4J1NA

Crystal structures of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
258
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
total genus 82
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j1nA00
4WASA 1ZK0A 2GN6A 3ZV3A 3I83A 2D0IA 1LDMA 1YGYA 3OBBA 4RO0A 5KVSA 2V6GA 1K6JA 5CP8A 3JQ7A 5T5QA 2G5CA 1N9GB 3JYPA 4B4UA 3OICA 4DVJA 2HMSA 5TIIA 5DCUA 4E5KA 3BA1A 5DBGA 3L6EA 2OP1A 4XCVA 4ND4A 3HDYA 4CL8A 1E92A 2SCUA 1X15A 4GX0A 4D44A 4OKNA 1QYCA 2ZB7A 3WJ7A 5JSFA 4EJ6A 5EERA 1YL5A 5DDIP 3TL2A 1BG6A 1EDZA 3H5NA 1HXHA 2DFDA 3DHNA 3DB2A 2HK8A 1Q2XA 1AE1A 4IDAA 4I08A 5CHEA 2E37A 4M8SA 5A9SA 4DRYA 3LC7O 1ENOA 2BMAA 5FF9A 2BFPA 1EVJA 1GTMA 4J1NA 5TQVA 4NMHA 2EW2A 1U9JA 2WWRA 4OXYA 2G1UA 4EJMA 3P19A 2Y68A 3I4FA 1RM0A 4TSKA 4AJEA 4BO8A 3WYCA 4KDEA 3ZWNA 3K96A 3NAQA 1X7GA 4EI2A 1HTBA 2XOXA 1GCOA 4M49A 4BNLA 3KUXA 1M75A 4JK3A 2W2LD 3K2BA 1ADCA 3KB6A 3ONDA 1EVYA 4ZN6A 4DBVO 3EK2A 3QVOA 4DQUA 3L4SO 5MGBA 1YWGO 2HUNA 1UXHA 2J8ZA 2PR2A 3JTMA 1PQWA 5TGDA 4BNUA 2DAPA 1KY5A 4NH4A 1RM4A 5GY7A 1X0VA 2IXBA 1T2FA 4HNHA 4MVJG 2YQ5A 2AEMA 4OL9A 4QECA 1K6IA 2ZKLA 1WZIA 4J43A 5KTKA 1Y9AA 2BFOA 2VWGA 4N5MA 4PVCA 4PLCA 1ZK2A 3KYDB 4FFMA 4MKZA 4OOFA 4Q3BA 4YJHB 4BO2A 4RDHA 3RROA 3I6IA 2IYPA 3GGPA 4II3A 5KVCA 3JD3A 4BKUA 4KWIA 3TFOA 3KRTA 1Q1NA 3ZNQA 3ZWWA 2NWQA 3D3WB 2BD0A 2CVQA 1QMGA 1PSDA 1P1RA 4CM4A 1Y7TA 2VYND 2VZ9A 3VOSA 4EDFA 4A27A 2ZQYA 3JD2A 3LF2A 3GHHA 4FS3A 4I8XA 3PJGA 5C7LO 1PR9A 2C0CA 2PTGA 1IPEA 3H3JA 4E12A 5TSDA 3N58A 1GQ2A 5G4KA 4BGVA 3L9WA 1S6YA 1DAOA 2CFCA 2BGLA 1YQGA 2GRAA 5BNFA 3DOJA 3QWFA 1KS9A 4XQCA 3VH1A 1P1JA 2GN4A 2ZQZA 5THQA 3INRA 3BHIA 5COQA 1T2DA 4XIJA 1XCBA 1R4NB 5F1KA 4IUYA 4GMGA 4FOOA 3IDSA 2X58A 1U2GA 3DBRA 1HE4A 4IJKA 4J4BA 1H6CA 1MC4A 1SNYA 3JQ8B 5F21A 3IKTA 3EZLA 3JQAB 1GU7A 3WMWA 1Q7CA 1Q7BA 1GZ3A 3DONA 2IYOA 3QIVA 4BNYA 3RUHA 4FPXA 2VUSA 5F3RA 3MJCA 4JJFA 2DTEA 3N7UA 4F6CA 4XGKA 4CQMA 4L4XA 3ZWPA 3AM5A 1E3LA 3JQBC 1NR1A 1HE3A 1E77A 2X4GA 3KZVA 2GD1O 1BW9A 2WD7A 5JLAA 3MOGA 4WECA 3D0OA 1ULSA 5DOVA 1JN0A 4UEOA 3I9KA 1G6KA 5JYDA 2FPGA 1ZCJA 2A94A 3DZIA 3AM3A 4BMSA 2EIHA 4DGSA 4WLVA 3PHGA 1AHIA 4D7AA 3WGOA 3WYBA 1LDEA 4XRRA 5L53A 1Z45A 2NU7A 2PZJA 2ZJ0A 1A9YA 1H2HA 4AJ2A 3KLMX 1CIVA 3AUTA 3K8ZA 4E33A 4BQRA 3TSCA 4XA8A 3G49A 3HQ4O 1R0LA 3DHEA 4E32A 3ZW9A 1I3KA 4Q9NA 3VH4A 3DBVO 3IJPA 1ONPA 4QTZA 1JKJA 4IINA 5KOIA 4CODB 2VRBA 1KERA 3PZBA 1VL0A 2TMGA 3PYXA 4PLTA 4U6QA 3T4XA 4UVHA 2VUUA 3ZZNA 4CLHA 1C0LA 1AGNA 1L7EA 3MJTA 2I9PA 2VTEA 3O03A 1EBUA 2XPCA 3V1TC 2FY8A 3FNEA 3IQDB 1K89A 5JMPA 5CDSA 3I9OA 2F00A 3JQ6A 2BLLA 2GSDA 2Q1UA 2QIOA 3EVTA 5IJZA 4NJMA 1H93A 2ET6A 2Z95A 2W8ZA 3WSWA 2ZIZA 2FHSA 1SC6A 3DHYA 3BTVA 4EUEA 1LSOA 4IQ0A 4CLRA 5JDCA 1YH3A 5GZ1A 4MP8A 1YB5A 2EF1A 1ISIA 2VCYA 2GF2A 2WJPA 5B4UA 3QY9A 2D5AA 3ICCA 3L4BA 4TRRA 3ZWXA 4CMEA 4OXNA 2P4QA 3OJLA 1B0AA 4CM7A 4FFLA 3PHLA 1GPJA 1ID1A 1EBFA 2GASA 8ADHA 2E4AA 4JXKA 2HQ1A 4PCVA 1FXSA 4HADA 4WNIA 4KTTE 4Y67A 4I9HA 3VH3A 1T2CA 3H3FA 3DQPA 4IJVA 4XD2A 2PH3A 1GUYA 2BRUA 3C7DB 3R1IA 1HWYA 2GN8A 3GGGA 1X0XA 4I5GA 3L9XA 2JCYA 3DAPA 4JJIA 3WLEA 5C5IA 4M1QA 3WFJA 4GMFA 2Q3EA 1DFHA 3GUCA 3RC2A 4MOWA 4O63O 4RLHA 2XXJA 3PHHA 1UDBA 4J1QA 3ZGYA 1WDLA 4PRLA 3ANLA 3TDKA 5KJ6A 3FPLA 4NU6A 4GWKA 2PZLA 4JLWA 4DMLA 4EJ0A 2Q1TA 4GX5A 2CSUA 4R16A 1PEDA 3QLJA 2B69A 3HN7A 3GRKA 2FSVA 4U0JA 5IDYA 5ADHA 1YS4A 3OEWA 2AEFA 4W9NC 2QYSA 1C3VA 3FI9A 3FWZA 4GX2A 5AVOA 4CMGA 1DC5A 2NUAA 3GNQA 3L0DA 4BNHA 5BNIA 1P1FA 4PRKA 3OIDA 2X7HA 2BGKA 1S7CA 1KEPA 2YV1A 3W6ZA 5DCWA 2B83A 3LLSA 3ROKA 3H9GA 1YKFA 4PLHA 1UDAA 4CMCA 3HUDA 4Z6KA 2EV9A 1CYDA 2HMWA 3RFVA 1Y8RA 2GLXA 1XQ6A 2J3JA 2OXIA 3JQFA 4NDNE 4R3WA 3CUKA 4H15A 3DMTA 1P9LA 3BTOA 5L95A 1A72A 2DU8A 5JFOA 3JQGA 1UZLA 5ICSA 2JCXA 3F9IA 4WUVA 2HMTA 2PD3A 3JD4A 5L9AA 2O3QA 1ZBQA 3I9LA 1ISJA 3Q1LA 4CMJA 4TVBA 3GVXA 4XIYA 4GAEA 4R9SA 2W2LA 2R6JA 2CF5A 1U2DA 5TX7A 1WWKA 4BKQA 5A1TA 3PHIA 4OXKA 4P38A 1QSGA 1IB6A 1H2BA 2UAGA 1QP8A 2DBRA 4GBJA 1K2WA 4GGPA 3ZNPA 1UP6A 5K0ZA 4E6PA 2ZATA 1EFKA 1U4SA 2X6TA 2NU9A 5JYEA 4YRAA 2YYYA 2CNBA 3D4PA 2WE7A 3OQ1A 2EW8A 3NRCA 4CMKA 1KC3A 1KETA 3H5AA 1E1LA 3LT1A 2A9FA 3ZI0A 5BNTA 3R3SA 2GDZA 2YHIA 3DZHA 2FSSA 4LRTB 1EFLA 3F4BA 1GZ6A 1GQQA 1PJBA 4L4SA 4NPCA 4RVFA 3PJFA 1QYXA 4WLNA 2X23A 3RUFA 5B12A 2VYNA 3M2TA 2O4UX 3OFSA 3WGZA 1DO8A 1E5QA 3GAZA 2C07A 5JMWA 4G2NA 4DMMA 2GPTA 1SEVA 1ZJZA 5JS6A 3OHSX 1BSVA 3A06A 3H6KA 3IKVA 3IUPA 1RM5A 2E49A 4ZQBA 2XXBA 4WCFB 3ULKA 4QO7A 4XQ9A 4RZHA 5L45A 4YJGB 4HUJA 2X0NA 3S2IA 2X9NA 4N54A 2PGLA 2Q50A 4ZQHA 3F1LA 3CINA 3BTSA 3RU7A 4TQGA 5B1YA 1O89A 1CF2O 1M66A 2DT5A 2PD6A 2O3JA 3KYCA 1KC1A 3ETGA 3GT0A 4UULA 3WOHA 1EE2A 4RQUA 5EMHA 4C7KA 3ENKA 4GWGA 4QO8A 4L76A 3ROMA 4CUKA 2HK9A 4GLLA 4OHUA 3ORFA 2Y1OA 1B26A 3N74A 4PFJA 1H9BA 4CM9A 5K6AA 1E7QA 4OM8A 3JCZA 3DBHB 3WQRA 2WTBA 1W8DA 2JFHA 4CM1A 1ISHA 3GLQA 2GZ1A 5L3ZA 5F5NA 3Q9NA 5JDCC 4YVFA 3E18A 4QFDA 2BI8A 4UUMA 1VJTA 5TF4A 3F5QA 4LK3A 4R5HA 1D1SA 1VL8A 4U8GA 6LDHA 2YFQA 4FC6A 3OF2A 1CQIA 1NQTA 4W7HA 4IZIA 5U9CA 1GR0A 4UUPA 4J1SA 1QR6A 1P1HA 5LDGA 3V1UA 2YUTA 4IZHA 3BHMA 4HNGA 1TT7A 4HFJA 2AMFA 3QSGA 1JAXA 3VTZA 3P2YA 2QRLA 3ANMA 3JQCA 4Z0PA 2JD1A 2Q2VA 5BSGA 3QVXA 4D45A 5EJ2A 4DPMA 2IODA 1LDNA 3LT0A 4HP8A 1BRMA 4XDYA 2FP4A 3GGOA 4NFYA 2Q2QA 3F5SA 3GH3A 4WNCA 2UV8A 4OOEA 4BGUA 1E6EA 4Z9XA 1ENYA 3RWBA 2AG8A 1ZFNA 2JFGA 2P91A 3E5RA 3GUYA 5DT9A 3WWZA 3ANNA 4ALIA 4D3DA 3UOGA 1E7YA 2ILTA 4PIVA 3OECA 2I99A 4LW8A 3LQFA 2GR9A 2ZTMA 1RYEA 2EEZA 2ZCVA 2VZ0A 3IC5A 2GCGA 1PJ4A 4Z9FA 3NYWA 3OJ0A 4FFNA 4M54A 4YAIA 1M76A 1OOEA 3FR7A 5JY1A 3M6IA 1MP0A 3DC2A 3DZJA 1N7GA 2Z1MA 4HFNA 1BVUA 3MWDB 3JYOA 5HA5A 1DFGA 3JQBA 1QKIA 5HM8A 4P4NA 5I9NA 3H9QA 1QRRA 4BNXA 3ST7A 1PJ3A 4ID9A 3TF5A 5LCXA 2B37A 5L40A 1C0IA 2H1SA 4PG7A 5KWEA 4P22A 1R0KA 1VRWA 2AQHA 3GAFA 3QJ5A 4GPD1 1GQYA 1FK8A 1MGOA 3GVHA 1BTOA 2EKQA 3B70A 3RQSA 1NPDA 3UF0A 3UGKA 3WGTA 1XSEA 1HL3A 1GZ4A 2EKPA 2G17A 1VM6A 1PZHA 5G0WA 4U5QA 2Q99A 1EUDA 3HDHA 1PU2A 1ZSNA 1D4FA 1V9LA 4E4YA 5KKCA 2PD4A 3OH8A 3IP3A 3ITDA 1T4DA 5A3JA 1PJSA 1EVIA 5L7WA 5DF1A 1AHHA 4E2WA 3D5TA 4NZ9A 3NTOA 4F45A 5JDIC 1YB4A 1EVZA 1QXSA 2YV3A 5EPOA 4EEZA 5ITWA 2HKIA 1ADFA 1M2WA 2WYVA 4AJLA 4J3FA 3KLPX 3COSA 1YO6A 3MOIA 3OJOA 1WVGA 1BGVA 3L4BC 4ALJA 4YRDA 1TLTA 4CMEC 1SOWA 4RVDA 2QYTA 4B4WA 5G2OA 2YZ7A 1P74A 3FD8A 3TQHA 3JQ7B 3RD5A 4PGFA 5CDUA 4CM8A 2C2XA 5JCJD 2ZYGA 1PS8A 2Q2WA 3D4OA 4W4TA 5IAAA 2O4CA 1U8XX 3STHA 2VZ8A 4QUKA 2QRJA 3QP9A 4MDHA 1T2EA 1ZW1A 3B1JA 1ZK1A 3BHJA 3DTTA 2FMUA 1I2ZA 4JIGA 4RGBA 3ZNOA 2ZYAA 2NU6A 4EUHA 4BNTA 1W4ZA 2NQTA 3LT4A 3WYEA 5A5EA 1DIHA 3UVEA 1SMKA 4RCVA 5EQDA 1MFZA 4YXFA 3NGLA 5A02A 1CJCA 1ENPA 4YA6A 2B35A 3FTPA 4H3VA 2PY6A 3EUWA 4E5MA 3U5TA 4UVDA 4A2CA 1LSSA 4TKMA 1NYTA 4JGBA 3P7MA 1KVRA 3OETA 1A9ZA 4E31A 5IN4A 3PIDA 2WYUA 3RKRA 4CR8A 3NT2A 3IP1A 1OC4A 3UKOA 3W1VA 2AEJA 2PZKA 1ONNA 3CXRA 3WLFA 4X54A 3PQFA 4KTVE 4BNKA 3GRPA 3A4VA 1E7SA 1G0OA 3JQFC 3C1AA 3GEDA 4L0QA 1IHYA 3W8FA 3QVTA 3B1KA 3F3SA 4HV4A 4RPGA 4E5PA 4W9NA 1N1EA 2JAHA 5A9TA 5H83A 4NR0A 4OAQA 3FCOA 3QRWA 5THKA 1F8GA 4KQXA 2B5VA 3V2GA 3RJ5A 2H6EA 4CV2A 3PJDA 3ZCXA 3PEFA 4KUHA 3INTA 1AN9A 3LYLA 1NTOA 4AJHA 2IEBA 5FI3A 3SJ7A 4BIIA 1RWBA 4KP7A 4KUEA 1NFRA 2PKQO 4R68A 4E13A 2X1HA 4UREA 1WMAA 3EDMA 4BNWA 4GVLA 1OI7A 1XEAA 1P1KA 1U3UA 1Y9EA 4FJ0A 3WR5A 1FF9A 5G4KB 2D59A 2CDAA 5DNAA 1W6UA 2Y1EA 3PK0A 2HRZA 2O7SA 3O8QB 4ND1A 1HSZA 1U3VA 2JKVA 2NVBA 1EUCA 3JQAD 3AY3A 1GDHA 1DC3A 1OZAA 1R15A 1OBFO 2HK7A 2WM3A 1YOVB 3SEFA 4LMPA 4ZA2A 3EAGA 3AY6A 1V3TA 2WE8A 3A1NA 1D1TA 3C8MA 4IBOA 3EMKA 5CEFA 4WLFA 5KJEA 1HE2A 3L07A 4WOJA 1PWZA 4R54A 2NM0A 4RPKA 1EQUA 3DO5A 4I5EA 3UCEA 3IUSA 3GN1A 5JAZA 1DJNA 2Y1FA 3U4HA 1VL6A 4MJLA 1HKUA 1C0PA 5JY6A 2W2KA 3HSKA 3DTYA 4TRMA 4CQMB 4FQ8A 3I1JA 2FR0A 1X1TA 2Q49A 4DIFA 3MEQA 1PL8A 3EW7A 3BMQA 1GD1O 1WDKA 1MG0A 1VE9A 2C7VA 1BW9B 2WD7B 3WGQA 3ICPA 1DC6A 2FR1A 2DBZA 3OQBA 2POQX 1XELA 3WQQA 1ZSYA 1I8TA 4KOAA 1NP3A 2D4AA 2YDYA 3SC6A 3BAZA 3FRJA 4TZKA 4ROSA 3DZBA 3EVNA 1RPNA 3PPIA 1SBYA 5K6AC 1H6DA 4AJNA 3E8XA 1UAYA 3WX0A 3ZU4A 1BXKA 1ZMOA 3CPSA 2FPIA 3WB9A 1Z74A 4J49A 2Z5LA 3W4KA 2PFGA 1VKNA 1I3NA 3RC7A 3ZDFA 2DC1A 2B4QA 4WPGA 3LLVA 3VHRA 1NFFA 5ILOA 3RVDA 4G65A 4WLUA 3INGA 8LDHA 1C1DA 3VZPA 1KOLA 1HYGA 4BKOA 1DJQA 1B3BA 2JD2A 1PWXA 3RFTA 1GV1A 1LLUA 1UP4A 3GOHA 5KCZA 3NGXA 1DHRA 2IZ1A 4ZGWA 5AXAA 5GZ6A 4XWYA 1G0NA 3S1LA 1YB1A 3K9QO 2PK3A 2GGSA 4NJMB 4QQRA 1T26A 2EG9A 4J7UA 1B8UA 1Q0HA 3HDJA 3OMLA 4R1UA 3CTMA 4GLOA 5B37A 1LC3A 3CEAA 1GEEA 1E7MA 4OQYA 5ES3A 3O9ZA 2G76A 1LQUA 2DVMA 4XJSA 2RIRA 1DOHA 1P3DA 1MX3A 4A26A 4GH5A 1E6WA 3NTRA 3VPHA 4PG8A 1NQAO 3RSHA 1Y8QA 4XKJA 4E0BA 3GNTA 5JNLA 1I5RA 1PJCA 3LC2O 2Y0DA 5A3VA 1YQXA 1DFIA 5DCYA 2NACA 1L1FA 2Y93A 2TMDA 3IAHA 3Q6IA 3KSDO 2HU2A 4IMPA 4RPLA 3WNVA 4BO1A 4AJPA 2BFMA 4I1IA 1N9GA 4KUGA 1VPDA 4NBRA 1FDWA 1UDCA 1JA9A 4Y98A 1JTVA 3RAJA 3WNQA 2I76A 4OSPA 1ZJYA 2AW5A 2J5QA 2BFAA 3X2EA 1M67A 4M86A 1LQTA 5JCJA 2E82A 4AJ4A 4OMUA 2B36A 3TZKA 4MIOA 2LDBA 2O2YA 1WMBA 5KJ1A 2UDPA 1NXQA 3RJ9A 3UXYA 3HB5X 4B79A 2CVOA 4FIZA 1H94A 1NNUA 4KMSA 2PKQP 2GO1A 3U62A 4E5NA 4CM5A 1U4OA 2OP0A 1U7HA 5EESA 1R6DA 3AI3A 1R4MB 3ZH2A 3IJRA 4ALLA 4BNIA 3ADPA 5KIAA 3GY0A 3KOUA 1I10A 1Y8RB 3CZMA 4E3ZA 3WSVA 3AFMA 4AJOA 3UW3A 2NVUA 4ZQGA 3JQGB 5B4TA 1B8VA 4OJNA 5BSHA 3PI7A 5DULA 4CLDA 1RM3A 4IIVA 3OQ6A 4MKXA 1I30A 1A4UA 3NJ8A 2HJSA 3H2ZA 3SLGA 1HZZA 4NU5A 1A5ZA 4L9RA 3H9EO 2X86A 5HWSA 3NUGA 2ZB4A 4W82A 1JKFA 1LRKA 4TMFA 3HADA 1V6AA 1WW8A 2W90A 4CPDA 3ABIA 2VRCD 4CM3A 3OJFA 1E1MA 5JDIA 4OKIA 2EGGA 2Q4EA 3WQSB 1DRUA 4IDCA 3KYDA 4YJHA 3GK3A 4IY1A 3E6AA 4QT0A 1O9BA 2J6IA 4ALNA 1BXGA 4B3IA 4DL9A 1ADGA 2EERA 1JWAB 3D3WA 1NFQA 1VC2A 4ZQFA 3WIEA 1DDOA 4J1TA 3G1TA 2IXAA 3DZFA 4Q3EA 4XB1A 2IDZA 1Y1PA 3NEPX 3AFNA 1P1IA 2YHIB 1B14A 4MINA 4HY3A 4LRSB 5JAIA 4NK5A 1I01A 1P33A 3I9NA 2C54A 4B3HA 2JHFA 3AWDA 3QWAA 3TNLA 1EEHA 1OC2A 3FNGA 3R0IA 2C5EA 1UJMA 2OHXA 1NWHA 5L4SA 4XR9A 1DHTA 3PVZA 5IXSA 1NQ5A 2IE0A 2W4QA 1PQPA 4ZU3A 4DIBA 5GZ3A 2EWMA 3NT5A 2V65A 1LX6A 3Q9UA 3BMNB 2FRDA 4Z3KA 2F1KA 3EGOA 4RORA 4CLOB 4P4LA 3JQ8A 2VWPA 4R69A 1DIAA 2O23A 2PGJA 4WGGA 4FBGA 3E9QA 4MVJH 2HDHA 1HDGO 4BO0A 1U3TA 4BGEA 2B4RO 4YR9A 4MVJD 1EK6A 4JN6B 3V2UA 2H5LA 1DIGA 3HFGA 3WS7A 3JSAA 1DIRA 1EE9A 3F46A 4MVJE 1X7HA 2D8AA 4QFCA 2Y05A 5AOVA 3W4IA 4BNNA 4YPOA 4AVYA 2NSDA 1MFPA 1SAYA 1DRVA 3BXXA 4FJ1A 3K73O 3RUAA 2EP7A 4WJZA 2V6FA 3RBXA 1A27A 3ZU3A 4J0FA 3UH1A 5JAMA 1I0ZA 5IDQA 1K5HA 1LBEA 1ZIDA 4ESOA 1BVRA 1KEVA 4OQZA 2NLOA 4YQZA 1LDYA 1LDBA 3ONEA 3NV9A 3GPIA 3LF1A 4EYEA 3DZKA 2QRKA 3RBZA 3VPGA 3AY7A 5C3MA 2AXQA 4WE3A 4IJUA 2Y1DA 4AICA 5CG2A 4EGFA 4IDDA 4E5YA 4BB6A 4YEDA 4TZTA 1NVTA 4F6LA 1LTHR 4JP3A 5T67A 1RYDA 2GN9A 3I23A 9LDTA 5T64A 5ER6A 3WGHA 1F8FA 2FZWA 3BTUA 4RVSA 4R1SA 4R1TA 5HTOA 2NNLD 3DXFA 2A92A 1QYVA 1X1EA 3PLNA 1O95A 2CMDA 4NG5A 1U7TA 1Z7EA 2NQ8A 1P0CA 3QE3A 4URFA 3K6JA 4NBUA 3VVCA 3ZV6A 3E03A 3CMMA 2G82A 3GZNB 3I5MA 5I7EA 4B8WA 3FWNA 1QV7A 2I67A 4W7IA 5FWNA 3JQDA 1J49A 5DBIA 5HBRA 2WYWA 1GPDG 2PV7A 3VKUA 4C7JA 4DWVA 5ENDA 3AW9A 2WDZA 3F1KA 4WK6A 1H0KA 1SEPA 4MIYA 3GG9A 3VVBA 3FSRA 1OAAA 1HLPA 2NU8A 3U9LA 5KVQA 1NVGA 1GEGA 1F14A 5TT0A 4B4OA 4I9NA 2OMEA 5IF3A 2P68A 4FW8A 3Q3CA 1NWCA 1A7KA 3RUDA 3SC4A 4CQLA 5IZ4A 1YL7A 4CMIA 4L74A 1A7AA 2Y99A 5EIOA 1ZZEA 4L75A 4BO3A 2AE2A 5I9MA 4GX1A 1C0KA 1WZEA 2O50A 3H9JA 3P2OA 2P9GA 3HFSA 4XQEA 3BMOB 1CERA 3DFZA 2OOSA 3Q2IA 1E3EA 1QG6A 5I9LA 2B0JA 1GV0A 3I9JA 4G81A 4OSOA 1JU9A 2PWZA 3HZZA 3WIDA 4MVJI 1DB3A 2IRWA 1Y6JA 3PJEA 4D42A 3U09A 4DREA 1MUUA 1WDMA 4A10A 3I3OA 2J5RA 3TWOA 1UXKA 4A0SA 4A03A 1P45A 2EXXA 1F0YA 2W98A 1V35A 3GC6A 4M87A 4YCAA 7ADHA 5F5LA 5JW6A 3ZHYA 1QYWA 3WMXA 4BNZA 3H8VA 5B4VA 5KVVA 1H6AA 4CM8B 4NJOA 4NI5A 4R01A 3RUEA 1T1SA 3WGGA 1R0SA 4YTEA 2FWMX 3H9UA 1YBVA 3VZSA 3LK7A 4KWHA 1X7DA 1MG5A 1VLLA 1HETA 3VDRA 1KBZA 3OJEA 4Q3DA 2UVDA 3MTJA 3ZW8A 2X8LA 4J7CA 3HE3A 4A73A 2JJYA 2OZPA 1QLHA 3LZ6A 3GEGA 1SOVA 1ZK4A 4ONEA 1K6XA 3G3EA 4DC1A 3RCBA 4GVXA 4CR7A 3DAGA 3S55A 4EW6A 2VRCA 4RQTA 1PS0A 2ZJ1A 3T4EA 3T7EA 4F3YA 2PKRA 3WTCA 4N5NA 4YAGA 2UUOA 3DOOA 4FFPA 3VZRA 5KNLA 2DTDA 1DLIA 5I7FA 5BSFA 2JHGA 1G1AA 5G4LA 1DAPA 5L7YA 3NX4A 1CEQA 3WXBA 4DIOA 4J6FA 5L51A 1NR7A 4MVJP 1QYDA 4QX6A 2Y66A 3UN1A 1LC0A 1UZMA 3D3EA 3F47A 4H16A 1UP7A 2X0IA 2RHRA 3RKUA 4UVEA 3JYLA 5DN9A 5EQFA 3L6DA 3TJRA 1AXEA 4HKTA 1U5CA 4YT8A 5I8WA 4RZIA 4M55A 3C85A 4WCFA 1T1RA 4HFMA 1NQOA 4HXYA 4L4RA 1CETA 1HE5A 2NTVA 4IS3A 4WOKA 3FN4A 4E30A 4YAKA 4DLAA 3JYQA 1SB9A 2XF8A 2JFFA 1JWBB 3R3JA 3OEYA 1NPTO 3QHAA 1SZJG 3CKYA 4XQGA 3OIGA 4IIUA 3PIIA 1O5IA 2AHRA 2O3UA 4FD3A 4ND5A 4NQZA 3JYNA 3PP8A 5IDWA 4YT4A 4K28A 3WWYA 2JAPA 1B16A 4NHEA 2NV6A 2EHDA 3OIFA 3H65A 4F46A 4XR4A 2VHYA 1YVEI 1BDMA 1DEHA 3F6YA 1V0JA 4YQYA 3ZWCA 4UVIA 5DP2A 2QZ9A 3U4DA 4BO6A 4IM7A 1I3LA 3GZ4A 3KHUA 4MVJA 4TWRA 4RDIA 1PZEA 4GGOA 4LISA 1UXIA 3SX2A 5CPFA 5A05A 4FCCA 2VWQA 2YQ4A 3DWFA 3C7AA 5JBIA 4GSLA 1JAYA 2Y0EA 2RH4A 3SJUA 3A9WA 5AXBA 3WGIA 4CL3A 4H7PA 4B4VA 4CUJA 1X13A 1WLYA 1E0DA 3ADOA 3RI3A 2J5KA 3CSDA 1YRLA 3Q0EA 4OH1A 2E48A 1ZNQO 1XDWA 1HDZA 1LA2A 1MLDA 2OORA 3MJEA 5H81A 3TOZA 1DRWA 3A14A 3UHAA 1DXYA 4D3SA 3T7CA 5A03A 4EEXA 3GA0A 3GMSA 2X5JO 2Q4BA 4XYMA 3GNSA 3VZQA 2J3HA 5IZCA 3CIFA 4R1NA 2A35A 2ZK7A 4Y6RA 1VI2A 2ZB3A 3AM4A 4II2A 3W6UA 5A9SB 3UCFA 2W2KB 1YBMA 4JQCA 4FDAA 3KXDA 2RBEA 3H7AA 4DYVA 4AJKA 3GEMA 1O0SA 2D3TA 3BMQB 1XR3A 1I32A 4Y8VA 3B20A 1I24A 4ZRMA 4PLWA 1W73A 4W99A 3K2EA 5K9ZA 3OA0A 1VKOA 3E48A 3FHLA 5I8ZA 3ZHBA 5CDGA 2Q46A 4YJFA 5JPIA 1Y5MA 4EZBA 1R66A 1XG5A 3KO8A 1C1XA 2RH8A 3HB4X 1ZK3A 4UEJA 5EN4A 3F4LA 2D1YA 3PLRA 4CR6A 4J16A 3K30A 5JC8A 3VAZA 4PZEA 2YDXA 4JROA 5JAQA 4GL4A 1BWSA 1ISFA 2VQ3A 3BYZA 4QXMA 4Q3AA 1E3WA 2PA3A 3NT4A 4HX5A 4UEKA 2HCTA 2OGUA 4Z9YA 4B7XA 4P4GA 3WTBA 1EDOA 1O8CA 3ZHZA 2WSBA 1V8BA 1LLCA 1H6BA 2ZCUA 2VOEA 4NBWA 1H9AA 1XQ1A 3ITKA 3PDUA 3V8BA 2QW8A 4AJJA 4CM6A 3B6ZA 4LSMA 1Z7BA 4PLPA 2I66A 1M6HA 4BV9A 1WXDA 2DFVA 3D5QA 2WD8A 2C59A 4TRNA 3TZ6A 4PZDA 2VNAA 3VPSA 4CM4B 4JNKA 1BMDA 4R9RA 2DLDA 2QHXA 2ZTVA 2VHWA 1XLTA 2DQ4A 3G0OA 3TPCA 1QLJA 4N18A 4B7UA 2QG4A 1HT0A 1ZO8A 2AA3A 1C14A 2V7PA 3ETEA 3M1LA 3HN2A 1LU9A 4AJIA 2HLPA 3RBVA 1YL6A 4XDZA 3RUCA 4UVGA 4RJTA 3GF4A 3JV7A 3ONFA 2BGMA 1FDVA 3FR8A 2IEDA 4LGVA 4FGWA 2OO5A 5J23A 1W0CA 4ZVVA 1IYZA 1HDXA 3IOYA 2DUWA 3PGJA 3E1KA 2IZ0A 4L73A 4BOYA 4ITUA 5TJ9A 1XA0A 5A04A 3NDIA 5G0VA 1R12A 5HS6A 3DBRB 2VWHA 1Y8QB 4R51A 5A9RA 2EGHA 3FPCA 4IMRA 4Y6SA 3CE6A 4JBHA 2OL4A 1WNTA 3VH2A 3VKVA 1XGKA 4CUZA 5L7TA 1PS9A 2GYYA 3FBTA 1FDUA 5IG2A 4GI2A 4YRBA 1A4IA 2X9GA 3B1FA 3ASVA 1SCUA 1GL3A 4J2OA 2VNSA 1JVBA 1DLJA 4MP3A 1E3SA 3PQEA 2B5WA 2PLAA 3P5SA 3ZN2A 4IDEA 4RF4A 4IDBA 2J3KA 1Z73A 3E9MA 1UR5A 1P77A 9LDBA 2FOIA 2V6BA 3WJAA 1XYGA 4YT2A 2CF6A 3PTZA 3NKLA 1HLDA 3CZRA 3GR6A 1IOLA 4OYRA 1F17A 4FSHA 1LUAA 5U4QA 1F06A 3GMDA 4ALMA 2I6TA 2BHLA 4A5OA 2DUUA 4J7XA 3LU1A 2AE1A 3ZWMA 1ZKMA 1TT5A 2C20A 2CDCA 4HWKA 4J2HA 5C37A 1BDBA 5I7SA 4NNJA 3DBLA 4B7CA 2DPHA 1EK5A 2J3IA 5CAEA 1E5LA 1VSVA 2Z1NA 1I36A 4XYEA 1TB4A 5C7IO 1MV8A 1FDSA 1NPYA 2NVUB 1ULUA 3HDQA 2UYYA 2NADA 2Q1SA 2ZYDA 4B8ZA 1JLLA 3MJ4A 2DKNA 1PL7A 2JL1A 2H63A 3WDSA 4WLEA 3PFWO 3UICA 1DBVO 3OA2A 5JC1A 1J0XO 2R00A 3LT2A 3M2PA 4PZCA 1B8PA 2VHVA 1VSUA 4ALKA 2VOJA 4U7WA 2HMUA 3I9MA 4Z3DA 3L77A 5CEJA 1Z82A 3EY4A 5DOZA 3EHEA 4FR5A 4CLRB 3VTFA 1YONA 2EJWA 3BMCA 3KSZO 5TNXA 1BXGB 1PJLA 3V1YA 1PGQA 1ZH8A 4J9UE 3ZU5A 1DIBA 2H9IA 1UXJA 1ISGA 4RF2A 4RPJA 1M6WA 3DAFA 4TKLA 3NJ4A 2C5AA 4RL6A 1P44A 5F1PA 4GKBA 1KVUA 1ARZA 2VUTA 4G5HA 4BNFA 1ISMA 1MB4A 4QSMA 5HS4A 2O7QA 1D3AA 3O8QA 3O4RA 4IDFA 1FDTA 3IS3A 4M89A 2Y1GA 1MC5A 1OMOA 1R37A 1NX6A 1TEHA 1YOVA 1UZNA 3LDHA 3SVTA 5EL0A 1V3UA 4DYDA 1PGPA 4R3NA 1Z75A 4XGIA 1MA0A 4Q39A 3VDQA 3BZUA 1HYHA 4FJ2A 2Q45A 3KVOA 3FNFA 3KEOA 1N7HA 3JQ9C 3FNHA 4XB2A 2E6UX 4WCFC 4HFRA 1LLDA 2R2GA 3HG7A 3ZV5A 4CM9D 1KYQA 2YY7A 5LDHA 1RKXA 3GFGA 4J0EA 4DQVA 2AQKA 3QW2A 3UAGA 4IJWA 4D46A 3GG2A 2V6MA 3ASUA 3PZRA 4GQAA 4IXWA 1I2BA 1E1KA 1ONOA 5ILGA 2LDXA 1D7OA 1ENZA 3AI2A 3MWEB 4Q3CA 4OGWA 4BNVA 1NHWA 3OSUA 3OM9A 5CG1A 4R5MA 4AL4A 1LLQA 2DTXA 4FOSA 1QV6A 3ON5A 5IN5A 2VT3A 1IL0A 3AUUA 5IFLA 1JQBA 4BO7A 3D1LA 1IE3A 5IDXA 5L4NA 5DZSA 4K1LA 4I5DA 2D5CA 3ENNA 1LNQA 2C7GA 1ZVMA 3H2SA 4NBVA 1HDRA 1XHLA 4ZICA 4BMVA 3VPFA 1KEWA 3SBOA 3JQEA 1XIVA 1IUKA 3ZWVA 4IQGA 3GVIA 4K6CA 1IHXA 4NK4A 2YV2A 4J4TA 1BXZA 3ZWYA 2RAFA 3KYBA 1A71A 2CD9A 1P31A 3ETDA 5U1PA 3G17A 5ITVA 3GPDG 1CDOA 2CY0A 1PJTA 1E7RA 1LRLA 2HJRA 3DEYX 2OFPA 3RFXA 5IZCC 5KJFA 1N8KA 1WP4A 2RCYA 2DBVO 4YB8A 5AYVA 2IZZA 4UUOA 1KEUA 4YBZA 3M1AA 4BVAA 5T57A 2BF7A 3LVFO 2QQ5A 1KVQA 2VN8A 4XX0A 4B3JA 3ROQA 1T25A 1HYEA 1XU7A 3QQPA 4UUNA 5FYDA 3NDRA 2QX7A 2GNAA 1WAMA 1IPFA 4YWJA 4MVJF 5TC4A 4R4JA 4J91A 3QWIA 4NFHA 5TRTA 1XKQA 1GYQA 1VJ1A 2NTJA 4LN1A 3S2EA 1R4NA 4O1MA 3WBBA 1ZEMA 3QWBA 4O0LA 4BNMA 4YAJA 5KKAA 1EMDA 3RC9A 4CMBA 3E82A 3EYWA 3IIEA 4BO5A 3ZU2A 1TVEA 5A5FA 1EUZA 2P2SA 3JQAA 1E7WA 3UUWA 3SLKA 3PFFA 2GERA 1K0UA 3KBOA 4CQLB 3D4NA 5TS3A 1HDOA 3AU9A 4CMIB 4RF5A 3KYCB 3QWHA 1NM5A 4ND2A 4U6SA 4D0SA 1B7GO 3K31A 4ZQEA 3U4CA 4INAA 4BMNA 7MDHA 1Z6ZA 4BQPA 3UFXA 3MCVA 2B4TO 3E9NA 3I4CA 4JBGA 5COAA 1PGOA 1YJQA 2CVZA 2FPPA 1IULA 2AG5A 4XZ3A 1LXCA 4UAGA 3IL2A 1PQUA 4NFSA 2BI7A 1ZXLA 4RLSA 1T24A 3C1TA 1XU9A 2VYVD 1IY8A 1NASA 2P5UA 1I3MA 2X5KO 4D79A 1N2SA 1I33A 1P0FA 2G0TA 2YW9A 4MIEA 4FGSA 1K3TA 3K92A 3TFQA 1R4MA 3HWRA 4ZD6A 3RIHA 4N7RA 2JD0A 1YDWA 1L7DA 2P4HX 4E2ZA 1N1GA 5CFZA 1UH5A 4XGNA 2X9VA 2EP5A 5A4DA 1E3JA 3WBFA 2DPGA 3PWKA 5T8KC 1TA4A 3EC7A 4EITA 1SO8A 4EBFA 1ZUD1 1PZGA 2XAAA 1JKIA 1ZMTA 3AOEA 4MP6A 1SPXA 3E5MA 1MXFA 4K9DA 1F12A 1V3VA 2P5YA 3O38A 2ZTUA 4QEDA 3PWSA 3CMCO 3AJRA 4RVGA 3VC7A 4J9VA 2FN7A 1ORRA 1YDEA 1R16A 2BKAA 3DR3A 1ZEJA 4MVJM 4LCEA 1N92A 4E21A 3RASA 1NAIA 4DPKA 3FBGA 4XEHA 2FR8A 4RF3A 4DQXA 2NVWA 2O3RA 4DLLA 3G1UA 4RVHA 3W8EA 3GVPA 5DP1A 1OFGA 1AXGA 1SB8A 3PXXA 1ADBA 4WEOA 3V2HA 5JO0A 2WEKA 1IZ0A 5G0TA 2OBYA 4NBTA 4CLEA 2GUGA 3MJVA 4Z0HO 3PQDA 4YJDA 4YAEA 4O5OA 4WKGA 4K26A 1UXGA 4FB5A 4WEQA 4IGEA 2P9EA 1LEHA 4XRGA 3MJSA 4BO4A 4BNGA 2X5OA 2BH9A 3JD1A 2EJVA 2EKLA 3GN2A 5BT9A 2P9CA 3R6DA 1YBAA 4CV3A 1D8AA 4IGFA 4PN3A 4DUPA 3BMNA 4CMHA 5IXYA 2YFHA 1DC4A 2OUIA 1TI7A 1GY8A 4CLOA 3AUSA 1E3IA 5JO9A 1KY4A 3AOGA 3RUIA 1GCUA 1GADO 2Q1WA 4YACA 5COBA 4GSKA 3TRIA 2R00C 2O3TA 2HMVA 3DOCA 5BQFA 2VHXA 4TRJA 4S3MA 4KDFA 4DXHA 3GFBA 4BS9A 1B2LA 1YE3A 4S1VA 4ZRNA 4CLXA 2C2YA 3GDFA 1GFSA 4PG6A 3GDOA 1DSSG 5T6BA 1KVSA 1MXHA 4J4HA 1LDGA 4O6VA 4PVDA 2CZCA 4BKPA 3KSUA 4L8VA 4RPHA 2I3GA 1AUPA 5MDHA 4A7PA 3HJAA 1O6ZA 1PTJA 3DZGA 2FZEA 4JJGA 1U3WA 1J4AA 2X0RA 5TT1A 1E6UA 4PLZA 2BELA 4I9UA 4TVOA 3BIOA 2YHUA 4YT5A 4W6ZA 1UAGA 4D3FA 4TROA 3D64A 3IMFA 1PIWA 1PR3A 5L4LA 4DLBA 1RJWA 1ZXBA 5FI5A 1FJHA 2A4KA 4JBIA 2I65A 3AI1A 3C3XA 1ML3A 1JDJA 3PYMA 5JCXA 2AQIA 1XWFA 4PG5A 4Q3NA 1JW9B 5EINA 1BHSA 3TN7A 5JE8A 4BB5A 4DC0A 3QV1A 1LI4A 1QORA 3U3XA 3V5NA 3U49A 3ZV4A 5AQ1A 5I7VA 4XYGA 4PLVA 3NTQA 1T4BA 1LSJA 4HBGA 3X2FA 4DBZA 4JP2A 5BR7A 3K5PA 5AXDA 3GZNA 4YJFB 1Q0QA 3H5RA 5JXWA 4JX8A 3DL2A 1C1XB 3GVCA 2VHZA 3TZCA 1IZ9A 3WFIA 4RV9A 4JCOA 5TJHA 4I5FA 1U1IA 4ZJUA 1I2CA 4D0RA 2PNFA 2I5PO 2JCVA 3EZYA 1X14A 3LC1O 3W8DA 1T2AA 3JQ9A 3L6OO 1E3WB 3A28A 2O3SA 4KQWA 4WLOA 5CDTA 3JD0A 2PH5A 1FMCA 4N5LA 1U28A 4YJGA 4BV8A 3KV3O 4Y6PA 4CV1A 3PDJA 2X22A 1HF3A 3HHPA 1Q0LA 4CV0A 2HO5A 3DDNA 1LJ8A 4ZHSA 2X0JA 4ILKA 2CDBA 1DPGA 1HDYA 4GKVA 2DM6A 4XJTA 1U8FO 1JVSA 2C29D 3PRJA 3ZNNA 4BHTA 4R41A 5CEEA 3TZQA 4BGIA 4PLFA 3O26A 4O59O 3GDGA 3BMOA 1HSOA 4E2XA 1EZ4A 4DPLA 3Q11A 4FN4A 5G0UA 2ZTLA 3H4VA 1Y5RA 3DBHA 4U0KA 1B15A 4YDRA 2Y1CA 3KETA 1EQ2A 4EUFA 1ZSVA 3PWZA 1HZJA 4AFNA 4RVUA 3TL3A 4MO2A 3RU9A 4WCDA 3S2FA 3MTGA 5A06A 5H82A 2I3AA 2VYVA 4BL5A 4KZPA 3GQVA 3FTNA 3KEQA 5FFFA 3HNPA 1LSUA 1J5PA 2O48X 2Y67A 4K6FA 3QVWA 2HSDA 4Y9DA 4NIMA 1PGNA 4C4OA 4FFRA 1PJ2A 4PLYA 3ZHXA 3U0BA 3ZWAA 4CQMD 1O94A 4BUCA 1HDCA 5ER9A 5BSEA 2PZMA 1GAEO 4J90A 2RHCA 4ND3A 4LMRA 1TXGA 5ENVA 1GUZA 4BKRA 5KJCA 3WG9A 1NBOA 4Z0TA 5F1OA 5AXCA 3C7CB 5TLSA 5LC1A 4IS2A 1YXMA 3GHYA 1KIFA 5FEUA 3DMYA 4IXTA 4D43A 5HRUA 3QVSA 1U5AA 4MPDA 3KTDA 3S2GA 3AUAA 4AG3A 1Y81A 4LVCA 3VPXA 3C1OA 5DBFA 4LCJA 4CJXA 4AJ1A 2HRBA 2GZ2A 2Y0CA 3CH6A 1CRWG 3PYLA 4BNJA 4YYZA 2YJZA 3TOXA 2VTDA 3G79A 1TT5B 2GZ3A 4P8RA 1YQDA 1VJ0A 3ROPA 1PL6A 1KVTA 1GYRA 1LRJA 3LSYA 2CUKA 5ICMA 3DBLB 3FF4A 3TZHA 1J6UA 3MZ0A 2VT2A 3C24A 4OIMA 4LVUA 2DBQA 1UUFA 1CWUA 4E2YA 3W4JA 1C1DB 3KM0A 5GMOA 1N5DA 5C7OO 1NHGA 4DA9A 1E1NA 3AK4A 3WGYA 3U4IA 3ZWOA 1H5QA 2ZB8A 2D2IA 3D7LA 3UCXA 4IPTA 3DMTC 1PZFA 3NDJA 3S8MA 2O2SA 3ZWBA 1PJQA 3Q2KA 2C82A 3PGXA 5CDYA 2WMDA 3I6QA 1GYPA 1HEUA 4MKRA 1Q7GA 2HAEA 2OBNA 4PG4A 2QZZA 3RC1A 4PLGA 6ADHA 1WPQA 3AOEC 1NVMB 3DFUA 3OP4A 4XYBA 4D41A 5CPBA 3WICA 4CMAA 3BMCB 4FC7A 3SXPA 1B3RA 1YJ8A 2PGDA 5G0SA 2UUPA 2NTNA 3QA9A 4DTIA 4XYLA 4IDGA 4BO9A 1NAHA 1PX0A 1GUFA 3AU8A 1PGJA 3I52A 3PHJA 4IQ8A 1CQJA 2AQ8A 4OO3A 5T8KA 1HRDA 4FFOA 4LSWA
chains in the Genus database with same CATH superfamily
2QJRA 3G7UA 3CUEF 2G4CA 4FQ7A 1PNVA 2D0IA 4QARA 3T4UA 3INNA 4UJ3A 4FDLA 2PMFA 3C4QA 3SQLA 4RO0A 3O0TA 3EXFB 1AUOA 4L16A 5KVSA 2V6GA 1K6JA 3W7BA 2WKPA 1V6CA 1Q3HA 3D6VA 1N9GB 3JYPA 1IBKB 4DVJA 4H7FA 2VZEA 5DCUA 2C4HA 3ILYA 3NC0C 4RK0A 4E5KA 2IHUA 4DR5B 4BV3A 5DBGA 2VNIA 3L6EA 3HBNA 1E59A 3HDYA 3PG5A 1KDPA 2H0QA 4UTNA 5ERXA 1EEXB 1K8RA 1GGFA 2G08A 3M0EA 1X15A 1KO8A 4OL0A 1NLFA 3IPLA 5DNCA 2ZB7A 2X2PA 3P4UA 1F5NA 1OLXA 1YQWA 3LW8A 2BP7A 4UZSA 4ZI5A 4CT4B 2FZGA 4L8GA 1CY1A 2ERCA 1JI3A 2CJPA 2Z8XA 1BG6A 1YE8A 2VTVA 3FUCA 3H5NA 4QYIA 4AIRA 4RTNA 4F2WA 3Q8KA 2WWIA 4GSYA 3IUJA 1VPEA 1Q2XA 2D1QA 2WTMA 4HPXB 3TOSA 4UCWA 3DXYA 4D9KA 1C29B 4Z4CA 3QLVA 4D3ZA 1N25A 3TD2A 1FSPA 1ENOA 3DTVB 4GZLA 1EVJA 1GTMA 2ONYA 1L8XA 4WY8A 4NMHA 1BWRA 3NOQA 1CQXA 1U9JA 3NORA 4XPIB 1W59A 5IK2D 4X6YA 2OTCA 2Y1LA 3AR6A 1D6MA 3EFEA 1FYWA 3A4YA 3GCZA 2B8JA 1TK3A 4LTNA 3WYCA 1CB7A 3C16C 4G0QA 3T34A 3ZWNA 1G7CA 1X7GA 4EI2A 3IBCA 5DH9A 3WIVA 4BNLA 1IDN1 3GFVA 1DIOB 1M75A 3VYTB 2W2LD 1A2OA 3ENWA 4IL5A 1K7FB 1K6EA 2PMCA 3KB6A 3ONDA 3EXIB 3P0FA 4KXVA 4YDQA 1YTUA 4KU4A 5ELLA 5K0TA 1MKYA 4MZDA 4MICA 1DKQA 2FQ1A 3HJUA 1UDWA 3CT6A 2J8ZA 1PQWA 2IIPA 1X80B 2WWYA 4LE1A 1ZISA 1TVMA 2HQOA 4LX8A 1CUBA 5K8CA 1KTIA 5LWHA 1QV9A 4JA2A 1RJ9B 2K2WA 4BVHA 2EWWA 5JCZA 4HNHA 4OQPA 2YQ5A 2Z98A 4R8MA 5KDLA 2TMKA 5BUQA 3ZPXA 2ZKLA 1H4VB 2CNDA 4G0MA 5KYVA 1U0SY 1Y9AA 4M99A 2QPTA 4OOFA 1E2EA 4FFMA 4NKRA 1Z5UA 3U9SA 4RDHA 3RROA 3SYMA 5BN1A 2P9TA 4AKIA 3NNNA 5KX5B 1H5NA 4BKUA 4U7HA 2ZE7A 4KWIA 3U44B 1N2ZA 1QM5A 2NWQA 2NZ2A 2OHOA 1XJWA 3CUSA 1S2LA 5DYNA 1PSDA 2F8SA 2FSGA 3F8TA 3PUHA 3ZHRA 3O7MA 3CRRA 2GJ4A 4FS3A 3M9XA 4AF8A 5C7LO 2P6RA 1B0UA 4P84A 2XR1A 4FZVA 3KXPA 4CKEA 2PTGA 4E12A 2P5SA 3FNQA 5FQOA 4OHKA 1BVHA 3L1JA 5G4KA 2I54A 3GV0A 1S6YA 1SN7A 1IU9A 2BGLA 5D5PA 2Q5LA 1ULZA 2Y1KA 3JTEA 2QN1A 2Q6LA 4MB2A 3QWFA 4XQCA 3VH1A 4KOEC 4LY0A 1Y4UA 4HPJB 1U6IA 3PKZA 2MOKA 5THQA 3CLRD 1FNDA 2GEUA 3INRA 3QTTA 3RT9A 1THZA 3BHIA 4L5BA 3W2GA 2X8WA 4OGFA 1CS0A 4BXOB 4BYMA 4XIJA 1XCBA 4CU2A 4YALA 2JZOA 2PSEA 2VCEA 3MMXA 1WBJB 1P4AA 3R3VA 2DBYA 4IUYA 4PQEA 1GA4A 4FOOA 1SK9A 1U2GA 2X58A 1HE4A 1FNNA 5A7GA 2NO6A 2GHRA 2Z0MA 4AKGA 1SBZA 4ZO6A 4G36A 4JSRA 1SNYA 4R2WA 1DBIA 2V0GA 5BMVA 3JQAB 1Y34E 4QGAA 1FRVA 1H0SA 4WA7A 2LCIA 3K0KA 1GU7A 1T9AA 2QX8A 1V43A 3OZBA 3WMWA 3JZIA 1PZXA 1Q7BA 4R2LA 3R9WA 3JPYA 1TAHA 2LCFA 3COWA 4FPXA 2YN2A 5GJCA 2DYKA 1KXJA 3RUHA 2IY9A 3RU2A 2DTEA 3RSSA 4PSCA 4F6CA 1ZDMA 1YRYE 3OFND 3AM5A 4NYMQ 4WI1A 2XEDA 5BN5A 3FPSA 4L0DA 1ICEA 1YZFA 3KZVA 4Q4JA 3WFZA 3HXQA 2LIPA 3MOGA 2VAPA 2AT1A 3WWCA 5F7XA 821PA 2OGTA 3T3DA 2PIDA 3EHDA 4OHCA 1G6KA 2R6CA 4CGZA 4YMSA 5KYUB 5BW8A 3UENA 2A94A 2COUA 2FK7A 5JTTA 3EF0A 2O8DB 5E9JA 3FYUC 4XWKA 2WHPA 2Q7DA 5K0JA 3FZNA 3R24A 3PHGA 4WLVA 2QB5A 3D8HA 3M49A 1G60A 3T0FA 5F9MA 1HUQA 1Z45A 4O2AB 1Y3BE 2PH7A 1F60A 3A0RB 4RHUA 4JOCA 2AYYA 3ZCSA 3WIUA 1AZLA 3WLLA 1QZXA 5ELMA 1MPXA 4DLSA 1XZBA 2FZVA 3ESYA 4JI4B 4QNRA 4YRFA 2XHZA 1G9XA 2IV7A 3VKGA 2A1UB 1OLUB 1XZEA 3B8HA 4PZ0A 2HN9A 4ER0A 1ONPA 1GL7A 4QTZA 3MT8A 4ZU6X 3RIYA 3DMRA 1D2HA 2VRBA 1VL0A 1DOZA 4WESA 2ATEA 4CLHA 1FIUA 3EGIA 1V37A 2QMZA 3BWDD 3MJTA 4KIJA 5GV8A 3TNJA 2I9PA 5GOZA 3O03A 4EG6A 2WPDA 3AUKA 4OYLA 4Y30A 5CVEA 3V1TC 2GA8A 1AB5A 5EVJA 1EGQA 4C89A 4U7PB 2RHTA 5CYFA 3GUUA 3AF3A 2OFFA 3ZCUA 2XCOA 5J3JA 5DV9A 2BLLA 3RTDA 2GSDA 2JC3A 2Q1UA 3PJRA 2F3UA 4L0MA 1GFWA 3SIRA 2Z95A 1NE7A 1WKVA 2DHDA 4KXQA 2ZIZA 3CEMA 4OP1A 4UBKA 5KNCA 3BTVA 3CJRA 2JK0A 4G24A 4EFDA 4H1TA 3FSGA 4JV5B 1QZUA 2WJPA 5B4UA 3L4BA 3ZWXA 5D00A 1JPUA 4OXNA 5FLYA 4RELA 4DIKA 2P4QA 1UBMS 1B0AA 3KPVA 2MTBA 3MMSA 3FGPA 1XD9A 2QF7A 3OJLA 3TLCA 2NP7A 1NW7A 5FOWA 4DJJA 3OUTA 3LUDA 4FU0A 3TLGB 4ES6A 4V2UA 3VTKA 2Q29A 4OJKA 2XSZD 4PCVA 3ZLVA 1TO6A 1S9DA 1WP9A 4I9HA 4M3NA 1T2CA 2QX6A 4NLLA 4Y67A 5LJIA 3H3FA 3AEQA 3A1UA 4YI5A 1I7QB 4U9HS 2VJOA 2B6NA 3PC4A 2PRJA 2Q3JA 4KQ9A 3K1AB 1GPNA 3AZQA 1U3FA 3CVOA 5CVJA 4B81A 3C7DB 2O2ZA 1J2RA 1LGYA 3R1IA 2WUEA 3RK1A 3RIXA 3CGWA 3QG1A 2PMDA 4I5GA 3HP4A 3DAPA 3L9XA 1TCBA 4M1QA 4GMFA 4G0UA 1DFHA 2JLQA 1BKDR 2BV3A 3A1EA 4ZQCB 2P2DA 3OZDA 5TQJA 3BXOA 2XXJA 2HCRA 2WU1A 1WDLA 3IV9A 1N3BA 3KT6A 3FOEC 3KSBC 1Y63A 1JIJA 5KJ6A 4ZYWA 4WBNA 4DMLA 3K9WA 1Q0UA 1WA5A 2FLWA 1ACJA 2Z04A 1QO0A 4GX5A 3VO1A 2CSUA 4R16A 2PGIA 2Y27A 3HN6A 1AX9A 1PEDA 2B5OA 3QLJA 5ADHA 3GRKA 4U0JA 1WDWB 2AEFA 2XMPA 4GX2A 3SIWA 2FWNA 4CMGA 3GNQA 1THTA 1R5BA 2X40A 4X60A 4BNHA 3O83A 3RE1A 4EUNA 2QLNA 2LP4Y 2Y2UA 3DG9A 3OIDA 3WDKA 4Z5XA 1BA3A 2BGKA 1S7CA 1KEPA 2CC2A 2QEQA 4C0AC 1CUEA 5ALVA 2IVFA 2B83A 4Q9HA 5WRFA 9GPBA 5JD4A 4M9UA 2Q9UA 1XJQA 3H0KA 3H9GA 2NX2A 4X45A 1K7XB 1UDAA 4GLBA 5EIBD 3AEKB 4N0EA 5HQJA 2EV9A 2HMWA 2IYRA 3KTFA 3M82A 4FXPA 4MCHA 1GT6A 5CB6A 2GVDC 1FFBA 3MWEA 4RD2A 4R3WA 3EDYA 1E99A 1P9LA 3DMTA 5I4IA 5DU2A 4K9PA 2DU8A 1MCZA 1IXRC 5JFOA 1UZLA 4G5GA 2JCXA 4WUVA 4TWZA 4HF7A 4MULA 3RVJA 2WAOA 4MAMA 4DFDA 4OHBA 1ZBQA 2Q0HA 2PBRA 3OI7A 3Q1LA 4TN5A 1VBKA 4TMTA 3GVXA 5AM4A 4GAEA 1MEOA 3EOAI 1HY3A 5HF9A 3UK7A 1JDZA 5TX7A 4BKQA 3USES 5KHLB 5A1TA 4EF4A 3UJHA 2QY9A 4KODA 2R8ZA 1QP8A 2UAGA 4GBJA 1ZOLA 3LXXA 4LYEA 3KJXA 2B20A 3A6EA 5A1JA 2WFAA 1J5EB 1WCV1 2X6TA 1KI6B 1RYYA 1Q44A 2HTEA 4YRAA 5JYEA 4HQ0A 4UXHA 1C4XA 1GAJA 5HKBA 1AKQA 4JWKA 1QRSA 5L3SA 3D2CA 1NMZA 3DTNA 1VKJA 4JB2A 2EW8A 2CNWD 4CMKA 4KJZA 4HDMB 1KETA 1QHXA 3TIXB 1KH3A 1E1LA 1NNSA 4DDKA 1BYUA 2A9FA 4NRDA 5AK4A 4FBLA 5AK0A 5BNTA 2FI1A 2YHIA 3A6LA 1EFLA 4DCJA 4L4SA 4BN5A 2A4MA 2RK6A 2V0NA 1OGIA 1ECFA 4GECA 3AFHA 1PYDA 3W9BA 3WO1A 2VYNA 3ORYA 3L04A 4OLFA 3WGZA 1MT0A 2YFKA 3GRVA 4F7DA 3GAZA 3I05A 1F0PA 1P81A 3DVSX 5JMWA 1REQA 4G2NA 1AO3A 3IV7A 4N12A 3ZBTA 3QE2A 5T7BA 4LJ5A 3A06A 3L43A 4FLEA 4GHWA 2W6JD 3QPBA 4MRRA 3EIXA 5DW0A 3PFNA 4UTXA 4WVLA 4ZQBA 4YUAA 1QS0B 4QO7A 3DULA 3O92A 3ZHOA 1O1YA 3NMUF 3OPQA 5L45A 4YJGB 3U48A 4CEJA 5TB5A 4AKTA 4NNPA 3S2IA 3O91A 1K7SN 4L7QA 4MRVA 3U1VA 1EM8A 4N54A 5HHTA 4HDNA 4HX9A 2ZRHA 3BH7A 4Z7NB 3H9BA 4IH4A 3RM3A 2EVWX 4TQGA 3LS2A 1JHDA 4IWXA 5B1YA 1M66A 3D6JA 4MV3A 1D09A 3ETGA 5JALA 2HXSA 5KOJA 2H51A 3ZHUA 1JR3D 1BXRB 3WOHA 1EE2A 3QE0A 2OCXA 2CLSA 4RQUA 4UDOA 2A5GA 5EMHA 4C7KA 1QCZA 3Q7QA 1NDQA 5C8DA 3TGLA 1TKAA 5HKLA 2VCHA 1JUDA 2HK9A 3A1VA 3ORFA 4GLLA 4AECA 3W5CA 5TQ0B 5KDDA 1EUYA 3GLGE 1Q7TA 1SCKA 2YW2A 4IR7A 2QVXX 4ZCQA 1BJTA 1OVMA 3U60B 1E7QA 5ITZA 3U13A 4ZTUB 4WOPA 1NBWB 1SU8A 5LNK6 1FTWA 1Y37A 3NB0A 3PE3A 5FI1B 3RQIA 4XLTA 1W8DA 3SK0A 4BFSA 1ISHA 1SZPA 4BQOA 2HEIA 4CKYA 3V7NA 2GZ1A 3AIKA 3W79A 3ER6A 5AM3A 1GTG1 1OLSA 3QFRA 2IU0A 3PDIB 5ALGA 1A69A 1C8LA 1NDUA 1OJLA 2YC2C 3B6KA 4TQAA 4GPTA 4U8GA 3VYWA 1A9RA 6LDHA 2Q6VA 2XTMA 1JU4A 1O77A 4W7HA 3TO5A 5LA6B 1ZCBA 3AF5A 4QPNA 1BWQA 4IZHA 2IYVA 4BBZA 4YN3A 5C1OA 1ACMA 4HLUC 4NU8X 3TDNA 1K88A 4KVAA 3DHWC 3QVKA 3VTZA 1BX3A 1C3OA 1GDDA 4UBJA 3N8IA 1PV4A 3P2YA 4HQ6A 3ANMA 1YZLA 2V4UA 2VP4A 5GM1A 3KLOA 1SQFA 4AX4A 3RS5A 1RPTA 4QDXA 2PZEA 2Q2VA 4AX8A 5IJ0B 1O96B 2OK8A 3IQHX 4D45A 4YAUA 2QUKA 2XD9A 2XZLA 5NULA 4ZVKA 3UAYA 1YHYA 4XDYA 3T8YA 3OCYA 4ZDKA 5EKXA 1P5JA 2AUMA 2SBTA 3GH3A 4FSDA 2UV8A 4WNCA 3PF9A 4BGUA 1E6EA 2WZDA 3N7AA 1NRXA 3I39X 2IPLA 5T3UA 2AG8A 5DT9A 4D3DA 4DAEA 1SXJC 3AV0B 1EGAA 3B7GA 5IH7A 4AQDA 2ILTA 5AJWA 3OECA 1QHEA 2I99A 4FXOA 1MX1A 2C1ZA 2WSSA 4MQ6A 4FEAA 1SCIA 3QF4B 2QKYA 4MYSA 4A16A 2ZTMA 2YJ4A 4Q12A 2EEZA 2ZCVA 4BC1A 6Q21A 1N77A 2YYAA 4QEZA 2V8OA 1BX0A 5T4EA 3SNHA 4Q4HA 3NYWA 1MU0A 1I6WA 1LK0A 4JCCA 4DCSA 2QLLA 4UHCA 2JRCA 1TJPB 1NU6A 3NHUA 1N6KA 1M76A 4M54A 4RHTA 2VF7A 3FR7A 4YAIA 1CR6A 3O95A 1MP0A 3UJDA 4E08A 1DWPA 3DZJA 3AVOA 3OLYA 1QZTA 2DPYA 1BVUA 3JYOA 4WFQA 4AUKA 1P0IA 2QYHA 5HM8A 3N2GA 1OB2A 2DXIA 4HNTA 1FTYA 4BLVA 4EPRA 2GHTA 1ODJA 1UBHS 2PT9A 5FBLB 4DR6B 2IHVA 4C0SA 3RSGA 1RQXA 4X3OA 1AV6A 1ZJ4A 4PXSA 4Y9UA 2V7QD 2AQHA 1NZDA 1VRWA 3QJ5A 3COZA 1R0RE 3QEJA 4NV3A 3URKA 1U8UA 2EKQA 1JG1A 5KTPA 2ON6A 4TKVA 3B70A 2X76A 1NPDA 3RQSA 3CFYA 2R86A 3C5HA 3Q87B 4XLZA 3S1AB 3FNRA 2VYCA 2EKPA 3ZKWA 1R5NA 4C0JA 2A0YA 4RK7A 2XUGA 4L50A 2UZAA 2I6XA 1E58A 2CVPA 3HDHA 4DA0A 3D8UA 1V9LA 4QU8A 1NGSA 5LUBA 5AM5A 1WPXA 1J20A 1EGHA 4KPFC 2MJLA 1L4YA 1T4DA 4UFNA 3P20A 3ZCRA 1PJSA 4E15A 2HHHB 4X44A 3HRKA 3D5TA 3H04A 2HZBA 1SBCA 3HTXA 3FDZB 3OF3A 1VKZA 2FXIA 4RJ2A 5JDIC 1YS1X 1YB4A 1EVZA 1T4CA 1GTRA 4EEZA 4MKFA 1CQJB 4PCUA 3LM8A 4HQNA 4UHJA 3UB3A 4DS3A 3PUJA 3FJ1A 4AJLA 5AVZA 4U2GA 1GPUA 3TLBA 4Q4CA 3COSA 3G2QA 3WSTA 2C2OA 4RU1A 4F1WA 5DGIA 1BGVA 2Y1WA 3LPCA 2UU9B 2ZJYA 4CMEC 1SOWA 1OAKA 1QTQA 3IURA 1TL7C 4YO8A 1EFRA 1R2QA 3FUTA 5BV8A 1P74A 2WKSA 3FD8A 3PUZA 2CMHA 3RD5A 4EHBA 2VEDA 1JQEA 3F2IA 2X3YA 4QM6A 1XB2A 4Q0MA 2MSNA 4M98A 4URWR 3CZ4A 4A8JB 2O4CA 1SHJA 3NOOA 2PX5A 3JRNA 4GQBA 3AERB 4HMPA 4P32A 2AKYA 1T5DX 3QP9A 5FO0A 2C03A 3B1WA 4GC5A 3B1JA 1VGQA 3BHJA 1ZK1A 1XWWA 2BP7B 2CL6X 2C88A 2LZ0A 3DTTA 1PN3A 4C5AA 4X62B 4KYTA 4W5JA 1AUXA 2AC2A 4PQGA 1O2DA 1Q3TA 1U65A 4JIGA 4RGBA 1COWA 4Y2PA 3I73A 3PNKA 2XZOA 2ZWPA 1ZI6A 3B9RA 4KQGA 3LL7A 1SCQA 3QUCA 4EUHA 3ILVA 5K09A 5DW3A 4CF3A 5A5EA 4ZAWA 3UVEA 4ZRDA 2J0SA 3KHTA 3AZPA 4HRXA 1FRZA 1Y6RA 2O7NA 2QRVA 3NGLA 4YA6A 2B35A 2BR3A 1AK1A 2XQFA 3DEJA 3N0VA 1Q95A 4OBEA 4AJ9A 2I4OA 1SXQA 1JHXA 5LBIA 3BRWA 5LQAA 5E2IA 1OWOA 1IH8A 4A2CA 3RC3A 4B0OA 1ZUNA 1I4DD 4ABTA 3D2LA 5DWVA 4ZC1A 1U98A 4YGYA 1HTWA 4E4TA 5AW2A 3PIDA 5K51A 1U2RA 5IN4A 2OVFA 5K3AA 2KPOA 2IEAA 4WY5A 3DBIA 3UKOA 2AZDA 3NHPA 3LLUA 3N0WA 2C5GA 3I2IA 1NX9A 1ONNA 2OCPA 2X0KA 3PTLA 1Z34A 5LP6C 4KTVE 1UKEA 2F48A 1RLMA 2LBPA 4W8HA 4A8PA 4BNKA 1ABEA 3IOBA 3W8FA 5C18A 4MVCA 1VJRA 2P90A 2UKDA 2Y4OA 1XP5A 2YWJA 2GD6A 3DDUA 4TYNA 4KQFA 3SYNA 4RPGA 5DSXA 2EJBA 3K1TA 1WB9A 2ZDHA 2OESA 2QVYX 3QKTA 4EVQA 3SE7A 1UBUS 2JAWA 4BLSA 3K6SA 1FQJA 2L42A 3BKXA 3CLUD 2WBLC 4TWBA 4CKXA 1DC8A 4AS3A 2H6EA 1R3UA 1XQYA 1W85A 4MS4A 3THRA 4DMFA 1FFXB 2C84A 4JDUA 1AN9A 4MMYB 1L7VC 1ZWKA 1NTOA 4AJHA 1RZRA 3FGZA 4MDYA 4NOJA 1YKGA 3HO8A 1SVMA 2NZUG 2PKQO 1CFJA 2X1HA 5KPDA 4R2IA 4GVLA 1OI7A 1US8B 2PPVA 1P1KA 1Y9EA 2X2FA 3IIKA 4CKEB 2HHJA 4WMLA 4C3VA 3JQPA 1TTHA 5G4KB 2X14A 3CUYA 1FSGA 2EIXA 2CDAA 2XVAA 1W6UA 3OKPA 1IQPA 1DINA 3EWNA 4M1MA 1MZPA 2WF9A 3GLGA 3I64A 1THGA 1BFKA 1QGYA 3F2VA 3O8QB 5FAXA 2ZULA 4ND1A 2Q5QA 3T5BA 4TL7A 5LP6F 2ZRNA 4HMOA 1G6Q1 2BF4A 2N47A 1LW6E 1NMXA 1V4VA 5E9AA 2OG2A 3O0DA 2WM3A 2HK7A 3A4NA 3AR9A 4QD3A 3AEUA 4HZGA 3EAGA 3AY6A 3TTTA 1SUAA 2GBIA 2QVCA 4IBOA 5M3BA 4EGQA 3EMKA 1SBNE 3JZDA 2VH1A 4WLFA 5KJEA 3O73A 4D4HA 1EE1A 5BMVB 4RPKA 1N36B 3FKSD 1E1DA 3UCEA 4CCWA 2MCFA 3TAXA 1C9KA 2IPMA 2P35A 2Y1FA 3U4HA 3VR2A 3PFGA 1NULA 3CX8A 1L5HA 1C0PA 5KNDD 2X3UA 3KTAB 2BGRA 3LKBA 3CLRC 4WXMA 4TRMA 5HMMA 1TPYA 2VTKA 4LTDA 1RSZA 1OWLA 3DDWA 1HDEA 5JSZA 2AWNA 4H6VA 4TMYA 3DJYA 1X1TA 2Q49A 4P08A 5BN5B 4DIFA 3MEQA 1PL8A 1DUVG 4QTXA 3TDKA 3RYFA 1GD1O 3BIJA 4Q4JB 1VE9A 3L06A 3QU2A 4TMXA 4F2GA 3ICPA 1OFVA 5C1BA 2FR1A 3WQQA 2POQX 4BYGA 1L4LA 5JAPA 1OWMA 2HH9A 1SUFA 3H2HA 4KOAA 3UB2A 3BSFA 2C5HA 3Q0IA 4JT9A 1G6HA 3R3WA 2ODWA 2H1VA 4K86A 3QFTA 1NQXA 4RFLA 1SVIA 1PW7A 5CLGA 4YJKA 5AUPB 3HKEA 4Q1VA 4ROSA 3DZBA 1RPNA 1RXWA 3WGKA 2IXFA 2QMQA 2P2ZA 2WKRA 4OPMA 5K6AC 4JLAA 5I4BA 4QUIA 4C2BA 4UUBA 2FPLA 3HVUA 1BXKA 2TYSB 2NT3A 3QKSB 1T9HA 2NO1A 3CF4G 3R6WA 4P7FA 1XZHA 2DZDA 2Z5LA 4JT2A 4RACA 2D2EA 4ZVNA 1VKNA 5BT9A 1ETUA 1I3NA 3RC7A 2UUCB 1DBQA 3EFHA 1Y3CE 3MHPA 1JJIA 2G4LA 4EA7A 4L15A 3RYTC 2QVBA 2G88A 2H1IA 4KYVA 4WLUA 3COPA 4GR4A 1NLZA 3INGA 2VDLB 4Q7MB 4DV3B 1TMOA 2QE6A 1HYGA 3IPRA 1NR5A 4DARA 1V39A 2VUHB 3CRNA 3BD7A 4QPCA 4MCIA 4BKOA 4E11A 3C8UA 2JNWA 1FFAA 2P8SA 5D6NA 3BF7A 3MYYA 4EO9A 2HCJB 3DNMA 5B7PA 2H29A 1ICIA 3RFTA 2ZSEA 3BFXA 4PYLA 4Y0AA 3CUWA 4RM3A 4DA8A 1G8FA 4R2MA 4TTIA 1KOFA 3KR1A 3UTCA 3LCRA 5A6SA 1YIAA 2B1QA 3T9CA 4MUFA 2FWJA 2XBMA 2PK3A 2GGSA 1JH9A 1NF3A 3UPTA 3PIRA 2V3VA 4G9EA 4J7UA 1MX9A 4FFBA 3HDJA 3MM4A 1GTL1 3CTMA 3OMLA 4GLOA 4R1UA 1YULA 3K0CC 1GEEA 1WKBA 2GCOB 2ZWVA 4G5OA 1E7MA 4M0KA 4OFBA 1TMYA 1UQTA 2Q4DA 3QXHA 5ES3A 1FQKA 5JNUA 1JDBC 3K1YA 1Z6AA 3D6TB 4MPRA 1QX4A 1H2RS 3L1UA 4IO1A 3FLAA 4BJ6A 4EG0A 5EIEA 2WV7A 4LOLA 1U0FA 4HD8A 4R6XA 1T6NA 2OGZA 2ID7A 3D31A 1AKEA 2D2VA 5AH0A 3IERA 1EZZA 4KQ6A 1XZAA 4I1SA 1E2DA 3BICA 3CSUA 3FVRA 4XKJA 5J5CA 3VC3A 1SBIA 1UM9A 4C0LA 5J4LA 4LKRA 3D0QA 1I2DA 1UK7A 5YASA 4LV5B 1YQXA 2E21A 4B6FA 2X1MA 5DCYA 2H5EA 3DMGA 2NUPA 2NACA 4PFSA 1L1FA 3AEQB 2TMDA 2V5VA 3OIWA 3KSDO 4LXYA 4MGYR 4DZRA 1U8EA 4RTJA 1VBFA 2GAOA 3FPJA 3H3XA 3UB4A 4J07A 5EC8A 4PCAA 5GONF 4KRFA 4RDCA 4JLDA 2E5LB 4C29A 3KSMA 1KIAA 1JA9A 4JJ8A 2A78A 2VF4X 2WIGA 2D54A 3LBYA 3A6ZA 5FULA 5IP5A 5BV7A 2YXLA 1Q19A 1A76A 2Q2OA 4I4NA 4BAGA 2E82A 2F1OA 1NUHA 2FUG1 3B1YA 4CG0A 4X90A 2B36A 2DFPA 3Q5GA 1V1JA 2FW1A 2ETVA 4E03A 1SCDA 1WABA 2ZREA 3G9XA 3UV3A 5KJ1A 1OF1A 2WTNA 3PRHA 1PQYA 1J8FA 1ZA2A 3OZ7A 3FW1A 1JBKA 1UPCA 4FIZA 1H94A 1NNUA 2GB4A 4KMSA 2V55B 1NY6A 3M8KA 3U62A 4RYDA 3BF8A 4CM5A 3K9GA 5AVWA 2EDCA 2BGJA 2HF2A 2NAFA 3GPCA 1RCUA 3O84A 1R4MB 5F7JA 4D82A 4G4SO 5JADA 2QZPA 2ZZMA 4E7OA 3AV3A 4KYIB 4RE5A 4FUTA 4BB0A 1ZU5A 2FFAA 2HOQA 3KOUA 4L3VA 5KIAA 1S3SA 4P0QB 1H66A 2IGBA 2X41A 4ND6A 4MVXA 5I9BA 3WSVA 4CKCA 3K5HA 4N9QA 1SD2A 2GD2A 4HDCA 3UW3A 1XVVA 2I4LA 4ECEA 1HEIA 4DTCA 3IUMA 2X2EA 2JJ2A 2WFMA 1C7ZA 4LS3A 5H8WA 4UHHA 5BSHA 3OJWA 4P4TA 3ZIDA 2QP4A 1EYZA 1W5EA 3B1VA 4CFZA 5BWBA 5KYNA 1RM3A 4Z1MD 4TV8A 4I46A 5BXQC 2GARA 3IVXA 1OX4A 2ZIWB 4H08A 4RSMA 4NU5A 1L4NA 3GJZA 2QUIA 1NW6A 4KLZA 1I51A 5MN5A 1KJJA 1JKFA 4TMFA 5EIBC 4GE3A 2HJ9A 5CW1A 4Q34A 1DMSA 2VRCD 1NVEA 3KLNA 4LE0A 4EW1A 2XYGA 2GDJA 1AKUA 1EX1A 4L4YA 5K4AA 1X7XA 2QTRA 2BH2A 1KYTA 2AR7A 3MUEA 4B3IA 2ZYHA 1VLMA 1OXVA 4DL9A 1JWAB 2QK4A 1P3JA 3LPNA 4ZQFA 5EMKA 2JFOA 4N40A 4V1CI 5EXXA 2EW1A 2IXAA 2JLZA 5DHTA 1UBEA 1A2QA 2IDZA 1FYVA 3NEPX 4MXDA 1P1IA 2YHIB 4KI7A 3V46A 1Y3DE 1ZVKA 2XKKA 2EZ9A 5MFZA 4HYTA 2AFIE 3LUJA 4WJLA 4P54A 2CUZA 3W3ZB 3T15A 3KZXA 2GK7A 1KJYA 5KSOA 3UQZA 4MYDA 5JJBA 3KU1A 1P33A 1OD6A 1TW3A 5EJ5A 4FMBB 3FE2A 3LHKA 3AF2A 3I9NA 4YUYA 1REQB 4TOIA 1H3EA 2C4WA 2Q21A 3T9AA 3AWDA 4YRPA 4B3HA 2BSXA 1T91A 1OC2A 2QTAA 3DV0A 3R0IA 3WL4A 2J32A 4LDJA 3FTEA 3C3AA 1NWHA 2J4FA 3PVZA 5J5AA 1SQGA 3OQJA 1PQPA 3VSDA 5I01A 2SECE 4HB4A 5DMHA 5EKUA 3VDNB 4DIBA 1W7AA 1U99A 2ZS8A 5DTEA 2OO7A 3AIMA 4CEJB 5CB0A 1DBRA 2PCLA 4Z3KA 4UNNA 3HR4A 3NP7A 2UUBB 2GPBA 2C95A 4HDNB 1ZMBA 4R69A 5JH7B 2HBZA 1XMXA 1V45E 4LPSA 1MX5A 2QUHA 2CWWA 4UW9A 4WGGA 5HG0A 2Z2KA 2KBFA 1HDGO 4BO0A 1EP3B 1GTZA 1U3TA 2OENG 4V0KA 1D5WA 4Q48A 4DANA 2J9ZB 1SG0A 3N8KA 2II6A 4YRKA 3ZTTA 1X2EA 3BXGA 2COEA 2PZFA 4MVJE 3UHFA 2Y05A 3I5XA 3W4IA 6REQA 3BJRA 3P94A 721PA 2NSDA 3I6BA 1G8AA 4NYIR 5ITZB 4LY3A 3C4JA 4DUGA 1PT7A 4FTWA 3ET4A 1XTPA 4BIMA 3M1YA 3AG6A 2JCSA 3GD5A 1ZHHA 1W94A 3GLHE 1L5QA 3C5WP 2Q07A 5A6VA 4CKWA 2ZUSA 4O4LB 1QO9A 4CVNA 1OLSB 3QW4B 1I0ZA 2WV9A 1RQNA 2DJIA 3EE6A 3KQLA 3K1JA 5HUQA 4LC9A 1AKRA 3G8YA 5DKFA 5K3EA 2KB0A 3ABOB 1PX2A 5JSYA 4G6ZA 4LXQA 2IFTA 3ONEA 4EOGA 2VQFB 2RGBA 3CZPA 3B1XA 4Y2GA 4Y7DA 2NV0A 3VPGA 3A9RA 3AY7A 4RKWA 2AXQA 2VP9A 3BC1A 1U31A 4XW2A 3O9VA 3QUQA 5GJWC 3UA4A 4B17A 1KFCB 3R3YA 2EZUA 1XMPA 2V5AA 3A10A 2I9KA 1D0IA 3IAEA 3ZEIA 1RVV1 1KWGA 1DRKA 2ECKA 5EPUA 3ZE9A 4BB6A 3ZCPA 2IU6A 2W6ZA 4OHVA 3RVPA 3UY4A 2C7RA 1O0CA 4CQNA 1LH0A 4JP3A 3ZHSA 3RVLA 1B4DA 3UZUA 1Z0ZA 4RD3A 3U7HB 2VAWA 1ZCFA 3HCOA 5B3JA 2IXTA 1F8FA 3WGHA 1K0FA 2QQ0A 5CMLA 1T2NA 1DNPA 5BMOA 2UZ3A 3KB8A 4R1SA 5HCIA 1BE8A 5ESWA 1YS2X 2A92A 4ZQIA 4MRPA 4JYAB 1O95A 4H1UA 1FY2A 1U7TA 1QFXA 5KQSA 1Y7LA 2FVXA 1BO6A 4NCHA 3HC7A 4BFLA 2F43A 2IELA 2X3FA 4OXRA 4AUNA 3VU9B 5I7EA 1GAQA 3FWNA 1YB2A 5DVZA 2I67A 4W7IA 2B9EA 1F2VA 5HIIA 1MAVA 3JQDA 3ETHA 1ZGCA 2ID9A 2J9FA 4B5LA 2O1XA 2GHQA 5DBIA 5FBVB 4KN8A 2WYWA 1GCGA 4JVOA 4DWVA 4YCJA 1KQOA 4IV8A 4Q4HB 2VZLA 3G2NA 1Q1BA 1RC1A 3F1KA 5JJKA 4YCCA 1XF9A 4MIYA 3ITEA 1UBJS 4JLJA 5D8DA 1Z4IA 1ZNZA 2H06A 2WWWA 5IBPA 1Z6GA 4KQ2A 1RRCA 1GEGA 1F14A 2Y71A 2CNNA 5C80A 2P68A 3M6WA 1Y1QA 1DTWA 4FW8A 3CVUA 1QGUA 1A7KA 1BDHA 5CIQA 3N2GB 4DDTA 1I4WA 5EXEA 2NZ8A 1PVOA 2P1RA 4ER7A 1A7AA 4NEGA 2PL3A 2G5TA 3D6NB 1KSJA 1OKKA 5CK4A 3DOFA 5DHSA 1TIPA 4Q3LA 2ZIUB 4URYR 1L5MA 4L75A 5DN6A 4BO3A 2AE2A 1X74A 3JARA 2PLFA 5I9MA 4GX1A 3IKMB 5FNVB 4GRDA 1IN4A 4YPFA 1R00A 4HQOA 4LZPA 1WF3A 1NW9B 1Z8FA 2DP4E 2EFEB 1CERA 3ZKWB 5D85A 4H1HA 3Q2IA 1ULBA 1JHPA 2HGSA 2O06A 5A4MS 1QG6A 1ODKA 5I9LA 1USUA 4QL3A 5HZGA 4QZVA 3ABSB 4PYNA 2O1SA 4X7PA 3EULA 1WBBA 1NYRA 4HBZA 4G81A 1JR4A 4BX2A 1AB6A 4EY6A 4X0EA 3I3SR 5EJIA 3IBFA 3SGLA 1XXHE 4ZI7A 1RXCA 3TQCA 4D5EA 3T1NA 5KVAA 1WTCA 4FE7A 4N3NA 1HFJA 4DREA 4OUDB 2EQ5A 3NIBA 5FBKA 4DLVA 3UXMA 3ENVA 1D7AA 2OY0A 2G07A 2NSHA 2PTHA 3IIJA 4ZEOA 4DYHA 1P72A 4ED9A 3H1TA 1UXKA 3OO0A 1OLOA 1RQGA 1P45A 3DPSA 3C6XA 3TINA 1E69A 1JYEA 3FDXA 7ADHA 2DQZA 2GBCA 2OHGA 3KQQA 5EVCA 5F5LA 1Z28A 3O1IC 4PPGA 3ZHYA 4Q1EA 3ADBA 1J24A 1FNCA 3JATA 1RXEA 3T52A 3H8VA 4M1EA 5IT5A 3MD9A 1PFYA 3HXKA 3N1UA 1KYIA 4CIXA 1GGVA 2ZDQA 4KR6A 1P2VA 1GPLA 3WGGA 5SYAA 4INJA 3QPVA 4AXXA 3FF1A 4LHVA 4FM9A 1M8FA 1JG7A 3F78A 1C9YA 3Q3GE 3HK2A 1MG5A 3OZWA 4FW9A 1I4EB 2BTQA 2Z3WA 1KBZA 2ZRDA 2Z6VA 3AYZB 3E1GA 3OJEA 5CVDA 3MGCA 3ZH9B 3UMMA 3W05A 4F7WA 2UVDA 1E61A 3MTJA 1VYVA 1RWOA 5BNZA 3T1HB 4ZMRA 4EKYA 1X9IA 3C8DA 2C9DA 3B5IA 3G5TA 1YJCA 2HNAA 2XD4A 2JJYA 2VTBB 3GEGA 4X7MA 3WMGA 4KN9S 1ESDA 4IMIB 3G3EA 3HLTA 4DC1A 1T6XA 3FJYA 1YU9A 4DM4A 4HRVA 5ARCA 5DLEA 3FTDA 1SKAA 4J3JA 1VHDA 3O2JA 2PKRA 2AI3A 2ZDGA 1XCMA 4UMEA 4NH0A 1JIVA 3W5JA 3N3AC 3MTEA 4YAGA 3D3KA 3OOJA 4CIBA 3DOOA 4MZXA 1FUEA 3SS7X 4UU1A 1DLIA 1BCSA 3G7NA 3FUWA 2G7MC 2W2MA 3H11A 4NZPA 4XJXA 1T13A 5G4LA 5H9VA 3ZD9A 3NX4A 1BKSB 2ZTSA 4E5UA 1KZHA 3CX7A 4ME6A 2AFHB 4NCIA 1SUSA 2PBLA 4PAWA 4J6FA 5L51A 1ISRA 3UT0A 4KVZA 2AFIA 3GJ4A 1ML4A 1M0SA 1LC0A 1UZMA 3KWJA 4MMXB 1YK1A 4RNDB 1PAUA 4H16A 5CYPA 4JZKA 1UP7A 3UW1A 5L3RA 1MT3A 1ESEA 3MMNA 4BMDA 5CNMA 1AMNA 4I8IA 3TUZC 4NMMA 1TA9A 2VP0A 4CF6A 3QMVA 1ZD8A 4QNNA 1U5CA 3L6UA 3M6XA 4RZIA 3SFTA 5IHXA 2SKDA 4HFMA 4HXYA 1W25A 1CETA 1LB1B 3EUFA 3H2BA 5AJHA 3LWZA 4WOKA 4IS3A 1XNRB 3K6SB 1IZZA 3OZSA 3G88A 1ZRNA 2W42A 4Z4EA 2JFFA 5FA6A 3LRPA 3RREA 2ZZNA 3L8ZA 3OEYA 4K5QA 4MS4B 2ZE8A 4XQGA 4ZYTA 4NQZA 2OQRA 4CDNA 3JYNA 3PP8A 1XNQB 4YT4A 1L5YA 4K28A 1KI9A 1A4RA 4UFOA 5BPFA 5CBKA 4E4RA 1DWUA 2NV6A 3OIFA 2O8EA 4ZPXA 1TIKA 2VHYA 4RH0A 3KZKA 3ANTA 3FMGA 4YQYA 3VR6H 2IF0A 4I1OA 3BQ9A 1Q3KA 1SG9A 2XQVA 3JVUA 2QZ9A 4UVIA 1WXWA 3U4DA 4YJ2A 1VRCA 4IM7A 2GFHA 3A0UA 1AJEA 1I3LA 1OZHA 4MVJA 1W19A 2R9VA 5FLXA 4FDUA 3CLUC 4DHWA 3RPEA 3VQTA 1YZYA 4ZGGA 4DCUA 4C0WA 5SYNA 4RZ2A 2XOKD 4UPDA 3D7NA 1BU5A 2P8JA 1QGZA 4M9RA 5JBIA 4P7BA 3G59A 3EA0A 4AD8A 1WIWA 3A9WA 2MYUA 5AXBA 2C99A 4M0EA 3WGIA 4B4VA 4CUJA 4YUXA 1X13A 5CT6A 1E0DA 2EBUA 2WU0A 3C3KA 1T5BA 1YRLA 3AEUB 4ODIA 2J0QA 1V8ZA 3H0EA 1INLA 4D3SA 4Q9IA 5DYGA 3LY5A 3A4MA 3QUBA 4Y7CA 1AY0A 2PAFA 2VF2A 4R1NA 3ZQ6A 2RK3A 4NVRA 4B8YA 4UTRA 1YS9A 1VI2A 2I2XB 4GZ5A 1T5OA 1L5HB 3GLKA 1CJBA 5CT4A 2IH5A 3DYBA 4NQRA 4XUGB 3UCFA 4DQKA 1QNFA 1MNAA 3A3OA 5A9SB 1PG2A 2BFBA 2EEPA 3I9FA 2IL1A 3KXDA 4FDAA 4GC9A 1XEFA 2QD1A 4F92B 5J43A 5JSZB 1VIYA 1O9HA 2JIRA 3RYFB 1RABA 4AZ3A 2OSVA 3T7SA 2VHEA 3B20A 3LKZA 3JASA 1RAEA 2D4HA 3K2EA 4IDOA 4B3RB 4OB8A 3OA0A 1P4JA 2HLNA 2RI0A 3FHLA 1N3LA 2H1FA 2Y8EA