1RHJA

Crystal structure of the complex of caspase-3 with a pryazinone inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-3
total genus 49
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rhjA00
5IABA 3EDQA 3V4OA 5LUBA 3H0EA 2QLFA 3D6FA 2C1EA 5IARA 3V55A 2FUNB 3QNWA 3KJFA 4JQYA 4FGUA 3NS7A 3K7EA 4QU8A 4FXOA 3R7NA 3H13A 5IAJA 4NOMA 4PRZA 5IAKA 2QL7A 4JJ7A 1RWVA 4PS0A 4ZVUA 3H11A 4DCOA 5IAEA 4N7MA 4NBLA 1NW9B 3D6HA 5LU8A 4NOKA 2C2KA 4QUJA 2J32A 3GJQA 5IC4A 1BMQA 4JQZA 3DEKA 4EHDA 1RHUA 3UO8B 5H0IA 1RWPA 1RWWA 4QU0A 1SC3A 3P4UA 3GJSA 3E4CA 1RWNA 5I9TA 4JR0A 1QTNA 3IBFA 4AWAA 1RWMA 4JR1A 1SHLA 1I3OA 1RHMA 1SC1A 4I1PA 2HBQA 2HBZA 1RWOA 3EDRA 3GJTA 4I1RA 2XZTA 4JR2A 3R5KA 1I4EB 3V3KA 4QULA 1PYOA 4D3ZA 3H1PA 4DCJA 1SHJA 3OD5A 3SIPA 3R6GA 5IBCA 1GFWA 3D6MA 4FEAA 5IANA 2QLBA 3PD0A 3SIRA 5K20A 1NMEA 1RWKA 2CNNA 1RHQA 4FDLA 2J31A 2C2ZA 4NBNA 2H54A 5IBRA 2H65A 2XZDA 5I9BA 2XYHA 2H48A 2Y0BA 4QUDA 3H11B 2CNKA 2WDPA 4EHFA 2QL9A 3NKFA 1NMSA 1PAUA 1RHJA 1RHRA 2Y1LA 4NOLA 3S70A 5IAGA 4JJ8A 3KJQA 4QUBA 1RWXA 3KJNA 4LSZA 3R7BA 4QTXA 1I4OA 2AR9A 3DEJA 4ZVSA 2H4WA 4JB8A 2HBRA 1IBCA 3DEHA 4QUHA 4M9RA 2HBYA 2DKOA 4IYRA 4HQRA 1KMCA 4QUIA 1M72A 4N6GA 4IEFB 4NBKA 2H4YA 3ITNA 2XYGA 3V4LA 4EHKA 4N6NA 3R6LA 3UOAB 3R5JA 4QUGA 3GJRA 1GQFA 4QUEA 3IBCA 1F9EA 1ICEA 1QDUA 4EHAA 4QU9A 2H5JA 1CVRA 2CDRA 3RJMA 4HQ0A 5JFTA 2H51A 4ZVTA 2P2CA 4ZVOA 2NN3C 3V6LA 1CP3A 4EHLA 1NMQA 2XYPA 2C2OA 4AW9A 2QLJA 2CJXA 2FQQA 1JXQA 2J30A 4QUAA 5IC6A 3S8EA 2J33A 5LUAA 4EHNA 4PRYA 3R7SA 2CJYA 5IBPA 1SC4A 4ZVRA 2QL5A 3NR2A 1I51A 1QX3A 3DEIA 2CNOA 3P45A 4QTYA 4EHHA 4D3XA 1K88A 3BIJA 4EJFA 4PS1A 4DCPA 4AWBA 1RE1A 1K86A 4N5DA 2CNLA 1F1JA 5IASA 2FP3A 4D3YA 5LU9A 4ZVPA 3PCXA 3PD1A 1RHKA 4HVAA 4JJEA 4NOJA 2K7ZA 2C2MA 4N6OA 4N7JA 4QU5A 4ZVQA 3V6MA 2H5IA
chains in the Genus database with same CATH superfamily
1H69A 2OHGA 4MS4A 5D7NA 2IP1A 4BUJA 2RBKA 1R0CA 2VZEA 3X1YA 5AHXA 3GF4A 1OE0A 4OEHA 4KPFC 2ZWOA 1VIVA 3KKPA 4X3CA 1YZYA 1QCZA 3CNEA 1R9NA 4GFDA 4UHEA 1BW9A 2B83A 3ONDA 4V0NA 1O5IA 4E0BA 1SXJD 5H81A 2OENG 4L8WB 2DSNA 2F64A 3ZY2A 3DPIA 4HDNB 1OH5A 4K6KA 5EPOA 1RRCA 2IX9A 4EW3A 5EUQB 4I1SA 1ZNXA 1TM3E 3DL0A 3OIGA 4QRIA 1ZNYA 1FSGA 1RPJA 4WTOA 4MWTA 5HCNA 1NZFA 2W37A 3WDMA 4C01A 4EY4A 2P2DA 1YRYE 2GMWA 1X7YA 2JI7A 2WE8A 3K9GA 4PPQA 4X41A 4ROSA 4TTPA 2BV3A 2Z9DA 2ZIUB 4GIBA 2MSCB 4PYQA 5KOHA 3IVAA 4DQLA 4A5OA 3CB4A 3CZCA 1KPHA 1UBRS 4IWNA 4DR1B 1Y6GA 3GEPA 4I0WB 4MWGA 2MT9A 1GZSA 2VATA 1G59A 3HHPA 3EFOB 4L9RA 4XTRA 3J7AC 3ENQA 5BY2A 1U7PA 4U00A 1JBKA 1TZCA 2R85A 1K06A 3TS1A 3R75A 4L6AA 1MEJA 1X15A 2QV7A 2XWPA 3W2IA 3EZXA 1C9NA 2DGDA 1RKVA 2V8BA 2FEWB 3QGMA 2C61A 1MDBA 4MW5A 3SHVA 3ZI7A 3MWDA 4ZAZA 1INLA 1NMXA 2O6LA 2PU7A 4ZFNA 3RRMA 2WAAA 3EGOA 3IMFA 1EWTA 5E8JA 3K0FB 1XEWX 4X91A 5KCMA 4PTZA 3E22B 3KXIA 2VRNA 3KELA 3EZLA 4I6JA 4C6TA 3KSRA 1LV8A 3CN7A 3FCOA 4CQLA 4ZGGA 2PIAA 5BSMA 1SR8A 5CVCA 4XM1A 1MF7A 3F9RA 4IR7A 3LLSA 5GVRA 4YXWA 3EARA 4L0DA 2NSHA 1U3FA 1T2FA 1ZXLA 1XZAA 3IV7A 4BXOB 3GG2A 2XMPA 2KYRA 3KALA 2EKBA 5T4FA 1GZDA 3C1AA 4ZO9A 2AK3A 3R5XA 1H23A 4BDTA 4Z3KA 3CEHA 1R3UA 3E5MA 4Y6SA 3LKVA 3G23A 3P2IA 2H5JA 4B43A 2WD9A 3QF4B 2OFXA 4ARIA 5DLDA 3QLUA 4UAVA 4CXMA 1S3IA 4M0CA 3G68A 1PRYA 5HYVA 2BEKA 3GGJA 4C7MA 4YJGA 4YUVA 1GTMA 5DBOA 5B2FA 1W4RA 4S24A 4X1YB 3RLFA 5JD3A 4IHJA 4QJBA 3T95A 3DBVO 5JXGA 3EFBA 5FB3A 1M0SA 1S01A 3FLMA 1VJ1A 3HYRA 2BH9A 3RQSA 2QG4A 2F62A 1GRCA 4A6PA 1X1QA 4MV8A 1F38A 1N8SA 1O9HA 2JGMA 3KD2A 3PHBE 4TV9B 2HLNA 3PNVA 4H3VA 3OEHD 2FJ0A 2XXAB 4PANA 4MKGA 4AKTA 1XL1A 1EVQA 2ZB8A 1R2QA 3C6KA 2H2DA 1Y3CE 1ISSA 1Q0SA 2FG7C 4UQOA 5CLHA 1LLDA 5C31A 3ZU2A 5EXSA 7REQA 3Q1KA 1SVOA 5T5QA 4US1R 1NE2A 1EP2B 1T2DA 3B6MA 3OETA 1ZXXA 1JPUA 1VE3A 4R1QA 4Q9HA 1J1ZA 4NJMB 1TDJA 4URWR 3P94A 4Q3OA 4UVEA 3QBTA 3IA2A 3E5NA 2JCSA 3DTTA 3B8EA 2I2AA 1KMMA 4YK7A 3IMCA 3HBLA 5IAEA 3CNBA 4DARA 5LYJF 2FPOA 1Y80A 4PLFA 2QLLA 3C5CA 4PGGA 5TQVA 1QRSA 1T10A 2W42A 3UMMA 2BF7A 2Q3EA 3CJTA 3UO8B 4H7FA 3QNMA 5EPUA 4HAIA 3QKTA 3WHKA 3EVGA 4J0FA 2QAIA 4NY1A 3ZCXA 4FBLA 4B9AA 3D1LA 1XCLA 2PMKA 3T3MB 1TIKA 1K89A 3CNQS 2ZUFA 1XMOB 4JK3A 2ATXA 1R15A 4NDNE 4RO0A 4D9JA 4O3FA 3I0NA 2NPOA 3ASVA 3I04M 2NNLD 4F4JA 1DEXA 3EUEA 4GR4A 5F51A 1XN1A 1CNEA 1E3JA 1FEZA 1T35A 2P41A 4Z9AA 1YMQA 4DANA 5KJFA 4B6FA 4WQMA 4XM2A 2QVCA 2JGIA 4MQEA 2GCPA 4MS4B 3C5WP 4BFWA 4QO7A 2WICA 5JYEA 2BP7B 3KWLA 5DM4A 4ZYWA 2V96A 3C6BA 3AVWA 2H54A 3AVQA 1SPXA 3TTWA 1UT8A 2YVLA 4WCVA 1KSGA 1J33A 4N7RA 4C5BA 1BS9A 2H92A 1JTVA 1YZHA 1E63A 1MC1A 1NR1A 3PQ4A 4NC9A 1JYSA 1Q21A 5DX0A 1QOPB 1T5LA 2K2WA 5EE1A 2OA0A 3A27A 3PG5A 3C3YA 1EXMA 3EF0A 3JYNA 4QTXA 2HO5A 1VJTA 3GT0A 3HH8A 4Z4HA 4FWTA 1IXZA 3IEMA 2BDTA 4D74A 1RRVA 4JYAB 3C98A 3D6JA 4HGRA 3W5SA 1HYEA 1X1RA 4JH0A 1JEYA 1M74A 3F74A 3RS2A 1EVIA 2ZT7A 3D8NA 3HJCA 1PEDA 1XD8A 3PFGA 4LRUA 2O19A 1O9BA 4X6UA 4Z1MA 1VE5A 7ADHA 4FKZA 4ZCTA 2REOA 1RYZA 2FUEA 1T9GS 4WCFB 4MCAA 4YRNA 1EUCB 4MV5A 4MRVA 4IX9A 4NYJQ 5FLEX 3A9WA 3RHZA 5ITZA 2AOXA 4OKIA 2HM7A 2YYYA 2WIJA 4FWIB 4KFTA 4Z0PA 4ZZ2A 3DEFA 1WIWA 5A5FA 3UNXA 4F4HA 1NM5A 3WGNA 3NRBA 3RSSA 1AMNA 5CPBA 5I48A 4LJ7A 4AS3A 2H0RA 1SC4A 2WABA 5BYAA 1G38A 1RLJA 3MYYA 5SZKB 4QTYA 2X13A 4NBSA 1OB5A 1XLVA 2Q6VA 2D5CA 2BI4A 1PJSA 2IYVA 3MIZA 3D6AA 4NH4A 4ZZ3A 1SWWA 1NVWQ 5BORA 3G2PA 3HYCA 1JDVA 1EWYA 4RVHA 4YCBA 4IIYA 4RABA 4MDYA 4JU8A 3PFCA 1Q50A 4N5HX 2X8BA 1I33A 3H5RA 3CU5A 3U13A 2GH1A 2ZGVA 5DH9A 2C20A 3K2IA 2YJTD 1N8NA 3KQOA 1LY1A 3W3AH 2OSBA 2H85A 4ZI7A 4L15A 3UJ6A 3V97A 4AJHA 3URMA 5ER9A 4KFCA 1FFBA 4MAAA 2YCBA 3KZMA 3COPA 1R9MA 2OCXA 2VJAA 4G9BA 3E2MA 2BMAA 1D0SA 1LLCA 3PFHA 2Q62A 3BK1A 5COAA 5FQOA 4DCOA 1F2DA 1KDVA 1SHKA 3UJ3X 4EI2A 1MH1A 4IIJF 1JXOA 5J5AA 1OOEA 1Z6PA 3GVIA 3HCOA 1YHYA 4F1WA 1KZGB 1R5NA 1KR2A 1WQ1R 4JT9A 2WW8A 1JA9A 3AI7A 3E2IA 4YPOA 1RQ2A 3A1EA 1P7CA 3RRNA 2HMVA 3ZLUA 2FFQA 2AI2A 4PR3A 3FNIA 1KKUA 1JSLA 3E1GA 1LDYA 5H3HA 2O0LA 3RARA 4KMRA 3K5HA 3VSBA 3H6HA 1UBGA 3IUNA 4HFJA 1NVEA 3GJTA 4YO7A 4MO2A 2QVBA 4EAQA 1HLPA 2JJ2D 2XRYA 4LRSB 4NKRA 3DXXA 5K0NA 1VGVA 3MILA 4MKRA 1PYOA 1KSJA 3H1PA 4GYKA 4UMVA 5SY6A 4K6MA 4A8PA 5AW4A 3OP4A 4HRAA 3WGIA 2BM1A 4POAA 1O2DA 4U1RA 4UM7A 3UW1A 2RH8A 3UWOA 1N2ZA 5LZ5A 1YS9A 3V2HA 1LTQA 1RWKA 2CNNA 2GCNA 2O8VA 2PA3A 2WWWA 4G81A 3ZHYA 3RLIA 4PRKA 3E9EA 4I08A 4DRXB 1UMBA 1W4LA 3A6EA 2VNJA 1NMSA 5A1TA 4YMTA 1TPZA 4IS2A 4NOLA 2J87A 3I76A 3N2KB 3UWMA 4LZPA 1V1RB 2CVOA 1QUFA 1Z8FA 1JGTA 1OYVA 3N8DA 1CUIA 1B0PA 1VG8A 3L0OA 5JCJA 1E2DA 3JAKA 3SF8B 1IBCA 1COZA 2WJPA 4E4TA 5JCJD 3ZZMA 5IUNC 2BE9A 4HDMB 4I1IA 3AETA 4G6ZA 4N6GA 1TKRA 4NIMA 1GZHB 5BMVB 5A4DA 2QY9A 2IEGA 3IVRA 1MJHA 1ZWLA 5E1MA 2R5WA 5FBHA 3JYLA 3SM9A 2VEDA 2IIBA 2C4HA 1LK5A 3DOCA 4YLEA 3HI4A 3VDNB 1PYDA 4M54A 1U81A 4LHWA 3ZE1B 2P2CA 2YC2C 5FWXA 3EGDA 3HP1A 4PICA 2JG3A 4FCVA 2C7RA 3DT6A 2AFRA 5C34B 4LBWA 4A0RA 2AG1A 3WNDA 1C5KA 3UJ9A 2BMEA 1A04A 1ENOA 2EGHA 2FWRA 3AESA 3ME5A 4P2BA 3T5CA 4LJAA 3WJ2A 2H9AA 5CDTA 3RGGA 1RAFA 2HWUA 3DXYA 3LBYA 3OIVA 2XGOA 3D4PA 2WTAA 4M88A 2AH5A 3UV7A 1XJ5A 2RAFA 4GMXA 1UBUS 5KHAA 4QDTA 5EIOA 2ZZKA 1RFLA 1BKDR 2Z83A 4LGCA 4JC0A 3FHLA 4D42A 1Z16A 3GN2A 3PPWA 3IPCA 3QX9A 1E1KA 1WR8A 2QUJA 4RM3A 3DR5A 2M32A 3KOZA 4CKCA 4MQFA 3T5GA 2XX3A 3H86A 4ESEA 4D1YA 1QVVA 4RWEA 1LPPA 2WBLC 1YDHA 1G3UA 1FE8A 1CRZA 4P2GA 4E88A 1L7RA 3HKBA 1VKOA 1E1RD 2ACWA 3KYCA 4M8LA 2X77A 3SC3A 1GTL1 2I3AA 3SYNA 3CKKA 3ZWBA 4QFDA 2XSZD 2AZXA 4R1SA 1J70A 1WCIA 2GT1A 3EA0A 1S2IA 4LOAA 4M1QA 2LE0A 1BCRB 4V0LA 4FD2A 2X3UA 4KOEC 1IB6A 2OXIA 3WISA 4HX9A 1BWPA 2R8EA 2AFHE 3NUZA 4FGLA 3ISVA 4RCVA 2BZ1A 1J0CA 4ZCLA 3V4FA 5JEEA 4RNCA 3ZU6A 1KMHB 3IUBA 3IIIA 4U7PB 2QPTA 5TPWB 2PGNA 1HPLA 1N6LA 1YDGA 2ATVA 1XD9A 2V59A 2X0JA 3U37A 5BNZA 2Y68A 2IHBA 1N36B 4C22A 1FJGB 3ENKA 3MPUA 3I1FA 2Q3JA 2VJKA 4CLDA 1KSHA 5JCPA 1PK7A 1Q7GA 1N7HA 3DF9A 1SC6A 3VPAA 2P9HA 3W1WA 1AHPA 1NYTA 1VHQA 1I3OA 3EDOA 3EISA 4ZQGA 4E2XA 1E77A 1QV9A 2CHVA 2RGXA 3KT3A 3EQ7A 1GZVA 3TLYA 1IUPA 4I4LA 3QW2A 1JSCA 1X14A 1XRLA 2O0JA 1SG6A 1UMDB 3ESCA 3MWEB 5J59A 3D54D 1OU0A 3OP1A 4R2HA 1QU2A 1TTQB 3QIVA 3B20A 4ZQCB 4ZHSA 4DY6A 1MDFA 5EUBA 4Y1RA 4J0EA 4G0MA 6ADHA 2BJWA 2KE5A 1LK0A 2ZVQX 3I9V1 4OHFA 1XPUA 4DV0B 5CX1A 1NUPA 2IU4A 1ZO8A 4NBVA 4YN3A 2EWMA 4Q03A 1ONNA 1MGOA 3L1HA 1D4ZA 3N8NA 5CYFA 2X0FA 2Q1YA 3ZHCA 1DXYA 4OQ4A 2KSQA 4CIYA 1EB9A 1PE0A 1Z5NA 2PUJA 2GWRA 3CNLA 3P0HA 1TK3A 5KYYB 1ZIYA 3RC7A 3SOZA 3G2JA 1WDLA 2M1XA 4K9SA 4J1NA 1U1CA 4U2EA 1TECE 4AD8A 1D1PA 3DV2A 1F8UA 1P0IA 2C00A 3WTCA 1U5BB 1Q95A 1TMKA 3JAWB 3MUFA 5EJ9A 1A5BB 2OCKA 4WZAB 1GTJ1 1PFQA 3W5UA 1BRMA 1T6YA 1Z8HA 4GQAA 5LZ7A 1DTWB 1SO8A 1WTAA 1NQXA 4M99A 3F78A 4M0FA 1E5XA 2FETA 1D2GA 3RYCB 1K5GA 1H2WA 1NLZA 1O94A 5DCWA 4FONA 3AM3A 2AT1A 1CUUA 2QRVB 2FTKE 1O4WA 4X45A 3AB7A 2ZRFA 4ZT7A 3RB8A 2H0QA 2HTEA 2FW6A 2I6TA 4ON9A 1BXGA 1VLLA 1XZLA 3A2NA 2C4UA 4ZC1A 4C0JA 4OJKA 2PUWA 2V54A 4JLDA 4KYIB 1JIXA 3V8QA 3Q2IA 5CFMA 4RTOA 4L3OA 2C5EA 3MAAC 5AIAA 1ZBQA 5FTJA 1P9LA 2C5BA 2PZEA 3BRSA 5TGTA 3PD1A 3G2MA 2R00A 2I2DA 1TVMA 3P0JA 4LXHA 3ZE6A 1KEZA 3OZBA 4DPKA 4IV5A 3GUUA 3EDQA 4G8CA 3H5LA 3OZEA 4AJJA 2F00A 2I66A 3S2GA 1M1NB 2EWVA 4M1SA 1N6NA 4HQNA 4TVSA 4QX6A 3RS0A 4Q00A 4QBGB 1W0KD 2C94A 4KDEA 2VP0A 1EAMA 1V43A 4O4LF 2O2DA 3FPGA 4CM3A 3Q6MA 3RUCA 1MZVA 2VCYA 4IF6A 1V6SA 2Q3CA 1CJSA 1FQOA 4ZWNA 3WWOA 5LQJA 2PGDA 4TQ9A 4HH3C 1YCGA 1BKYA 3SICE 1YF3A 1SXIA 1EHCA 2J3LA 3P2MA 3DE7X 5AXAA 3OSZA 5JZVA 4NXNB 3QWBA 5AI5A 5G41A 4XSVA 1CEQA 3DYBA 2V5VA 3AR6A 3O91A 4X62B 2CLHB 1JR3A 1MABB 3BBLA 3IBSA 1WKVA 2REBA 3JVDA 4O1HA 4CGYA 1TZKA 4C07A 6PFKA 3N59A 3OESA 1IULA 3SBEA 1AMUA 2MOKA 3OT4A 1B8OA 2KI5A 1XCJA 3STWA 4CDGA 2P9QA 4UCFA 2RGNA 1JDSA 3G8AA 3W04A 1AK1A 3B6IA 4PYJA 1NDUA 3WK9A 4KTTE 4LYJA 2WYIA 1OFUA 1V2GA 2YXLA 4YIKA 1T43A 4CV0A 3WK5A 2R8XA 3E0QA 2P79A 4MINA 2F43A 4NE7A 3CRVA 3E3AA 1NOJA 5TMBA 3SNHA 5C81A 4D43A 3BD6A 3MS2A 3TTVA 1LDBA 3QOXA 4QEKA 3ZKAA 3ZHQA 2TRSB 3G2LA 3HN2A 2HWKA 3D02A 2OQVA 2C07A 3JY6A 1LF0A 1TYEB 5FV4A 3PT5A 3G02A 4HK4A 1P39A 1Z35A 3H4VA 5CBKA 3W5AA 3VR6D 2QPAA 3RVNA 4B5LA 2VJBA 3G2IA 1ZEMA 1WUYA 3I1IA 2A14A 3OX1A 1LBHA 4XGKA 2P4UA 1X86B 1AU9A 4Q3LA 2JGEA 3VO8A 3P0FA 4RK7A 4DCMA 4QHTA 2QLMA 4IJVA 2Q4EA 1Z68A 2IUEA 3KEGA 1K4YA 5FHQA 5DGDA 3PE6A 1DZ3A 1FTQA 5KPDA 1YA6A 3OFND 1HQCA 1LRJA 2FF7A 4JLOA 3D7MA 3U26A 4B3GA 2YNMA 3NDRA 5KSWB 1XQ9A 1X94A 3I34X 5D8DA 4BU0A 5KSOA 2J5XA 2OUKA 3TSWA 4PCLA 2W58A 2A5DA 2A5YB 1PT5A 2UYOA 1PD1A 5ETJA 2RE8A 2RCNA 1DHRA 1V37A 2ZB3A 2P4EA 1LW7A 1MQ9A 2J30A 2F1KA 2P4SA 2X4DA 3UOWA 3OOYA 1DL5A 2N75A 4KQ6A 4V02A 3DOEA 5AKYA 1AKUA 5DKFA 2X5OA 3WRXA 4A91A 4CEJA 1D2RA 3AUKA 3BPSA 4DIMA 4D3DA 1CLEA 3AJ8A 1IXKA 4AKGA 1HURA 4HTAA 2TSYB 4Q3AA 3RODA 2PSEA 5FUYA 1QONA 3L4KA 2QTLA 4ZO4A 3DVRX 2OXEA 3FKSA 1BGWA 2KJQA 3FPAA 4KUEA 1XAJA 3PVCA 4KB5A 3BL6A 3KG2A 1I3LA 4A6DA 4IDQA 2Z0MA 1RBYA 3N0RA 4C3ZA 4DCSA 3VC3A 3CF6R 3PDHA 4YWHA 5C5EA 3DHVA 3PGA1 1GSHA 1N1MA 6REQB 3VO2A 4GKVA 1KYZA 3EDCA 3KAQA 2YQ4A 4X20B 3ZU4A 3BL5A 2O2CA 1DOAA 1D9XA 4HMQA 3SGLA 2AB0A 3LOPA 3B3FA 2VF2A 1I4TD 4RF5A 2WVGA 4RQTA 4W5WA 4DM4A 3CRMA 3D7RA 1H0KA 3CUVA 1PKEA 4AUKA 4H7EA 1MX1A 3DZCA 2D1YA 5IABA 3UB2A 4H0NA 1C4OA 3PLNA 3VZDA 2JLRA 2A59A 4Q3CA 1T0UA 5F7JA 3ZY6A 4DRXA 4YX9A 5LP6C 3AVUA 5KQPA 2C3PA 4AICA 1A5SB 5INTA 3PTAA 2ZYHA 3Q3JB 3T7TA 4R9VA 4BMZA 1R4ZA 1EP9A 1OSNA 4W7IA 3B6ZA 1H2RS 4CHGA 5H9WA 3NBFA 3OX3A 2C59A 4WOBA 3RSFA 4X85A 5ANRB 1G5PA 4UDYX 1NVVQ 3JQBC 4OXQA 4KZKA 3N76A 1NYRA 4XIJA 5KINB 2ZK7A 4BQRA 1MJFA 2IW3A 1XF9A 2RGAA 3WICA 4JXZA 3NBMA 1SBHA 3GEBA 2XTNA 1RU3A 1YJCA 5T3YA 3SQDA 4CWAA 4GI5A 1O5TA 5JQGB 1U80A 4PQGA 3K16A 3BEOA 4JLBA 5C52B 3J81A 4NWIA 4HNRA 1MC5A 5IN5A 1YR2A 3GWZA 4EJSC 4EELA 3JQ9C 4XJVA 1W5SA 5DXAA 4B3IA 4ZZ1A 4RPIA 2AZMA 3C85A 3V7YA 4L51A 4ND5A 1ESNA 1ESCA 4JNCA 1HTWA 1VMIA 3I28A 3RKUA 3U4MA 4BMPB 3PA6A 1PN3A 1YONA 1TYCA 3CH7A 4ICIA 5KVVA 4IQ8A 1TI7A 3VU9A 4IMIB 2PUEA 3H17A 3T94A 5GP1A 3FRJA 4QUHA 2O2JA 3GARA 3RK1A 3DYIA 4II3A 3ZZTA 4ZDWA 3AI1A 4M60A 5KI6A 1J2TA 1CKEA 1QVWA 1KYQA 4BFLA 1N34B 1DRKA 3JALA 2J4CA 1BOOA 5EQJB 5FFNA 4D82A 4BVAA 1JHUA 3GBPA 1XMIA 4Z2AA 1P77A 1EZ1A 1GOTA 3I9NA 5IEBA 1ZCZA 1LSSA 4QG7A 4RORA 3SYRA 3S2ZA 4MV9A 3IUEA 2BMDA 2GHRA 3IDSA 3QKUA 4HFMA 3ZJYA 2DPLA 3R9XA 1H4SA 2CLFB 3CW2A 2DHQA 1ZGBA 2W71A 1ZCAA 1G1AA 3IJEB 4S1NA 1VGRA 2AJLI 3GFGA 1BXRB 5LP1A 5FNVA 3EGVA 2F9LA 5KQGA 1UJCA 4J75A 4M98A 4XLLA 4ZALA 4B6RA 1FFSA 4ZZIA 1Y4DE 2QM0A 1Z12A 2C9ZA 3S2IA 4ZMBA 1FVFA 5EJ8A 3ZI0A 4R1TA 1P44A 1C2TA 1JECA 4KYVA 3O2JA 4GXNA 2CFIA 5P21A 2XB4A 5EG5A 1U6KA 1JR3D 1S8AA 1ADYA 1HC7A 2AJDA 3B5JA 3PDWA 2FPPA 1YTLA 3OQ1A 1A7KA 3NTXA 1DO2A 5D84A 3SX2A 3T61A 4AY5A 4XYLA 5I7VA 4YALA 1AGNA 2WIFA 2ZRKA 1SN7A 3EZGA 4FYYA 3DOUA 3K0HA 4MVJI 4WNYA 2YWHA 4X7PA 2CFTA 3R0QA 1U6IA 4MARA 5I6DA 4UBIA 1SD2A 2QXUA 2WVAA 3AK4A 4UOZA 4Z7OB 1XTBA 3H5OA 3FRHA 4MS1B 4C06A 5AKGA 4KI0A 1C3JA 1W0KA 1GPDG 3HCNA 1ZRNA 3E8SA 1E0KA 4LSWA 2ZZMA 5JSHA 3C6XA 3M34A 3WIUA 3G6KA 4HLQB 4D80A 3BIXA 2PKQP 4LHYA 3ZNQA 4ALIA 1VCHA 4OUKX 5K6AA 1LTKA 2HMAA 1A5AB 1N3IA 2CL6X 4XDZA 4ANFA 5KS2A 3F3KA 1MZPA 2JL1A 2K6GA 5DI3A 5ENZA 1U7ZA 3GLUA 3IEUA 3V1YA 4ETNA 3F3MA 4NTZA 5IVHA 2HMTA 3MJEA 3CW9A 3DXFA 5JXJA 1IAVA 3EPKA 4L7QA 3OVMA 2HFJA 3E48A 5IEJA 2QZPA 3O03A 1RQLA 4X3PA 5G02A 4UTZA 1M5TA 5GV7A 3SX4A 2QZ9A 2ENUA 2EZ8A 4RF2A 3IUMA 5K3OA 5AO9A 1DOHA 3OCXA 4RXUA 1VCNA 2H7VA 4MRAA 3QHPA 3BHNA 4DA6A 3K9HA 1I3NA 3L82B 4WBXC 3WXBA 1U9JA 2GCOA 1G6KA 5FO1A 5BQOA 4DCCA 1PDOA 4NJMA 2OBNA 1NNUA 3DKPA 4DZRA 3HKCA 3E8XA 1SXPA 2O59A 3RK0A 4Y67A 1XN4A 5TB5A 1T9GR 1QHHA 3ETGA 2BKXA 1GKKA 1JILA 4R0MA 3L1JA 5AVJA 4D02A 3ZQ4A 2GM4A 1THGA 1LBIA 5C18A 2WJVA 1S3GA 1JR4A 3EOAI 4FDTA 4IUBS 5DJ5A 5CB4B 1FF9A 1KYTA 1GNVA 2IS6A 3ZD8A 2A1IA 2M2IA 3PU6A 4H7DA 4X1OA 1XMJA 1KO8A 3LQKA 4BTVA 1WMEA 2WZBA 1KFCB 5DHQA 4BJ1A 1XVVA 2QGZA 1ZJZA 2XOXA 1DWOA 2JFYA 5KTOA 2BAGA 4UTPA 4U0KA 3EAQA 1O1YA 4YUAA 2J0SA 4FNAA 4EFLA 4EPXA 1B0ZA 1FSSA 3FSRA 3KJEA 1EGHA 2GEVA 3CRNA 4A15A 4EO7A 2BSQA 3H42B 1U2GC 2FLWA 4GXTA 1K3TA 1OC4A 1Y3IA 4BNIA 2CHUA 4MR8A 4R7ZA 3KOMA 4A03A 4A8JC 1CY8A 1KWKA 2OZVA 4JAVC 2XXJA 4WOJA 2XYPA 4GRDA 2CWWA 4CKBB 4YRFA 1GG8A 4QUAA 4KPGA 2YV3A 2AW5A 2IQ5A 5JWOA 5HUQA 2PWYA 3AINA 4JC4A 1CDOA 3DS8A 4FFBA 4I55B 3GJ5A 1FVXA 1RI1A 5E4FA 2WKQA 3S40A 2PQ0A 4B7UA 2QX4A 4DR4B 4ZEXA 4MRRA 4QJ4A 1GY8A 1SRQA 2DU8A 2HCTA 2FUKA 4H4DA 4Y0NA 3UC9A 1AQ6A 2O3UA 3B1ZA 3B9PA 3BL8A 4KQJA 3EEBA 4KIJA 4LV5B 2QTBA 3WAJA 3QIAA 4B3DA 2Z6QA 5FUVA 5CCXA 5FQNA 4GOJA 4LVCA 5HJ2A 3K5IA 2WQ6A 1ZL2A 1P7VA 1Q83A 1S0UA 1UFKA 3ABIA 3B7WA 1XTVA 1PJAA 3HVUA 3PR3A 2Q41A 3LFUA 4UZSA 4EY6A 4PEVA 4F0JA 4BTLA 1Y48E 2ASEA 3VX3A 1I36A 2AOUB 4LE0A 4G85A 4RHEA 4D0RA 5ITWA 3CYFA 3A2LA 4HGQA 3TBKA 1JJ7A 4G4GA 1XTKA 4HAVA 3OQMA 3LLCA 2G07A 3R0XA 1Z5ZA 2PJUA 3HDHA 1R6UA 1NVVR 1H66A 2BGJA 2NQ2C 1CQWA 5EUMA 5JEDA 4RQUA 4DDKA 1SXHA 4CEHB 3F96A 1I6WA 4CIAA 4GPBA 4O1MA 1ZKMA 4EVSA 3DB2A 4G0PA 4YDHB 4DT1A 4TX1A 4IGFA 1XIVA 1VXOA 5EI5A 3A58B 4CN9A 3CEPB 3ENWA 5C8VA 3HP7A 1P1IA 3R0ZA 1VFPA 4JJFA 4GICA 4ID3A 4QOEA 2JEZA 4BQQA 3VSEA 2WVJA 3KB1A 3OM1A 4N0DA 1GZUA 2OD2A 2RI1A 3TW8A 4OQZA 2C99A 3ZE8A 1SULA 4LECA 3Q3IA 2AEJA 3A1SA 3ZCQA 3AW9A 4XQ9A 3TZQA 4EABA 5DI3B 5JMWA 2ZRLA 4R8SA 3TVYA 3B78A 3WNBA 2Q4OA 1C9JA 1KERA 3AVVA 5JYBA 3BFXA 2JJYA 5KWVA 3AG5A 2CK3A 1RI3A 3MT9A 3G5AA 3K0CC 1D09A 1OUMA 1PV2A 4HYYA 1WZ2A 3PD7A 3HKDB 2IBSA 3L6EA 1ZOPA 3MCTA 2UVQA 2WNHA 1Y7IA 2DFTA 1TJ5A 2DZDA 1IZ0A 2XF8A 2YV5A 4N01A 4RJIA 3TKLA 1M6VA 3NM4A 2NTNA 3CH6A 3NIDB 1VP3A 2P5UA 5BV0A 4ZV9A 4TYYA 4PFSA 1P1RA 3JW8A 3IAAA 3SM3A 4KDCA 3PNMA 4OI4A 3FR7A 3S44A 4ZV4A 1NI3A 3I5UA 2PUTA 3VPGA 1EUQA 1V8OA 3GD5A 1Z47A 1RHJA 1AK2A 3JXEA 4PO3X 3L7OA 4EQZA 3RROA 1XU7A 4KO2S 2Z3VA 1XJQA 3CHYA 4ZVSA 2QMYA 4CQMA 4V0KA 5I5GA 1XD2A 4K1XA 1RC1A 2X19A 2CCJA 2HSJA 3AWDA 1CIJA 4L4XA 4YECA 4YRTA 4HB2A 4O0MA 5DLQC 4FS3A 1T8TA 1L4UA 4HXGA 1OLUB 3X3HA 1QV6A 2W6IA 3IXLA 4GWLA 2GK4A 3IT2A 3U09A 3NHMA 2VHYA 3DE4X 3QWIA 3UY4A 4XFKA 6GPBA 3AZOA 3IEIA 3ACBA 4YXWD 1C3OA 2V3VA 3WQBA 5HS4A 1OV6A 4NMHA 4JYPA 4OIFA 1CRLA 4HUJA 3RS8A 4F3YA 4NQZA 4YP1A 3AYZB 3JR3A 1TVKB 1KQ3A 1M1YA 1ONOA 4J6EA 4G1MB 2JH3A 4LVUA 4MUIA 3RRYA 1AO0A 4KHZA 4QTTB 3QTBA 1XZQA 4GMHA 5M34A 5LD2B 1Y3BE 1CQXA 1HV8A 3AP3A 1CUDA 1JFLA 3L46A 5KNBA 3GH3A 1VKZA 2PSSA 3A0RB 1I2BA 2AOUA 1JIJA 3KXDA 4FUQA 4ZOLF 5AM2A 4I1VA 1PT6A 5KQSA 2QYSA 2WP0A 4EZBA 3VV3A 4DV1B 2WSBA 3V8PA 3L1VA 4AUNA 3W4KA 3RK4A 5JVDB 2JARA 3A04A 3HJUA 2BBTA 1E9BA 1T5SA 1POXA 4W7SA 4Y6PA 1T9CA 3C87A 2R6FA 4XUDA 1U04A 2VBGA 2W43A 3SBDA 5AW2A 2M6LA 1X7HA 2FW9A 3N2GA 2FFRA 1MOPA 1L4KA 2BF4A 1C4XA 3FE2A 4NU5A 4YAWA 5KYKA 3ROEA 3NHZA 3NAZA 4QNMA 1VL2A 4ZRMA 3HS3A 1Q6YA 1MJ5A 1T25A 1NT2A 1A50B 1R4AA 2ZRNA 3I52A 3IODA 4YJGB 3L6DA 4P7BA 2W4MA 3FPJA 2NO9A 2V7EA 5DNEA 5I7SA 1UJNA 1NGSA 1X38A 2IHNA 1UBKS 4DQUA 5M2QA 3UOGA 1PNTA 1CQJA 5F73A 1Z0AA 4FNMA 2E4ZA 1ZHHA 3C2QA 1USGA 2VDWB 5J2TA 1T4MA 5H3LA 4BJ5A 2NQTA 3VOBA 3R77A 4AT1A 2VH2A 3LYAA 1BXKA 4S35A 2OHHA 3EMVA 4HWKA 3O90A 4LNAA 4CL2A 4KQ1A 1PWHA 3AZQA 4GOOD 4QD3A 4QL3A 3HCCA 1DHTA 3PRHA 2E3JA 4TOIA 5AM4A 1UM9A 4B40A 1YHNA 1Y6JA 2I54A 1CK4A 3T4EA 2XE4A 3L8ZA 2IZ7A 2JGLA 2WKSA 4Q12A 5AW5A 3C6MA 3QPDA 4I1PA 1KGDA 3N7AA 1X7ZB 2WQZA 1N5RA 3PUWA 1KJ8A 4YFVA 1UEJA 3CW8X 5FADA 2QU7A 5G53C 4F46A 2G0AA 5BXYA 5FUMA 4ESVA 1CHNA 3HXLA 3L0IB 1L9KA 4E5VA 4AUMA 4BNMA 1DIGA 2CMGA 1S9HA 4GRAA 2CFSA 2FW0A 1NVAA 4WERA 4DQVA 3S81A 3VZPA 1J1UA 4CF4A 4RENA 1L7AA 3C97A 2R6DA 3L1IA 1H2BA 1L7QA 2WKPA 1KMIY 4TMZA 4FFSA 1QX4A 3LY5A 1Z2AA 2OB1A 3HR4A 1FW8A 4HH4A 3WQHA 4EGJA 3NHBA 1XC7A 3P9XA 4IZIA 4RVDA 1CEEA 2HTFA 3P32A 3CIFA 3T8YA 5MF6A 3ZTWA 3IL2A 4IHQA 5KEIA 5FP0A 3ZV3A 2R6ZA 3N6XA 1N1GA 5J23A 1L5HB 2NOAA 2QNRA 3O8QB 4OYYA 1OBVA 4X6XA 4URXR 4CIXA 1XXLA 5B64A 2Y4OA 3DC2A 4J2TA 2A86A 4N4AA 3UHJA 4AIIA 3LMKA 3TCKA 2B3DA 1YQGA 1W0CA 1P5HA 1X1DA 2C03A 3V8BA 1KAHA 3E3OA 3PTZA 4I19A 1SOMA 1D6MA 1IRXA 3EEIA 4HQ0A 1GA1A 2GNAA 5THKA 1YD7A 1ZIDA 1DAHA 2CL7X 2NO0A 2A2ZA 3BBPA 1NVUQ 3L8EA 4IBOA 3ORYA 1ESZA 3E15A 1W87A 1N2SA 1OT3A 1OMOA 3VPCA 3P97A 4ERXA 1J0DA 4Y2GA 1YB4A 5DB4A 2R8BA 3KSAC 2Z3ZA 4ZXPA 2FPRA 1JU9A 2YS6A 4WSOA 4ARZA 1P75A 4B8YA 3KQLA 5HOQA 2G4VA 1MJNA 1I51A 4LX0A 4OQEA 4OYRA 3I2HA 1GQOA 2BEUA 5AVRA 1A9TA 2B99A 1EFLA 1WOMA 2EJWA 4OBEA 1OY1A 3BF7A 1EUDA 5JTUA 1TJ3A 4JC8A 2I6XA 4HC4A 5EHZA 2GEBA 5IMSA 3DZKA 4GX2A 2O2XA 4G5HA 1KI3A 1YQDA 3D0QA 1CV2A 1R8YA 3HCAA 4HLCA 3T34A 3DSRA 4C03A 2XT0A 4ZOLA 3RYFB 4ASUD 5IJ9A 1WJGA 3D43A 3TPZA 5HVNA 2HSEA 1THZA 1U0JA 4HXFB 4WLFA 3MBIA 4GNKA 2F1IA 4MTLA 3FTCA 4RIHA 5ALOA 1AS2A 5CNMA 4DJJA 4X66B 1WPRA 3G5UA 4PHCA 4LYDA 3K8OE 5EKDA 1PNQA 3HEBA 4IIVA 2I8LA 5ESWA 2QKYA 1B8UA 3T1NA 3OE1A 4X93A 2X3FA 5I8ZA 1FVHA 3MK31 3S55A 3TZBA 1YFJA 3WMGA 4DBLE 1XXHA 2H59A 4CU5A 3TQFA 5ALFA 4L6CA 2QYTA 3IPXA 2FWAA 4HUQA 2PR7A 5L4SA 1QTNA 1GRVA 3KJIA 4G5FA 4CMJA 5FAKA 4YRZA 3CLUD 3JD4A 3OQHA 3QVWA 4QYMA 4XWYA 3U49A 3FBTA 3SX0A 3TXAA 2W2OA 4NZYA 2WU1A 2D06A 9ATCA 1IM5A 1Z5PA 2DJIA 3PC7A 4MW9A 1V6CA 4P35A 2FJPA 4LMRA 5CDFA 4E21A 3H5WA 2WG2A 5DYGA 5B1SA 1QIIA 3NORA 3C4VA 1YUBA 2DHCA 4NECA 2HSDA 2C83A 1TB4A 3NV9A 4WACA 5KNDA 2WSMA 4AECA 2RJ3A 3B48A 3ZGVA 2C5GA 5DT9A 2GXSA 3I9JA 4QUDA 4MDFA 2PGAA 4RA9A 2B4QA 5IJZA 3FVTA 2CNWD 1UXIA 5KOJA 2XAAA 1KETA 4FGSA 1YA4A 4DJ5X 1IOVA 1D5WA 1XZFA 3FCSB 3CA8A 3RASA 4ZOLB 3TJZA 1UDCA 3ZE2B 2KLHA 2HRRA 2ZBDA 3HKBB 1US8B 1IBRA 1MABA 2HBRA 1ZGCA 2P4HX 5JSZA 3EVEA 3OQ6A 2WINI 1Z0IA 3BGVA 4QLAA 3ZXXA 4DV7B 4G5RA 4JZYA 4ZQHA 2GRAA 3BWCA 4X71A 4YRPA 3TRJA 1NXOA 4F85A 2VS1A 1FQKA 1SKAA 5BUCA 3J80A 2ZTVA 5LKAA 1E6WA 4IINA 2G82A 2HNKA 3TPCA 4NU6A 5ECWA 4BU1A 3IQWA 1UP7A 2HRQA 2G0NA 3I2GA 6Q21A 5JROA 2IV2X 5AXDA 1VLVA 2CFRA 4U9IS 3ZY5A 1QV7A 2P9TA 3HJTA 4E1VA 3T1TA 3P7MA 3HACA 1TU4A 1PW5A 1RLIA 5K45A 1ECCA 3ET4A 1G5QA 3IE1A 2P6MA 3K4QA 1OW3B 2VF7A 4WKPA 2H16A 2MHCA 1Q19A 1Q0ZA 3BEDA 4HVTA 4RL6A 2NUTA 1QX3A 4HS4A 4TS1A 1XNQB 5DHRA 3U9SA 4D6YA 4EPTA 3P45A 1A1SA 1U99A 4E5PA 3EIFA 1VIYA 2ZRAA 3RIEA 3TUJC 1LA2A 1XYGA 4EJFA 3SD7A 4Q1FA 3TCXB 1L5VA 2CNLA 5LL6P 1Y4SA 1U65A 4NE9A 1EXWA 1D1SA 1QANA 1U7XA 3A6FA 5JCOA 3GUHA 3TLEA 5J4VA 3GMDA 1LUAA 1PR1A 1F3OA 3N5CA 4YA6A 1IIRA 1Z3CA 4R9NA 2GZ3A 2NO7A 3A1TA 3HCBA 3I72A 4JQOA 2OZLB 4GP7A 1JHOA 1TUBB 4NX2A 3O9ZA 5I8WA 3QKRA 5DLPA 1XRNA 1MLDA 1QGUB 2HNAA 2OP1A 3LNTA 5HW0A 3NCHA 4IFEA 4GPEA 5AVTA 3FUWA 1P6QA 4PQFA 1P0QA 2BR4A 2PKXA 2YMLA 4GWGA 5AHKA 3P52A 4N48A 1YJ8A 1UKZA 2R44A 3EXFA 5HFAA 3M1AA 5EJ5A 1S8NA 3A7DA 2GZ1A 2LGJA 2QUKA 4Z51A 2C54A 4AXBA 3TZHA 3GCXA 4UNQA 1VI5A 2AOWA 3NV7A 4DNFA 2NP6A 4L50A 2WIGA 3HCWA 1L1FA 4I3HA 4Z3DA 3UMGA 1G3IA 1IWPB 5KOIA 5ERYA 2VFAA 4U7GA 1QS0B 1R6VA 2JFZA 1RBQA 4MICA 3FUCA 3LUKA 4FGKA 3BF8A 4OO3A 3IEVA 1USWA 1RQRA 2HXYA 3ZWCA 3M6LA 4RULA 3S2EA 1BWQA 2QG9A 3DBLA 1CUAA 3WGQA 1NKVA 5H7XA 3VU3A 3P9YA 4BASA 4BQIA 4Z4FA 3PUZA 1BAPA 2FZ4A 2X6RA 1S5PA 3QLVA 4L85A 4IL5A 1TIBA 6LDHA 2GBLA 2G1KA 2E55A 5JD4A 2V6MA 3PFNA 4J76A 3DZIA 4DCJA 4P0TA 1GFWA 2X5JO 4R71A 5SZHB 4YRQA 3DO5A 1WXEA 5TEVA 3MS7A 3UMVA 4YPFA 5EZYA 3U3DA 5FUBA 3RAFC 3GROA 1RT9A 1A8HA 1H93A 2YVUA 5EVJA 4I5GA 3V7FA 4UDNA 4PXYA 2WOOA 3BFVA 3Q11A 1X3SA 4GXQA 1GILA 1I7SB 1KAOA 4QUBA 3NWOA 1XZGA 3BD8A 4XKJA 4XPZA 3WKEA 1YS6A 2VDOB 1OJ7A 3HEMA 3IPRA 2XB2A 1JQ3A 1G7TA 1IPFA 4AQYB 2J41A 1MA3A 1M5UA 1RXSA 5CFPA 2BSXA 2G7MC 1G60A 3DOOA 4ND4A 4X84A 1UMDA 3H0KA 4YASA 2WMNB 3G0CA 3VDQA 4XYEA 3GCWA 5D3MB 1GNTA 4DLTA 1EZ4A 2IRWA 2UUOA 4UDOA 1JZQA 3UMJA 4QUEA 4I9HA 3VO9A 1KFKB 2J9ZB 3O3OB 1GNRA 4F4UA 2QIPA 2FG5A 4QPJC 4ZOQI 3CNHA 5BT8A 3G8YA 2EW8A 5E6SA 3PFFA 3NEYA 5TQJA 3MHPA 1Y9DA 2EKLA 1AURA 2V0CA 4P5EA 1QAOA 1Y7PA 3TR5A 3V6LA 1W6RA 2AN5A 2P68A 5AOBA 2PZ8A 5D01A 5HSGA 4ZTZB 4GVXA 5AM5A 5EIAA 4YAGA 5DHFA 4UJ3A 1WHTA 4BGDA 1QYCA 1GIAA 1KORA 3TLZA 4EGQA 2IDZA 2BFCB 1U1IA 4NI5A 5AJTA 3UCFA 5LYJA 3LWDA 1AUXA 1KVRA 2VDQB 2WHYA 1RABA 3OWHA 3GLSA 3LOUA 3DZ8A 1AZWA 5ESDA 3KZCA 3FI0A 4E5YA 1A27A 4B3JA 1J4AA 4U6NA 5AKZA 1A3CA 4N5DA 4RJLA 4ZYTA 2XYRA 4REMA 1BFKA 1SKBA 2A1TR 1QLJA 1DFGA 4RKQA 1KE2A 4QSMA 4KNYA 5CB8A 2FFAA 1H2HA 3N8IA 5FO0A 4YMSA 1C29B 4PW0A 1QO9A 1AA9A 1C7QA 2BFBA 2GAFA 4ARSA 5LP6A 4V38A 4HX5A 2FV8A 2C3OA 1QC5B 3L7IA 1GNQA 4GEGA 4N40A 5DHTA 5JQGF 2ZTHA 4RTLA 3QYJA 4QU8A 1C7RA 3DOFA 1WDWB 3I92A 4XB1A 1V71A 2WF7A 4Y2RA 2I2FA 1F2UA 5KYGA 2PUBA 3LGXA 4NL4H 2JATA 5B57C 2CXHA 3OJLA 2AMLA 1SHUX 1OBOA 3IMEA 4ENPA 3ZG6A 3MSXA 1WG8A 1PV1A 4FYIA 3AF6A 1ZD5A 3EGCA 3KQKA 5IMBA 1QHSA 3QEMB 4ESOA 1EX6A 4O4IF 4BGEA 1IOZA 1CX9B 4KYUA 4MQUA 5B7PA 3CX6A 2JCYA 3TZLA 4HNVA 2VHWA 5DU2A 3WYNA 4DEXA 3HA5A 5JMPA 2VDJA 3CWZA 4LQ4A 3UENA 1Q3TA 2HRBA 4Q1DA 1SU8A 4FZJA 2SKEA 1W88A 5CFOA 3C8UA 4FTWA 3OICA 4M87A 2FN8A 3GP5A 1UEXC 4FMBB 4QECA 4RFSB 3SWWA 5BR8B 3VTZA 3TI9A 5E3JA 4TZTA 4YY3B 4J4BA 1YDEA 3LHDA 2C9DA 1YHZA 3NALA 4M38A 4UU0A 3S2FA 1T5DX 3AKYA 4TTTS 2EHDA 1GGMA 5EESA 1SIOA 2VXYA 4TV8A 3ZNPA 5IT0A 5KO2A 1N32B 1ELOA 3I2FA 4TVKA 1WEHA 3UAYA 5L45A 2DBYA 3FKQA 1YV9A 3B2EA 1IEQA 4DC1A 1Z8DA 4YR9A 4YJFB 5F23A 5DGXA 3SJUA 4WJZA 3G79A 4KAXA 1DRUA 2R8OA 4UNNA 3L84A 5G0UA 3B9RA 1Q1NA 2Z43A 2ZUSA 3HZRA 3U6BA 4IAOA 1Y5IA 2VT2A 3S5JA 5ERGB 3AHIA 1HG1A 3D2LA 1P4JA 3I0ZA 4WX2B 2HA6A 4OFXA 3UPTA 1QIGA 4RF3A 4FLEA 1P1BA 2GPNA 1FFGA 1KMCA 1FNSA 3P20A 4JOBA 3IURA 4PC7A 5DSXA 2WG1A 3VI3B 3WFIA 4F12A 2JI8A 1KJWA 2XYGA 3VYSB 4UCXA 1UJBA 1Z8NA 3MMPA 3D1VA 4EHKA 1HRDA 2IK8A 4O4HB 1GUAA 3OBBA 4LIPD 3Q9LA 4RUKA 5A6SA 2RGBA 3DH0A 4OXKA 4E2YA 1JX6A 1FRVA 2DFPA 2PX5A 5JDCA 4CF6A 3WL8A 3WGUA 5LQNA 3TECE 1XQWA 3BJEA 4IIHA 5KZMB 1P7YA 4WK4B 3WLMA 5I45A 3WO1A 4ETMA 5EWJA 3AIKA 2Q2NA 2QX6A 3R6WA 1SFRA 3QNUA 2P9JA 3PFKA 2JI6A 1UDXA 4AZSA 3UUEA 1UT6A 4LWZA 1BQ4A 1RQXA 4P5PA 4YS6A 3VFDA 3H65A 1R5BA 3KXPA 1T8WA 3C1UA 3MNFA 2XCTB 2ZRDA 2Q5QA 2X0KA 4B71A 2P9FA 3K0KA 2ZTSA 1VYTA 2XUQA 4R84A 5LBIA 3L93A 4ZODA 1PS9A 3CX8A 5BOSA 4UHJA 4C7OB 1JSRA 4EO9A 1BD3A 4L3VA 4Y9RA 5AVVA 1O6ZA 1HQKA 3EZ7A 5IM5A 5DWQA 1CWUA 3AF4A 4KGDA 5AJUA 3KS9A 3ZOKA 1XZ8A 3QV1A 3PQ5A 5JQWA 3NPMA 2LZ0A 4G5YA 4AYXA 1F17A 2OO5A 4HJRA 3V6MA 5J4KA 2JZNA 1WZEA 2OKCA 2QPOA 2WIDA 2C0PA 5CHEA 2XTMA 3L0YA 2O5EA 1KDYA 2X1HA 1J2YA 1A4IA 4KSBA 1EUZA 1E2JA 5K03A 2JBWA 1E5QA 3SZOA 1I94B 2B92A 4L4RA 4YAIA 2UU9B 4TRNA 4WZBB 4EFDA 2GN8A 3F9CA 2PX6A 5G40A 3OKAA 4KI7A 5L3QB 5DOZA 1L5WA 3B2NA 1IK6A 1YE5A 3U4CA 1C3OB 1C9DB 1SD1A 1ONBA 1Z7WA 1JHYA 1FFHA 1NR5A 5IC4A 1OXSC 4AY4A 4M9CA 1RHUA 2CLKB 5D51S 3WXMA 3IEXA 1OH7A 2YIMA 4BWYA 2B4TO 1LD3A 2RBEA 3HCEA 1Q0RA 1RQ7A 4Q9AA 5ALEA 4CQNA 1EG2A 5D85A 1HORA 4EG5A 2J5QA 3BWYA 2B30A 1TUEA 1V26A 2PH5A 2D74A 1EYZA 3DT8A 3EIWA 3IBFA 2J9FA 3MJVA 3FHCB 5GONA 1TJYA 3QU4A 4NEHB 3U17A 1HK7A 4M0KA 2WA1A 2ZWPA 3BJRA 4WJKB 2IGBA 1TRHA 2CVZA 2FWNA 3QYPA 3G59A 3JVUA 2ZM5A 5ALWA 1KP3A 1D1TA 1QO0A 3DAPA 3C3BA 3GJ3A 3ISJA 721PA 2IJGX 1UJ5A 5BPFA 2Z8XA 4R3WA 3UQYS 5HZHA 1FYXA 1YE3A 2XNSA 4G4SO 3UFXB 2AKEA 3ZHSA 3O8DA 2RAUA 2OLEA 4JHXA 1GU0A 4GMGA 4DA8A 3EWAA 3ZCPA 3GHYA 4L9AA 3MTGA 4KRGA 2QRUA 4QQFA 2O2IA 4CM4B 2FR8A 1FFCA 4XIFA 4DEYA 2XQIA 1QO0D 1QYVA 2YTZA 3KX2A 4I1OA 4CLXA 1BIFA 2NSJA 4RPGA 2DQYA 3TZKA 4JT2A 4Z9YA 1L4YA 4WLUA 2O8BB 2O54A 3GR6A 1WE2A 4N39A 4OQMA 3OU7A 2YXNA 3D2CA 4ZEWA 4F7WA 3I8OA 4NBTA 2EGUA 4P3NA 2HADA 2AE1A 4MIYA 1V5GA 2HPHA 2AF4C 1ZQ9A 3B70A 2XD9A 3H16A 1J23A 4KNVA 4OP2A 4R83A 5JRJA 3DEHA 3DMYA 4LY3A 3PEFA 3ZV4A 2PUFA 4TYMA 2B2XA 1CBUA 1JFVA 1ONPA 2ZB4A 3KXLA 3WLHA 4AULA 4C30A 4C4PA 3IDFA 1T36B 5K0CA 5CEEA 3GLIB 4HEA6 2FCAA 1JW9B 2YQZA 1G63A 3C8HA 4HQOA 2CJWB 1YC5A 1KR5A 2PEYA 2VSYA 1CIVA 3JZMA 1I32A 4HGZA 4P08A 5BOSB 2DR2A 1M1UA 4G01B 5JFTA 2HV9A 2GASA 2N1BA 1E7YA 1I0ZA 3I1JA 1L5NA 1JDJA 5F7OA 2XT9A 1Z88A 1L4EA 1YUMA 3ZQ6A 4BMOB 1OA1A 5EXTA 2QAGA 3HB0A 4HDRA 1G16A 2RIRA 2PPLA 3L0SA 3FY4A 4JBGA 4IOMA 4KG7A 2CZCA 4AS2A 4CKYA 5FBWB 1DEHA 3RTAA 3ZW7A 4LYEA 1TMGE 1J24A 2GVZC 3ACDA 3B5IA 3G2HA 1V7QA 2FFBA 2XUKA 5IT5A 5LYYA 3NVMB 3R3JA 4R2KA 2BLNA 3SC2B 1V9CA 1BO6A 2V9PA 3MCVA 3NAMA 1Z73A 2ROQA 1H0SA 4XCVA 5IJXA 3DWGA 5CLLA 5KVCA 3MXOA 3K72B 4FFMA 3JQ9A 3KTOA 3QLJA 3PXAA 2CL5A 1BDHA 1PJ3A 1FUKA 3Q98A 2IYOA 3C7DB 3M2TA 4HTFA 4D4JA 1A98A 2OMKA 2QY6A 3RC2A 4DIBA 2AJCA 3CCBA 2FWMX 3ADOA 4RLFA 1L5HA 3O73A 4LF8B 2BGRA 2P1ZA 2WPDD 1NBHA 2V9CA 4XGQA 1IHYA 1QWOA 1DJNA 4LHVA 4Y2SA 1V8DA 4TT3A 3U7IA 3VSDA 5A4IS 2BM8A 4NDAA 2AN3A 3DP7A 1WPGA 1MO2A 3GLQA 3PHIA 3OPYB 2IU0A 3AL0C 3GELA 3D3WB 3ABQB 5JHHB 4HUTA 3GMTA 3UEOA 3O3CA 3H7AA 3CIOA 1M8GA 4D3FA 1E0DA 1S4MA 2JGDA 1QZUA 1ORVA 2RONA 2V6GA 2YW2A 3QH4A 4G67A 4UUOA 4BX9A 5GJBA 5E0KB 5AT1A 1P2SA 2Q9UA 4M7RA 3U9LA 2OO5C 3ZBTA 3L0CA 3FMVA 1M8FA 1L1QA 2J67A 5B4TA 5EMHA 1FXWF 3PNBA 4Z7QB 4TTIA 2YN2A 1DVRA 5ULLA 4OA8A 3DBOB 2NYUA 1RWOA 4JBXA 3RDPA 1HUQA 2BONA 5U4XA 2GXQA 1T2UA 1FBTA 1BS2A 1UPCA 1E7SA 5MFZA 4DJDC 3R6TA 5EZ5A 1QP0A 1B0UA 4HGOA 3LNCA 4MAFA 2QLBA 1T1GA 2NU6A 1QVZA 1YVEI 1Q7TA 3UBTA 2GXAA 4HN4B 2V45A 4LC1A 5I9NA 3IB6A 1BOFA 1QGYA 1R18A 3ILVA 1JJAA 3VBCA 4LKOA 1Y6ZA 3HU1A 1IN6A 4RZQA 4TSFA 4HPWA 2G08A 4PPFA 4C29A 3MN1A 4UPVA 3NAQA 4RVNA 3QEJA 3DJYA 4EIWA 1G20B 3GEHA 4J91A 1ZD1A 4UFOA 3TZCA 1KIFA 5AOAA 4F2DA 3LX6A 4L4UA 2IDJA 2P90A 3W2GA 4EHJA 4FW9A 4B8ZA 3IXQA 4P9NA 3SC4A 4RSRA 1J6UA 5HDBB 3FLBA 3AY7A 1PL0A 1CC1S 1GGVA 1SKYB 2R00C 3DM9B 4B81A 1EUYA 4I66A 2H5EA 4WD3A 4YMUA 5KJ1A 2DFKB 5FEUA 4GL4A 3VZRA 3SKXA 4GMDA 5LVAA 4J07A 4UHCA 1UCFA 4DLZA 3C48A 5GM1A 2I7VA 4N76A 5ED4A 3GEDA 2OTCA 2HDHA 1K3FA 2P6NA 4KJZA 3LE8A 3H87A 3LUFA 1ZM3A 3PGKA 3TBFA 1WZIA 4MKFA 1IJEA 3CVOA 2A0UA 4G5XA 1ZRHA 2IPMA 5K51A 4GBGA 1K4MA 2HPVA 4Y6QA 5E2AA 4DSNA 2W2TA 1U2DA 2VHUA 1ORRA 2ZPTX 3T7RA 3IQEA 2BFEA 4WFKA 3GLIE 1JIQA 1TM5E 4QREA 2Q7OE 4MMXB 2DFNA 5AJYA 1ULZA 2XQKA 4EMUA 1EK1A 2B37A 5JBIA 1DADA 1AGXA 3COVA 4XDHA 4AY3A 5HF9A 1PZEA 3WA6A 1QTQA 3BICA 3K30A 1V1JA 3PCTA 3VYUB 3U7FB 4JI2B 2H1RA 2Q2OA 5EIWA 4BO0A 1R0BA 2A0KA 5JSQA 2NSYA 1OFTA 2GCEA 1G4UR 5A4AA 1T2CA 3JARB 4YV7A 1V16B 2ZDQA 1W1WA 3DVQX 4G41A 3C1OA 5IWCA 4LI0A 1KI8A 3ZGXA 1DCFA 4FDUA 1MAWA 2DY1A 5TJHA 1DV2A 4J0JA 4DKXA 1YS1X 4ZI2A 4G36A 2O8EA 1M8KA 2J3EA 1IUOA 3DLCA 3RKSA 4H59A 4CEIA 3LCRA 2B35A 4Y2XA 4PRZA 3U16A 2XKBA 1CJBA 1XCMA 3KBOA 1GV1A 1U11A 1KY2A 1VRCA 3QJGA 4KQ2A 4EFNA 4LY0A 3HM9A 4TWJA 1H2XA 2QRMA 2ZYRA 3B51X 5JZSA 1NFRA 2UUAB 1KZ6A 3N58A 1CHDA 4XR9A 5HQJA 3EPPA 1LNSA 3I6IA 4Z3OA 2V9ZA 3G82C 2P3OA 4MVJP 1QH1B 1SC3A 2Q4RA 3L7NA 4K6GA 1M73E 5ELXA 4JCCA 2UZ4A 5JZBA 1K1EA 3RH0A 4BGVA 1T0HB 2IH4A 2VJMA 5IXYA 2GJAA 1X80B 1WMFA 3QLEA 5JDCC 1H1DA 2AMYA 3KE9A 3RUPA 2QAJA 3PDIB 1K0UA 3GNSA 1U2SA 1U3DA 4WOKA 4IOLA 1MVOA 1GAQA 1TT5A 5K8CA 1UWCA 3JTEA 1BVRA 2XVZA 1E2UA 2RHMA 4MWBA 3V8RA 2QSUA 2QRQA 1TTPB 3N6RA 3OE4A 2JBHA 2XIQA 3FNQA 1RYBA 2ZBPA 1V0JA 2WPNA 1FS5A 2J3HA 1Z62A 1W8DA 3K4HA 5E7MA 3THXA 1OASA 3GA5A 4Q1CA 1JB1A 1NUSA 4OSPA 3L4BC 4KL8S 2W2LA 5ESXA 4J90A 1SIWA 2C98A 3WBJA 3AJEA 3WRYC 2CF5A 5DX8A 1SG9A 2YYZA 4MV6A 1OVGA 5JJCA 3D6NB 4M9UA 4Q16A 1HYQA 1XNJA 3BCHA 4M36A 3AV0B 3AVOA 4KNWA 3E9QA 3JD2A 4P7FA 4ARBA 2IYPA 3NOXA 1Z38A 2O20A 3QKRB 1MXHA 1HKUA 3E8MA 1IWBB 3GFPA 4UUBA 2O7QA 4KO3S 3MHTA 3U7EB 3WQSB 2NGRA 2OGUA 4YRMA 1SBIA 5AJHA 2I2XB 2UYYA 1FYDA 2XUOA 4HQRA 4CF5A 1T2NA 3GVHA 3STVA 1OROA 3R23A 3W3AA 4YJ2F 4TYPA 2HQSA 4AN0A 1FP6A 5BR7A 4UPDA 3NXSA 2G8LA 1VDMA 3FCCA 3W6UA 1B2LA 1P9OA 3R20A 2KW5A 1OF1A 3ZHZA 1TL7C 1PSZA 4CM8B 2NU7A 4QU9A 4EB3A 5JWRA 4HDNA 1WDMA 2NUAA 2ZSAA 3W4JA 4HDCA 2O8BA 5KTNA 3LHKA 1AUVA 2WMDA 3QXHA 5L7YA 2NZ8A 4QYIB 5JJBA 1S2OA 4ZVMA 4IKPA 3AFMA 2JIBA 3WA7A 4LF4B 1NLUA 3O1IC 3M4NA 5B1EA 1U0HC 1NIPA 3ND5A 2Z1NA 3UG7A 3MFYA 3ZCRA 3F49S 4V2UA 3SHOA 1DC5A 4HP8A 4B7XA 4CIDA 1NW4A 3RFUA 3DDHA 5HR5A 3DW1X 1ISRA 4G23A 4ZRNA 2DETA 1ZS9A 121PA 4A8TA 3IQGX 1AF7A 5FBZA 1UZAA 5GONB 3ND8A 3WLIA 4D99A 2QS9A 3PE3A 2BDEA 2GN9A 3DLBA 3PCXA 3QELA 4GBJA 4LXYA 1GM5A 1E2FA 4C0XA 2O2GA 2VQ6A 4KQHA 4Q4AB 3CO5A 4ZAGA 2C4KA 5E9AA 1VHDA 4DBLC 3W05A 2IW1A 2VXCA 1MC4A 1YASA 1LVGA 2QD2A 2QE7D 5J9FA 5JWHA 3DM5A 4PS0A 1L3CA 5F1PA 4URYR 4YP7A 2NYVA 5GJVC 5C1BA 1BDIA 3GEGA 1KI9A 2RHCA 4CM4A 4TSFD 1UAAA 3JQGB 3OAAA 3AG6A 3CTPA 2WFAA 2KM1A 2REQB 3UMFA 4YYZA 4FSXA 3KOYA 2W2MA 1M2NA 1NAIA 3LC1O 3OFVA 4M0PA 3K9BA 3QVVA 4WCFC 4ZANA 4RTRA 5SV2A 4RTQA 2E6KA 2E48A 4XCXA 4CV1A 4AYWA 1G55A 3LBHA 1UBSB 4Q66C 5HF5A 4FZ3A 4NPCA 4R81A 1DBQA 5U1PA 5KSYA 4WE3A 1GL6A 2PK3A 2VYVA 4O4LA 1A7JA 4OYHA 1J49A 1WTCA 2R4TA 5T8KA 4ENTA 3EZ2A 5KC9A 2WLTA 3F7OA 4UHFA 5JNSA 2HAEA 1P5RA 4ER7A 3S2YA 4HEQA 1FDIA 2JNWA 5DK4A 621PA 1TK9A 3QUSA 1QTIA 5K6RA 1WXHA 5IUKC 5CCDA 4D9KA 3K0CA 4G3XA 3OU2A 4WXPA 4XWKA 3JSXA 4F4FA 5JD6A 4CIBA 4IXNA 1CW2B 1DRVA 1USIA 2Z5LA 4GKAA 1NMEA 2BKUA 1TYZA 3AFGA 2WTNA 2ZW9A 3PHLA 1XRPA 2WWFA 4TWRA 1NUTA 1UAGA 2NTJA 2X9QA 4HWOA 1E3EA 1NY6A 2CF6A 4QQNA 5BWBA 3R9XB 3TG2A 1F0YA 3ZK8A 2YOGA 1TU0A 1UWKA 3BG5A 4DILA 1W47A 2IYLD 5EIBD 4CLOB 4ZCRA 1UXOA 4B17A 4WLVA 3DTVA 2AN9A 1ULBA 1DBRA 1BQEA 3FLEA 2V0GA 3C1TA 4Z9XA 1T9ZA 1W0JD 2Y1XA 4O4HA 1Q2UA 4NENA 3V4VB 2HSWA 2HU7A 3EE6A 3MXTA 5EE9A 3RT9A 4BNDA 1BMFA 3EF1A 2YWGA 5B55A 1NJSA 1GZ4A 1W9MA 4Y0AA 1HRKA 3CLRC 2VA9A 3L6UA 3OHPA 5ITVA 3O21A 1X0VA 5CX4A 1K92A 3AY6A 4PZ0A 3NP9A 3T6KA 2PIDA 4QATA 4H35A 5D87A 3IBCA 2HRZA 3HSYA 2PO5A 5KTSA 4PYKA 3EHDA 1OBHA 3VDXA 1KI4A 3RJ5A 5G0SA 5FTNA 3VPHA 5FIUA 1BCSB 1EFHA 1I8TA 4ECAA 4DQXA 4F04A 5ADVA 2F3TA 4G26A 2EVWX 2B9EA 4I9FA 3VA7A 2D6FA 2IU6A 1Z83A 2FZWA 5HIKA 2G71A 1F9AA 1PDWA 1TO1E 1KYYA 3NHLA 4D4MA 5LXTA 1AV6A 3ROTA 3O9MA 2OZLA 4JVMA 2YDYA 4A0GA 1OXXK 3UT5B 3KIPA 1HEYA 4U39A 1F4VA 4EKNB 1N3LA 2DECA 3OKFA 1OIXA 1P6XA 3NR2A 3W9BA 1MO3A 2WYVA 3D3EA 3HYSA 3MWLA 4NEQA 3GDWA 1VJ0A 1IMJA 1GYQA 4DBZA 4CR8A 3LL7A 3OTHA 1NPDA 1RLMA 4IDFA 4DV3B 4W5OA 3T3HA 2BHTA 3A11A 2QVGA 4HD8A 4MQMA 4GZ6A 3RC3A 2QIOA 3U7GA 1RYNA 4ARVA 2FKAA 1CR2A 1KY4A 1P61B 1QCCA 1QYWA 1Z2PX 2JAOA 2VOJA 2X8LA 3SF8A 1ACJA 5JC1A 1W36C 1Z2CA 5HBRA 1PEKE 3QVLA 3CH5A 2VNAA 3O8CA 1M34B 2C1EA 4NS4A 4ETWA 4ZYUA 5JCOC 4FMPA 4DUYB 2BCEA 2H07A 4HDRB 2GJ4A 3FVWA 3K7EA 1G21E 3H9UA 3NS7A 4W1SA 5I9MA 1TZBA 5J2UA 1K5PA 4ILEA 3OM9A 2FZKA 2X1MA 2I3DA 2PZBA 2VHJA 4QGHA 5C8YF 4YUWA 3TOXA 4UHBA 4Q24A 3HBJA 4P38A 4F60A 5JH7A 3L8GA 3HDQA 5BV7A 1Z4OA 2ONZA 2XGGA 4DOMA 1MKYA 4NBUA 2HB6A 3ABRB 3BRWA 3F2VA 3KKOA 4XD7A 3ROQA 3S68A 5LA6F 3WRYA 1DI0A 4YMWA 3WQRA 1Y9JA 1MP0A 4QASA 1FNCA 2WWRA 4MUAA 1GQSA 3T0FA 4XUEA 5TE9A 1N5OX 4Q48A 4DLKA 1Y3AA 4ZYXA 1F8GA 1KMQA 1JQLB 4RBNA 4MW4A 3TN7A 4D25A 4MDHA 4LDQA 3GIWA 4OYLA 1TFRA 3ZIDA 3L8YA 1UPTA 3M70A 1N5IA 3GJZA 4G1BA 4RKWA 4ZPXA 2IX3A 1LEHA 1N7GA 1RLTA 5DGCA 1YGPA 3H04A 4WKBA 1OPXA 4HX2A 4YLYA 4KQKA 3HO8A 1QQ7A 4X0EA 1B8VA 2YJGA 3EVDA 2NYAA 2YJNA 3NHYA 3TCNA 3T38A 3KEFA 2EX1A 3TW0A 3ZY3A 3BJMA 3EW7A 5E1OA 4ENUA 2IYNA 4JLVA 4A26A 1AKYA 1OTHA 1G5IA 2Q0HA 4PGHA 3WZMA 3CUUA 4RHYA 4EGFA 1I4DD 1F14A 2R5NA 5IDYA 1ISGA 4OI1A 1ULUA 3F7TA 4YUXA 4TKLA 4G65A 2AR9A 3ZK7A 2ZIWB 2R86A 1KS2A 2EZTA 3HVJA 3QE4A 3A8TA 5FHRA 3OF3A 3KSDO 3TNYA 4BLSA 2G04A 1E3IA 1YR9A 1NJGA 1VI6A 3NDIA 4ND8B 1J7KA 1NJ8A 2G70A 1ZU5A 1GN8A 1RZUA 2R1VB 1D2AA 1CY2A 2PT5A 4J9UE 4RMHA 3B7PA 4CTOA 2O8DB 2HFKA 3ROZA 1FK8A 1ZRMA 3OO0A 3THSA 3WLKX 5I7FA 4HRVA 4CM1A 2YIJA 2PUHA 2E5FA 3L4EA 3MMNA 4LYAA 4OF4A 4FYHA 4FYVA 1N4AA 1EFPB 4DR6B 3RREA 1EFVB 1XUOA 2GX6A 4HAZA 4E5KA 3HMQA 3BE8A 3RTBA 3UYLA 2HIMA 3BHJA 1XZDA 2HA7A 5IKOA 4H1WA 3SG0A 1FX0B 2HEIA 3Q8XB 5BN4B 3UAGA 1U1DA 2ZQYA 3MGBA 1QK3A 1XMVA 4WEOA 1IJFA 3O3MB 3S1AB 5ABPA 4CQJA 2UZ3A 5IF3A 4ZXFA 3H2JA 4BPRA 4OA5A 2JFBA 5A3VA 5BRJA 4ND8A 4IYJA 3TLBA 3DEIA 4RXTA 2ZT8A 3ZCSA 1JFFA 2C2XA 3G2OA 3PNOA 4RY2A 1R8JA 3EASA 3GAZA 1TLFA 3L7LA 1Z26A 4O5OA 2Z2JA 4C20A 1G6Q1 4AO7A 3OCVA 2DCUA 5DP2A 4FFLA 3W5IA 1NPTO 4GUAA 3L05A 1FLVA 1Z0KA 3FFAA 2D62A 2MYNA 1FZQA 1Q0TA 3WQQA 3E58A 1ZONA 4UUNA 1EM8B 4JJEA 5EKUA 1PL7A 2YY6A 3VR4H 1GU7A 2JEYA 4EGSA 2H1IA 2QX8A 2ZXUA 1F12A 1B2RA 3EGIA 1SIUA 3BFKA 4PO9A 1E1MA 3A1WA 3H9GA 4FBMA 3ZOZA 1I24A 1O95C 4BKOA 5J4LA 3ZI4A 3OEEA 3ZKWA 1W5EA 5CMLA 2QTRA 3PHCA 4EGCB 2AVDA 5DCLA 1R0YA 4B2PA 1ZG3A 4M1YA 4IIDA 3H9JA 3ZLTA 4C4ZA 1L4BA 1AHIA 2RB4A 4TYNA 1H6BA 1Y6FA 1NNSA 4CFYA 4R51A 1YTUA 2C5SA 3VHXA 1OLSB 1Q74A 4MGEA 4MUHA 3PNLA 4YP9A 3KDAA 1JF8A 2BHLA 4ZU3A 3S7TA 2JKZA 2V1UA 3ZWKA 4M7OA 1GAWA 3OA2A 4MB0A 1JH8A 3ORFA 3V4PB 3ZTYA 5I9TA 4HH1A 4II7A 1IG3A 3X1KA 4WK2B 3QPUA 1GDDA 1NW6A 1UBFA 1ZCBA 1ZXBA 1C81A 2UV8A 4DLXA 1PR4A 1SCUB 4E2ZA 2ODEA 3OQPA 3MOIA 1YQ9A 5TC4A 3K09A 1U2TA 4UTXA 1WULS 2WOJA 1M6HA 3X1ZA 3X43A 3TUIC 4ZDKA 2X2EA 1ISPA 4WXYB 5IVDA 2WR8A 3TQCA 4EUSA 1T0IA 4ZOCA 1L7NA 5K2OA 3R24A 3Q7QA 1QIJA 2JAHA 3TOZA 2BYTA 2FZEA 1GGEA 3A4VA 3IP8A 3PXCX 4IX1A 4D6XA 2QU8A 1TADA 2VP9A 3FFWA 4EG4A 1SU7A 3LX8A 3KKEA 4J03A 2IWHA 1Z7GA 3JWEA 4IRXA 3RIHA 2XZDA 5BQXA 1H4TA 4GKKB 1O5OA 1M3SA 1USUA 5FLXA 1O0SA 4AWXA 4E6EA 3J81k 1J42A 2E4WA 3EXG1 1WXDA 3JD3A 4WBSA 3SSNA 3T3NA 4FOLA 1L5KA 5AKLA 2QTZA 4Q9IA 2E1PA 4RIFA 4LSZA 2JCGA 3B1WA 2CV2A 5TF0A 3JD1A 3Q0IA 3V4RA 1QSGA 3ZWAA 2QN3A 2B2NA 5AM1A 2ASVA 4QT4A 4KGXA 4HB3A 2EERA 3CUSA 3ZEIA 3QVMA 1NF9A 1Z5OA 3M6MD 4KIFA 2B4YA 2CXXA 2F17A 2YXBA 4ZHQB 5IDWA 2ILVA 1MFZA 2OMEA 4JL5A 4EHAA 5EMLA 3QXCA 3RKRA 2PV0A 3MRTA 4BE9A 2UZ1B 3W8DA 4RACA 4Y6GB 4ARAA 3KKQA 5JXIA 3OZAA 4V0MA 4W9NA 5FOXA 4QOFA 5F9HA 2HJVA 2JFFA 4CN8A 2VSOA 3HJNA 4ZU1X 1JAYA 1PUXA 3R3YA 4RELA 5CP8A 5HFNA 5CJJA 2NO5A 5EVCA 2HU2A 4DABA 4FYKA 4L74A 4D8UA 5JT1A 4W5TA 5LSAA 4YHBA 3UM9A 4IIFA 3IJ5A 1BQ3A 1VDZA 1DEKA 1HT0A 2RAPA 4GYWA 4DRYA 2NVWA 4X54A 3OC0A 4KIUA 4WAUA 2CZGA 5ALSA 1BX1A 5I4KA 3W9UA 2X0EA 4FQ7A 1WU7A 2CV0A 3RTDA 1Y0BA 2JHPA 4PZPA 3C24A 5FD8A 4GBED 5KX5F 1K86A 3IR5A 1KARA 1T6XA 4C7OA 3NHRA 2UUBB 4CFSA 2BGNA 4R9RA 4BKUA 1JFFB 3VR1A 2IPXA 4J7CA 2DLNA 2R65A 1KZYC 3BRWD 3TOVA 5GMOA 4PIVA 5C4IA 1O95A 4B8WA 1US8A 2W48A 4REOA 5C37A 5HKOA 4W5QA 4BFVA 4KHPB 1W30A 1XLTC 1D0VA 4Q1EA 2HUNA 5JE8A 3KXKA 1WHTB 5IUJC 1NX9A 2YFKA 3AKZA 5HIJA 3SDSA 2CXSA 1EBBA 2DAPA 2PX2A 2WE7A 3EXEB 4RQBA 1NLYA 4EQ6B 2ZSHA 1JXMA 5FOTA 3HUDA 5DM1A 1XDUA 1ZGZA 2ID4A 5BRNA 5D86A 4BO7A 1N5MA 1Y4ZA 2X7JA 3GO4A 4KUGA 5HGJA 4YJHA 3S99A 4MV4A 3W90A 3WLQA 1KNXA 4B3HA 4GW3A 2IF2A 3QJ5A 4Z6KA 4Z7NB 5D3MA 2O14A 5B3AA 4LKRA 1EUCA 1OLUA 1PUJA 4QXRA 4A0QA 3I62A 3ZLVA 1K4KA 2EWWA 3AR7A 3HO6A 3DXZA 4RV4A 3SOPA 4MQFB 3RRFA 3WRXC 4DUPA 5I7AA 3TL2A 3AHCA 3EFOA 3OPYI 1Y8QA 1S4QA 5EIXA 4OU4A 2IBMA 4BPBA 3NOQA 1LC3A 4L02A 1FXSA 3VKVA 1KC3A 3UTCA 2IEZA 1Z56C 1ANKA 1H1TA 1FDOA 3E70C 3K5PA 2BEUB 2PS1A 3AF1A 1TCVA 1XEXB 4I1RA 4B3BA 3FGNA 5K9ZA 3DA8A 5HCIA 1HG0A 1YGYA 2B8TA 4LISA 3BORA 4QFBA 5HKLA 3ZDQA 3T9FA 5IANA 4RFVA 4I9UA 3SMVA 5JG7A 4GVPA 2BMVA 1Y8RA 4BUZA 1YQQA 1MNAA 4MQEB 4PNEA 2H31A 1ZQ1A 3N7TA 4HSEA 4CRWB 1IZ9A 3OY7A 2ARKA 2QMHA 4KSYA 4LRXA 5FWXB 4JKOA 5IG2A 2GM5A 4ZRDA 4XGRA 2QQ0A 4MJ7A 5EIEA 4B80A 3R7BA 4DIKA 1AKTA 3ZHOA 1E6MA 3VI4B 1O58A 2P7IA 1FU7A 1R4MA 1Z4NA 2G8NA 3WK8A 2DWUA 4CKWA 5EJMA 2BBSA 1PFVA 5JRZA 2RHGB 3IP1A 5TQ2B 4PYLA 1LI7A 3CGGA 3WNQA 4BNNA 4D9NA 4AKHA 3GXOA 1X9GA 3UC5A 2O2YA 3D6TB 1E3WA 1DAEA 3NFYA 2VYFA 4IF4A 2ZE5A 2PQ2A 1JG3A 3DBHB 3OLCX 3MCAA 2C5LA 4RMGA 3ZXSA 3ZZ1A 3FKSD 1T4CA 2CVQA 1ZM4A 2BY4A 3A05A 3Q5DA 1IFXA 2QTWB 2QUZA 2V98A 1T9BA 1Q14A 4X6YA 5J2UB 3UJAA 3ZWMA 2W70A 1SCIA 1PR2A 3NLLA 4TTAA 3RRJA 1Q0PA 4QT0A 4OB7A 2J0QA 4E1BA 2NMVA 4LZWA 3DE1X 3VVLA 3L7KA 1QUEA 3HWX1 3BILA 3SR0A 3AP2A 5ECDA 3VSCA 4F56A 1APBA 2GYWA 2OVBA 2VTEA 4LRYA 3MT7A 2FHSA 1XMXA 4JNKA 3HJHA 1X7ZA 1H9BA 4J4HA 1V8PA 4AS1A 2HIGA 1MC8A 2BM9A 2PXXA 5EHIA 4XX0B 4M1ZA 1EK6A 4P81A 3SZMA 4RANA 4F2HA 1OAKA 3FGOA 3DE0X 4AN4A 1IY8A 3A4NA 4DV2B 1QQ5A 1NBMD 2GLTA 2H5IA 2FW7A 4A73A 4B3FX 2GN0A 4YWJA 3AOEA 4CUJA 3KBBA 1EAYA 1EGMB 3BYZA 1C8LA 5E6RA 1I2MA 4GM4A 3FTPA 2G67A 4HOYA 1OGYA 2XEXA 3MOSA 1DQRA 1HE1C 2ZXFA 3LRPA 2R60A 4RM2A 2AWOA 4RHXA 2EG9A 1H5NA 3G0GA 2EBUA 5L3RA 3ETEA 1NW9B 2WLSA 1OA0A 3COYA 4BWGA 2IDMA 2XCIA 1KYVA 1YSCA 3H6GA 4ZCSA 1GFZA 2H2WA 1G2IA 1XZJA 2P7HA 1CZHA 3L7CA 4RZ3A 3OOJA 5DM60 4E5DA 1WL8A 3A1NA 4LDJA 4X97A 4ERNA 3MLAA 1IY9A 2ID8A 1ZM9A 2W8BA 3S6JA 5LWQA 2BTEA 2VTVA 1NW3A 5FJIA 2CW5A 5CDGA 3C41J 1H2ZA 3BZUA 4F5EA 1FNBA 3MLEA 1FUIA 2SECE 4V0RA 1X80A 1HDYA 2OO3A 4BYGA 1LH0A 1X7GA 2F3RA 2MIIA 4G84A 4BX8A 4EJ2A 1I4EB 5F77A 5JS6A 2XBMA 2HX1A 4OVKA 2PWPA 3JU3A 1FMCA 3S28A 3TQHA 3QQPA 1E2HA 1GRNA 1T24A 4H1TA 3WO0A 4CGZA 3LP5A 3BJZA 3TLGB 5JSUA 3EX7C 1ZRSA 1N0VC 4AZ3B 1EJ2A 2D1TA 5M5BA 3EA4A 3I5MA 3M82A 3NB0A 4JJIA 3TD6A 3TL3A 3N53A 3V3TA 1P81A 1JEOA 2A58A 4UU7A 5JAHA 4JXXA 3CF4G 4MB6A 4DM7A 4BRUA 5HRAA 4TWAA 1X77A 4BNUA 4H7HA 3QK7A 4O5AA 2R47A 4NNPA 4QJ5A 2C2GA 1JDUA 1V3UA 1TC2A 3AR4A 1SQFA 4YBZA 3KKKA 3IH5A 4BBAA 1VJGA 1OILA 4IDPA 1JAHA 1JQAA 1UP4A 1VBMA 4YCSA 1ZW1A 1UBOS 3BN3A 1XPJA 3RRZA 1RXCA 3AU9A 1LBTA 4MYDA 1PGNA 1YR6A 4HEA1 5ALRA 3JWGA 4E13A 1K98A 4LCBA 1OT5A 1NSYA 5J1TB 2XHZA 2IY8A 5JV5A 1Z4QA 1GCUA 2EG5A 3LYUA 3QUCA 4O1IA 2PD6A 5JVDA 1E8NA 3MA0A 4MP3A 2IE0A 5M7EA 2G88A 2C95A 1IPEA 3F8SA 1C4KA 2BTOA 5FOUA 3VR4A 4BKQA 4QYTA 2VDRB 1KI2A 1R50A 3IP9A 3RRXA 1VJRA 2RHRA 2B7CA 1NXXA 2X1LA 2QUIA 1SUIA 1MW8X 3RBXA 1GSAA 1R0LA 3DYVA 3WB1A 4WN3A 4A0SA 4TLEA 4O4JF 1PP4A 5CNJA 4OQFA 4B2IA 1BN7A 4EVRA 2LVBA 4XVCA 4KFRA 1WDKA 2AZ4A 3QPBA 4RDHA 2BR3A 4DA7A 2OHJA 3BGWA 3C5VA 3KAKA 3WYEA 1M6NA 1XA3A 3FWZA 1QRUA 2P11A 1H5QA 3IT1A 2UKDA 1Q1ZA 3ZR4B 3DEYX 4EB6A 1CY7A 3GQBB 3G7NA 4AZWA 5KWIA 1WRBA 1VM6A 1F0PA 2H2IA 3LK6A 4Z0TA 1Z0UA 3T4UA 4CT4B 1UUFA 1YOVB 4J16C 4UHHA 4L0MA 4PNZA 4RVFA 3SYLA 4B7AA 4PHTA 4CDNA 1T1SA 2XB9A 3VNUA 1PR0A 1F8XA 3OCYA 2OZKA 3K2QA 4UAJA 1AXRA 8AT1A 1RIIA 5AJVB 3WKAA 3OJCA 3H0CA 4CU2A 5IULC 2SKDA 4EKIA 1Q91A 2H1LA 2RGEA 3ETCA 4KMMA 4ZCIA 4Y6LA 4MB2A 2JLCA 2RHTA 3ZVNA 2JFOA 3TTYA 3B36A 2EYQA 5CM8B 5EPEA 3VNQA 3U5ZB 1RJ9A 2GJ9A 2YZKA 4LHSA 3SJBA 5IW8A 4EMTA 3F2IA 4I6EA 1RRKA 3UCEA 5TT0A 5HIAA 4PCUA 3VZSA 1XPOA 4MMZB 4J29A 3UV3A 2O8NA 2QMQA 5FFFA 2HSGA 1DKQA 4MP6A 1WNFA 2AX4A 2VUUA 1CY4A 2KS6A 4HNAA 5BV8A 4EG8A 3TFWA 3F6RA 1DIOB 3G0OA 4FXPA 4PV7A 1DAFA 1U28C 2DBZA 4KKVA 4YMIA 2VEOA 1VPDA 3TW8B 5KNDD 3LUCA 1NDQA 1YL6A 3MF4A 4B09A 3GJ6A 4IHJB 1HE4A 2G9ZA 2I3GA 2ZSDA 3TD9A 1UZNA 2IZ5A 3ZU3A 4DWWA 5B7NA 1CUHA 2XR1A 1VE1A 2GBFA 4NNJA 1KFJB 4TTQA 2CDNA 1E9DA 2ZKIA 3IC5A 1JSXA 4FYXA 5CXQA 2NZVG 4CKBA 3GRUA 1WAMA 5EMKA 4ABTA 2VYNA 1QAMA 3Q3GE 3KAPA 2F1JA 3I58A 3FWKA 3E9MA 4Z53A 3LC2O 3FBWA 3PNPA 3QF4A 4QPZA 4N3CA 4I5FA 4I7EA 1Y6QA 1E61A 1JIUA 1Y3HA 1Y98A 3HKEB 2SHKA 4KBGA 4JLUA 3FH0A 3MGKA 3W5DA 2Q1UA 3JCZA 2PRYA