 1HF3A 1XQYA 5HIKA 1MFPA 3O83A 2BEVA 3PYXA 1QIJA 4O4JF 2P6MA 2W7TA 3KR9A 1ZO8A 3CRQA 1JG1A 2R11A 4HD8A 1KR2A 1WA5A 5ESDA 3ZNOA 4AROA 3STWA 5BSWA 4NS4A 1TA9A 1GYQA 3BXXA 4RMGA 3LPDA 2CFTA 2G82A 1E9DA 2L82A 3ZN2A 4RDCA 1EP3B 1HZZC 1MOQA 1UINA 1V1RB 2WWHA 1H93A 1B15A 3DZKA 3PB3A 4FJ1A 1Z5ZA 4EPWA 4CM4A 4AX4A 3Q41A 1DLIA 3VR5D 2HDOA 2WJPA 2QYOA 3IP6A 5KTMA 1ZNXA 1TMYA 1Y1LA 4JL6A 4YP7A 2B4AA 1OU4A 4ZCLA 1TIKA 3PQ2A 1F7VA 2VDMB 3AV3A 4KE6A 3NP7A 1TUGA 3HJUA 3MTIA 3KQYA 4AW9A 2TSYB 2WJGA 1A0OA 2BPOA 5DLPA 1JWBB 4FMBB 1JE0A 1R6VA 2A5JA 1L4BA 2G4LA 3GDOA 4HT3B 4CKBA 1Z0JA 4I50F 2BHSA 3L7CA 3WJ1A 2QM7A 1THMA 3RVMA 1QKKA 2BMEA 4C0AC 4KHZA 1F0PA 1T2NA 1V41E 3LT4A 1FUKA 3G0CA 3ZVMA 5K6RA 5DLEA 3PXGA 2P8JA 1CETA 2QTBA 4XCXA 4PO8A 1I1HA 2PZEA 3ZV5A 5LXTA 4WGFA 5HUQA 1AC5A 1RRPA 4OHRA 5LYJ