4OK5A

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 9 [1-(3-ethynylbenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
446
structure length
441
Chain Sequence
b'FTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPDVVVVSTDALMTTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 148
structure length 441
sequence length 446
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4ok5A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok5A01
1IXZA 3VR6A 2P6RA 4FW9A 3EPLA 1W0JA 5IDVA 1D2EA 3KX2A 2QSZA 6Q21A 2GXAA 1G41A 4D0NA 5G41A 4LJ5A 1T3HA 1AS2A 2GJKA 3W6OA 3W3AA 5KSZA 1N6RA 1EX6A 5BYJA 3FMOB 4G01B 1EESA 1E99A 1NN5A 2FE4A 1MO6A 5FPSA 5KO2A 4Z51A 3NBXX 1RKBA 1EG7A 1E0KA 4TLCA 1G8PA 3RDPA 2ZYWX 4ESHA 1OH5A 1G20E 1Z6YA 4NBSA 3QKSB 1X1RA 1H8HA 4LBZA 3K0CC 4O3MA 1KYIA 5H68A 4TMXA 5JS7A 5JEEA 1AS3A 1RZ3A 1N5JA 2AHOA 2ONKA 2Z6VA 4IOLA 2KBEA 1DTSA 4KO8A 2ZAOA 4HI0E 3LD9A 4B44A 3OEEA 3ZD6A 4FCTA 2OLKA 1SXJB 1EFRA 1XB2A 1YZLA 1OV4A 4JSYA 3MJRA 1W5TA 4CT4B 1FTNA 1Q1ZA 4DXAA 4A0HA 3KXLA 1IN5A 1KI4A 5L3VA 2C04A 1AM4D 1V5WA 2P5TB 2IS6A 4TQAA 2AXNA 4OJQA 3SS8A 1KHTA 3AH8A 2WJIA 3LQQA 4Q1FA 2BVNA 5AUQA 3U7HB 2YKGA 3SR0A 4F92B 2HXSA 2YYZA 3U3OA 5LDDC 1EX7A 3AQ4A 2BHRA 4QGAA 5SZHB 5FR1A 1O3YA 3LW8A 1KDRA 4GPTA 1H8EA 4M1SA 2HLDD 2BEKA 1JEEA 1WBBA 2ODWA 4R98A 2N1BA 2HCBA 4Q47A 5E4FA 1EK0A 1C4OA 4RCZA 4G5OA 1DAMA 5EXPA 3N2EA 3T1OA 1NP6A 1T8TA 2JLRA 1M34E 4BZXA 3AKDA 3CF0A 1COWD 4FN5A 3KJHA 1Q3HA 3OIUA 2OHFA 4Q9IA 1A1VA 2HUPA 1E9SA 1KZGB 3NWJA 2BBOA 3WNDA 3TLXA 1ELOA 1ZNWA 1NRJB 3ZZ0A 3B1XA 3SJCA 3V4FA 2O0KA 1KI9A 3B2EA 3O47A 5CM8B 5B2ZA 3ZJYA 2V1XA 1US8A 1G16A 2AD1A 2IYXA 1PUIA 1Z08A 2IYTA 4JKYA 1GNPA 4H1VA 2ATXA 4Q4AB 1WRBA 1E9BA 1CRQA 3UANA 5FL7D 3AP2A 3SJZA 3GJ5A 1NLYA 4GMXA 4A6XA 3EC2A 3WP1B 5J5CA 3PUVA 3HU3A 4OHVA 1QG2A 3JZAA 1MRNA 3PXGA 3GEIA 3TUZC 4HAZA 4ILEA 4HAWA 1A7JA 2C03A 4HZUA 3S1AA 2BBTA 3ZLJA 1YZUA 3KL4A 1R5NA 1CEEA 3ZZUA 2BJWA 1KO1A 1WB9A 3IPYA 4XTRA 2RCNA 1UBCA 4IDHA 4LHWA 4Z54A 3OE7D 4W7SA 1X8KA 2HLDA 2PT5A 3BERA 1DAIA 1G8FA 2E87A 1OF1A 5EP4A 2AD5A 4D6PA 4LOAA 2OSBA 1XD2A 2WOJA 1E2EA 4B74A 3QY0A 1AKEA 2EVWX 2IC5A 1PLLA 1FQJA 3JVUA 2ZVQX 1Q44A 4MYUA 4AC9A 1YRAA 1ZM3A 2WJYA 3MSXA 3VKGA 1X6VA 3I1FA 1SXJC 1ZINA 4TL6A 4ZIRA 4Q1AA 4BFSA 4RZUA 1LNZA 1GVNB 4Q1DA 1RIFA 5A0FA 4OI2A 4Q19A 4ASUD 4C9BA 2W0SA 4PC1A 2ODNA 4G5SA 2WJVA 4NTZA 2O52A 1T5LA 4EPXA 2O8FB 2CMKA 1D9XA 4UNQA 1A5TA 5FL7A 2QP9X 1CKEA 4TN1A 1CU1A 1XJ0A 3A1TA 4RD3A 1R5BA 4US0R 2ERXA 4MUBA 3FKQA 3FHOA 1W48A 4ZCMA 1SGWA 2QU8A 4QOSA 5FUWA 4JKIA 3T1QA 3CUEF 3LBIA 2N42A 3LX8A 5HE9A 1EWQA 2FFBA 3Q8XB 4B3XA 1DPFA 3K70B 1E4VA 1U0JA 3TR5A 2DFLA 3EZ2A 4Q00A 4AYXA 2XTNA 3I73A 5AJZA 3OE7A 3BFXA 1F48A 1IN6A 3LXXA 4JVLA 1G7RA 2DY1A 2WJGA 1GILA 1JNYA 4I99A 4FMDB 4HAXA 1KO7A 4XVRA 5HCIA 1Z0IA 4UNPA 2C5LA 2GZHA 2FOLA 2QAGC 4LYJA 3FKSD 3V9PA 1C1YA 2F6RA 2ZJ8A 3W5IA 2WWGA 1QG4A 4TL8A 5KTYA 1GP2A 4BLTA 1K5GA 1NLZA 1KI6B 3AVOA 4GNKA 4RD6A 4EPYA 1G6OA 1P5ZB 1P72A 4V03A 4Z8YA 5G53C 3AVYA 1UBEA 4OHYA 3KB1A 5JJIA 3FFBA 3A58B 2ZRMA 1Z28A 4BLOA 2HF9A 5FTMA 4TT3A 5L3SA 1VIAA 4AY2A 2CL7X 2QRZA 2REXB 1ZM2A 3K8YA 1G4AE 2DFTA 2OAP1 3KKOA 4OQXA 2HEIA 4ASUA 1ZM4A 3TVTA 3THXA 3PEVA 3AVXA 1G7CA 1ETUA 1W36C 3ZD7A 1G8HA 5FOTA 1Q12A 2ANCA 3WYGA 2MMCA 1RJ9A 1QHNA 4KJZA 3SE0A 2KBFA 4UXJA 5J4YA 2QBYA 4TTPA 3BORA 4GBMA 1F2UB 5TV2A 1XTIA 4TMTA 1YJ5A 4KI0A 1G7TA 1R8SA 3N2IA 4MKFA 3U3MA 4XWKA 4NCKA 1I2MA 1XNJA 3EIHA 4RJLA 4MA4A 1RE0A 2H57A 4XJXA 5P21A 4TL9A 3WP0A 4KSCA 4A0FA 2A3RA 3G0HA 3T5DA 2Q3HA 2IYUA 3D31A 5FPYA 4I1UA 4MQBA 3K9GA 3B9PA 4YXWD 1TQ4A 4DT1B 1G4UR 3QKRB 4XVUA 4TYWA 4DCUA 3CRQA 3L0IB 4DCVA 2DWPA 2JJ2D 3CR8A 3FKSA 5IRCD 1W7AA 2AWOA 4P4SB 2BEJA 2ZRIA 3QE0A 3U4QB 2VHQA 4EFNA 3I8SA 4LRWA 1QZXA 1EXMA 2IEYA 2G1JA 1MKYA 4ZDJA 4ACAA 1ZP6A 2YNMA 4RZ3A 4DUGD 2OESA 2IYRA 3DKVA 3H84A 1E9CA 3CLVA 3JVVA 3MD0A 3GLGB 4C0KA 1MV5A 2RGAA 2B92A 4HYYA 4C4PA 2HV8A 3OIYA 3EWSA 4FMDF 3TW4A 1TEVA 3K70C 5HKKD 4D80A 1DARA 1R0YA 1FP6A 2UVQA 1VHLA 4LBYA 1BKDR 2Z43A 4LJ9A 4X8MA 1KI3A 1MOZA 4UJ5A 2IS2A 2DB3A 2ZR9A 1J70A 2QA5A 1PZNA 1CXZA 2OV2A 4FCVA 3QOFA 3AGQA 2BMDA 1IY0A 4LHZA 4EJSA 4V0ME 2YC2C 1XTSA 4Q1BA 2B7BA 4DDWA 1XD9A 2VP4A 1UFQA 3VR5A 3LW7A 5SZIA 2Y8EA 4U7DA 2R2AA 3ADCA 5EP2A 4NYMQ 1AK2A 1FP7A 1D6JA 2RH5A 4AKEA 3FPAA 2WMOB 4E22A 1TTTA 4B6EA 2ZI5A 1JB1A 4HDOB 1MR3F 4NMMA 5J40A 4L16A 4LV8B 4DCSA 4B71A 3UKDA 1D5CA 4OHWA 1SHZA 1XF9A 4KBFA 3C4JA 4RSGA 1P73A 4Y0AA 4EFMA 3EZFA 2AFIE 3DMNA 4KVAA 3SBDA 5KNDA 5K8UA 1KZ7B 2JJ2A 2DFKB 3W90A 4CRWB 1W44A 3DO6A 3EZ7A 4DCTA 2J87A 1ZD1A 2CCKA 1EFTA 2BBSA 3KJEA 4UXIA 1CR4A 3IUYA 2IBMA 2F43A 4HDCA 4U00A 2R6CA 4YMUA 3B1YA 5LD2B 2YWGA 4EPTA 2J0VA 1DAFA 2WIBA 3FFAA 3ECCA 3SZRA 3U44B 2CNWD 4BZPA 2IW3A 2BMEA 3BFKA 2VEDA 1KY2A 3K0FB 2QMEA 1JQJC 1YZTA 4V0LA 2F1RA 2B7CA 3L2OB 4QC2A 2V55B 4B32A 2QQEA 4CEJB 3KFVA 5HKKA 4LJ6A 1U98A 2FSFA 1F2TA 1YR7A 1S1MA 2IEZA 2ZI3A 4V0KA 4IKEA 2G0NA 2GXQA 3W34A 4A36A 1VYTA 1AA9A 1TU4A 2IF2A 4C2UA 2VF8A 1XEFA 4H1UA 1IAQA 4ON9A 2WSSD 2FZ4A 5EJEA 1N6IA 1HYQA 4NCJA 1YR9A 2QZ4A 3EW9A 2JEOA 3QUSA 4C30A 4NCNA 4N3NA 2QTHA 4GI7A 4RD1A 4Q4JA 5K8IA 5GJBA 5DN6D 3KQKA 2REOA 2XTZA 2W58A 1QHYA 2FG5A 1QF9A 3CZQA 3BB4A 1UKZA 2J0UB 5JS8A 3CONA 1T3SA 4DSOA 1VKJA 3C41J 4TMWA 3LY5A 3JZMA 3QG5A 2FEOA 1HE8B 4TTRA 4HUQB 1JQLB 5JRZA 4TWZA 4BGDA 2VSOA 1LTQA 1F60A 1YQTA 1MABA 1JXOA 1Z83A 1CR2A 4LI0A 1GZSA 5EE0A 4OHZA 1LF5A 2V6IA 3DVLA 5FTKA 1E4YA 3IDQA 3UPUA 4UNSA 2I3BA 1FX0A 1KI7A 4I4LA 4NKRA 2RMKA 2GZDA 2ZSDA 4G5RA 2ZUBA 5BN5A 4L9SA 2PH1A 3AF3A 2CE7A 3K0CA 1TAGA 5B30A 5FUYA 3LVQE 4Q03A 5CIQA 3OF5A 1AZSC 3VU9B 4WXPA 2CCGA 2J41A 3B85A 4L15A 1M74A 2SHKA 4BUJA 1CTQA 3Q5EA 1XWIA 1KTVA 2PJZA 4YMVA 1OXXK 2WSSA 2D7CA 1FFHA 1XXHA 1NY5A 2AKAB 4HSEA 4M1WA 3KKNA 2Z5FA 2D62A 2GVDC 1PV4A 1XMJA 4BE7B 1I4LD 1OIWA 3IIJA 5FPKA 2YOGA 3K9HA 5DN6A 2ZRLA 1UEJA 5LD2C 2J7KA 1E2QA 1Q1QA 1U9IC 4B2LA 3D8BA 4AI6A 2ZSFA 4LBWA 1OKKA 1N6OA 3VFDA 2ZSBA 4C7OB 1GOTA 4B3BA 1R0WA 2FWRA 1GL7A 3R7WA 4RVCA 2Z83A 1K5DA 3W8NA 1VHTA 4M4SA 2O8DA 1H65A 1KI1A 3K0AA 5KNCA 3GLHB 4II7A 4M2LA 2F3TA 4P32A 4NYIR 4TMKA 4IFEA 4HB0A 2XAUA 3AP1A 5E7IA 3WRYC 1E9DA 3RABA 5EUMA 4RFSA 1P62B 5TVKA 2P6NA 1HUQA 3ZDQA 3LRPA 3BS4A 1LB1B 1ZU5A 4ITRC 2YV5A 3EASA 4KV9A 4X8HA 1HY3A 1RRGA 4DBLC 2Q9BA 2D2EA 1P9NA 2F1HA 2WWIA 1ANKA 4B73A 2YINC 2JASA 4PPGA 3RRNA 2IUSA 4C0BA 3THYB 3VTKA 3LWNA 1VCMA 4V0NA 5DI9A 1YKSA 2WICA 1WP9A 3GQBA 3LAWA 1E2GA 1OXSC 2O8BA 1GL9B 2FMXA 1PLJA 3E1SA 5LBIA 3O8CA 1NG1A 2RHDA 2RGEA 5DE3A 2ZPTX 2QL6A 3KZ1E 1KSFX 1NVXQ 4CGZA 2O8CB 4FWTA 1GRQA 4R9UC 2QM8A 1E1QD 1IBRA 1HQYE 4Q7JB 4NHOA 3VR4A 3KKPA 3R20A 3AP3A 1XX6A 4C0SA 2KSQA 3Q9LA 5EE9A 3QKTA 4W5JA 1IN7A 4OK3A 2QNRA 2YZ2A 3NBYC 4M1TA 1VECA 2CJWA 2C9YA 4AURA 4DLXA 1NMYA 1Z5ZA 2JIZD 2R6AA 5KOYA 4TYNA 3AVWA 1IY1A 5B64A 2ZRFA 5FBRB 2IF0A 1S9DA 2WHXA 1HQCA 1II8B 2IT1A 3U7FB 4DSNA 3MRSA 2KWIA 2GAAA 1YHNA 3H86A 4QBHA 1II0A 1SXJA 5CB8A 3WNBA 4GOJA 4CVNA 3NTUA 3GMTA 3D7MA 4IDNA 4URYR 4DDVA 4QM7A 5EQTA 4CZ2A 1HV8A 1WF3A 2H5EA 4JT2A 1GRRA 4M8NE 1VCOA 1U8AA 3A1VA 3WYFA 3EPJA 3NDBB 4F93B 1W36D 2NOAA 2ZJYA 2FSGA 1CS4C 3AV0B 3QPWA 4P31A 3ZS8A 2W6JD 1FPMA 4LGMA 4Q4HA 4J0QA 2WPDD 2VLIA 3GJ4A 4RY2A 3IIMA 3CF2A 1W0JD 4G5GA 4OKSA 3VNVA 4R2IA 4XSHA 3ND8A 3ZVNA 4KITB 1P2UA 4MDFA 1ZAKA 1WCV1 1QHXA 4JLKA 2XNSA 1YZQA 4KLNA 5TARA 3PENA 1XTJA 3SJBA 3NVAA 4P4UA 4URVR 2PMDA 1R0ZA 1SVOA 2XITA 3PIRA 1G64A 1VG8A 5J47A 1UAAA 2V54A 2PCLA 4TYYA 3TRFA 1H8HD 4JMPA 1Y3AA 2CVFA 2FEMA 1CBUA 3RRZA 2GF0A 2O5VA 3R8CA 3H4MA 2WSMA 4CF7A 2QAGA 4F4JA 1YR8A 3QF4B 3C8UA 5EP1A 3SYNA 2OE2A 1W4AA 2X2FA 4GZMA 1Z6XA 1KMHA 4OJKA 3WRXC 5AUNB 1GRNA 1EFRD 3FDIA 2QTFA 3SDZA 5GVSA 2AR7A 1XEXA 2DHRA 1JALA 2WV9A 4TYQA 3SFVA 5JMTA 2GXSA 3QXXA 5JJKA 1XMVA 2BOVA 2ORWA 1OW3B 1QHHB 3LNCA 2WAXA 3FMIA 3OESA 4B3DA 1EFHA 4URWR 3P27A 2YWFA 3IKJA 3IEVA 2V7QA 1NBMA 2ZR7A 4CEIA 2VP5A 1HE1C 4IEIA 3KTAA 2GCNA 2CHQA 2HXYA 1H8ED 4HB2A 4ZO4A 4C0QC 3AF4A 1KGDA 2C2HA 3NKVA 2W6JA 3GFPA 4JVNA 1XTRA 5L3QB 2MMGA 3SYLA 2QY9A 3IBYA 5AR1A 4ZKEA 1G7SA 3WMGA 1ZRHA 3A6PC 4PANA 2P65A 3O8DA 3TKLA 2DPXA 2NO0A 2ZRAA 5CM9C 4U02A 2V9PA 1NJGA 3QXSA 2ZE6A 3GFOA 4PC3A 4DKXA 4US2R 3D6TB 3Q85A 3NEJA 4GOKA 2CK3A 2AXPA 2A5DA 2FA9A 2XJ9A 2AN9A 1CJVC 2VIIA 3A36A 4JJKA 3HPQA 3Q5DA 3GLFA 4Y0VA 1W2GA 3M4YA 2MSDB 2J1LA 2ZUCA 3AKCA 1ZD9A 5CDFA 2NO9A 2O8FA 2QN6A 4WW0A 5EXXA 1IHUA 2GEDA 3BH0A 4FWIB 3NH6A 4N0EA 1F3OA 4YC7A 2Q9AA 2ANBA 1RC8A 4KFSA 2FGKA 4PZLA 2A5FA 2ZIAA 3ETLA 1GFIA 3AVVA 2ZS9A 2ZRDA 4W9MC 3HR8A 3HU2A 4MH0R 1XXHE 5A5GA 1AS0A 4PAOA 3QXHA 5CK4A 2RGNA 2VYFA 1OE0A 2BKUA 2YHSA 1DAKA 3CNOA 3PCRB 3DZ8A 1OH7A 1U8ZA 721PA 2R9VA 2VHCA 4LYHA 2FPLA 2ZE8A 1SHKA 4UQOA 4A2WA 4RCYA 1VG0B 2GCPA 3QENA 5FFMA 4P0TA 4BLQA 1G5PA 4K81B 5H70A 5DGXA 2C99A 2J3EA 1IOZA 2PX3A 3BOSA 1DADA 4PXAA 4AYWA 3U6KA 3IIKA 2ZUDA 4TL7A 4D26A 4ZCIA 3OEHD 4IFBA 1P9WA 5JSZB 3P32A 3KFXA 4JBYA 1E2HA 4CW7A 3Q7QA 4BFYA 4A8JB 2I1VB 3EIQA 4PC7A 4KLZA 2I1QA 2ZRPA 4D82A 3W6NA 1BH2A 1NMXA 2W0MA 2PZFA 3UWOA 2R65A 3LO5A 4ZDIA 4JVSB 2FJUA 2ZJZA 2WJJA 3SI7A 1QDEA 3TSWA 2D06A 3CF6R 5JEDA 1ODFA 4DLSA 4QJ4A 1OIVA 4RZ2A 2DFNA 4XH9B 4I1OA 1W4BA 2NG1A 3GCGA 2WKRA 4WXRA 3QKUA 2Z4SA 5EZ6B 4F4IA 3RNLA 2HJGA 3FHCB 5BQ5A 3VKWA 3FHTA 2HYIC 4YDSA 2FF7A 1E2LA 2HJVA 1HT1E 3FYHA 1JBKA 4XTCS 5BN4A 1NLFA 1YZNA 3X1DA 3NXSA 121PA 2X19A 4QXAA 3CW2A 2G77B 4RD4A 1N25A 3B8HA 3BWDD 4MRPA 5FR2A 2QTVB 5ELXA 2BM1A 2CE2X 2REBA 4IOKA 1S96A 3QKRA 5JI2E 1UADA 3BIFA 1S2MA 2GWHA 5JCPA 1S0UA 2ZRKA 3PUWA 2V6JA 4GL2A 1GSIA 5DI3B 4P4SA 1E2NA 2G1KA 4R2HA 3TQCA 3LDAA 2BKEA 3RS5A 1S9HA 2FZLA 1N6NA 2ODBA 3VX3A 3I92A 4QBIA 2Q6TA 5HCNA 2G88A 4QGFA 2V1UA 1SQ5A 4TT3D 3E2IA 4BFZA 1XEWY 4PC2A 2ZSEA 3OEHA 3C5HA 4AKGA 3OZXA 4Q66C 4QRHA 4LUCA 1CR0A 1WA5A 3FTQA 4NL4H 2GEVA 1BIFA 3HWSA 4XWOA 1CP2A 2CL6X 4PO1A 5AUOB 1U81A 4G1UC 4B6FA 4HAYA 1WQ1R 2QENA 2J5XA 2NPIA 4OQFA 1LS6A 1W46A 3C16C 1R2QA 2P3SA 4CEHA 1UF9A 4G5QA 4Q7LA 2OO7A 5DYIA 1OH8A 3CH4B 3D3QA 4ARZA 1E69A 1SVKA 2ZE5A 5E3HA 1PJRA 1Q0UA 1E32A 2XZPA 3CX7A 4I81A 4QJ3A 1XEWX 4MKIA 2ZI7A 3OAAD 4NE2A 4DJTA 4OBEA 2GKSA 1GNQA 4HLQB 5C2JB 1N0WA 5FI0B 3RS0A 5SZKB 3LXRA 3VKHA 3FVQA 3UMFA 2IYZA 2GBLC 4EFLA 4A8JC 2R6DA 1SVWA 3B1ZA 1ZU4A 1ZUHA 4LC1A 3BD9A 1E0JA 3RS7A 4MITA 4Q1CA 2E9SA 3SQXA 3RVBA 1DVRA 1SZPA 1XMIA 1EWRA 2F1IA 4JLNA 1E98A 1X1SA 1XTQA 3ZZTA 4M9ZA 1U0LA 2V8OA 5DO9A 2GCOB 4GFDA 4JBXA 2CHVA 1X3SA 2PEZA 3SEAA 8OHMA 3EZ9A 3K0FA 3LVRE 4L8GA 4CYMA 3W6PA 2ZM5A 5J4KA 2QPOA 2CLCX 3PQCA 4MUAA 3KJGA 1X86B 4OYHA 1KK2A 1NBME 2P67A 4X8LA 1G17A 2XOKD 4WBSA 2NQ2C 4DLUA 1DELA 4KYUA 5G3YA 1IY2A 4KHZA 1UJ2A 3KUDA 1G1MA 2IXFA 4CIDA 1OFHA 3SN6A 1DAEA 1US8B 1QRAA 4PC6A 5FI1B 2UKDA 2JLVA 1TQDA 1TF5A 3LFUA 1F5NA 5LB4A 4AIIA 5EZ5A 2RGGA 1TEXA 4L4UA 4CT5A 2ODEA 3OAAA 3EPHA 1XU4A 4LV6A 3T61A 3SU8A 4LC0A 3FWYA 4PQYA 3KUCA 3ND9A 4MRNA 1CR1A 1P7CA 1E79D 2FPMA 4PR0A 3A1WA 1NVUQ 4UKDA 3CBQA 2X1VA 4R7ZA 3IBGA 5H1YA 2AK3A 4EIWA 4HZUB 1HT2E 2NO7A 1XPOA 3KDSE 4LYAA 3PUXA 1W4RA 1N2CE 4NZYA 5HR5A 3IQWA 2OXRA 2CDNA 3GLFE 1UDXA 2WWHA 3TUIC 4LCBA 2GF9A 4Q21A 1ZUIA 2Q0HA 4PFSA 1L7VC 2QMOA 2VH5R 5CDFE 3TSZA 3AEZA 2OAQ1 3GEHA 4L5BA 2AWNA 4WA7A 4XOIA 3C14C 2IS1A 3DHWC 5KSYA 1XD2B 3T5GA 3EC1A 2QM7A 4M22A 1N6LA 1XZPA 3L0PA 2PCJA 3NEYA 1ESMA 1RYHA 4KBGA 1JJVA 5DYGA 2BJVA 1KDTA 1RRCA 1AQYA 1YRBA 4M21A 2QPTA 1DG1G 4JLVA 3A1SA 3W8RA 4G3XA 3IEUA 1E2IA 2NZJA 1UM8A 2PL3A 2XOKA 4ZIRB 1Z3IX 1R4AA 2O8EA 1E2JA 3VU9A 1QHIA 1JPNA 1Y63A 1YVDA 2D2FA 2G0TA 2RGDA 3DL0A 4BEBA 2NIPA 3T1VA 1ZC3A 4MRVA 3B5JA 3U3RA 2B6HA 3SNHA 5GADl 2VRWA 1J8MF 2ZETA 5AJVB 1FOEB 1QHSA 1UKVY 2H17A 1DO0A 2GNOA 1Z0KA 2A7QA 1R8QA 4QNMA 4JBWA 1Q20A 4NDZA 2ZRJA 1G6HA 2JLQA 4IW3B 1EGAA 4DB4A 3MFYA 1CJKC 1OB2A 2ORIA 1E79A 4MYHA 5IK2D 4PO8A 4IRUB 1FQKA 2JDID 5LB2A 1W2HA 3WMEA 4TQ9A 1E94E 3AVPA 2ZYTX 1NSFA 4A0GA 1TL7C 5DSZA 4NYMR 2GESA 4C7OA 3QBVA 2AX4A 4RZXA 4FINA 3MWKA 1RRFA 3M6AA 2KE5A 2F9MA 4GP6A 5F2EA 3QI2A 1N6PA 4E07A 1GL6A 3BB1A 3QPUA 2GDJA 4HAVA 2XJ4A 4IEEA 3IILA 3KQLA 1P2TA 1ZBDA 3GJ8A 1A2KC 1Z63A 1OFUX 1NF3A 2PBRA 1DOAA 2QE7D 2ZYVX 2EW1A 4JLPA 4LHYA 3HR7A 1OPXA 1KO8A 2IX3A 4EKDA 3V00A 1ZNZA 4U5XA 5FTLA 2ZRGA 3GLIA 2ZI4A 5CLQA 2IS4A 3TW8B 4Q02A 3KKMA 2G9NA 5D3MA 2TMKA 1VPLA 1ZUNB 3VHXA 1NN0A 3TH5A 2BV3A 2PT7A 5C18A 3THYA 4BPBA 5FUXA 1MT0A 3VHLB 2IL1A 2H1LA 2EFGA 3DOFA 3GFTA 4I1SA 3EPKA 3EIEA 5JWRA 2VA8A 2ZVPX 1L4YA 4D2IA 4KFUA 3TMKA 3I32A 1DE0A 1WDTA 5KHOC 4EPRA 1DAGA 3THXB 1E2KA 2VP2A 1M2OB 1DS6A 3K0EA 1JR3A 4HLUA 2WWXA 4M9QA 3H2YA 4WZAE 1XMSA 2A5GA 2J0QA 2O8CA 1HTWA 4JT4A 3PITA 2GVZC 1RJ9B 4EQ6A 1KMQA 3HU1A 1IONA 4KFTA 3CKLA 1OKKD 1U99A 2QP4A 3C7KA 2XNDA 3IO3A 5IK2A 3M1IA 2OZEA 3MUFA 2JDIA 4Q9LA 2ZANA 2QBYB 2NGRA 4UNNA 4XD7D 3K09C 3GJ6A 4HEJA 1E9EA 4TTQA 1MRSA 2OG2A 4WZBE 3MLEA 1XCPA 1LW7A 5TMPA 4DCNA 5GJWC 2HCJB 4LDJA 4A4DA 1HA3A 3B82A 1ESNA 1G19A 1II8A 2ZREA 2CBZA 3CRMA 2QE7A 2OM2A 1GM5A 1OFIA 5BW8A 2NO1A 4LJAA 1Z06A 3MWYW 2GJ8A 4BRWA 1HURA 4BFTA 2PLFA 4BQSA 1Z2CA 2GXUA 1KJYA 1XJQA 2ZR0A 1VG1A 2CLDX 5F98A 2C8VA 3NHBA 1CJMA 2OBLA 4O2RA 1OXTA 3RRYA 4JS0A 2QP3A 4BECA 2G3YA 4A15A 1LY1A 1YZGA 3OFND 1E9AA 4AD8A 2GJ9A 3HP1A 3GPLA 2XZLA 4ABYA 1L2TA 2ZJOA 1KK3A 2J45A 1KO4A 1VYVA 5KDOA 2W2VA 4ZV4A 1GAJA 2BCGY 4DLWA 4H9GA 4PHFA 5DLQC 3THWA 2I4IA 4B34A 1NY6A 1EFUA 5AJWA 3SQWA 3IHWA 1Z6AA 4JL6A 4LSGA 5EXSA 3T15A 3WMFA 1Z22A 5BN3A 1FUKA 4PSAA 2AL7A 4Q18A 3DEFA 3QNUA 2BDTA 2HDNB 5KPJA 2FN4A 3EAQA 5FPHA 4A0RA 3RLFA 2D7DA 3OIWA 1RW4A 4BZQA 4XD7A 1IN8A 2JGNA 4FCWA 4NU0A 4IVQA 3UATA 1L8QA 821PA 2OEPA 3U2QA 2GRJA 5L8VA 4LWZA 3QVUA 3N70A 4MGYR 1GITA 4KVGA 5CYOA 1E0SA 1JPJA 1SXJD 1NSTA 2UZ3A 4DLYA 2GJSA 1KNQA 1GDDA 1Z0DA 2W2XA 3QG1A 2Z4RA 4WAUA 3I62A 2P0EA 1I2DA 2WM9B 4RD0A 2VP9A 1OH6A 1CIPA 1N5KA 4GDFA 4RKEA 1E2DA 2PZGA 3QEOA 3QJYA 2VP6A 2JLWA 3M0EA 5HZHA 1P2SA 3U61B 2XXAA 3NBZC 2AKYA 3G82C 3C15C 2F7SA 1T0HB 5JWHA 3OFNA 5JRJA 3TNFA 1MO4A 2F43B 5JFGA 3SYKA 2ZJ5A 4BLPA 2EU8A 2H8KA 3NC1C 1LVGA 3SJAA 1E9FA 2Q3FA 4TSFA 1KAOA 2JLUA 5CITA 5L3QA 1S4QA 5CJPA 1XCGB 5JCZA 2J46A 2ZTSA 1Z0FA 3L0OA 4KU4A 4URUR 3UMSA 1J2JA 3TJZA 3I5YA 4HATA 4G0NA 3WNCA 2WAYA 3PVSA 4A1FA 1F2TB 1YU9A 3BFVA 1XRJA 1WE2A 4OHXA 1OT3A 4QBGB 5CYPA 5F9HA 1OHHD 2W00A 3X2SA 3SFZA 1KSJA 2ZS8A 5FTJA 4Q48A 1JR6A 5EP3A 2XEXA 3QKSA 4A2PA 5KU1A 2QAJA 1TUEA 1M7BA 2ZEJA 3GJXC 1MO5A 3ZIAD 1BO6A 4Q7MB 4Q4JB 4AK9A 4EAQA 3DM5A 2C9CA 1GWNA 3TGPA 2R6GA 5FOVA 4M1YA 1UDWA 5C4GB 621PA 1S3GA 1M8PA 2Q21A 1VCNA 2QROA 3BB3A 4KSBA 5CLLA 1ZW6A 3ASYA 2VSXA 4QM6A 3LBHA 2ZRNA 3RRMA 3HJNA 2V7QD 1NBMD 2ZJAA 4L9WA 1GG2A 4MKHA 3SHFA 4C0LA 4K46A 1N5LA 1ZC4A 4IXNA 4N0DA 5KDLA 3K53A 1KNXA 1MABB 1XPRA 5FBVB 3IPXA 1P2VA 1T3LA 2QMHA 3QF7A 1Q3TA 1DG3A 1RPZA 4ZDWA 1NI3A 3DMDA 1Q21A 2KJQA 4LYFA 3ZQ6A 5BYKA 4OQNA 3K9LA 5JZVA 2QQ0A 2ATVA 1NN1A 2VF7A 4PHHA 4MYTA 3L8ZA 3QPVA 1E2PA 3F3YA 1G3RA 1U90A 1NVVQ 2ZRCA 1G5TA 3CRVA 2IYWA 4PTLA 4W5WA 1PLKA 2OCYC 2Z0MA 1ZCAA 3U3KA 5HZKA 4LJ4A 2X2EA 5SZJA 2CK3D 5M04A 1NN3A 1OHHA 2QUZA 3BH7A 5AK0A 4A2QA 4F38A 2CEAA 1AN0A 3U6BA 3R9XA 4ERNA 1DAHA 2FFHA 3CWQA 1XXHB 4B47A 5EE5B 3AF1A 2GBLA 3GLIE 3U5ZB 4LJ7A 1WBDA 1CF4A 3P4XA 4A8JA 1A82A 1GKUB 3BH6A 4Q4AA 2YJTD 3U3JA 3AGPA 1YE8A 5FPTA 3ZIAA 2C95A 3GP8A 2GTPA 4DDUA 1NG9A 4DWJA 3NIBA 2OCPA 5IHPA 1JI0A 4URXR 1Z6GA 1YZKA 3CB4A 1GIAA 3R7WB 1OSNA 1E96A 4KAXA 2O8DB 1SKYE 3K0AB 3IQXA 4M1OA 5HPYB 2W6IA 2ASEA 3PEYA 3K70D 3P26A 1O87A 4D4MA 4P4TA 4DC9A 1YR6A 3K9NA 4O2LA 2JA1A 4RFSB 2ZJBA 4JVMA 1OXVA 1XPUA 1TUIA 2X77A 1G3MA 3CWZA 4Z1MA 3VR2A 1OYWA 2OILA 4Q01A 1JXMA 1LV7A 1P61B 4N1AA 1E6CA 3ONWA 1GTVA 1J8YF 4YONB 2IHBA 2VO1A 4DLRA 4MGIR 4E03A 2EYQA 4WZ6A 3QBTA 4HDQB 1TU3A 3NG1A 1LF0A 3F0TA 2PLRA 2EQBA 4IHQA 1IM2A 3L8YA 1VDZA 2OFOA 4GT1A 4WOPA 4A82A 2O8BB 2ZAMA 4JL5A 2LKCA 2IA5A 1OFTA 3B1VA 3UIEA 3EA0A 3AF0A 1E1RA 4OK6A 4PAQA 2HT1A 3WHLA 5JECA 2R44A 4D4LA 4M9XA 3GJ0A 5F3WB 1KI8A 5CB6A 2ZITA 4AWXA 2HYDA 2X8AA 2ONJA 3ADKA 4WVFA 5FL3A 3TR0A 3SOPA 2J7PA 5F9FA 1W0KD 3I3SR 2PZEA 4B76A 1FMLA 5KDDA 2CJWB 1IJEA 2C96A 3T34A 2BC9A 3TIFA 4TZ0A 3T1TA 2ECKA 4BLSA 4ZDKA 3CH5A 3MGCA 4LX0A 3VAAA 4F7WA 3CPHA 5KPDA 2O0HA 2ZSAA 1KSGA 5B57C 3TK1A 2FPKA 1OB5A 2IK8A 4PAMA 4AKIA 3DKPA 1G5RA 1XCMA 4LHVA 3TQFA 1IJFA 3VR1A 2K5UA 1R10A 2C78A 2BMJA 1EFCA 5K8TA 1FUUA 3CRW1 2IYQA 3BE4A 2D3WA 4HLCA 4QG7A 1KI6A 3EARA 3PG5A 3A37A 3BK7A 3WHKA 2WZQA 4QHSA 4M53A 4NP6A 4JLDA 5JHHB 4Q4HB 3VX4A 3ZS9A 3KB2A 4TMVA 1Z07A 2H18A 1GKYA 4KODA 1G18A 1KAGA 2A2ZA 4AG5A 2Q3MA 1Z6TA 4V0MA 1KDPA 2OCBA 1X8JA 2GCOA 2LWIA 4GP7A 4IVRA 1Z29A 3AKEA 5KSPA 4F91B 4PQRA 3CNNA 1TADA 5JJLA 3CX6A 2FNAA 4BFXA 4PSVA 2ZE7A 3B78A 3A4MA 2J59A 3I8XA 4GSYA 3LH5A 1KDOA 3X1WA 1W0KA 3T06B 1OYYA 1R6BX 4B35A 4IXMA 3U60B 5JHGB 1CJTC 1D2NA 1NIPA 1OXUA 3KQNA 2QAGB 2RHMA 3A8TA 3BGWA 1F2UA 5TDHA 5A4JA 1FNMA 4F4CA 2WWWA 1KK0A 4XWAA 1KMHB 3RS3A 3CPJB 2VTKA 4M0LA 5EE1A 5LPNA 5E7MA 1XEXB 1OLOA 4GOXA 4P3YA 3TAHA 2EFDB 2VPPA 4QKQA 2KB0A 4KYIB 5G3ZA 2RB4A 3CIOA 4DT1A 1NNEA 2KI5A 1Z8FA 1F6BA 2LKDA 5IT5A 4QBFA 4MGZR 1NKTA 3N5CA 2YVUA 1SVLA 3PR1A 3WXMA 3NC0C 4CEIB 1XDBA 4KXFB 3U4QA 2QSYA 3KTAB 1W36B 1G3QA 5G40A 1T4GA 1V43A 3LX5A 3K0SA 1CJUC 1KKMA 1S8FA 2NZ8A 3CM0A 4TLDA 4Q9KA 1SXJE 4C3ZA 2VQSA 4YMTA 3TVDA 3GLGA 2YOHA 3F8TA 4O0MA 2ZJ2A 3QXJA 3RSOA 4LV5B 3QIAA 3TBKA 2JCSA 3BXZA 4B2IA 5FBLB 3K09A 3ZGXA 1AGPA 1COWA 3Q72A 1Z47A 2FFAA 3B13B 5UKDA 3AUYA 1L4UA 2C77A 4AKHA 1IN4A 3GJ3A 2FGJA 2ZYUX 3UG7A 2WTUA 4C2TA 1QVRA 4JIMA 3X1XA 1GUAA 2EFEB 1KKLA 1ONBA 3MG9A 4LJYA 3GLFB 1FMJA 4XIGS 1I4DD 3QXCA 2CXXA 3TAUA 1XJCA 1B0UA 4Q5IA 2A78A 5EE3A 4DEYA 3R9WA 1IQPA 1U2RA 4M1MA 4ZKDA 1KOFA 1VG9B 3FMFA 2D74A 2DR3A 4B2PA 2IYYA 3UMRA 1OJLA 4YMWA 4C0HA 3KQUA 1P9RA 1G3UA 3A4LA 2B8WA 4MRSA 4JZKA 5EXTA 3UWKA 2GEUA 1C9KA 1M6NA 2G6BA 3I4LA 4HB3A 2EFCB 5FTNA 4JLMA 2NPFA 3DM9B 3LLUA 3GEEA 1XD8A 1MO3A 4TYPA 4JYCA 4P33A 4FI3C 1W47A 1UEIA 2FX3A 1QHGA 1FL9A 1U9IA 4D81A 1HH4A 1TPZA 2YWEA 3B1WA 3U44A 3MJHA 1AJEA 3W3ZB 4QHYA 1KIMA 3B7GA 4BEJA 2C98A 4EPWA 1M7HA 2DYKA 1PUJA 2QMUA 3UXMA 4DZZA 2XB2A 4UNRA 2C9OA 4IDOA 5JBQA 4CEJA 2WOOA 2JATA 3VQTA 4RFVA 1NJFA 3R8FA 3R9IA 3PUYA 4MYCA 3ZYCA 1G8YA 2F9LA 2PX0A 1ZM9A 4US1R 1UPTA 2ZU6A 4X8OA 1Z0AA 2F3RA 4C0AC 5J4LA 1JEDA 1NMZA 5ANRB 3NBFA 1DO2A 2CHGA 2WMNB 3I72A 2CLSA 3ZQJA 4PZYA 2QG6A 3AVTA 1TF2A 5C4MA 3RS2A 3O8RA 5GJCA 1IXRC 2J0UA 2L0XA 2WKQA 1CULC 4Q7KA 3X1ZA 4XVQA 1KI2A 2GETA 4JLOA 3S1AB 2OFWA 2FFQA 1G21E 5HTKA 5FBWB 5IF9A 2QORA 4HAUA 3HYRA 2Q9CA 3KXIA 2PJRA 4HUQA 1ZNYA 4JYBA 1MH1A 4YLGA 1R0XA 3PEUA 3AVUA 1E2MA 4BLRA 4MDEA 4MKGA 2EYUA 3DPUA 3OIVA 5L3RA 3A1UA 1AQUA 4TLEA 5EUQB 1UKYA 4PO9A 1OIXA 3FB4A 1VCIA 5CIWA 2CL0X 3CR7A 3EZ6A 4EPVA 2P5SA 1P4SA 1ZYUA 3BC1A 2VSFA 4PHGA 1VTKA 4E5UA 1T5IA 2F55A 2WWYA 4OI0A 3X1YA 3ICQB 4CDGA 2O0JA 1TMKA 3KJIA 4NCHA 3KKQA 4FIDA 1NKSA 1E9RA 3B6EA 4B75A 1Q22A 3NHAA 2XSZD 1N0UA 3HPRA 1JR3D 3G5UA 5KYKA 2J9RA 5DNYB 3LQRA 3ZVRA 2YC4C 2IWRA 2RGNC 2V3CC 1B23P 221PA 2EFHB 1RVDA 2PEYA 2XNDD 4JJZA 1T0JB 4MRRA 3CZPA 2JLXA 4CEHB 2H92A 3U7GA 2VHTA 4ARZB 1FW6A 4WIAA 1WMSA 2WBLC 4K8OA 1HEIA 3RANA 2H16A 1ZD8A 3HYTA 4QL3A 3GLHA 5HE8A 1KK1A 1A4RA 1BYUA 1SULA 2DWQA 2QEQA 3Q3JB 4LPSA 1DEKA 1XFAA 4JLJA 1BOFA 2IWHA 3ICEA 1Z2AA 1XZQA 2NTYC 4DEXA 3LLMA 1P6XA 2MSCB 1DBSA 4OQLA 4YXWA 1U94A 5AUPB 5C1BA 4FMBB 5C46F 1QBKC 2EWVA 1NVWQ 4GRAA 1T6NA 1TX4B 4E09A 3BRWD 3RSLA 4IDPA 3LV8A 5CK5A 4Z8XA 3KQHA 2A5JA 4V0OA 2VHJA 1X8LA 4QFMA 1BYIA 2A30A 5L3SB 4DUGA 2RGXA 1XBTA 2JJ1D 5D3QA 3RWMB 1VYUA 2JLZA 4IDQA 3CPEA 4A9AA 5CJ2A 4PQFA 1G3IA 3WY9A 421PA 2XSZA 2BBWA 2W2TA 5DH9A 3ZVLA 3BAFA 5FOWA 1PVOA 4PPQA 1FZQA 3E5HA 5FOUA 4D0GA 2B21A 4I1VA 1RRPA 1Q57A 4YQFA 4B3GA 1VMAA 3MAAC 2VHUA 4B3FX 1IXSB 5J4VA 2QI9C 5H8WA 5E95A 1M7GA 3Q7PA 1TF7A 3W5JA 4GMDA 3GLGE 3TUJC 3AKYA 4OQMA 3PEWA 3I61A 4PPFA 3AF2A 2RGBA 4QJ5A 1FTSA 3DZDA 3SC3A 4BRUA 2BM0A 2BIFA 1ZIOA 1K8RA 4OL0A 2GILA 4Q1EA 5TB5A 5JLJA 4XSGA 4BFUA 3PJRA 4JSTA 2NMVA 1NL3A 3FOZA 4DLTA 3EA5A 4PHTA 2R8RA 4C0JA 4BFWA 1II9A 3PFIA 3REGA 4ZI2A 2YWHA 4NCIA 4DB2A 2P6UA 3K1JA 1AZTA 5DIFA 5JI3E 3HDTA 1QVAA 3MWLA 3LBNA 2OLJA 3DDCA 4BASA 1VIYA 3MCAA 4TSFD 4HZIA 1K6MA 4FMCB 521PA 3QSYA 3E70C 3CNLA 3WBKA 3NH9A 4DSTA 3I5XA 2GAOA 4S2EA 2JJ1A 1W1WA 1AGRA 2V4ZA 2CNWA 3T12A 1R7RA 1J7KA 2A9KA 2DWOA 2E1RA 5FH9A 1ZMXA 4FXPA 4ZI3A 2VP0A 4LPKA 2O8EB 3AM1A 4ACBA 4B33A 5TY0A 3EX7C 4UXHA 3V4RA 2J0SA 5GJVC 2FU5C 1ZJ6A 4B48A 4EJSB 2FDCA 3FMPB 4JL8A 1M1YE 2W83A 1N3BA 3AUXA 5FOXA 5KUTA 1J90A 1XTKA 4QNRA 4OI1A 1N0VC 4OI4A 1Q1BA 2RKOA 3QF4A 4PSKA 4Q4LA 2IYSA 4A92A 1G291 3L43A 3RYTC 2OT3B 3UK6A 5GVRA 3RC8A 1ZNXA 2ZRHA 1G8GA 3L82B 1WXQA 1U0HC 3F5FA 3P20A 4DLZA 3A4NA 4D25A 4NYIQ 4O25A 4DRZA 3SBEA 1QHHA 1UBFA 3PV0A 2P2LA 2ZQ5A 4S35A 5FOSA 4ESVA 4B43A 2GK7A 4DHEA 4TZ6A 3RS4A 2BCJQ 4TLBA 2LCFA 2CVHA 2OFXA 3RC3A 2HF8A 2VBCA 4DLVA 1N5IA 4R71A 3IHLA 3MWJA 4M9SA 3J81k 3MMPA 2OBMA 3VR3A 4LY6A 1BMFD 4KFRA 4KCGA 2FH5B 2IXEA 1LFDB 3GLIB 1JJ7A 1N6HA 4HB4A 2H7VA 4AYTA 2F1JA 4BWYA 3LA6A 2ZRBA 5D3MB 4PZZA 1S1CA 2ZU0C 3H1TA 3CX8A 4PPNA 1JAHA 3VNUA 1CLUA 5AJYA 4EDHA 2CCJA 2RAPA 1SVSA 4POAA 1E0AA 2GZAA 1KY3A 1D2MA 5B58C 1SKYB 3O8BA 5FBQB 3IGFA 3VMFA 1U8YA 2QT1A 3FGNA 4JLBA 1KJZA 4DSUA 4QHTA 2ZXUA 2WWFA 3FE2A 5E7JA 4FMCF 3ZH9B 4M1KA 1I4TD 3TE6A 1ZCBA 3EXAA 1JAIA 5KSOA 2DCUA 1R5OA 3B60A 3GD7A 3RAPR 2ORVA 4QGHA 4TMZA 1W4CA 3REFA 3BJIC 4ZCLA 1RYFA 4EQ6B 1J99A 3GJ7A 3P4YA 2B8TA 1AKYA 1SVIA 3P1JA 2OXCA 1UBGA 5FUVA 5KNBA 4RKFA 2NO6A 2A5YB 1GNRA 2OUKA 2G83A 2IXGA 4PX9A 2W6ID 3T35A 2FSHA 1P60A 2XTMA 1D8TA 3DOEA 1TQ2A 3NDPA 3ZVMA 2PMKA 2QGNA 4GZLA 4DIDA 3EWAA 4JLAA 5J4HA 4LHXA 1RFLA 2XGJA 1KO5A 4LBVA 1AIPA 1T91A 3TSOA 4NONA 2QRNA 2R62A 3AVQA 1FX0B 1ZVQA 2WKPA 4V02A 3WBJA 4DIEA 1BS1A 1T8UA 3CO5A 3IO5A 4LJ8A 4MGKR 2WIAA 4Z1MD 3THOA 2JLYA 4EJSC 1BMFA 3OHMA 2IUUA 4HUTA 4Q9HA 3BBPA 5JWOA 1D9ZA 2D4HA 4LK2A 2OBNA 2RGCA 4URZR 2XZOA 4LZZA 1ZM7A 4TLAA 2GK6A 4DVGA 2BWJA 2IYVA 2DBYA 1T9HA 2FV8A 4EUNA 2YOFA 3GLHE 1TQ6A 4NH0A 3QQ5A 4A6PA 2MSEB 5AWFC 2FSIA 1W49A 1NVVR 2QPAA 2R6FA 1E2FA 4IJMA 2XB4A 4NPHA 3RWOA 3QVVA 2IYLD 3B9QA 4IVPA 1GKIA 4FD2A 5JSZA 4IOMA 3THWB 1E1RD 1NIJA 3WYAA 5DHAA 4UJ3A 2QT0A 2EWWA 2WJHA 1Q1EA 1KJWA 3L0SA 4QGGA 4IOJA 1W5SA 2UZIR 1UKEA 1Z0JA 5AJXA 2IHYA 2VL7A 3SHWA 3W9YA 1P75A 2BMFA 2ZS7A 2J7PD 1E1QA 4DDTA 4NYJQ 3EG5A 1FNNA 4TQUS 1P3JA 4RD2A 5TXGA 4BFVA 3ADBA 1SKQA 2GJAA 2ZI9A 3ASZA 4HLDA 5DHFA 4AG6A 4B3CA 3AB3A 2HT6A 3QEJA 1SVMA 1ZIPA 4D0LB 1G9XA 2JJ8A 4NYJR 1JR3E 2JIZA 5BXQC 1S3SA 3C5CA 1LS1A 1N6KA 3OEED 4OK5A 2JAQA 4D4JA 2XX3A 4W5HA 2AK2A 3CRRA 2WVJA 1A2BA 3H0KA 2JLSA 2ERYA 2GHIA 2ZI6A 2ZROA 2AFHE 4YMSA 3U7EB 4HLUC 2N46A 1TNDA 5BWMA 4YDHB 4Q9JA 3PUZA 5DI3A 1JECA 2QGZA 3UG6A 2XXAB 1CRPA 5DISB 2OCAA 4D4KA 2GA8A 1XP8A 5K8LA 2IUTA 4ZPXA 3KXKA 1E3MA 3RHFA 3ADDA 1KSHA 2WPDA
chains in the Genus database with same CATH superfamily
1ISRA 4QOGA 2P6RA 3OJFA 4W8GA 1W0JA 3ZLVA 3EIWA 2QSZA 4DQKA 3A9TA 2GXAA 4H77A 3F7TA 1XL1A 2C2YA 1Z4PX 1MOPA 1Z4QA 3MTGA 5KSZA 2YW2A 1EX6A 3FMOB 3RKRA 1H0KA 5LL6P 3DF7A 1TQHA 3HEBA 5HGJA 3RBZA 4YHHB 5FPSA 2ZYIA 2QVLA 5BWOA 4F84A 1ZOIA 3DR3A 4HDRA 3I23A 4ZOBA 3AW8A 5DJ5A 3RSGA 1RKBA 5L6MB 2PZAA 5C7LO 1FF9A 4QPPA 3A2NA 3TDKA 4ESHA 2RGYA 4NBSA 3P19A 5DFAA 3LMKA 3FYTA 3MIZA 4LBZA 1QH8A 3K0CC 3MUOA 4O3MA 5B3JA 1KJIA 1QH1A 2NZYA 3MWDA 4FC6A 1N5JA 1RAHA 2Z6VA 1ZN8A 2GPAA 4IOLA 2PGNA 4I55A 1XVTA 2FWIA 4HI0E 1VMDA 4PE5B 1VSBA 4FCTA 5EI5A 1P19A 2OLKA 4R05A 4B4UA 4DXAA 5FPQA 1UT8A 4XARA 1NR1A 3QP9A 4EF6A 2XYPA 1JIUA 2AOUA 4ZYUA 2Z2ZA 5CFNA 5J2TA 2M9MA 2CFIA 4MV6A 2ENWA 3Q3VA 1AM4D 1N1GA 4P4NA 1JHRA 1IC6A 2AXNA 4W5NA 3C5VA 4FDAA 3BILA 1JLSA 1HZJA 3AH8A 1YAJA 2WJIA 4JB0A 4Q1FA 5AUQA 5T8KA 3WGTA 3U7HB 2YKGA 2OV3A 2QK4A 2JFWA 3RVJA 2HPHA 4BFCA 3UUFA 3U3OA 4DV1B 2CNOA 3AQ4A 1T4DA 5SZHB 4B6OA 3I4CA 1YL7A 4DPMA 2RGUA 1O3YA 3CUSA 3LW8A 4GI2A 2R8ZA 4GPTA 3K35A 4ZPJA 1MPXA 2G70A 2HLDD 2VK2A 2BEKA 1OBFO 3P2OA 4RCZA 4YRMA 4I9HA 1QIJA 5TMEA 5AVYA 1UXHA 2VAWA 2AW3A 1AKRA 1DFHA 3MD9A 3N53A 4UOQA 3IALA 2X22A 1M34E 2XCRB 1QFZA 3VGPA 3WTBA 1COWD 5FDFA 1VLVA 1Q3HA 2P2CA 4C14A 5T7BA 5HCUA 3KNZA 4WLUA 2PPLA 1A1VA 1I2ZA 1Y4DE 3KLOA 1LZKA 2HPAA 4Q9IA 2I6SA 5GONF 1GFWA 3NWJA 4XLTA 5TPZA 3TLXA 1ELOA 3UMBA 2O5EA 4HNQA 1ZNWA 2AN5A 2VUIB 1L5OA 4GUDA 4QO8A 4ZVUA 4BN5A 3B1XA 1JIIA 3O91A 3SJCA 3K2EA 1KI9A 3EVDA 3FYUC 3B48A 2MSKA 4PRYA 3JQ9C 4MMXB 2V1XA 4GX1A 3ZDXB 2B82A 2AVDA 3HNPA 1Z08A 4BO6A 1K4MA 2F3QA 3BJZA 4FC7A 4Q4AB 3QVXA 3HXQA 4WLNA 3RU3A 4PZCA 3AIMA 1CRQA 3CUKA 4UEQA 3KYIB 4KGZA 3S99A 3HXTA 3EC2A 3HO8A 4QE3A 5J5CA 2C4NA 3UNXA 2BHTA 4OHVA 2V9ZA 3PLRA 3PXGA 4HWPA 1F7VA 4HAWA 3GH1A 2C03A 2XE6A 5D87A 3W1WA 4L9AA 3S1AA 4UHHA 1TK9A 4GR4A 1RHUA 4UOEA 4YLYA 5I7WA 1A76A 1MJGA 3L7LA 5GY7A 1BMDA 3KL4A 1U3WA 3ZZUA 3QSGA 1KO1A 4B79A 3PE4A 4XTRA 1UBCA 4LHWA 1FPQA 3ZOKA 3O03A 3OE7D 1B16A 3RBXA 1X8KA 3M9WA 1KYZA 2Q4DA 2I67A 1MXHA 4R1TA 1G4HA 3IV6A 1KRWA 3I6ZA 2E87A 4YB8A 1H3FA 1NWCA 4FE3A 5KNCH 3ABOB 1EHCA 1IH8A 4LOAA 4MV8A 1X0VA 1TZJA 1E2EA 1ACJA 2FSUA 2JCBA 3AHDA 4X1KA 1UH5A 2WTNA 4GEKA 1AKEA 2R1VA 1ID8A 2ZVQX 1ZO8A 1U3UA 2EX1A 2WJYA 3ZTWA 4LX8A 3WQHA 3MSXA 3CVJA 3VKGA 2DBRA 3C7AA 3I1FA 5E6RB 1MO2A 1ZINA 5F4BA 4BFSA 1K75A 1WQ3A 3F5MA 3G9QA 2Q1XA 1RIFA 4TOIA 1BX3A 2CLHB 4OO3A 3RVLA 1F2DA 1GZ4A 4OI2A 3ZCPA 4J0JA 1PJQA 2W0SA 2K7ZA 4DQ0A 1PJBA 1P31A 1Z3CA 2BR4A 1PWXA 2ZWVA 3FWHA 2O52A 1I10A 1PR2A 4EHKA 5BYAA 4WZBA 1DIGA 4MLDA 3TFWA 4TPKA 2C5BA 1WMFA 4MW1A 4A91A 3UK1A 5C35A 2F62A 4R6WA 1R9JA 2ECQA 3A1TA 5CD1A 4A6DA 2HK9A 1EBFA 2QV7A 4WL0A 2VCHA 3FKQA 5F64A 4G65A 3OBBA 4CM8B 2QU8A 3ZQ4A 1XCOA 4ARCA 3R5TA 3W5BA 1RNLA 1ULTA 5FUWA 3UT5A 1VHJA 3UW1A 3CUEF 3LBIA 1RKXA 5HE9A 3RYHB 4CU2A 4LSWA 2WKSA 1QYXA 1KGSA 3CV3A 4X9XA 2RHRA 2WF9A 2XDQA 3O1LA 1GAQA 3VR4H 4PYQA 4Q00A 4GIBA 2OC9A 1T0UA 5CYGA 4ZGWA 3MM4A 4ZOLF 3KSRA 1G7RA 4K6HA 2WJGA 3WL4A 4I4TA 4B83A 4I99A 1G2IA 3EOAI 1KO7A 3G1TA 3G0DA 4RH0A 4UNPA 3T9DA 2WW8A 3M83A 4E4YA 5JATA 5LXTA 2GZHA 1ORWA 2FOLA 2QAGC 2XUIA 3FKSD 4O0LA 1C1YA 3OURA 3ESXA 2FMFA 3DAOA 3ICPA 4HGYA 3V9PA 3W5IA 2Z2IA 2PVSA 1O5TA 1TM5E 1WO8A 2WFMA 2XD4A 3ED1A 1I30A 3LXUX 4TL8A 5ILQA 5KTYA 1IPEA 4G9EA 1H6AA 1ZK3A 1WW2A 4TRJA 5GQSA 4DKJA 4ZT3A 3Q41A 4G0UA 2C4HA 4J94A 1QQAA 4I3HA 4NF2A 1A4XA 1G6OA 1P72A 3GROA 3HLTA 4P7BA 4V03A 3RSHA 1B6RA 3L1HA 3KB1A 3FFBA 1ZK4A 2VPXA 1BD3A 1J6UA 1Z28A 3MWGA 4MVJE 5FTMA 2D5BA 2R7AA 1EHYA 1QGZA 3D2LA 2WU3A 3KEOA 4TT3A 1ZUD1 2QRZA 1GRVA 3D7SA 1G4AE 3I2YX 1O7JA 1G8JA 1T2FA 1J0BA 1MOQA 3AVXA 1M2OA 5FI3A 1W36C 1PR1A 4ER3A 5LQDA 2FSPA 3LCRA 5F12A 3KQMA 1BXRB 1GEEA 4DJFC 1QRUA 3TFQA 3RCBA 2R7KA 5GP1A 4QGSA 1QHNA 3FPBA 1QE5A 3T9EA 5BT9A 1V16B 2G72A 3K6SB 1QE3A 1VLHA 4Y9DA 3VDNB 3FB1A 3B5EA 4UXJA 4N54A 2V7EA 4GAEA 5B58T 3GBVA 4KMRA 1XZKA 4PYNA 3ZHVA 1VJ5A 2RAFA 2Y0DA 4JB8A 2ZUFA 2MYTA 3HJAA 5KVAA 5EXEA 3F49S 1F2UB 1JLLA 2KM1A 1XTIA 3MJSA 4TMTA 1YJ5A 2PXHA 1R8SA 4K9SA 4EATA 3ROTA 1H2FA 1W19A 4RJLA 5EIAA 4CKEB 5BNWA 5ALYA 3P2KA 2CB9A 4KSCA 3UJHA 4MQ5A 4A0FA 2Q3HA 4I1UA 3ZE1B 4QQFA 4HDNA 3UW3A 2V7XA 3G2LA 1G4UR 1IZYA 1G8AA 2JJYA 2PUHA 2C3UA 3PTZA 4B5KA 3OZGA 3DE0X 4FZ3A 2DWPA 2JJ2D 4DCVA 4DHWA 4YBZA 5KC8A 1W7AA 2C83A 4GE0A 5IH3A 4GQIA 3U4QB 3DPSA 2VHQA 1E62A 3BK2A 3I8SA 3TIGA 1BDMA 4CTMA 1D0VA 1UL1X 3KKLA 2FWJA 4UHJA 1CS0B 1T15A 3SVTA 2PUVA 3ANTA 3NOVA 4MA5A 2ISSD 2AI3A 3RWBA 3IQEA 1E9CA 3GQVA 5KREA 2G8LA 1B3RA 2RHTA 3COVA 3LT4A 3R0IA 1XAJA 2B4TO 2OTCA 3EK2A 1ZX1A 3KT0A 3GLGB 2Q3CA 4HYYA 4ZJZA 2Y71A 4MV9A 3NUQA 2HZ7A 4TXNA 3V4VB 4R6XA 3WNZA 3QYAA 4C4PA 3EWSA 1WMAA 2CSXA 1TEVA 1LD3A 2EERA 4TTJA 1IWPB 1DARA 3PXEA 4F8EA 3NNNA 1I13A 2NADA 3FPCA 4U8GA 2VXYA 4H6PA 3RTBA 4L2IB 3WG9A 3MINB 4LFAB 2HRZA 3NT4A 4UJ5A 1KVQA 3UJ6A 5LNK1 4NBKA 4YCSA 3LOQA 3SR4A 3LZCA 1Z0SA 1HR0B 3AHFA 3L49A 1YI1A 3AGQA 3HRHA 4LDZA 2BMDA 2ILTA 4B8YA 2CW5A 4O4JB 4NJOA 3Q1LA 3KWJA 1T34A 1XD9A 2FN8A 4FJ0A 3TTUA 2W2PA 3EDYA 3ORFA 4EDFA 3IDAA 4RY9A 4UVEA 3U0BA 4A8PA 2Y8EA 1NF2A 3ADCA 3Q8LA 4D1YA 1QCCA 4NJMB 3DE2X 1Q19A 1KEPA 4OX9B 1D6JA 3OZ7A 4AKEA 3R8XA 3DFFA 5JTTA 4X1IB 4B6EA 2YWCA 1TTTA 1JB1A 4HDOB 4R1SA 5IDQA 2ZJ7A 4B71A 3FVRA 4OHWA 4AY6A 1TUGA 4KBFA 1GAWA 4WCFB 5JD6A 1P73A 2J9GA 3U3ZA 4IHJA 4L6AA 2AFIE 4JZYA 4KVAA 4MUGA 3IUPA 2GN0A 5KNDA 1VJTA 4MP3A 2CNBA 5IJ0A 4H3SA 3JU3A 4NEGA 3RADC 1F8XA 4OGWA 4TTIA 1UMCA 3JTEA 5JV5A 3CVWA 1T2CA 2BBSA 3EG9B 1CR4A 5T4EA 3ISTA 2IBMA 3U31A 1R6VA 1UMBB 3LUBA 2I8LA 2YWGA 1IQUA 3PRHA 4A27A 4BRZA 3U44B 4NXMB 5E9QA 4M37A 3T41A 2VEDA 2WDZA 3H7IA 1RPJA 3K0FB 3ZGZA 5BSMA 2F1RA 2NYUA 1KFBB 4KXVA 3L2OB 1KE1A 4B32A 1E1CB 5J63A 3CW9A 1NI5A 1U98A 2HMWA 1HQDA 3JWHA 2O20A 1Q0PA 2IEZA 1EUDB 1S1MA 4RDIA 4IFTA 4IKEA 2UYYA 4HCJA 4RPJA 4AP5A 1WSBA 1M33A 1ZFNA 2Q8QA 1R6TA 1TU4A 3LQ1A 2RB5A 3UB2A 1XN4A 4D9MA 4C2UA 2VF8A 4NPAA 1XEFA 3ZNQA 4H1UA 4Z0HO 8MHTA 4PX3A 2FZ4A 4P92A 5EJEA 4YAWA 3PRKE 1JXAA 3S5JA 1LBSA 2QTHA 1KU6A 5D6OA 1EFVB 1GPBA 1U31A 5GJBA 1U0EA 2R00C 4LHSA 1JDBB 1JEAA 1XPJA 3KQPA 4ETNA 3AL0C 3OLYA 1DJPA 3L7BA 4ZJUA 2QJTA 1UKZA 1QGDA 3LL4A 4RWZA 4PYLA 1T2EA 5JS8A 5WRFA 3CONA 1PYOA 1Q91A 2NT4A 4ZI7F 1VKOA 4YUXA 3DUFB 3QG5A 2FEOA 1HE8B 4KXUA 5JAPA 4CE6A 1MJNA 1NPDA 2GB4A 4BVGA 2FW0A 1UAYA 2XW6A 3BHNA 4TWZA 5JRZA 4PYKA 1SXHA 1HE3A 3AJDA 4L5CA 4BGDA 1LTQA 2ZZKA 2C2ZA 1CR2A 3DP9A 4EAAA 3ILSA 4PGGA 1X39A 1LF5A 4HWRA 3DVLA 3IDQA 5DYNA 1ZXXA 3V1LA 1XDGA 3VR3D 1FX0A 3AXTA 3KQQA 5JLAA 1IHDA 4I4LA 3U56A 2VTDA 5A9TA 1N32B 2EP7A 2CLOB 1J2YA 2AIRA 1Z68A 2HQOA 3EVNA 4LVNA 2ZSDA 4P3PA 2Q4BA 3V46A 1WXFA 3N2YA 3OTHA 5JC8A 5BN5A 4L9SA 5JADA 1BCRA 1A4UA 2CE7A 3K0CA 2HBQA 4YQEA 4KPFC 1ZH0A 2GBPA 5DTRA 3OUUA 3VO9A 3SBOA 1XR3A 4ZICA 4D4GA 3ECSA 1JDNA 3F5SA 3GGDA 2FKNA 4L15A 4DTCA 2IEDA 1M74A 2SHKA 3QPAA 4H6XA 3HY4A 4R84A 3RIHA 2CHFA 3CBGA 3TS1A 2PMEA 2PWPA 1OXXK 2LXNA 4KNWA 2AKAB 3HYNA 2IFTA 4CM4A 1NVFA 4EW3A 5E6SB 4M1WA 2D62A 3D2CA 5K5EA 1XMJA 3IA7A 4OV6B 1I4LD 1OIWA 3IIJA 3LYUA 3UWSA 3AZQA 3K9HA 4MS1A 3LQFA 1TLFA 1ZS9A 2PN1A 4N39A 5DN6A 3O31A 4ME6A 1UEJA 4CQLA 1E2QA 3ZIDA 4PN7A 5CLJA 1YCHA 3D8BA 5KNBD 1OKKA 1RYZA 3RPEA 3VFDA 1IL0A 4MIYA 4B3BA 2P11A 1WCWA 2FWNA 1GL7A 3CLKA 4O2AB 2Z83A 1X7XA 4RVCA 3W8NA 3PF8A 5CU7A 4MB0A 5EHIA 1NE7A 5KNCA 3GLHB 5KWSA 4II7A 1E4OA 5EMNA 5B36A 1XRPA 4RS3A 2HHCA 2JRCA 3RYCA 2OC4A 2QM3A 5D5PA 4QSHA 5TJ9A 5BV0A 4BNKA 2WM2A 4HB0A 4IXWA 1EX9A 1PZFA 3R7SA 1E9DA 1UBJS 1KEUA 2WC1A 3AJEA 4KB5A 1HUQA 2X8JA 3GFFA 1MPTA 1QTNA 1XRRA 3BS4A 4KPGA 1RHQA 1LB1B 4W1QA 4B1FA 5ILOA 4GH5A 2GM4A 1UZAA 4IGIA 4UAVA 3FNIA 1GPH1 2N9UA 4JB2A 5JNRA 3JQ9A 3DZFA 2Q9BA 1P9NA 1ANKA 4B73A 3NP9A 2CLEB 3RRNA 3N0TA 3DZIA 4II3A 4V3BA 2IUSA 1DRKA 2REQA 5EG5A 4OXQA 3VTKA 1JDBC 5JCOC 4XX1A 1N3YA 3ZCSA 3NPAA 3MERA 3KOUA 3NV9A 4BB5A 2FMXA 2P9QA 5FWXB 2ZPUA 4XPIB 3ZZNA 1CZOA 2QZSA 1T8PA 1H2BA 3HHEA 3ZY6A 1QE0A 4OA5A 1R6XA 4X6UA 2VPIA 1P8JA 3E6AA 1H2XA 1KSFX 1NVXQ 1NVTA 2C0CA 4FWBA 1AXGA 1Z37A 4XA8A 1GRQA 4ZCTA 3RQIA 4UPDA 3QE4A 4NAVA 1W5BA 2CDCA 3IXMA 4RCVA 5BMVF 1E1QD 5JMPA 1M73E 1RWKA 1JGTA 1QPBA 3BIWA 3KJNA 3M6IA 1TYCA 4Q7JB 3DNFA 3VR4A 2DFPA 3RIEA 4EUKA 1S3FA 5KHLB 1VZ3A 3WISA 1PN3A 5EE9A 3QKTA 3PRYA 1QHEA 4TXHA 3AHGA 1IN7A 3IQHX 4ALNA 2QNRA 5JYCA 1ORVA 1Y1PA 5JSUA 1HNXB 1VECA 1EEXB 4Y3UA 1Z5ZA 3DEHA 3EQ6A 4TYNA 2Y0CA 4DAOA 4RQUA 1PYDA 1T5DX 3ETNA 3EVEA 2HMAA 4Q39A 2PYDA 1S9DA 5FBRB 3RG8A 3KSMA 2VBGA 3I05A 1QORA 1SG0A 5YASA 3L1JA 1DSSG 2DRIA 3DAGA 4I8DA 4OFZA 4QBHA 4HH3C 3WNBA 4GOJA 3MCWA 5D7BA 2H4JA 1O97C 5IAGA 1V4VA 1SAYA 4YGYA 4L4ZA 4QM7A 2AUTA 5EQTA 1GL3A 2HCRA 1WF3A 1MC8A 4JT2A 1GRRA 3MBIA 4M8NE 3M4ZA 3P2JA 4H6WA 4YA6A 5ITZB 1KOJA 3NDBB 4CTOA 2IVFA 2PS3A 4D9FA 4JK3A 1ESZA 2W6JD 4Q4HA 2FWMX 3MS2A 2GAJA 2VNJA 4UQLA 2VLIA 1NXQA 4EI2A 3IA2A 1LA2A 2CZGA 1QR6A 2O8VA 2VUUA 1NE2A 2Y1OA 3MOGA 1B2LA 4EJFA 2Y92A 1U2EA 3OU2A 1M6WA 5A1TA 3TGWA 4CCSA 4HVCA 2HBZA 1NMEA 1W34A 2Q4TA 5IAEA 4P3KA 3E7XA 1H05A 2HHHB 3QPBA 4KLNA 4NSNA 4PLHA 5DCLA 3SJBA 1JF8A 3E05A 4BBAA 2RGWA 4URVR 1LX7A 4D44A 3QU7A 2PMDA 4TKZA 4CF3A 5ED0A 4IPTA 1OWNA 2PCLA 1QIHA 2QLNA 1WCYA 2ZBPA 1H8HD 1RM3A 2PH5A 3TNDA 2AG8A 4UAUA 2JIBA 3CVOA 2ZT8A 3QM1A 2QAGA 1AHIA 1Z35A 2X6TA 4R3UC 3C8UA 3TJMA 3OECA 2OE2A 2WNSA 1W4AA 3T9FA 5I7VA 3LGAA 1S8OA 2HWXA 1KVRA 4GECA 4GKAA 4QDTA 2VDJA 2KMLA 4OJKA 3V97A 1V3TA 1QKKA 3HBLA 5CLHA 3JVIA 3DBHA 3JD0A 3PUHA 3WMXA 4TYQA 1TT5B 1PNRA 5DEOA 1NDUA 1OTXA 2F1OA 3DDZX 5JANA 4FILA 4DF3A 4M60A 1Q0HA 4UZSA 4B6GA 2BKXA 2WD7B 3LNCA 2A94A 2WAXA 3EOBI 4K03A 5BUCA 3PEEA 4B3DA 1M34B 2HWWA 3I1YA 4Z9AA 4HWGA 3FTEA 1LRLA 3CEAA 3IEVA 4ZGBA 4OXIA 4GGPA 2B98A 2VP5A 4GP9A 1HE1C 4E13A 1VPVA 4BV3A 4DA6A 5BMOA 2GCNA 5EKDA 3FOCA 1JYSA 3AF4A 1D1SA 2RBEA 3OZWA 2HHLA 5EKSA 1LDEA 4JVNA 3V7WA 1JVSA 1XTRA 2NYRA 2MMGA 4OB8A 3STWA 5L3QB 2O2ZA 3UJ8A 2Q7XA 1Z5UA 2A7XA 2O1WA 3SC6A 3MRVA 2HSDA 1EBBA 3KKKA 3A6PC 2EAUA 2WFAA 3DZCA 3VVBA 2ACKA 4UM8B 1Y9JA 2B2CA 3O8DA 1L7EA 5KTKA 2XMRA 4D74A 4DTIA 1XE3A 1C80A 1HSZA 4GOND 3ZU5A 2IZ7A 3FZNA 1QPZA 4U02A 4YJ3F 3H2GA 3QXSA 4UBJA 3GFOA 4J07A 5DHUA 3GUVA 3QJGA 3D6TB 3Q85A 3NEJA 3R3ZA 5KVQA 2CK3A 1YB5A 1RWBA 2AN9A 1Q84A 3AIIA 5CIYA 1CQJA 2RBKA 3A36A 1CC1S 1N2CA 3BMQA 2PA3A 3HPQA 4LOJA 4QUDA 3E53A 2GDZA 4UOZA 3RRFA 1QJ4A 3BL6A 1WZNA 2GEBA 3HCRA 4BP3A 4Y0VA 2V03A 5I9IA 1PDOA 2PGJA 4QUGA 2DX7A 4GZ5A 3G8AA 4TQGA 4ZVSA 4OX9Y 5KYWA 3AKCA 2HTEA 4RIHA 4JI0B 2ATCA 1B26A 2QVZX 2BFOA 3EYAA 1Z4KA 2OCGA 4FWIB 3O82A 2YMQA 2YV2A 3G7NA 4WFQA 4N0EA 4WOJA 4YC7A 4CV1A 1C0EA 1FTYA 2Q9AA 2X15A 3G8CA 4IH1A 1IDOA 4DA9A 1KC3A 2XNHA 4PZLA 5LQMA 3OTOB 1VFPA 1SOMA 4MTCA 2HI0A 3CGGA 5EZQA 3H8VA 3JAMA 2P3LA 1XN1A 2QZ9A 1GGNA 4QYIB 5CGZA 2WNIA 5BUZA 4MH0R 4YMGA 2J9YB 1M1NA 5A5GA 1UBHS 3B53X 1XHLA 3HFGA 4G86A 5EJAA 4DMRA 5CK4A 2I99A 5LFAA 1OE0A 1Q7RA 2YHSA 4XASA 1DAKA 5CXQA 2YIDA 3CNOA 2GWRA 4KR9A 3DZ8A 5AVVA 1GPWB 2WQ6A 4DLLA 1CK4A 1U8ZA 4KVZA 5EFZA 4N5LA 4O1IA 4Q82A 4C7VA 4JCCA 3GJQA 5DASA 1SHKA 1X8XA 4UQOA 1RWXA 2H3EA 3H99A 3PWKA 5ERXA 1VG0B 4A2WA 5JY1A 2FEXA 4FFDA 1AUPA 5FWAA 5MN5A 1EVQA 2I4OA 4P0TA 5MN6A 1Y1LA 2J6HA 1YIAA 4BLQA 3ODPA 3Q8KA 3TZKA 2W2MA 2AZ4A 4GPAA 2C99A 4WJZA 1A5SB 2H2DA 2OK8A 3ZHXA 1BJTA 2VA9A 1I3MA 3F4BA 2J31A 4MUNA 3SWWA 4XM1A 2CXPA 2O6HA 3P9QA 3U6KA 1XLTC 1T5TA 4G07A 4KX3A 2HK7A 2X40A 4LTDA 4N9WA 4ZU1X 2D0DA 1Z38A 2R5FA 4LVCA 1J2EA 3P32A 3V42A 5IKOA 4XUGB 1E2HA 4AMBA 3K72B 3MLBA 3EIQA 3W2IA 4OBBA 4D82A 2HFJA 4WESB 1NC3A 2RHGB 1PHRA 2PL5A 3FXAA 5SYAA 4JI1B 2E0IA 2BEUB 5AM0A 3V2GA 1K7CA 3FPGA 1I9GA 3B1JA 3NI2A 2WTAA 4W82A 2ZXEA 3R3YA 2AR9A 3K6SA 4EG1A 3KKZA 4QJ4A 2IIBA 4EB6A 2DFNA 4I1OA 3G8BA 5LMUB 5EZ6B 5I8WA 1C1XA 3RNLA 3FHCB 3BXOA 4E1BA 1K6IA 3WL3A 2HYIC 2FF7A 1L8OA 4ALJA 1HT1E 5IX8A 4JC0A 4ZV9A 2PUAA 4XFKA 4QXPA 1ZZGA 1OVMA 2X19A 3NXSA 4MPPA 2QN3A 4RD4A 4ZI5A 4BZZA 4CMIA 3NBAA 1C4XA 5ELXA 4P22A 2BM1A 5J23A 1DXHA 3ZQKA 1E1LA 2PFSA 2D54A 2G28A 3TBFA 1AUXA 3KWMA 2DE0X 4FB5A 1S0UA 1PJ8A 2ZRKA 3BXHA 2ZIGA 3LZDA 1I51A 2N75A 1N8SA 4NJEA 5EMKA 4OBWA 5EWJA 5B1SA 4MMZB 3S28A 4IDAA 2BKEA 1S9HA 5FP0A 5EEHA 4K0KB 2ODBA 4EHBA 4YRNA 1MA3A 2V1UA 1MJFA 1HE2A 3UTCA 1BE8A 3E2IA 3M4XA 1KQOA 3QWIA 3P9RA 3HJFA 7ADHA 4PC2A 3FNHA 3BJMA 3OEHA 4ZAZA 2XVYA 3FLMA 3OZXA 2CXSA 4FN4A 2JS7A 4XUDA 1M2VB 4J4HA 1MXFA 3Q0TA 3Q7SA 1T4MA 2C2KA 4LIPD 4YTEA 1MAWA 3HWSA 1VL1A 1JA1A 2CL6X 3K96A 1X14A 5AUOB 5LQJA 5B6IA 1J49A 4YYEA 4F4HA 2J5XA 3EQ8A 3N2KB 3FPSA 4OQFA 1LS6A 2DWCA 3ONVA 4WECA 1UF9A 2PLWA 4Q7LA 2W7TA 1FUEA 2PSJA 2FR0A 3D3QA 4HNGA 4ARZA 2D6FA 3FWZA 1DKMA 1Q0UA 2D5CA 1ZOOA 4NX2A 1E32A 3VSBA 2XZPA 3ANLA 3CX7A 5IANA 1X1AA 3NXKA 1XEWX 3RRJA 4AZTA 2ZI7A 4NE2A 1PGNA 1E7MA 2NZVG 1UJNA 1XJ5A 2A0KA 1YJ8A 3VH2A 4INJA 5LJLA 3A6HA 4PCLA 4RHFA 3NTOA 5FI0B 5M5BA 5CVTA 3HTXA 5IT9A 2E49A 5SZKB 4N0QA 1VKRA 4BE9A 2V7VA 2HA5A 4X71A 1YTUA 2R6ZA 1DV2A 4NEHB 2GBLC 4GX2A 5IC6A 1OBHA 2R6DA 4XIFA 1ZN9A 1ZU4A 3D3NA 5TR9A 1RPNA 2J3MA 5CT6A 2IOYA 4Y6PA 1V8BA 5K6AC 4YLEA 1M1ZA 4MITA 4Q1CA 1NQVA 2R60A 4B31A 3GFQA 3ZWMA 1JDUA 1XMIA 3Q0IA 3AWIA 3NOQA 2XF8A 4UUQA 1L9XA 5CVCA 3RU7A 1H66A 4GYWA 2E4VA 4QARA 3VHRA 4EOGA 4EX7A 4IZ6A 1XCLA 3DVSX 1QYVA 1E6WA 1U0LA 4JBXA 4DA8A 2CHVA 2PEZA 3JYOA 4FNGA 1T0IA 1SM4A 3K0FA 4L5JA 1RWVA 1TC2A 1PJZA 2ZK7A 3W6PA 4CYMA 3ZI7A 4XQ9A 1G5HA 2JF0A 3TLGA 3KJGA 1KORA 4PZ0A 1XCJA 1Z74A 2PK3A 4P35A 4WLFA 3N1UA 4BUZA 3L93A 3FJYA 5F1PA 1XNRB 4WBSA 1CQPA 1UOPA 4DLUA 4YYZA 2FUKA 6REQA 3DTVD 1CDDA 2WUDA 2DLNA 1IY2A 4IMPA 5G3YA 4KHZA 2F3UA 1G1MA 2AFIB 5TEWA 4BPBA 2H06A 3SDBA 4PC6A 2XIQA 5KIAA 1AU9A 1TQDA 1TF5A 4G37A 3LFUA 1KFCB 3K5HA 3U16A 4FR0A 3UHJA 3H5WA 4QOHA 2PAAA 1YCFA 2JKVA 3Q7IA 4DJAA 1GZDA 3HCOA 4DRXB 2PUEA 1GCOA 1ADGA 5TGDA 2JVJA 1CR1A 4MRMB 5JCOA 1TK3A 3AI2A 4MUEA 1I9CA 1SY7A 2ID9A 1W8DA 5AVXA 1I6LA 2VPQA 3KSZO 3SEQA 2NO4A 2AK3A 5EQDA 2Y68A 4IUDS 4RVNA 3C24A 1NFQA 5J2UB 1DU4A 5JQGF 1W4RA 1U11A 3IQWA 1K8QA 1YMUA 2L17A 2PSFA 2CDNA 1GGJA 2O2IA 3AUAA 4KQ1A 2B4AA 2P3QA 4LCBA 4BMYA 3R3XA 4L3VA 4BAGA 2DPLA 2Q0HA 1NU6A 5CDFE 5AKYA 1NQAO 2A58A 3TSZA 3EWNA 4IYJA 4BNHA 2A4KA 4QNNA 4UTXA 3GEHA 4I1YA 3F46A 4I55F 3GUHA 4XDYA 4XOIA 5TQ2A 3DHWC 3CEHA 3W6UA 4BQPA 1TIKA 5KSYA 1NXOA 1RMTA 1T4CB 2MOKA 5K03A 3ZWAA 4M22A 2RKBA 3WVNA 4DCCA 5BP7A 2O57A 4K8RB 4MGEA 4KBGA 5DLPA 2X0DA 1KA9H 2BGLA 5DYGA 2BJVA 1DBVO 3VPFA 5AYVA 5KJEA 4AMVA 2IY9A 3W8RA 1XZMA 1YSCA 4C6TA 3IEUA 4G23A 5KYXB 4EMUA 3MJTA 2XOKA 4ZIRB 2AOWA 3C3EA 1Z3IX 5GOZA 2O8EA 1GPLA 3J7TA 1JPNA 1L5FA 1Y63A 3FMGA 1H69A 1YVDA 5DLYA 1ZCFA 2JIPA 2RGDA 5ALSA 1EDOA 4B6SA 3OCCA 5CFRA 2XB6A 5IU6A 4MRVA 3U3RA 2B6HA 4G5FA 4UDYX 1G42A 3MQ4A 2XYRA 4CL0A 1UKVY 4OIFA 1J5EB 4BNUA 2GNOA 1Z0KA 4KPUB 1R8QA 1Y1KE 2KQUA 2VC2B 4NDZA 2CNDA 2FP3A 2QD2A 4IQFA 5G0UA 3K9FC 2AF4C 3SIPA 3VR6H 1RMYA 1V37A 1V5FA 3OA2A 1MJHA 1SBIA 4I5DA 3L7AA 1LLCA 5E6UB 1E79A 4WDRA 4DGSA 5IK2D 3NV7A 4PO8A 1P1RA 2JDID 4L7QA 4BGIA 4WJLA 5LB2A 4O4LA 2EKBA 2P7IA 1ORTA 3V2IA 2F8LA 3L8EA 1AKTA 4A0GA 1AQJA 1ZXBA 2GESA 3R6DA 4EGAA 2AX4A 1FY2A 5IJAA 4FINA 1J2UA 4IG9A 2Y66A 3MWKA 3A06A 3M6AA 3HA3A 4L74A 3NO4A 3TLJA 1O96B 4GP6A 4K2AA 5BT8A 1UJ4A 1IRIA 5GZ3A 3BB1A 1LFAA 4IEEA 4GBED 2VJCA 4JOQA 5FWNA 1OFUX 3L7KA 1NF3A 2AR0A 2PBRA 3SXUB 5K0FA 5E0OA 2ZYVX 2BGJA 3FW1A 2EW1A 3OM0A 2ZIWB 1OPXA 1TZMA 3SNKA 3NR2A 1RJWA 2QY6A 1SB9A 2RHLA 1ZNZA 3A6DA 2K7FA 4RXUA 4YJ2B 1VJ1A 5CLQA 2W2KB 4WXMA 3RSFA 3O1JC 2CXTA 1M67A 1WNFA 1XQ9A 4E12A 3WL8A 1XQVA 3U5TA 2BHLA 3HEAA 3KKMA 3N87A 3N7UA 5B3LA 1GYQA 4UFPA 4YCCA 2TMKA 5C37A 5I4CA 4R8MA 3TH5A 2BV3A 1V5EA 5FUXA 3VHLB 4H16A 2IL1A 3EXHB 2DTEA 4NFSA 2J3IA 4MQ4A 2EFGA 3EPKA 3F3MA 3NHMA 2A9OA 4I1SA 4E46A 3EIEA 2OQRA 4KQCA 4N9QA 5JWRA 2H2HA 2PZKA 4KFUA 1WDTA 2PZ8A 4FNAA 3VC3A 1DAGA 2SCUA 4S04A 3THXB 1E2KA 1HOTA 5LN1A 3TLZA 4CIWA 4IHAA 1PK8A 3BVPA 1BQ4A 1O8BA 1Q14A 2XY4A 3DTTA 2X5KO 4Y2YA 3BHMA 1WUTA 1JNXX 1Y7TA 3A3NA 3PITA 2KHZA 4B0PA 2J30A 2R47A 2X4GA 1GN9A 3CKLA 3S2FA 1ZJZA 2QP4A 1QYDA 3IO3A 3ZK8A 3MUFA 2C97A 1PU2A 1F0YA 4C4ZA 2ZANA 5BVHB 5A1JA 2I34A 2ADFA 1T6XA 5E3JA 3ZPXA 2X6RA 4XD7D 5EWMA 4BC1A 3AJAA 5IP5A 1L7BA 4CMHA 3WIVA 3JYNA 5AKKA 3GJ6A 1R6UA 4HEJA 2QTAA 2NNWB 1MRSA 4MHOA 4MKZA 3MLEA 3ODGA 1VIMA 1QOQB 2W93A 4DCNA 1WVGA 5DOVA 4EW6A 2NP6A 4MGHA 2ZREA 4Q12A 4QWWA 3D43A 3ZQUA 4RK4A 2OM2A 1PFKA 1VYHA 1ZWLA 3DDUA 2PRSA 4LJAA 3OZFA 1Z06A 2H2FA 3VUEA 3MWYW 1PQPA 5DP2A 1ORRA 4BFTA 3QEBZ 2G1AA 2Y6UA 4IDFA 1BTOA 1X42A 3X1KA 4BX3A 3CHYA 4UD2A 1KF0A 4ER6A 5L40A 2MDTA 1RPAA 1R0KA 3WWPA 2C8VA 1Q6YA 2OBLA 5CNIA 3E8MA 4O2RA 3RRYA 5JNUA 2QP3A 3RAFC 2G3YA 4BXOA 3Q2OA 1TZCA 1EZ4A 3QX7A 3Q2IA 2EKLA 2GJ9A 1A71A 4S1OA 3G5LA 1Q2UA 2X9GA 4B3TB 1JHOA 2VG8A 5K9ZA 3UCXA 2ZKLA 4ZOCA 2ATIA 2TMDA 4XQ0A 5E9WA 1NP7A 3B7WA 1RHRA 3H3JA 1UFKA 4OOFA 4DLWA 4I4TF 3JQQA 1Z5WA 1SBCA 2C3MA 4F71A 5BWNA 1O6GA 3PQFA 3JASB 4RF2A 4OP1A 1LSOA 3IHWA 5EXSA 3PDJA 5U4QA 3SQWA 5BN3A 1Z22A 4P5DA 1U8UA 3FPKA 1CUYA 2OV1A 2I76A 1SVUA 4K6KA 3G7SA 3QNUA 2BDTA 1BGVA 1GNTA 2P8JA 2YMPA 3I9KA 4K9OA 2Q28A 3MT8A 1NYRA 5KPJA 5EJ5A 4A0RA 4C05A 4XJVA 4U5QA 3I9NA 3L5KA 1HG1A 2X6QA 3A6EA 2DU8A 4DCPA 4S1NA 4OMCA 2TMGA 4W1RA 5AKHA 3OIWA 5LA6A 4C1NA 4QUEA 1SUPA 3DQZA 4E32A 4F12A 4Z2YA 2JGNA 2FR8C 4H7DA 3UATA 3UCEA 4UUAA 5AKJA 4YIHA 1NTOA 2GSWA 1NPTO 3N70A 2YN4A 1GITA 4MGYR 4X5OA 3OJOA 4OEHA 3E9QA 2CJFA 3EHDA 1SXJD 4F5YA 1XQXA 1GDDA 3AZPA 3QG1A 4D8TA 4YRPA 2HSJA 4MI6A 5JVDB 3E84A 2Z5VA 3ICVA 2WM9B 3ND6A 1CIPA 3DT8A 2W43A 4OHCA 1EE2A 4KC0A 1JR2A 5CB4A 4IIXA 1LRKA 1Y8ZA 4GDFA 5LLSA 4FBMA 1E2DA 5DW0A 1QUFA 3EPPA 3QEOA 4GLOA 3QJYA 1I0IA 5ADVA 2WAAA 4YALA 3NBZC 3G82C 4YX9A 3C15C 1JAXA 3AX6A 5JWHA 5K3FB 4X64B 1RC1A 2DFDA 3TNFA 2CXOA 3D6UA 5JFGA 2ZJ5A 1ZJWA 1NRIA 2EU8A 4HNHA 1E6LA 2H8KA 3M8KA 1LVGA 3RFCA 3SJAA 1KKUA 4F3NA 5L3QA 1L5SA 1S4QA 5CJPA 3W2EA