4FOPA

Crystal structure of peptidyl-trna hydrolase from acinetobacter baumannii at 1.86 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 65
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4fopA00
4LWQA 4ZXPA 1RYBA 3NEAA 3TCKA 4QBKA 4JX9A 3TD6A 4DJJA 4YLYA 3VJRA 1RYMA 4FOTA 3P2JA 4QD3A 4P7BA 1RYNA 2PTHA 4OLJA 5IMBA 2Z2KA 2NAFA 2JRCA 2Z2IA 4QAJA 5IKEA 4JC4A 2Z2JA 4HOYA 3KK0A 5IVPA 5EKTA 4FNOA 3V2IA 4DHWA 4FOPA 3KJZA 4Z86A 4FYJA 5B6JA 2LGJA 2MJLA 4ERXA 4QT4A 3TD2A 4IKOA 3TCNA 4JWKA 3OFVA 4JY7A
chains in the Genus database with same CATH superfamily
4OXQA 3NP7A 1VKHA 5E3HA 1O95A 3THWB 3HWRA 3ZPXA 1ISFA 1JG7A 4X63A 1JX6A 2H4XA 3N2EA 1GL6A 3AFHA 4Q9IA 1U3TA 4OHZA 4PNEA 2HLHA 1EX9A 1PYOA 3L0OA 3VJMA 4K9LA 5AW1A 1UR5A 2FG5A 1Z6GA 2W2OA 4RHCA 3OQOA 1KPHA 3SIWA 4ZVMA 2C8KA 2IYTA 3RYIA 1Z0IA 4AO8A 3OBBA 4ZYZA 5JCPA 4CMEC 1BWRA 1L4YA 2RGUA 3DZJA 4XYBA 4G3XA 4ZEWA 2IEDA 2IITA 2H5IA 2WIGA 3RYHA 2GRAA 3ECCA 2DQSA 2LGJA 4UQOA 3GT3A 3CE9A 3D6FA 2BC9A 4JXZA 2FEWB 1DT5A 2J32A 3FUWA 3RSHA 4ALNA 1RLUA 2GHRA 1VKJA 2PD4A 1HH4A 2WWGA 3GIDA 1RRFA 3O95A 1FLVA 1MG0A 5AO9A 3PI6A 2SCUA 5F52A 2PLAA 5LMZA 2A57A 4TKVB 4Q1VA 2XLCA 3LHIA 2F8LA 4X60A 1AK9A 3B5EA 3IHWA 2CCJA 2HZ7A 5FBQB 3TDNA 4DLTA 2IS6A 3HKBA 1FK8A 1DWQA 1LGYA 1GD1O 1S3IA 2YWHA 1CEEA 1GSIA 4KVFA 3VVLA 2HJRA 2FSSA 1UJCA 4DUGA 3T1TA 4D5EA 1A2OA 5TGDA 3R40A 4NECA 5CA0A 5T7BA 3H5RA 2XKJE 1XYYA 2WWWA 2QLMA 5DEIA 5C51B 3OWOA 4RHYA 1NNI1 2HSEA 2RHOA 2WHQA 1ZRSA 1JR3E 3DLPX 5A4KA 2WTMA 4Y7DA 2KM1A 3EOAI 2GEUA 4BO6A 1PNRA 4MUGA 2WKRA 4JI0B 3EFEA 4OI0A 4IDFA 2PD6A 5GVRA 1S02A 1V16A 3EZYA 2EZ4A 4TLBA 3RIGA 3U4AA 1H5NA 1Q92A 1DFIA 4DSZA 5KB3A 4MQUA 4EM6A 1W8DA 1YAHA 2VKQA 4J9VA 5LQUA 3GPDG 4MA5A 1P1RA 4RE5A 5KX5A 2CJWB 3B5JA 1FRNA 4JXKA 1JAYA 2J07A 1B42A 3FMPB 4EHHA 5SV2A 3DMHA 3DB1A 4MUFA 3X1YA 1P3JA 4UTOA 4XW2A 1GXSA 3NDPA 5U4XA 3RWBA 5LNK6 2NWQA 2XUDA 2D74A 4UBLA 1Y8AA 2PR2A 1FS5A 1QCDA 5DX1A 3RDPA 4EGFA 4DCSA 1N77A 3KAJA 3D3WA 2QI9C 2PRSA 3DAHA 2DHEA 3ILHA 1PK7A 3PIDA 4LV5B 1KSFX 4MKGA 3MK31 2QU7A 2VJAA 1QWOA 1WHTA 1C0IA 3EIXA 4UEOA 5EI5A 1FU7A 3BHIA 1VLVA 3AHCA 1BMQA 3N2KA 1M0SA 5C1DA 1EH5A 4G37A 3FYDA 3HKCB 1TM4E 3BWXA 4IUDS 1QG2A 4LXQA 1EJ2A 4DMMA 5HBRA 5LNK1 1VPWA 4RFSA 4YBRA 1T9ZA 1BD3A 2E4XA 2V0CA 4QT0A 3O1JC 2I8CA 4BJ1A 3U9SA 4AB1A 5FQNA 3DWGA 2JF0A 1C4WA 3HDHA 4PC7A 3TFOA 4B6SA 1C7JA 2JI9A 2FR0A 5BV2P 2QTGA 3RSGA 4M22A 2UUOA 5TS3A 1SPBS 3IEXA 2MIIA 2G1KA 4QSHA 1NQ5A 2IYFA 3GLKA 3D59A 5FPTA 2E9SA 5ER9A 4DNXA 1U1EA 4QKQA 1H2HA 2HMWA 5CCXA 5T57A 4JWKA 1H93A 3D4PA 4Y9TA 2A59A 2XEXA 2XE4A 5HDQA 3B1JA 1JQ5A 2AQIA 3WQQA 4DT1A 2AI2A 2O8CA 5ESXA 5FFNA 2RAVA 1AOXA 4ENWA 5E38A 2GOYA 3RBZA 2LKCA 3IC5A 3G5MA 3SQLA 3TW6A 1ZKMA 2O0MA 3B12A 4XWYA 4J91A 3N3BC 4UUNA 3QMPA 2Q27A 2BAGA 2ZJZA 1VJDA 2FMKA 3DMDA 1HYQA 2I4RA 5JH7F 4KRXA 1ICEA 3D0KA 2VZ8A 1UMBB 3E3NA 2PXXA 3FPFA 4RY8A 1N2XA 1VBKA 4KGZA 3GXBA 1JAXA 5EGNA 4KH0A 2V6BA 1UKBA 4NBRA 4M1MA 2W37A 5AJHA 3AM3A 3N58A 4BFXA 1S9HA 4DHEA 4EJ6A 1Y6FA 3RC8A 1VE6A 2X7HA 3NBQA 3QYJA 4B6FA 5KNBH 2W2VA 2YFHA 1A9TA 3EXEA 3FW1A 1XROA 2WG0A 4S1NA 1II0A 5B58T 4OP2A 4Q9HA 4BKOA 1C1DA 1RQRA 3NYRA 2EP7A 9LDTA 5AW7A 2Z57A 1X1BA 1R5OA 1ZK3A 1LW7A 4RHEA 3LOQA 3TQQA 1KRHA 1E9AA 1JXQA 1P6XA 1VSVA 2NX2A 2CNNA 4MRPA 4QOFA 3BAFA 3AF2A 4R69A 3QNUA 1HTBA 2C92A 2HK6A 1OH8A 4B80A 4L74A 3RHZA 1NIJA 4B1FA 3HZRA 1Z07A 4TKUA 1AM4D 2D8AA 5IT4A 4S0XA 3R0JA 3HYCA 2H4ZA 1A8HA 5EMNA 1SZJG 2WHEA 3GK3A 4FDAA 3TLGB 2FZ5A 4G56A 1V3UA 1S8FA 2IEZA 2QRQA 4P6VF 4YRPA 1OFTA 2ID9A 4M0EA 4YBZA 3E9MA 3W1EA 2YICA 4N5NA 2FEMA 1KPGA 4OMDA 5COQA 5AUQA 3DEZA 3VHLB 1R9NA 4C0XA 2ZE7A 1ID8A 3TLMA 3V1MA 1RJEA 4G41A 3AW9A 3G1TA 1HGXA 3BRWD 2PCLA 1TZJA 1ULHA 5J2UF 3F46A 3K9NA 3D8RA 4X7MA 3JYNA 4B4UA 4X1IA 4MI3A 4Y2GA 4RF5A 4DAOA 1W5AA 3BMOA 4FMDB 1AMNA 2X4IA 3CH4B 4O08A 3ZVKA 2FPMA 2EKBA 3QJYA 4W6QA 3THXB 4G0MA 4UTZA 1SCUA 5HKOA 3UPUA 4DV1B 4D9JA 1TGYA 1TCBA 3V7YA 4F1WA 1WF6A 4PAMA 1Z2EA 1ECBA 3T7DA 4OOEA 1AF4A 1W4ZA 1Y48E 2HNBA 1JU9A 3KXLA 4MVJD 3OH8A 2GESA 2LPMA 5J5CA 4X64B 5IKMA 2I6GA 2G80A 3C3BA 4K05A 1JB9A 4L8FA 4RY2A 4LHSA 5FL7D 4CI9A 2IXGA 3FNBA 2VQ3A 1F6WA 2ZTUA 4A5OA 5CCBA 1ZG3A 1Y1TA 3V97A 4BBAA 4LN1A 3C2QA 3LYHA 5K8TA 2ZIGA 1V96A 1GM5A 2NAPA 1WZIA 4WXYB 1E6CA 4ESVA 2PGNA 3HU5A 4PLGA 2Z04A 4CM7A 4J49A 3KO8A 5T5QA 3RHTA 4GUAA 4U1RA 1GPBA 4JU8A 3L6DA 5AM5A 3QITA 3UB2A 4BUZA 1G5FA 1QMPA 5DTEA 1K27A 3CF0A 1PGQA 2P6PA 2WOOA 1MGPA 3BCSA 1JPJA 4H1HA 4C4RA 1ODKA 4HAWA 3V8BA 3AB3A 3HEBA 5E3JA 2RGEA 3SYNA 1FW6A 3HJFA 1UXOA 1ZMBA 2QUAA 3H42B 5FPKA 5FUXA 4MYUA 2GWHA 2C3PA 1A8QA 3AU9A 3KL4A 4N8EA 2FMHA 3NHLA 1CZHA 3Q7TA 4Q34A 3T4EA 2SNIE 1L7EA 3AWDA 4F2HA 4BLVA 1C29B 1H2AS 1J8QA 5JH7A 3UANA 2FR1A 2J0VA 3PFFA 4N49A 3WKAA 4UPDA 2YKGA 4ZV9A 4E14A 1G3RA 1NPDA 3DCNA 4G65A 4D9IA 1EFLA 1G8FA 3F67A 3LDUA 4O4IF 5IG2A 3CCBA 3DEKA 4JB3A 1WMEA 3D8TA 4AF8A 3JVEA 1U0BB 1JI3A 3RV3A 3AHFA 2OM2A 3C43A 3G2MA 5EC8A 4D81A 3CVVA 4J1NA 2X1HA 1PJQA 3RG2A 3RJ5A 5CLLA 2IPOA 4UHHA 4MA0A 1LFDB 1J56A 4KXWA 1I2AA 4KYVA 3WZMA 1Z39A 1I8TA 1SHTX 1VSBA 2O3JA 5EIEA 5IARA 2HMVA 4PQEA 3OQIB 2X5KO 4UHEA 4LHVA 5IEJA 2ERCA 2PANA 2OHIA 3EN0A 3B9RA 3MWEA 2YJNA 1RZVA 3AEUB 4Q1EA 1I51A 4D96A 2Z6UA 1E0DA 1UBTS 1OGJA 2CB9A 2E4VA 3IELA 3HYTA 1XDZA 2WPNA 3P9ZA 4IHJB 3DXYA 2GEBA 2VCYA 2ZETA 3CEHA 3P0FA 3AL3A 4NEQA 1ZVVA 2G9RA 2PL3A 1N6KA 3TZQA 1CUZA 3KV3O 3DKKA 4GXQA 5HZMA 1YV9A 1VMEA 1ORHA 1QRDA 3FPKA 3FWKA 1XD2A 4QULA 4R1PA 1U7ZA 3T5GA 4JJ6A 2JHCA 1D04A 3OZ7A 3RSCA 4HH4A 3ZLUA 1JS1X 5LQDA 3FWYA 2VHVA 1VJTA 3SXUA 1JFSA 1ZIXA 2EDCA 1YVPA 4UTRA 4TRNA 1QO7A 1USKA 3L41A 3S27A 1G2PA 4EY5A 1ZN7A 3EVAA 3AQ4A 3WL8A 1FMCA 1RQNA 4Q48A 2JI7A 1DQPA 1P8AA 1BNCA 3GHYA 4LV8B 4EVQA 1ZM9A 3D4NA 2G8LA 1KNQA 4Y9SA 3RIEA 3CSUA 1SOUA 1NF9A 2JBAB 1FY2A 4RLHA 4UFNA 1U0RA 1CT9A 4M55A 3OEEA 5AK4A 2WU4A 3OZSA 3F0TA 2YHIA 1G3IA 3QEMB 4GP9A 2OSBA 4DIOA 4DG5A 5C8YB 2P6RA 4PONA 5ALVA 4CEJA 1KL7A 1E59A 3I2YX 2CEAA 3THRA 3IMCA 1R1DA 1S8OA 1U6KA 3LBYA 3UV6A 221PA 3RHSA 5IT9A 3HYNA 4RE6A 3HK2A 4IDOA 4D3XA 1IJBA 3TQOA 2J3EA 1ZNZA 4JQOA 3CZPA 3L6RA 2V0GA 4KQ9A 1MRNA 1IZ7A 4B73A 1DC5A 3BDVA 4GXRA 1E69A 5K8UA 4RVDA 4LWPA 4OQFA 4QVIA 1Q1BA 4PSVA 3NT2A 3JQPA 3R6LA 4TL9A 3K16A 5DI3B 3Q9LA 5IAEA 4CNQA 3EQZA 2PDAA 4I50B 4OBEA 5JARA 4FFVA 4A8JA 1FUIA 3W8RA 3MRVA 4WK6A 1Y3DE 1B0AA 3IXMA 5THQA 4NCBA 3RSSA 1ETUA 1AO3A 3FCAA 3NB0A 3VAYA 1FX0B 1E32A 3V2IA 4LTMA 2HBZA 2I1WA 2Q4OA 4PHGA 3RAGA 1WY5A 1X7ZA 1BA2A 3LG2A 4W9RA 3C1OA 2DR0A 2YVQA 4XR9A 1YS2X 3L0SA 1W2WB 2R84A 3JPYA 5JHGB 5JFGA 5SZJA 2MYNA 2Q1TA 5BYJA 1HFWA 4C05A 3B48A 1T3TA 3EVEA 1NBHA 4URZR 1F4PA 1E2LA 1KJYA 5JCXA 1WM1A 1SVNA 1I30A 5JZ9A 5DP1A 1A9ZA 1J33A 3DO5A 4BEWA 1NR1A 2BR4A 4DEVA 1QWSA 4ALMA 4C0LA 3T3GA 3OP4A 1XDDA 1HTWA 1Y0BA 2PLFA 3DBOB 4GYKA 2XCUA 3SFVA 2ZSFA 2Q4RA 3WLIA 4TL6A 3HJGA 3DZ8A 4TQAA 3WGIA 1QF6A 4WFQA 3BK7A 4ZYTA 3FTFA 3I62A 4KR6A 3EF3A 1RJGA 3CNLA 3IBGA 1E2DA 5E0KB 1KO8A 3R20A 1YFJA 1Z5UA 2R6HA 3ZE0B 1RPAA 1G8KA 3KYCB 2F9LA 2WAXA 5F51A 1NI4A 2AA3A 2ZYRA 2PH7A 4FOLA 1X80A 1VPTA 3K1AB 1V7CA 3F6CA 3MCZA 5ECWA 1XLTC 1HEYA 5BMVB 4Y2JA 5L3VA 3NXSA 5AW5A 4ASUA 1LX7A 1W87A 1XWIA 2P2LA 5DBOA 5BSRA 3B51X 2AHRA 3RC1A 3CKMA 4B7CA 4YRAA 2PKXA 3BX1A 3C3DA 3L04A 1VL2A 2VCEA 3GEGA 4L3OA 4NFLA 1NAIA 2KLBA 1WSBA 4ZC8A 5H80A 3G6WA 5A0FA 1IJEA 4HSEA 3LSTA 3F2IA 4KJXA 3NRBA 5AKXA 5HDBB 3WIBA 4WESA 2B35A 3P27A 3ZLTA 4OO3A 3V1UA 1GQYA 4QUHA 4ZAVA 3RUEA 4DOMA 2VHCA 5BOSB 1YZHA 2X0FA 2YMLA 2ZS8A 1AVTA 3DWEX 4LHEA 4LY0A 4EG1A 1SXPA 3ICVA 3BG5A 3EMVA 1VBMA 1FYXA 3KPVA 3NPAA 4OH1A 4DDVA 3O4RA 3PC8A 4EELA 1UBCA 2VYVA 3LUKA 3OKPA 4N5DA 3K5WA 1V8ZA 3GJ4A 1SIBE 4J3FA 1MC8A 3QFCA 1PJ4A 3TR5A 1XK6A 2PRZA 3TZCA 4OMUA 2V0NA 3QVUA 3VZQA 3A9WA 4ES6A 4BECA 4RZXA 2WQZA 4B7XA 4E6EA 4N7RA 2ID8A 2WPDD 3GT4A 2P6MA 4ZC1A 4YY3B 1FSSA 2QN2A 4AZ3B 1QE3A 1XZIA 3PUHA 3LNTA 1E2IA 4RAOA 4CE6A 2O8BB 2H11A 4FT2A 1ZOSA 3QKRB 5BWCA 3O4IA 4AKIA 3VR3D 2J85A 4RK6A 1JPUA 5ALRA 2F17A 1YIOA 4KN6A 2GD6A 3IEKA 1S2OA 2R6R1 4D4MA 3WWOA 5CFLA 4EITA 3WNVA 2BFDA 1KDZA 5JV5A 4PGFA 2Q0HA 3TCKA 3REFA 5JPIA 1Z4QA 1AA9A 1NL3A 1ZNWA 3E1GA 1E1RD 3LBAA 3M4YA 2OHGA 3PWZA 4AECA 3GLIB 1IY2A 3HXQA 4C6RA 1EINA 1VHWA 1Z18A 1E7MA 1K92A 1KY2A 2VXYA 3T9CA 4MVJM 5JS6A 3WXMA 4HQFA 2XCSB 1AGNA 1OAOC 3UYKA 1I4LD 3R8FA 1TCVA 4G84A 4G24A 4WD3A 4WINA 3FHTA 1AKYA 2ZRBA 1WPXA 5JBNA 1N78A 3B3QA 1L8XA 1MB4A 2WM8A 4YP6A 3TL2A 4KWHA 2VYQA 5KOHA 4ZV4A 3Q3EA 2AFHA 3H2HA 5GJWC 1CY0A 1NQTA 2D2IA 2RH4A 3JATA 4H6PA 4PFQA 3RBXA 5C8XA 2OD9A 3A1WA 1Y5RA 4JDUA 4M1EA 3CGWA 2XI4A 3PRYA 1MFZA 2V7PA 2DTEA 2ZJAA 1EFVB 3PZRA 2OBYA 1X19A 1ZGCA 4IG4A 4KZKA 3AM1A 1XRLA 2ZI3A 3E61A 4KO3S 4PSKA 4OJKA 3NI2A 4H3KB 3OLXA 2VYNA 1GU1A 2GPTA 2FW7A 5NLLA 4YIKA 2CFRA 1KH2A 4Y7CA 2BGLA 3L7YA 4QXPA 5BVHB 2HJWA 1IEQA 2NZVG 3F3MA 1H1LB 3LY9A 4LSZA 1JBQA 4EKYA 3AKEA 1GV0A 3WLRA 2ZUFA 1IXZA 3FDJA 3Q1KA 5DIFA 1ZH0A 3PR2B 3AP2A 4YLGA 4HV4A 3JD2A 3ZX5A 4AZWA 3V4ZA 4IGFA 2ZRAA 3EB9A 5A2QA 4C7OB 3NGXA 1SXIA 3H84A 3KDAA 3WSTA 3ZY3A 1LSJA 1VP3A 3GMIA 1UEXC 4CMJA 4IGIA 3W3AD 2J45A 1B0PA 3AP1A 4W9NA 3E2IA 4RS4A 3ACDA 2QT0A 3CZ9A 3L4JA 4ZOLF 4V38A 1D0VA 2QGFA 4BNGA 3ZD7A 1ODJA 2P6UA 2BFBA 4R1NA 1XKLA 2B1RA 3KWLA 2DTXA 1YC5A 5JDCC 4HXGA 2V5VA 3ZXUB 1OVMA 3NIDB 4V0NA 2N46A 1YRWA 2Y9MB 4EO9A 4NBWA 3MS2A 1HURA 3PDUA 1RSZA 4IIGA 4OYHA 4DJ5X 3BWDD 4UHKA 2HK7A 2AR0A 4P2BA 1W44A 2LE0A 1ZWKA 4YTEA 3QRWA 1RCFA 2ONKA 1ECPA 1FXWF 1ENZA 1W96A 3KP1A 4MUJA 4OU4A 4UOEA 3GLGB 5I9SA 3F98A 4I9NA 5F77A 3BMQB 4IG9A 2WY2D 4I3HA 3IV6A 1KO4A 4POAA 1YKGA 2A5JA 1Z5NA 2PUBA 2PZBA 4GNRA 3E05A 1XAIA 3M6MD 4V0KA 5LMCA 1GA6A 3T3HA 2Q2VA 2VHYA 1P81A 3WK7A 3A9SA 1XB2A 3X1ZA 2V74B 4PGHA 4DDUA 3INYA 4NTZA 2GK3A 5BWOA 4GPEA 2Z5LA 1I9CA 3ZQKA 2VC2B 2ZTMA 2DY0A 3SI7A 1KZ1A 3GGOA 4F4DA 1DNPA 2HM7A 3TI7A 2PUGA 1FLDA 4HDSA 2DPXA 5ITVA 3D1JA 5LP6B 3B13B 2IE0A 2LNDA 2ZULA 3I04M 8ATCA 5HWSA 5D1HA 1NQUA 1HZZA 1QFMA 3U3JA 2ZATA 1Y6RA 2JLUA 5E8RA 1W4AA 1YI0A 2G5CA 2GZRA 2NU9B 3TRKA 3SYKA 3W2FA 4CL3A 2GA9A 2ZZKA 1K75A 5ILGA 2IRWA 5TJHA 1I5RA 3M1IA 1V35A 1QO0D 3ZDBA 1XKQA 4AJLA 1ICIA 1T5IA 3CZCA 3EGDB 4OCZA 4RADA 1JKFA 2GN1A 2HAEA 2HV9A 4K1XA 5FB3A 3B2EA 5FJJA 4J1QA 2X0DA 1T4DA 3TMKA 3ZN2A 1M5RA 1P72A 2OUIA 4N8DA 1B0ZA 2F00A 5BVGB 2FAXA 3KWMA 2IYNA 3OIYA 1FVXA 5F1KA 5T6BA 4H1UA 2LCQA 4P32A 3F5DA 4BVLA 5C37A 4OXXA 1MVNA 2DE0X 5DX8A 2YIMA 5E0OA 3VI3B 4Q1AA 4RTJA 2I65A 2YS7A 2I9PA 5EUMA 5LUAA 3I05A 1DX9A 1LUAA 2HDOA 3W04A 2GHQA 1J06A 1CTQA 1MD9A 3AKYA 3G0GA 4ZHQF 4QM6A 1E0SA 2QLJA 1LBIA 1IFXA 1I9GA 1VZ2A 3I09A 3OO1A 3T9DA 4CKCA 4Z4GA 2CD9A 5EZ5A 1E79A 1WULS 1YDMA 1Z7BA 4QREA 4X1KA 3IHKA 3WWCA 1KI9A 4UXJA 4MV1A 5ADUS 5KNBA 5TT1A 4AG3A 5JT1A 4HTFB 4ITVA 4KJZA 2CBZA 2OLJA 4UE3S 3TNLA 4ZJZA 2Z2YA 2FUEA 1AGRA 1N6OA 1CRWG 2RB4A 2Y76A 3SKXA 2P30A 3DBIA 3QVXA 4EWLA 3HM9A 3CHYA 2WQ6A 4DE5A 3RSQA 4ZOLA 3VKVA 3DTVD 3V4FA 1G98A 2PU7A 3KHTA 2JGDB 2GD2A 4XKJA 3V8PA 5CEJA 2YYZA 3C4JA 3C74A 3GEPA 3NHYA 2O2EA 4WKOA 1A04A 5B64A 3Q6NA 2BKEA 1C7QA 2XZOA 1M5TA 3OZIA 2HPAA 121PA 3S81A 1UQUA 2KHZA 2VJLA 2XE8A 2G07A 3NV9A 4PINA 3H5AA 4Q05A 1R0LA 3SE0A 4D1YA 1N2ZA 3FSJX 4ZEOA 2O48X 5AKEA 3L40A 4G8CA 3CVXA 3UCEA 1E66A 2C9OA 4JI8B 3O8DA 4XTCS 3SZGA 2OG1A 1ZHHA 1YR8A 5MDHA 2HTEA 2XWPA 3H17A 4NENA 1A69A 2I7TA 4PQRA 1K8ZB 3WMFA 2XB6A 3TB6A 2IPMA 5KWSA 4E4RA 5DHAA 4M1TA 2VDMB 5JDIC 1JAZA 3S3TA 2RSLA 3I4LA 1OKKA 3TVTA 5BW4A 4J6EA 4K8OA 5FEMA 1KBZA 5H3LA 1E9BA 3ROPA 3ZD8A 1KSJA 5DU2A 4PPNA 3OZBA 1E7SA 4WJZA 4UCQA 2EQBA 3VFDA 2WINI 5ITZA 4P58A 3RNLA 4ZMBA 1UKEA 1ULZA 1Z5ZA 3ZGOA 4XWTA 1ZM2A 2WJVA 1NJ6A 2IUSA 3P9YA 2FYTA 4JP5A 1WZCA 5JANA 1JECA 5SY4A 1S0UA 2XUGA 3OT1A 5I4BA 3CPSA 1EP9A 1N75A 1RVV1 2IDKA 2IHVA 2XA9A 1MB0A 2P27A 3RW9A 1UQTA 2JAUA 4ETMA 4HDMB 4V1CB 3LDFA 5T67A 1N5IA 4AMBA 1WB4A 3WNDA 3W5CA 4IWNA 4PR3A 3AL0C 1N92A 4LKRA 1MJNA 4KL8S 4B6OA 3ITEA 3L2OB 3V4PB 4NNPA 4WNIA 4ZA2A 1TCUA 4CFSA 1W0KA 3IJPA 4K9OA 1T0HB 3BJMA 4RENA 4UBKA 2A5DA 1ZD2P 2WU8A 4WZBB 1M67A 4YV1A 4MAFA 4P1ZA 5JE8A 2R8YA 1MR3F 3HDYA 3N8KA 4FS8A 2O0KA 4L1KA 4R3UC 5C18A 2Q9CA 1BCSB 1WQ1R 4KNYA 5U4QA 1V71A 2ZYDA 5KCZA 1IUNA 2E48A 1TPYA 1I10A 4RD3A 4WN9B 1XDBA 1EPUA 1OI4A 1P5JA 3K1ZA 4XUGB 2QV7A 5KREA 3W6UA 4TVSA 1MX9A 3FGNA 4E70A 3FPAA 1PG5A 2FFQA 2XB8A 4ZFNA 2NO4A 4H4DA 1NYRA 4J0HA 1BVUA 1PJ2A 4LDJA 1FL9A 1X7YA 4G1MB 1TK9A 1JLLB 2J48A 3C5WP 3KOOA 1K63A 3P9QA 4K8RB 5I51A 4NMXB 1V8FA 4XGQA 3DMTA 3FNRA 3N7UA 2OHHA 2CN1A 2G76A 2R00A 3OHPA 4P5DA 1LVHA 4ZHQA 4U7JA 4PZCA 1E2KA 3BXZA 2MSKA 4FQ8A 4JLDA 1Z2PX 1EYZA 5EVJA 5A0TA 3WGTA 4PS0A 3NALA 6CHYA 1Z8FA 2SECE 3EUEA 3QXJA 4L85A 5K8IA 4RMNA 2M1ZA 3FMOB 4FKBA 3ZXXA 4YYZA 3JR3A 4R1UA 4AUNA 1SIUA 5CK5A 3CRMA 1SHJA 3D8SA 3DDOA 4H17A 4OF4A 1MMFB 3N70A 3KFXA 2JK1A 3MNFA 4Q7KA 4EYOA 1VKNA 1PZNA 2I3GA 2WJHA 1BMFA 4BLPA 5TPWB 4RQAA 4DMHA 2BP7B 3A9TA 1SQ5A 3IH5A 1L4LA 3IIIA 1KAGA 3B7PA 3ZC3A 1SIWA 5AESA 4I0WB 3R9XB 3QBTA 1NTOA 4OP1A 2WOJA 4NI5A 3RFXA 4IH4A 2KB0A 1QUFA 2V7GA 4I8XA 1L4NA 1YQEA 3AY6A 4NNOA 5ALOA 1B6GA 1KJNA 1XMVA 1ZL2A 3T1HB 4PPQA 1GNVA 3QBJA 3QX9A 1GN8A 4K1LA 4LA4A 1ZD4A 4FYMA 4QUDA 3PCRB 1H23A 5FHQA 2HNAA 1WVMA 1U8YA 1AK1A 1CF2O 3FKSA 1EM6A 1M2VB 3N8HA 4Z7JA 2V9CA 2RJNA 3QNWA 3AIKA 4IJKA 4D6XA 5KSZA 2ROQA 2YJZA 3EZ9A 2ONYA 2QX8A 4GYYA 5AI4A 4I1YA 1DAEA 2W11A 2GN4A 4WFKA 1IEWA 3HB5X 3KUCA 4L15A 1W5FA 2B2CA 4WBXC 1KZ6A 4WASA 1EFPB 1SUAA 1JJIA 4NAUA 3QU4A 3K0FB 5DASA 2NZXA 2WLSA 4ZQGA 2QY6A 4KGXA 2ZRNA 3KKLA 5AVOA 1C8KA 3B53X 3MFYA 1CQJB 2JDIA 3SVTA 1ID1A 1IDN1 3QE3A 1P1HA 3UH1A 4ZDKA 4AQYB 5B58C 2QG9A 2WD9A 4MVXA 5DBFA 2Q9UA 1BA3A 2HSDA 4D7AA 1ESMA 1X8KA 3L5OA 5BO5A 4ZVSA 5IT5A 2GPAA 4PX3A 3ZV4A 4DEYA 1CNFA 3W9SA 5ELLA 1NJ8A 2I29A 1LJ8A 5F33A 5FBLB 5C1OA 2QLBA 1Y4SA 4LPKA 2EG9A 2IVZA 3FGOA 4OIFA 2FMXA 5C1IA 4XWOA 3C24A 4PGAA 4G0VA 3KQUA 3NEAA 4C21A 1QIDA 4QECA 1QHHA 3NDJA 4MWCA 4YAOA 3VSEA 4XX0A 1JHMA 3TG8A 2DFPA 4ARVA 1J7JA 1PI3A 4R9NA 1E2HA 1E0KA 3H97A 4R2JA 3SYRA 1QCZA 2BEVB 4YVFA 3DZBA 4YQZA 4JOSA 4I4CA 3ANNA 1PX0A 2KJQA 1XRRA 3KQVA 4K9NA 3HGQA 2TMDA 3O38A 1WPRA 2P5UA 2HMTA 2J9FB 3HR7A 1Q44A 1YI1A 5LKRA 3VYVA 1SIOA 1NI3A 1T1IA 2RHLA 3OZAA 2WIKA 5K20A 4LF4B 4TUYB 4D4HA 3PFBA 2VJQA 1QDLB 3SBDA 4JBXA 5K0GA 2FE1A 3CN9A 3VV3A 2R1TA 1EM8B 4M37A 4DIKA 2C1EA 2WAMA 4HAOA 4E5YA 3PQ6A 4OUKX 1DQNA 5E2BA 2OXEA 3JW8A 3HBNA 5ICFA 4LF6B 3KZOA 3IMEA 2E87A 2PMWB 4PBTA 1S6YA 3BSSA 5I7AA 4C06A 3DF9A 3O94A 1XXLA 1P2DA 4KQCA 3D3EA 2GN9A 1J9EA 4E7OA 1GZ4A 4FGLA 4LZWA 2OCPA 4AYTA 4B6EA 3PF8A 4GMFA 3CJQA 3HCWA 2VHUA 4KLAA 1V6AA 4QNMA 4XVHA 4HMOA 3SZUA 1GEEA 3WIDA 3LL4A 3R3WA 4KAJA 3HXOA 4XQEA 1HQCA 4B3TB 3N5CA 4B87A 3LLUA 3WHLA 1MDBA 2BN4A 3T1NA 5IABA 1RACA 5FPPA 3C5HA 5FWDA 4BNVA 4ZGBA 1I6LA 2VKTA 2WAYA 4UDNA 2QRLA 2V54A 3VH2A 3UJ9A 1KETA 5KTOA 2B37A 4NJEB 3WBKA 4YLYA 2QAGC 5DXJA 5CLQA 3WVNA 5H02A 3M1LA 3VH4A 2PXHA 5ETJA 1CUIA 4BRSA 4DM3A 2PL9A 2H1OA 1I2ZA 1A2KC 4WQMA 1X70A 1XJQA 4XSGA 3VSDA 1DSSG 3PF9A 1ZH2A 4QBHA 4FILA 4DB2A 2JH8A 1OXMA 2GCIA 3GV0A 1UAYA 2F43B 3PUJA 1A4XA 2QTVA 1PR0A 1FU4A 1TTHA 1M6VA 2R62A 2TSYB 3IVAA 3L0ZA 3OTQA 4HQRA 3WB1A 5AVUA 5K4GA 3HXKA 1PGJA 4GAEA 3P19A 3MAGA 1PVDA 2AXNA 3K09A 5IWCA 3NHFA 2J5BA 3GHHA 4XQ0A 4IIBA 5DGIA 3V6LA 3EVDA 4C87A 5CITA 1Y7TA 3IOCA 4KXFB 3S2YA 2C1XA 2QIOA 2YYYA 3R7FA 1CBUA 3U40A 3VYTB 1AG9A 2VRCD 3IA2A 2ECOA 2C95A 1E20A 3Q98A 4J8PA 4KQ1A 5ALZA 4YRCA 3H5WA 1VLMA 3TE6A 3O21A 4BQQA 3OX2A 1ZGAA 3FUUA 2C2XA 1CUBA 1EQAA 3K0SA 2HDNB 4JBWA 2P9GA 2PM8A 2W2MA 2C4HA 4IM7A 1SKUA 5CNKA 3LWBA 3R77A 1UBMS 4EFMA 5CB4F 3UG6A 1ZJ6A 3L93A 4L95C 3EEFA 3NNSA 3A6HA 1LNQA 1ZW6A 4L2IA 4O4JB 3IGFA 2QLNA 4IQ4A 3FOFC 2J3LA 3ZVRA 1YR6A 2DWUA 2N47A 4TYMA 2NYAA 5DYGA 5JVDA 4ZRNA 4H0CA 4ZDWA 2QM3A 5LA6B 3DZCA 1D0IA 3IAFA 2ZRFA 3LRTA 5C2JB 2B5OA 3WBFA 5T3YA 2VPWA 1JA9A 2OAQ1 3QVKA 2A1UB 2PEZA 1XA0A 2VPXA 4M8SA 1NXSA 4KQEA 1FDOA 1GY8A 3WRYC 1R10A 1QE0A 2OP0A 4LNUA 2DX7A 2O8FA 2NYRA 1YZTA 1FP7A 1WSAA 3V1TC 2J6CA 3HP1A 2H1IA 5D84A 3JD4A 1GCAA 3QE2A 3RPEA 4GMGA 1G64A 3QPDA 1XZ8A 2BM9A 3PTAA 4ZN6A 4KQMA 4FFPA 4E5KA 2DF8A 4QVGA 1OB5A 1H4TA 1E3EA 2GHTA 2GUGA 3FD8A 1U7DA 4K2HA 3FIUA 1ZH4A 3ELWA 1YZ3A 3AERA 2DWOA 2F8MA 3HHPA 4MHTA 4LJ7A 2JIZD 4RESA 5AWFC 3RFTA 3TTTA 2XVXA 5IULC 2FOIA 4LYDA 2ADFA 1ANKA 4RPJA 3OQVA 3EZNA 3Q0IA 4BUJA 5H9VA 3BF8A 4EENA 1RKBA 3O1LA 4DBLC 3G8AA 1LSOA 2B1QA 3H5TA 1JHPA 5JJBA 1N2BA 3Q7EA 3C0KA 1KI1A 1UXKA 4MV9A 2BY4A 2HXYA 4Y9RA 3QYFA 4EDHA 1ODSA 1STOA 4F46A 5BN3B 5IUNC 5TV2A 2F48A 3MJHA 4XIGS 3U39A 1VHQA 1B73A 2W7TA 3G3EA 2NO5A 4KXQA 3RRJA 4C1NA 2D5AA 5HSGA 3SXPA 2YWEA 4NP6A 1X1RA 4ARSA 3ADPA 3KTOA 2JI8A 2VTKA 2NTNA 3ORSA 5H59A 3KIPA 1D2GA 3OPVA 3H75A 1YMVA 4G1UC 4JR0A 2MSWA 3B8HA 2NOAA 2P8JA 2PN1A 4YCMA 5IM4F 1L4UA 2QTCA 1RIFA 1DXOA 1L7MA 3KR0A 2QP9X 1XZHA 2W2XA 3RC3A 2BFPA 3M82A 4UNSA 4D9GA 3U6KA 5K3CA 1L7OA 5C9ZA 1NVMB 3UWPA 2QT9A 2XDQA 1NDUA 4BQNA 3NDIA 4O4HF 2XXAB 3E9YA 3JAKA 3UG7A 4FBMA 1ST2A 4LNAA 1U3WA 2YWBA 4PN7A 4RPGA 3TW0A 4HAZA 5FYQA 1YULA 3DULA 4OXRA 1E62A 1FFCA 3HL0A 1ABEA 3LV8A 4LYEA 2IBMA 4O6VA 3S2FA 1EESA 4HLUC 3K53A 4URVR 1PZFA 4RZSA 2ADMA 1E9VA 2PVCA 3M6LA 4LZPA 2OBNA 3OUTA 5EERA 3LC2O 1BH6A 5AHXA 3LTEA 2LTAA 4R7TA 4MV8A 1AS0A 4Q3CA 4F21A 2ZRKA 4ILEA 2O2HA 1YMUA 2QGZA 2J4DA 3NIFB 2VTDA 2WICA 1NBIA 4WEQA 4C4YA 3WS7A 4F8YA 3QU2A 4D99A 4TPKA 3WICA 4Q7EA 4Y2UA 3CX7A 3B7WA 1KDRA 1Z25A 2W6IA 2HCRA 3EVGA 3FIJA 5A7HA 2F64A 1MB2A 4I9FA 3UOGA 2VDUE 5B3LA 5K8VA 3GFBA 3UGTA 3C1UA 1X3SA 1E5QA 2ID7A 2OBMA 1UDRA 4UC0A 3H1FA 4TTSA 5D01A 4BATA 2HD4A 4EG4A 4BRUA 1WXHA 1XL0A 2HW8A 2GA8A 4UAGA 3SP1A 2GEJA 2Q2QA 1FLAA 2RC6A 1XA3A 3BJIC 1Q22A 5E1MA 1RHQA 2ZWPA 3I9MA 5JUWA 4H7PA 5DSZA 3HLYA 5HQ3A 1SXQA 5HBGA 3U7HB 3FUVA 1U3CA 2ZYSA 1SKAA 3ROMA 1THMA 1WF3A 1N2IA 2VPTA 4Q4JA 3NBAA 4ZT3A 3N59A 4MK4A 4CUKA 1N4AA 2W2PA 2YDYA 3F5MA 3LIPA 3KE9A 1SCQA 2P9ZA 4X0EA 3UUEA 1LFAA 1S3GA 4OQNA 2W6JD 3PI7A 3QVGA 4TVKA 4IIEA 5G3ZA 4DR3B 2XRMA 3UAXA 3EZ2A 1ZJJA 2PMKA 4J90A 4Y98A 1TYBE 2R6JA 3KBOA 2IZOA 3IKTA 3O4JA 1MCZA 2GSWA 2W98A 2I1LA 3LPNA 1RBQA 2YJ4A 1RI5A 3MA0A 3MUNA 4M86A 4ALIA 5A5FA 3GEDA 3ADKA 3HZHA 4MLDA 1R5BA 2O6LA 3BOSA 3C3CA 2ZSUA 4UNIA 3RVPA 2VK4A 2W2LD 1J8FA 1XZNA 3MJDA 4NBVA 4IDHA 1UMCB 3MINB 2VXOA 3NRJA 3VJKA 2I4NA 3KHKA 3WRXA 4IS3A 3OUUA 2ZYVX 4U9UA 3IXLA 5KYXA 1TW3A 3VHRA 3WGMA 2BZ1A 4L3WA 1K1EA 2CE2X 2ZIFA 4I1RA 4YH1A 4A0QA 3HYRA 1X7WA 1DO8A 1H2WA 2JBHA 1S2LA 4ZDIA 2QB5A 5CCEA 3DNMA 4US2R 4CEIB 3PL1A 3QHPA 5HOEA 2PV0A 1GHTA 3KPYA 3TSYA 4K9MA 4XWGA 3S1LA 3S2IA 1OXTA 4L9WA 1GTZA 4EP1A 1JDJA 5B30A 2PYDA 1FDVA 3KTAA 1D4FA 4INPA 3ND8A 4G5YA 2EFJA 5IM4A 1O4WA 1N25A 5TVGA 4NU6A 5FWAA 2GBFA 1DBPA 1FRFS 1EP2B 1TUGA 2FR8A 4RSRA 3IDOA 2ECKA 2I91A 2Y0PA 5LVAA 1R0KA 2I7DA 4S1WA 5P21A 4FYXA 3R3JA 1NPTO 4F9FA 1PJTA 1E3WA 3CR3C 4R8VA 3TZ6A 1LWOA 2X5XA 3SM3A 2XPCA 4O4HA 4RDCA 2G9NA 3GZNB 2NPOA 3TZHA 1JLMA 4A0RA 1B3BA 5FJIA 3NBMA 4MLZA 4FFRA 5IN4A 1YVUA 2H06A 3VNRA 2LDBA 3Q15C 4N0EA 3ZD9A 2QX4A 1Z13A 3KJIA 5AJTA 4KR0A 4YUVA 1SUEA 2JH3A 2GTHA 4UASA 3TR0A 3UHPA 5PGMA 1MJFA 2MINA 3TTVA 2CB0A 5DJ5A 5M34A 4KMOA 4W82A 1PFVA 1UINA 2QRMA 2GZDA 5LFAA 4IDNA 1VJCA 2VNSA 2PYZA 3VTKA 3ABZA 4R68A 3ROTA 5HRAA 5FV4A 1ZD5A 4F38A 5E9AA 3ZDDA 4U6SA 2R8ZA 3GMSA 1R50A 4FMCB 3DT8A 4GBMA 3ZBQA 4E15A 4AJNA 1Y4UA 1XELA 3GGSA 1FDWA 2B36A 1H94A 3WLEA 3G8BA 4D9FA 3T7SA 1AKTA 4WXEA 3UAVA 1W36D 2QTTA 5DRYA 2VSNA 2N75A 5G02A 1P2TA 2FRXA 3D7SA 1T1JA 3AJ8A 1IHYA 1Y82A 1XG5A 3E53A 3N0TA 3ORQA 2DUMA 4L4UA 4PVDA 2XOKA 3MS4A 1CG6A 3C70A 2HMAA 2YIDA 3IO5A 2FF7A 2ECQA 2R65A 3AHJA 2I6XA 3GPBA 4XWKA 4TRRA 4CFYA 3DPSA 2JFUA 2VXBA 1NXXA 3DTVB 3MBKA 1YE5A 4X20B 4G07A 4C4AA 4ZI7F 3AF0A 3ZH2A 2YUIA 1JRLA 2OCYC 2P68A 3HJUA 4RPHA 3IEIA 3WRWA 5LWQA 3D6MA 2FN3A 3CSDA 1UAGA 1UFVA 3U19A 1TYCA 5EMJA 5LMUB 1NY6A 1TFRA 2BTQB 2HCJB 1ACMA 3TW8B 3EGXB 3BH0A 1DO2A 1JR4A 3KDSE 1KEEA 1I32A 4UOZA 4ALLA 3V8MA 4XYLA 4EPYA 1CUDA 4CCWA 5CXSA 5C8DA 5CXQA 4CLEA 4LXUA 1DCTA 3TJRA 5DNYB 1TZMA 3NCTA 1DKUA 1GRQA 1NSTA 2YINC 3AFOA 1PJBA 3CZ5A 3WNBA 4X3OA 1S2DA 1DCKA 3BBLA 4G26A 5FAKA 4QPCA 2D0DA 2HUNA 3BL8A 3M0EA 1RQ2A 1XZJA 2BGRA 4F9TA 4N5LA 1EZ1A 4BNIA 3SJAA 4LZLA 1XKXA 4DLZA 4HGOA 3MB5A 1KMQA 1JKXA 2H2WA 1ZH6A 2WEKA 5K1ZA 4Q4HA 5AKLA 3WGZA 5KYUB 1ATIA 1MN6A 1IMOA 5F4BA 3V8RA 4ND7A 1K5HA 3NUGA 4KX5A 2WB2A 5J9FA 2XMRA 5F9HA 3R7WB 4KFUA 5FWXA 1J49A 4R0VA 1IN8A 4CWAA 2XGSA 5AVTA 2ZKLA 1K2WA 4WSOA 1GUDA 1H4VB 3X0DA 4JWTA 4CMCA 5FYDA 2YZ2A 1GN9A 5EHGA 2P7HA 2W0MA 3IQEA 2QZ4A 2QN9A 2QVYX 4A10A 2WTNA 4XSVA 2APJA 1EHYA 3ETHA 3P2KA 5FCDA 1E1CA 1R7RA 2GBGA 3R2JA 5AW9A 2JCSA 4YI3A 5EL0A 1Y3HA 5AM0A 4QEDA 2CWDA 4PGGA 5CDHA 2DBZA 3KQSA 2CFOA 2Q1UA 3AEQB 3KAKA 2V03A 4YAIA 3FAKA 1MG5A 3RVJA 5JAQA 1E1DA 1PO7A 3X2EA 1F8YA 4Q9JA 1EUDB 2PKQO 1W75A 2ZCUA 2G3YA 4IW3B 1OLXB 2ALJA 1I14A 3ZKWA 4TWJA 1ILEA 1ULBA 3RE1A 1RM4A 1IULA 1YS6A 3OFNA 4FD2A 4HVAA 1WO8A 4M9UA 2GCOB 5EXEA 4CKBA 2DSTA 4M6WA 2XNCA 4MDHA 2UKDA 4W6ZA 4MCHA 1KOLA 2X0IA 3K72B 4FHZA 4FE4A 4KQ2A 3I61A 2RIPA 2QN6A 3TVYA 1U8XX 1FTSA 1I33A 3R5TA 2G6BA 1BOOA 5HOQA 2QMOA 4W7IA 3GLHA 3HCEA 1E2FA 1KQOA 3AIIA 1EK5A 4M60A 2JCYA 4ZZ2A 2VUHB 1BDHA 1QK5A 2WFMA 4GL2A 1CHNA 1SM4A 1B7GO 4WZAB 2OHFA 3ADOA 3LUBA 1KDOA 3ZNOA 3OCCA 5AVJA 2JLXA 1QV9A 3C3PA 1K08A 1I0ZA 4LKOA 5IFLA 1JSCA 2OOSA 3OT4A 5K6TA 3BE5A 1CEQA 4UMFA 3TNDA 5JQGF 3R6DA 1VBNA 3D6VA 2FUKA 1NIPA 1ODIA 4NKRA 4HEQA 4GIBA 1ESDA 1NBMD 4LTNA 2WTBA 4BGVA 1GRRA 4FFSA 3ZWCA 2O8EA 1Z3CA 3RCBA 1ECCA 1R88A 1P5FA 2R8XA 4IDAA 3VR4D 3A0RB 3Q1LA 1ESNA 4CQMD 4QJIA 4P0PB 1AURA 4ZI7A 5AJXA 1Z2CA 4P5EA 1TRHA 1BKSB 3LBFA 1SD5A 2D59A 2ZPTX 3EXAA 4REQB 3ZY4A 2I54A 2FPPB 4Y9DA 4B45A 4NOMA 5AQ1A 2C0QA 2VWQA 3AM5A 4HUQA 5K0TA 4RZ3A 2Z8YA 4TWZA 5EMHA 3R75A 1AUOA 4MVWA 3VNUA 1EU1A 1FS6A 2A0UA 3ZHXA 1YZNA 3EVNA 3R3SA 4ND8A 2J5KA 2H00A 1D2EA 3LW7A 1YVEI 3PNVA 3PPVA 1QH1B 1TEVA 2I2XB 2H07A 2H2FA 1PJSA 1U8UA 4NOLA 1HLFA 4YRRA 3HA3A 2PUFA 3RG8A 2RAPA 4MV0A 4KH1A 3K94A 2IP2A 2ZROA 5LQAA 1X1AA 5IF9A 2FETA 5L95A 3IMFA 4C6HA 3PXUA 4DR1B 4ZOBA 4CQNA 1V26A 5A03A 3EDMA 1DXHA 1G17A 2H8GA 2P1ZA 1F5NA 1M3SA 1NVVQ 1T5OA 1YRQA 3DHWC 4AXXA 4ZK2A 4DCNA 1C7FA 3RFUA 1Y8CA 2FMFA 4MGHA 5LQNA 4KKVA 5AM2A 3R3HA 4HS4A 1UP6A 3WJ7A 1SPXA 2HLDD 4HXYA 2QF7A 4OKIA 4FYPA 3RVKA 2R8EA 1Y5IA 3RS3A 1Z16A 4G0WA 3O4GA 4FOTA 4F97A 2FFAA 2RGXA 4RMHA 1RYYA 3ZCTA 4WL0A 2D1SA 1JKIA 3JYOA 3D6AA 1M1YB 1JE0A 3HMQA 4CLXA 4HDKB 2IQ5A 1E2PA 1P74A 3ZDYB 1EJBA 1RWBA 2FMUA 1T6XA 3E0XA 3O91A 1V5EA 4KGVA 1OFUX 2FPLA 4LMAA 4RPLA 3AOEC 2PZLA 3S44A 2OAGA 1LXCA 1Z73A 1ADCA 3UENA 1PEKE 1NW6A 1UMKA 4Q9DA 4LOJA 4WMLA 2BMDA 1CQIB 5ALWA 2OHVA 4RKRA 2R47A 2XCQA 2HA4A 3EBPA 1UKCA 1Q1AA 1YZQA 3KT0A 4GMHA 4MKRA 1KYIA 4PC2A 1PJ3A 3KQPA 4XDHA 3T94A 1MB3A 1VKRA 1SO8A 3JVVA 1DWUA 1O97D 2DFNA 4LYYA 2AN9A 1J25A 2Y92A 3U3KA 4D92A 2XODA 2QMEA 1X1QA 4NFHA 4EHFA 3BHMA 5AVKA 2IVFA 4RZIA 1EIWA 1WDWB 3GCGA 3O2NA 2OZLA 2TMGA 3KKKA 1H0HA 3I1IA 3LHFA 5D3KA 2LZ0A 3M9XA 1QH8A 2O2IA 4QBFA 4LJ5A 4RD0A 4FSHA 1WV1A 4BAUA 3C6YA 2JRCA 3L8HA 3TUJC 3UF0A 2P2DA 1GPDG 4OY3A 3SY8A 5C7OO 1U2ZA 2KBFA 4DIDA 4MEAA 1FSPA 3DGFC 4DDWA 3GLFE 1N5KA 1HLDA 3M4JA 3ZJTA 4Y2XA 2XQJA 1REQB 3CUKA 4JROA 4YDHB 3K9WA 3U7JA 3VTAA 5AKKA 4Z7QB 5JQGA 3C8HA 2X23A 1CUVA 3HZOA 3TCNA 4EG7A 1YI8A 1LBTA 4JJ4A 2I1QA 3FGPA 3TRDA 1RJDA 2BEJA 5HR5A 3AUYA 3V1KA 4GZ6A 1GA1A 2FRVA 5J2UA 1NMXA 5JMTA 1RRKA 4R84A 5ITSA 3LX4A 3QENA 1QIEA 1UKYA 1XZKA 4I1VA 4Q12A 2AVNA 3ZS9A 3K5HA 1BVYF 3WFJA 2FGKA 2B61A 5CVVA 1QHIA 1KI3A 1CS0B 5SZKB 3AP3A 1NU8A 1THTA 2QSYA 4XUEA 5CPFA 1CUJA 1QB7A 2JRLA 5F3DA 3AF6A 1DDOA 5IZCA 2IEYA 4X7PA 2H2AA 3C8MA 4BO8A 1NW3A 1XOIA 4FR5A 1ZITA 3AEZA 2QG4A 3CJRA 2EGGA 3KLOA 4ESHA 2J5RA 4RD6A 2JIQA 2IUTA 3ROGA 4LS3A 1OW3B 3LF2A 1UMBA 3RYTC 4TLMB 2ZAOA 3U3RA 5B1EA 2AZDA 1SN7A 4QUJA 4CCSA 3PGA1 4I6GA 3PV0A 4M4SA 2MYTA 2QG6A 3CLSD 1LS6A 1W5TA 4DQKA 1A5ZA 3L0IB 2VDRB 3IAUA 4XM2A 3AX6A 3TD6A 3WB0A 3KYDA 4F7DA 2JLVA 1TU0A 1WZ2A 1ORTA 4HKTA 1L9KA 1ZSYA 2CFSA 3CEPB 4WADA 4M7RA 5CGZA 3M6AA 3UN1A 2XZTA 2YN0A 5B2EA 3PRHA 5JJ5A 1F4LA 3BL6A 2G04A 1BQEA 5IU6A 4D3YA 1QGUB 3LHKA 1RAEA 1JR3D 2IH4A 3KKQA 5BQOA 4KYUA 1IWBB 1D2NA 2CV0A 2FQXA 3FPHA 2ZJ2A 3EBLA 1EGMB 4BZQA 4IAOA 1H8EA 3GRCA 1U9YA 4X8OA 3W2EA 1RLTA 4FGZA 4FC6A 4LZNA 4Y6OA 1L5LA 4ZD6A 4C76A 1BSVA 2ZCVA 4HATA 2RH9B 4INZA 2H29A 4MRRA 3GZTB 2X86A 4RD4A 5KS2A 3SXJA 1MABB 3TLGA 1UDAA 4M8NE 5A3VA 2I6UA 2RFLA 3KT8A 3UCFA 2VBFA 4FFDA 5F5LA 2QKYA 3G2HA 3F8SA 2O8DB 1DKPA 4L73A 2ATXA 3EWNA 4CIYA 3THYB 2ON6A 4RHTA 3P2MA 4BNMA 3VHQA 4U2FA 3O84A 4DCPA 2D3WA 4M1YA 5A62A 4JA0A 2J33A 4KDCA 4MW2A 1XZCA 2OPBA 2PIAA 3PSAA 4RGYA 4UCWA 1N2CB 5GONF 1KVSA 1OBHA 1TU4A 1P4SA 4XDYA 3SDZA 2CMKA 2FOXA 3DBRB 4E08A 2V7TA 2EP5A 4AVYA 3AVTA 3GLFA 2G0AA 2QNRA 4MPRA 1KYTA 1LI4A 1NYLA 4CDNA 3F4KA 3WRVA 4L8WB 4BNJA 3JARB 4QDOA 1GKLA 3T15A 2JATA 3FF1A 1P61B 3W2TA 5D6NA 2OXRA 1GGJA 2WF6A 3ERCA 2OQ2A 2XSZD 3K15A 1GPYA 1N8KA 3KJXA 4F3NA 2JA2A 1N5OX 1K6JA 2FV8A 2ZXEA 2AQKA 4Q4AB 2Q1YA 4EPRA 4EL0A 3MZ0A 4MW1A 4JUCA 5BSEA 5AKHA 1YCFA 2HMYB 3OLWA 3DQZA 5CW1A 5BNFA 3ZI7A 3HY3A 3IUQA 1XZDA 2H1FA 3PFHA 2J7PA 3IAXA 4EA8A 3WV5A 4L28A 4CM8A 4B3GA 2V96A 2B1JA 4IXDA 3U0BA 3ES9A 1KJJA 2QPAA 3ZLBA 1LDMA 1OF1A 4TMTA 5CK4A 1ZL0A 4DA9A 4EX7A 5ALUA 4NDAA 2QSJA 4JLKA 2FWMX 3GLQA 2AFIB 2H4JA 2PWBA 5CB6A 8GPBA 3UT5B 2X41A 2XUJA 3E82A 2IEBA 2VUTA 2XX3A 1C8VB 3BHNA 4RVOA 4PZPA 3VQTA 2A9OA 4KN8A 2IUUA 3UGKA 4EG6A 2WYUA 2VDPB 3DDNA 3KOZA 5KJ6A 3E5NA 2HV8A 3RREA 1SOWA 4FD3A 4MGZR 3V8VA 3ZJVA 1RP7A 2J9XB 3HJBA 3K31A 4MGIR 4OIMA 4UW9A 2ZRJA 3ZXYA 4C6TB 3BAZA 4D8WA 5KSWB 3RADC 1B3RA 3O8QA 3EXHC 3HA5A 3GUHA 3OZWA 4INOA 4NK5A 4E5VA 3K70C 1B15A 2B0CA 3GARA 1RPJA 2PKCA 4KUHA 3S2SA 4W9MC 1F4VA 1KYYA 2TRSB 2B4AA 4NK4A 5HFJA 4BBJA 1SBIA 4ZOEA 3NX4A 3EWSA 2PUEA 1VMKA 1Z74A 3AF1A 3NJ4A 1IHXA 4F45A 2IZ7A 4TVBA 4Z0HO 1X74A 1XTKA 4F2PA 2XV1A 3MC1A 2QE7D 3MUFA 1YOVA 4ZCMA 2BGWA 4RXUA 3NANA 1CVIA 2Z98A 2G67A 2EL7A 3BORA 3Q3GE 4GXNA 2WRZA 1BX1A 3KD3A 3OD1A 2BRUC 2RBKA 1H85A 5K0LA 1EDZA 4P5PA 1USIA 4H7HA 3GGCA 5B6JA 4HUTA 1Q14A 3HN2A 3AO0B 4GRAA 5EKXA 3S1AB 2RGWA 1NVWQ 4OOFA 3HVRA 3IBSA 4FYHA 4I1SA 1SK8A 4G5OA 4DY4A 4LX0A 3EUFA 1Y5LA 4N12A 1JQLB 1NRXA 2EYQA 2OTCA 1A9QA 1C80A 3M5DA 2BTEA 1T0JB 2E49A 4F3CA 1GDTA 5IYZF 4OHKA 4K6MA 5DVZA 1MOZA 3MF4A 4IHJA 3K0BA 2X6QA 4BO7A 2VBGA 1KMMA 2BGTA 1K4MA 3AEXA 3BIOA 4PM4A 1CXZA 1ZRNA 2EFDB 2PX0A 1TZ2A 1WHSA 2Q7XA 3GFRA 4G0QA 2ZRDA 1RRPA 3G59A 1VPDA 1OH7A 3P4YA 3F6RA 4UZSA 1A88A 3SWWA 5CYGA 4GI2A 4P0QB 1KAHA 3DOFA 2CVFA 5BWNA 2YZKA 1F7VA 3EE6A 1G9SA 3LC1O 4W5TA 4F86A 2HI0A 4QBKA 3QKWA 3K30A 3UGQA 2ZWVA 5HK8A 2QD2A 5DF1A 2R60A 4RDXA 4E12A 5DMXA 4PZLA 3QLVC 3FVQA 3RAEC 3AJ9A 4NU5A 4H3VA 3K7EA 3QWBA 1XCLA 4R8RA 3T7KA 3WBJA 1NSFA 2WMNB 2JBAA 5ALGA 2IIVA 1UKAA 3Q40A 4GW3A 1E3SA 4O2AF 2FZGA 1W4BA 1CW2B 4TXJA 4D02A 1R9GA 4FNMA 3RC7A 2WMDA 4W5JA 5KJCA 1JG2A 4MQBA 1KHHA 2BSQA 1NOIA 3NTRA 1XMJA 1IIRA 1NVAA 2J30A 2AB0A 4B3RB 1TADA 4MV5A 1N7IA 2XA1A 3BILA 4QUKA 4RM3A 5DHFA 3VOSA 3ZGXA 3OIGA 4KE6A 1F1JA 1QO9A 3GDOA 2HQBA 4FVTA 3AXTA 1R4MB 1IVSA 4RMGA 5TDHA 3FVWA 3I1JA 1Q0UA 2KPOA 3VR5A 3OZTA 2D4AA 1ZGGA 3FOAA 4H18A 2FX5A 1R4NB 5GWXA 1PT5A 4QAJA 4WTOA 1P0FA 3BJRA 4I50A 3LQRA 3DOEA 1TT5B 2K2QB 4JS0A 1KWGA 3BGVA 2GDJA 1CZLA 1Z0DA 3Q8WA 1LJLA 1EDOA 4UD2A 2CVOA 2DUJA 2ZAIA 3E27A 3A1SA 3G0BA 1V1MA 3I6ZA 4Z53A 1U1IA 3DV9A 2C5AA 1FDUA 3GJSA 3D0OA 5DHUA 3RANA 4DSUA 4QYIB 4BQRA 1SXJB 2H08A 4PQYA 4JB2A 4CUZA 1KK0A 4RLQA 3TTSA 1E7WA 1Z6TA 3OQJA 2F6RA 3AONB 3T4XA 4KPEC 2ZOSA 4YAGA 4HP8A 4GKJB 4MYSA 1QNFA 4AJHA 3JWHA 1PL6A 3CX3A 3AUKA 4HHEA 4US0R 3T3MB 1Y3IA 3QWIA 4K9PA 4CDRA 2PD3A 2JKYA 4O2BF 5DW3A 1VIDA 2GXSA 1WKCA 4QELA 4YEDA 4G4IA 2AOUB 2R1VB 1GVHA 4LISA 1E89A 3D3KA 4PIVA 3FHLA 2QLLA 4ENSA 1TL7C 1Y7PA 2BONA 4YMGA 4Q4CA 4W5RA 1QPBA 1F8FA 1P60A 1GQSA 1TEXA 4QBGB 5DT9A 1BEZA 1W36B 2YV5A 2Z6QA 3IMGA 1YQ9A 2VBCA 4A82A 2REBA 2XOXA 1CX9B 3QYAA 4OVKA 3FPEA 3GC6A 5FV7A 1KO1A 5IYZA 4MLPA 1SUCA 2BUAA 5A6SB 1J39A 2PH3A 4OQMA 4UD6A 1LI5A 4H1TA 3V7WA 5FUYA 2ECPA 1T8WA 4TV9F 1TDJA 4FHGA 2JGJA 3VKWA 4JNCA 5KJ1A 2Y1OA 3A9UA 5A5EA 3AR4A 1LI7A 4GI3A 4X66B 2NZWA 3WBBA 3O3OB 2NPFA 1XPRA 2RG1A 2AKEA 3P45A 1P3DA 3V55A 2XUPA 3EIQA 1QTQA 3T3OA 2ZUDA 1ECJA 1V1RA 2A9VA 3OAAD 4G85A 5CYOA 1JB1A 5C7LO 2XUHA 4PYLA 1JL3A 3WGOA 1EHCA 3LCCA 1JN0A 4J75A 1RAFA 4RA6A 4AKGA 3CBGA 4K86A 3ZLJA 3MIIA 1CEXA 1HE4A 1B16A 3A7EA 3OWXA 4I3FA 4AS3A 4HAVA 4RXTA 3DC2A 2CDRA 2YYSA 3EFBA 3U31A 1JEQB 3PR1A 1DBSA 3UWDA 3ETJA 3P71T 3QW4B 2YN4A 4CIWA 1APBA 2ZUVA 5AXAA 1G5PA 2R5FA 4V0MA 4O2AA 1JG6A 5TPZA 1MHPA 3SHWA 3WQRA 2WFAA 3G7UA 4FE3A 1BHO1 1NA5A 3U6BA 2WP8J 3HDGA 4B35A 1TO1E 1FNNA 4UBIA 4EZBA 1XXHE 1QTNA 1JQ3A 1T8UA 4G6ZA 4LRWA 5FOTA 4R2HA 3ER9A 3L1VA 3QKRA 1OI7A 4OLAA 3BK2A 3ZWNA 4W5OA 5HILA 4YJFB 2EJUA 3MEQA 4N0DA 1FQJA 2A67A 4PY2A 4EJSB 3RS8A 5MGBA 3FTDA 1HDCA 3BYZA 3I9KA 1O5TA 3H65A 3I72A 3L7KA 4YA6A 5FUVA 4PYNA 5JO0A 5HNKA 4Q7JB 1M8PA 2IW1A 1ESEA 5J3JA 3T9EA 1ZMRA 5F12A 4JR1A 2NQTA 3RVSA 2BEUB 3DG9A 2NVWA 1CSEE 4XD7A 3SF8A 4BL5A 5HM8A 3Q2OA 5LD2C 1VTKA 4JI1B 2OSVA 5B1HA 1MW9X 1NW9B 4H6VA 1YGPA 3TTXA 4H77A 3I45A 4KBGA 1PKEA 5CHEA 5B1SA 4V1CI 3TN7A 4H4EA 1SBQA 3BGWA 2Q8QA 4ACBA 2C2YA 4GH5A 1YCGA 1K3TA 2DT5A 2C3MA 4F6RB 2OXIA 1LQTA 1Y4DE 3V2HA 3H05A 5H9WA 2GD1O 1Y9EA 1PR5A 4XD2A 3MM4A 5D5QA 3KEFA 4QJ5A 1UK9A 2HB6A 3HRIA 3ON5A 4IR7A 4X3CA 5SYNA 2BI8A 3A6KA 1N5JA 3LUAA 5IKXA 1HFKA 1SU8A 5J47A 1KMNA 1CUWA 1S2MA 2I4MA 1IVNA 3OM1A 3GR6A 1BZYA 2OGUA 3LQKA 1JEOA 1Z12A 2V9PA 3BA1A 3ZE6A 4XIFA 1TM3E 1YZYA 3W2HA 1W5EA 4RY0A 3R7BA 1U7XA 1SC1A 1TE2A 3C8DA 1PIWA 4BKMA 1GTMA 2PKRA 5EJMA 1PZMA 1Z6XA 1T2VA 3KVYA 1JILA 1L9XA 3CC8A 3CKKA 1JEDA 3LO8A 4ZPJA 3R5JA 3MCWA 4LDNA 1DEKA 2BH9A 4K9RA 4J3NA 4LE2A 1HV8A 3WHKA 4PRYA 5DDIP 5CXXA 1CR6A 5CLIA 4C7OA 3NP9A 2NZ8A 4RJ2A 2MSLA 4ZTUB 4DV3B 2GCGA 3LKZA 5H7XA 3KYBA 4I9GA 5B6PA 2BF4A 2ST1A 2PRIA 1CUEA 2Z09A 1O7JA 4FXOA 4UUOA 1SZCA 2N42A 2I99A 2JFXA 1K8RA 2P3QA 2WM2A 3P2OA 4JENA 4MIOA 1IG0A 2FWNA 4QSMA 1DEOA 3I8SA 3DE6X 3ONEA 3LU1A 1TIPA 4TV9A 1DRJA 1U2GA 4UDOA 2B6NA 3L8EA 5TT0A 1VP9A 4RDIA 3HJNA 4P4NA 2OGTA 4Q15A 1EVQA 3ZD6A 2Q0QA 2YXBA 2BMFA 2PHZA 3SDSA 2GR9A 3E3AA 3CH5A 4IKPA 1E4YA 3Q10A 3RARA 1XU9A 1AUQA 2SBTA 5EJIA 3QW2A 4A7PA 2PNFA 3ANYB 3RK4A 3RVOA 2WKQA 2AK3A 3MQ2A 4M0KA 3JZMA 4TLEA 2DFDA 3PRKE 2G1PA 4GYJA 3DYBA 2DFKB 4FKMA 4U00A 4F84A 2X2PA 3AJEA 3GVPA 3NYWA 4I66A 2WWRA 4BX2A 2XVZA 4QRDA 1OX4B 4C6SA 1ZM7A 1IM8A 1FTYA 4IJVA 1NJFA 3RYIB 5C4MA 1MC1A 4AJIA 5JAPA 1UJ6A 4YJGB 4E2WA 2G9ZA 4XGIA 1UFKA 1TQ2A 4QXMA 4KRGA 3T3PB 5IJWA 1GTL1 2YXDA 1K9SA 3A4IA 1ZMXA 4JK3A 2JKVA 4PYIA 3RYHB 5TQJA 1ZJYA 2CLDX 2Q0XA 3TQRA 3WZ2A 3L1KA 3L8CA 3VDQA 5K3OA 1KEKA 2V5UA 1KY4A 4YMUA 1U9ZA 4QXRA 2PL5A 1LBEA 2AHOA 3CONA 4PZUA 3D3QA 2SCUB 3N75A 4Z2YA 1XALA 4NZPA 2UVPB 4EJ0A 4J94A 5BSFA 2G6TA 4KBFA 2QX9A 3HP7A 1USUA 2OORC 3NHRA 2DLCX 4BFVA 4QXQA 1T0UA 5JU6A 2AMJA 3N7TA 1T3HA 2F3UA 3LA8A 1TCAA 2IDMA 3BE6A 1SC9A 3OA2A 4MW7A 4PCVA 1QR6A 3QSYA 4JR2A 1QKJA 3EVBA 5MN6A 3WYBA 3BERA 1QZXA 4Q3EA 2P4UA 2FRDA 3S5UA 2XMPA 4QGGA 1QK3A 4B17A 3AKZA 2Q0SA 3SK0A 4JI4B 1H2RS 4I3GA 4D8YA 4GL4A 3EGDA 5EXPA 1V16B 1VXOA 4FI3F 3JX9A 4AW9A 1LQUA 4PN3A 3L3BA 4LXHA 4CDMA 3A2KA 5BVGA 2FN7A 2WT4A 3FOWA 4JUFA 4PXSA 4WUVA 1DAPA 5D51S 4PZZA 4O4LF 4EECA 1ZZEA 8ABPA 1KK1A 1D1TA 1YRBA 4RSGA 3ZTWA 3RO7A 1E2EA 1O96A 1PNTA 3OJ0A 1P6UA 4JA2A 1W581 3PX3A 2VN8A 2Q41A 3OG9A 4IJUA 3ETNA 2WK1A 4D3SA 4OKNA 1IRXA 1SK9A 1Q6YA 3D3WB 3ESQA 4DLUA 3H87A 5FNVF 5FLEX 3WOVA 4BC1A 4DC1A 5H4GA 3ICWA 3JSAA 1BGWA 1NXQA 3KKNA 5EPUA 1KIFA 4YP0A 1BFUA 3NAGA 4H1WA 4J16C 2RHMA 2P0AA 4AJEA 3LYUA 3A1EA 3HGMA 5JCJA 3EGEA 4OUDA 2HBQA 3VPSA 2BH2A 2DAPA 5ERXA 4RCVA 3TQCA 3F6EX 4FXPA 5IKOA 3CH7A 5DX0A 3STTA 1U31A 5HK9A 2CCKA 2YCBA 3GG9A 1NUSA 5ICMA 4KN9S 2P78A 2QRZA 2VAWA 4YS6A 4C20A 3UJ8A 4DBVO 1I7NA 2HQRA 3LL7A 4E5PA 1B4DA 4R1OA 4KIFA 4UUBA 1IZ8A 1N0UA 1ODCA 1WMFA 2P69A 2EKQA 2ICAA 4KU4A 4Y6LA 4JZKA 5G53C 3WFZA 4BHTA 1A9XA 4UE6A 3H2KA 4Z0TA 2ZR0A 3GBVA 3M4ZA 4MI1A 1QRSA 3M34A 4Q4DA 1U4OA 2EZTA 4I1OA 3U13A 4J2TA 3I5AA 1ZCZA 4IMIB 4CIVA 2JARA 4L0CA 4MJ7A 2DPHA 2YBEA 2A94A 4OYLA 4N47A 5I7SA 3ZTYA 1OJLA 3F3SA 1WXEA 4DRZA 3JD0A 2O8CB 4Z6KA 2BV3A 2NU7A 4B44A 3L8ZA 4ZMSA 4HVTA 3PEFA 3DUFA 1DUSA 4KFTA 4WY8A 1KOGA 3LSYA 3UAWA 4BVEA 5EJ5A 1PDOA 4JLUA 4PLHA 2RI0A 2W70A 8OHMA 1D1SA 5LR6A 4Q24A 5JWHA 1F8XA 3ZYZA 1TRKA 4MQFA 2N9UA 4YT5A 3O75A 3Q88A 1PLLA 4HNUA 4YUAA 1LU9A 2PXAA 2CFTA 4KMSA 1K6XA 1G0OA 2P3OA 2IXDA 3Q3IA 2B2NA 4MRNA 4PRLA 4E88A 4MP6A 4CIAA 3WIOA 4ALKA 5BT9A 4JGBA 4TL8A 1IXSB 3DVAA 3H4MA 3ZCQA 1T5LA 4AY5A 4BE7B 1VCNA 3ER8A 2D3TA 4GHWA 1XQ9A 5CVDA 3TIXB 4I4TF 4I55F 4MMZB 3T7IA 3EXEB 3V2GA 1VZ3A 4RYLA 1C1DB 1KZ9A 2AI1A 2PTGA 3G2QA 3UAYA 1B8UA 1GNLA 4TSFD 4TRJA 3FM9A 5JALA 4KXNA 2QZPA 4JBYA 1MH1A 2YOHA 2V1XA 3NZEA 5GV7A 4P3NA 4HDMA 4B74A 1G7TA 2ZAGA 3ZBPA 3NWJA 3URMA 4MX8A 1T1EA 1EXVA 1VC2A 3MQFA 4Y1RA 4RQTA 3WAJA 3KM0A 3L84A 1NR7A 1I3NA 4TKUB 5E2IA 3HUDA 3G8CA 2AXQA 2B25A 2IIPA 4KLZA 4U0JA 4QUEA 4IIHA 4IF4A 2YBDA 3LOPA 2W4IA 2ZQYA 3ZOZA 3ZZTA 3IQDB 4GVLA 1W0KD 2V65A 1W30A 2XYQA 3AR5A 3N07A 4F60A 4TTVA 2NTEA 1FZQA 2VZLA 2YC4C 1PZEA 1BE0A 3BRWA 1ZCBA 1F8GA 1FSZA 1KU0A 4IV8A 4KCGA 5JNVA 1HNZB 3W9UA 5KDOA 1B6TA 2C5SA 4HUJA 3RRYA 4I19A 1Z7WA 4PLTA 2P41A 4TS1A 1SKBA 4O4LA 3OFJA 3NJRA 2FMIA 2Y99A 3OIUA 1V25A 4UEQA 4Y30A 1NOJA 1P1KA 3TLXA 1L1EA 2JB9A 4WLFA 4X1IB 3PK0A 3QV1A 4YXWD 3W4IA 4IO0A 1W49A 1U8EA 1UPFA 1BW9B 1ZMTA 2GX6A 3AJRA 3BMOB 2V7QA 2VRBA 3AFNA 1FS4A 1KS2A 3M1AA 4C2AA 2HJSA 2R11A 9MHTA 1L5KA 2IODA 3E1SA 2PZKA 5JNSA 4B4DA 1L4EA 4FDVA 4MVJA 4N9WA 5FNVA 4DYDA 3DVSX 3P9CA 4BWFB 5FL7A 2HREA 4TMYA 5JLAA 1DC3A 1U6IA 1DXQA 4K87A 3WA6A 2IZ5A 3SSAA 2WM9B 4XAQA 3TFWA 3CWQA 1EXWA 5BNIA 5JJLA 2BFOA 1VM6A 3DCIA 1AMOA 4ME6A 4EGCB 5KYYA 3ZDRA 5B55A 4Q6WA 3S68A 1RC1A 1Q2XA 3LAWA 3VH3A 1OAAA 1F8UA 1W9HA 2N0SA 1AJEA 2OWEA 4KWIA 4GLJA 1AH2A 3VBEA 4DGQA 4TLDA 4RLFA 4G2TA 4GI1A 3ZE2B 4G5HA 3GFOA 2G4CA 3PT5A 3JTMA 4JJGA 4Z9FA 4ZQIA 4RGVA 2ZJ7A 1GYRA 2BP7A 3NKFA 2BPOA 1YKSA 2GNOA 2LW7A 3ZWQA 1YHNA 1ZR4A 2N1MA 2PWPA 2H48A 3RV4A 3HVJA 1PZXA 1Z37A 2WYHA 4X6LA 4ZT2A 4OJQA 3F7OA 1HDEA 1QOPB 2ASEA 3PPIA 2BEKA 5BYKA 3AIMA 1R16A 4GGMX 5FO1A 3U4DA 2HLNA 1RBYA 1G291 1JDBB 2JGAA 4QFCA 3IQZA 4BNLA 1H2BA 3AI3A 3CIFA 3P0JA 2DQYA 1P9WA 4J0EA 1QCYA 4YGXB 1Q7RA 2Q6KA 4GOMD 4QNNA 5K0NA 1LLUA 3FR7A 4GXTA 5DT2A 3EGVA 2L69A 4D26A 1K98A 4N65A 1H0KA 4HN4B 3NKVA 4OGKA 5JH7B 4IJ6A 4P7FA 1G59A 4GPD1 1W85A 2V97A 5B3JA 1YBAA 3RU9A 4GYWA 4BZPA 1Y3CE 2LUOA 3D3JA 3KLBA 4CHGA 4DMRA 5AHWA 4OJNA 2WSBA 3V4LA 1RE1A 5A3JA 3UXEA 4OHXA 1G8JA 1AF7A 4N5IX 2CFIA 5T6MA 1RYHA 2D1TA 4I4TA 4I55A 4DM7A 1VRVA 3NASA 5IXSA 1T0IA 2QXYA 4UM5A 1Q0PA 5HKKD 2NZUG 2UYHA 1VJRA 3SC6A 1TEHA 1Y6JA 4OHCA 4E07A 5ERGB 1G66A 2GPYA 5AICA 1NFQA 1RZRD 2P79A 2HF9A 4QPJC 2JHFA 1RPTA 4QUAA 4R16A 3U3DA 2H52A 4ZAZA 1VSTA 3W8EA 3WLNA 2J87A 4PAWA 4MZXA 1EEXB 2OILA 1JR6A 3ZJUA 5L7TA 4AC9A 4H1VA 1OVGA 4J7UA 4WOKA 3ZJYA 4R83A 1JAHA 3SHTA 4W5QA 5KKNB 5JXHA 3QVWA 4WH0A 1N6PA 1XR3A 4A9AA 1E7RA 2YR0A 3A9RA 3Q12A 4CL8A 1Z4NA 1RHJA 4ILKA 4WVLA 4Z4CA 3MWEB 5HE8A 1OJ7A 5D87A 3MT8A 5K8CA 2P4QA 4B2YA 2XYVA 1T2EA 3FMVA 4C1BA 2K7FA 3TM4A 4JI6B 4E6PA 1KY3A 3HXMA 4HFRA 3RRFA 3I04A 4GZMA 3PS9A 3LMKA 3QP9A 3DP7A 4K6OA 1YB4A 2EGUA 2IPLA 2C0PA 3HNRA 4I08A 3PXBA 4BMDA 1HETA 1IN6A 1PSDA 3GEEA 4N6NA 5I5EA 1C3XA 1Z4PX 3HADA 1FJHA 3CLTC 4RKWA 2IOFK 1XD2B 4FSDA 2C78A 2D1RA 1D2HA 1JIIA 2JGNA 1L5OA 2ZJ3A 3MYRA 3C6BA 3KD2A 4NSNA 1NQAO 1WS6A 1ZH8A 1BG6A 2QDKA 2ZDQA 4GVXA 3U37A 4AURA 3PFIA 3SXUB 1N9KA 1DMSA 2FSVA 2HIMA 2WLTA 1QQ6A 2C8LA 5HZHA 1EJ6A 3HCFA 2YUTA 1YDEA 3BCUA 2H6EA 1N5DA 2VFAA 1CQWA 1YACA 2ZBQA 3TPFA 4EVRA 8ADHA 1BJKA 3VU8A 5FAXA 4BCDA 1GTRA 2QI9F 4L5IA 4X6UA 1TMOA 4Z4FA 3SICE 3SSNA 3B20A 4R9RA 1KRXA 2AX3A 1IHPA 4JD5A 3RUHA 2H9AA 2ONCA 1WABA 1GL3A 3C1TA 2WD8A 3UA3A 1M7GA 2NVOA 1SG0A 3RC2A 3PUXA 4BQEA 4CEJB 4O0MA 3SM9A 1TUIA 2YY5A 2ZIXA 5CRIA 3WA7A 1A50B 1WOYA 2EX0A 3WYFA 1POWA 4BMXA 2C7GA 2JZCA 1P9LA 1G16A 3T1OA 4CMBA 1IY9A 4WBNF 1PJLA 4RH3A 4BX9A 2X4DA 2YOFA 4OGWA 2XKKA 4M7OA 2CXRA 5BR8B 3CCCA 1RXEA 2IYOA 1XMIA 4TYQA 2XEDA 3E3MA 3OIWA 3U49A 4TRMA 4TGLA 2G40A 2OKGA 2D5IA 1IN7A 1ZBDA 3K5IA 1VGVA 1XTZA 5GADl 3PEYA 5LB2A 1WDLA 3AHDA 4AX8A 1M34E 4D2IA 4DUZB 1YCHA 2X1MA 3D2LA 2JEOA 1U3GA 2P6NA 1EB8A 5HJ5A 4L75A 3AG5A 4BYMA 2YJTD 2YOGA 1ZLYA 2IZZA 2EFCB 2NAFA 2Z2KA 1X7ZB 1X94A 4AJOA 2C59A 4FCVA 5DIZA 1PD1A 4O4IB 4DTCA 3I5YA 3EIFA 1RKVA 2PT9A 4CMEA 1P3Y1 3ISJA 4NV0A 3KVOA 1YL7A 5JXIA 1TO6A 2ZJ6A 2IX9A 1YSCA 3GJ6A 4PFKA 4R31A 5DNCA 3EK2A 2BF7A 3F73A 1W19A 4YPFA 3ZWAA 1I4TD 1RI1A 5IXJA 5LXTF 4RVUA 1IVYA 4KLRA 2QROA 4I81A 1I0IA 2ZSKA 3HPQA 4DCMA 1Z28A 1RAHA 4O4JA 2X4GA 3WL5A 2NN3C 1MV8A 4FW9A 2HMUA 4G4SP 4BVKA 2FFHA 3EEQA 4RKYA 5HUHA 4DLKA 4GEGA 1E4EA 3X1XA 4TMZA 4ZO4A 3W5JA 1QKIA 1RWWA 3LQQA 1Q0ZA 4FN5A 4HJRA 4UTXA 3SC4A 3WOHA 5IZ4A 4JYBA 5F7XA 2DMRA 2WIJA 4LJSA 4QAQA 1XQ6A 1LF0A 3AL2A 2BFAA 1RIIA 3ESAA 1E5VA 4GSYA 1P6QA 1I3LA 1QQ5A 3QTLA 1DU4A 3VUFA 1CJMA 1KSHA 1X80B 1PSWA 2B83A 4XOUA 3ITDA 1W5SA 2W58A 2H51A 1ZI6A 2QTNA 4LGMA 1ZICA 2I33A 3DE5X 4R2XA 2VQEB 3LT4A 4C0HA 4XWAA 3ZDZB 1CWUA 3T5MA 4UEWA 3RFCA 4HQLA 1V2GA 1P0PA 2DPYA 2ZBDA 5C4GB 1SHZA 1GNRA 1W73A 1ZDMA 2SHKA 4XVQA 1A5TA 4IOLA 1H3NA 4YQFA 1XZMA 2VJBA 3JZDA 4UHFA 4DZZA 5ILQA 4IQ8A 4J0KA 2DPLA 1T3SA 4WESB 1R4AA 3SD7A 2GPNA 4RANA 4IXTA 1V11A 1CZUA 3S28A 1S2IA 2QZZA 5TVKA 5ADHA 4DKJA 3RUIA 1N3BA 4CMGA 2GCEA 4F04A 1VCMA 3SVLA 1JDZA 1E5TA 3ZU4A 1VKZA 1XE3A 4E0BA 4ZJPA 5KJFA 2R66A 3SSOA 1BE8A 2EC5A 1XEFA 3D31A 1DPFA 1OYYA 3E3OA 2GBPA 2BUCA 3H3JA 3K0EA 3SHFA 3LTNC 4EFLA 2IQIA 1U5BA 1GEGA 2WPDA 3UQYS 3DLAA 4G0YA 3UC5A 5HUJA 1U63A 3DE1X 4P3OA 5THXA 3OEYA 4PSDA 4RDHA 1F14A 2WJGA 1O3YA 4MS3A 3T61A 2OL4A 4LRYA 5FI1B 1AZLA 4LMRA 4NBTA 3VR3A 1AUXA 5BNTA 1QANA 3Q72A 4AJKA 3CRQA 2VP0A 4JKOA 1A5BB 3EZXA 3QI7A 1RXYA 4QO8A 2H4YA 2VDNB 3OLZA 4L0MA 4TS4A 2Z4SA 5DW0A 5ILOA 2YZNA 4YJ2F 4XPZA 4DQDA 1H66A 1E1RA 4RTSA 1GQFA 1BWQA 4KTVE 4E2XA 3VO9A 3EISA 1UZAA 2PGXA 2CLLB 3BEOA 5JS7A 1MOQA 3FCCA 2MMGA 4A3SA 1K97A 3AF4A 1JNXX 4H35A 1V5WA 3PCXA 1G3QA 4Y0NA 4AAYA 4MO2A 3E22B 1PWEA 4J1TA 2YQ5A 2HFKA 1I13A 3F3KA 4YRBA 5GZ1A 4OB8A 4EB0A 1AKRA 5G3YA 1P19A 3COZA 1UUFA 4DDHA 1O77A 1Q5PA 3L82B 1B2LA 5CA1F 4PBRA 4Z1OA 4L7QA 1SQ0A 5BSWA 5KOHB 2AFHB 5DK4A 2VWHA 1H6BA 3JATB 1B2RA 3QJ5A 5G0SA 3UWMA 1DMRA 3VDNB 4RTRA 1M6NA 1QBKC 1TO2E 3IE2A 5JS8A 1NUPA 2P67A 2Y4OA 1V5GA 1DEHA 3I8XA 3EY4A 4M2LA 4Q5IA 1V37A 5LXTA 3LQ4A 5C5EA 3ZDXB 2C5GA 4U7GA 1RU3A 4C4XA 5DE3A 2QIPA 3OU7A 3FKJA 3TTUA 3UWSA 2GJSA 3NQ41 4HEA1 3IKMB 3LY7A 1N57A 4YHBA 3SF0A 3YASA 4YRIA 2VF4X 2ZVJA 3K9GA 5C7IO 5LQCA 4BNFA 4AYXA 3B1WA 3PQCA 4GI5A 1JH9A 5AW0A 3IVGA 1RE0A 3A3PA 4TXNA 3W3AA 2J9YB 4HWGA 3NORA 5KO2A 1T5TA 3N28A 2QYOA 5EFZA 3AR3A 5DOZA 3RKSA 3IR7A 2XQVA 1ND6A 5CTJA 3WYGA 1B93A 4D46A 2VDWA 3FCEA 4Z0PA 4ARZA 3RBVA 2AOTB 4YWJA 3I6YA 1UH5A 2RHHA 1MW8X 5DGHA 2BFBB 2IHTA 1WMDA 3FOBA 4X84A 4PZDA 4S12A 4PLWA 1CY6A 1RR6A 4WCFC 4ZRDA 2G36A 2RD2A 2I2FA 1UK7A 3Q11A 2JAHA 1WB5A 5K5EA 1V4BA 2FW0A 1PUJA 3LD9A 2PSHA 2ZI6A 5E7QA 3BWEA 4LMPA 4UAVA 4CF3A 2EL9A 4DC9A 5EJ6A 5CURA 4IYRA 2Z4RA 3MINA 4Q93A 5EWJA 1I2MA 1LPMA 1NW4A 4C0BA 4HRAA 1C8LA 1XO1A 3ZHQA 5TR9A 2Z5GA 1UZMA 3CUUA 5JTUA 1MX3A 4XTRA 2ZT5A 2I22A 1T9KA 3X43A 3L07A 3M4NA 5LM3A 3GNTA 2VP9A 3KC2A 5CNIA 1FF9A 1S2GA 1ULUA 3KZNA 3PGMA 4ARBA 3QEJA 3AUSA 4F6LA 2G28A 3JZAA 2W5UA 4JUIA 3FN4A 1UOEA 4J4HA 4WV3A 4R9VA 2Q46A 2EEZA 1JFTA 3IIJA 3QFFA 2CT8A 2NT4A 2EX4A 5EAIA 3DTTA 3QQPA 3L79A 3A70A 1N2JA 3UIEA 3H9EO 4RK4A 3ER6A 1MNQA 1D3AA 3AR6A 3DE0X 1I6WA 2SICE 3LQYA 4HDSB 4FGJA 4GZ5A 5HJ2A 2J08A 3JQCA 2VJMA 5EE9A 1E2JA 2FSGA 4MYTA 3VC3A 4DDMA 4KKXB 3GAMA 1U2EA 2XNSA 3VKFA 4YJ2A 1DBVO 2ATEA 1WMBA 1B43A 5AVQA 2D7JA 3UXMA 1YBHA 3W5IA 5CT9A 1RCUA 4S1TA 2C97A 4FLMA 3GPIA 1YCDA 5DLEA 3I34X 3UK0A 2NP6A 4IICA 1PR2A 3DM5A 1F2UB 4KI7A 1C8BA 2M9MA 2ENWA 4Z8YA 1YQQA 4RORA 2WTAA 3W5VA 1CJCA 4PTLA 3IBFA 3GFVA 4IQFA 3HWSA 1A8SA 4HNTA 3EJWA 2C00A 4CJXA 2OMKA 1Z08A 3OF5A 4D4GA 2IJGX 1SNYA 4GC9A 4HF7A 3DMFA 1ACJA 1ZI9A 5HF5A 1HEIA 2ZQ5A 4UOQA 3ZUGA 3MMNA 3D7LA 5CA1A 3ROQA 5CBKA 2X1VA 4LZZA 4RM2A 5BW6B 4C43A 3FH0A 1N1MA 2P11A 7YASA 2XIJA 3FB4A 1LV8A 3WYNA 1GZ3A 2H16A 3H1PA 4HN9A 1ADYA 2Y1CA 4I8DA 5CLFA 5JSUA 3MMZA 3B85A 3PLRA 3ANLA 1GCIA 2VAMA 4MHOA 3EXHB 1EFAA 1P44A