4FOPA

Crystal structure of peptidyl-trna hydrolase from acinetobacter baumannii at 1.86 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 65
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4fopA00
3OFVA 3TCNA 3TCKA 1RYBA 3V2IA 4DHWA 4OLJA 2PTHA 2JRCA 4JC4A 4JWKA 3TD2A 4JX9A 3TD6A 2Z2JA 1RYMA 4FNOA 4IKOA 4QD3A 4ZXPA 3VJRA 3KJZA 4P7BA 2MJLA 2NAFA 4YLYA 4QBKA 5IVPA 3NEAA 4QAJA 1RYNA 4FOTA 4FOPA 4LWQA 4Z86A 5IMBA 4ERXA 3KK0A 4DJJA 4QT4A 5B6JA 5IKEA 2Z2KA 2LGJA 4JY7A 3P2JA 2Z2IA 4HOYA 4FYJA 5EKTA
chains in the Genus database with same CATH superfamily
2ZZNA 2VKQA 1ZN7A 2BKLA 1K6EA 1G64A 2XT9A 3TSZA 1UZNA 1Q6ZA 3C24A 3O8BA 3RJ9A 3ER9A 3PUHA 1KE2A 3ZCQA 2ZXUA 1V8DA 1X1CA 1K4YA 3AUYA 5ALUA 5M04A 3PXEA 1GZ6A 4FFBB 3DZFA 1GEGA 5EQDA 1XEWY 1CC1S 4OHRA 2NYUA 2WKSA 2WU4A 4IX9A 5DF1A 3RVKA 3W6ZA 5KREA 3U60B 3NIDB 3MIZA 1MLDA 1THTA 1MZVA 1RPAA 1SM4A 4J4BA 2HADA 5AHWA 4D4IA 1E9CA 4A0HA 4Z4GA 3K9GA 3O91A 2WD9A 4O29A 5FBVB 3W2HA 1JRLA 5T8KC 1VDMA 1COZA 2CHVA 4MUFA 4YEDA 1WX1A 4DVJA 4JQYA 1FYDA 2XAAA 4FFLA 2IU0A 4CM6A 5IYZB 1RS0A 4EFMA 3OZIA 2XUIA 5A6SA 4ZOLA 1IM5A 3AF2A 5K6TA 4PLHA 1L1EA 4NZMA 4B31A 1YQDA 1WQ3A 2B0CA 1XMPA 4YP1A 5EIHA 4PONA 5HGJA 5HF8A 3X1ZA 4CV3A 5FUMA 2Q3HA 4ZYZA 2Z56A 3KQWA 4QPNA 4FOOA 1DJPA 5I7FA 5IN4A 4C0WA 4N8EA 1F4PA 1ZESA 5EWLA 4B75A 1QWSA 2I7VA 1OY1A 2GO7A 3BWMA 4RA9B 4AN1A 3HS3A 2GYYA 5JISA 1YBMA 4ZGGA 3DHWC 1D7OA 4G4JA 2XVAA 4JB8A 4CQLB 1U1EA 2O0LA 4LY0A 1CDDA 1FE8A 2FWPA 2YINC 1VKNA 3K72B 5JFGA 4MP8A 1QYWA 1PZNA 2FWNA 1AGXA 1GITA 4IH4A 1YSCA 3BB3A 1QGOA 1GGVA 5AHKA 3TAHA 4DBLE 2B8JA 3UMMA 3FZYA 1OH8A 5K5EA 1CKEA 1QWOA 2J09A 4DR2B 1QU2A 3C15C 1OX6A 1RAIA 2GFHA 1T3GA 2JRLA 3AIIA 3KT8A 4WOBA 1T35A 2EQBA 1U7WA 2YMQA 3BWVA 3OT5A 3KDPA 5AVOA 3GJZA 1R4AA 1IMJA 2RHBA 1QBGA 1ULSA 3DW1X 1NAHA 3BHNA 3HB7A 2WFLA 4I9UA 4BP3A 1ISHA 2HT1A 2VAPA 4LJ8A 3RKSA 5ILQA 1XZGA 2MYTA 3CW2A 2BGJA 5CVVA 3H9JA 4FEGA 4NBWA 2ZULA 1XRLA 2GF2A 4ZXFA 4JYZA 2C00A 4Z9AA 3TLXA 1F8YA 3K5PA 2W0SA 3H8JA 5JVDA 1VCMA 2PWBA 3ANMA 3QYJA 3IQIX 4JODA 4OUKX 4BX3A 3TEMA 1U6KA 1FVOA 4IDOA 4LXTA 1V6AA 2P79A 4FEAA 4ZXPA 4B4OA 2IIQA 4FYMA 7GPBA 3QI7A 3GLIA 4EY3A 4J8PA 3SQOA 2BBSA 4ZV7A 3T9FA 2ZUFA 1J9GA 2AUMA 3NDPA 3PYMA 4JR0A 2PIAA 3K2QA 2J07A 2R1TB 4N18A 4PCVA 1I3CA 3GCXA 3DMGA 4YJ3B 3I0NA 3M3PA 4DXHA 1NUTA 2A5JA 3RTBA 3HI6A 4G3XA 5G2OA 4A8PA 3GUCA 1M7BA 3PNPA 3T1QA 3V4LA 3DFMA 1J7KA 2IE0A 3HSYA 1WXIA 2ZREA 1YR7A 4AWBA 2ZRNA 1PG5A 1KYIA 3CVVA 1MQ9A 1UT8A 4BVLA 5DGTA 1KXJA 1UOOA 3LLSA 2WHPB 3T9BA 4UKDA 5KX5B 1GKKA 2YRWA 3OZSA 3T5MA 1EP3B 1WCWA 1YFKA 4QOFA 5GOTA 2C2MA 2QR3A 5FA5A 1SB8A 1M34A 3WZLA 2TRSB 1NC3A 4OATA 4L4UA 1OB5A 3L0IB 1Z74A 4H2DA 3E22A 3FNIA 5CVCA 5IDYA 3UMBA 4ALNA 3C7AA 4RZIA 4B6GA 4QU8A 1P18A 3F97A 2ZRLA 3SYMA 1SUCA 3A4NA 2VRCD 1SXQA 1U9CA 2ODEA 2XUFA 3JYLA 4KI0A 4WXMA 3A6JA 4DCVA 2ZQ5A 3OMLA 4CIXA 4NATA 1GDTA 4DMCA 4J6EA 1CB7A 1IEWA 2GILA 3JD1A 5CTAA 1XTPA 5FTLA 3DDOA 3EK2A 4DCCA 4DQKA 2CXNA 3EXHA 4ND6A 2HZ7A 2CEKA 2AKAB 2WTBA 3IAHA 1OU0A 5AJZA 4CCYB 4UM9B 3FDXA 1KO1A 2OBNA 2VQSA 4O1HA 5L40A 4EL0A 1ZGJA 2IW1A 3B3JA 4EYGA 1I3KA 2R6JA 4KQJA 4AJ9A 2ZUCA 4Q7EA 3DBIA 5DHSA 2FCAA 2AOUA 3CONA 5E3JA 2B20A 3PTZA 1FTWA 4WECA 3R3WA 2W7TA 2XLCA 3IAM1 3P1JA 5JDCC 3Q7SA 4I1YA 5KYYA 2HREA 4ZREA 2G36A 4G8BA 1HKUA 1A2OA 3A1UA 2CLHB 1RCFA 5P8WA 3HVRA 3CLRC 1NTRA 4LCBA 4BQQA 4DPKA 4WOPA 2FPIA 1FRVA 8LDHA 5AVZA 4II7A 3HM2A 2FFAA 4OJMX 2PMEA 4B81A 3IP1A 3F3KA 4GH5A 3SX2A 4BNGA 3CZ5A 1IB0A 4URFA 4B3DA 1UAAA 4KQWA 5H3CA 2QJWA 2Z57A 3GRYA 2E37A 1EP9A 2CMHA 1F0KA 4W9NC 2PPVA 1V7CA 1ZPDA 2YV4A 3BDVA 3C74A 3CF4G 3E7WA 3PFIA 2INGX 2OQIA 3MWKA 2A5YB 1G21A 1VHTA 5DBGA 5IAAA 3F6YA 2R9VA 2DUNA 1IUPA 1SZCA 1W75A 1NVAA 2PKQO 2VT3A 2YOHA 3I2IA 3OFJA 2VQ3A 3QBDA 1KE1A 1UXIA 3LDAA 4JL8A 1ODJA 1UPAA 4PSAA 3FM9A 2HLDD 1GGFA 1E7WA 4G0YA 4OSOA 3JD4A 1UFRA 5AJYA 4BB6A 4F8YA 4FJ1A 4YPVA 2RGEA 3T0IA 1YK0A 4DMHA 3CLVA 1DBIA 3SE7A 2BAGA 5KYXA 4Y1RA 2CBXA 1PKXA 1S96A 1VHDA 2JIDA 4L3VA 5HCNA 2X5NA 3RS5A 1HDOA 3WA6A 2MR5A 2HA7A 1T25A 3AU8A 4REQA 5CJ2A 3VV3A 1PAUA 3QU7A 1SCQA 4HQLA 3O8DA 1GCOA 2BFAA 1XOIA 3CB2A 4AYWA 1M72A 4I14A 1T5SA 1X3LA 3LM8A 1ZM3A 1KSFX 4Z4HA 1I7NA 1LTHR 2B94A 1CJCA 1R6UA 2A86A 3TNJA 4BVAA 2QZZA 2EGHA 4ESOA 3SC6A 1D8TA 2GEJA 3WL6A 1UQTA 1U5BB 2B8EA 2WSMA 2X7XA 3NIWA 3SJUA 4GNKA 5MN5A 2ZLBA 3D4IA 3ZU3A 4RQTA 3ZD7A 4IF6A 3B8HA 4R4JA 4Q93A 4EJSC 4PTYA 4QGGA 5DVZA 3F47A 3KU1A 3D8NA 3MS7A 4RYLA 3VPAA 2JFPA 1FVXA 1OLXB 2WLSA 3B6KA 3EXIB 3R3JA 3RF7A 4QPPA 4M1SA 1FY2A 1RJ9A 2GWRA 4DRZA 1L8QA 2C3PA 3WK6A 4BMCA 1L8XA 4EVRA 1SVSA 4M54A 1E2LA 4FU0A 2CLOB 4MWZA 3VO2A 3W1VA 3OIUA 3MG9A 4CKCB 2YRFA 4R0MA 3VSBA 3CNEA 5B4UA 2QU7A 4N54A 4TSFD 4X60A 3V48A 5B58T 2AK3A 4HQRA 4DIDA 4DLTA 5A5FA 4IJKA 1YQTA 3D3WB 4PRYA 2JHGA 1P6UA 4ZQIA 1JWAB 3QMMA 1H2ZA 4U6NA 4ZU1X 3H16A 2SKEA 2X0KA 4N8DA 3FOWA 5GZ3A 1GCIA 2DKNA 1LQTA 1I36A 4UHDA 3Q3JB 5EP3A 5A4IS 5K0EA 5E4TA 2XNDD 5F21A 5C5IA 1EXNA 5HBGA 3STTA 1I8TA 3WLHA 3NJRA 1II0A 3X43A 4RTKA 1HEYA 4PYKA 4NV3A 1M73E 2AYYA 1XPOA 5DW0A 2H7XA 1AUVA 4I3GA 4UHFA 1XLVA 4Z6KA 2G07A 5A5EA 4YQYA 1OHHA 2AWNA 2XXJA 3E3NA 3DDCA 1CNEA 4R3NA 4RSGA 4Q9JA 5EHIA 2VYCA 1U1DA 4XX0B 4PWZA 4PN7A 1Y7TA 5DMXA 5LQCA 4B34A 3KLMX 4HGQA 3ODPA 2GVZC 4R54A 2ATIA 1I1OA 5D7NA 3S27A 4HAXA 3UHAA 2YBDA 2CF5A 4Y0AA 1R4MA 1XTZA 3NVDA 4OQEA 5K8JB 3IIEA 2OHFA 1TAQA 1DQZA 1FMTA 2BHSA 2A58A 2ZJ3A 3PWZA 1JDVA 1N2OA 3LDGA 4RABA 1JFVA 5TEVA 2BGWA 2W2XA 2IBTA 3TD2A 1E3DA 2VYNA 4MO9A 3FIJA 1MX9A 2GCOB 4RQUA 5LCXA 3UFXA 3ZDZB 3D1LA 4BYMA 1I5RA 2DULA 1GZDA 2Q5EA 10MHA 3VHQA 3ZGOA 2JGMA 2YJGA 3GHYA 4Q3AA 5HDQA 3B1ZA 4GUDA 4RKYA 3R5KA 1LC0A 2XQFA 1P77A 5AKEA 2P30A 3U5ZB 4AKIA 3BMCA 1EK6A 3DVAA 3PSHA 1JHMA 1RAGA 4ZO9A 4I99A 4AM8A 3PFWO 1XDDA 2O2HA 5A4MS 1NXQA 1RKBA 2FRDA 3A6ZA 4YBRA 3W6OA 4RA6B 1RFLA 4LE0A 1T10A 5D85A 3ICEA 5AK3A 1TTHA 4ZTBA 1X1AA 2OCYC 4KWIA 4NOLA 2YZ7A 1UF9A 2JGEA 2WWVD 2WJ6A 3FRHA 1D2GA 2HHAA 3M6MD 3NTLA 5I45A 3B12A 4TVOA 1QK5A 3B3FA 2P8SA 3CE9A 4TTSA 3T94A 1BN6A 4Q9HA 1J00A 5EVCA 4F6RA 2CUTA 2VEDA 1EG7A 3F5DA 4ALIA 4BO1A 1LBQA 3NTQA 4F4UA 1UJCA 5PNTA 5A7FA 4F04A 2QA5A 5KNDA 1HLGA 1K5PA 4JUAA 1QKJA 5E2BA 3Q3CA 2PKQP 4P0PB 4IIJA 3ZV6A 3AI1A 2PL9A 1AZWA 5H16A 1EA5A 2H1CA 2ZTSA 4LHEA 4C7JA 4EVIA 1NQVA 1VRWA 1XCOA 5JYCA 2ZGVA 2JZCA 3O4HA 2NPIA 4ARZB 5BQFA 1HDGO 3IKMB 2QROA 4I9HA 4KLNA 2HA3A 4OQZA 4EOGA 2SKCA 1NP3A 3OTGA 1UINA 4E5YA 1II8A 2DMRA 2J5BA 1YMQA 4PSCA 3O9VA 1D3AA 4N0QA 3D1VA 4Q7JB 3M6XA 3UCEA 4G4SO 4PNPA 2YNMD 4BKRA 3ED1A 5KTMA 1TZMA 4E6EA 3F3SA 1DS6A 2XOKD 2C2GA 2Y3IA 2HX1A 2YVAA 3DJYA 3INTA 3LLVA 4TMWA 4RJTA 4P3XA 4TZTA 3W7VA 5CFNA 3W5DA 3R6TA 1HMPA 4GBJA 1H6BA 3OD1A 4S0ZA 2DTEA 1TU0A 4PU0A 2I71A 2BRUC 1B73A 2J67A 3A1WA 3BTOA 2BZ0A 1IWPB 3KYDB 4PQYA 4DAOA 5K0GA 3HCDA 1ZUWA 5GADl 3K2IA 2NZ8A 1KPHA 3CC8A 4R7ZA 5HNKA 2NZUG 1XV5A 2QN3A 3VJMA 4F3YA 2ZAGA 4L2IA 2XE8A 4KXVA 1WCYA 3GOQA 4C7KA 2N42A 5F4ZA 4DV7B 1R15A 1EM8A 1T0HB 1UBGA 3Q8MA 5MFPA 1Y5NA 1FW6A 4GE3A 1H5UA 1ZCJA 3G85A 1SCNE 3GAZA 4XJXA 4II3A 2EJTA 1B2LA 1YXMA 3G49A 4LX8A 4KXFB 4NG5A 4CYMA 2VHJA 1K6JA 2NZXA 1KSGA 2ZI3A 4JLOA 3O6VA 4NMXB 1U2ZA 5EMJA 1XAJA 4BFCA 4CLHA 4XD2A 4TSKA 4EAAA 5ALXA 5K99A 3MJHA 3CZ9A 2C7QA 2V55B 1ODIA 3AEUA 1I7QB 3NTRA 1O96A 3L6RA 1Y3BE 3U6KA 2EHJA 2W37A 3H1BA 4FDMA 1XN4A 4KB5A 5TQ0B 1TCVA 1FDIA 2WJZB 2X76A 4GOMD 2W9XA 3MJCA 4HV4A 2QD4A 1Q16A 3DGFC 4GEKA 1UP4A 3OT4A 3F4LA 3SYRA 4H7DA 3O8LA 1E1RA 2QTCA 3DFFA 2AC2A 2YHAA 3UYKA 4B2YA 4FCVA 4ZO7A 1Q1GA 3CVWA 4BLTA 5L3SA 4E5VA 1KFKB 1MX3A 3KXKA 3SIPA 3OZGA 1DKMA 3Q5GA 5D5PA 5E1MA 3T3HA 4D4MA 2NP6A 2YJ6A 3QF7A 2ZTVA 4O2RA 2OM6A 4ER5A 1GD1O 3OI7A 4G84A 3WMXA 1B00A 1W0KA 5I9LA 2Z83A 5EPOA 3DOJA 2ZCJA 1HE8B 2C2BA 2KM1A 1ZP6A 1SMKA 4HQOA 1CDOA 1WXQA 4DBLC 5JZVA 2PS3A 2PSHA 2QLLA 1NMQA 3B70A 3O5AA 1AS2A 3FB4A 4HBGA 5LBUA 5DM60 4D82A 2WHEA 4EHIA 1J2TA 1O03A 2ADFA 3E2PA 2VXCA 2FOLA 2QZ9A 3R6DA 4E21A 4EYQA 3WIVA 4IWXA 3ZX4A 4JI4B 2JFNA 4TUYF 2J9XB 4WHMA 2B4AA 3ZWWA 3OQOA 1JIUA 4F3TA 1N7IA 2PT7A 4RVNA 4U00A 2QZJA 5HGXA 4F5EA 3ZHOA 2BI8A 1RVV1 3SZ3A 3ZXXA 3JQAA 4Q4CA 3KZXA 3RVNA 4BASA 4A0RA 1GL7A 1ZCFA 3II6X 2V7BA 1A69A 1PJBA 3EPKA 4A5SA 5CT9A 1QC5B 1UPUA 1VG9B 1G5FA 2HF2A 2QMYA 3A2MA 5I9SA 3UXYA 4DR5B 3PUIA 4MQ5A 3D5EA 3S8MA 3ESRA 4EPTA 1D04A 1NJ1A 2IF0A 2HCFA 3AUXA 2PTHA 5CAEB 2WJAA 3ZHVA 1VYUA 1QIMA 1QVAA 4G0PA 3AERB 1CDZA 1IPHA 4ARVA 2YXPX 4RMHA 4HNAA 1E9RA 3MMSA 1LSUA 4N41A 5AW8A 3PC8C 1HE3A 1PTKA 4HXGA 4WCDA 1QGUB 9LDTA 1SG0A 1U81A 3JQFA 1VE3A 3DKRA 5TGTA 1YUNA 3IVAA 4TWZA 4G8JA 1GSIA 1VPTA 1Y9EA 3RJZA 2QR2A 3FKQA 4D6PA 2JAOA 2HAEA 3D6UA 1PL0A 3GBPA 5FL7A 4FT2A 4L4YA 4IV5A 1OWPA 1V71A 1WOMA 2VJMB 4X97A 3CH4B 3BJMA 4C3OB 3IVCA 3NBYC 4LDPA 3TLGA 3WGQA 2IYOA 4PC1A 4UOZA 3HCFA 2YFQA 4JU8A 4LY3A 2QDKA 4BKQA 2HUPA 1BDBA 3F7OA 4B4VA 4E13A 3HYSA 1T0IA 1JAXA 3FOBA 2VIIA 1ZSNA 2E1RA 3E9ZA 4DR6B 2GKSA 2I87A 3VU1A 1ZC4A 4YYEA 1NOKA 4J0GA 2H7VA 5K0BA 1M7GA 4NZNA 2O5EA 1HPLA 1N6IA 4IJ5A 2DC1A 2JFZA 4WBSA 1EJ6A 4E3WA 3SFTA 1AN0A 4N7MA 4DCUA 4FFRA 1P1KA 3D02A 3PF9A 5K3CA 5KCMA 3RSQA 4CMCA 2ORWA 3ANLA 5LP6A 4F5YA 1XRQA 1JG7A 3AQ4A 1Z73A 1ZBDA 4O2AF 3PEYA 2C2KA 2HC9A 3KEOA 1I3OA 3NH6A 4Q47A 4Y2HA 4MWEA 2PUEA 3P4UA 1X42A 2K5UA 4BV2A 1E79D 1N6NA 1C3OB 1S02A 1I4LD 2JIOA 1QFYA 2ZYRA 3OM8A 4G4SP 2NWQA 3CEHA 4ZT4A 3T3PB 3DL4A 4JOSA 5GP1A 4D9BA 1ONOA 4XUEA 3IBSA 4DYVA 4MVJE 2CXTA 2G08A 3LKBA 1G4AE 1CE8B 2GEKA 5KPJA 1D0IA 1G3IA 4ZOQI 1SHLA 1QHIA 2BZSA 3KE8A 3QFTA 1U3DA 3EEYA 4WH0A 4FB5A 3FY4A 2WMYA 2QSZA 1NBME 2KI5A 3OQIB 4X7PA 5K8UA 5BQ3A 2YHIA 3WLIA 3N8KA 5I48A 4R9SA 4BBAA 2NTEA 4EMBA 4RIEA 4PZDA 2Q3JA 1C1HA 1UMDB 3LZDA 4MJLA 1JMVA 2HMSA 1BVHA 3FNEA 3WYFA 4UU1A 2GN0A 2A14A 3O2SB 2HLPA 4G1VA 2FMFA 2AZDA 4WXRA 1KR2A 3WYDA 4CQNA 3R9XB 4C0HA 1N9ZA 1XWIA 4I46A 4PBRA 1P61B 2G0TA 3N2GA 1MJGM 2NYVA 3EIWA 3L7CA 3R3ZA 1P3DA 2F9LA 3JALA 1KI2A 3QKSB 3OO1A 4EMSA 4F4DA 3RBXA 4GZLA 4A8TA 1G8JA 1FLDA 2H1SA 3OWOA 3AUJB 2JJYA 4E2ZA 1F7VA 4D98A 5CNKA 3QEOA 3WLAA 2O23A 3ZHQA 3DXXA 4F97A 3AZQA 5CBPB 3OEHD 4A1FA 2X8JB 1NKSA 1WHSA 2ENUA 4FE4A 1IFXA 4A36A 1ACLA 2BFDA 3LNTA 1ZGAA 1SFRA 1E9BA 3WWCA 1F3LA 1XD2B 2PMCA 4CLOB 1K3UB 1G98A 1TM5E 1XYGA 2OXEA 4HAOA 5K2MA 3PHGA 3QXSA 3S99A 3TM5A 3HKBB 4E2YA 5B57C 1LNSA 1X1RA 2H57A 2NU7A 3V97A 3A32A 4J0QA 5EYPB 1FF9A 3ZLBA 1SHTX 4TRJA 5A7HA 3VO1A 3ZJ5A 4B4KA 3L4KA 1UK7A 3BGSA 4Q5IA 4RE6A 1JH9A 1ZM7A 5FWAA 2GI4A 1JFFB 3C3MA 3PIIA 2C9YA 3FLMA 3U3ZA 5AH0A 2J41A 3L4BA 1W48A 3HB9A 5ALDA 3IR6A 4DQDA 1DQNA 1RADA 5JD4A 4M3NA 1G7SA 2PX4A 3ED5A 3N75A 4G9EA 1EB8A 3IOYA 3BA1A 4ZVKA 1C4OA 4A3SA 5DK4A 4I8DA 4E1AA 2HD4A 4GXTA 4I1OA 4MV0A 4BE7B 1HUQA 1YC2A 1XVUA 2Q7OE 3L1VA 4TT3D 2V5AA 1KH3A 4DDWA 3PFFA 5BV1A 5J5AA 5AVQA 4Y7DA 1HFKA 1MRNA 2UYYA 1MCZA 4NL4H 2NVOA 4MVYA 2F62A 3VR4A 3ZU2A 2J33A 2YH2A 1O95C 3RS4A 3ZJUA 4DG9A 4EA8A 2I62A 5AW5A 3TZCA 1E3TA 3ERCA 5LQNA 1H4QA 4L4RA 4KWEA 4W7IA 1MOZA 1T2NA 3HKCA 4OXRA 2FX2A 2V1UA 4ZYYA 1M3SA 2WKRA 4MKFA 2XRMA 1FUYB 1TAHA 4EITA 2I4NA 2OC9A 3UHPA 1S3IA 3EG9B 2HCBA 3I8SA 4CDRA 1W85A 3PJFA 2O20A 4XQCA 5LKRA 4DR4B 1W36B 2W98A 5LXTA 4GI3A 4XFJA 4OU4A 3S5UA 4FGKA 2IOYA 2HBQA 1MO5A 1T5DX 2ATEA 3KUCA 3Q3EA 3HEBA 4JP8A 3UOWA 1RBQA 4CLXA 4EZBA 5LYJA 3U48A 3SN6A 1CY0A 1EB9A 3BYZA 3OHSX 1RWQA 4EHDA 4F9EA 5EL0A 1D2NA 2EBUA 4A0QA 3NUZA 2PX3A 3WLPA 1C4XA 5CJJA 2IDKA 3WSWA 3I1IA 2XVYA 5FOWA 1M0WA 5HR5A 1J4AA 5AK0A 5LQRA 4AI6A 2KX7A 3UWKA 1LPOA 2DFKB 4QHYA 3RUPA 2AG0A 1R1DA 4XWAA 2A1IA 3OZ7A 1Z0FA 2QUKA 1XTKA 3BJRA 3H9CA 4DG5A 5BUCA 1U0SY 3E9EA 3FCUB 3MUEA 4JJGA 5AW9A 2HV9A 3E9RA 2YQ5A 3LE8A 3AF3A 2RHCA 3UF0A 4NR0A 4V1CB 2FMTA 2I7DA 1V16A 3HH8A 3F3MA 5FPTA 3MEQA 4M8NE 3WO0A 3PR1A 3MBKA 2OHOA 4WLEA 3ZEIA 1E59A 2FPMA 4GFDA 2XYRA 2OV3A 4L9RA 2HIGA 2ONYA 3UENA 5AOBA 3W5CA 2QZSA 1MENA 3I39X 4QDJA 3QEBZ 1WPGA 3RK1A 4CKXA 2WU3A 3RSHA 1YQGA 3B7GA 5ECDA 1GEEA 1M8KA 3MSXA 1IY2A 3L41A 3P9QA 4K9QA 4OJQA 4TS1A 4TQGA 1GLNA 2NU6B 3TWOA 4REOA 4Y2GA 3HWX1 4F3KA 1MH9A 1WMEA 2P5UA 2CLDX 1YR3A 1G2PA 1S8NA 1RRPA 1T2AA 1YQ9A 1XEXA 3N6VA 2QRMA 4M1OA 1V6CA 4J29A 3OJOA 3TX6A 4GW3A 1O5IA 4FLMA 3FHJA 5EXSA 3SBDA 4LYYA 5DP2A 2D00A 1KVSA 3AX6A 4TZ0A 5LR6A 4JR2A 1KY4A 1AXEA 1XALA 4YUWA 2KYRA 2JLUA 3O3NB 3ICCA 4ZYWA 1A27A 1BFUA 1EX9A 2QMEA 2X9NA 3NYRA 2HGZA 5EGNA 1NW5A 1U80A 1Y4UA 2FZKA 2R87A 4Z0NA 3SIRA 4U7DA 2NMVA 3ZS9A 5DT2A 3SD7A 1M1YB 1Z5OA 4JBGA 1TRKA 5BT9A 1ZIOA 5LLSA 4EY6A 2FLVA 1XP8A 2W48A 3IT0A 1XJWA 5A03A 3WYAA 4ZAZA 2VSOA 2W83A 4QAJA 5E38A 4L7QA 2DUJA 2BEUA 3OQJA 5D6NA 4EHBA 4F72A 2RGAA 4URHA 5JVDF 5H70A 3W1WA 1S3GA 1XKXA 2RB4A 3DB1A 3GFFA 1JXAA 1MHPA 3UJ3X 5IPFA 4M9SA 3ZY4A 1UBHS 4EHJA 3WJ1A 1W88A 1Q7BA 1L7AA 1B43A 3EEFA 1ZC3A 1YVEI 3IPAA 2BDTA 3PQCA 5GM1A 4JVNA 2ZRKA 5THKA 1P0FA 3W3AA 3UY4A 2BP7A 3WGGA 3VR5H 2JLCA 4QC2A 1LDEA 2P90A 3GLVA 2W2LA 4QZVA 1TL7C 1UPTA 2HTEA 2MU1A 1A9QA 2OZKA 4NFLA 1MW8X 4A15A 1TUIA 1W4ZA 4FFPA 2CBZA 2IHJA 1L6RA 2QOEA 1SKYB 4M2LA 3ZHBA 3ZK7A 3BQNB 3FSRA 2WM2A 4KMMA 5BVGA 1ZK2A 2XE6A 1QOQB 4MUJA 5KVVA 3FOCA 4UTXA 5C31A 3MGAA 5IS2A 1NW6A 1NW4A 3GP3A 3ZC3A 2ZSJA 2PWAA 5K3DA 1C9DB 2X0NA 2GHRA 4TMVA 3ZBUA 5EQTA 4TGLA 3VR6D 3BCRA 3KYJB 5HZHA 2XUJA 2Q6LA 3WKDA 2Z5LA 3IKLA 3Q3VA 1XMOB 2ERYA 1QP7A 1PZHA 2OAGA 1LBSA 2VFAA 3A9CA 4MS4A 4BQSA 5JCPA 1I94B 3EUEA 4FDLA 3U7HB 1BA2A 4JBXA 4L5CA 1SOUA 2PGLA 1E62A 1K6MA 5DFAA 3WGNA 3R9WA 3D4LA 4HS9A 4JOBA 4G85A 1HSZA 2CNLA 5F64A 4XKJA 3F1KA 3Q3IA 1KFBB 1SY7A 3EGXA 3JR7A 5E6SA 2ZYGA 3E3MA 3V34A 1VPVA 2PLAA 3TIFA 3PGKA 3TB6A 4IIFA 3ZY6A 5BV7A 1T4DA 2B1GA 4GECA 1K3TA 4X6XA 1TIPA 1OREA 3AEYA 4UUMA 3Q6IA 3W05A 1AGNA 1NU8A 1V11A 4HMOA 4ZHQB 4HAIA 1E5VA 1A5TA 4D8XA 3M82A 2TMGA 4JCCA 5G0SA 3OLZA 2WI8A 5KDOA 1VJCA 4LC9A 4MUAA 1VCIA 3MXOA 3MRVA 4U2GA 3QPCA 4WFIA 4EZEA 1W52X 1GV0A 3V4SA 2GESA 2PXHA 3BSSA 4NDNE 1H0SA 3AUSA 5EAIA 2XLBA 2BF7A 1FQKA 3N8NA 4MW6A 1AF4A 5HFNA 1GA6A 1T2EA 4AG5A 2ZWMA 3MMPA 4QU9A 4U9IS 3G0CA 4IJ6A 3OE4A 3LP5A 5T64A 2IX3A 4I50A 4L0QA 2O8CB 3H3XA 3EIXA 3GUVA 1YJXA 5B36A 5T8KA 4NONA 1TD9A 1CQIB 5CT5A 3TZEA 4NP6A 1J0CA 4GWLA 1C9EA 4EFDA 2NTNA 4EEXA 4HUTA 3QEJA 4Q9IA 1IZ8A 3KC2A 3BXPA 5HPYB 2J0SA 4C7OB 1ZD3A 3PNVA 3VJKA 1H9AA 1X9HA 4R83A 5EXTA 1SC6A 1QANA 1A7UA 2NSJA 1J33A 2ZYHA 4EUKA 5IJ9A 4KYUA 4MV6A 1QOZA 4MQLA 2ZRDA 3DVQX 5FD8A 4LI0A 2P7HA 3G2KA 3HP1A 2Z4SA 4ZOBA 4TL8A 2XB4A 3HXOA 2CV1A 1PR1A 2PLWA 4BKMA 3IIKA 3DTTA 5F5NA 1DG9A 1DSSG 1AKTA 2ZR9A 4YIKA 5J2TA 4X65B 2C5FA 1CIPA 3IIJA 4QXQA 2PUJA 5DH9A 3TPCA 1IATA 4WK0B 2P6MA 4WKGA 3AF6A 2C04A 2CNBA 2YKGA 1IJEA 1X7ZA 4CCAA 3TAUA 2ROQA 4ND1A 1RLIA 1EGAA 4JGBA 1XYYA 3BERA 1NMYA 1V8OA 4WZBB 5DYYA 3TTVA 1FRZA 2WWFA 1C8BA 1DIBA 4RX1A 1R8SA 2JAUA 1K7YA 1VE9A 1SU8A 4JXKA 4IIDA 4RD2A 4O4HF 4C5AA 1D5CA 1Q77A 1UBTS 2IEIA 3D6NB 4LEIA 1SK8A 3WL4A 4WIAA 2PX5A 4NMLA 3ZWAA 1LPSA 1T8YA 2GA8A 3LP6A 4MAMA 5LDGA 3RTAA 4U63A 1EBUA 5ICGA 4P84A 4U7TB 3MMXA 1HLDA 2R11A 3GOHA 3IDQA 5IW8A 3VSAA 1CJTC 1IK4A 1XTQA 4N82A 4MRAA 1G2IA 2VP6A 2PHZA 1V5IA 2PD3A 4LSGA 4UCXA 3TLEA 3TVYA 4D9HA 4YR7A 2RC5A 5K01A 3BD8A 3T15A 4GMXA 4QFCA 4L5BA 3ZCSA 1OV4A 5ER9A 1GL3A 1AS3A 3WWOA 2CEAA 2WZBA 3U61B 3OPYA 1O8BA 5CU7A 4HEQA 1B7GO 1U1FA 2IZZA 3CW9A 5CP8A 1WV1A 2XZLA 4I6EA 5IARA 3GVHA 2WJVA 3I2HA 2G80A 3PUYA 4NFSA 4OHPA 3T99A 3RYCA 5DV9A 3SQDA 3RF6A 5B64A 1NATA 4BO4A 4KU4A 5KVCA 3DO5A 4KQ2A 3E61A 4ZKEA 2QM8A 1VJ5A 2FZEA 2QD5A 2BF4A 1MB0A 2QTMA 1WKVA 4NAVA 5KWIA 3FYCA 1CR6A 2P4SA 2DHCA 1PYDA 1HZZC 2PU7A 2WWHA 4RSRA 4Y18A 5LZ7A 3USCS 4NENB 3CNHA 3CSUA 4EY5A 4IJMA 3T95A 3FNRA 1G7CA 1K0FA 3C7KA 2N47A 2Q1WA 4FCWA 2IF2A 1EUCA 1NUAA 4QKQA 2AOTB 3A1TA 5EFZA 2HQRA 2P67A 2BN4A 2C5SA 4FGWA 3CRW1 3V2HA 4DA8A 4B9EA 5C46F 5K7SA 2FPPA 3BFKA 4J76A 4HLNA 5J4HA 1SK9A 3QBJA 4IMRA 3LBYA 3P9ZA 5ALIA 4ZEVA 1M2OB 2AQ8A 1RQXA 2DWOA 2EGUA 2VK2A 2YMPA 2WICA 2ZANA 1AKYA 1IBCA 4PAQA 1LRKA 3WY9A 5GJBA 1E2FA 3NNDA 3F6PA 2PZMA 3U37A 4MX8A 5FUVA 1XKQA 1A98A 4BWFB 3AINA 3PL5A 4KQGA 3C5VA 2A0WA 4GGMX 4XM0A 2BPOA 3AXSA 3QIAA 3UMRA 3VDQA 1GKLA 3GFVA 3GGJA 1ANKA 2Y1KA 1HQKA 3O47A 1JJFA 2XMRA 4KWHA 4KXUA 4NTZA 4RGVA 3SYTA 1ZA2A 5HQ3A 1TYCA 2BFWA 2ORED 4Q4JB 1WF6A 2VCHA 1TLTA 2FQWA 2P8JA 2QTLA 3LUGA 3LX5A 5AK5A 4Z9FA 3GL9A 4ND7A 3VC1A 1J23A 2YJ4A 2R3SA 1GNPA 2E4ZA 2VPIA 3D7KA 3BAZA 1ODTC 1HRKA 3M89A 4II2A 4IDGA 1W8DA 1N5KA 1T8RA 1V6SA 1UM9B 1V8PA 2CNKA 1NKTA 3Q7QA 4ZVOA 3FIUA 5ED4A 1QORA 2PR7A 3C4JA 4K2AA 3RFFA 1N1EA 1KL7A 5ELXA 3TG2A 5KTRA 3REQA 1RAAA 3AJDA 3D3JA 4IGEA 4V0ME 3VPGA 1AK9A 4C3ZA 2WVHA 3ZZUA 1EWQA 2H4JA 2FMKA 3VVMA 1DXQA 2YWFA 4I1SA 4RKFA 3PJDA 1Z83A 5EZ6B 2Q4TA 4X93A 1MQ8B 2GM4A 1TZJA 1GY8A 4P7BA 5CFPA 4ZYUA 3DE0X 4HLUC 3G2JA 3RYFB 4DTCA 3ZE1B 2PUFA 3KS9A 2V6GA 5BNZA 2UUBB 1N6KA 1OYWA 3KHTA 5JNSA 1B26A 3O0TA 1H3EA 2GZ1A 1L5WA 3V3TA 1OLSA 4HEA1 3LAWA 3SCZA 1RTTA 4P3PA 4IIJF 2CSXA 4MVJG 1Y7LA 2KLHA 4ZICA 1G18A 3EDRA 3GA5A 3JZIA 3NHRA 3W7BA 3SVTA 1MIOB 1PJ3A 3WZ2A 1IZ0A 2EERA 2Q0SA 2QRKA 3AG6A 4LXIA 3QIVA 1PS0A 4MKHA 1QPGA 1IG0A 5BUZA 2M32A 4N76A 3OUUA 5JFTA 3WLJA 3LCMA 4RHEA 5BYJA 4EW1A 1EFVA 2HBYA 2ZRFA 2QBYB 4BXOA 4U7WA 4Y2XA 4A2QA 2JDID 5HZKA 1KYZA 2ZWVA 2G7MC 5CPFA 4RZQA 3TRKA 1LJ8A 3EEIA 1N8NA 3LRTA 4RD3A 2QG6A 2GN2A 4XYBA 2JFUA 2JJQA 5ETJA 5L7WA 1G3UA 2DR2A 1EVKA 5JIBA 1G5IA 2PGXA 5JSKA 3KDSE 2JH3A 1TZKA 2YS6A 3JYNA 4E2XA 1K7EB 2C2OA 4G09A 4HX5A 3UPUA 1JTVA 1KSJA 2WWIA 2XEXA 3M2PA 4GHWA 3BXOA 4XJSA 4ZT3A 2FPGA 5DCUA 3H6HA 1I13A 1NMXA 2PBZA 3TLYA 4J3JA 2IZ7A 2EWVA 2B5VA 1TQDA 4YCJA 2G71A 4LQLA 1EFRD 2WT9A 3I83A 3DOHA 4KPGA 3SX0A 5EEGA 1PF7E 3IGFA 4M9RA 3GMTA 4WL0A 3K1ZA 3I92A 2PUAA 1UKYA 5ITVA 3H9EO 3N6XA 2X77A 5E3IA 1E2DA 3HWRA 3LLMA 2FN4A 1IEQA 4TOIA 2IX9A 4TXMA 3O8QB 4S1OA 1M54A 4MPTA 5DLQC 2WWWA 3NHBA 1MVLA 1H5NA 1XHLA 1EEHA 2A9QA 2XOXA 1N2HA 2F1OA 4ZVUA 1T0PA 4BUJA 2UYHA 3A9SA 3VYSB 1KIFA 1XZJA 2E4AA 4F9TA 5IUJC 3VNUA 3NWEA 4TTRA 1C1XB 1QGED 2MINA 2WZCA 4I55A 3QFSA 1XVLA 4GOJA 4TMXA 3GUZA 3REGA 5MF6A 1FS5A 1JHQA 4IH1A 3EYWA 3HKEB 4AUEA 5ES4B 4RTNA 3K1AB 1IUOA 3W0LB 5A5GA 4QYIA 4Y2PA 5BV8A 1A9ZA 2ID7A 1YZFA 1BVUA 1ZN9A 5KQLA 3G0OA 4BGVA 2RHLA 3BFPA 5EIOA 4ONEA 1QH1B 5IBCA 3T41A 1JJIA 1EH5A 3L8YA 1U9JA 1H8HD 1XZPA 1ZD2P 4G24A 3ICQB 2WYHA 4OB8A 2JCXA 3AF0A 5F33A 1NRWA 1G20A 2OCIA 2W4MA 1SOAA 2D8MA 4MYRA 1DUSA 3LXUX 4O2AB 1DUVG 2X9VA 4O4LA 3U9TA 1CEQA 3O7WA 3D59A 1TJ5A 4RXUA 1USGA 2XNCA 3L9WA 1T3TA 3LKDA 4M1TA 3NDRA 1E1NA 4NECA 4OCZA 4UAJA 1UDBA 2H08A 3JZDA 3SHTA 3LQ4A 4M21A 1G5QA 4K9OA 3JQRA 2QP3A 2ZBQA 1SHZA 1H2HA 1L5OA 1SN7A 3G5MA 3OLWA 3VR3D 3I09A 1U8TA 3IAEA 3WNQA 1QV7A 1OFIA 1XPRA 1X13A 3PRYA 5SICE 2AFHB 2OOSA 4B17A 1XE3A 1E63A 1PG2A 2WPDD 5CD1A 1IOZA 1R0LA 2OFPA 3GD7A 2Q5CA 4KLRA 4MQUA 2CNWA 5AHRA 3NEAA 1QO0D 2WJIA 3FR8A 3OLXA 1CJVC 2JFXA 4P2GA 4ANFA 2Q6KA 5AHXA 1MB4A 3GT4A 4EZIA 3ND9A 1ZIYA 4FC6A 3R75A 4CMIA 5AD1A 1U63A 4H1TA 2XT0A 3W7AA 1UODA 1VL6A 1TTQB 1CS4C 2I3AA 4ND4A 2PRSA 1EIWA 2DLCX 1E4EA 2VUTA 2XX3A 3R7NA 2HBRA 5IZ4A 1REQB 3WLEA 1AUPA 1EJ2A 4M0LA 1NXWA 3Q6MA 3DDSA 5GJCA 2DSTA 1UQUA 4FSDA 4Q1FA 2P68A 4C21A 1OJ7A 1A5ZA 4KVFA 4EG7A 2V5VA 3WQBA 1FS4A 4G0MA 1KEZA 1AOXA 2VNKA 3TIIA 1M2KA 5HE9A 1AZSC 4Z9YA 4QASA 3KQOA 1K86A 3VPSA 5JAQA 6ABPA 2R0QC 2IPOA 2WV9A 4G8CA 1T5IA 1E2QA 3MTGA 4K9NA 5LVAA 4CF4A 5BW5A 3TGWA 1Y5LA 2GCGA 3LLUA 3M9XA 3HI4A 4J1TA 1KJQA 3I1JA 1PNRA 3I2KA 3JU3A 3RGGA 5HS4A 1U2GA 1E0AA 2B36A 3MFYA 4F2HA 3MJTA 2JGFA 1GU0A 4J1SA 3E2MA 4PWYA 1XI2A 4J75A 3HJTA 5CYFA 1QDLB 1O9GA 1RZUA 2NSLA 621PA 5KYNA 2G6BA 2WF9A 1I51A 2VF5X 3IB6A 3RFVA 3U09A 3V4RA 3AEQA 2QVYX 1N75A 5EP2A 1GADO 4ZANA 1WO8A 4TKVA 3RAGA 3DUFA 2IELA 3DZJA 5LP6F 1TA0A 4IVRA 4OJYA 3EULA 3KB1A 4GDMA 2NV6A 2PGOA 5F23A 5D3QA 5H3HA 4IHQA 1V25A 3BRSA 2O8VA 2QJFA 3FKJA 1W1UA 4BLQA 4BVHA 4FZ3A 1AGPA 4RJ2A 3QTLA 1C3VA 1BAPA 1Z62A 5FFFA 4F6CA 4CIWA 4YCNA 4D96A 1HTBA 1OROA 4FFMA 2CDRA 2J5KA 1SKBA 5HK8A 3UATA 2HSJA 3KQUA 3KLOA 3A06A 4O2LA 3HO8A 4X7RA 2BTQB 5F5XA 3NW9A 4WXEA 1QRRA 3K70D 2NX2A 2H18A 1YA8A 2BEVA 2X0DA 2X2PA 3ZOZA 4BMOB 1DAHA 3TVDA 4AO6A 5I7WA 3C6KA 5K2OA 1L1QA 4ZD6A 2VR1A 1D7AA 3VRHA 3R6LA 4LC0A 1M8PA 1CQJA 3DH0A 5KYKA 2AMLA 1UC8A 3KBBA 1WVGA 4S3MA 2AJTA 5TY0A 1C8KA 1GV1A 1U99A 2J9RA 3IV7A 1RI2A 3B2QA 2FE1A 3ZHYA 5LNK1 3AK4A 4P4TA 2D1FA 3SJCA 4LUCA 1A9XB 1MNAA 1SWVA 4YJFB 3NALA 1Z0UA 2Y1LA 3KV3O 4J2TA 3ULKA 1VL5A 1DX9A 3CXRA 3HFRA 1EDZA 5C1PA 3KOZA 2Q5LA 5JZBA 3OETA 4G01B 3PCXA 4KP7A 1XNGA 1JHUA 3G6WA 3MQ4A 4ICIA 4MW0A 4BZZA 3FOZA 4PS1A 3E8XA 3S70A 1HT0A 3A6PC 2EGGA 2HSEA 4P7KA 3EZ7A 5BPHA 2VP3A 3SOPA 4CKEB 2N75A 2QLFA 3I37X 4EJMA 6NULA 6LDHA 1DELA 2I2CA 2IOQA 1FEZA 2RHMA 2HNKA 4WFJA 5B1IA 3PR3A 1TUBA 2C61A 2O0HA 4ARCA 1RRMA 2YUIA 2Z8ZA 5DYWA 3TX2A 1IHUA 3ADCA 5AI6A 1N6LA 2BM0A 3OF2A 4WZAB 2PUHA 4NCBA 4M0MA 3CTMA 3CPEA 5J5CA 1JA0A 2JCSA 1PQPA 4LOIA 4O59O 1E66A 1DEOA 4S0XA 2X9QA 4MAAA 5BSKA 1T8WA 2CL0X 3ESDA 2DHQA 1ACJA 5D00A 1JQAA 3N59A 2Z2ZA 1L4EA 2GFQA 3BK1A 3BM5A 1R0BA 4CMEC 4QTZA 4ZJZA 1MAVA 4IDFA 3W9YA 5LA6A 1GKYA 3LX4A 5KSWB 2VAMA 3RG8A 1D4ZA 3C3PA 4WERA 1XDZA 3AGPA 3DP9A 1QG2A 2IU3A 4DIFA 1C3LA 1N5OX 1WE2A 1YZUA 2REBA 2P1DA 2WIJA 1RE0A 4PYJA 5ALHA 1R4NB 1M74A 2O6HA 5DT9A 1U3UA 4OD0A 4TQ9A 3HPQA 4LZWA 2REQA 4UBIA 5BY2A 5FNVA 4WA7A 2DPYA 2EZ4A 3IV6A 4KN8A 3LJKA 4W6QA 3WB0A 5EJIA 1CERA 4XDYA 3DMTC 4DV6B 1Q1NA 3BE4A 1DRUA 4HWKA 1EQ2A 3THYB 1DPGA 4HZGA 2CHFA 3AONB 2QIOA 4P8RA 3TTTA 4A91A 4AMGA 3HUDA 4YMSA 2Y1OA 1ZGBA 1IHYA 2JBAB 3HUFA 4KN5A 1HDRA 3IOCA 4F60A 1NQTA 3PC8A 2VHYA 4ZK2A 4C43A 2JVIA 4JI0B 2AVDA 4NZ9A 2GXQA 3UQZA 3KPYA 4ND8B 1O6FA 1V8ZA 1R5JA 3EYAA 3GDFA 3ICVA 1ZH4A 4IDEA 1Z8HA 3ZHXA 1S5PA 1MO3A 3VTZA 4AJJA 4KFSA 5LYJF 1P7VA 3EGDA 3F2VA 1QM5A 3H4TA 4EHKA 4PZUA 4BFXA 5F73A 1L7BA 1RWMA 2QVGA 4AD8A 2ORYA 5M5BA 3QWHA 1FMFA 2A9RA 4QXOA 2ZT6A 4J1NA 5AJVB 2WKQA 2W93A 4I1IA 3AO0B 5JS2A 1X70A 1S89A 5L51A 1XVVA 4N6NA 1RPNA 3I9OA 2CGEA 3O4IA 3ISVA 3MAJA 3MGBA 3LK7A 4EQ6A 3PYLA 5C37A 1E60A 3DS8A 3VFDA 5IK2D 2OXFA 2GYWA 3H5WA 5JLAA 3ZWYA 4E94A 5J59A 3C14C 1PJ8A 1ZY2A 5ARCA 4XSGA 5JR3A 2VLBA 3VA7A 1N9GA 4LJKA 4Y9DA 5MFZA 5A3QA 3CLSD 1CVLA 1XQWA 1KYVA 3M83A 4PPFA 1DRVA 2D0PB 2VQDA 4M4SA 1Z6AA 4QU5A 1VI2A 2BUCA 3CH7A 2IYZA 1UWKA 1H8EA 1F9EA 1KK1A 2VNIA 3FPEA 2WE7A 3FWNA 3O4VA 4QYSA 4C6HA 2HMAA 4A9AA 3MBIA 4N3BA 5IN5A 3AL2A 1P1BA 3WRYA 1B74A 1Z0AA 4MCAA 1MA0A 3K09A 4Y1GA 2OWEA 4YJGA 4WEOA 5DTMA 1VYVA 4NYMR 2W6OA 2P6UA 4ZKDA 3PL1A 4NZZA 4JGIA 3D64A 1SU6A 4Z3KA 3ROTA 1NJ5A 2RH8A 3ETEA 3IFSA 2ZRMA 4X1KA 1EXVA 4ZHSA 5C51B 1DOAA 1ISPA 4R1TA 3M4NA 4GO1A 1FSPA 2C5GA 3S2IA 4QFDA 4IEEA 1JEYB 2FUG6 2FW1A 4HUQB 1OFUA 3BMOA 1RJFA 3PT5A 5ESRA 3NIFB 1Q0RA 2JFFA 2Y77A 3HSKA 2AYZA 3NM6B 3UT0A 3KSAC 1WY7A 3BRWA 1UMBA 3P2IA 4R9UC 1BS9A 3GRPA 4UUQA 3SPXA 3T9AA 4TKZA 4IJUA 2VHXA 1NMEA 1Z4PX 2YJZA 2WYOA 3L0PA 4HEJA 4KIFA 2N46A 3S68A 3S2YA 4M37A 5EUMA 5AUNB 1PNQA 4CL2A 4DY6A 1NVMB 1WU8A 4IIBA 3RR2A 2B99A 1TEVA 4DWWA 6REQA 4CJXA 4WBXC 5I5GA 2QAGC 4DADA 4BAZA 1DV1A 1MDFA 3LL4A 1P4HA 4A23A 3MT0A 3LGAA 3R2JA 5JDIC 3VYVA 3THWA 2ZPAA 2DF8A 3DZ8A 5AI0A 2YHBA 2J7KA 3QE0A 1UP6A 3TMKA 5GTDA 1XMXA 2HJHA 5IDWA 2E5LB 2V0GA 1GP2A 1RT9A 2G28A 3QK7A 2WC1A 3HUTA 2O3RA 4JJAA 4NWIA 4UCWA 2X41A 1D9ZA 2FI1A 5H83A 1CEYA 3QVGA 3EA5A 4DBZA 1ORWA 2I76A 3DBHA 3C8ZA 3GHHA 3SR3A 1PDWA 1SH7A 3IERA 5B2ZA 3SFZA 4ZCIA 1FSFA 3KZOA 3TIGA 1NPTO 5JBQA 2JARA 3AESB 4C08A 1B1AA 4FX5A 2TECE 4AF7A 3B1JA 5ELMA 5AO9A 3QVTA 3QVOA 4XQ0A 3M49A 5T4FA 1JEJA 2XNHA 4D4LA 1DOZA 4JYCA 4EO9A 2BGMA 1ENOA 2J31A 1C9YA 2YWRA 1D9XA 2CY0A 4UU8A 4YONB 4GVXA 4CKWB 3Q8KA 2BFPA 1JV2B 1WTCA 3KHSA 3QLVC 1FNDA 1EQAA 3JAKB 2F3PA 4RQBA 1NYTA 4O4HB 3ADPA 4K88A 1QZXA 3PCRB 5KAMA 4DEVA 4EG1A 2Z3WA 4NCHA 2DFVA 1LW7A 4ND5A 2FFRA 3WYCA 1Z6YA 3ESBA 1T5BA 3H8SA 2P2DA 1SOMA 3M6WA 4PO8A 4UUPA 4AO8A 5KMGA 2VP0A 2BELA 1NUHA 2ZU6A 4H3HB 4I9GA 4UJ3A 1RM5A 4X3PA 4OHFA 2WYIA 3WIUA 2J85A 4D99A 5AVWA 5FI0B 3PR2B 1VL2A 4YUZA 5EG5A 1R6XA 2J0VA 3BE5A 4XQEA 1WLYA 2OO7A 2DECA 4LHWA 3GJ0A 1Z6TA 1E8NA 1VKJA 2UYQA 1RHQA 5CA1A 4CWAA 3N8IA 5IDXA 4MKIA 1G55A 5JY1A 3F5SA 4YUVA 1RAHA 4QUKA 2G25A 1DBSA 1VHLA 4ZPJA 3MJRA 4Y2TA 2I99A 2ZB2A 3G1TA 4CMJA 5ALYA 2DBQA 2AF4C 3PLAE 2YWXA 3D5QA 3WMRA 3JQEA 2JAPA 5JZ9A 4I50F 1I4EB 1C5KA 1R10A 1QVRA 4E7OA 1YZVA 3DQZA 4RO0A 4WE3A 2Q45A 2ZTMA 4DM3A 2W6QA 3AKZA 1P1JA 1ZOOA 2Y1XA 1HKHA 4TKUB 3GDWA 2IDZA 4EAQA 3PKZA 3CT6A 1KNQA 4NFYA 2E2WA 3ZZ0A 1J0BA 5EXDA 3RKRA 4NYJR 3UJ8A 1JB1A 3HFJA 4CQMD 3T5DA 9ATCA 4X90A 3NHWA 2JJ1A 4B8WA 4C89A 4ZYVA 2MR6A 2X0FA 1Q50A 3UJHA 1P2FA 1I5EA 1ECFA 4NCJA 3VU9B 4MUEA 2QYSA 2UXBB 4KQXA 1M1YE 3S4YA 3Q7TA 4ACAA 2WUWE 3WGTA 4IV8A 4D80A 5CIYA 1PYGA 2FLKA 2GPBA 3ECCA 3KKOA 4NFHA 1MJNA 1V1JA 1SCUB 2O6LA 4HRAA 3NHFA 1G2QA 1KI4A 1OMOA 3DPUA 3JQ7B 1QIHA 3NEPX 4IO1A 5J2TF 2DXIA 4D26A 3IPRA 2VDWB 4XUDA 1GSOA 1WDLA 2CN1A 2W6IA 5K4AA 1CXZA 1PG0A 2ZE5A 2F17A 1DTWB 2VOEA 3IO3A 3U4DA 2J0UA 2I4MA 4EYEA 2FF5A 2QQFA 3QSGA 3T4UA 1EDEA 2AFVA 3FZQA 4NJEB 1ZHFA 4WLVA 4ARUA 4XRGA 1V7PC 4V0RA 3QTTA 1RYZA 3IP3A 3JD3A 2HU7A 2JPDA 4GR4A 4RZSA 4UPDA 3T3NA 4YRBA 2WFMA 1FZQA 2A67A 1H4VB 4UTOA 2WMDA 2I6TA 4D9NA 4XD7D 5DJ5A 3VKHA 1XWWA 1OYYA 4QRDA 1JWLA 4X8MA 5JI3E 1SKYE 5GGYA 1S4QA 2IQ5A 2P5TB 4ITVA 1K68A 4IGKA 4K1XA 2I8LA 4KPYA 4QOEA 4Z99A 2KSQA 4O8CA 2XEDA 1ZD8A 1TADA 4MYSA 3WIBA 2O1EA 4ESVA 4X9XA 1OZHA 4AQ7A 4QJIA 3OCXA 1WULS 4RY0A 3W5BA 1WB5A 3C3CA 1FX0A 2QUJA 3KSRA 3ZUGA 1W29A 1LPBB 2P0EA 1Z82A 2HJRA 2O48X 2P2NA 4IQGA 4GR9A 3WFJA 2FKNA 1SVIA 3I05A 3HTXA 1KFEB 3BH6A 3IMCA 2GETA 3NRBA 4QBKA 3OA2A 1L2TA 5EUBA 5JAMA 4F6LA 4BNDB 2JAQA 5B3AA 2FWMX 2SHKA 1E6MA 1RI5A 4C0SA 3AY0A 3AIKA 3N7TA 1U8YA 5E8RA 3A14A 5B3KA 3TW8A 4BMNA 4EMTA 1TX4B 2O4UX 2JLWA 4QQKA 4GMKA 4O63O 4HWPA 2RGWA 3OX1A 3AH8A 2L82A 3ANSA 1KYWA 3BCUA 3G5TA 2A9JA 5AOCA 5IHXA 1UBMS 1UK6A 1S2IA 1QZTA 4IHJA 5AHOA 4ACBA 3Q1KA 4K6FA 1PFKA 4L8YA 4CM8A 2JLYA 4IIHA 3OOHA 4K03A 3UAVA 3PQEA 1V7QA 3A9RA 3DCJA 3LUAA 3UO8B 1VYTA 2ZYIA 1U8XX 4DA6A 1T34A 1N4DA 3QQ5A 2B4YA 1WSBA 2OO3A 3PUVA 3I6YA 4OQDA 4DLRA 5LQAA 2QL7A 2O7VA 1Q21A 1R3DA 2OY0A 4FHDA 4LIPD 4YLEA 4OHZA 1OCEA 2RGBA 3FSGD 3Q9NA 2O7QA 2AR0A 2WWTA 5K05A 1KI6A 1NN5A 4WK2B 2C0CA 4CHGA 3TMAA 3ND7A 1F2TB 4XTCS 3PS9A 1HYGA 4DLAA 4MQ4A 5KNBA 1CUIA 4YT5A 3K5WA 3LQFA 4ESHA 4FXPA 1Z45A 3O92A 3KO8A 2O8BB 1GFSA 2MYPA 1GZSA 1GGNA 1IZZA 1N2BA 1RRGA 3EFHA 3GLHB 4KIUA 4X91A 3TNDA 2PWPA 2EKPA 4BYGA 1CHNA 2QN7A 4BOYA 4TLDA 3JR3A 3Q15C 3TJZA 4BGDA 4FN5A 3GPCA 3LO8A 3RHFA 1R0XA 3U7GA 4R69A 3O83A 4YMGA 1ZWKA 1PI3A 2A4MA 2P62A 2XRFA 5JNWA 5MDHA 3NZEA 2WTUA 1N3YA 1WCIA 4K40A 1RTKA 2ZI4A 2COEA 4DLSA 2BGNA 3KQPA 1HY3A 1MAWA 4BBPA 3UICA 2HU2A 4WCFB 4NBRA 5BWCA 2P2YA 1TC1A 1Z13A 2D2IA 1W0JD 3OOJA 2C4UA 4JV5B 1H4SA 2XSZD 4R8KA 1ZMBA 1ZH0A 2BMAA 2ZJ1A 3HJGA 2HV8A 2YIDA 4B1FA 1YIDA 3OPQA 4WZBE 1JAYA 2MCFA 3EMBA 4NOKA 2C2XA 3WYNA 1CFZA 1B0UA 1FVFA 2QGNA 2BUBA 1NJFA 2YFHA 1U8ZA 5BN4B 4I9NA 1WMAA 5B53A 4CM1A 1CZKA 3AJRA 3E58A 1NSFA 1Q7GA 1Q2XA 2HI0A 3PGLA 4PLZA 3U17A 5JD5A 5CCXA 2FR0A 3F5MA 4DWVA 4UJ5A 1P1RA 3MIIA 4UHJA 4KNWA 2GK7A 1NP6A 5FFNA 3A1EA 1EFPA 1J99A 4DA4A 2GF0A 2QM7A 4C2UA 5GV7A 2H7YA 2Z1MA 4KX3A 4TL6A 5EEHA 3BD7A 3EOAI 3LFUA 1G7TA 2FUKA 1EYZA 1BCSA 3O8NA 2VUSA 4LMBA 4CW7A 5FBLB 3I9MA 1M0TA 5TPZD 1IHOA 2ZUSA 4ZV4A 3D8HA 2HSWA 1IBLB 1MB3A 4RMNA 4FE7A 3R4CA 1E3SA 1JSRA 5TF0A 1Y8ZA 3PIDA 4TS4A 2JGIA 4TQUS 2DUWA 2JHAA 4LWPA 5DHQA 5FWYB 1M10A 5HKBA 4I1PA 3DULA 5JSFA 3D6TB 4AB1A 4NU8X 2XB2A 4WJLA 5JY6A 4JJFA 1FMLA 2D5BA 3L7AA 4R1QA 3H5VA 4PAOA 1H65A 1FL9A 1VBKA 1RZRD 1Y89A 2FHSA 3I6IA 2VQEB 1N2JA 1U0EA 3IE0A 1GQYA 2JASA 4UBOA 1RACA 2Q5JA 2B98A 2R6CA 3TLKA 1QJCA 4JP2A 3KT3A 4PLGA 5BSFA 3OUZA 4JK3A 1GRCA 4V3CA 4TL7A 5ICSA 1WBDA 2OMEA 2BSXA 4PCLA 4ZZ0A 3U3DA 1F2UB 1KOJA 4M0FA 4KO2S 1DC4A 1SKAA 3AJ9A 3NVAA 1JHYA 2V9ZA 4IIUA 2Q3FA 2BFCA 1UJ2A 1CT9A 2ZBEA 1U5CA 1UOQA 4O2BF 3ZIAA 1WZCA 5KHOC 1IM8A 3D4NA 3IAM6 2G1JA 2J5RA 3QYFA 1M83A 3PX3A 4G5SA 5KJCA 3L77A 4TTQA 5KOIA 1TM4E 1FDSA 1WNFA 3EZNA 5C1OA 4A26A 4AMVA 2WG1A 3TFQA 4QVIA 1VKZA 2X5OA 2YC4C 3TKYA 1HZZA 1VPEA 4G86A 5JRDS 4GP6A 4KDFA 4MP3A 3UA4A 1OT3A 1ZMRA 3I5YA 3FWHA 3Q41A 1G59A 4PHCA 3TI9A 1Y7PA 3ESQA 3STHA 5JQGF 1WP9A 3H05A 1NOJA 1U0LA 4OBXA 1PTJC 3JD0A 1Q7TA 4XB1A 4LRUA 3AF4A 5ESDA 3H86A 2HRRA 5JPCA 2YZKA 3AVXA 6Q21A 4ETNA 2W6NA 2C8VA 4MVJA 1ST3A 5ITZB 4O4LF 3TAXA 1BKYA 1P2TA 1S3SA 4HLQB 3PP8A 4GZ5A 1M6HA 5KYWA 4FMCB 5C35A 2HYDA 1Y8RA 3SR4A 4QDUA 3DFUA 3AB8A 1I1QB 1NBMA 1AO0A 1IBKB 3ID6C 1PVVA 4ARBA 3IEIA 5ALKA 2FZVA 3M6LA 4QQNA 3CB4A 2Y0DA 2OSVA 4H17A 1F6BA 4C30A 5F2KA 1JDBC 4E14A 4FB4A 4E1VA 4L28A 4N6OA 3UUGA 2BIFA 4GMHA 2NM0A 4CI0B 3F90A 1TMGE 3G7SA 1XA3A 4OHOA 3LYAA 1I0LA 1YVPA 3K73O 2WA1A 1QK3A 4YV7A 4TSRA 5LM3A 3K30A 4P7JA 1GT91 5AOAA 2ZIXA 1PFUA 4DEXA 4QGSA 1YKGA 2A33A 2YWHA 4RVDA 2ON6A 1IUKA 2F90A 2JD0A 1O6ZA 3AOEC 2CLKB 1OWLA 4W6ZA 3UJBA 4EQZA 1OTYA 4OXQA 1VM6A 2XTNA 1GTSA 4OI0A 1FP4A 3B85A 4ITRC 1EWTA 5GOZA 3FHLA 3GD5A 5JI2E 2D7DA 3KLNA 3NRJA 3WKEA 3KX2A 4BN0A 5J2TB 4RTPA 1RPZA 5EUCA 3AHGA 4R05A 3BMNA 5EWJA 3NEJA 3QHAA 4RPHA 4CEHA 1NBOA 2PG3A 3PRHA 1ESZA 1L4NA 2F9FA 4JX9A 5IX8A 2RGUA 4XA8A 3GT7A 1QP0A 5ERXA 1V1RB 3HB0A 2VQ6A 3DZGA 3HCOA 1X8LA 2MMCA 2V4UA 1I30A 1K8RA 4HLUA 4JJIA 5JYBA 2FGKA 1J70A 3LSYA 1R9JA 2PEYA 3MK31 3HBAA 2IC5A 4XVQA 3KOOA 4H77A 4G0WA 2QN2A 2IZ5A 2CFIA 2X4IA 4EPXA 3QKUA 3QQPA 4MHSA 2FA9A 1QLJA 2VG8A 3ZLTA 4F0JA 1FDRA 2IYYA 3ZWMA 6ADHA 4AKGA 1XL0A 2QL5A 5CX1A 4KSCA 3KUDA 2RAVA 4RH3A 4XDGA 2W2PA 2WILA 4HYYA 4ZALA 3L8ZA 2IW3A 1TZ2A 3I01A 1ZUHA 5CVTA 1UIRA 1GN9A 2G70A 2Z2JA 4C20A 5TF4A 2EFYA 2VDPB 5A2GA 1NTOA 4HNRA 5C8YA 4JFRA 4ALMA 3CU5A 2HCTA 4IS3A 1F4VA 1Z18A 4YJ2B 3D5TA 3I5MA 2E9SA 1GTL1 4KPUA 1QF9A 1KJIA 1CUHA 1OPXA 3V1YA 1FPQA 3DOOA 3V1LA 1V9CA 2QUZA 1NL3A 1ZM4A 2XKKA 3A6EA 2YW2A 3G1UA 5BUSA 3U4HA 3C5WP 3IE2A 3Q7EA 4BZPA 3BZUA 1JUDA 4L75A 1OZ0A 4TN5A 4X71A 5EP4A 3SF8B 4AVYA 1BQ4A 4D41A 5E6RB 2ZYDA 4HSGA 4HVTA 2PMKA 4UXHA 1Y5IA 4C1BA 1PJCA 3IQHX 4OXYA 2G9ZA 3C5HA 1CHDA 3RK0A 4DPMA 5C8VA 1DFGA 1F1BA 1M33A 1SQGA 3A7DA 3O4RA 1RXYA 1W2HA 2HRDA 2JLSA 3O8OA 2NSYA 5FTKA 1CNMA 3VNBA 4WXPA 3DV0B 1TKRA 3STVA 1QRSA 4Q4HB 1QTIA 2P4HX 4YCCA 1BMDA 2B5WA 4FDAA 3OJXA 2GB4A 3UHOA 1H93A 1RAEA 1VHWA 5ALMA 4MQFA 4WOKA 1JQEA 2D5CA 1SBIA 2LW7A 3F0TA 4ZVMA 3BULA 4ADSG 3T9CA 3UV3A 1E20A 1L4YA 3F98A 2YW9A 4FYKA 2O54A 1YI0A 1YR2A 3PHBE 5CH3A 1A0OA 1I80A 2E4XA 4JS0A 3W2EA 4R51A 1LRJA 2QQGA 4RENA 1WNTA 2AT1A 2CE2X 2L69A 2WVAA 5EIBC 3KPJA 3LY7A 5IZCA 3JAMA 3FRIA 1L5FA 5EJ5A 1NMSA 3CCFA 3Q1LA 4GKAA 5D7BA 2CNOA 1KK2A 3TL2A 4GSLA 3IC5A 1OB2A 2FQYA 4FQ5A 2UVPB 4K26A 4LDJA 1AGRA 1Q83A 2AFHE 4RPIA 2OXTA 5JYDA 4Q3OA 4B0OA 4NZYA 4BC1A 3ICOA 2C99A 4FUQA 1JP7A 3E3AA 1QQBA 4A5OA 1NDQA 2ZJ0A 3MOIA 4CLRB 4GPD1 3GI1A 1YJAA 1ULUA 3FA2A 1EK5A 1GR1A 3FPCA 1JLSA 1UBEA 3L82B 1RIIA 3M1AA 1Y6QA 4HDMB 4JKYA 1FTQA 4X45A 1IDOA 2H51A 3G8DA 3LT5A 4NNOA 4PBTA 1LPAB 4V03A 4ZPXA 4HMPA 3H2IA 2YFKA 4X63A 5KNCA 4DR3B 4DJ5X 4D42A 3NNSA 3ENZA 3IBGA 2VC2B 1SVWA 2B6HA 1WW8A 3ROFA 3HXKA 3UB2A 4W5OA 3P4XA 3E7XA 1GPAA 3SJAA 1J56A 1QBKC 4P32A 5JPIA 3N0TA 1RHJA 3QOXA 4FR0A 4FZ5A 3O7MA 4G41A 2IWRA 1PR6A 1XYVA 2FW9A 3VZPA 3ZGXA 2EX0A 1SUDA 4M55A 3RRJA 2CKDA 1AE1A 1ES9A 2WDZA 3UZUA 4C6TA 1Z4MA 2XJ9A 1ZNXA 3LPLA 1I33A 3STXA 4IIVA 3DHYA 2J9FB 3OP4A 4JYPA 1O7JA 5FNVF 5AVTA 5LU8A 3K70B 3AC0A 1VIMA 2XA2A 2XZPA 1T2CA 4JLDA 3K0FA 4FYJA 4ENSA 2DB3A 3LVBA 4URVR 1Z34A 1DAIA 2AOWA 3KL4A 5IBPA 1NP7A 1BU8A 1GRVA 2CV2A 3BEDA 2VT2A 5TJHA 1B3RA 1JQ5A 4E4YA 1OR8A 3VPXA 1C9JA 4E33A 3EBLA 2GJ9A 4QQFA 4L1KA 5DN6D 1YJ8A 3PHIA 2Q5QA 4R8VA 5IBRA 3P0IA 2IS1A 2FG6C 1VB3A 1VMEA 4NICA 1Y9JA 2QW0X 3GJ7A 1Z56C 4XGRA 2VTKA 3GN2A 2ZS9A 4OP2A 3AYXB 4Z86A 1UWVA 2BI7A 4L3OA 5BR7A 2AKEA 3M9LA 3UNXA 1DUIA 4YRRA 3SS8A 3S8EA 2R00A 8OHMA 4Q9NA 1OTHA 4C4XA 4GYYA 1JPUA 1LS1A 2BCEA 2G09A 2X4DA 3L8DA 3PNMA 1EU1A 1JJAA 3ASUA 3G9ZA 3TS1A 4KR7A 5E7JA 1U98A 1YU9A 3CR3C 2X8WA 1HH4A 2I1WA 3AR4A 2IIBA 4D3YA 5B7GA 4XJVA 3MA0A 4G0QA 4MYUA 4MRPA 1VXOA 5ECGC 3VMFA 2XKAA 1SPXA 3O2QB 4C07A 5FYDA 4FFBA 2Y1WA 4DCSA 2EIHA 2QV0A 3LUBA 2O2SA 4YMLA 3ONVA 4EGSA 3ETHA 221PA 3MGKA 3PGVA 4Z1MD 5BXQC 1DVRA 3AHHA 4NCKA 1E1QD 5KIAA 2R47A 1RI1A 5B30A 1TDJA 1VLVA 2IPNA 1R6DA 2IP4A 4YN3A 2YY5A 3X1KA 4NMWA 3ZZ1A 1YE5A 4X1YB 5GZ6A 3IODA 1OFUX 5HIKA 3SK0A 1F5SA 1ZLYA 3C6QA 3B78A 3KOUA 4MR9B 4F3NA 1XMIA 5DYGA 3TTWA 4B9AA 3ZV5A 4PSKA 3LFTA 2OXRA 5A1JA 4B3MB 1S8FA 1GPMA 2QPAA 4QO7A 3TCXB 1KK3A 2O3UA 3P2EA 4Z9BA 3FUXA 2C2WA 3OPYI 3RW9A 3ZBTA 5KOHB 1YHNA 1G42A 1QX4A 4W5WA 3E9QA 5G41A 1E2IA 4J03A 5C81A 1Z37A 3TZKA 1GSHA 3RIMA 4QTXA 3VHXB 4UCQA 4DJAA 4RA9A 3THXB 4D56A 1BXKA 1KO4A 1EEXB 4UTRA 1B23P 1XTSA 2DY0A 1NF8A 3EVNA 3NBQA 1B76A 3ZD9A 2CDBA 1ZVMA 5AJXA 4CQLA 5JH7F 3LPCA 4EKGA 2Q3CA 3FHTA 4KIGA 4WZAE 4MDFA 2D0DA 4OPMA 2A30A 2QYHA 3DMDA 4HQKA 1JHAA 2YCBA 1L5ZA 1T1JA 2WWGA 2H4WA 3KXLA 4X54A 4YRGA 1V8FA 4HVCA 3BAFA 2H52A 3ZGZA 3IBTA 2Q5IA 1NVTA 3W3ZB 4C0XA 4D7AA 3V8VA 3EXEB 1VZ2A 2L0XA 3OLQA 3UTCA 3FBTA 3AHCA 2MSDB 4LZZA 1N32B 5L8VA 2QY6A 5DM4A 1H2BA 2IT1A 4YLYA 5FLXA 5F7OA 2HN9A 5PGMA 3IQFA 1N6OA 4K9KA 2YZMA 4QU0A 2ZROA 4JNKA 4YRDA 5DCWA 5TB5A 4OMDA 1JVSA 5G0TA 2HRZA 1EZZA 2VF2A 4H6PA 2PV7A 3G2OA 4EI9A 2VN8A 1TU3A 3TKAA 4DUPA 3FVVA 5JSHA 2B1QA 4YXWA 3PK0A 3T7EA 2YV5A 4FKBA 4TTIA 4UASA 3GF4A 1MC4A 2V7EA 1LBEA 5TDHA 2UYCA 2G72A 2Q6OA 1H2FA 2Y9MB 4L0CA 4CIDA 1V5GA 3GAMA 2PRYA 4YH1A 3GLGB 2PT9A 1GPNA 3TQTA 1DEKA 2ID9A 3MC1A 3R0ZA 4IUDS 3GRAA 4RIGA 5EIWA 3K9FC 4PNEA 4Y9SA 3IURA 1KZ9A 1H66A 4IZIA 2GZDA 2R1TA 3R5HA 3JQGB 5T3YA 3LG2A 1ITZA 4TX1A 1LA2A 2ZM6B 1G4UR 1Z29A 1NULA 3TFWA 1KI1A 1K9SA 4HN4B 1MXHA 3ZPXA 3WX0A 4XIIA 5CCDA 1WMDA 4JQCA 4O3MA 2R7KA 2O14A 1IXYA 3FE2A 1FFYA 2HK7A 4G1MB 1L5KA 4UE3S 2E85A 1E0DA 3N8DA 3W5SA 3ZDXB 1CRLA 4D25A 4CMGA 5JLJA 1ZR4A 4F4HA 2WHPA 5DNWA 1W4CA 2ATCA 4PNHA 5KX5A 2AGVA 2V7QD 5A9TA 1KVQA 2Q6VA 1T3LA 3OHMA 3EF0A 4GAEA 1CR1A 3HA3A 3I5AA 4OL0A 2H11A 5H1YA 2YCLA 1XCPA 3DOEA 1W49A 4I81A 5KTNA 4QX6A 3W9SA 2FU5C 1CSEE 1CUUA 2J9ZB 2QNRA 3CGWA 3C5EA 3HXTA 4TWBA 3VR0A 1E7QA 2QT1A 3GRZA 3QYAA 4GMFA 2BGLA 2DQSA 2HDNB 2JCYA 2LGJA 1M34E 1TUEA 3WK5A 1ACMA 5FADA 3G0DA 4KR6A 1MNQA 4OK3A 1AV7A 4R9VA 3V55A 1GWNA 5D87A 2GPTA 3KP1A 1C3XA 1SCBA 4BL5A 4EUHA 2IXFA 3NUGA 1BS2A 4ZV9A 4CCYA 5KNDH 2VUIB 5DEOA 5LMNB 1I7SB 3H9GA 4L8FA 1DFIA 4XSVA 4DEYA 1CR4A 5DI3B 3MUNA 5AM0A 3QE2A 5D3ZA 4KC0A 3MGGA 2ZB8A 1YJCA 4EENA 4L08A 1FFGA 3LY9A 2G8LA 1BGXT 4EHHA 1A8IA 2W6PA 1ZX1A 1VL0A 1ZVJA 2HWUA 3W79A 4UW9A 2WP8J 3S8YA 2J3MA 3DKKA 3P26A 2QK4A 3B6ZA 2J5QA 3DDHA 2NSDA 4YP7A 1FP1D 2E6KA 1N0WA 1X2BA 1YASA 3COZA 4MUIA 1Y8QB 4DA7A 4ETIA 3UBTA 4KQ6A 1QIGA 1G6HA 2XCQA 2EV9A 4RTRA 2JD1A 3OX2A 4DILA 5JXHA 1IQPA 3NOVA 4BGUA 3L0BA 2V8OA 2OHVA 5F78A 1CP3A 2EHDA 4BO5A 7REQB 2PBLA 4DN6A 4AK9A 4JLWA 4TKLA 3T38A 4C78A 1JYEA 3GJ4A 3F1LA 3SIWA 4ZGBA 5B5SA 3F9RA 2GEFA 2QX6A 1URPA 4JEIA 4EFKA 1M1ZA 1TKAA 4W8OA 2FSIA 4AF8A 1CY2A 1ND5A 3DW3X 4U02A 4OK5A 3IEPA 4NCIA 3IKTA 4N0PA 2XUZA 3ETNA 3CMMA 4Y9UA 3GY0A 1K0UA 3K9CA 4MIOA 2K6GA 4BQOA 5LD2B 2JAHA 1QONA 2IYQA 3LVFO 5DSZA 3GMSA 1O57A 1AN9A 3ZCUA 1EVLA 3FVRA 5LIPA 2Z5VA 1BDMA 1VPLA 2IK8A 3NBMA 2ES4A 3TTXA 3H18A 3H7IA 3LMKA 1A7AA 1ZISA 3C5CA 2PV0A 3IUMA 4KK4A 3NJ4A 3KB2A 4DMKA 4D6XA 4BQIA 3LUFA 1AD2A 3F78A 1U2SA 3KTAB 4NCXA 4V0MA 4EVSA 5FTJA 4IF4A 5C4MA 3V7FA 5LB2A 3EVGA 2FSPA 5KO2A 3R7LA 3ZWXA 3RS7A 1E5TA 2NAFA 3PHJA 5ADHA 4C4ZA 2Y4NA 3ISJA 1R0SA 5A2QA 3ZE0B 1RFGE 3BBPA 1U5BA 4PBSA 1NVEA 4HNUA 2FW8A 2O2IA 1FU7A 5HQTA 3P2KA 3NHLA 5I4CA 5G0VA 4UE6A 1YRQA 5DNVA 5JNVA 1JG6A 2NO0A 3GVCA 3WRXA 2I6XA 1DQRA 5I6DA 3MM4A 3EGIA 5JDIA 4HLCA 3SC2B 1QF7A 3Q72A 1HE4A 2FG5A 1OLXA 2RGXA 3AEXA 3EXIA 3IMKA 3KQNA 1CJSA 1XVTA 3W5HA 1UBUS 1LBIA 3QX8A 4XCVA 4NULA 2GPAA 1NRIA 1RYFA 4E70A 1UWLA 4DQUA 1HLFA 5HYVA 3AXTA 3RHZA 4ZIRB 4X92A 4ZWNA 2Q5FA 2BZ1A 4FHFA 2VJNA 3HCRA 1GGKA 2F3TA 2PZ8A 1ODFA 4QDTA 1I3LA 4EG4A 2QN9A 4C0AC 4CQMB 3E35A 4KQIA 4CKCA 4YMUA 1PHPA 1TMYA 5DX8A 2V0NA 1QTNA 1OXVA 2GJKA 2BE7A 3WK8A 3ZDYB 5LQDA 3DLHA 1R5NA 3MD9A 2FW6A 1VMKA 3D3WA 1BHQ1 3CIFA 3L49A 5HM8A 3KD2A 5CLQA 4RY2A 2VK8A 3BF8A 1JJ7A 3R7FA 1GQFA 2QQ0A 4D6YA 5B3LA 3L84A 4I6JA 1CUSA 4IHJF 9MHTA 1A4RA 5FL7D 1Q1BA 3G5AA 3OFND 2IUTA 4QXMA 3ROZA 3K0EA 4EK9A 4LF6B 2DBZA 2VXBA 3AR9A 4UUOA 3G2PA 4LVUA 2XB6A 4MUYA 2Q29A 3KYBA 2EJVA 1OIVA 1K2VN 2JAXA 2FSVC 3CO0S 3LOPA 4JSTA 3O74A 4MV9A 3WGZA 4YT2A 5IXJA 2JIZD 3ON5A 4DIUA 4OGKA 2IYRA 3L7IA 4KSYA 3LBFA 1GGHA 2GRUA 1W5EA 3HN7A 4PG5A 5CNIA 4IOJA 3EVFA 2IY7A 2UDPA 4MR7B 4C4YA 3GJQA 4ENQA 4MRMA 1MB9A 4XX0A 3A0UA 3EUWA 2NO6A 2JLVA 2HXYA 2Q9AA 1B0AA 1CRZA 3ADOA 1RC0A 4QOJA 4URUR 2VPZA 3N7UA 5P21A 3PJGA 2NU8B 3D7MA 1IIBA 3C70A 1B15A 4TVKA 2Y92A 3E48A 2JANA 1QF6A 4QUEA 4P4LA 1J5PA 3KETA 4Q3KA 3S1AB 2VTBB 3U40A 2YV2A 4NEGA 4E22A 1C14A 4W9MC 1HNXB 2QYTA 2XF2A 3DG9A 2Y67A 1U0RA 2GCOA 4GOLD 4YO7A 1NC1A 3WAKA 4E32A 3SVLA 4D5EA 3KQKA 1T4MA 3H0KA 5DASA 1K6XA 2AE2A 4ZAVA 5HIJA 4R8MA 1ZAKA 4A8JB 3P9NA 1EPUA 1NBAA 3CLTD 1VGRA 2QE7D 5KVAA 2AHOA 4ZI2A 1E6EA 2E3JA 4PO9A 4FS8A 1TC2A 1KEVA 4OMUA 1PZFA 3IEUA 4JJ4A 4QBHA 1O94D 4DGQA 5JQGB 1RQRA 4BZXA 3SEZA 4RA6A 3SLRA 1IUNA 2BY4A 1GQQA 3EXFB 4GLFA 5GINE 4UNSA 3QGMA 4WJKB 2XGJA 5JO9A 3CEMA 5F77A 5M3BA 3ZTYA 1OAOC 1RRVA 1VMAA 1EXWA 2PSSA 3HU2A 3N28A 3IS3A 3K05A 3Q11A 1Q1ZA 1SUIA 3RS8A 4GI2A 3I4CA 3DF7A 1N0VC 4RETA 4EB8A 1H9BA 1N2GA 1IWOA 1P4AA 4M8IA 1EX7A 3IUEA 3Q7PA 4CM5A 1QYVA 1PDOA 3H1FA 4NBLA 1SJ9A 5AXAA 5DISB 3IUPA 4BPRA 2XIJA 1Z5PA 1BXGB 2QRJA 4QRHA 1MJGA 2Q7DA 3FMGA 3SBEA 4Q4AB 3BWBA 4H7KA 5AYVA 3AP1A 4C4SA 2PUCA 3CW8X 1JT9A 3E3LA 4QYTA 1HF3A 2QLMA 1SZDA 3L0CA 3VR2A 4MGEA 1HDXA 4RKQA 3OPXA 2OGWA 1L1FA 3TTUA 3IUBA 4HN9A 4ARZA 1C9MA 4AUNA 3CJTA 1GFWA 3TEJA 3OCUA 1MDBA 2CE7A 3M70A 4XIYA 3U4QB 2VZLA 4K46A 2E5FA 3LBAA 3FWKA 2A5LA 1RXIA 2D5IA 2PSJA 4FINA 3S81A 1DRKA 2LBPA 2VJKA 3GPDG 4DCGA 4IL5A 1FIUA 1RU3A 2Z43A 3HCAA 1PS9A 3IV9A 5FFMA 4L4ZA 2VSNA 3UB4A 5DTRA 2R4UA 1ORIA 2I67A 5AM4A 1TQ4A 3WLNA 3I53A 4M46A 4J0HA 1JEEA 1OIWA 5BWBA 4RJLA 3PFHA 4M38A 1JG4A 3LNCA 1MTZA 1HXHA 2ZS8A 3HUEA 3K1YA 1VL1A 2WSSA 4HTAA 4WLOA 5FXMA 1M6VB 4CMBA 3KYDA 5JATA 4MDEA 1NRXA 2IXTA 1KMCA 3OECA 1MJ5A 3GC6A 4FBLA 4F1KA 3VKVA 3V1NA 4UBJA 3GJ3A 1Q92A 4DABA 3OE7A 3VO9A 3F6CA 3DTNA 2P2LA 4JLVA 1FFEA 2QTVB 5CYOA 5K8TA 5E3HA 3T35A 1YVDA 4BMVA 5KS2A 1P19A 2TMKA 4JBYA 4I4LA 1VDZA 1MU0A 3HBJA 4MTCA 4Q3EA 3NMUF 1D4AA 3I4FA 1KI3A 1LLQA 4M1KA 8ABPA 1IAQA 4JFAA 5JANA 2Z4RA 1HL7A 2FN7A 1QFZA 2RHHA 4LBYA 3WL8A 3CVUA 1SGWA 4EJ2A 4UAGA 3FTPA 1U8CB 1YOVB 1BW9B 3PUJA 3R5TA 5IM4A 1ZUNB 3GLHE 4WMLA 3SS9X 5DRTA 5LUAA 2ASEA 1QGYA 1UBKS 4I5FA 3F7NA 4X1IB 2FZ4A 3R44A 4FTWA 5TQ0A 4D0LB 5CB6A 5JMOA 4MVJF 3AVOA 4H7PA 3CT4A 1THGA 1D2RA 5JCOC 4PZPA 3VR4H 5LMCA 4N5IX 3I6ZA 4GX2A 3R0VA 3DD1A 3OBIA 1T8PA 2AD1A 5ITSA 1Z7EA 1QUEA 1FNCA 3SHVA 5K8IA 3U3OA 4AU1A 1U1CA 3KM0A 5CA0F 2BV3A 4D8TA 2DGDA 2ZB4A 3R41A 2I8CA 2O7NA 2VJYA 2I33A 3NTXA 4L9SA 2PLFA 4P9NA 4E2FA 1KERA 1ZI6A 3VTAA 4ZJUA 4KKVA 4C2TA 1FNBA 2DUMA 4HK4A 1R8YA 3B52X 2FY8A 3OZTA 2ZSKA 4QXAA 3KSDO 2WSLA 2IDMA 2V59A 1PSZA 5C7OO 1BXZA 5EE3A 2BVNA 3DDZX 2BJWA 4LA4A 3VKFA 4QUJA 5C5EA 1BROA 4L76A 3ND8A 2QEQA 3ZWOA 4BJHB 1H1TA 1E3MA 4TROA 1Q3TA 1CDEA 4P3OA 1XCGB 1W4BA 3B20A 1PQYA 3RYIB 6GPBA 5JBIA 1NNEA 5D84A 5JSYA 2W2MA 1X1TA 3Q0TA 3MCZA 1WZIA 1V1MB 2NV2B 3OSUA 4D0NA 2KHZA 1MD9A 1XDWA 3ZKAA 1ZD9A 3OTHA 4AMBA 3S40A 1DG1G 3A10A 1P9NA 2VOJA 1QC5A 1Y98A 3MPOA 3MXTA 3FOFC 2NXEA 3HXLA 4H35A 1USVA 3NOXA 5FUBA 1RM4A 1PT6A 2GM9A 4IDCA 3JASB 3W34A 3EQ9A 1VJDA 3JQ9A 5CAEA 1RWKA 1SBQA 4CTNA 1IQUA 3B1FA 3AERA 1B6SA 1CY8A 3VHRA 4LV8B 3U9LA 3O8RA 2LIPA 4JC5A 2IEDA 3VNAA 1JDZA 2JW5A 2GPSA 5E9JA 2C84A 3CRMA 2GBLC 3FXAA 3PDIB 4WASA 4I1VA 1E69A 7MDHA 4YIHA 2IV3A 4CTOA 1QGUA 3SQLA 5AICA 3HXPA 4MJXA 3D6HA 4PQFA 1NHWA 2GN9A 1OZGA 4EW3A 1RXWA 3E6AA 2EKDA 2ZBFA 3LDFA 5KSPA 2CJXA 2FWIA 4X95A 4DSNA 3L4JA 3EHDA 4EABA 1ULTA 3WRVA 5A4DA 5LZ9A 3DMYA 3LPDA 1EMDA 4K28A 4LGVA 2VJMA 5JSQA 2F4VB 1BJTA 3W5JA 3LBHA 1J1UA 2V45A 3N6RA 2FUCA 4JJ6A 3GYGA 4MLPA 1ZO8A 4NPHA 1JIKA 1NXPA 2X5KO 3PA6A 5ALFA 2FSHA 3W77A 4E4RA 1A7JA 5I8ZA 3JAWB 1ZGGA 1PBNA 3DEAA 2XE4A 3DOUA 4ZAYA 1KQNA 1J0DA 3SQMA 3UKOA 1ZR2A 5I9NA 3LQKA 4YWJA 3H2YA 5CXQA 1S2MA 1B4DA 4HBZA 4Y6GB 3TR5A 2QRHA 3G9XA 3OTIA 1EHIA 5TMBA 5TMDA 4H3KB 1SBZA 5U9CA 3A6DA 1I4DD 3SX4A 1YA4A 4D43A 2AZTA 1AHIA 3V7UA 5AUOB 4PLYA 3WS7A 1ZM2A 3KVYA 1ECPA 4ZDKA 1CD5A 2ZJ6A 3MLAA 3TVTA 4BJ6A 4B73A 5I7SA 1JBKA 3WNCA 2PKCA 4BTVA 1P3JA