4OK5A

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 9 [1-(3-ethynylbenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
446
structure length
441
Chain Sequence
FTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPDVVVVSTDALMTTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 148
structure length 441
sequence length 446
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4ok5A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok5A01
2X1VA 4KYIB 3SOPA 2V3CC 5A5GA 2P67A 3PG5A 1ZBDA 4L16A 3B7GA 5LD2C 3SJBA 1ZW6A 2JLZA 4TQAA 1ZCAA 3BJIC 1KKLA 4Q48A 1UBFA 1XD2B 3LDAA 4Q9HA 5F2EA 3TW8B 4AKHA 3OIWA 1VG0B 1ZUNB 1YR9A 1SVOA 4QJ3A 1MR3F 4H1VA 1P9WA 4FMCF 4KFTA 4AYTA 3KQUA 4TSFD 2VHUA 4X8LA 3DKVA 2Z4RA 1E69A 3FKQA 3RWOA 5HKKD 4IXNA 4EPTA 5BQ5A 3FTQA 4RFSB 4CDGA 4BRUA 4LJ9A 4IDPA 1QG2A 1E1RA 4IVPA 1ZCBA 1KMHB 1DADA 5ELXA 1OIWA 1SVLA 4A8JC 1OXTA 3FOZA 1QHYA 3I61A 5H1YA 121PA 3SEAA 1OV4A 2V7QD 3W5JA 4IDHA 2GEUA 4AYXA 5K8IA 4B75A 3KZ1E 1P3JA 2V9PA 4LBYA 1MV5A 2CL0X 1EFRA 1NRJB 2IS6A 1XEWY 1M7GA 4MH0R 4A0FA 2ZR9A 4JJKA 4O2RA 2OHFA 3L0OA 4ESVA 4YMSA 3QF7A 4GOKA 4IOKA 1E2FA 4YMWA 3IIMA 1OPXA 2AHOA 3K9HA 4QHTA 3FE2A 2KSQA 3GLGA 2QEQA 1E4VA 3EARA 3U7HB 2F1HA 1W36C 1XXHA 3LXRA 1GNQA 4Q66C 2QM7A 1RRGA 2RKOA 3PUYA 1SVMA 2HLDD 1ZIPA 4ZKEA 5D3QA 1L4UA 3B1YA 2D62A 2GEVA 2IYSA 3KKMA 1P6XA 3IQWA 4WA7A 1CR0A 3TSWA 4DUGA 3FB4A 4P4TA 2IF0A 2J45A 1J99A 1NVXQ 3U61B 4TZ0A 1II8A 2AWOA 4XVUA 4NMMA 5KOYA 2RH5A 4JT2A 2QMOA 1DS6A 1FQKA 4Z8XA 1R0XA 4TTQA 3QI2A 3W6PA 1R2QA 3ZIAA 5KNBA 4FIDA 2YVUA 3LX5A 1U9IC 2OBLA 3FHOA 2BMJA 3SDZA 3MGCA 1E9FA 4U02A 5G3ZA 4P0TA 5EXTA 3NC0C 1ZD8A 1ZNZA 2DCUA 3UATA 3UWOA 2J7KA 3KFVA 3OF5A 2RGNC 1MT0A 2DY1A 1E9EA 2GK7A 3GMTA 1XZQA 4JLBA 4XOIA 1IY0A 1VG8A 4L5BA 2W0SA 4NH0A 5A4JA 1Q0UA 2PZEA 1G19A 4R2IA 2E1RA 4B32A 4B73A 1N0UA 1UKYA 1W2HA 3QSYA 4HAYA 5BXQC 1H8ED 3EA5A 5KSOA 3SS8A 1AZSC 3CX6A 1WBDA 4RD2A 3HPQA 1BS1A 4EPRA 2H17A 2GA8A 3LBNA 2YC4C 3NVAA 4OHXA 1FX0B 3T15A 4ARZB 4KITB 2LKDA 1GUAA 3TNFA 4Q19A 3U7GA 4Q7JB 3U3RA 1UEJA 1N5LA 1P9NA 4A2QA 5UKDA 3ADCA 3ETLA 4DRZA 5HR5A 1G6OA 6Q21A 1IXZA 1UKZA 4F4JA 1PLJA 4DCUA 1Z0AA 4IEEA 4M9SA 2QT0A 1JR3A 2ZJYA 3T1TA 1OH7A 1FNMA 4KU4A 4A2WA 3CNLA 2IYUA 4P31A 2QQ0A 3AVVA 3GLIA 1XZPA 1ZD9A 1N6HA 2F43A 3LV8A 1VIAA 3U44A 1HE1C 3IKJA 1C9KA 3O8CA 4QBGB 3SBDA 4JVSB 4A9AA 3H0KA 2N1BA 3OEED 4GZMA 4CF7A 4ZCLA 3GEIA 3LX8A 2QAGB 5P21A 1UKVY 1PV4A 1ZUHA 2F55A 3CNNA 1AS2A 3L8YA 4KLZA 5DN6A 2IBMA 3C5CA 1YZUA 3OAAA 2R62A 2QPOA 2IYLD 1OT3A 3NEJA 3AVUA 4OK5A 4MGYR 1NBMD 3SR0A 1G7CA 5EJEA 1OFHA 2J0QA 3WRXC 2QGZA 3D8BA 4US1R 1S8FA 3ZVLA 2FE4A 2Q3FA 4HAVA 5D3MA 2RHMA 1YKSA 2NTYC 2FWRA 1CJKC 1YRBA 3AF4A 3I1FA 3MCAA 4TYQA 3TR0A 4DEXA 1F5NA 1RRPA 5E3HA 3MUFA 1Z2AA 2IX3A 2YINC 1VCOA 4TMWA 1EFHA 2ZREA 2R2AA 3A1WA 4FW9A 3QY0A 2HXYA 3EPJA 1X1SA 1M34E 2ZAOA 3IPXA 2ZTSA 4HUQB 4BFUA 3ZJYA 2H92A 2ZE6A 4W5WA 4CT5A 1KY3A 3IIKA 2VF8A 3B1ZA 3KKPA 1JR6A 4PHFA 3M6AA 5EZ6B 3P27A 3THWB 3K9NA 4Q1BA 1R0ZA 2OAQ1 4OQNA 1LS6A 5A0FA 3AVYA 3PENA 4L9WA 3B82A 5FI1B 4JJZA 1KI2A 2D74A 2VQSA 4IW3B 4RJLA 3L0IB 5FOSA 4HLQB 4BLOA 1CF4A 4LI0A 1G16A 4MGZR 1YVDA 1DARA 1G6HA 4KYUA 5GJWC 4ZDKA 5EP4A 2QORA 2J0VA 5J4VA 2ZSAA 2YWFA 4UKDA 4XWKA 3TMKA 1Q57A 4M1TA 3B6EA 1D2MA 4NTZA 4DT1A 2BHRA 1JNYA 2O8EB 1WP9A 4PQFA 1L2TA 1HURA 4LV6A 3TVDA 3WXMA 2ZROA 3O8BA 1HT1E 4TL9A 4LDJA 3PIRA 3BS4A 3W3ZB 2V8OA 2ODNA 3R9WA 2JCSA 5FUVA 2L0XA 2ZR7A 4HDQB 4B3GA 2JJ1D 3KQLA 3RSOA 1OLOA 4NE2A 2G1KA 2D06A 1I2DA 1G8PA 4D2IA 2W2VA 2XB4A 5CK5A 5H68A 1DAGA 3RRMA 1NKSA 2GCPA 4AG5A 4CEJA 1E79A 4MRRA 1QRAA 2WSMA 2QNRA 3QXSA 4ACBA 3V4FA 2X77A 1NJGA 2HF9A 1EXMA 1CTQA 1R7RA 1Z6TA 2AKAB 4NYJQ 3TVTA 1W0KA 1ZC4A 2CMKA 3MWLA 3I5XA 1IN6A 2QE7A 3OE7D 3QEJA 3DPUA 4PAOA 1G4AE 1XMSA 4TWZA 1I4LD 1NSFA 5KNDA 5BWMA 2O8CB 1QHGA 4CEIB 2V1UA 2QP3A 3DL0A 2EFHB 3BXZA 3WMEA 3AV0B 3ECCA 3MLEA 4A1FA 5EQTA 4P4SA 2G83A 1G9XA 2ZUBA 3CRMA 3HDTA 3ZZUA 1XEXB 5DYIA 4TMZA 4QHSA 2CEAA 4PAMA 1L8QA 3K53A 4PO1A 4QHYA 1G3UA 2ZEJA 4YDHB 2JAQA 2QBYA 2JLSA 2DFKB 4DSTA 1LF5A 1G7SA 1KMQA 4YXWD 2C9YA 3RC8A 2VTKA 2WTUA 2GVDC 4MQBA 1SVKA 1MKYA 1HH4A 3NEYA 3QKRA 4FMDB 2AXPA 4EAQA 2GZAA 1IJEA 1A2BA 4WVFA 3VNVA 4R98A 1ANKA 2CL7X 4I81A 4M9QA 1TU4A 4C9BA 3QENA 1MH1A 4WOPA 5L3RA 4E22A 2WAXA 3KKQA 3I62A 1K5GA 4NCIA 2GWHA 2DYKA 1WB9A 1OXSC 2QPAA 5FOXA 4IDNA 4Q1DA 1M74A 3AP2A 2CK3A 3ZZTA 1E9AA 1SZPA 2G0TA 3AKYA 1KJWA 4DJTA 4LYJA 2WWFA 2QUZA 3AKCA 3RLFA 1CULC 1GOTA 4TL8A 1TUIA 4N0DA 2WIAA 1VCMA 3TRFA 4D80A 2BCJQ 3H2YA 3MWKA 5J47A 2CCKA 3AQ4A 2NPFA 2CJWB 2VSFA 4KV9A 2C2HA 1IN5A 2PJZA 4R7ZA 5AUPB 1JJ7A 4IJMA 4MKGA 2PLRA 3VX3A 1EFCA 2PMDA 3K70C 3R7WB 5IK2A 4BLRA 3FWYA 4IFEA 4KVGA 5B30A 5M04A 2LKCA 4NP6A 3ZD7A 2C99A 4PSKA 2O0KA 5BN3A 3QKSA 1NI3A 4C0BA 5DLQC 4JMPA 1GM5A 3GJ0A 2QY9A 1YR8A 1XJCA 3QF4A 3RNLA 1KI6A 4OKSA 3QIAA 2GJAA 3K0FB 1QHNA 3KJGA 3GFPA 1E2IA 1DAHA 1CJVC 1Z07A 4PPQA 1LNZA 1SXJD 2WAYA 4DLZA 2QI9C 1WE2A 1R6BX 3N2IA 2OBNA 1KSJA 2IK8A 4GBMA 4CGZA 4RCYA 5FL7D 1ZIOA 3GEEA 3ZLJA 1IAQA 1R5NA 4HZUA 1SGWA 4E07A 3QKTA 3LD9A 3RVBA 1UEIA 421PA 1GFIA 2GTPA 3THXA 4UNPA 4OI0A 4Z8YA 1YJ5A 2ZI7A 4LGMA 4I1VA 1MOZA 3QOFA 5JLJA 4N3NA 3AVWA 3KKNA 1FTSA 1W4CA 4UNQA 5EE5B 3TE6A 5HZHA 4FWIB 3SYNA 5C1BA 2BBWA 5HTKA 4AK9A 3TR5A 2VHQA 3FHCB 1MABB 3HU3A 1FZQA 2O52A 4LC1A 3EA0A 2P0EA 1NBME 3SJZA 4C0HA 721PA 4CEHA 4B35A 4DWJA 5TV2A 3ZVNA 4AC9A 1U98A 3EASA 1GAJA 3PQCA 1QDEA 1NNEA 1ETUA 4HDCA 1E32A 3VTKA 3A8TA 4RKFA 1ZYUA 2J5XA 3GJXC 3ZS8A 3ZQJA 2C95A 2BIFA 1GKYA 5L3SB 2QROA 1IXRC 3P4YA 4C30A 5BW8A 3CLVA 3LH5A 3B2EA 4V0MA 3BFXA 2J3EA 3WNCA 3CR7A 1CJMA 3CPHA 5B57C 2ODEA 2QTVB 3CONA 1IONA 1N6OA 1YR7A 3RS5A 2WICA 3FFBA 4M1YA 5EP1A 4C0JA 5KNCA 3QBTA 3NG1A 4QGGA 3KXLA 2GK6A 4M1OA 1CLUA 4HAWA 2GJKA 5KSYA 2VP0A 3NH6A 5HKKA 2IS1A 5G40A 4D26A 4EIWA 3IILA 1NN5A 1XNJA 4JL8A 3I72A 4D4MA 1KO4A 4JVNA 3SQXA 4H9GA 2VHJA 4LJ6A 3K0CC 1N6LA 2ZS8A 2HT1A 4F4CA 2YV5A 2HT6A 4D4KA 2V7QA 3TIFA 2FFHA 1COWA 1G8FA 2ONKA 3PUWA 1RYFA 2CLSA 2X2EA 4LV8B 1RJ9B 4PANA 1GKIA 4QC2A 1E2GA 1ZP6A 4QXAA 4QNMA 3WNBA 2CNWD 2Z6VA 5JWOA 2WIBA 1U99A 1AKEA 1YZTA 5TMPA 2AD1A 2TMKA 1GG2A 1B23P 4A6XA 1EK0A 1U2RA 4CZ2A 4B3BA 2ZI5A 3K8YA 1K6MA 1CR1A 1NVWQ 5JRJA 5F9HA 4W5HA 3IEVA 3K09A 3LVRE 4DLRA 2OLKA 1JEEA 5EE1A 4PX9A 1DVRA 2BMEA 1IJFA 2X2FA 4US2R 2J46A 3AUYA 3MFYA 4YDSA 1F48A 4PPNA 1EX6A 4R2HA 1D6JA 1EX7A 1XRJA 5FOVA 5EZ5A 1S2MA 4RCZA 2KE5A 1TTTA 1UADA 1E2EA 1N6NA 3ZVRA 2IYRA 1GNPA 1KIMA 2EVWX 3AEZA 2C9OA 2R6DA 4OI1A 1NMXA 2CCJA 4QL3A 4YMTA 4B3FX 2ASEA 3DZDA 5EE0A 3BORA 2QMUA 5BN4A 3AVPA 2E9SA 2ZYWX 4M9ZA 1R8QA 3VHLB 3M1IA 1VCIA 1ZM9A 5TXGA 1U8YA 3IGFA 4US0R 2GXUA 4IDOA 3T5GA 4MDEA 4HLDA 4B34A 4AKGA 1KK3A 2BJWA 5GJVC 4RSGA 3MWYW 4LJAA 4V0LA 2QMEA 1GZSA 1NL3A 4RD0A 4AKEA 1G3MA 2O0JA 1FOEB 3Q7QA 4KBFA 2AK3A 4JBXA 2F1JA 3AGPA 3THYB 3Q8XB 3ZD6A 1DAMA 1IOZA 3CW2A 1XP8A 4NZYA 4EFMA 2JA1A 4X8HA 4F92B 5JI3E 1H8EA 2D7CA 3BBPA 3C4JA 4Q4HB 1DAIA 3G5UA 1K8RA 3VR1A 1ZC3A 4FXPA 4LJ4A 4JYBA 1EWQA 2IYXA 1N0VC 1US8B 2G77B 1QVRA 2XNDA 3UMFA 1TX4B 2YOFA 3GQBA 4ZI3A 5L8VA 2B7CA 2A9KA 4LWZA 3H84A 5JSZA 2O8DA 1JXMA 4IVQA 4MRNA 1NMZA 5JMTA 4DCNA 3GCGA 4A82A 3WBJA 5FTJA 2YOHA 2NO9A 3EC2A 1NVUQ 1RIFA 3RRYA 1UKEA 4QKQA 1AZTA 1GRRA 4MITA 3A4LA 4Z1MD 1VYUA 1ZUIA 4POAA 1DO2A 1RPZA 1JALA 4B6EA 2G3YA 4B74A 1H8HD 1KYIA 1IN7A 4X8OA 1W1WA 3VKHA 1KTVA 3FKSD 2R65A 4XD7D 3VNUA 3QXCA 4EJSB 4JLOA 2W6JA 2V6IA 1IN4A 1R10A 621PA 5L3QA 1RYHA 5JI2E 4LHXA 3P20A 3W34A 4EQ6A 5LPNA 2CE2X 2ZRAA 4NYJR 4DIEA 2XOKD 2BJVA 3VX4A 3U2QA 1KDTA 1XBTA 4LBWA 3UIEA 4BE7B 1E9SA 3QEOA 3FMOB 4LC0A 4FCVA 1XEWX 1XJQA 4JSYA 4Q4AA 5FOWA 4URVR 3T61A 1N25A 5FTKA 3GPLA 3QPUA 1Z6XA 1PZNA 2CE7A 4OHZA 3NBFA 3DHWC 1SVSA 5KPJA 2QAJA 1E99A 4OHWA 2KB0A 3EXAA 2WWHA 1BH2A 3R8CA 4MYTA 2IYVA 3DZ8A 2GJ8A 4EPXA 5IF9A 5FR1A 1Q3HA 2OZEA 4G5GA 1GL6A 2K5UA 1IN8A 2BBTA 1LFDB 4TYPA 2O8FA 5LDDC 3P4XA 5JHGB 3EWSA 3MJHA 2MMGA 3ZS9A 4WW0A 1DEKA 1OFUX 4Z54A 1W4AA 4L15A 4PSVA 4Q18A 3WYAA 1MRNA 4QBFA 3G0HA 4A0HA 3RYTC 4ZDIA 2QQEA 4Q47A 3PXGA 4CIDA 1GITA 1KZ7B 1YZNA 4JVMA 1QHHA 1XJ0A 4P32A 2ANCA 1P75A 3R9IA 5CLLA 1Q20A 1E2QA 2OE2A 1XMJA 3DOEA 2YWEA 1GVNB 1XCPA 2ZU0C 1GP2A 1XB2A 2QA5A 4QFMA 1Z6YA 3SZRA 4D0LB 4UNNA 5CLQA 2WWYA 1CS4C 1L4YA 2PT5A 3U6KA 1KSFX 3G82C 3KTAB 4GZLA 2IEZA 2I1QA 2FU5C 1E98A 1CJTC 5EXPA 1Z5ZA 4AD8A 4NYMR 3TSZA 2J7PD 3Q72A 5AJYA 5JEDA 2ECKA 1EESA 2FG5A 5G53C 5CYPA 1OKKD 1UBGA 2A5GA 5AUQA 2UZ3A 4C0AC 2XNSA 5BYJA 3R20A 4UXIA 3VMFA 1LY1A 3WHLA 1VYVA 2FEMA 1VTKA 3OFNA 1NLYA 3RC3A 2O8BB 1BMFD 5BN5A 4KLNA 2AXNA 3QPWA 5EP2A 5H70A 1PUJA 2ZI9A 4PXAA 4B2PA 2J0SA 2NZ8A 1FP7A 2IYQA 1Z6GA 4B3XA 4ZCIA 3QG5A 4F4IA 3OE7A 1GWNA 3A58B 1N2CE 4OK6A 2H8KA 2FFQA 1U0JA 1GTVA 1NIJA 1W4RA 4LCBA 1E2LA 3ZDQA 4A8JB 2P6RA 3K0CA 1KZGB 3EX7C 2O5VA 4V0KA 1VECA 1Z83A 3LFUA 4LHYA 1XTJA 5F3WB 3HP1A 1W0JD 1IY2A 1KHTA 4PQRA 4XH9B 1TQDA 4ASUD 1T5LA 3B60A 5FBQB 1NY6A 2EFCB 2PLFA 2XJ4A 2NO7A 3MSXA 4WZAE 5CJ2A 5CITA 4Q9LA 1CIPA 2EYUA 3IPYA 5CK4A 1CKEA 1F6BA 2QRNA 3CF6R 3AB3A 4F38A 4BFYA 4TYWA 4Q00A 1EFUA 1AQYA 3MMPA 3X1ZA 1W36B 1BYIA 2Q9AA 4JYCA 2PEZA 1KKMA 1W4BA 1E2KA 4HUTA 2B92A 1ESNA 2IA5A 2OLJA 5DE3A 4JZKA 1Q1QA 3PEVA 4M22A 1OH6A 4HAUA 4DBLC 2ZRCA 4ZPXA 4B47A 2IYYA 2RGGA 1X3SA 1T8UA 1FW6A 5DIFA 2V55B 4M1WA 3EIHA 2EFDB 4XIGS 3RHFA 3VR3A 3EPKA 1YQTA 2NO0A 3SFZA 4IKEA 3O8DA 4D25A 1KOFA 1U94A 2WJHA 2V54A 4Q4JA 4UXJA 1M8PA 2AWNA 1G21E 3W8NA 3QXXA 4D4JA 2WHXA 1JPNA 2OT3B 4YMUA 2WWIA 4RD3A 3L43A 2BOVA 3ZH9B 2OO7A 3CB4A 3I4LA 2QT1A 4IDQA 3NBYC 3GD7A 4K8OA 4PC3A 5L3VA 2HJGA 4QGHA 4B2IA 3DVLA 3WY9A 3L2OB 1J7KA 1T8TA 4ITRC 4HB2A 4I4LA 4W5JA 1F2TB 2WSSA 4WAUA 3MAAC 3LQRA 3GP8A 4GT1A 4PZYA 4TLCA 2WV9A 4U00A 4DSUA 3B13B 4CT4B 4NCJA 2VP6A 3SQWA 4Q1AA 5KDDA 1Z6AA 2JIZD 2CDNA 4KCGA 4Q21A 4Q1FA 4ZIRA 2OFWA 5KDOA 2R9VA 3AP1A 4TLBA 3E2IA 1TQ6A 3C5HA 3PUZA 4TLEA 2BEKA 1Z3IX 4P33A 1KI6B 4N0EA 4BLTA 1ZJ6A 3DEFA 2WZQA 2WOJA 3A1TA 2F9LA 4V0OA 3A4NA 3O47A 3SYKA 3TK1A 5KSPA 4TT3A 5E7IA 3ASZA 5TARA 1BOFA 1SXJA 5JZVA 4LPSA 4B2LA 3I5YA 2GRJA 3THOA 2JATA 2JDID 4D0NA 3TQFA 2J0UB 2B7BA 2FMXA 3NXSA 5FL7A 2Z83A 4JLJA 4DDUA 4FMBB 3S1AB 1KO5A 1FMJA 4TQUS 5GJCA 2H16A 1G18A 4KVAA 1OIXA 2DBYA 2GAOA 2RGXA 4WZBE 1NVVQ 2NO6A 3OEHA 4EPVA 5KU1A 2CLDX 3EPLA 1KSGA 1KI8A 1XMIA 1QZXA 1E1QD 1G8HA 4G5OA 2RHDA 2IS4A 3D31A 2V6JA 2NMVA 2C8VA 5DNYB 3CUEF 1BO6A 3AF3A 4KO8A 5AJWA 1IQPA 4BECA 3WMFA 4RZ3A 4DLXA 1Q12A 2GETA 3ADKA 1J2JA 5J40A 4B33A 4F93B 2VRWA 1JECA 5EXXA 3PJRA 5AJVB 1TMKA 5HE8A 1LS1A 1PUIA 1OHHD 4G0NA 1MO4A 1TQ4A 3C8UA 1HY3A 2P65A 1SVIA 5JRZA 1Z8FA 2JEOA 4DLTA 1ZM4A 3BH7A 1IBRA 1DPFA 3H4MA 3H86A 3KB1A 5AK0A 3B5JA 2W00A 1GIAA 1KSHA 1KI7A 4KSCA 3RS2A 4BASA 1SVWA 5FTLA 2CXXA 1CRPA 2NO1A 3UWKA 2QP4A 1LV7A 1XD2A 4A92A 1NN1A 2IHYA 4AURA 4BEBA 4AG6A 1GILA 5CDFE 1HE8B 2F7SA 4FI3C 4ZI2A 3PUVA 4G5QA 3K09C 2Q0HA 3VR4A 4NCHA 3PEUA 2REBA 4BFWA 2JLRA 3ND9A 5E7JA 3GFTA 2GCOB 2NGRA 4V02A 1U8ZA 4OL0A 3UG7A 1WMSA 3Q85A 2ZS7A 4RFSA 5SZKB 3O8RA 5AJXA 3RS7A 1RZ3A 2A5JA 2FSIA 1OW3B 1UDWA 3AUXA 4DCTA 2BC9A 4ERNA 1P60A 1KMHA 4K81B 1DAFA 3GJ6A 3V00A 3P32A 2CNWA 2DFLA 1DAKA 1I2MA 4QJ4A 3J81k 2Z4SA 3WYGA 1AS3A 1S0UA 5CYOA 2H5EA 4KFUA 2SHKA 1HT2E 2D3WA 1S3SA 2AR7A 3HU2A 2YNMA 1TEXA 1FTNA 4C7OB 3NDPA 2ZU6A 2ZRPA 3AH8A 2ZM5A 1E0AA 3AKDA 2RB4A 1XFAA 4II7A 2FGJA 2FFAA 1HQYE 3N5CA 3AP3A 3T06B 4S2EA 4TTRA 1AGRA 4B43A 5IRCD 3K9GA 3K0SA 4O3MA 2FA9A 3CRW1 1PJRA 4DUGD 2ZPTX 1KDRA 2XX3A 2R6FA 1R0YA 2H18A 1X8JA 1K5DA 5J5CA 4DCVA 2BEJA 4GP6A 4A0RA 1AGPA 2IW3A 1YZLA 2A7QA 2MSEB 4BZPA 1AQUA 1XTKA 3CRRA 1GNRA 2ZUCA 3FVQA 1IM2A 4FMCB 5FPTA 3CPJB 1Q44A 4HB3A 5IDVA 3MD0A 4PC2A 2GBLA 2AFHE 3GLFB 2HYIC 3REFA 1QF9A 2B6HA 4EDHA 4LHZA 4TN1A 3IQXA 1CP2A 3B8HA 3WBKA 4NYMQ 3SBEA 2VP9A 2GILA 5FOUA 4KAXA 4TTPA 2W6IA 3E5HA 3R8FA 3BIFA 1E0SA 5HCIA 1C1YA 2W0MA 1KJYA 3PITA 5KDLA 1AA9A 2QGNA 4NONA 1Z0KA 4BZQA 4PTLA 2FX3A 4QJ5A 1AKYA 3ICQB 3CM0A 2H7VA 3M4YA 4GSYA 2WM9B 3BD9A 3CF0A 3EG5A 3U6BA 1FX0A 1OF1A 1QBKC 1ZM3A 4ARZA 1Z47A 3MWJA 1PVOA 3TUZC 3OZXA 4Z1MA 1EFTA 3PV0A 1ONBA 3ADDA 3VKGA 3IUYA 2QSZA 3U3OA 2FH5B 4MYCA 3GLFE 3RABA 3RWMB 1H8HA 2QU8A 3GFOA 5EXSA 3QBVA 3BH0A 3ASYA 2AX4A 3FPAA 1E2DA 1LVGA 1JR3D 3FKSA 3VU9B 2YJTD 4IFBA 5FR2A 1FL9A 5EE3A 2VL7A 4ZCMA 2D2EA 2JLXA 1W48A 1DBSA 2XTNA 2WJVA 2ZSFA 1JQJC 2YOGA 3CIOA 4LBZA 1WCV1 3U4QB 2QG6A 2XEXA 3LW8A 3RS3A 3GLHB 2XXAB 2F9MA 3T35A 3ICEA 1AJEA 4RZUA 2VA8A 2HJVA 3IIJA 5FL3A 1YZKA 2IHBA 1T91A 2GAAA 1Z08A 4O0MA 2HXSA 4IOJA 1KI4A 4KODA 1KDOA 4XJXA 4KFRA 1G4UR 2GF0A 3B9QA 4TMKA 1S3GA 2UKDA 5FBWB 5DI3B 4Q5IA 3KQHA 2QAGA 5FPSA 3BK7A 1NG9A 3X1WA 2G88A 3SFVA 1Z29A 5CM8B 2OSBA 2IT1A 2RMKA 2IYTA 4C0LA 3KDSE 3OAAD 3KUDA 4B3CA 3H1TA 4DSOA 4PAQA 2OCAA 3HPRA 5JWHA 5TDHA 4KHZA 3CH5A 3K0AB 2FOLA 2JLVA 2ZJOA 1G7TA 4UQOA 3QE0A 2OXCA 1LW7A 2EFGA 1W2GA 4URZR 1UJ2A 1VKJA 1BKDR 4MUBA 3SI7A 4QRHA 2OESA 2R44A 2VO1A 2ZRNA 3HU1A 1AM4D 4E5UA 1N6IA 2ZANA 1AN0A 1KNQA 5JWRA 4JLMA 2Q6TA 2WWXA 5GVRA 1VMAA 1UDXA 3L8ZA 1P5ZB 2ZE8A 4HAXA 3LWNA 3ONWA 3CPEA 5JFGA 2Z5FA 4G5RA 4PFSA 1E9CA 1ZM2A 1B0UA 1XTSA 1WA5A 2C98A 4HUQA 2HV8A 4LBVA 1TADA 2W83A 1MO6A 2REOA 5AJZA 2JLUA 2G6BA 2C96A 4TSFA 3THWA 3I92A 2DFTA 2RGEA 4OHYA 2NQ2C 4JBYA 1FUKA 2XZOA 1X6VA 4MGIR 3W3AA 4C3ZA 2WKQA 4HYYA 4JLAA 4UNSA 4BLQA 1HA3A 4NHOA 3CRQA 2G9NA 3SHWA 3SJAA 4A15A 1P2UA 3UK6A 1OKKA 3PCRB 2FZ4A 2OBMA 2XTMA 4O2LA 5FTMA 5DHAA 5C4GB 2O8EA 2EWWA 4Q03A 1T0HB 3A37A 3BC1A 5FBVB 3CNOA 4OQXA 2LWIA 3FMPB 4RZXA 2IWHA 1Z06A 1OXUA 4B48A 3A1VA 3U3JA 2PEYA 4L8GA 5KO2A 4DDTA 5B64A 1R4AA 4Q9IA 1KAGA 2FF7A 5F9FA 2QSYA 3M0EA 3GLGB 3CR8A 1E79D 2FDCA 2ONJA 4C0KA 1XXHB 2ZRBA 4TYNA 1KI9A 2ZVPX 5K8TA 4FWTA 1Q22A 1E2NA 4AYWA 4DC9A 5KPDA 4ZDJA 4TZ6A 2HLDA 2F3TA 1W0KD 3QNUA 4I99A 2ORVA 3SJCA 2QE7D 3C15C 4OHVA 4LYAA 5AR1A 2CHQA 2I3BA 2GESA 2O8CA 4F91B 5FUWA 4CEIA 1II8B 4HDOB 1W0JA 1G3QA 4ILEA 4PHTA 1NVVR 4DLSA 1S4QA 4ASUA 3W90A 2ZRGA 1F3OA 1I4TD 1WBBA 3B1XA 2OM2A 1WRBA 1XTIA 1X86B 1TF5A 3RS0A 1G8GA 1Z28A 3GLGE 3BAFA 2VF7A 4JT4A 1XEXA 4PR0A 4ZO4A 1XXHE 1ESMA 2D4HA 4HATA 2WMNB 1KGDA 1T3LA 2W2XA 2KBEA 2FFBA 3VAAA 1IHUA 2PCJA 2GHIA 1T5IA 2DR3A 1J8MF 2Q9BA 5TB5A 1D9XA 1F60A 1M2OB 4NU0A 1W36D 3MRSA 4IOLA 1UM8A 5E7MA 2A5DA 2BM0A 5FI0B 1FNNA 2JJ2D 3GJ5A 3L0SA 2JLWA 4BEJA 4PO9A 4NYIQ 5JBQA 1A1VA 3LBHA 2DPXA 1PLKA 1V43A 2VP5A 3AKEA 4G3XA 3BRWD 4Q9JA 3NWJA 4HI0E 1R5BA 1J70A 5E4FA 2V1XA 1T4GA 3CBQA 3K1JA 1ZNXA 4URWR 4BFTA 1HEIA 2CK3D 1XTRA 1SXJC 5ANRB 4DXAA 2CHVA 1I4DD 3PVSA 2WJIA 4OYHA 3BB1A 3ZZ0A 3NHBA 2AFIE 1SHKA 4L4UA 4NCNA 4HEJA 2HYDA 4BUJA 5DI9A 5C46F 1TF7A 8OHMA 2OILA 1JAHA 3AVQA 3VQTA 1MRSA 4Q01A 4GMXA 4U5XA 2IUTA 4ZIRB 1E9DA 3GLIB 3R9XA 5JHHB 1DOAA 1JEDA 1FPMA 1BYUA 1F2UA 1KY2A 2CJWA 3LBIA 4ZDWA 1G7RA 4GMDA 1PLLA 2F43B 4P4UA 3UPUA 3AM1A 1RVDA 4DEYA 5IK2D 3U44B 3R7WA 2ZRJA 2HDNB 4PZLA 3IEUA 1U90A 4ESHA 1WQ1R 3C14C 3EIEA 4RZ2A 1T6NA 3OEEA 4MUAA 2ZRKA 4GOJA 4ABYA 4JLDA 3GJ7A 3K9LA 2PZFA 2BWJA 1E2HA 5LB4A 3BE4A 3KFXA 2BV3A 3LRPA 1L7VC 1SKYB 2C03A 4N1AA 4XTCS 1NY5A 3K0FA 4IHQA 1JR3E 3F3YA 4BPBA 2QMHA 2C04A 3VHXA 3TQCA 2YWHA 2ERYA 5SZHB 4M2LA 2IL1A 1GL7A 4DIDA 1VPLA 3JZMA 4OI4A 3W8RA 5KUTA 1NBMA 1N3BA 2OCBA 3BERA 4RD4A 4YONB 3GLIE 2GCNA 4AIIA 3LQQA 2JASA 4S35A 2IEYA 5D3MB 2VIIA 2ZYTX 1UBEA 4M21A 4EKDA 5CB8A 4DZZA 1HQCA 1E9RA 3OHMA 2BDTA 2FJUA 2ZUDA 3GJ8A 3AF0A 3X2SA 5HZKA 1TU3A 2IUUA 1GSIA 1LTQA 4JLVA 4MYUA 1SKYE 3C16C 4Q7LA 1Q21A 2D2FA 1U81A 3W9YA 3F8TA 1ZVQA 1MABA 2FV8A 3C41J 3EZ7A 4B44A 4DLVA 1Z22A 4I1UA 2QL6A 1XPUA 3TJZA 1KDPA 2J9RA 2ZRFA 4URUR 1YE8A 4WIAA 4MKFA 1V5WA 5C2JB 3PEYA 4D0GA 2X19A 4OJQA 3DOFA 1KNXA 4F7WA 2GF9A 3QG1A 1LB1B 4X8MA 4QOSA 5HE9A 1II0A 2WWGA 2Z43A 3F0TA 3NBZC 5SZIA 3HR8A 5FUXA 5L3SA 2R6AA 3EAQA 4FMDF 3RRNA 5KHOC 4HB4A 5DGXA 1AK2A 3DKPA 3IO5A 5JS7A 1D2NA 1G5RA 4DT1B 3FMFA 1NKTA 4EUNA 2PJRA 2VP2A 3NTUA 1ZAKA 4DHEA 2C9CA 2N46A 3L82B 1D9ZA 1W49A 4LPKA 1JAIA 2LCFA 3U7EB 5LD2B 2OG2A 2XSZD 4EFLA 4MRVA 4RVCA 2A78A 2GZHA 4PHHA 3KXKA 2ZETA 2JJ1A 3SE0A 4GL2A 3PR1A 2JGNA 3GEHA 2G1JA 3IBGA 4CEJB 4URXR 3VFDA 1P2SA 3CZPA 2ZI4A 1S1CA 3B78A 2G0NA 2DB3A 1Z0JA 1G1MA 1A82A 3RSLA 3ZVMA 4TMVA 1QG4A 1XPOA 1GRQA 1UF9A 2X8AA 1LF0A 1FP6A 5EE9A 2Q9CA 1COWD 1NLFA 2PBRA 3EZ6A 2ZYUX 3RS4A 3WYFA 1OXVA 3NH9A 4FINA 4I1OA 1RJ9A 4LHVA 4A36A 1XD8A 4DLUA 1XWIA 4P4SB 1NF3A 4Y0AA 3WP0A 2BBOA 5FBLB 2FPLA 2CLCX 2VPPA 1XMVA 3LO5A 1JBKA 4WXPA 4M0LA 4OQFA 1IXSB 1H65A 4BFVA 5GADl 2QBYB 2GBLC 4Z51A 2QPTA 2R6GA 1TF2A 2RGCA 4PO8A 4DKXA 4OK3A 4YLGA 3HYTA 1E0KA 1E9BA 3JVUA 4YXWA 4PC1A 5F98A 2ZI6A 2VHTA 3QJYA 1KO8A 4YC7A 3QKRB 2ZQ5A 2ZVQX 4PQYA 2JJ8A 1EWRA 4M53A 1Z2CA 3B1WA 5FUYA 1RW4A 3NC1C 3QKUA 3P26A 1II9A 2FPMA 5G3YA 1XCGB 2BKUA 2GJSA 2ZRMA 5AUNB 2WPDD 1TPZA 2QP9X 2YHSA 4HZIA 2HCBA 3KQNA 2C78A 4QGAA 1E4YA 4LHWA 1Y3AA 5JS8A 4B76A 1CR4A 1FMLA 2VHCA 5J4KA 4FCTA 5CIWA 3T1QA 2MSCB 4C2TA 1G5PA 2PX0A 521PA 3X1YA 1FUUA 5GVSA 2XB2A 4B71A 4EFNA 2UVQA 4OQLA 2XAUA 3B85A 2ZRDA 4KI0A 3THYA 1P9RA 3KL4A 4PHGA 4Q02A 3T5DA 2IF2A 5BYKA 4KXFB 4DCSA 1G8YA 4AKIA 4Q4HA 1O87A 4JKIA 2GXAA 2RAPA 1QHSA 3KB2A 2P5TB 2H1LA 5J4LA 3EZFA 2XNDD 3CWQA 3KJEA 1US8A 2HUPA 2I1VB 3QKSB 1KAOA 3EZ9A 4D82A 2PMKA 3QXJA 4QBIA 5JCPA 3A36A 5DO9A 2GDJA 1S9HA 2QAGC 4MRSA 1W47A 5AUOB 3QF4B 1MO5A 1X8LA 4JL5A 1X8KA 5CM9C 2FZLA 1W5SA 2WVJA 1E3MA 2A5FA 1JQLB 1AIPA 2QTFA 3DO6A 2YWGA 3TGPA 2BCGY 4JKYA 5JJKA 1OE0A 1P4SA 4M1MA 4HZUB 1KI1A 3Q5DA 4DDVA 2V4ZA 4U7DA 3PEWA 1CEEA 2W6JD 4JVLA 2FSFA 5TVKA 4EJSA 3THXB 3U3KA 3DMNA 1TAGA 5IHPA 3E70C 3K0EA 1FFHA 2XGJA 3HJNA 2BKEA 3K70D 4BFZA 2VSXA 4D4LA 4J0QA 4UNRA 2IXFA 4LJ5A 1SULA 4LV5B 4LJYA 4RFVA 2ZSDA 4BFSA 3I73A 1NLZA 4MDFA 4XSHA 3P1JA 4CEHB 3RANA 2C5LA 1GKUB 3MG9A 4PC7A 4V03A 4MKHA 4LOAA 3ZYCA 3U5ZB 4UJ5A 3T1VA 5K8LA 1Z0FA 1X1RA 1XD9A 3BFVA 5FFMA 4GP7A 4FD2A 4RD6A 2RCNA 3KKOA 1ZNYA 2ATXA 1QVAA 2GNOA 4LZZA 3Q7PA 3TH5A 4NCKA 3I8XA 2HF8A 1CU1A 2QZ4A 5JECA 4CRWB 2XZLA 3EWAA 1TUEA 4LUCA 2QM8A 1A5TA 2NZJA 3OIYA 1D5CA 2HEIA 3NIBA 4LRWA 4PSAA 4TMTA 3HR7A 1KJZA 4TQ9A 2IWRA 4TYYA 2IS2A 1ZNWA 3X1DA 1N5JA 1CR2A 2VYFA 3CF2A 2ODBA 3OIVA 4NYIR 3GJ3A 1KO7A 5DYGA 3VR5A 4JLKA 2VEDA 5EUMA 1E6CA 3KX2A 2F3RA 4LY6A 1KO1A 1XTQA 3EZ2A 4DB4A 4CW7A 1Q1ZA 1XDBA 1XPRA 5K8UA 1M7HA 3CWZA 4NBSA 4B3DA 3AF1A 4M4SA 4V0ME 4HLCA 3NDBB 2C77A 4RKEA 1BIFA 3KTAA 1JJVA 1HYQA 2UZIR 1E1RD 4W9MC 1J8YF 3JZAA 5J4YA 4JLPA 4KSBA 4KJZA 2H57A 2PL3A 5TY0A 2BBSA 4WXRA 3LVQE 1W44A 2FSGA 2CBZA 4C0SA 3EPHA 1D8TA 3N70A 1EFRD 2FSHA 2RGBA 4Q9KA 4PPFA 1OSNA 1SHZA 5JJLA 1TQ2A 1G291 3OFND 3Q9LA 1XX6A 2B8WA 2O8BA 4LYHA 4GI7A 4LX0A 2WKRA 2QTHA 4Q7KA 2EFEB 4YQFA 5FPKA 4MYHA 1T0JB 4PPGA 1OB5A 4L9SA 2ZSBA 2Y8EA 2P2LA 4DDWA 2IYZA 1OH8A 4ON9A 5DSZA 1OYYA 3WNDA 1ZMXA 2B8TA 4JS0A 4A8JA 2D7DA 1N0WA 1VIYA 2OUKA 4JBWA 4D6PA 3AVTA 2GVZC 2VLIA 2XZPA 1KK1A 3WMGA 2A5YB 2OFXA 3L0PA 2RGAA 1A2KC 2EW1A 4NL4H 4G5SA 5FBRB 3TBKA 3QPVA 4WBSA 4OQMA 2EU8A 3PFIA 2ZXUA 2JLYA 4NPHA 1ZINA 2P3SA 3NHAA 3ZIAD 4DLYA 2PT7A 3TW4A 1VG1A 3CH4B 1R8SA 1S96A 1Q3TA 2YC2C 2F1IA 2AN9A 4EPWA 1AS0A 4MRPA 1S9DA 3X1XA 4OI2A 4JLNA 5CB6A 1CJUC 1N6PA 2E87A 4TLAA 1VHLA 1VDZA 2JJ2A 1E2PA 5G41A 4LJ7A 3SHFA 4TL7A 2OFOA 3QUSA 3AGQA 5DHFA 4XVRA 2XJ9A 2ZJ8A 1A4RA 5JSZB 3D7MA 2O8DB 2XTZA 2WWWA 4JIMA 1ZM7A 2GXQA 2YZ2A 2YYZA 1JPJA 3HWSA 2O0HA 3OIUA 5JCZA 4BQSA 1P7CA 2FNAA 2KBFA 1OIVA 4OJKA 1Z0IA 4ACAA 1E96A 1U9IA 5KSZA 3CZQA 3QQ5A 4HLUC 4E03A 3KJHA 2DHRA 2ZITA 3BFKA 4BZXA 4IRUB 2FEOA 1OFIA 2WSSD 1VHTA 3OESA 4R9UC 3W6OA 1F2TA 2RGNA 1F2UB 2ZJBA 4KFSA 4E09A 5JJIA 1W7AA 1D2EA 2WBLC 1OH5A 4XD7A 4A6PA 3F5FA 4KBGA 1JI0A 5L3QB 1ELOA 3CO5A 3A6PC 2PX3A 4GRAA 2JLQA 2PZGA 4GFDA 3U7FB 4EQ6B 1GL9B 3RAPR 4C0QC 2Z0MA 3EC1A 1Z0DA 2XOKA 2EYQA 1N5IA 1UFQA 1DG1G 2N42A 4IOMA 3K70B 3TUJC 4HB0A 3V4RA 4Q7MB 2DWOA 3LLUA 3KQKA 2ZRIA 4Q4AB 1KK2A 4NDZA 1C4OA 2AL7A 4TT3D 4H1UA 1OB2A 1E2MA 5SZJA 1JB1A 4C2UA 2IXGA 5DISB 3TSOA 1Z63A 5DN6D 3HYRA 1WDTA 3UMRA 3SU8A 2J0UA 2R6CA 1OXXK 2Q21A 3W6NA 2ERXA 4Y0VA 2ZR0A 3A1UA 4DVGA 3S1AA 1RRFA 4ZV4A 5H8WA 3FYHA 1U8AA 4QBHA 2KI5A 1P72A 3RDPA 1U0LA 5GJBA 2O8FB 3GLHE 4OBEA 3OEHD 2IUSA 4BFXA 2OCPA 5FPHA 3SNHA 1YR6A 3BH6A 4QGFA 2W58A 4Q4LA 1W46A 821PA 3SYLA 1N5KA 2GZDA 3LXXA 4G01B 4UJ3A 1SQ5A 1OJLA 2EQBA 5CJPA 1SKQA 2ZE7A 2ZYVX 3WRYC 4FN5A 3I3SR 1QHHB 4PC6A 2DFNA 3ADBA 4C4PA 1UBCA 4R71A 2FPKA 221PA 2OV2A 3JVVA 3NKVA 2FGKA 4W7SA 1P73A 1DG3A 2I4IA 2WJYA 2ZJ2A 3Q3JB 5CDFA 1G17A 3N2EA 5HCNA 3BB4A 2KWIA 4BWYA 3IBYA 2AKYA 2ZAMA 3UKDA 2EWVA 3UANA 1DELA 1Q1BA 1N6KA 4XWAA 1UPTA 1XU4A 1ZU5A 2AD5A 3U3MA 4BRWA 4YMVA 3KXIA 2J7PA 2DWPA 3T34A 4A0GA 2ZRHA 2ORWA 4BLPA 3FHTA 1T9HA 2BM1A 2XSZA 1EG7A 3TLXA 2J59A 2ORIA 4MGKR 3ND8A 1G41A 1G3RA 1QHIA 1YU9A 4M8NE 3TUIC 1ZRHA 4LYFA 1Y63A 2BVNA 2ATVA 1GRNA 4LSGA 3WHKA 1YZGA 3BB3A 4URYR 3TAHA 1P2TA 3ZQ6A 2A30A 2VP4A 1A7JA 1BMFA 4XSGA 4GPTA 2IXEA 5AWFC 2GCOA 3VKWA 2OXRA 1NG1A 1ZD1A 1RFLA 3I8SA 2CCGA 1IY1A 2RGDA 4EPYA 5LBIA 5EP3A 1YZQA 5HPYB 2WJJA 1FQJA 3ZGXA 2MMCA 1VYTA 4QM7A 1O3YA 1NP6A 2F6RA 4JSTA 3SC3A 2BMFA 4BGDA 4IEIA 4O25A 1HV8A 1NN0A 3IO3A 4IXMA 4AWXA 1KI3A 5IT5A 1YHNA 2ODWA 1G3IA 3VR2A 3AF2A 4QM6A 1G20E 1P62B 1G64A 1WF3A 1NIPA 2CHGA 3LY5A 3PUXA 2VSOA 1R0WA 3B1VA 2A3RA 3IDQA 3LNCA 1ODFA 4JL6A 4C7OA 4M1KA 4CYMA 1U0HC 2W2TA 2DWQA 4WZ6A 1E2JA 2Q3MA 3CRVA 4QG7A 2YKGA 3KJIA 1TNDA 4BLSA 1S1MA 3TKLA 5C4MA 3QVUA 1NJFA 1CXZA 5FPYA 4CVNA 1GDDA 3I32A 3TAUA 2A2ZA 1CBUA 4IVRA 1DE0A 4D81A 1RE0A 2IC5A 4A4DA 3Q5EA 4DLWA 5J4HA 2ANBA 4B6FA 2IYWA 2AK2A 2WPDA 3CKLA 3DM9B 3MJRA 4XVQA 3DMDA 4M9XA 3B9PA 2ZIAA 3KUCA 1ZU4A 3AVXA 3T12A 4MA4A 4NKRA 4Q4JB 4RY2A 2ZI3A 3A1SA 2FN4A 1G5TA 1NSTA 2ZS9A 2GXSA 2BMDA 2HCJB 3CX7A 1YRAA 3D6TB 3LA6A 4G1UC 4A2PA 2P6NA 3FFAA 2QN6A 4TLDA 3EW9A 4QNRA 4GDFA 3T1OA 2ZJZA 3AVOA 3C7KA 2WOOA 3GLFA 2CVHA 1DTSA 2GJ9A 1M6NA 2P6UA 1DO0A 4LK2A 5C18A 4DB2A 5JEEA 2PCLA 3QVVA 1E0JA 4TMXA 1XCMA 1N6RA 5FOTA 2J87A 4EJSC 2ZJ5A 2W6ID 3UG6A 1OYWA 1T3HA 2JIZA 1TEVA 1P2VA 1QHXA 3CX8A 2ZRLA 1TL7C 5DH9A 1J90A 2NPIA 3UXMA 1RRCA 3W5IA 1NN3A 4GNKA 4XWOA 1HTWA 2J41A 4GOXA 4PZZA 1M1YE 2ZJAA 1VG9B 1RC8A 3DM5A 4UXHA 3LW7A 3IHWA 5B2ZA 2QRZA 3FGNA 2ZSEA 2WKPA 3DDCA 1P61B 4M1SA 2OCYC 5FH9A 1VCNA 4AY2A 4AI6A 2GEDA 1SXJB 3IHLA 2P5SA 3UMSA 2F1RA 3LLMA 3A4MA 3BGWA 1XF9A 2JDIA 3BWDD 1T3SA 3RRZA 4DSNA 1RKBA 3U60B 4HLUA 1HUQA 3VU9A 3NBXX 4ZKDA 1NMYA 3BOSA 2B21A 2REXB 4HSEA 2CL6X 3U4QA 2WJGA 1JXOA 4RD1A 3FMIA 5B58C 3FDIA 5KTYA 1UAAA 2GKSA 3GLHA 3D3QA 4FCWA 4Q1CA 2XXAA 3SN6A 2NG1A 2XITA 1OFTA 4P3YA 5EUQB 3WP1B 5FTNA 2R8RA 1E94E 3E1SA 3GJ4A 3V9PA 4MKIA 4V0NA 1E1QA 4HAZA 1Q1EA 1MO3A 2WMOB 1DAEA 5CIQA 5KYKA 2CVFA 3LAWA 4K46A 5LB2A 2J1LA 1SXJE 1CRQA 2QENA 2ZE5A 2OAP1 4I1SA 3EIQA 3QXHA 1M7BA 5DI3A 3VR6A 2Q3HA 1EGAA 2OEPA 5E95A 4TL6A 2NIPA 1W5TA 2VH5R 1OHHA 1WXQA 4Q1EA 4XTRA 3REGA 3K0AA 4LJ8A 2VBCA 1XEFA 2PH1A 2KJQA 2NOAA 2MSDB 1R5OA 1KK0A
chains in the Genus database with same CATH superfamily
4KYIB 5A5GA 2P67A 3PTAA 4O1HA 2RHTA 4B6QA 1A71A 2DPHA 3U62A 3UH1A 3GLFE 1FFAA 4TWBA 1V26A 2AVDA 2JIDA 3U7RA 1FX1A 1YQXA 1JIKA 4TQGA 2NTEA 5F2EA 1XD2B 3LDAA 1W581 4QFBA 4IDAA 3U16A 3ED1A 1TCCA 1VG0B 4G2NA 4MVCA 1PZHA 1YR9A 3CZAA 1SVOA 5A9TA 2CNKA 4IJWA 1IDOA 1MR3F 4AF8A 4RAOA 4WNIA 1JI3A 4OJYA 4GGPA 4LRTB 3O90A 1B42A 5IEBA 3GCXA 3YASA 1GAQA 3EDYA 4Y9TA 4AZWA 2I6SA 3USES 4OKIA 1N8KA 3FKQA 3T0FA 2B1GA 1RHJA 4BGUA 2HL6A 1U5BB 2H63A 3G0OA 3OOHA 5BQ5A 3KYCB 4OHPA 4NABA 4RFSB 1Z12A 1SBYA 3PNPA 5EIOA 4LJ9A 1D2GA 4GPBA 1YKGA 1E1RA 3SJ7A 3ANMA 5B4TA 5C7OO 1SU6A 4TOIA 4JOSA 1KMHB 1KYZA 2KHZA 2JAXA 4I9HA 2I2DA 1E3DA 4JFRA 1SVLA 3CVXA 4A8JC 1JDUA 3EQ7A 1HNXB 4FBLA 2P3OA 3FOZA 1QHYA 4BMZA 1DQSA 2GK4A 1OV4A 2P4EA 2IH5A 3HADA 4EKIA 4IRXA 1Q2UA 5K8JB 5K8IA 5FA5A 1HPLA 1NXQA 3DZHA 3HI6A 1EINA 1P3JA 1TT5B 2BDUA 1L4FA 1R27A 2CL0X 1EFRA 3ABZA 3BCSA 4PNHA 3RREA 1I7SB 1SM4A 4FE3A 4QQKA 1P0FA 4N5LA 4K05A 6NULA 1KH3A 1F14A 5EZQA 4JJKA 1NI5A 2J9ZB 2FY8A 3HFSA 3L0OA 1VCHA 3ZH2A 3PJEA 4GOKA 1SD5A 1OI2A 2EX4A 1OPXA 2Q1XA 3IIMA 4QHTA 1TK3A 3E9DA 4DJ5X 3WYNA 1HBJA 1PKXA 4JGGA 1OYVA 1M9NA 2FUG1 3ELUA 4GXQA 4RANA 4DYDA 4P80A 1JA9A 2RKOA 1DMSA 5HUJA 3WGMA 2HLDD 3ZCRA 1UQTA 4C06A 4E5MA 3JZDA 2D0IA 3B1YA 4X92A 4CV1A 3UMJA 3NV9A 2QTLA 1C30A 2NZUG 3B9BA 3F67A 4F04A 4ZYXA 1CHDA 5ALRA 3FB4A 3MBIA 2IF0A 3BM5A 2VI5A 2YIMA 3K94A 4TZ0A 1II8A 3KEMA 2QS9A 4QVKA 3K0BA 4JT2A 2QMOA 4TXNA 1DS6A 2JKZA 2BISA 4Y2QA 2H1SA 3SZOA 3W2GA 1PG0A 3RJ5A 4ZFNA 1R0XA 2Z95A 1M1NA 1R2QA 3DOCA 5AVOA 3PZBA 4YJGA 1MJFA 2R8EA 2OBLA 3KR0A 4RK6A 3U37A 2PY6A 1A5AB 2YS6A 3L9WA 5COAA 1T15A 5D3KA 1CW2B 1DKQA 1ZNZA 2VT7A 4Q3CA 5E0OA 1FTWA 2DCUA 5HOEA 2I7DA 3OF5A 1AC5A 4C4TA 4HRYA 4CMKA 3U9TA 4W5NA 1MT0A 2DY1A 2HU8A 3E9ZA 2BYTA 1MN6A 3GWGA 3LQYA 4TX1A 2AFIA 1XA3A 4L5BA 3HC7A 1BJRE 4P5DA 5HIKA 1Y8RA 3RPEA 1Q0UA 3BGIA 3D6HA 2ZUFA 2PZEA 4R2IA 3WXBA 2R6JA 2A58A 2A5LA 4ZYZA 5K6AC 1W2HA 4MKZA 5A6SA 5HKAA 1TCUA 1LEHA 1NV9A 3KZMA 3OICA 4PRYA 3SS8A 2PLNA 4G0UA 1RRKA 2QMQA 1BCRB 1PW5A 1NQXA 3D2AA 3HPQA 4RD2A 4UE6A 3RIHA 4OU4A 3ZYZA 2H17A 4EGJA 1NQ5A 1GPAA 3NVAA 1FX0B 3DAGA 2PS1A 4OP3A 5HYVA 5IS2A 2Z6QA 4B0PA 4AJKA 1KMIY 4KQCA 3R1IA 3OOJA 5KAPA 3U7GA 4CV2A 1O0BA 3U3RA 2VYCA 4A2QA 1Z38A 4JHLA 2EGGA 4GSKA 4L7VA 1X2EA 3OX4A 4GGMX 2H1WA 1R66A 4DNFA 1BU8A 2QJRA 2R66A 5BSVA 5LM3A 2ZJYA 1IJKA 2QUKA 3BFPA 2OGWA 2HNAA 1IWOA 1KYTA 1VHWA 2IYUA 3V8RA 3ZU5A 1K89A 3A9WA 1L4BA 1O94D 3EVNA 4MIKA 4RV4A 2UVDA 1OWPA 2ROQA 3I09A 1RAHA 1N75A 1OY1A 4EI8A 1ZD9A 5FLYA 1VGRA 2O20A 2Z2ZA 3LWDA 1N6HA 5EPUA 4C3VA 3U81A 1ITZA 2F43A 4NECA 4PPYA 3ZZ1A 5A06A 5FX2A 2W7TA 2FKAA 2ZVJA 4M7WA 5I7WA 4UCQA 1X7XA 1HE1C 1LBEA 1C9KA 1T3ZA 2AOWA 2B35A 3OX1A 4OM7A 4QBGB 4JVSB 1BCSB 1FUEA 2JFYA 2N1BA 2A14A 2YASA 3OEED 1YCGA 3PXUA 4FGUA 4GZMA 4ZQCB 4LF8B 3LX8A 2WUFA 1JPUA 1GSAA 3GG2A 4LDRA 3FM9A 1ZCFA 2ZB4A 1RQXA 3OG9A 4E2WA 4BEVA 1IUPA 5HIMA 4LI3X 2IBMA 1RZRD 1YZUA 2QY6A 1JE0A 4TMFA 4OK5A 3V3TA 2XRYA 4Z3DA 1DHRA 2AZTA 4G1MB 2EFJA 1XDDA 2WZDA 4HDKA 4QDJA 5EJEA 5IZ4A 3BYZA 4YHBA 5LQAA 2QGZA 4WFJA 1W8DA 2XWPA 4E13A 2JEYA 1BVHA 1YVRA 2FWRA 1CJKC 4BMCA 3AF4A 2RAVA 1YO6A 4YJHA 1JGTA 3IDFA 5TPWB 1USUA 2VH1A 3EJ6A 5J9FA 1KF0A 3SYTA 4G0VA 5E3HA 1LBIA 3TNLA 3EEOA 3BT7A 1HDGO 4X0EA 4TMWA 4M6WB 4CM4B 3D2LA 3UWMA 4HDSB 1A1SA 1VIDA 1X1SA 1M34E 1T1RA 4I55F 2VJMB 3IPXA 4HUQB 4KX3A 1QCYA 1O57A 4BFUA 3MJFA 1CJCA 3VVLA 4C4ZA 3KKPA 2VF8A 2QLTA 2XUQA 3FZQA 1AHHA 2H59A 1I0LA 4HY3A 4RVFA 3ZKAA 4BB6A 1M73E 2UUPA 1BG6A 4OQNA 2Y76A 3RBVA 1SZDA 3GLQA 5EIHA 3K8OE 1UOOA 1VKRA 4IQ0A 4XM1A 4LYYA 3PSHA 4AP6A 4MIEA 5EWJB 3CLUD 1MJGM 2NYVA 4RJLA 4RHYA 4WBNF 1EE1A 1EEXB 4QUEA 1G16A 3OWXA 4OX9B 3RTCA 1G6HA 3AOGA 5CEEA 5F9MA 4ZDKA 3P9QA 1C29B 1QR6A 4CL3A 1PQ4A 3OEYA 3TMKA 2RGYA 4J3NA 5TIIA 4M1TA 4NDNE 1F4LA 3MS7A 3OZIA 5FO1A 3UUGA 1JNYA 4KPGA 3B6MA 1D7AA 4FKZA 1W29A 1HURA 3WXMA 2MOKA 2ZROA 1HT1E 4TL9A 4AT1A 1AU9A 3BS4A 4Y98A 2ODNA 3K1YA 2IZ7A 5KVSA 2PMBA 4EEXA 4GR4A 4CV0A 2GZSA 2WRZA 3OJFA 4HDQB 1J6UA 1RU3A 4GMHA 4ZAZA 3WIOA 4B3GA 1OLOA 1U7UA 1TVCA 4V2UA 1PJ8A 2G1KA 2P30A 2D06A 4YYZA 1I2DA 5LXTB 5DNCA 4GR5A 2PMWB 2W2VA 2XB4A 3GA5A 5H68A 1DAGA 1IBMB 1GCOA 4QTTB 1X9IA 3SC2A 1UBLS 4MRRA 3VZRA 2WSMA 4F6RA 4MUHA 5GOTA 5BV7A 1Z0ZA 1PEKE 3ESBA 2G7MC 3RM3A 1NJGA 1FBTA 2HFJA 1EXMA 4GQAA 3BF7A 2AKAB 4JH0A 1O5IA 4NYJQ 1UAYA 5JVDA 2HREA 3EXHA 4FVTA 4G0XA 4KUGA 3KOMA 5JDIC 1C1DB 2EEZA 4ZXPA 4GVXA 2VJCA 1G4AE 1XMSA 2R1TB 2HU5A 1DHTA 3PUIA 4BU1A 3K2BA 5CEJA 1GT6A 3KT3A 4DPMA 1BQEA 1ZR2A 3TL3A 3ZQUA 2BLLA 2EFHB 2B1JA 3DP9A 4IBOA 4QUAA 3UKJA 3WMEA 2EJTA 1NUSA 1D1SA 1V95A 1NSYA 3ZZMA 4E1AA 3H7IA 5DNEA 2PQ6A 2KW5A 3N2ZB 3CRMA 1I0ZA 1CUWA 3HRIA 3C3WA 4YMLA 3HE3A 4CL0A 4TMZA 2BF4A 3SY8A 1EZ1A 1V9LA 4IUDS 1GV1A 1ZKMA 2DFKB 2HJWA 3MWGA 3PCXA 4NE9A 4DMGA 5CFQA 2FETA 2XMSA 3EBOA 3M4XA 5IHXA 1KMQA 4IL5A 2C9YA 1J8DA 4CDRA 1YS2X 2O3UA 1ICIA 2WTUA 2GVDC 1T5BA 2CLEB 5I7VA 4EUHA 4A16A 3SDBA 1UK8A 1HH4A 3EGWA 2HXGA 4HDMA 3LHFA 1JJBA 2Q4BA 2R8OA 4LYDA 4RQTA 1VPDA 1N92A 1V8ZA 2A94A 3SHTA 2GZAA 2PU7A 2XQIA 1IJEA 4WVFA 1YCFA 4KIUA 3TD6A 3GXBA 4BBPA 5CDSA 3VNVA 2QJOA 3GAAA 2JD1A 1Y0BA 2C9ZA 3G89A 1MH1A 3QENA 3BL5A 1EUCA 1SQFA 1XMOB 2OGZA 5HP4A 2DU8A 4L28A 3GZTB 5KYYB 1Z4PX 2QPAA 4FB5A 2AUNA 5A2QA 2YHUA 1OVGA 4EECA 1REQA 4QYWA 3BXOA 1VJTA 1CDEA 2G0TA 3LY7A 4J4TA 4XVCA 3DCNA 2CLMB 4GWGA 2GF2A 3U7IA 1WW8A 1CULC 1GOTA 4EF4A 1SUFA 4HPJB 3U0VA 1KEEB 4N0DA 4D80A 5FOQA 3UJ3X 5GOZA 4AN0A 1U3UA 2WAAA 4XASA 5J47A 5JYDA 4K9MA 4E46A 4JIGA 1NM5A 3G2NA 2C2HA 4G8JA 1UC8A 1TA4A 2PZLA 2X5NA 1ZL0A 1J20A 3EGCA 5JQGB 4C21A 4UDOA 2PLRA 2AN1A 3BD6A 2IV2X 3CJQA 4QTUB 3QLUA 4HAOA 4W7IA 3ZNOA 4IFEA 5ELMA 1GGJA 1UOEA 3ZD7A 4D46A 4KQIA 1N5RA 4R81A 4BB0A 3ZNQA 3UMYA 3OC0A 4E4YA 5DLQC 2GN8A 3NHYA 4JMPA 1GM5A 2QY9A 1N2XA 3L46A 3Q2IA 2V6GA 5H3LA 2G6TA 1CUXA 2GJAA 4UULA 5KJEA 3LPAA 5LCXA 4OGGA 5A2GA 1DAHA 3HNRA 1CJVC 4MQFB 1Y1PA 5FT9A 1O95A 1ZOLA 5HJ2A 3ZD8A 1SXJD 3JVDA 1XK6A 2J3DA 5IXSA 7MDHA 2QI9C 3FA2A 2OQ2A 3JWEA 5F7ZA 1VSBA 2EEPA 1BD3A 2WWVD 2IK8A 3AZOA 4OH1A 4WGGA 4EZIA 1C3XA 1KFJB 4KJXA 1ZOPA 5IJ9A 1IBSA 3R0XA 1IZZA 3L8GA 4EL0A 3JS5A 1WX1A 1X9HA 2GASA 3RVBA 1UEIA 421PA 5KOIA 2GTPA 3G0IA 3R5KA 1NMQA 4L8LA 1NZDA 1SELA 3UYKA 5JCOC 4N3NA 4ZVQA 4DA0A 2HMYB 1DDOA 2GR9A 4FE7A 2J9XB 4UNQA 5EE5B 3UQZA 1C0PA 4HWKA 1K3UB 1RWVA 1L3IA 2IXBA 4ETIA 2V0GA 1H3EA 4MI9A 4YFYA 2PUDA 3W4IA 5ENZA 1GCUA 2VHQA 4LE0A 1MABB 4EVSA 1KR5A 3NS7A 2QUHA 3C6QA 721PA 3VYSB 1IATA 3DLHA 2H00A 3DR5A 3IUJA 4AC9A 3RV3A 2BGUA 3PQCA 5D00A 1QDEA 4HDCA 4ZN6A 3F2IA 2XLCA 1L5VA 2D0PB 3EVZA 3A8TA 4RKFA 4F4DA 3GJXC 3WK7A 3MMNA 2C95A 3GH1A 2BIFA 1GKYA 2PUCA 3H2JA 1IXRC 4R40A 4DJJA 4LNUB 5BW8A 3LH5A 4OQZA 5DSXA 5JROA 4GXRA 4V0MA 3BFXA 1ZK2A 3O6VA 2OXTA 3AZQA 4CR6A 4JNKA 1FSGA 1WU8A 1CJMA 3CPHA 1TGYA 1VE6A 1ML3A 4M99A 2CUZA 3DD5A 4MZXA 4OOFA 2VS1A 3W77A 2DBQA 3SSOA 4AQDA 2DKFA 3CONA 1GGHA 1LDGA 3FSJX 2WICA 4HX2A 2RGWA 3U26A 1ZN9A 3L8CA 3RRFA 5B2FA 2RHGB 1ADYA 5U4QA 5KNCA 2AJLI 5A05A 3CKYA 4CUZA 3K31A 4OXYA 3LLSA 2GK6A 5CD1A 1PDVA 2GJKA 5KSYA 2VP0A 3NH6A 2ET6A 1QYVA 3BMCB 2OOSA 3PNMA 4XIIA 3LT0A 3M5PA 1J2RA 3IILA 1NN5A 1P18A 3VO8A 3SQDA 1QZ3A 4YQEA 4JVNA 3SEZA 4H6PA 3SQXA 1XVTA 2CVPA 3Q6MA 1H2WA 1I3NA 3CVYA 4KWTA 3V8EA 4J07A 4X7MA 4F4CA 3C8HA 3H8JA 4MQEA 4D4KA 4DWVA 1NVMB 4MUGA 2O8BB 1COWA 4BIIA 1AHNA 3N6XA 4D79A 2PZKA 4Z53A 4AKSA 1RYFA 4W8OA 1RJ9B 4C14A 4QC2A 1GKIA 3IVCA 2YWCA 3RYCA 1AKEA 2AD1A 5JFTA 3FUCA 1EK0A 2FR1A 4CZ2A 4B3BA 2ZI5A 3EBLA 3I83A 1MJNA 1K6MA 1NVWQ 4JQOA 3VPGA 3UFBA 2FSUA 2QDKA 3FN4A 3K09A 5DYNA 3FFXA 3ZTWA 3LVRE 4DLRA 3EDQA 4PX9A 2BMEA 3NTRA 5CT5A 2ZXFA 1IJFA 2W2KB 1Q14A 4B3JA 2Y1LA 2WKWA 3KKEA 4M37A 3H5VA 2G9QA 1ZVVA 2J46A 1FFGA 3KJFA 2HBQA 4ZAFA 4KR2A 2MINB 4YJFA 5JSKA 3VV3A 1F48A 4UHBA 1F51E 3JQBA 2ZCJA 5HUHA 4MB0A 5EZ5A 3L9XA 4CL2A 2QTBA 5E4TA 1TTTA 1E2EA 1XVVA 1N6NA 1GCGA 2WVGA 1HORA 4Q93A 1I14A 3L6BA 4DRXA 2LR0A 4MW6A 4BBAA 4TGLA 4F2HA 3HQ4O 2PX2A 3DB1A 4OI1A 3CEPB 4V24A 2NU7B 3JPWA 4QL3A 4B3FX 4ALKA 2ASEA 3DZDA 3PQ6A 1WPXA 1BXZA 3BORA 2XECA 5BN4A 2M1XA 1PR9A 2ZYWX 3EQZA 1UANA 3V8BA 1VCIA 1U8YA 2Q5QA 1EXDA 2GXUA 4IDOA 4ARVA 4HLDA 3B8EA 3ZJVA 2BFBA 1Q6YA 3A1FA 4RSGA 2L69A 2A9PA 3MWYW 4H3VA 5L6LB 3CLRD 1NL3A 4O0LA 5C34B 3LKZA 1YGPA 3T41A 3R7DA 1TLLA 2GPWA 1U1CA 3QVOA 4TKLA 2EC5A 3NI2A 3VBEA 3KU4A 1OPRA 1QGAA 3Q8XB 2IPOA 3DUWA 2PUAA 3SICE 2FRDC 1MXHA 1XP8A 3H3XA 3FPEA 3CSUA 1K27A 3NRCA 3QLTA 4H7FA 3CWCA 5EIBD 3C4JA 3ZWPA 5JI3E 1RI2A 1JHRA 1T8PA 3T5MA 2Z04A 3UJ8A 4LJ4A 3DV0A 4Q12A 1EWQA 3FSRA 4WQMA 2WF6A 3BQMB 2G77B 1QVRA 1PS8A 2XNDA 2IELA 3OTQA 5IAJA 5J1SB 2YOFA 3GQBA 5L8VA 2H5LA 4LWZA 4N0PA 1DQRA 2R1UA 2O8DA 1PTKA 3ER6A 2NSJA 3DE2X 3PIDA 2FDXA 2DX7A 2WYVA 3GLSA 3IESA 3II6X 5FTJA 4YPFA 2X2PA 1NVUQ 3NYQA 3HDYA 1GRRA 1B7GO 1LGYA 5TQ0B 3ANYB 3G1TA 4POAA 1DO2A 1RAGA 4Q6WA 5IWAB 1I9GA 3V1UA 3C8MA 5DBHX 2X23A 3R7FA 1C1XA 5ERXA 1LNQA 1M8JA 5J2UF 1YJCA 1KYIA 1IN7A 2V8BA 3VKHA 1CQPA 4GE0A 1BDMA 1CUCA 2C2XA 2MJLA 1Z5UA 4MVJA 3PNOA 1T5SA 4XD7D 1T2CA 3QXCA 4E6PA 3QLEA 3ZK9A 2WTBA 4JLOA 3DFKA 3ZVKA 1R10A 2YV2A 1LQTA 3BL8A 3W34A 5LPNA 5IKOA 2ZRAA 5KMGB 3EA4A 1O1YA 5GIOE 1CRLA 2P5YA 3VX4A 4CF3A 1NDQA 3QELB 1VPTA 3ADOA 1JYSA 2O54A 4OU5A 2XGOA 3KT8A 4BRSA 3B12A 1BHJA 2NSHA 1XNHA 1KXJA 1E9SA 1YH3A 3FMOB 3GUCA 2V7WA 3KBOA 4LC0A 4F3KA 1LVHA 4OV6B 4Q7EA 4FI3F 4YP0A 4YAEA 5BQFA 4QQRA 5FOWA 4URVR 2ACWA 2ECQA 3UT6A 1KYWA 4RA6A 1RI5A 5B7NA 5FTKA 4NK5A 4HVTA 5CXSA 2EP8A 2TS1A 4DF3A 1Q7CA 1GPLA 4JBHA 3DHWC 3BMNA 1SUEA 3ZU3A 2X22A 3FHJA 1PK9A 4FZ3A 3IEIA 1BH2A 2AGVA 5K4GA 3P2IA 4EPXA 2GJ8A 5DCWA 1E3SA 1PT6A 1SXQA 1QVWA 1GTG1 1XRPA 1FVFA 1IN8A 2YZNA 1LFDB 5E9AA 4PHCA 4DA8A 5LYJF 2O8FA 5F76A 1NQAO 3LUFA 3ESXA 4OLHA 1WXGA 2MMGA 4IHJF 3KDAA 4RXMA 2EV9A 3LU1A 1OFUX 4H0NA 4Z54A 3BQ9A 4GMKA 1JDTA 4F9EA 1RWXA 1CE8B 1XALA 1V4VA 3PXGA 4ZDIA 1AUOA 4BNFA 5IULC 1GITA 1K98A 1YZNA 1KZ7B 1XJ0A 4P32A 2RBKA 2ANCA 4DG8A 3A9RA 4TKVA 2WSIA 5CLLA 3JAKB 1E2QA 3DOEA 3KS9A 3KYJB 1XNRB 3COZA 1U31A 1JHZA 2EGHA 2QA5A 1N9GA 2YIDA 1Z6YA 3IMFA 3F9IA 4UNNA 2HGZA 5CIYA 1L4YA 3UFXA 4QA9A 3GMSA 1M76A 3AFMA 1KSFX 1LLFA 2IW1A 3G82C 3KAJA 4GX1A 5EZYA 2AW5A 3VH1A 3LBFA 1AB5A 1QV7A 3DE3X 2VN8A 4FFSA 5K0CA 2K4MA 2FPPA 2FU5C 5B36A 1CJTC 2HDHA 2OAGA 2NW6A 4EMSA 1N2CB 1Z4IA 2BM8A 3Q72A 1G8SA 1UMBA 1Q91A 1K5PA 4FFWA 2G04A 1K3TA 3HSYA 4ZODA 3N05A 5G53C 3ROEA 4DJDC 4YRNA 3TLBA 1X87A 1U0EA 3KLMX 5ARBA 5KB3A 2NUAA 4LFCB 1IY8A 3BPSA 4C0AC 3EH2A 4UXIA 1JB9A 5HFNA 3V8QA 5TPZD 1BXKA 3KXPA 4QELA 3KR9A 5TRTA 2FSPA 3I9FA 5DWDA 4YP7A 3E9RA 4YROA 2J9GA 4BWVA 1C7IA 5IAAA 3OFNA 1BMFD 2MWMA 2YFHA 5H70A 3R09A 4PXAA 4R0NA 4N0MA 2VH2A 1OTYA 3HKBA 5LZ8A 3UGTA 3IT0A 1NWHA 4WKCA 1IB0A 4OSEA 1FP7A 5KC8A 1JHQA 4X1YB 3BEDA 1ZCZA 3ND7A 4AKTA 2ID8A 3ML1A 1GWNA 5JSHA 1BQ3A 3DJYA 1SKAA 1U0JA 2NU6A 3BXFA 3HNOA 3PHCA 4G23A 1I30A 2W2LD 1W4RA 1TQ8A 2F8LA 3FYUC 1RPTA 4A8JB 4L4SA 2PNJA 3FTPA 1YDMA 4V0KA 1Z83A 1F6DA 5HF6A 1XTJA 4DVJA 5EJ6A 5JMWA 1X7ZB 1Y9JA 4JP8A 3HP1A 3W1EA 1EVZA 3VR2D 3GDWA 4FDUA 4PQRA 3LF2A 5KC9A 1I7QB 2WWRA 2XB6A 4ASUD 1T5LA 4MW2A 4N9QA 1WCXA 4A7PA 2BGNA 3A2LA 3MSXA 4KYVA 4WZAE 4Q9LA 4R9RA 5FD8A 3X3HA 4NJEB 2Y1DA 3N5KA 2XA1A 1V2GA 2P7HA 3DEZA 1RJDA 5CJJA 3RUHA 1DLIA 4ARBA 4F38A 4B6GA 2Q2NA 4RV9A 4EHDA 3MMPA 1Q7BA 1Q1NA 1ZI8A 1J56A 1VPVA 1KQPA 2WFMA 4BNJA 5BV0A 2XYRA 1IYZA 3DSRA 4JLSA 4J90A 4JYCA 5KJ1A 4CMIA 1NM5C 1A77A 1U3WA 1W4BA 3VJMA 1PAUA 1R4MA 4KW7A 2IA5A 2OLJA 4M22A 4XXHA 2XCOA 4KWHA 3SQOA 2A0FA 3SOZA 1OH6A 3BWCA 4L0DA 4AS3A 4HC4A 3QLUC 4B47A 4G5YA 4H4DA 5B3JA 1T8UA 3CCFA 1FW6A 3B3QA 4YRAA 3IP5A 3J81A 4EF6A 1U2GC 3UUFA 4PG4A 4HNRA 2EFDB 4XUGB 4R3NA 3EY4A 2HD4A 4ND5A 3ZUPA 3SFZA 4BX2A 3O8DA 5LQNA 1U94A 4KXVA 4X6UA 2AWNA 5A6VA 1G21E 5B1YA 5K9ZA 4E2XA 4UUPA 3SKVA 4AZ0B 4Y2HA 2IU6A 3KT0A 3C4VA 1DC3A 1SPXA 3WGJA 4AQYB 1T8WA 3NBYC 4PC3A 5L3VA 1O95C 1WOYA 2OO3A 3HLYA 4QGHA 4DANA 3L2OB 1J7KA 1NQOA 2G08A 4W5JA 2P9BA 1GQOA 2VWHA 1EWTA 2WSSA 4WAUA 1FE8A 3MAAC 4BV3A 1H2RS 1SH7A 1ZA1A 4DN6A 4ZOLB 5MN4A 4K9PA 2W9XA 2VDJA 2O57A 3OZWA 4Q1AA 5KTKA 3I28A 1D7OA 2AXQA 2WK1A 4Q21A 1H2ZA 1A4XA 4Q1FA 4ZIRA 2OFWA 1IN1A 5CBPA 4D3SA 4TLBA 1E3QA 1B73A 1IUKA 1TQ6A 2OYRA 4E0BA 1EK5A 3BZWA 3C5HA 3PUZA 1A50B 3KLOA 1L5HA 3AM5A 5LZ7A 1Z3IX 1KI6B 4N0EA 1QH0A 1T1JA 1KPHA 1YD7A 4TV9A 4IAOA 4BLTA 5MGNA 1ZJ6A 2JIQA 4JI0B 1G5FA 1U9ZA 3A1TA 2F9LA 3VZSA 3IOEA 2B3TA 2R11A 3P94A 1UK7A 3AR9A 5E7IA 3ASZA 2AF3C 1Y5MA 5KREA 4MROA 1DT5A 5JZVA 3NDRA 3EMVA 3X1JA 1LWNA 2I7XA 2JATA 5BNWA 1FMFA 1XNGA 1SFRA 4AQ7A 2B7BA 3RT1A 4PSUA 3D4PA 5FL7A 1PVVA 3LDGA 2V7BA 2DWCA 2FP3A 1ADFA 2FMFA 3NOXA 1KO5A 2HPVA 1YNSA 4TQUS 3U40A 1P5RA 2AJBA 2Y99A 2EZ9A 3RLIA 3VNAA 1G18A 3W4JA 5ITZB 3LPLA 4WNYA 1OIXA 4YMGA 3A9VA 1QF6A 4PZCA 1WPQA 3TGLA 3KTOA 1GDHA 2I6QA 1C81A 5EFOA 2P1ZA 3DR3A 2YIJA 3Q9NA 5LA6B 3EPLA 1KSGA 1KI8A 3LUJA 1K9SA 3U13A 4R51A 1FFXB 3E3MA 4U6NA 1UJ5A 1SHTX 3OU2A 3O5AA 2YJZA 4FDVA 4NOLA 2K2QB 4C5AA 4KMMA 1IH8A 2V6JA 1U9CA 4AM8A 1PK7A 4AUMA 2QRGA 4AX4A 2PBFA 4PYNA 3CUEF 2WF9A 4HNAB 4KO8A 2HTFA 4PX2A 4MA5A 4DLXA 2XR1A 3OCZA 5AO9A 5FORA 2HWWA 3E18A 4P98A 3IAEA 3AOEC 2VYNA 4B33A 4YJ2F 1CS0A 2RCYA 2BFCB 4O4HA 4X1KA 4QDTA 5HE8A 2QNBA 1I1OA 5TLSA 2CLOB 2OSVA 5EEGA 5AVVA 3EEBA 4D02A 4PS0A 3UB4A 1XDGA 3ZWXA 1HY3A 1QIFA 1NBHA 2Q07A 4XE5A 1OMOA 1W4LA 1YS4A 2P65A 4QQNA 1IBKB 1SVIA 5FWXB 1YONA 3BH7A 1FZTA 1F17A 1IBRA 3SS7X 5JSUA 1WF6A 2EBHX 3MT8A 4HR7A 3H86A 4YV0A 3LFHA 4OXRA 1DJQA 1PBTA 4UPDA 5KTOA 4YUYA 3OJEA 3E2MA 2XCIA 3MCZA 2W00A 1KSHA 4KQ1A 2EGUA 4LXTA 3VYTB 5IVKA 4DTCA 5KQLA 3N39C 1CRPA 1X13A 2NO1A 1PT7A 4FGZA 1M5UA 2QP4A 3RU9A 1IQUA 2DSTA 3HVJA 4FR0A 5KQSA 4IV5A 3TW8A 1NJ1A 4AURA 5B7GA 2P2SA 2W90A 4II2A 4R8SA 1GILA 1VP9A 1T29A 3NTVA 2MIIA 5D5PA 3PUVA 2IPXA 1YK0A 1WLSA 3K09C 4G5QA 1EP2B 5JAMA 3PEUA 4MR7A 2VF4X 5L3ZA 1XQ1A 2JLRA 4RLQA 1RXUA 4J91A 1B8PA 2NGRA 4S0ZA 5JH7A 2VTBB 3WWZA 1KZ4A 2ZTVA 2H2DA 4KOAA 3L84A 4MS3A 5DXAA 1NUPA 3CJTA 1WMSA 3RKUA 2HZ7A 3JQBC 3RO7A 3NP7A 3O8RA 3ACBA 5SZKB 3H2GA 2GSWA 2I55A 1Q0ZA 3RS7A 4FD3A 1OW3B 1YJQA 1TC1A 3K35A 4DCTA 4HDRA 4I4CA 4LA4A 2ECFA 3B3JA 2BMWA 4GR9A 3KD2A 4NLLA 3P32A 4ZVLA 1CX9B 4TVKA 4PG7A 1A72A 4J4HA 1S0UA 2PGXA 5I4KA 4DR7B 2SHKA 1QGUB 2D3WA 3DMGA 1R9JA 3DTVD 3LWBA 4QPJC 2H4XA 2YNMA 1E7RA 3TQIA 1TTPB 1JEQA 3BWYA 3DXFA 1NMSA 1FTNA 3OMLA 4M98A 1PWYE 3A06A 3P2MA 1QAQA 3NDPA 1N5DA 1TXGA 2ZM5A 1SHUX 4UARA 4YBZA 4M1ZA 2RB4A 2VBFA 1CP3A 3LCVB 4II7A 2FGJA 3FVTA 3FHLA 1IZ0A 4HDNA 5DGTA 4CM1A 3AP3A 4GSLA 3KALA 2GVNA 1CUYA 4TTRA 4AECA 3SZGA 1AGRA 2C5SA 4Q6BA 4B43A 4R1UA 5G2OA 3K9GA 1Z26A 1Z75A 5CA1A 3P4UA 2FA9A 1W4ZA 1HFJA 2XCLA 3R3YA 1H0HA 1YAHA 2ZPTX 3C4QA 3HJHA 4EI9A 2XX3A 2NM0A 1I6KA 4RGQA 4K6CA 1Q5PA 4FOSA 4AY4A 4NENB 2WINI 1NE7A 1CDDA 2PMEA 2C7RA 2POQX 3IJEB 2Q5HA 4CPDA 2C9BA 3SDSA 3STYA 3GVCA 3SFTA 4WE3A 5KNBD 4BZPA 3UB3A 4R2KA 3LUDA 2E4AA 1SCAA 3FVQA 3HA7A 2PK3A 1EUQA 2EJBA 5FPTA 1KH2A 3NHZA 3RGWS 4PGAA 3QOYA 4W9NC 4HNSA 4XPIB 3L4KA 2GBLA 4EARA 5E1OA 5FIUA 2GRAA 4WESB 1XL0A 1DZ3A 3AIOA 3I01A 3O0TA 1WDMA 1O8CA 5CMLA 4G8DA 3V4LA 4JOQA 3KNZA 4NYMQ 4G1FA 2GILA 1DKOA 1BSVA 1JG2A 3QU9A 4ZRMA 3E5HA 5F1KA 1E0SA 2CEKA 1BW9B 3JYOA 3WLQA 3HKEB 1ZIDA 1E3JA 4E30A 2BMVA 3K6JA 3QX7A 4OOEA 3E9CA 3WO1A 1F2VA 5TQJA 1CRWG 2B3DA 3W78A 4GI1A 5JAIA 3CF0A 3EG5A 3WX0A 1B93A 2H2WA 4ARZA 4LJKA 3MWJA 2VK2A 3DWFA 2Q2WA 3M4JA 4DYVA 4Z1MA 3ZWNA 1V41E 4O4LB 3I6YA 3NBQA 1X3LA 3PV0A 1ONBA 2AOXA 4MEAA 4NBUA 1KVSA 4ZAYA 1NR5A 3N2LA 3RABA 1GYPA 3RWMB 5IBCA 1AQ6A 1CUFA 2C5FA 1JG6A 2QU8A 3JTMA 3QBVA 2DM6A 2BEVB 3C7TA 3K9BA 4PGMA 3ZE9A 3BGVA 3OA0A 1LVGA 1JR3D 5EE3A 1NF8A 2D2EA 2Y0DA 3V80A 1W48A 2XTNA 1POXA 2I33A 3I34X 3JAWB 3MPOA 4LBZA 1JQJC 4UVEA 5T41A 3TQSA 1C5KA 1TMOA 3GRVA 2XEXA 3LW8A 5C5CA 3GLHB 4PBSA 2ZIXA 2P2GA 2K6GA 3LCMA 4GYKA 4RZUA 2ODTX 2X58A 3TEJA 3BFJA 1KDYA 4OFXA 1L0BA 5BRNA 1Y3HA 4LHSA 2GAAA 1PDWA 1MQSA 3BCHA 3GHYA 3HCWA 4I6EA 2UAGA 4AU1A 2SKEA 4R4JA 2BFFA 4BGVA 2JK0A 2X0NA 3ST7A 5FBWB 1UH5A 1JRLA 5IT9A 1PJAA 2IHNA 3WK5A 4ZVVA 1C9NA 1CEQA 2XB9A 1P5FA 5FPSA 4G85A 4U2BA 1NG9A 1O54A 4ZZ0A 2JFXA 1Z29A 4LXGA 2YZKA 4WY2A 4CL8A 3KDSE 1ODJA 1H5NA 1Y3DE 3H1TA 3NORA 4TUYB 2QK4A 1RLOA 4TZTA 3TLJA 3ILSA 3KZKA 2GD6A 3G8CA 3LF1A 5JWHA 4MPPA 5TDHA 3WNQA 4NPAA 2CNBA 3CH5A 4QIHA 4ADSG 2O6LA 3K0AB 1QIEA 3FWHA 3I6MA 4DAOA 4F5WA 2ZJOA 1P4GA 2V7UA 4UQOA 3QE0A 4NAUA 3HXKA 1MTOA 3C5WP 1FS4A 4URZR 1VKJA 1ZKDA 2IV7A 2ZYHA 2BFEA 1NU6A 1ZRMA 3EPPA 3HA5A 2AEEA 1FTQA 3ONNA 3R23A 4FYHA 3PC6A 1RYZA 3MOSA 3OKFA 2ZANA 4HUJA 3PUKA 1AN0A 1XQWA 1KNQA 4CCYA 3JD2A 2D0DA 2NNLD 3GMIA 5HDQA 5DYTA 4AS1A 1K4KA 4N48A 2ZE8A 4HAXA 2WUWE 1UC9A 4F9FA 1PF7E 3ONWA 5JYBA 5D3ZA 2GM3A 3PRKE 3FGZA 4PFSA 1E9CA 1ZM2A 3OH8A 1K7XB 3CUVA 3O92A 1XTSA 3H65A 4N6GA 1WA5A 1H3NA 2C98A 4MS1A 1F3LA 4LBVA 5LLSA 1E3TA 1TADA 1FSPA 2O07A 2PA0A 2Z1NA 3KV1A 1MZPA 2REOA 3GFGA 4RIEA 2YWRA 3E3AA 2G6BA 4C4YA 2OV6A 2D59A 2NXNA 1U4OA 2VWPA 2NQ2C 2Q8NA 3IPLA 3UUWA 1N57A 1XLTA 4B4VA 1D1TA 3P9PA 1SMKA 2CXQA 3ZNPA 1XYGA 4MGIR 4MCHA 4I0WB 3FCCA 4X9XA 4BFCA 2BFAA 4JLAA 4HHEA 4HWOA 1L4LA 1HA3A 2EARA 1Y82A 3W5HA 2G9NA 4YV1A 1T4CA 3AV3A 3F1KA 4RPIA 4B8WA 1WXFA 2QR5A 5HJ7A 1W5BA 1BGVA 4Z4IA 3OJXA 4ZK2A 3T9CA 2CLKB 1DCTA 2QUAA 1NBAA 1V16A 2JANA 2FZ4A 2B83A 4WI1A 3L4EA 2XTMA 4ZVNA 4B45A 5FTMA 3S2IA 2O8EA 3L6UA 2EWWA 4Q03A 1H66A 4RUKA 3A37A 2HFKA 4BUZA 3ZLTA 3OCJA 4NBLA 4OQXA 1HGXA 3L8HA 4B48A 4FEGA 5CX4A 1RVV1 1EA5A 1HYHA 2OK8A 3PL1A 4TSKA 2F4VB 3RYIA 1JJAA 5CFNA 2AJTA 1R5JA 1AUQA 2QSYA 3ZIUA 1NW9B 3W0LB 3LGAA 4O59O 2XUOA 1VRVA 1ENYA 4HNQA 3RQSA 4TYNA 3IV9A 3U49A 1TKRA 4U2KA 4DC9A 3FSGD 3NVMB 4OB6A 5JAOA 4ZDJA 1UPBA 2HLDA 2RHLA 2GPNA 1QAMA 4X20A 1EYZA 1Z15A 1AO3A 3A1CA 3SJCA 5AR1A 4HH0A 3M9LA 5A7GA 5B3JC 1KA9H 5KNDD 3WLPA 1F9AA 1YR3A