4J1NA

Crystal structures of fabi from f. tularensis in complex with novel inhibitors based on the benzimidazole scaffold
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
258
Chain Sequence
b'GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMGNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structural and biological evaluation of a novel series of benzimidazole inhibitors of Francisella tularensis enoyl-ACP reductase (FabI).
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 82
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j1nA00
1K6IA 1C1XA 1VC2A 4NBWA 3TZKA 5JCJD 3IDSA 2G82A 5EPOA 3ADOA 4ALNA 3I23A 1PZGA 1QMGA 2IZ0A 2EEZA 4XX0A 1ADBA 2HK9A 4HFNA 2J5QA 1R66A 1DLJA 1W4ZA 1LQTA 2AQIA 2AE2A 1O89A 2D5CA 5J23A 1WMAA 1KOLA 4BVAA 4KUGA 1T2EA 4DBZA 2UAGA 4YVFA 1R4NA 1N1GA 3LQFA 2QIOA 1A5ZA 4MVJM 1W8DA 4FFOA 3AY6A 5G0TA 4MINA 3VTFA 4YQYA 1I5RA 1KYQA 1LDGA 3H9UA 3BTSA 3HADA 2B69A 3GNTA 4UUMA 4YJHB 1T2CA 4BMVA 4GGOA 3PHJA 1YQXA 3UKOA 3PWSA 1R15A 3SEFA 4CMJA 3GDOA 3IIEA 3WG9A 3DZBA 1BTOA 3MJSA 3WGTA 3I3OA 2NNLD 3ZV5A 2J3HA 1GQYA 4WNIA 5EESA 3O8QA 5A04A 2GCGA 1BMDA 1P0FA 3GDFA 4PLFA 2A35A 4BNTA 4JROA 3QWHA 4U6SA 1OC4A 2CVQA 2QX7A 3LT0A 4RGBA 1N9GB 2P91A 3LT1A 1M2WA 1T26A 1ZNQO 4LCEA 3PJDA 3GUCA 5DOZA 4RDIA 2WD8A 1UR5A 2B4RO 1LUAA 5HRUA 1SMKA 2IZ1A 3GAFA 3GPIA 4NI5A 2BF7A 4FSHA 3A28A 3ANNA 3Q1LA 4YRAA 1DFIA 3ABIA 2FZEA 1YB5A 4CQMD 5JBIA 2IYOA 1DJQA 5A9SA 2PD6A 1JVSA 1SBYA 1UDBA 5BSEA 1YRLA 1WZIA 5JY6A 2D0IA 4ZN6A 5L4LA 4NH4A 4AJ2A 4BKRA 3H7AA 5A02A 1ZSVA 1PGNA 2ZCUA 1DPGA 4IS3A 1TT5B 2PD3A 1GCOA 4IZIA 3DBHA 3V1YA 5BSGA 1XEAA 1F8FA 2WE8A 2WEKA 1BVUA 4DLLA 4XYEA 5AOVA 8LDHA 2W8ZA 4DC1A 3E6AA 4WECA 1LA2A 1KC1A 1O6ZA 3AU8A 4QUKA 2IZZA 2VYNA 2YDXA 3QWFA 2EJWA 3GRKA 5L3ZA 3HJAA 2NVBA 1LU9A 4DPMA 1DIRA 4ZRMA 3GR6A 2RH4A 1OZAA 2UUOA 4BO7A 2ZYGA 2DLDA 1DXYA 3WWYA 1R0LA 1NVMB 5JY1A 1VM6A 3MJEA 5DOVA 4B3IA 1B8UA 1YOVA 1ARZA 1XKQA 5JAMA 1E5LA 4KZPA 5U9CA 4UVGA 3MJVA 1ZK4A 4WCFA 5JDIC 1O9BA 1O5IA 4IY1A 1B8VA 3BHJA 3LLVA 4KOAA 4MP3A 4E3ZA 2NTVA 4Q39A 1JKIA 5T8KC 3I83A 1LXCA 5ENDA 3KYCB 1GV0A 1ID1A 2DPGA 3EVTA 4DMMA 2HU2A 1CQIA 3BMOA 3ANMA 1WPQA 1V9LA 4Y6SA 5LC1A 3K6JA 2R00A 2O4UX 1DJNA 2X86A 3I9NA 1ZBQA 4NFHA 3RI3A 4FQ8A 5L4SA 1H2HA 4TZTA 3JD1A 4YWJA 5TJHA 5H82A 5GZ1A 4FFLA 3FPLA 4IDFA 5CEFA 5A5FA 4YQZA 1HSOA 1R37A 4DIBA 1E1NA 5KVQA 2NM0A 4XIYA 1V6AA 2PFGA 3T7CA 2UVDA 4HWKA 1NX6A 5EINA 4YB8A 2NQTA 3PLRA 3V1TC 4WOKA 2WYWA 3GZNB 1N8KA 4CL8A 5TLSA 3OIDA 3NRCA 1C1DB 2E37A 3KO8A 1E5QA 4S1VA 3WQQA 3FD8A 3OA2A 3IOYA 3KSZO 5TGDA 2IRWA 2Y1EA 3AU9A 2GPTA 3RJ9A 3TWOA 1DO8A 1DC6A 4RL6A 1EK5A 3DEYX 2ZB4A 1EVIA 2O48X 4FW8A 1F17A 3BMNA 3MJTA 2Q46A 4I9UA 2AW5A 3NYWA 2JHFA 3HZZA 4GKVA 2B5WA 3EHEA 4PLPA 2PNFA 2I99A 4E32A 2DM6A 3N58A 1ZKMA 3PVZA 1Y81A 4DIOA 3ENKA 3JD0A 3S55A 1HSZA 3HUDA 4IUYA 2JD0A 3OIGA 3V2HA 2CF5A 4JK3A 4RF2A 1PZFA 3P7MA 4EZBA 5L7WA 1JLLA 1QRRA 2GASA 2PD4A 2VWHA 4RORA 4BIIA 1P1IA 3VC7A 3ZI0A 3ZW9A 3ZHBA 3W6UA 4IGEA 2O3TA 3RUCA 1IPEA 3PZRA 1J5PA 3TJRA 4CR6A 2BGLA 1UXHA 2CNBA 4GPD1 2GF2A 2NLOA 3TL2A 3CH6A 3NGLA 5EL0A 3O38A 3NV9A 4RPJA 1KY4A 1NFFA 2E49A 4BO5A 2Q99A 4IDCA 1PQPA 3QLJA 2I76A 1Z82A 4MJLA 5JNLA 5F3RA 4CQLA 3ZWOA 4I5FA 1ZK3A 2AXQA 1I3NA 5B4UA 3AJRA 3UCEA 8ADHA 2QZ9A 4BO3A 3KBOA 4PLCA 3TPCA 3VH2A 3CSDA 2FP4A 1HT0A 2GD1O 1ISGA 2H1SA 3CPSA 5CPFA 5JCXA 3JQGA 3WIEA 3U09A 4IDAA 1LRLA 2XPCA 2DFVA 3BAZA 1YDEA 3ZWYA 3LZ6A 4CLXA 1K2WA 1T4DA 1EBUA 1E3LA 3INRA 3OJEA 3GOHA 4NQZA 3L0DA 4CV2A 3LF2A 1PJSA 3GNSA 3ANLA 3GLQA 1IHXA 4XQGA 5JLAA 5C3MA 4RLHA 5DF1A 2NV6A 2GERA 2PZKA 1BXKA 1WWKA 1FF9A 3OA0A 1CRWG 4XYMA 4YJGB 5TT1A 1M75A 3L4SO 1ENPA 4WNCA 1O95A 1M66A 4XDZA 3W1VA 4HFRA 4FDAA 2NUAA 2HK8A 2Y0CA 4IQGA 3ADPA 1GV1A 2FZWA 2ZB8A 3DHYA 4BGVA 1CF2O 5DBIA 4B4VA 3I9OA 3PHGA 4XR9A 3IAHA 5EERA 4KWHA 4HBGA 1YGYA 3JD4A 4CQMB 3C3XA 1FMCA 5IJZA 1I01A 1GUYA 1I3MA 5DNAA 2D3TA 4BNLA 2P5YA 3FN4A 2FRDA 1QLHA 1LDBA 4ROSA 2ZK7A 4S3MA 2O50A 2OHXA 2X23A 5MDHA 3ZV6A 2WMDA 3CZMA 4CL3A 1Q2XA 1ZSYA 2VCYA 4NFSA 5GZ3A 1E1LA 2IE0A 4K6CA 1HDRA 1J0XO 5JE8A 4DUPA 5B1YA 1LNQA 2C07A 4CM8B 1AN9A 4XB2A 1CERA 2DBZA 2BFPA 2GN6A 3P19A 5L7TA 3PIIA 4R4JA 2NQ8A 4Z0TA 1A9YA 4OQYA 1I3LA 2O4CA 2X9NA 4WPGA 5TNXA 4CMIA 1PS9A 3ROQA 4AJPA 3K2EA 1A4IA 4DIFA 2GN4A 1WW8A 1HWYA 1UDCA 3K30A 4PG5A 1GPDG 1YBMA 2JCYA 4RF5A 4RV9A 1HE4A 3NDIA 2VWGA 4OMUA 4BNMA 1NQOA 3C7DB 1YONA 1D4FA 3QWAA 4NJMB 1UXKA 1XHLA 3VH3A 2DC1A 4MP6A 1ZJZA 3CUKA 2ZB3A 5CDTA 3RIHA 4GSLA 1MX3A 1I0ZA 3WSVA 4CR7A 1YVEI 1J4AA 1NBOA 4K28A 1N92A 3HN2A 4BQRA 3ZWAA 4BV9A 5L7YA 2VT2A 1ZXBA 5ER6A 5G2OA 4JP2A 3KEOA 4P4LA 2G0TA 2I6TA 1PWZA 3SLGA 4BNNA 1I2BA 2VTEA 1ISFA 3JQAD 4KDEA 4LVCA 4U0KA 4R5MA 5IDXA 1TLTA 2HSDA 2H5LA 1F06A 3JYLA 3KRTA 3L77A 4J1QA 3CMMA 1NHGA 4PRKA 3V1UA 5KWEA 3EYWA 4OOFA 5T57A 1GYRA 5IN4A 5I9MA 4INAA 4A10A 4XRGA 1R16A 1CWUA 4IDBA 4U7WA 4NK5A 4KQXA 4Y8VA 2QZZA 3LU1A 1KIFA 4E5KA 3I1JA 4B8WA 3RUAA 3ZZNA 3JD3A 4FOSA 1KEPA 2HMSA 2Y1FA 3BMCA 3RWBA 1EVYA 2DTDA 3TNLA 1XCBA 4M55A 2Z1MA 5AXBA 3O4RA 4HUJA 1AGNA 4B4UA 2FPGA 3RJ5A 2VRCA 1GD1O 1LLDA 1QLJA 2G17A 3DTTA 4W82A 3UXYA 1HE5A 1OAAA 4BOYA 1XU7A 3ONFA 3KYBA 4TQGA 2DBVO 5DBFA 4D44A 5A4DA 4CUKA 1XQ6A 3FTPA 1Y8QB 4RPHA 4TWRA 4YYZA 3C7CB 3DQPA 4PZCA 1JWBB 2WM3A 4A2CA 1PGOA 3GT0A 3I9KA 4U6QA 3JQ8A 3R3JA 1KVRA 1H2BA 4CLOB 1HRDA 2C0CA 1PTJA 1XELA 3C7AA 3FNFA 3LYLA 4PG6A 4Y67A 4CLRB 2WE7A 2FY8A 2HMWA 2BMAA 4IMPA 2VUUA 4J43A 4TSKA 4URFA 3TF5A 5B4VA 2EXXA 3DZIA 2OMEA 3ZU5A 4M89A 2HMUA 2YQ5A 2JFFA 4JNKA 1ZSNA 3F3SA 2V6GA 1EZ4A 2AG5A 1EVZA 4BNIA 4WJZA 5COQA 3UICA 1LDMA 1M76A 5COAA 3AM4A 2QHXA 5KIAA 3NT4A 3K2BA 2QQ5A 1B26A 2E82A 3ZDFA 4CV3A 4BGEA 2ILTA 2P9EA 1EBFA 5JO9A 1X15A 5JXWA 4BNVA 1VE9A 1NVGA 3JSAA 1ADFA 1W73A 4J0FA 2O3RA 1P77A 3DBRB 3ZHXA 5HM8A 3B1FA 4R41A 4O6VA 1H6AA 3FSRA 3ULKA 5JYEA 4ZGWA 3TN7A 3GVIA 3RUFA 3OJLA 3VH1A 2CFCA 3DAPA 3GFBA 4W9NA 4XQCA 1KVTA 1Y9AA 3GG9A 3ETGA 3BYZA 3I5MA 3H9QA 3OP4A 3NGXA 5ES3A 2X6TA 1T1RA 2ZKLA 2C20A 3Q3CA 3GGGA 1ZH8A 4RPGA 4I08A 3NJ8A 4BUCA 2QG4A 5TC4A 1GZ6A 5KNLA 2OUIA 2DU8A 1LJ8A 1I8TA 1Y5MA 3S2EA 1DLIA 1CYDA 2B36A 3PXXA 5G4KB 3B70A 4YJHA 4HP8A 5L9AA 3GUYA 3I9LA 3RFXA 3E9NA 4BMSA 1ZIDA 4GVLA 5B12A 1DSSG 3M1LA 1VLLA 1PGJA 3FCOA 3K92A 1HDCA 1LC3A 5CDSA 1XDWA 4GX2A 1TA4A 3OSUA 1D8AA 3KSUA 4O1MA 1X0XA 4CV0A 1DIBA 4MVJE 2Q1WA 1WNTA 4GLLA 1N9GA 4PRLA 2ZIZA 4WLEA 2IEDA 1ULSA 3L6EA 5KJCA 1EVJA 2Q45A 1MV8A 5G0SA 1P74A 4DYDA 3R3SA 2B4QA 1R0SA 2PZJA 2FN7A 3HHPA 3ZGYA 3FR8A 4Q3NA 2GZ3A 2O3SA 4DYVA 4PLYA 1XIVA 4TRJA 3WSWA 3WNQA 1NM5A 2Y66A 2VTDA 1SEPA 2BRUA 1HF3A 2I65A 3RAJA 4FN4A 2HKIA 1HYGA 4BV8A 5AXDA 4JJGA 1A27A 3DB2A 3JCZA 5CDGA 1SEVA 1A4UA 1P1HA 4XEHA 1VKOA 1RYDA 3D3WB 1VJ1A 2GR9A 2QRLA 4YT8A 2PK3A 4J1SA 1U2GA 1TT5A 4OAQA 3C1TA 5JDCA 2O3JA 1ORRA 2HQ1A 1BDMA 1T2AA 1DBVO 3BA1A 3PWZA 5KCZA 3M2TA 3DZGA 4PG7A 3TZ6A 2VYVD 4W9NC 1JA9A 2VWQA 3GN1A 4I8XA 2BH9A 5F5NA 4NU5A 4PG8A 3D4NA 3QE3A 3VVCA 3TFOA 2PGJA 5GY7A 1KVUA 4ZD6A 2X9VA 4QO8A 2Q2VA 4Y9DA 1BRMA 1LDEA 2ZTLA 3IUPA 2CD9A 1NPYA 1UDAA 1PJCA 3IKTA 5FFFA 3TZHA 3PP8A 1L7EA 4RF4A 1X1EA 4M87A 1ONNA 2CDAA 1NASA 1E3WB 3JQAB 1C0PA 3H5AA 2PZMA 1CJCA 3F1LA 4QTZA 1ZK2A 2BFAA 4WASA 3W6ZA 3Q11A 5AYVA 4FFPA 1SB9A 1ADGA 2G5CA 1R12A 3F5SA 4XGNA 2FOIA 4Z0HO 3LT2A 1LLUA 3OQBA 3STHA 5L45A 4OXYA 3O26A 1P31A 4J7XA 1ZK0A 2Q50A 2WD7B 1UAYA 5JC1A 3PFWO 2HMTA 1WLYA 3KYCA 4BNGA 1PR9A 3DL2A 4J4HA 1XYGA 4DC0A 3HN7A 2RCYA 4EI2A 2EKPA 5DBGA 1SO8A 3MEQA 1UAGA 4XYGA 3JQFC 2B35A 2YDYA 3VPSA 3ZNPA 1HXHA 3OEWA 6ADHA 3IP3A 2Y0DA 4LN1A 5EJ2A 3WBFA 1A7AA 1U4OA 3H5RA 3H3FA 4I5DA 2ZQZA 3GZ4A 4XWYA 3GZNA 3PFFA 3NX4A 3ETEA 1C1DA 2YHIB 1WDKA 2RAFA 2OL4A 4LSWA 4Y98A 2VNSA 4P4GA 4LK3A 5IDYA 2C2YA 3UOGA 4J0EA 4FD3A 5KVSA 5JDIA 1P1KA 3RQSA 1PJ3A 1EQUA 1VSUA 2FPIA 4JN6B 1PR3A 1GZ4A 4E13A 3W8EA 3ZWWA 2P2SA 5AVOA 5TJ9A 2E48A 4XIJA 5JDCC 1ENZA 3ASVA 1YO6A 5T8KA 1EDZA 1ZUD1 1NWHA 3ICCA 1XU9A 3L6OO 3RUEA 4RO0A 3PHLA 4MKZA 1HDXA 3WQRA 5L51A 3LC7O 2J5RA 5JCJA 4JP3A 5C7IO 5CAEA 7MDHA 3ZWXA 2WDZA 2WWRA 5F1KA 1T25A 2X0NA 3MJCA 2YUTA 3K96A 4NG5A 2EHDA 4R1SA 1V3UA 4BNFA 5I9LA 3CEAA 3SX2A 4Z9FA 1SCUA 1QV7A 4H3VA 2CDCA 4ZQGA 1Q0QA 3PPIA 1Y9EA 4FC7A 4UVEA 2GSDA 3T4XA 4W4TA 5TS3A 4ZICA 1M67A 1KVSA 1YKFA 4QT0A 4J91A 3WBBA 1HE2A 2P68A 4H15A 2WSBA 1IHYA 3VDQA 4E30A 4B4OA 7ADHA 5ITVA 3QA9A 4CM4B 2V65A 3RC1A 1C0KA 4FS3A 1OC2A 4IQ0A 1U8FO 4W99A 1V35A 3G49A 4RDHA 4NIMA 1BW9A 3AFNA 5TRTA 5A06A 5IG2A 1X7GA 3KXDA 2I5PO 3Q2IA 3TDKA 4AJLA 2XF8A 3JQ9C 1U5AA 3E5MA 4Z0PA 4CMHA 1B16A 5IXYA 2VHVA 2GZ2A 3HSKA 4QFDA 4Q3BA 1PX0A 3PQDA 4CM5A 2TMDA 2OGUA 5KJEA 4EJ6A 3MWDB 4AJEA 1SOVA 2OBYA 1NR7A 1ONOA 3H3JA 4FBGA 1U7HA 4YJGA 3HB4X 1F0YA 4JX8A 4KTVE 4CM9A 4DL9A 5DULA 1GYQA 2Y93A 2YFHA 3AM5A 1MA0A 4IIVA 3HFGA 5KJFA 2O7QA 3NT5A 1YBVA 3OF2A 1FJHA 2YV1A 3WGOA 1PJBA 1QG6A 2VQ3A 4Y6PA 4YPOA 1DAPA 4NMHA 3PQEA 1R4MB 3TSCA 2BELA 3F6YA 4G81A 3ZNNA 3OEYA 2DAPA 3Q0EA 4RVGA 2EP7A 4CQMA 1DHRA 1WDLA 2EKQA 3E5RA 3AOGA 3AOEC 3ZU2A 2EG9A 4BL5A 1N2SA 1HYEA 4PFJA 4B7UA 2UDPA 3OHSX 1GUZA 2ZTUA 3M2PA 1AXEA 2EIHA 5A3VA 3DOOA 4QO7A 2OO5A 2ZTMA 3BZUA 2AA3A 4WLOA 2X1HA 2PKQP 4CR8A 2Q49A 4ALIA 1O8CA 2UYYA 3GN2A 2D4AA 4WLUA 3RUHA 5HTOA 2H9IA 2HK7A 2WYUA 4LGVA 1TT7A 4YJDA 2NVUB 3OMLA 3FBTA 4O0LA 4CMBA 1KVQA 4MVJF 4CM8A 3NJ4A 2O2SA 5JFOA 3PI7A 3ZCXA 3S2GA 5T6BA 3E1KA 4OSOA 4QQRA 4LSMA 2PA3A 3WS7A 4IDDA 4K26A 4D46A 4RVUA 1YE3A 2FWMX 5IDWA 4IJVA 4IXWA 4NNJA 3PLNA 3H65A 1OFGA 4B79A 3E9MA 1YB1A 3JQCA 4MKXA 1N5DA 4OM8A 4GMGA 1U3WA 4R16A 5CEJA 3UGKA 4NJMA 1UH5A 3EDMA 1C14A 3TZQA 4BNXA 1T1SA 3UAGA 2BGMA 4UEJA 4AJNA 5DCUA 2ZTVA 3U4HA 2Q1SA 1MB4A 1Q0LA 3PRJA 1XA0A 1I2ZA 3KETA 1PS0A 1G6KA 3CXRA 4R1TA 5G0WA 3AW9A 2EGHA 3I6IA 1NVTA 2NADA 2EGGA 2X22A 3FPCA 3UFXA 2PTGA 2C7GA 2OFPA 4D7AA 5DP1A 1MP0A 2BHLA 4F6LA 1QYVA 2O3UA 3GC6A 4ZA2A 1LQUA 4ILKA 1YQGA 3OICA 4CM7A 4HFMA 1Q7CA 3UCFA 2R2GA 1AUPA 3P5SA 3VOSA 3BMQB 1HYHA 1X13A 4L4RA 3FWNA 4XDYA 3SXPA 4DQXA 4BNZA 1UJMA 1ZEJA 2A92A 3QQPA 3E82A 3AFMA 5I7SA 3OJOA 1HZZA 4RPKA 3AUAA 3MTGA 4GI2A 4D3SA 2XXBA 1FDWA 3INTA 5IAAA 4OKIA 2IXBA 2YYYA 5FI5A 3RC9A 4BNJA 1LRKA 3F4BA 4A73A 5IXSA 5ICMA 1ZEMA 2IODA 1JTVA 3U5TA 4EUFA 3R0IA 1ZCJA 2Q1TA 3X2EA 4GX1A 4HX5A 3GMSA 1XSEA 1V3TA 2EF1A 3NKLA 3BHMA 4RZIA 1ZVMA 3GF4A 3U4DA 1E7SA 1Y8QA 1DDOA 1N1EA 1UXGA 2SCUA 3I9JA 4ZQFA 4ID9A 2PGDA 1NWCA 2ZYDA 5TF4A 1PGPA 1H9AA 3RBVA 1U3UA 4CLOA 1ZK1A 4JCOA 3COSA 2POQX 3HE3A 1NAIA 4CLRA 2RHRA 3W4KA 5ILOA 3P2OA 4E31A 4UULA 4XYLA 3NDJA 4CMKA 3DBHB 1WVGA 1B3RA 1DRWA 2Q2QA 2PR2A 3DC2A 3EW7A 1HEUA 3LK7A 3H9EO 3PGJA 4PN3A 4MVJA 3QVWA 4MPDA 1ZMOA 2NACA 3T7EA 2Q4BA 4E21A 1LTHR 4B3HA 3GQVA 1EE9A 3D5QA 3E18A 1D3AA 3U4CA 1HLDA 4BO2A 2D59A 1P0CA 1EK6A 4BS9A 4DA9A 4EDFA 1K0UA 2WJPA 3DBRA 4G5HA 2W2LA 4FGSA 4OSPA 3ITDA 4IPTA 4MVJI 5MGBA 3MWEB 3G17A 4PG4A 4CMEC 4IS2A 3QVOA 3K5PA 3B1JA 2X5OA 1JDJA 1BXZA 4N5NA 1X1TA 3QSGA 4QXMA 1NHWA 1U1IA 1EDOA 2G76A 2AQHA 2Y0EA 4BMNA 3ST7A 3TFQA 1LDNA 2D8AA 3OETA 5ER9A 5B37A 1E3IA 2V7PA 3LC2O 2HCTA 3NDRA 4MO2A 1CETA 2Y67A 3JQDA 3WJ7A 3QJ5A 4CLEA 4IQ8A 2GDZA 4KUHA 3VZQA 4XQEA 3CZRA 3F1KA 1U2DA 3GHYA 1LSUA 3ZHYA 2W2KB 5EN4A 3GHHA 4Q9NA 1Z45A 5LDGA 1V8BA 3OM9A 1U3TA 4GH5A 2P4HX 4LISA 2QRJA 5G4KA 4NBUA 4CM6A 1NYTA 4UVDA 2I9PA 3A1NA 4MVJP 4KTTE 4RVHA 5JMPA 1W6UA 3WGQA 3TQHA 5H81A 3BXXA 1QYXA 1WXDA 3KLPX 4L74A 1QV6A 3VPFA 4IXTA 5IZ4A 1T2DA 4AJ1A 4BNHA 4NJOA 4ZU3A 3QWIA 1TI7A 1HDGO 1YXMA 1TEHA 1U28A 1FDVA 3IUSA 4LRTB 5BQFA 3G0OA 5JO0A 2PH3A 4PIVA 4TVBA 1FDSA 1Y5RA 4B7CA 2JHGA 4JQCA 1MFZA 1LI4A 5F1OA 3SLKA 4YJFB 4UEOA 3G1UA 3PZBA 3K9QO 4KDFA 2GZ1A 5KKAA 3KB6A 3BMNB 4J1NA 1M6HA 5TT0A 2HRZA 3QIVA 1OOEA 3IS3A 1QSGA 2PH5A 1YL6A 3HDJA 3ZHZA 4R1NA 3RSHA 3EMKA 4PVCA 1I3KA 1MXHA 1PJ4A 4N18A 3AI2A 2J8ZA 4R69A 1NAHA 4D43A 4J7CA 4MOWA 1LLQA 4MVJG 1SC6A 1KEVA 3SJ7A 4EJ0A 4D41A 3D3WA 3WYCA 2RHCA 1P1JA 1EFKA 3S8MA 2CVOA 3ICPA 2Z95A 2LDXA 3I4FA 3BTVA 1X7HA 3IJRA 2EV9A 4WOJA 2BLLA 3C8MA 3DBLB 3QY9A 3F4LA 1GR0A 1D1SA 4B7XA 2BFOA 2P5UA 1X0VA 3ZWPA 1O94A 3H2SA 4WEOA 4D0SA 1K6JA 5TSDA 4CUZA 4BB6A 4FJ1A 4DTIA 3RKUA 1IE3A 2OP1A 1LX6A 2VUTA 4CMCA 5L95A 3VHRA 1YQDA 3GA0A 4OGWA 3GAZA 3ZNQA 3UVEA 3PYXA 2DFDA 4NHEA 4TMFA 3H8VA 4FFRA 2DPHA 1R6DA 3KYDB 1BG6A 2AEMA 1B0AA 4WCDA 4OL9A 4F6CA 4I5GA 3WMXA 1K5HA 3NTOA 1UP6A 3HG7A 2DT5A 2HJSA 2QYTA 1KBZA 2VOEA 1AHIA 3OIFA 4BKUA 1YS4A 3DZKA 4YAKA 2BI8A 1M6WA 3GNQA 1E3WA 3KSDO 3JQAA 2OORA 3WLFA 4UEKA 4K1LA 1I33A 5DCWA 4A03A 1GCUA 3R1IA 5JPIA 3C24A 2PKQO 3RFVA 2B37A 4ND4A 5F5LA 1GUFA 3PJEA 4YCAA 5JAZA 3WQSB 3RU7A 2TMGA 2FSVA 4N7RA 4XA8A 1GDHA 3RUDA 3SJUA 1UXIA 2WD7A 3V2GA 4GAEA 3WGHA 4XJSA 4J3FA 4D79A 1ZW1A 4MDHA 4E12A 1PL6A 4L75A 2V6BA 3MTJA 4HKTA 4CLDA 2AQ8A 3N7UA 4WUVA 2DUWA 1YJQA 3DMTC 4DPKA 2CVZA 2DVMA 5GMOA 4YT5A 3KEQA 2YY7A 3ZW8A 3KVOA 1P33A 3ZWNA 4LRSB 5A05A 2C5EA 1DFHA 1HL3A 4AL4A 4EW6A 3GVCA 4ZHSA 3G3EA 3H9GA 5U1PA 3O03A 4CODB 4AICA 3D64A 5L53A 3DZJA 2O2YA 3U49A 2YHIA 2GO1A 1YDWA 3UCXA 3BIOA 5ICSA 3TL3A 2CY0A 1I36A 3DFZA 3Q9UA 4IJKA 4OXNA 4R3NA 4NBVA 5FF9A 1KETA 3GMDA 3KM0A 2VZ8A 4ZVVA 3F46A 3ZV3A 4NZ9A 2Y1DA 3MJ4A 5L40A 3JQBA 2X0IA 2ZCVA 3N74A 4IIUA 2EW8A 4XRRA 1BVRA 3VZPA 1RJWA 4FOOA 1UP4A 3H9JA 2XOXA 1SNYA 1ISHA 2DKNA 4K9DA 4YRBA 4ITUA 4ND3A 1XGKA 3WDSA 4FB5A 2FSSA 4W7IA 4OKNA 2H6EA 3VPXA 4HNHA 3UUWA 3JQFA 3NEPX 3E48A 4J90A 4J4TA 2VN8A 3DR3A 3DOJA 3QHAA 4RZHA 3ITKA 1G0NA 3KV3O 3H4VA 3RUIA 4BQPA 4A26A 2BI7A 4YAJA 1MC4A 4GVXA 4NU6A 5T67A 1DOHA 1LSOA 1HLPA 4OO3A 1LDYA 4BGUA 4HADA 1HDZA 5DN9A 2X4GA 1F14A 5T64A 3IMFA 3D0OA 3IP1A 4BKQA 1IYZA 3WOHA 2D5AA 5DCYA 4ALKA 4B8ZA 4DRYA 2AE1A 2X0RA 3WICA 4NBRA 3ZWBA 3JYQA 4ALJA 3WFJA 5FYDA 1E6WA 4GWGA 3DHEA 4CPDA 1IUKA 3HQ4O 2NWQA 2X58A 4M54A 4NK4A 5JS6A 4WKGA 1DC5A 4DLBA 2DTXA 1CDOA 1GQ2A 3LC1O 2VHWA 3L4BA 3I9MA 1ENYA 3GK3A 4J2OA 2IDZA 2P9GA 3ZU4A 3K73O 3KHUA 4ND5A 3FNEA 1JKJA 1FK8A 1KEUA 4PZDA 3RC2A 4TZKA 1E7RA 1NXQA 5TIIA 3WR5A 4QSMA 4GX5A 3PQFA 3D1LA 4DMLA 4MIYA 1P9LA 4B3JA 1HDOA 3ROKA 5HA5A 5THKA 1RM5A 4FGWA 3INGA 4B4WA 3JYOA 1CEQA 1UUFA 1H6DA 1KY5A 2Y1GA 4OHUA 4PLZA 4E5YA 1R4MA 2WYVA 1XG5A 2P9CA 2BGKA 1SPXA 4RVFA 3GEGA 3JQBC 5EMHA 4OJNA 1C0IA 3KZVA 4BHTA 3T4EA 3DOCA 2FPPA 3A4VA 2X7HA 3IL2A 1GTMA 1GY8A 1PQUA 2JL1A 3EY4A 1VL6A 3EK2A 3WTCA 1JW9B 2B5VA 3JQ9A 1DIGA 1U9JA 2R6JA 2P4QA 5KVVA 4Q3DA 3CKYA 1CIVA 4RCVA 4E6PA 3D7LA 4PLTA 2JAPA 3V2UA 4DLAA 3VH4A 2ZQYA 2IXAA 4TRRA 4D42A 3ZWMA 3M6IA 5CG1A 4L9RA 2NVUA 2ZJ0A 3GDGA 1Q1NA 4BO8A 2VYVA 4TVOA 3WGIA 4A7PA 2WTBA 2J6IA 4CV1A 1ZFNA 1HDYA 3QWBA 6LDHA 1JAXA 4YRDA 4LCJA 5KKCA 3D4PA 5CEEA 1HZJA 1Z7EA 1B8PA 2QW8A 3H5NA 3JYPA 4L4XA 3ETDA 4FFNA 4HNGA 5JMWA 4RJTA 1QKIA 4IM7A 3RCBA 1JU9A 1W0CA 1AXGA 1V0JA 3DHNA 4E2YA 1U5CA 4KP7A 4ZQBA 2HDHA 1PQWA 3AI1A 4Q3EA 5DZSA 5BR7A 1P44A 9LDBA 2JAHA 2VUSA 3AOEA 3IJPA 1MC5A 5G4LA 4EJMA 2Y1CA 3VPGA 4G2NA 3ENNA 3HDHA 2B83A 2I3AA 3WGYA 4XGIA 3QRWA 2JD2A 1Q7BA 2X5JO 4ALLA 4YAEA 1H6BA 3PJFA 4EBFA 1LLCA 1Z75A 3OJFA 3ORFA 5C7OO 3L4BC 5G0VA 4M1QA 4BO6A 5K6AC 2YHUA 2W98A 2GUGA 3DMYA 3JQ7B 3I4CA 4TROA 2YV3A 4WLVA 5I8ZA 2O23A 3RBZA 2VHZA 2Y99A 3BMQA 4WEQA 4E0BA 2DBQA 2VYND 4WE3A 3E9QA 1H0KA 1EEHA 1QYWA 3E8XA 3PDUA 4KMSA 1WAMA 4CM9D 3AUTA 1I24A 3DO5A 2Z1NA 3WYBA 1RM4A 3PGXA 3NTRA 4CMGA 4E5MA 4YR9A 2CSUA 1J49A 1S7CA 4GX0A 4E5PA 4O63O 3OBBA 3U62A 5A9TA 5BNTA 1UZLA 4OOEA 4DPLA 1GYPA 3NTQA 2E4AA 4N54A 2F1KA 4A27A 1E3EA 5IZCA 3RU9A 2ZJ1A 2D1YA 3EUWA 4D3DA 4II2A 4BGIA 4BNUA 2VHYA 3D3EA 3ON5A 2OP0A 4JJFA 3OQ1A 1VRWA 4J49A 4MVJH 4AVYA 5HS4A 3OJ0A 3WB9A 1DB3A 1Y1PA 3GH3A 3I52A 4J9UE 4P8RA 4BNWA 5K9ZA 1ONPA 2UV8A 1LSJA 4IBOA 4MIOA 3X2FA 3MZ0A 2PY6A 5U4QA 1ZZEA 4Z9YA 1MUUA 3JQEA 1Y7TA 9LDTA 3HWRA 1H9BA 4EGFA 1PGQA 5KJ6A 1OI7A 3U4IA 1NQ5A 4L76A 1I2CA 5I9NA 3VZRA 1T4BA 3QV1A 3JTMA 4N5LA 2GN9A 5ILGA 1GAEO 1MG5A 1Y8RB 1PL7A 3OFSA 4J1TA 5A5EA 1C0LA 2RIRA 4JLWA 4R1UA 3AI3A 1PS8A 4KQWA 4DREA 2DTEA 3VKVA 4OXKA 1TB4A 2PKRA 4YXFA 2C7VA 2JJYA 3QVSA 4L8VA 4R54A 5F1PA 2H63A 1PJTA 2CZCA 1BXGB 1SAYA 1HTBA 5I7VA 3KUXA 4WLNA 3Q9NA 4GQAA 3EGOA 3G1TA 2Q1UA 3DONA 4HV4A 3ONDA 3TZCA 1ADCA 5FI3A 3VAZA 5A9RA 1WP4A 1I10A 4XQ9A 3O9ZA 4EUEA 4Z3KA 5B4TA 3WIDA 1PIWA 4BO0A 4FCCA 1NP3A 3GGOA 3WWZA 1LC0A 1V3VA 3F9IA 3FHLA 4MKRA 1I32A 2CUKA 5C37A 5IF3A 4Y6RA 1JVBA 4H7PA 3A06A 1C1XB 3SC6A 4HFJA 1WZEA 3D5TA 3HFSA 4E2WA 4RPLA 3ROMA 4A5OA 3W8FA 4Z3DA 2W2KA 4L73A 4XB1A 4JGBA 1E7QA 2GN8A 5EQFA 1MG0A 5K6AA 4IDGA 2DUUA 2QYSA 1ZJYA 2EW2A 4XZ3A 3W8DA 1YL7A 5K0ZA 3ASUA 4GWKA 4KWIA 3QW2A 1QORA 4RLSA 4N5MA 5FWNA 1R4NB 3SVTA 5CG2A 1XWFA 4RVSA 1SZJG 3GVPA 1P1FA 4CMEA 4WGGA 5A3JA 5IZCC 4J4BA 1NFRA 4OIMA 2VT3A 4GL4A 3HDYA 4ALMA 3PHHA 2EWMA 3QVXA 2JFGA 3ZNOA 2G1UA 1C3VA 1RYEA 3GRPA 4IJUA 3WGZA 5BSFA 3FF4A 4OYRA 4AJ4A 4EYEA 2F00A 1EQ2A 3L9XA 1DIAA 3KLMX 1GFSA 1EUCA 2CMDA 4YJFA 2EP5A 1IULA 4BO1A 5I7EA 1O0SA 1TVEA 1R0KA 4YA6A 2PLAA 3UN1A 1K89A 5BNFA 1N7GA 1SOWA 3JQ6A 2YV2A 3O8QB 1E7YA 3ZH2A 4L4SA 4P38A 4YAGA 3EC7A 1IPFA 1E6EA 4R9SA 3DAFA 4TKLA 3LF1A 2B0JA 4GGPA 4M8SA 1JN0A 2EERA 4EEZA 4MVJD 2J3JA 1K6XA 2HJRA 3DWFA 5I7FA 3V8BA 1I30A 3TOZA 4UAGA 2C54A 1H6CA 1Y6JA 1B7GO 5I8WA 3GEMA 1F12A 2GGSA 2C5AA 2GNAA 3CE6A 2OXIA 4DVJA 4CM3A 3DBLA 5CPBA 1OMOA 4JBIA 1E92A 2OOSA 1A9ZA 3U3XA 4E4YA 3K31A 5BSHA 3EAGA 2W2LD 2DBRA 3AY7A 3QVTA 5JW6A 1MGOA 5A9SB 3PYLA 3B1KA 4AFNA 5JAIA 4OH1A 3D4OA 2A4KA 3CMCO 1X14A 4XKJA 3FTNA 1IL0A 4PVDA 1D7OA 3DZHA 1NFQA 1FDTA 1ISMA 3EZLA 4LMRA 4WCFC 2ZB7A 3WLEA 2XXJA 3B20A 3L9WA 3RROA 2HO5A 1DFGA 3KYDA 5BNIA 1FDUA 2HMVA 4JBGA 4UVHA 3RC7A 1PZEA 3LSYA 1NR1A 3RASA 1IZ0A 3DDNA 4Q3CA 1BW9B 3GFGA 5EQDA 5CFZA 1EFLA 3AK4A 3IC5A 1Q0HA 1EUZA 3PJGA 2EJVA 1Z74A 4ONEA 1FXSA 4R9RA 1GADO 4J2HA 3FBGA 4BKOA 2R00C 1DEHA 4EUHA 2C82A 2X0JA 2VZ9A 1PWXA 4QFCA 1A7KA 2JFHA 1YWGO 1ZO8A 2NSDA 3Q6IA 3LVFO 3WXBA 4C4OA 4DGSA 2NU7A 1VJ0A 4BNKA 5HS6A 5KTKA 1Z6ZA 2I66A 3BHIA 3LLSA 4PGFA 3VPHA 3CTMA 4J9VA 4O5OA 3AUSA 1P1RA 1U8XX 1A71A 1UP7A 4NDNE 3K8ZA 2FHSA 3H2ZA 5KOIA 1AE1A 1U3VA 1HE3A 4D0RA 1YOVB 4YTEA 5HBRA 2Y05A 1RM3A 1T24A 3B6ZA 3DXFA 4FFMA 2AQKA 1PU2A 4FPXA 3G79A 3IQDB 4WCFB 1L7DA 5AXAA 3MCVA 2AG8A 1G1AA 4PLHA 4WLFA 4PLWA 5DT9A 3MOIA 1GU7A 2O7SA 1DIHA 4BB5A 4IGFA 2YQ4A 1LRJA 2AMFA 4W6ZA 1QYDA 3KOUA 1P3DA 4ZRNA 3EVNA 1EE2A 1MFPA 2C29D 3AWDA 2B4TO 4AG3A 4UUPA 4C7JA 1WDMA 3UF0A 3OECA 3BMOB 3F5QA 1GEGA 2RBEA 2V6MA 2W90A 2PV7A 3NUGA 3RKRA 3DBVO 2A94A 2QRKA 2NU9A 3PYMA 2VOJA 1LEHA 2E6UX 3V5NA 4EITA 3DTYA 3OH8A 3PIDA 1WMBA 4FJ2A 2ET6A 4NFYA 3IKVA 1E7WA 3BTUA 2YZ7A 1JAYA 4YAIA 2FR0A 5AXCA 2ZYAA 3PK0A 3VVBA 1E1MA 2EKLA 1E3JA 3A9WA 3LT4A 1PL8A 3ZWCA 1JQBA 1H5QA 4QEDA 2VRCD 1PJLA 4BO9A 3PWKA 4MIEA 5TX7A 2Z5LA 3VDRA 2BD0A 1NNUA 1ML3A 5IFLA 1E0DA 3DMTA 1H93A 1QYCA 4XCVA 1U7TA 1IY8A 4GBJA 4R68A 3ZU3A 4EEXA 3VKUA 3S1LA 3FR7A 2NVWA 5F21A 1VPDA 1B2LA 1H94A 5LCXA 1S6YA 5ADHA 1UZMA 1HKUA 4RVDA 1J6UA 3GGPA 4YACA 3NT2A 4TRNA 1P45A 3DZFA 4CUJA 5A1TA 3WGGA 1ULUA 4O59O 4RF3A 5FEUA 3VZSA 3PHIA 4E2XA 1KC3A 2NTNA 4YT2A 1GL3A 3HDQA 4R5HA 5ENVA 5JAQA 4NBTA 2D2IA 3WMWA 4PLVA 2X5KO 1TXGA 4XYBA 1RWBA 1DAOA 1G0OA 2X8LA 4CLHA 1DC4A 1MXFA 1Q7GA 4NPCA 3W4JA 4E2ZA 5KJ1A 2PGLA 5IN5A 4IINA 5EIOA 4AJJA 1D1TA 4ND1A 4QECA 1QP8A 2A9FA 1N7HA 4XD2A 2VWPA 1EUDA 1Z73A 3CIFA 5LDHA 4ZQHA 5AQ1A 2IYPA 4DWVA 3GPDG 2OZPA 3L6DA 4F45A 1E1KA 3GVHA 5ITWA 2AEFA 3FRJA 4C7KA 4CQLB 2I3GA 1IB6A 2YW9A 3WFIA 3RD5A 3RVDA 1NQTA 1DRVA 4R3WA 1PEDA 1VJTA 3QP9A 3SBOA 2JCVA 4AJIA 3C1OA 4L0QA 4F3YA 4AJKA 4I5EA 4M86A 3JQGB 1XR3A 5COBA 2IEBA 4YDRA 2VZ0A 3ZV4A 3MOGA 2BFMA 2JKVA 4LMPA 2BKAA 2O3QA 3DFUA 4HXYA 1E3SA 1DRUA 2GYYA 1QR6A 3PEFA 4YBZA 5KVCA 3SC4A 1XLTA 4H16A 4A0SA 4GKBA 1HETA 4TKMA 4AJHA 2XAAA 4JIGA 4ESOA 3WJAA 4R01A 3UW3A 1QXSA 4FJ0A 2Y1OA 3FNGA 1T2FA 2X9GA 5JC8A 1IOLA 4BNYA 3NAQA 4AJOA 4GSKA 2J3KA 5CHEA 1X7DA 3JD2A 4UVIA 4JXKA 1DC3A 2Q4EA 3ZWVA 2NTJA 1VL0A 5DDIP 1GEEA 1K3TA 1PZHA 4GMFA 1YH3A 1DHTA 4LW8A 3RFTA 5A03A 1U4SA 1B15A 4R51A 1UXJA 3WYEA 1ZXLA 3HB5X 2I67A 2NU6A 4J7UA 3ZN2A 2Q2WA 1KERA 1XQ1A 4U8GA 5G0UA 4WK6A 5T5QA 4IJWA 3RBXA 4E5NA 1PJQA 4G65A 4X54A 3I6QA 3F47A 4P4NA 3W4IA 1F8GA 5CDYA 1E6UA 1E77A 4E33A 4MP8A 4XJTA 1YL5A 2C2XA 2JD1A 4CMIB 5BT9A 2HLPA 2DQ4A 3M1AA 4IDEA 3AUUA 4CJXA 3WTBA 3JYNA 2YFQA 2ZATA 1YBAA 3AM3A 2LDBA 3LDHA 4RQUA 4TRMA 3FI9A 4XR4A 4D3FA 2NU8A 4JBHA 5CDUA 4Z6KA 3R6DA 1LBEA 1LSSA 3WNVA 1PJ2A 3JQ7A 2FMUA 1ENOA 2Y68A 1JKFA 3FWZA 1BHSA 2JCXA 3UH1A 2AEJA 4RQTA 1YB4A 1IZ9A 5CP8A 1RKXA 3OQ6A 4DQUA 2YJZA 5HWSA 2GLXA 4ZJUA 3ONEA 2VNAA 2CDBA 1NPDA 4M49A 1AHHA 2FR1A 3H6KA 1GZ3A 3U9LA 1B14A 4PZEA 4CM4A 4I9NA 2J5KA 4IZHA 4ZQEA 1ISJA 3Q2KA 4BKPA 4II3A 1B3BA 4UUNA 5TQVA 4GLOA 1KEWA 5GZ6A 3JV7A 2RH8A 4DBVO 3GG2A 4KUEA 1BDBA 1VSVA 3HNPA 4JJIA 4Q3AA 3A14A 1GPJA 4CMAA 1NPTO 1PSDA 3E03A 2W4QA 4FR5A 3U0BA 4W7HA 3BTOA 1RPNA 4PLGA 3BMCB 1KS9A 2FR8A 5DP2A 5H83A 2V6FA 1Z7BA 3WX0A 2PWZA 3GY0A 4BO4A 3S2FA 4CM1A 3C85A 4D45A 4OQZA 3VTZA 1MLDA 3AY3A 3KTDA 4LVUA 1ZMTA 2CF6A 2HRBA 1A72A 1NQAO 2HUNA 4XGKA 4DQVA 5L4NA 3DAGA 3FNHA 1BGVA 3PTZA 1Y8RA 4YEDA 1OBFO 4DXHA 4PCVA 1L1FA 4ND2A 3JQ8B 4QX6A 5JSFA 1UZNA 1SB8A 3ROPA 1BWSA 1VL8A 3EZYA 3PDJA 1GQQA 1JWAB 1CQJA 2PZLA 4UUOA 4F46A 1BSVA 1VI2A 2UUPA 3TRIA 5JYDA 3UHAA 1BXGA 3GVXA 3C1AA 4FIZA 1EMDA 2GRAA 4IMRA 2J3IA 3S2IA 4I9HA 5C7LO 3P2YA 4K6FA 4HY3A 1VKNA 1ISIA 2VRBA 1NTOA 4U0JA 4YT4A 2VHXA 5C5IA 1E7MA 2AHRA 2OBNA 3L07A 4NR0A 5IDQA 3CINA 4I1IA 3TOXA 4P22A 4J6FA 2Q3EA 1YJ8A 5THQA 4Z9XA 1RM0A 4J16A 2HAEA 4UREA 2C59A 3GEDA 4FC6A 4U5QA
chains in the Genus database with same CATH superfamily
5JCJD 2G82A 1POXA 3LHDA 1PZGA 4NXMB 3ACBA 1M5TA 1NW6A 1Y5IA 1C7JA 4M76B 1L4BA 4PFKA 1ADBA 2HK9A 3ICWA 1AOXA 2J5QA 3W06A 4DJTA 5IANA 2WQ6A 1E3MA 1WX1A 4CKCB 5LA6F 3MWFA 2O8CA 1J5XA 1WF3A 4HVCA 1EFUA 1W4ZA 1COZA 3GA5A 4F8EA 3WO0A 2AQIA 1QH0A 3I5XA 5JJ5A 1R5NA 6REQA 3N6RA 3WV5A 4CETA 1KOLA 4D99A 1HNZB 1UM8A 2V96A 2KBFA 1JR3D 4N41A 3A3NA 4G86A 3JVUA 4J8PA 4B0PA 1TFRA 3U9SA 3A36A 2B1IA 1PZNA 5JANA 1Y80A 3VYSB 4A0HA 1FYWA 5IWCA 4M8LA 4BBPA 1V1RB 4G1BA 5CA1A 4G84A 1PVOA 2H1CA 3LPNA 4FZVA 1T3HA 4MINA 1JNXX 3EQ2A 1DT5A 1NM5C 3SAJA 4AYXA 1K7YA 2PH7A 4PAOA 5T3YA 3FH0A 3K9WA 3BE8A 3U31A 4Q1BA 4GOND 3E61A 4KIJA 2C4VA 4GC5A 4BMVA 2W2NA 1YQXA 4NCKA 1T8RA 3KJHA 3PWSA 4CMJA 3GDOA 5AVUA 4AMUA 2FR8C 2AGVA 3N6VA 3SG0A 3B5JA 4HN2A 4BZZA 4TKVB 2X7JA 1P4HA 2IPXA 2NNLD 1QO9A 2P0AA 3EBPA 3LGSA 1PK8A 1YNOA 3VR6A 2JEOA 3KXLA 3SM3A 4AUMA 4EQZA 2GHRA 4H0FA 1UPBA 4EG0A 1XT6A 1XRRA 5A04A 3ECSA 5B1SA 1P0FA 4OQ4A 4I3GA 3GDFA 4JMPA 4XGRA 2E5LB 2ADFA 2CHQA 4HD8A 4ECAA 5KHLB 2A35A 2NUPB 1WUYA 1IMJA 4YQEA 3MMSA 2QP4A 2O0HA 3LT0A 4P36A 5EJ7A 4LYDA 2XCOA 2VDWB 5DNDA 2IELA 3OEEA 5FOUA 3UKJA 1SRRA 2C9MA 2IPAB 3B52X 3GUCA 8AT1A 5DOZA 4CFSA 3VYTB 2GZRA 3Q3HA 4W8HA 1FFDA 1LUAA 1IEVA 5HKAA 1DCFA 1RC1A 2IZ1A 1OXUA 2OV3A 4QE3A 2BF7A 4M9CA 3PQ4A 3ETLA 3HR8A 4MWZA 1HQKA 4DJEC 3CUYA 1VB5A 3ABIA 2EWVA 2FZEA 3P32A 5TQ0B 3U4MA 1U6KA 4ZAZA 4LYHA 2JCBA 1UDBA 2PD6A 3KZ1E 2YS7A 2FZKA 3AB8A 2VL7A 1WZIA 4MV1A 1JG2A 4DLUA 2Y76A 1F20A 4B6JA 3ZI4A 1APBA 2KE5A 4NH4A 4AJ2A 3BQ9A 3H7AA 5EXEA 1ZR2A 5FUQA 3UMCA 3EUAA 1NT2A 1QGAA 2GPBA 4IS3A 3CFYA 2JFQA 4JVMA 4KQ2A 2PD3A 1B0ZA 4IZIA 4OIFA 2P3QA 2HTFA 3L4KA 4U2DA 1K06A 3PQ2A 3PWTA 1Y4SA 2R1ZA 2WWXA 4G0NA 1II9A 4INPA 3Q8LA 2RGAA 2WE8A 2WEKA 5DHFA 3ZHSA 5TMPA 3LNTA 1QHFA 1F0PA 4LBVA 4PYNA 1FVXA 3GGJA 5H3CA 5FR1A 4DLLA 3KQHA 1PN3A 2PMCA 5AOVA 2XXAB 3EASA 2VDJA 8LDHA 4CN8A 5E6RA 1T36A 2F1IA 2I1QA 1F8XA 1FRZA 1K86A 2IBMA 3E6AA 2XQKA 4WECA 4A6DA 4GPEA 2RARA 1O6ZA 4PS1A 1SUSA 2VYNA 2YDXA 4HEA1 3GRKA 3HJAA 2C4UA 5DSXA 1EFPB 1U2RA 1LU9A 2Q3BA 1HYQA 1O58A 4MV0A 4MQFB 1Y3BE 4YRGA 4ZRMA 4V2UA 5EE5B 3DF7A 1RNLA 3AVWA 2DLDA 3PHBE 2O7NA 3EH1A 3U80A 4X64B 2O8DA 4B3IA 2D2VA 4CJXA 1B8UA 2QMEA 4KPUA 4J75A 1XN1A 1SVNA 3KKZA 5JAMA 4HDNA 3GP5A 3P0JA 4E4TA 1XMIA 3CHYA 3R7DA 1A96A 1GPKA 1NUAA 1XVUA 3MJVA 3IXQA 4ZDJA 1O5IA 3LPLA 3BHJA 4N0QA 3WLAA 1IN7A 2VP2A 3FETA 5IW8A 2XCIA 4KOAA 2C2HA 3J80A 1CUUA 3OQVA 4WZAE 1U0EA 1UPAA 1JEYB 16PKA 1THGA 2XOKA 3GLFE 5T8KC 3NU1A 1H4QA 5JNTA 1WSWA 5IUNC 3K94A 4RQAA 5ENDA 4ETWA 1ID1A 1PJAA 1MJFA 2HU2A 2IIQA 1GPUA 5EWJA 3G2QA 2WHPA 4C07A 4OU4A 3D31A 1F5SA 2GFQA 3D1VA 3I9NA 1ZBQA 5J43A 1GFIA 1M9NA 1N2EA 2XQVA 4YWJA 3ZD9A 1I7PA 2BF4A 3GRZA 1OPRA 2ZKIA 4FFLA 2VYFA 4R7TA 3S40A 5CEFA 4YDQA 2GLUA 5JD3A 4ZPJA 5E6UB 1E1NA 1GSHA 4HEA6 4S24A 4N8EA 4H7HA 4MAAA 1U04A 4TV8F 2FJ0A 2ZSFA 3QKRB 5EINA 4YB8A 2NQTA 5EE0A 5BMOA 3V1TC 2AYYA 4WOKA 2WYWA 3GZNB 3E1GA 3D81A 5TLSA 3CNLA 3NRCA 1DXOA 3QPUA 2XWPA 2E37A 3D5EA 4LRWA 4O2BF 5DGXA 2ZSIA 4S1VA 4O3FA 4IKPA 4OEHA 5IKMA 3OC6A 4RW0A 1EFDN 2IV2X 3V1KA 5EIWA 1LBQA 1IG3A 2IRWA 2Y1EA 4HL6A 2GPTA 13PKA 1NBHA 1P4AA 1U0HC 4IWNA 4RA9A 3RIMA 1C9JA 2FDCA 5U4XA 1XAIA 1JHXA 1V6CA 3DEYX 1XTZA 1U90A 2O48X 3Q9SA 2M32A 1F17A 3BMNA 3BWBA 3RREA 6AT1A 3UIEA 1VG9B 2I99A 1OXBB 2DM6A 2DR2A 1FOEB 1QF6A 1HQCA 1ZKMA 2BM0A 3PVZA 2PSFA 1Y81A 4DIOA 3JD0A 3WMRA 1H2AS 1KEEB 1SBCA 1M6EX 2GMWA 2Y92A 3QUTA 2J41A 4IUYA 5DT2A 3NHMA 4MGIR 3RTDA 2CF5A 2GF0A 4GYKA 4UZFA 2Z4TA 4QOSA 2R8XA 2WA2A 3MT0A 2K5UA 3GDHA 1ZUNA 2O8FB 4XM0A 1NMYA 3ZI0A 3GWGA 3MT7A 1Q0UA 1Z4JA 1JL3A 3AHHA 3OFVA 3ZHBA 4A8JC 1I5EA 1X1RA 1ZKDA 3W2GA 1DKLA 1U6JA 5EQJB 1SCBA 5LOVA 4YH1A 4JU9A 1AURA 5G1OA 4RDXA 4KPYA 4C0LA 1VIAA 2C83A 1IPEA 3DPUA 3KBBA 3N2GA 1J5PA 1P2SA 3P9ZA 1CVIA 1UANA 4CR6A 1Z63A 1QDUA 4C4PA 4P4SB 2C2BA 1AQ6A 3TL2A 3W4IA 1JH8A 2AD1A 2HU5A 3OTGA 1JXOA 4ESHA 1GZ7A 1QK5A 2E6KA 4MMXB 5GONF 3FUXA 2OK7A 3AUYA 3PRHA 3LFUA 5AO9A 1DTWB 3CW8X 3DMRA 4BO5A 1NFFA 3P20A 4HNRA 4IDCA 1JMKC 2FETA 2I1VB 1Z82A 2I76A 1Z7WA 3MS4A 3QLJA 5F3RA 2FOLA 5JNLA 1MH9A 3L18A 2ZJ4A 3HGQA 4WKNA 1L9XA 3OU6A 1MJGA 4G5QA 2WV7A 4NLLA 1VI5A 1DQZA 2QTAA 4ZT4A 2QZ9A 2IUFA 3HY4A 4BO3A 1SC1A 4NBSA 1AKEA 2FP4A 3P2EA 1DAMA 1VQ1A 1ISGA 4RADA 1T4CB 5CUQA 3LDAA 3ERCA 5BSRA 2PRSA 2ZM6B 3GZJA 3M6UA 4FNOA 3M6MD 5KYTA 1LRLA 2XPCA 2DFVA 1KZYC 2YMLA 4CLXA 5IU6A 1LV7A 2OD7A 3TEFA 3LW7A 1Q7RA 1ZJJA 1IRXA 1EBUA 4RK4A 4P92A 3KCNA 2D1SA 4C06A 1S4MA 5C3MA 4XQGA 1Z0ZA 4OBEA 3H5OA 2NSLA 2K7ZA 2JJ2A 3HB7A 3ET5A 4K6MA 1Y98A 4MW2A 2XVXA 2I6SA 1DG9A 1BXKA 4MEJA 2OV1A 5ALKA 2WABA 1WG8A 3B6EA 2C88A 3HV2A 4C6TA 4V0SA 1NQWA 4JVNA 3RRXA 3CJTA 1ODCA 4XYMA 4YXWD 1L0BA 1M75A 1D4AA 1BD4A 4C0BA 1B41A 3KQKA 2Q9BA 5EWMB 1M66A 4HFRA 5EG5A 4NARA 5BRJA 4RTJA 2WF5A 1E3QA 2XNCA 3T94A 4EHAA 3KTAA 2Y0CA 3BE4A 3ROXA 3WYGA 1G66A 3T9CA 2WUVA 2HRDA 1SVMA 3WKCA 3VSBA 1RJFA 1FU8A 1RXVA 3B1WA 3ICVA 5E7JA 4EEKA 2KMLA 3Q85A 3V3TA 4K9QA 4P4UA 2JC3A 4D9CA 5DBEX 4I14A 3ADCA 2ORWA 3C3XA 4WA7A 4KO4S 1JTEA 5IJZA 1SUCA 1XZ8A 1YDGA 3DAYA 2P5YA 1ZJ4A 4AP6A 4D80A 3B9RA 3G5MA 2O7VA 3HFRA 3IO5A 4ZXFA 5H3HA 2ZU0C 3ASYA 3NBUA 4S3MA 2M2IA 4ZJYA 2WP8J 4FYIA 4NS1A 5MDHA 5AJXA 3UXEA 4JVSB 2QX8A 2YZGA 2YVUA 2BEUB 3PUHA 4WJKB 3ESZA 4YRTA 4E11A 3K6SB 1E1LA 4MQEA 1HDRA 1GG8A 3MJHA 1PK7A 5KYWA 2F55A 1VBKA 4BFWA 2C1ZA 4QOHA 2H1LA 1JQKA 1MAUA 2F6RA 1AN9A 1MV5A 3L7NA 4XB2A 3ZEIA 3UWSA 2RB5A 5L7TA 1ZX1A 4RV4A 5JAUA 4WRRA 3Q8XB 2QLTA 2D6FA 3JWHA 5BORA 2Q7DA 4YAOA 5EMKA 4CMIA 1PWHA 2V3CC 2ZBPA 4KLZA 5E2AA 5EOVA 2W2XA 4AJPA 3U44B 4DARA 1I7DA 1TU3A 4RHEA 1YU9A 1HWYA 3W5VA 1AV6A 2YFYA 1GPDG 1RQ2A 1Z47A 2V8OA 4OMUA 1SCJA 1NQOA 1EYZA 3EVGA 3HJGA 4DDKA 3C3PA 1D4FA 3DMGA 3HACA 3EA5A 4L72A 3F97A 3PE6A 3T9EA 3DMDA 4MP6A 3UT6A 2WZQA 1Q1BA 3FAZA 3QELA 3CUKA 2ZB3A 4JJ8A 4RAQA 4BY9E 4GSLA 4PAGA 3H84A 1ZDMA 2WB4A 4ZV4A 2VHEA 3QVKA 1X9IA 4K28A 1DCMA 5KO2A 3RGWS 5L8VA 2HA0A 2IX9A 3FKSA 3HB0A 3IQHX 2D1RA 3UFXB 1ZXBA 4M6WA 4XWKA 4ZWNA 2OZKA 3OQMA 3AKCA 3KEFA 3FWYA 2YHSA 1SG6A 5AI0A 3IPYA 2G0TA 3R24A 2VJDA 4MQBA 1KARA 3A6FA 3V9AA 2J33A 1P3Y1 2VTEA 1JLMA 5I5GA 4R5MA 2OXCA 2IHYA 4XVQA 4F92B 5IDXA 1X92A 4I50B 3L77A 1F06A 1R6AA 2Y9MB 3KRTA 1C8VB 3W5AA 1QQAA 3GRYA 3KE8A 2TYSB 3V1UA 4D4MA 4EX6A 4EB6A 5FWYB 1O96A 4ZV7A 4E2FA 1AHNA 2QN7A 4FSDA 1WXGA 4A10A 2AR9A 3PC7A 1IRIA 4F4DA 3JALB 4RTPA 2XGGA 4B9EA 1SRQA 3LU1A 1KIFA 1CY0A 4O0MA 4E5KA 1RE0A 1UDRA 1BN7A 4FTWA 1EZ1A 3BH6A 3RUAA 1UZUA 4JFAA 4GOMD 3R9IA 3RSGA 2X9LA 3BMCA 2Y1FA 2JFXA 3FMOB 3H1FA 4LE2A 3DTVD 3TNLA 5IXJA 5LP6A 2VP5A 5AXBA 1XTTA 3UYKA 4RDCA 5ALYA 2JKZA 3IR7A 4NY1A 3NWEA 2G17A 2B20A 1IQPA 2GM5A 3OQIB 4I3FA 1KDVA 1JAHA 3WNBA 4BOYA 3S27A 1MKYA 3VSEA 2ZRBA 5HE9A 2XMGA 3K0EA 5DBFA 4D44A 4CUKA 2Z4SA 5A4DA 2M6RA 4QOIA 2GBLA 1IWPB 2KLBA 2XTZA 1Y8QB 3T0IA 1DJOA 4RM3A 4RPHA 1RP7A 5I9IA 4OQLA 1JWBB 2XD9A 4PZCA 1CJVC 4X45A 4FHZA 5EP2A 1RZRA 1M0WA 1TUEA 4U6QA 1HLFA 2B61A 1YZHA 1SCKA 2EF0A 3R3JA 3IKMB 4YDHB 2JIBA 3EBLA 1E9RA 5KQRA 2C0CA 3KT8A 1NRWA 1PTJA 2HCRA 1UC8A 3LXRA 4LYJA 1IM2A 3MUFA 4M7PA 2G9UA 1CS4C 3CCBA 3GI1A 3JATB 4ZVMA 4TS1A 1OLSA 2HMWA 4IMPA 1Q77A 4J43A 1FTSA 4Q12A 5D85A 1TYEB 2B5OA 1Z6AA 4U9HS 4BASA 5B4VA 2Q1YA 2QZ4A 2EXXA 2NUTA 3HCBA 2WP0A 5F1YA 4M89A 3AMVA 4IGKA 5LQNA 2JFFA 3MHPA 1JE0A 3F3SA 1IU9A 4F1WA 2AG5A 3SSOA 4ZCPA 5COAA 5HUHA 2QHXA 3RR2A 4HQOA 5IBPA 3U13A 3N6XA 2PSHA 2E82A 3AESB 1IPHA 2VQFB 2P9EA 1ZM3A 4HTFA 1TCCA 5JO9A 2XHZA 2XUPA 4E70A 4YJKA 3TAXA 5J47A 2O3RA 5DWQA 5D5QA 1WB5A 2PAFA 3OO0A 4O4HA 3ODPA 5HM8A 1XMQB 1ZD8A 2X40A 2B92A 2GPJA 2SNIE 2BI4A 5REQA 1ZQ1A 3WJ2A 4FLFA 2A0KA 4NOMA 4WX2B 1I7QB 5D7BA 1L1EA 1WULS 2QTLA 2F3QA 2JLWA 2NSHA 1NVBA 1IN1A 4K03A 3VH1A 3DAPA 3UJ3X 3MB8A 3LYHA 5ALTA 5LLTA 1A8UA 4OHWA 3ZY6A 3ZHUA 1N2CB 3BSSA 3A0RB 3SJCA 2D74A 4NV0A 3RYFA 3I5MA 3TLCA 3H9QA 4FLMA 4BWVA 1WCXA 4HZUA 4JENA 1ZINA 2ODPA 3F0TA 2IOHA 5DX0A 5FL7D 3TB4A 4P1ZA 5AVZA 1TRHA 1F2TB 1QU2A 1QHYA 2QN3A 1ZH8A 3W5JA 2V0CA 1JZSA 1ZD2P 3KFLA 3OKFA 4I08A 3LUBA 3UANA 5GOTA 1CLUA 1GZ6A 1V39A 1TEXA 3F2VA 7MHTA 2PZBA 2FEMA 3LP8A 2BSQA 3CQ9A 2PKEA 1VOTA 1SC4A 5BSUA 1Y5MA 3O1JC 1M6VA 3DXXA 4UBIA 1PX2A 2B36A 1Z2NX 1K6MA 3OVMA 5LLDA 2NU9B 5IKXA 2SBTA 4LZOA 5HNKA 4XTCS 3MHTA 3QEMB 2VRWA 3MRVA 1ZOIA 1L4UA 3GUYA 2QXYA 4FN5A 4MUHA 4C7XA 2P69A 5E3JA 2OD9A 1N34B 3RRMA 3V4FA 2H8KA 2HJVA 5T4EA 5JCOC 1AS3A 4GVLA 1C9DB 1DSSG 2QN1A 4UU1A 5KI6A 3T35A 3NHPA 1PGJA 3O75A 3FCOA 3TTUA 3K92A 2IUTA 3OZGA 5HZMA 5I4KA 1NMSA 2PUJA 1TA4A 4O4LB 3DEFA 3T5DA 1D8AA 4O2AF 3EC2A 4CGZA 3SEAA 2I2BA 5BWCA 3LECA 2JI8A 4TMZA 3O2QB 4TL7A 5AJWA 1JJFA 4KOEC 4J0JA 1XZKA 1Q19A 4I4TB 1BKSB 4G1CA 1H05A 3F74A 1C3OA 1WNTA 2ZWOA 1IHPA 1HOTA 1XTPA 1YR7A 4QBTA 3SR0A 1EVJA 4DG8A 2RGGA 4Q48A 5G0SA 1MOSA 5H02A 2B4QA 4C4ZA 2A58A 1JDBC 2DFPA 1DEAA 2CZGA 2FN7A 2I7XA 3HHPA 5FUYA 1GA6A 4Q02A 2RONA 2C04A 3F49S 4B80A 1G18A 1P5HA 2G5GX 4YONB 4Z4FA 3L0YA 5DM0A 1NM5A 2Y66A 4JC0A 1IB0A 2BRUA 1XMXA 1L5MA 4FN4A 3T1TA 4PHHA 2NV2B 4JJGA 1S9HA 2DWQA 4DSAA 2M6SA 3FUUA 4MS4A 2EZ8A 4G85A 2RGWA 1YQQA 1R10A 1SEVA 2DCUA 3NHFA 1A4UA 3PX2A 4BLSA 2HHHB 3CUVA 5K5EA 3CR7A 5AKYA 3D3WB 2VSOA 2GR9A 2QRLA 2CN1A 2X41A 3ONWA 3OD5A 1WBDA 1VHQA 1TOAA 2PK3A 1PO7A 1M34E 1NOJA 5LVAA 1WKCA 4M8NE 4DLSA 1P4GA 5CIWA 1JILA 3PKZA 1S2GA 3F73A 3Q4GA 2N42A 1ORRA 5JFTA 2O59A 3MGBA 1T2VA 4FHCA 3AHGA 5DVZA 2IPNA 3E70C 2H0RA 4WFJA 3F3YA 3H5TA 5HK9A 3DZGA 4PG7A 3TZ6A 4MX8A 1COWA 3K0AA 4DA6A 3P45A 4KXMA 5EVJA 3F7TA 4CKEB 2RGEA 4QVKA 3FWKA 4DV1B 3EF3A 4ZCLA 4Y2YA 3IVMA 3UK6A 2JK0A 4MR8B 2QLBA 5BQ3A 4PG8A 4W5RA 3BGIA 1YR2A 1BFDA 4ZEMA 3WB2A 3E22A 1E9EA 4NJEA 3PVSA 1CZNA 4EFMA 2PS3A 3EJ6A 5EJFA 1UC4B 1X2BA 4YCMA 4C7VA 1RBMA 4Z8XA 2EARA 1Y5LA 2ZTLA 1MAWA 3ZXSA 1NNEA 2PX3A 4CEIB 1UDAA 1PJCA 2XA2A 3NOOA 5JSZB 3W7BA 2ZSDA 3D8RA 4BEVA 5CBPB 1EX7A 1LH0A 4RF4A 4TT3A 1OV6A 1ONNA 4MW1A 4EGSA 1G9TA 4LAFA 1WRBA 1ZH2A 3H5WA 1XRQA 1UBCA 2R47A 3H5AA 5EJ9A 1PFWA 4QATA 2P6RA 1CJCA 4WASA 4YP0A 1ZK2A 2PXAA 3G0IA 3G2HA 4PZUA 4BTVA 4CF5A 4RJLA 4ZMSA 1SB9A 2J08A 4KEAA 2A3RA 2XD4A 4DHWA 1IOVA 1HFJA 3FY4A 1PNTA 3KOYA 1NBEA 4YJ2A 2E4ZA 4PHCA 2ST1A 4X90A 1ZK0A 4JLDA 4AKHA 1UAYA 1GUAA 4FMCF 5AW3A 1Q14A 5JASA 3RB8A 3UWPA 3ILSA 2H85A 2FEAA 1U1DA 3KYCA 4MV7A 4AG6A 1NNI1 3DL2A 3HV0A 4J4HA 3FWPA 1XYGA 4C22A 3V1NA 2RCYA 4OLFA 1WY7A 1QQ7A 2O5CA 4NABA 3KJGA 1FJ2A 3IP7A 4DB4A 5DBGA 1KGDA 1XE3A 4IJMA 4RK5A 4YRLA 4XYGA 3AHFA 3CZ4A 2ZIEA 1E6MA 2QRPA 4UBOA 3V34A 2MSDB 4TV9B 2C42A 1V71A 1KJ8A 1Z4PX 2GWHA 3KOWA 2V9PA 2WM8A 3BWMA 3IEXA 4X20A 3WISA 5KTNA 5A3RA 4LN1A 3WBFA 4MUAA 4ZHQB 3H5RA 1U7WA 2I0FA 3CV3A 3TUIC 3F3MA 1JBQA 2YHIB 1WDKA 4XAQA 1RJEA 1NSYA 2OL4A 1YRWA 3FTEA 3QQ5A 3HCEA 4J3NA 4HDSA 3NC4A 3PDIB 1C9KA 2ZSAA 4P4GA 4ND8A 2TRSB 1OGIA 2R5WA 3A3KA 1PAUA 3IVGA 3MUOA 2P2GA 1P1KA 2J6CA 3EZFA 1Z26A 2A0WA 1E96A 3EGVA 4E13A 2BFDB 2AT1A 4R3UC 4EK9A 4XSGA 5AVOA 3RG2A 1BX0A 5TJ9A 1OTYA 1DWOA 1ABFA 4NU0A 1ENZA 1T8SA 1ZLXA 1JHRA 2GWRA 3ASVA 5T8KA 2V0NA 1H2WA 1UPCA 4JGGA 1VBFA 1Y6ZA 3D2BA 4G4JA 4TM7A 3LUGA 4GW3A 4QPJC 1BJKA 4RANA 3L6OO 3RUEA 4RO0A 2QEQA 3NDBB 2EFYA 1LPBB 1VMDA 1MQ8B 4TLAA 3RTAA 2J5RA 1ICEA 5JCJA 3MBOA 4LSZA 3RRJA 4MH0R 4JP3A 2AI3A 1X9HA 5C7IO 5CAEA 3JU3A 2VQEB 2QTBA 1A9SA 4PPQA 3IVRA 1LQ2A 3E53A 2HT1A 2OK8A 1R8YA 5EXSA 721PA 2EHDA 1ZRNA 4OJKA 5I9LA 1OXSC 4RFSA 1XF1A 1CFZA 2XIQA 3SX2A 2AWNA 4U39A 2UU9B 5AD1A 4PPFA 4Y2SA 1YI8A 1KFBB 2H51A 2OTCA 3PPIA 5G02A 1JR3A 5TS3A 3AR5A 3T4XA 3UBMA 4ZICA 5J5CA 3L40A 2FG7C 3LQ4A 4YP1A 1O03A 5LIRA 2R8YA 1ZC3A 3B12A 1ZMBA 2R11A 2XVMA 4RE6A 1ZH6A 1J8YF 2QI9C 5FULA 1GPAA 2WSBA 4Q6WA 3VDQA 1Z2PX 2O9JA 3NNSA 4GVPA 5FHRA 4BMPB 3NKFA 4BEJA 1RZ3A 5CX1A 5CXUA 4WDRA 1LNSA 2Q6LA 2YXDA 5AQEA 4K5QA 4RFVA 3H4IA 3RC1A 1EPUA 3IP6A 4PF1A 3RIYA 3K9HA 3HXTA 3RHTA 1KMHA 4FS8A 4ZVOA 4NU8X 3SZUA 4B47A 4DXAA 4F60A 1BW9A 3I8XA 5TRTA 4J0QA 2ZREA 1LS6A 3KC2A 2WK1A 3HKEB 3V1LA 2ATXA 5HFNA 1Y9ZA 3GRRA 3KLNA 2XF8A 3O31A 1VG8A 4ENVA 5BW8A 3WLSA 3KG2A 2XDAA 1T34A 4KXQA 4LJYA 3AB7A 4UNPA 3SU8A 4I50F 4A8JA 3IMCA 3ZGXA 1HG1A 2A4MA 4LV8B 2OXTA 5JPCA 4LA4A 2IY7A 2TMDA 3K1ZA 3P1JA 1DOAA 3VJMA 5CMLA 1JKJB 1J33A 3FROA 3QMMA 5EXXA 3WWOA 1NR7A 3H3JA 4YJGA 4D92A 3DKVA 1F0YA 2CZQA 4KTVE 5FHQA 4M83A 5KC8A 4LDNA 3RVBA 2QQGA 3BSFA 1CUWA 3FPEA 1WNFA 1E1YA 3SOPA 3SZLA 3T7DA 3AM5A 1MA0A 1CNMA 3BD7A 1DBWA 2R8OA 1K3FA 4XGQA 2JRCA 2O7QA 3DD1A 2KX7A 3NT5A 5KJFA 3QYPA 5IEBA 4IJ5A 1QANA 2Q3FA 5BRAA 2EZ9A 5CA1B 3MD9A 3P4UA 4IYRA 1QAMA 3LVBA 2I3DA 2PX2A 4L95C 4N0MA 1DAPA 4Y6PA 3TDNA 1R4MB 4HH1A 3TSCA 2X2PA 3F6YA 1HEYA 4CDRA 2QDKA 3HS3A 3TI7A 5H0IA 2CFSA 2JHPA 3AVVA 3U0VA 4V2IA 2QTHA 1NJ5A 3GFPA 1N2SA 4E46A 1N7JA 4F96A 3BORA 1G5IA 3CIOA 4YN3A 5FA6A 2ZTUA 2YICA 1U65A 4GBGA 4M2LA 5GGXA 4G8JA 3FMIA 2D00A 3BCRA 2WFZA 4QO7A 4XH9B 2OR3A 2OO5A 5JBQA 4U00A 1OU0A 2BFWA 5FB3A 1Z5ZA 3DR5A 4CR8A 2XCTB 2Q49A 3WBKA 4ALIA 2UYYA 4DE5A 4NCBA 5C1DA 3VHQA 3GT3A 4KU4A 4PGGA 2Z6AA 4UHJA 4LXIA 3BKWA 5HTOA 1LBSA 1KU6A 1UPXA 1W1UA 2HK7A 2WYUA 3EFEA 3G89A 1NUPA 4L5AA 4O0LA 5F35A 3TLEA 4ACAA 4MVJF 4CMBA 5CA0A 1VLMA 3SZ3A 2F8LA 2IV7A 4EHKA 3ZCXA 2J3QA 2W7TA 2G7ZA 1E4YA 2SECE 4K05A 4KE6A 4OSOA 4WKPA 5ECYA 4AWXA 3O6VA 3IOMA 4MGEA 5C80A 2WF7A 3N0VA 2C9ZA 2HM7A 4IXWA 2XX3A 4IEIA 4Y6GB 1TC1A 4ZAVA 3M33A 2YYSA 3CURA 5DBOA 1MHTA 1VIYA 4DR7B 4QNMA 1TUBA 1K0FA 3GJ0A 2RKBA 4F3NA 3H1GA 3OM1A 2XGJA 1U3WA 4D9MA 4R16A 3HYSA 1EAMA 4C14A 1CZRA 1UH5A 4RH3A 1I3OA 3DDWA 3INYA 4Q4LA 3UAGA 2BGMA 1XZEA 2BMWA 4IIFA 2ATEA 2MIIA 4UEJA 4YFVA 5DCUA 3TINA 5KQMA 4C87A 3DG9A 3U4HA 4C7OB 3WGMA 3OESA 3UGQA 1PDOA 3CNHA 1Q0LA 4GM4A 3PRJA 1XA0A 1S3FA 2X77A 3GWZA 4LQDA 1PS0A 4R1TA 4U1RA 4C4RA 2CYBA 2FFJA 3G8YA 3RODA 3ZBTA 2EGHA 1V48A 1NVTA 2NADA 4XWTA 5KMGB 4LZNA 2EGGA 3FPCA 2F8MA 4BP3A 1P7CA 3G9XA 2GK6A 2XQJA 4RABA 2E4YA 4UTNA 2OCDA 3ZGNA 3L6CA 3UEOA 4ILKA 4ZZ0A 4OBWA 1DQPA 4R9NA 1SHZA 1RJ9B 3MN1A 2R2GA 1TJPB 1AUPA 1FYEA 4HPWA 2ZBRA 1X13A 4L4RA 1ZS9A 1M1UA 4U3JB 3SXPA 3DHWC 4D4LA 3A6JA 5L3SA 2NAFA 1FP4B 2VBFA 2GEDA 2VYQA 4NPAA 2J5XA 3STVA 1S2IA 2TECE 3ECCA 3A1DA 3OJOA 4RPKA 1CRLA 2IYQA 3IULA 4R0NA 4TUYB 1EWVA 4GI2A 4YREA 3T5MA 1B0UA 4D3SA 2AEEA 4HWRA 1Z22A 1NNSA 1U6IA 3D2LA 4G09A 4GUAA 3SKVA 3T3HA 3WK9A 1LRKA 4A73A 4BNJA 3T7RA 3MMPA 5ICMA 2E2WA 3WRYC 5HXAA 4Y2JA 2BDTA 5KNDH 4DR5B 5B30A 2C7BA 2H1OA 4ZYXA 4NECA 1VB3A 4BQEA 4GX1A 2XTJA 4B45A 2CB0A 3LDUA 2C5LA 2XBLA 4P84A 1OE0A 2J30A 3BHMA 3DNFA 4ZK6A 5AW2A 4RZIA 3EX7C 5DRYA 1ZVMA 4AWBA 3ZDRA 1G8HA 2C4TA 1E7SA 3E05A 4IIYA 4PQYA 5BMVB 1UXGA 4GDFA 5A3QA 4ZQFA 4IG9A 5KTTA 2ORED 2XNHA 2YV4A 2GCPA 4RLQA 4RTLA 3ENVA 3H1TA 4JCOA 3VZDA 2BONA 3A1EA 2W4MA 2POQX 3HE3A 1NXXA 1GO2A 2RHRA 4RIGA 4L3VA 5ES4B 3CNOA 4Y1RB 1LPOA 2PEYA 1U5BA 2V9CA 1N0WA 3A6DA 3DXYA 3EVEA 3KALA 3NVAA 3NRBA 4K88A 1WVGA 2WWFA 3O3MB 1KI4A 2Q2QA 3U7QB 3A1WA 3EW7A 5GVSA 3LK7A 1G19A 2PLWA 4PONA 1X39A 3SYKA 3IP5A 5AR1A 4UTPA 1RLIA 5DYGA 1YMUA 3QVWA 4L7QA 1FFWA 3TB6A 3T7EA 2VK4A 3HJTA 1AO3A 1P6QA 2IXFA 1EE9A 3D5QA 4E03A 1D3AA 4LXQA 3ZEAA 1UDWA 2AI1A 4RIFA 3U4CA 4C3UA 3JARB 5LQDA 3VMMA 4BS9A 1IEXA 4EDFA 1UMBA 2GPSA 1K0UA 2E5WA 2WJPA 3AR7A 3OPVA 5DXAA 4F2WA 2C97A 4I1RA 1XHFA 1O5OA 5LJLA 2FZ4A 3ITDA 1NA5A 4IPTA 3FGZA 1G42A 3GROA 4MVJI 3KJIA 4EJSA 3AXTA 2J0EA 2XE7A 2ZI4A 4LXHA 5E7QA 4EHLA 4H1WA 1ILEA 3B1JA 2X5OA 2H4ZA 1BIFA 4QXMA 2J32A 3I0MA 1NHWA 1MIOB 2G76A 4FVTA 2AQHA 3IMEA 1QVRA 3SR4A 4E14A 3LC2O 2V7PA 2HCTA 2AMYA 4MO2A 3HZOA 2G5TA 4LZJA 4UATA 4JT8A 2W6ID 2BIFA 4BFSA 1HNWB 3BGOS 4N6NA 1EZZA 4OHFA 4D4JA 4Z9BA 5K0TA 3ODGA 1OX6A 5C35A 4TTAA 4XQEA 3F1KA 4TLBA 4K9KA 3KD2A 3ZHTA 4Q1CA 3SLRA 1RBQA 3ZHYA 2YV5A 1TYBE 5EN4A 5EHXA 3GJSA 5DTEA 1S01A 2ONKA 2AZ4A 3FKJA 4M53A 5L6LB 1DS6A 1V8BA 2IW3A 2ZDGA 3O95A 3AR8A 3KT0A 4OYHA 1P4JA 1ULHA 2QU7A 4CM6A 2PS1A 4UVDA 3A1NA 4MVJP 1U7DA 4KTTE 3WGQA 2DBYA 4YXWA 3AF6A 5H81A 1G2PA 2FXIA 2JPDA 4TS3A 3QX7A 4PO8A 5M34A 4N48A 1RMQA 5GIOE 4L74A 4HNAB 1T2DA 4F2HA 2BEWB 2D0PB 4AJ1A 4A91A 3Q0IA 2A9QA 3REGA 2MDTA 4NJOA 1UBTS 4BBAA 1QUEA 1HDGO 4A15A 1AUQA 1U28A 1RYBA 2IXGA 1WHTA 1A76A 3G0OA 3P4XA 3H86A 2PRKA 4LRTB 1Q84A 4NZYA 4B82A 1FDSA 5JO0A 1Y5RA 1E1QD 4MI6A 3I2JA 4RMNA 1GDTA 4OLAA 5B7NA 2JHCA 2OSVA 3NWOA 1M7BA 1MFZA 4KXUA 1LI4A 4JIMA 2MMCA 2NZJA 4QIHA 3IEMA 2W6NA 2ZJ3A 4YJFB 3W1EA 4FCTA 4NV1A 3PZBA 3BWYA 1E2FA 1SQ5A 4MLCA 2QTGA 4UHEA 1M6HA 1I4OA 4URZR 4DNPA 1NJ2A 1TYDE 3URKA 4S1NA 3RVOA 1FFXA 1YASA 1KO5A 1WXIA 2PH5A 3PR1A 1O87A 7AT1A 1YL6A 1A2OA 2IQ5A 3HPRA 2YVAA 4URYR 4WOBA 4A6PA 1GG2A 2E5FA 1H65A 3QUQA 3RSHA 3EMKA 4BLVA 1NXSA 3FJYA 3RK1A 1NZJA 4NSNA 4F9EA 4US1R 2J8ZA 4TQAA 1MN6A 4CTJA 3ADKA 4G56A 1A9RA 5AOBA 3FG9A 3LYUA 3F3KA 4PO1A 5KYGA 3C8HA 3ED5A 1KEVA 3P0RA 3SJ7A 3WJ1A 4DV4B 3ORQA 2RHCA 3W5IA 2CVOA 3F4KA 4KAFA 5AK3A 5DX1A 5JCOA 1VXOA 9ATCA 4Q5IA 5A5DA 4BVHA 2R68A 2WJZB 2EV9A 1M0TA 1SWWA 2C7PA 4HWSA 1NN3A 1I4LD 1USUA 5IT5A 1W7AA 2XNSA 4DHEA 1T3LA 4EY7A 5LYYA 2JAOA 3E9EA 3CLSC 1QPZA 1X9GA 4WEOA 4BQFA 3BGVA 4WCVA 1KDOA 3L0ZA 4EPYA 1A88A 4HB0A 1DADA 1YJAA 3MWGA 4Q7KA 4JV5B 3V8PA 3PYXA 1V1JA 1GSAA 3OTWA 1W87A 3OCWA 5AM4A 2BTOA 2QE7D 3K5IA 3IB6A 1R6DA 4GI1A 1BG6A 4ITVA 1YR3A 2HGZA 1B0AA 1H4TA 4F6CA 1K7FB 3FGNA 3L8ZA 3RNLA 5JROA 2ZSHA 2XB2A 2DHQA 5KTSA 2COEA 2W71A 1RI1A 3WZ2A 1UP6A 5C1PA 3CVVA 4MRPA 1NKTA 1WUHS 5A7HA 1TM1E 1I51A 1CPYA 2HJSA 5K8IA 2FSPA 1M1YE 1YS4A 2NSJA 1VLHA 1MZPA 1U3DA 4INOA 1AKRA 3BWDD 1RKUA 4KXLA 4ZRDA 3RNOA 3H6GA 1CY1A 4A03A 3L7AA 1GZDA 5JPIA 3ME5A 3EXEA 3RFVA 2QTNA 4WNAB 1OTHA 1N2GA 2GAFA 1M1XB 3GLGB 5BVGA 4UEQA 1NW9B 3R9XA 3Q3VA 4YCAA 4AO8A 4DM7A 2ZS9A 1XJQA 3RU7A 2O19A 4B3SB 1NRXA 1XX6A 3TRKA 1VCIA 4XWOA 3SJUA 3CLVA 4XUEA 3S68A 4GAEA 3WGHA 1TCVA 2G1PA 3W5HA 4LVOA 1I1QB 2H4WA 5FO0A 1AK2A 4MYTA 4D79A 3U3KA 4E7PA 1ZW1A 4N1AA 2YHBA 4A92A 1PL6A 3DTVA 5LMUB 2V6BA 3W77A 2P78A 1NVFA 2A3NA 3MTJA 4HKTA 1FX0A 2EL9A 4PC2A 4IXNA 4AD8A 1JEJA 1YJQA 4H3KB 5KOJB 1BN6A 2DG2A 1OZGA 4JDPA 1CUAA 3HL0A 1RYMA 2Z3ZA 1YQEA 3KEQA 2YY7A 2Z2KA 2H07A 3KVOA 4DG9A 1P33A 3PXUA 2GKOA 2VEOA 2C5EA 2IYWA 2A1UB 3G9ZA 3DM9B 2BISA 1ESZA 3EXFB 3W3AD 5HJ5A 2GO1A 4EUNA 2JVKA 5AHRA 5ICSA 1NJSA 2Z2ZA 1MRNA 3BIOA 4A5SA 3DFZA 2NX2A 1QHHB 2PGNA 3RF6A 3U61B 1Z17A 3SYLA 4D56A 5J4YA 1B23P 2OXRA 1YE8A 1BX3A 1PBTA 3VHXA 3KL2A 1B42A 3N74A 2CDNA 221PA 4R2JA 2EFGA 2FZVA 4CNQA 2AR7A 3NWBA 3KAJA 4FFWA 2XLBA 4RXTA 3I2KA 3Q72A 3B5IA 4NESA 4CFZA 1Z83A 2XOXA 3NP7A 4GP9A 1ISHA 4K9DA 4BX3A 4U7PB 3K1JA 1XGKA 4LJLA 2EQ5A 1SQFA 1F60A 3RBXA 2XMDA 4YMVA 1RD4A 5IT4A 5IT9A 2BGTA 4WZBE 2QJFA 3TQRA 2BCJQ 2XYVA 4IIJA 2JBHA 4NOJA 1GRNA 5KKNB 1JMVA 3GJTA 1ST3A 1G0NA 1KNQA 3ITKA 1NBIA 1II8B 3L0SA 3ZXIA 4BLRA 4BQPA 4Y1EA 4A26A 1WCIA 3BBPA 4INZA 2YWJA 2QD3A 3H2JA 3QU5A 1LJLA 2A1TS 2EIXA 4NU6A 5CH5A 4JB8A 1A95A 5FI1B 1U11A 2WTEA 1N8NA 1RHUA 1HLPA 5JD5A 1TKBA 4U9UA 4EIWA 2GK3A 1AKWA 5ALHA 1TD1A 3GH1A 1YUMA 2HGSA 2PXXA 2JFBA 3AYXB 5FL7A 5T64A 1SA0A 3JAWA 4LHZA 1RCUA 2MYTA 2O7RA 2H11A 3TCKA 2D5AA 4ZAYA 1G3MA 1W5TA 1WMEA 4B8ZA 4ISBA 3FVVA 5IAEA 2AE1A 3LCCA 3T7IA 1ACJA 1KKUA 1P2UA 1VP3A 3FPHA 1AZWA 2B1QA 4GMHA 3L6BA 4OM7A 4R40A 1IY9A 3CZQA 2OV8A 2GB4A 1IUKA 1EWRA 5C8YF 3OE4A 2QBYB 4KFCA 4UJ5A 5TMEA 2PJZA 1GTL1 4TYWA 5INTA 2C4MA 2ZYSA 4LVNA 4RNDB 2YWBA 3C3AA 3FOCA 2F3RA 5JS6A 3W9BA 1ID8A 4CF6A 4Y7CA 2QPOA 3DS8A 4BQIA 2E7ZA 4HZIA 1BCSA 2DTXA 1IATA 1CDOA