1RHJA

Crystal structure of the complex of caspase-3 with a pryazinone inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rhjA00
4EJFA 1QX3A 3R6LA 4IEFB 2CDRA 4JR2A 5IARA 4QUDA 2HBZA 3PD1A 4HQ0A 4ZVRA 3DEIA 2QL5A 4FEAA 5LU9A 3R7NA 1K86A 2H51A 2CNKA 4QUEA 4DCJA 3DEKA 4ZVTA 1KMCA 2K7ZA 1RHMA 3NS7A 4ZVPA 1NMSA 1RHQA 4QU9A 1RWWA 1SC4A 1SHLA 4M9RA 4ZVUA 2XYPA 1RWKA 4PRZA 1PYOA 2C2OA 2FP3A 1RWVA 3H11B 4FDLA 4ZVQA 3V4LA 4PS1A 3R6GA 3EDQA 1BMQA 1JXQA 4EHNA 4JJEA 3KJNA 1RHRA 1F9EA 2FUNB 1PAUA 5IAGA 4NBKA 4QU8A 1SC1A 3V4OA 4I1PA 4NOLA 4LSZA 2C2ZA 2CJXA 1GQFA 4AWAA 2QLJA 2XYGA 3K7EA 5IC4A 1RWMA 4N5DA 1RWPA 1CP3A 2FQQA 1I4OA 3H13A 1I4EB 4FXOA 3P45A 2CJYA 4HQRA 2HBRA 4N6NA 4NOJA 5IANA 5IABA 3V3KA 2WDPA 3E4CA 3OD5A 2DKOA 3GJTA 1IBCA 3IBFA 1RWNA 2CNNA 4PS0A 5IBPA 1M72A 5K20A 4JQZA 1RWXA 3D6FA 2H5JA 4JR0A 3GJQA 3SIPA 4DCPA 4QUJA 2C1EA 2H4WA 2H5IA 4QTXA 4QULA 4I1RA 4QUIA 1RHUA 5LU8A 3D6HA 1NMQA 2XYHA 3V55A 5H0IA 3R5JA 5IAKA 3P4UA 4QUAA 1NMEA 4QUHA 4QU5A 5IBCA 5JFTA 2H48A 3H0EA 3NR2A 4QUGA 2XZDA 5IASA 1RHJA 3DEJA 3S70A 1NW9B 1QTNA 2QL7A 3GJSA 4QU0A 2XZTA 1RWOA 5LUAA 1RHKA 4EHFA 4EHKA 5IAEA 3H1PA 4D3XA 2H65A 1QDUA 2HBQA 3NKFA 4N7JA 4FGUA 4AWBA 3V6LA 4DCOA 2J32A 1SC3A 3S8EA 1K88A 2QLFA 2C2KA 3QNWA 2QLBA 1RE1A 4PRYA 2H4YA 4AW9A 4D3YA 3UO8B 2CNOA 3EDRA 5IAJA 4EHLA 2AR9A 2QL9A 2C2MA 2Y1LA 4EHAA 3R5KA 2Y0BA 4N6OA 4IYRA 3R7SA 2J31A 2J33A 3V6MA 4NBNA 3DEHA 4JB8A 4QUBA 1CVRA 2P2CA 5I9TA 4JQYA 5IC6A 1ICEA 3H11A 1GFWA 4HVAA 2J30A 4ZVSA 3GJRA 4ZVOA 3D6MA 3SIRA 4JR1A 3KJFA 4QTYA 3ITNA 5I9BA 5IBRA 3KJQA 4EHHA 4EHDA 4D3ZA 3RJMA 3PD0A 4NBLA 4JJ8A 3PCXA 3UOAB 1SHJA 2CNLA 3BIJA 1F1JA 4N7MA 2HBYA 4NOKA 5LUBA 1I3OA 2H54A 4NOMA 2NN3C 3R7BA 4N6GA 4JJ7A 1I51A 3IBCA
chains in the Genus database with same CATH superfamily
3WJ2A 1SBYA 2AC4A 4CR6A 3STTA 2A84A 4OMUA 4ZAXA 3DEZA 1JR3E 2VP0A 4L08A 3PGLA 2D62A 1C81A 1P18A 1JT9A 1Q19A 4DCJA 3O1LA 3ZCPA 2EBWA 2G09A 1ONPA 3L46A 4IQ8A 1MO5A 1OXTA 4P5PA 5HTKA 1T29A 3IVRA 4LE1A 4PZ0A 3TIVA 1HNXB 3VU8A 1J0BA 4TYNA 2RHDA 3JAWA 3L3BA 5EZ6B 2C2OA 2Y0CA 2DHEA 3OETA 4FTWA 2PGOA 2XIJA 4L4ZA 4TLDA 4EG4A 5ALDA 1GZ6A 4YCBA 4QDUA 3L0YA 4NL4H 1JFFA 2W2KA 4YV2A 1K7FB 3IJEB 1TX4B 2K2QB 3HM9A 4IOMA 4HLUC 1BAPA 1TJ4A 1CRQA 1IK6A 1CK4A 1W75A 2RHLA 3DJYA 4IO0A 4OG2A 1QORA 5FEMA 4PR0A 5JWHA 1AKRA 4Q1EA 4KQGA 4W8GA 3IE2A 2HWXA 3K7EA 2Q0SA 3CKLA 3JASB 5FBQB 4DWJA 4F4DA 3AFNA 3LS2A 3NEAA 5BN4A 4XGKA 1G3QA 4FFBA 5J4LA 5LQNA 2GAAA 4WSOA 1CUUA 1FJ2A 2FDXA 2UV8A 3TQRA 3R20A 5JZOA 1DINA 1MRSA 4RFVA 3V9PA 1XZEA 1EUCB 1VCNA 1RXCA 2V5AA 3FTDA 3NFYA 4IOJA 3QVLA 1YR7A 1VIAA 3THOA 5C1DA 2XNDA 3FCCA 2VCYA 1SG6A 3PENA 1LUAA 3HV0A 3RRNA 4WEOA 2XCIA 5HRAA 4N0DA 1OLXB 2R60A 3DUFA 5DHQA 4XDZA 5BYJA 3ZTYA 5K3BA 3ZLVA 5ITWA 1MO3A 2PA0A 5A3SA 1E9RA 5IVDA 3P9XA 2PJUA 4CTJA 1SWWA 4BNJA 1H2WA 1Y1TA 2AUTA 1ZJJA 2Q3DA 3BBLA 3MT7A 4UAJA 2GM4A 1W6UA 3QLUC 5JCXA 2E18A 4WI1A 2GEDA 3RVSA 1NG9A 2DXIA 1PR1A 1ZA2A 2QN3A 1SOVA 4IDEA 4OUKX 4EEZA 3RO7A 3UJCA 4AUNA 1ZXLA 3SBEA 3KKEA 4AYTA 2ZBGA 4XYBA 3I6BA 1ZD4A 2CHVA 1EGVB 3U17A 2O7VA 4Y2GA 3USZA 3QUTA 4B17A 1ZW1A 1Y5LA 1ZGBA 4OGFA 3TD9A 4E7PA 2H4HA 4JBXA 3CNOA 1TL7C 4KQWA 1LPSA 2DHRA 3FVVA 1INLA 3NOXA 3H19A 1JLLA 3EDRA 5G40A 4XWGA 5KYTA 3PEWA 2AR9A 2I67A 1Z0ZA 1ZL0A 2DWUA 3IAM1 4RKEA 3ZD9A 4DMGA 2ZS9A 3OQVA 4WT7A 4ZMSA 1Q0TA 2I65A 1S0UA 1HDXA 1S7GA 1JAIA 1ADCA 3QFTA 4HTAA 4O4IA 5FTNA 3G1WA 2H3EA 3U26A 5EP2A 1XEWX 4DV1B 2R6GA 2C00A 4JJ4A 1Z5UA 1E60A 3EVCA 2IE8A 2C2YA 3I1FA 1Z13A 1A8QA 2Q2OA 5B6JA 1Q12A 1XNJA 3GFPA 3KQSA 3KWLA 4K6FA 3VC2A 4JROA 4CPDA 2H1WA 3HCAA 7ABPA 1EUQA 2NO5A 5IN4A 1SXGA 1W4AA 3A1FA 3L5OA 3OHPA 1R9NA 2VP2A 2XT0A 2ZBUA 2A1UA 4H6VA 4IP0A 2I66A 2PH7A 1JIJA 3KE9A 3HU3A 1QR2A 3GRYA 4UNIA 3HWX1 3LY9A 3OPYI 1E9DA 1L5QA 2VZ9A 3M6XA 2OA0A 1KE2A 2CW5A 3M34A 5EE5B 4N0PA 1Z47A 2WJHA 2XECA 3WAKA 2O14A 2XTZA 3CWQA 3H97A 1KSHA 2DQ4A 2XUQA 3AV0B 1ECPA 2D54A 2IHBA 1TD1A 3DZDA 4ZAFA 5F35A 4EB0A 4HDAA 1IHPA 3E9RA 5I7UA 1OLUB 4PX5A 5I4BA 3K8YA 4C4YA 1ZI8A 2PX4A 3GHYA 1YBVA 2GRJA 2NTNA 3P27A 3WQHA 1L5MA 2HJWA 1HGXA 3GP5A 4NZOA 5LQDA 3G2PA 1F2VA 1M2KA 1X9GA 1F7UA 1TT5A 4KWHA 3B3FA 3E5MA 4HVCA 2R4TA 5IAAA 2G9ZA 1O8CA 3KXDA 4UBIA 1NOKA 3O8DA 5DHFA 3RFXA 4W5NA 1T5IA 2PMWB 4RCYA 3RU7A 1WZNA 2JEOA 4N7RA 3TOSA 1OV6A 1XVTA 2VWQA 4C4TA 3VVCA 3GAMA 3KS9A 1CR0A 3OT1A 4LOLA 1T3ZA 1N9ZA 1GQ2A 1OF1A 2XAUA 3LTEA 4TT8A 5IRCD 3F6CA 2JGRA 3TWOA 4B3BA 4I81A 1D1QA 2AQKA 2QI9F 4M3NA 4MITA 4QLBA 3KEOA 3L8HA 3V48A 3QRWA 4E2ZA 4UOQA 3LLMA 5KKNB 1E6UA 3F5FA 3QE2A 5LXTB 3GFOA 3NHBA 2GSWA 4JUIA 3WKEA 2X2EA 3QEOA 4N8DA 1PJ8A 4X84A 4E1AA 4MVJP 4BZZA 3WLKX 2WHEA 4B3TB 2P77A 4QDJA 1TRKA 2WR8A 3OJCA 2ODEA 2KJQA 1C8LA 3ANSA 1L4KA 1VPVA 3MPUA 4PGFA 5E1MA 3LDGA 4MCIA 3ETLA 1GUAA 4CF6A 3MBIA 4OVKA 2KPOA 4X1KB 5CVEA 5E1DA 2ONZA 2CY0A 1WBJB 2G63A 1KDZA 5HF8A 3PTLA 2XSZD 4H27A 1YV9A 4UUNA 1H2FA 3UPTA 2IHKA 2V97A 1WTCA 2BHTA 3ND5A 1GGKA 1RAGA 4PSDA 2JI7A 3RG8A 2AYYA 1ZNQO 1DHRA 3M9XA 4H4EA 2EWVA 4B6OA 1SKAA 2HDNB 4GP9A 5JCOC 2OCGA 1GVNB 4OI2A 5IT4A 2VPIA 2PZLA 1ZIPA 2XEXA 1PF7E 4KX3A 5KTOA 2ZSIA 4ZHQA 4GX1A 1FS6A 2R85A 1PGQA 1II8A 2Y67A 2JH3A 3IHLA 1ENOA 3HFGA 2V74B 2PKYX 1NT4A 3MTJA 4K2HA 5ANRB 1EFVB 1N2GA 3WQSB 1RI5A 3TE7A 4MSUA 2R4QA 3M1LA 3WB1A 1FF9A 3ENKA 1UC5B 2Q5EA 3IGFA 1RYEA 4HDSA 3UMFA 2OHGA 4B6QA 3IUJA 1JJ7A 3BRQA 3JQEA 3JRNA 4P34A 5AKJA 3U62A 4CG0A 3A4NA 2XGGA 4EG6A 2ZRJA 5REQB 4MVWA 4DDMA 2R8PA 1F3OA 2Q6TA 2V1XA 3KAQA 1BNCA 3RYHB 3HR8A 2YNMC 1JW9B 1R6DA 1O54A 2YZKA 4FYXA 5A6VA 4RK4A 5BMVA 5BQOA 2BDTA 1GUFA 1Q14A 1PJZA 2YJGA 4GP6A 4NABA 2LCFA 3ZZ0A 1DADA 3KRTA 4B3IA 5FADA 4IDPA 4ONEA 1K97A 3PS9A 2GAJA 3KVVA 3NLLA 4MARA 1B4DA 1O94D 3M6WA 3WLOA 5KJ1A 2PSJA 1H5UA 3NHKA 5JIBA 1Z6AA 5ALQA 2ON6A 1OB5A 4YRFA 3F49S 2FEAA 1SCIA 3L4EA 5MN6A 3OZTA 1O6ZA 2BEKA 3VBCA 2NXCA 2W70A 2B1RA 5KS2A 4R9RA 5PGMA 2QR3A 3K1TA 1OA0A 2O07A 3DOCA 1IEWA 2NV0A 3M6VA 4Q24A 5TRTA 1E0AA 3CR8A 2VFAA 5AJWA 1CY2A 1TZCA 4CLRB 4BX8A 3VAYA 3GAFA 1V11A 2QNIA 2NXNA 5SYNA 3WYNA 2JLYA 2GM5A 3R24A 3WBBA 3E8MA 2C84A 4JLPA 1Z8HA 3CEPB 1FRNA 4RKQA 3WWDA 1KI4A 2OFFA 1JEYB 2QGFA 4KFRA 5JAPA 2O3TA 4HDMA 4YQEA 5C3MA 2X9GA 4E94A 5JS1A 3GRVA 1O9HA 2CJXA 2ZRPA 521PA 4V02A 2FW0A 3OP1A 1A9XA 1W4CA 4LQDA 3QLUA 4O2AA 3VDXA 3JVUA 1J2EA 1W2GA 2C2BA 1X7YB 3AEQA 5CLHA 3TRDA 2P40A 1RVV1 1J06A 1K7SN 1WXDA 4R3NA 1D1TA 4TROA 1BU8A 3LYHA 3MCTA 1YGYA 2F55A 4NXMB 1A9RA 3LRPA 3DB2A 4BFCA 2P9BA 2GPJA 2H07A 2PBLA 4HDCA 3F96A 3G2HA 3A3KA 1GQRA 3TNJA 4V3CA 1BFKA 2V7TA 1D2CA 1TM7E 4ILEA 4YFVA 2UKDA 1LF0A 3R40A 5D5QA 2M1ZA 3IQGX 1EINA 3LW8A 3GCDA 3GI1A 4OBEA 2D1YA 2Z2KA 2Z1MA 3B5JA 4B34A 4GRIA 5CFMA 3WO1A 1XN1A 1Y7TA 5TF0A 4C0QC 5CA0B 3FOZA 2PX3A 1QTNA 1GRRA 2PE5A 4B09A 1JVBA 1AMNA 2Q9BA 4PSAA 4D9IA 1PGNA 1D2HA 5LA6B 1G21B 1QYDA 4UOEA 4UTRA 1XDSA 1Z6YA 4KAFA 4D45A 2OTCA 4LGCA 3DHWC 1WCV1 3R09A 3ZJYA 3WADA 3GUZA 1JDNA 3NXSA 2WE8A 3SM9A 2E5WA 1E5LA 1B8UA 1C30B 2G40A 3EQ2A 2JFPA 3ESQA 2JLRA 1XN4A 3KEQA 4Y30A 3T0FA 4Y0VA 1M0EA 4G1BA 4QXAA 1XEAA 3H2IA 4C7MA 3UJPA 4ENUA 3I9LA 5LMCA 3TUIC 1NNLA 1K66A 2BTQA 2LE0A 5DHTA 1AMUA 1RRKA 4IJUA 3VGPA 4JSTA 4GH5A 4EJSA 4HVAA 1XTVA 2OSBA 1Z17A 1GR0A 2QTWB 3B6EA 4ZVMA 5A1JA 2ZCJA 1KTVA 4G5SA 4I5DA 4DQ0A 3K35A 3UVEA 3UHJA 2ZROA 2FYTA 4RMHA 3PPIA 1WIWA 1O03A 3ZZMA 2WTEA 1N4AA 4NS4A 2GHRA 4XGIA 5HZMA 2IP1A 3LU1A 4YUYA 4Z4FA 2RGAA 4I9NA 3TG2A 4ZTUB 4AL4A 5AMXA 1Q1BA 2I34A 2PKCA 2R96A 2V6JA 2AOXA 2ZVPX 5AJYA 2YHAA 2X5XA 1AZSC 1JIXA 1QGYA 4FC7A 3PRHA 1V8DA 1BSVA 1K68A 4MX8A 1E2BA 5KBYA 2QMUA 2VO1A 1JFTA 1Q91A 4G5QA 3C39A 4AF7A 1TGVA 2H29A 4K6OA 4K9NA 4E33A 1NUHA 2WG2A 2YZGA 3F78A 5LR6A 1SXJC 3LIPA 1T4CB 4AD8A 1N2XA 3L4SO 1T2VA 2CUNA 2W6JD 3EAQA 4HFMA 3RYCA 1X94A 3TI9A 1NJ2A 4YRDA 1ZZGA 5IAGA 3IAUA 2P0YA 4E51A 3M4XA 4R01A 3S40A 3IDFA 1E6WA 4LTNA 1XQXA 3F7MA 2FR8C 1KMIY 5JDCA 1E63A 1ISGA 1NVEA 1MX9A 3AEKB 3DOOA 3NDJA 4IKEA 1D2EA 4Q4AB 2RJOA 3F74A 1KPIA 3I58A 4Q9LA 4BATA 2B8NA 2UDPA 5CAEA 2ZZNA 1IUOA 1YZ3A 3W5BA 3DZIA 4ZCPA 2GCIA 5JNRA 2RHGB 1SK8A 4FW8A 1PYDA 3PXDA 1PK8A 4GI1A 1RWNA 4KBGA 4UPDA 2BR5A 3EGIA 4MYDA 2O05A 4B46A 4MEBA 4QARA 1GG2A 2YQZA 3MPOA 4BGEA 3AP3A 4BLUA 1M74A 1ISHA 4KBFA 3GFTA 4PYJA 4H3HB 1W25A 1E58A 4G65A 2F8SA 5DCWA 1KWKA 3I9KA 3Q6IA 3EQ8A 4GAEA 2O8DA 2PSFA 3JD0A 5AI6A 1J5EB 4ENRA 3DBVO 4JI1B 2P67A 2LR0A 1MQSA 3E9DA 3WBKA 1NUAA 1WMSA 4RD0A 1A69A 4LJ9A 4PAGA 4WKGA 4ESVA 3TX2A 4MV1A 2FEPA 1V95A 3OO1A 1O3YA 1MQ9A 1X7XA 1OJ7A 3OM0A 4TTQA 3NHFA 2H1SA 3MUFA 3CEJA 4ZYXA 4EPWA 8OHMA 2A0XA 3GPLA 1LC3A 3V2HA 1V6SA 1B23P 4HQNA 3UMGA 4L74A 1MV8A 3MZ0A 4RLQA 2QU7A 3F46A 4QGSA 1GQYA 1KKMA 4XW2A 4BN0A 1YB7A 3ZW9A 3M5PA 3O74A 1PD1A 4C0BA 1N0IA 4J4HA 5EWJA 4IYRA 5IH7A 3B2QA 4OB7A 3CUSA 1JQBA 3EGDA 1GNPA 3R4CA 5L53A 2ZRBA 5EVCA 4QYTA 3N76A 2ZJOA 3DLIA 3IA7A 4JGIA 5K6TA 1IL0A 4AY5A 1I7LA 2K87A 4UARA 4BV8A 2CLEB 2ODNA 3SJZA 2NXEA 3GFFA 2J3MA 2M6LA 5KYWB 3AY3A 2HDWA 3UMSA 3C6ZA 1Q0RA 2G9UA 4OM7A 3ZDAA 3ZH9B 2A9KA 2YOHA 2BEVB 1FFWA 4AJKA 1E7YA 3FFTA 3EWAA 3TSYA 4FDUA 4BASA 3KFLA 3JZAA 3KQHA 4IIYA 4ND3A 5DNDA 2O7QA 4WA7A 1TK3A 2NP6A 5EJ6A 3GYBA 2IYNA 4AIIA 1LLCA 3FPKA 3JYPA 1XP5A 3PNQA 1E0KA 5CEEA 3SVTA 2WJ4A 3I32A 4LJ7A 4V03A 1EDOA 4ZU1X 1N78A 3PZRA 2IYVA 3P9KA 3ZDCA 1F20A 1QGDA 2O4UX 4E22A 3REQB 3TJZA 2WM9B 5DYTA 1LDNA 1HYEA 4F21A 3TDMA 3EXEB 5AESA 4UTNA 3T1YB 5C9ZA 3UG6A 4CFZA 4HAWA 2JRLA 1YA6A 4Y7DA 4DYDA 4HZGA 4G0MA 1G55A 1XYYA 2ZREA 5F7JA 2JB9A 1WSDA 1YS1X 5A9SB 4DR2B 4DR5B 4IQGA 1NBME 3DJFA 2I54A 1MB2A 1HDRA 1HFWA 1CKEA 1SH7A 4I5FA 1TCBA 3L6RA 3EZ6A 3PX7A 3UZUA 4NE9A 1U2DA 2QRVA 3IHTA 1C0PA 2FPIB 2HM7A 4HDNB 1NM5C 4B6FA 1SRRA 3R9IA 1T0PA 2BM1A 3UUEA 1SJ9A 3IQFA 1VPTA 3COPA 3P45A 3QXSA 1FTGA 1HETA 4NOJA 4Q4HA 4D4MA 4B4KA 4ML3A 2Y0PA 1Y7PA 1QMPA 1BTOA 2EG5A 3CXRA 3EUEA 4QDTA 5K0CA 1I33A 3AQ4A 2Z0MA 2BPOA 3NYWA 1NATA 3IJRA 1YBFA 4ZEOA 1ISIA 2A5YB 1YS6A 1LD3A 1ZISA 2QX6A 1P1RA 2G25A 1Y9ZA 4K2AA 3WQBA 3NDBB 2C59A 1NUQA 3Q2OA 2ZRQA 1QYVA 1Z4MA 5T57A 2HSWA 1UBMS 3EG9B 3AVTA 4Z2YA 4N41A 3ISTA 1DQRA 1L8LA 2GB4A 5EJIA 3DDSA 1MEEA 1XOIA 1UEXC 3EXFA 2EKBA 3H0EA 2JD0A 3JQGB 3MLEA 3L0BA 1MENA 4KB5A 5C8YA 4ZU6X 3AHCA 5EWLA 1K98A 4XUEA 2GJ8A 3OFKA 4C4ZA 4BEJA 3EXAA 4B48A 3VNUA 2WQ6A 2WWTA 4IXDA 4PX3A 4UW9A 1C9YA 5IAEA 3WOVA 5KNDA 3OU6A 4H7HA 1WP9A 3GVIA 1JH8A 1X6VA 3N0WA 5JADA 2IYAA 3FOFC 3UT5B 2DKNA 1EXWA 1E9FA 2EYQA 5FUYA 4FHGA 3IDOA 1VKRA 4Y98A 4PC6A 4HG2A 1P5JA 1PEKE 3ONEA 2C2KA 3VXKA 1W9MA 3IPYA 2COKA 3EULA 5CYOA 3A58B 3QXXA 4HXFB 5ES3A 4F06A 4C7JA 2Y1LA 3GEGA 1NMYA 4CXMA 2JIZD 2JGMA 3E35A 1USUA 2J31A 3KWFA 3FNGA 5BW5A 2NVWA 3BXGA 5BXQC 4F6RB 1THGA 5HUJA 2CFRA 2O48X 2VHZA 3JD1A 1SVMA 2CHQA 2CL7X 3QWFA 2M32A 2ZCUA 1QIJA 2QR2A 4QO7A 2XNDD 4R2HA 1ORWA 5DNVA 2CSXA 4OQQA 4BP1A 4ZOBA 1T0HB 1JEOA 4QTYA 5JHGB 1AKVA 1YHYA 1I1QB 2GARA 1KPGA 2PGJA 3KPWA 1XU4A 3TKYA 5IF3A 1U2RA 2NUTA 1PT5A 3DA8A 3L6OO 2PKWA 4EZIA 3BULA 1K8ZB 4KR3A 4AY2A 1U7ZA 2MSDB 2R7NA 1XEXA 4TMTA 1ZICA 4FFRA 4E2FA 2VRCA 4TVOA 2ZS7A 3MRTA 3M3PA 3LTNC 1M1NA 4DCCA 1BQEA 1Q1QA 2XH8A 4QOJA 4U7DA 5JXJA 2JJ2D 3OG9A 1KSJA 3VR6D 2Z1DA 5CP8A 4GWLA 4EKGA 4BXOA 3M33A 4MVJF 1A72A 5L7WA 1P74A 2E37A 3KAJA 4MAMA 1EJ6A 2GFQA 2N47A 2C07A 4LDNA 3JQFC 1H2ZA 5TQ2A 4MV9A 3VH4A 5AW9A 4LDJA 3L7MA 4F85A 1TUEA 3ECAA 1FYEA 2VXCA 4F2WA 1L9KA 2UXBB 2QD4A 4YPOA 4DLAA 4U9IS 5EMKA 1GAQA 3DUWA 5DLEA 4M7PA 1QTRA 3D2CA 1P1IA 2ONKA 1G20B 2RB5A 4EY8A 2YW9A 3DZKA 3T34A 1AA6A 1SCDA 2JFZA 4CTOA 4JYBA 5FTJA 1Y7HA 2RGNA 3E3AA 3G79A 2OQVA 1Z18A 5JAUA 2OFOA 4ENPA 3PBKA 2GBIA 4P5EA 5CB4B 5IZCA 2GA8A 3NWBA 1DJPA 1QYXA 3EFOB 4OB8A 3M2PA 4LF9B 4GX5A 4UXIA 4ZTBA 1HPLA 1IZ9A 4XVUA 4K9PA 2VAPA 1YVUA 2JIBA 3CUEF 3D7LA 2DFLA 4RGQA 2A5JA 2MCFA 3ROMA 1EDDA 2FUEA 3PIDA 4RXMA 2VF4X 4OXQA 1EB9A 3HH8A 4J3FA 1VJCA 2DH5A 2DKOA 4L8GA 4NZZA 3BORA 4LJ5A 3VOBA 5B64A 3QWIA 3ZCSA 1JKXA 3P2JA 2CVQA 3FN4A 4I1OA 4OFZA 5LJIA 1P9NA 1VIDA 3U19A 4OXXA 2HB6A 4MVJH 3RAGA 1UFQA 1UZMA 3FHJA 2VT7A 5CBPA 3B3GA 2G8LA 3QOYA 2CL6X 2PH3A 3A6GA 1DAHA 4JLOA 4Y0AA 3RUCA 1TIBA 1V6CA 2VUUA 1UZAA 4J7CA 1DTWB 1J2TA 1I6KA 4CMEA 2GVZC 3NYIA 3WDMA 4F71A 3HKBB 3VKGA 4CLHA 1PNQA 2OAP1 3FCEA 1MLDA 2Z2IA 2O8FA 1RHKA 2H1VA 4JC5A 3ZY3A 1Y0BA 4D44A 4OLBA 1SA0A 1Z08A 3OU7A 2I62A 4MKFA 1MT3A 3CR7A 5K8JB 3AEYA 4DMRA 5FUQA 5I3ZA 4WOKA 3KJIA 3LLCA 4I9FA 4RMJA 3WFJA 5KNBA 4GW3A 3GLSA 5EUCA 4DCSA 2OY0A 1YJ5A 2LGJA 1ZN8A 4X85A 5DLYA 2AD5A 2FRDA 3SQXA 3RBAA 3V3TA 1J8QA 1DRUA 1FP1D 4R1MA 4EF4A 5FPYA 1SBCA 1L9XA 3K4HA 2QY9A 2HCFA 5L4NA 1XP8A 5EKUA 2ZSEA 4OHWA 3R0VA 3HO8A 3IUMA 1V1RA 1CT9A 2KSQA 3E0XA 4IWNA 4AO6A 3AJ8A 1ZM2A 3QXJA 3SEFA 3HGMA 4DDTA 4OA8A 5K1ZA 1FRFS 4CT5A 3ITNA 1R0ZA 2VHTA 5H16A 5E6SA 4P83A 4IHKA 4XVQA 3WISA 1JHOA 2C96A 1Z29A 3KYIB 3RM3A 1DBRA 1ULHA 1W85B 2FFQA 1JEJA 3AR4A 2PD3A 5TE9A 2XUHA 3FPCA 3HM2A 4P0PB 1U3FA 3P9SA 4H16A 5H70A 1ZIOA 4UEWA 1M2GA 3AVXA 3LP5A 2OV2A 2YMPA 1G8HA 1ZRMA 3CNBA 1SFRA 2LVBA 2O9JA 1U9CA 2Z08A 1JJIA 2RGDA 3HB5X 4HUQA 3VHRA 1Z83A 3DZGA 4TSFA 1XVAA 4R7ZA 4U9HS 2BFFA 4AK9A 1LPNA 2XY4A 3H7AA 2H1OA 1WVMA 2EJVA 2LW7A 1P7WA 1I6LA 4YJ2A 5JD4A 1JJBA 2EJTA 3HJAA 3I8SA 1BX1A 1NVKA 2FZEA 2Q0HA 3NP9A 3Q8XB 4ZOLF 1APBA 4HDQB 1PZMA 4EO9A 3EEBA 1JU4A 1Z68A 2CGEA 4DIBA 4CIYA 3KVRA 4CM5A 1JMYA 3FBTA 1TVMA 5B3JA 4KXMA 4MH0R 2G5TA 3PKZA 4RD2A 1DCKA 1DDOA 1IWOA 4JKIA 1PTJA 4B1FA 1SU7A 3C98A 3L77A 4UMVA 3OQIB 4DLVA 1TTTA 3ET4A 1P4GA 3OO0A 3UMYA 1HE5A 1CUIA 1ZNZA 4JX9A 4MLZA 1R18A 4E2XA 1YF3A 4FHZA 4JA2A 3FTPA 2J3QA 1USIA 5TQ0B 4DANA 1CZLA 1WVGA 2VATA 2FZVA 3VR1A 2CKDA 3RYTC 4HH4A 2WD7B 3TF5A 3V1LA 2AGVA 2ZK7A 1FA9A 2H2DA 3F6BX 4EMBA 1ZMTA 4G0YA 4IS2A 1JEQB 4CM8B 1H5NA 4GOKA 1M1UA 2JK0A 3ZLBA 4NEHB 3GPCA 4B87A 5JTTA 2YY5A 4JZYA 5I8WA 1A1VA 2J3IA 1EVLA 1B2RA 5CURA 3UH1A 4C0AC 3GJXC 4FSHA 4IIEA 1XRQA 2H4WA 4U3JA 1IMJA 2X0FA 1QGUB 4B84A 1RM4A 2BFMA 1WMBA 3KQPA 4LVOA 4QDXA 2X0EA 3N8HA 2EU8A 3FMPB 1T0IA 4KX5A 5FI0B 1F8UA 4DJTA 2ADMA 2X1MA 3WDLA 2YS6A 3DSRA 3HDYA 1QSGA 5AVOA 1AA9A 2WWRA 2C57A 3V2UA 4W5OA 3Q8MA 4WPGA 1W96A 3VO9A 3RK0A 3QLEA 2WP8J 3D3EA 2GCEA 4LCJA 5AH0A 4UHJA 2P62A 1JQKA 3CNNA 5G0SA 4HEJA 1RACA 1XD2A 2ZUSA 1P6QA 3L8ZA 3QX8A 3WIVA 3VAAA 5BSGA 4CKZA 3O8RA 1C3OA 4A4DA 1HV8A 3EC7A 4MLDA 3FPEA 4MDYA 2FTKE 1SC3A 4CTMA 3JD3A 2AOUB 3ZEIA 1BCRB 1PNVA 2CDNA 1VBMA 4RMNA 3LYUA 1O89A 4G9GA 1BJKA 4GXRA 1Z2AA 4YT5A 5GMOA 5L7TA 2QHXA 4NCXA 2H7YA 3FOEC 4UVHA 1E3DA 1J39A 1DEKA 5CR9A 1CY4A 5FA6A 3EEIA 5D3QA 1F7VA 2BFDB 4D8WA 5KOHA 1Y3HA 3OOWA 4QGHA 3JQFA 2QP3A 3R5FA 2AD1A 3TRIA 1XU7A 5B4VA 3L6DA 1UQTA 2FN7A 2ZXUA 4FHDA 3IURA 3IXQA 5A71A 3UHPA 1THMA 3H6KA 4I36A 4Z3KA 5HG0A 4XWTA 2ZUWA 1EDZA 1G2IA 3ADBA 3Q9LA 2WG1A 5D7NA 4Q4LA 4WAUA 1NR1A 2OFXA 2B8WA 4PZCA 3CC8A 3DOFA 4RV4A 4WOBA 5AK0A 2B6NA 1LU9A 1JHYA 3IAS1 5E9WA 3WFIA 3CJQA 3OX3A 4HGYA 2XWPA 4YCLA 2W37A 4LY6A 3IVCA 3N8DA 1QZTA 3CZ9A 4TRJA 5TGZA 3UICA 1ZGCA 3EGOA 4EJ2A 4MO9A 2X0RA 1NFFA 3IPCA 4M8SA 3A2NA 3FCSB 3ZDFA 1IJEA 4ZI3A 4BLWA 2IEGA 3KVNA 3VR4H 1KIMA 4EFMA 3WR5A 2O2CA 1OCEA 3ROKA 5TIIA 4KAXA 2YR0A 4RZ2A 4EBFA 2WK1A 3CG4A 3MM4A 3AY7A 3QKRA 1M0SA 3MTAA 5J59A 3NONA 2P4EA 3BQMB 4Z99A 5IDWA 2O59A 4X8LA 2OAGA 5KSZA 2QAGA 1GL9B 3DO8A 2Z6UA 4K9KA 1E5VA 3B2EA 3FRHA 3Q7SA 4K03A 1K5HA 3TGWA 1LQ2A 5EUBA 2O6LA 1I3CA 1N8KA 2RFLA 5E9JA 4R8VA 4QU8A 5FFMA 3F3YA 1VP9A 1BKDR 1MAVA 2J9RA 3I37X 4Y7CA 1MQAA 4S1NA 1TUGA 3I9NA 4YO8A 4TLCA 5DW0A 4C88A 4YT4A 2UVPB 4CM9A 2JANA 3G2NA 5KVVA 2ZDQA 4B3SB 4AXXA 2MR5A 2GN1A 1DOZA 1FP7A 3LVFO 1H9AA 1CHDA 2BGLA 5E6UB 3ZR4B 1UMDA 1VOTA 4FQ8A 4JELA 1IY1A 2QUAA 2DUNA 5DYGA 3F3MA 4WUTA 2MSKA 1VA4A 3FZGA 1RZ3A 1IJBA 1QOQB 1PRYA 1XAIA 3NHPA 3HJCA 1PS9A 5C81A 3K8OE 1NP7A 2FSSA 2QN8A 2GCNA 1SUWA 4B5KA 2CZGA 3L9XA 4H0CA 1N6PA 4JU9A 2F43A 1H3EA 3W7AA 4Z2AA 2ZAMA 4QUHA 3ZXYA 5HW0A 1ETHA 2WB4A 2YWJA 3Q7TA 2A35A 4KAAA 1C7RA 1JIKA 4JS0A 5DGXA 3S70A 3ZNQA 1OWLA 2X9NA 1VP3A 3BIFA 5DHUA 1RW4A 3AERB 1R4ZA 5KTNA 1QP4A 4XQGA 3U44A 3MINB 1FCJA 1E96A 2I87A 5CA1A 1U5BB 3H1TA 2RHMA 4DCOA 5K4HA 3G17A 1SG9A 4HGRA 2WJYA 3P8ZA 4UAVA 1PFYA 4F2HA 1OH5A 1UAAA 4WWHA 1MJNA 2Q5IA 3EVAA 5ESXA 3GUCA 1Z45A 3UF0A 3PC2A 3GGCA 2AOWA 2O2GA 4EJ0A 1NXPA 5AKEA 3EPHA 3BL5A 4M1MA 3ESZA 4Q7LA 3D3WA 4QQKA 5EAIA 2QV0A 2WWGA 4EVIA 4Z9BA 1F8XA 1E5TA 1JLRA 4NBSA 3V8VA 2F1HA 1J22A 2O0LA 2XTAA 4C3VA 2VTBB 3VTKA 2WWYA 5GIPE 3RC9A 3C6BA 4JLSA 2OCDA 2V6GA 1L1QA 3D0QA 3JAKA 1AS2A 1RYYA 5EOVA 5JASA 2VNHA 5ED4A 4B3GA 2FSVC 1UEJA 4YJKA 5F73A 3MUEA 3UTDA 1R5OA 3VI3B 4B45A 4HGNA 1DCFA 3ZEAA 3A1UA 3OE7A 4BUZA 1GG9A 1SVLA 1HFKA 3K09A 2CUTA 5JRZA 2I76A 3TKLA 3F90A 4RNCA 2C78A 3C6QA 3B9QA 3EYWA 3PCXA 4MZXA 5COBA 5ECWA 1GZSA 3Q7IA 4JMPA 4QRHA 3TSZA 3FTEA 1HLPA 1XLWA 3GN1A 2ZJ8A 4MR7B 1RQRA 4M54A 5BV1A 1C1DB 2CXTA 2OFWA 4E5PA 4CGZA 4JITA 4WASA 1XBTA 2H5LA 1TQ6A 4OL9A 2P69A 4LVUA 5F98A 1NVXQ 2JIOA 1WW3A 3URKA 4BP9A 4C7XA 3L40A 2VEDA 3TECE 1XDZA 3NATA 4F6LA 3OZSA 2J59A 4PZUA 3OE1A 4CKEA 2BC9A 2J09A 4MDEA 7AT1A 3S81A 1WW2A 5T3YA 1I3KA 2D2XA 3U7FB 4E5YA 1Y6QA 3AUYA 3PZBA 4M53A 2P78A 4YMTA 4IRUB 5K0BA 4DIDA 3GRFA 3S2ZA 1XNHA 2ZDGA 3VO1A 2VT3A 1EX6A 3K8QA 1NN5A 2AKYA 1SVOA 4A6EA 2F1OA 1ZRNA 2A14A 4RU1A 5ICCA 1IB6A 5A5GA 5LD2C 1CJBA 3OOHA 4IM7A 1MA3A 3QFHA 3UAVA 4D0GA 3C0KA 2HQBA 1M2HA 2C20A 1DEHA 1CQXA 2BTOA 2KX7A 2JJYA 1UBSB 4M1YA 3A6LA 4UM8B 1XRJA 3SYRA 1H0HA 5CH5A 4GOMD 5BPHA 3E1GA 4RTQA 5CB8A 2QLJA 3GJ7A 1N2BA 2OVBA 2NZ8A 4DNPA 1QH8A 1VE5A 5ALFA 1Z12A 2VDWA 3T9CA 4IYJA 4DHEA 1DFIA 4RJTA 3LP6A 1QHEA 1NQUA 1S8FA 3ESCA 2EHJA 4JODA 3KU1A 1I9CA 1PU2A 1XJQA 3PDWA 1Y6FA 1Z74A 1LLQA 3AFGA 4OJQA 3RRJA 1R3DA 4BLOA 1EK1A 1M34E 2QTAA 4HB2A 3HQ4O 4C0KA 2XUFA 4ZRMA 2XVAA 4TKMA 2R48A 3OQMA 3G9TA 3Q6MA 3SIPA 2IH2A 1B3RA 1GRCA 3WNCA 3IEMA 5AHWA 5H80A 1I6MA 3NBKA 3PGMA 3JATA 4ITVA 5DYYA 3SF8B 1XG5A 3T5BA 4FFWA 2PKXA 3L8DA 4TM7A 4EJMA 1YFZA 3FPAA 5A03A 3PWKA 2XITA 2JLZA 3HSYA 4G24A 2VLBA 4KRYA 2B92A 3MUOA 5CHYA 3QEMA 2LRHA 5F3RA 3I6IA 4K1XA 2XKBA 5IJWA 2FUKA 4AAYA 1ZK4A 1YAJA 3M4NA 3IVXA 4ANFA 4C7VA 4PEVA 4F5EA 1OAKA 4BO8A 1DX4A 3QP9A 3H1AA 4RX1A 2FN8A 3MSXA 4TSKA 5I7WA 1NVBA 5LQCA 5TC4A 2JH8A 4GYJA 1I7NA 3GJ3A 3IVAA 4MGYR 4OQDA 3K6SB 1U3CA 1QDEA 3CINA 4RD4A 3UMVA 4EHBA 3MGGA 4KOAA 5HZHA 1YZQA 2AFVA 2Z83A 1V5EA 4N03A 1UZUA 4QO8A 3P5SA 1NF8A 3FIUA 4RWZA 4Z4GA 1BH2A 1W5FA 3GLKA 2Q6KA 2RAUA 3PU6A 2VP3A 3ZYZA 5JSQA 4EY7A 2PRYA 2IDJA 2PFGA 2OESA 4I4NA 4IWXA 5A04A 3X2SA 4WCFB 4V0LA 4BWFB 3C87A 5AXAA 1ICEA 5EERA 1KRHA 2FFJA 1QH9A 3H9CA 3NC0C 4YIKA 3VPCA 1CE8A 1XZNA 4HAYA 3DGFC 4AO8A 3KK0A 4IIVA 3AXTA 1WBDA 5AKIA 3LHKA 4O4JA 2AXPA 2VAWA 4P35A 5JJBA 1E2GA 2PJDA 4KYVA 4U6SA 3TW8A 1E62A 4F93B 1J1UA 4Q93A 4QQRA 4YK7A 1SHJA 1FXWF 1H2HA 5BVGA 1L3BA 2NN3C 4NYJR 4JDPA 3LUPA 2F8LA 2WFLA 4JJ7A 4DL9A 3MRSA 1ZCBA 4NX2A 2BELA 3PX2A 4OCZA 4HNQA 4R8SA 3ES9A 3I5AA 1EHIA 4ZQEA 3A1WA 4F96A 2VCEA 4IHJA 5BWNA 2QG4A 5CK4A 4RPHA 2DUJA 4W5RA 4W1QA 1TRHA 2DMRA 3B1VA 1TVKB 1JJAA 1ZAKA 3FYHA 1QVVA 4JZKA 4O1HA 2VHCA 1WZIA 3K0FA 1PBTA 3EHEA 5KKCA 1K5DA 4J0GA 4UVGA 1GSHA 4LRSB 3TI7A 2H85A 4QPZA 5DP2A 2ROQA 3IQZA 3VZDA 2QYOA 3JRXA 3HV2A 3K9LA 2R9VA 1B8OA 4O1MA 4W5JA 4U7PB 5DW3A 4CN8A 2R1TA 2G5CA 3BMOA 3OCUA 2VIIA 4D8UA 2DR2A 1KJ9A 2YOGA 1ISFA 1Y63A 3OURA 4URHA 3USCS 4YV7A 1VE9A 1ACLA 2WBLC 1HDZA 3O84A 4MQLA 4BUCA 1L8QA 5JZMA 1SXJD 3NBQA 1JSRA 2VJNA 3KKMA 3K4QA 4Q15A 2C03A 2DWQA 3HGQA 3QW2A 2G9QA 2GRUA 2VRCD 1E3WA 3ME5A 4IG4A 3WMWA 4MAFA 3TM5A 3CF6R 3HN6A 3L4BC 2ERCA 1GY8A 5DGTA 4YRGA 2O7RA 4TV8B 3QI2A 4PC1A 5L3ZA 1XLVA 3EFHA 4PIMA 3KB1A 3OT4A 1PJ2A 1YWGO 2FFAA 1DX6A 4HF7A 3OSZA 4IJQA 3RV4A 2BAGA 3B48A 1XDUA 2RCYA 1KYWA 2BFAA 1QIMA 2P9TA 1A5ZA 4MO2A 5COAA 1JMVA 2RK6A 4EITA 4PC3A 1QQAA 4G01B 3BTVA 2ODTX 2VNAA 3SSMA 4EY5A 5ALOA 3WRYA 4HSEA 2LXNA 1GO2A 2QN2A 4GXNA 4GR5A 1I4LD 4U2FA 3UAZA 3UJ9A 2PH1A 3UQZA 4MUBA 1TXGA 4KZPA 4XJSA 1WTAA 2YXNA 3PC3A 1ZJ4A 3G2QA 4DN6A 3B1FA 3A9CA 3SKXA 4QU0A 1V3UA 2YJNA 1FEZA 4FR0A 1LBHA 1KOFA 4EB6B 4RJJA 2DQKA 4L78A 1BVUA 3WSTA 4AKGA 4A8JB 2PGAA 3IO3A 1SULA 4PW0A 1XKLA 4L4UA 1HL7A 3R75A 1PP4A 3T95A 1BX3A 1KS2A 2IDZA 2AMYA 3ABSB 3ESXA 4GIBA 4KPUB 4PRYA 2DQZA 5CVJA 1L8AA 1HKUA 2QQGA 4LZWA 5TXGA 4DV5B 1E3LA 2C54A 4UM5A 1M10A 5K0NA 5JEEA 1VL2A 2C5AA 5SV2A 1H1DA 4NBNA 5AXBA 3WYCA 5B6IA 1RXSA 1JDVA 3DB1A 3EA4A 4DZZA 4A03A 4K40A 1T6XA 4LOKA 5FBLB 3S7TA 3AH8A 4CNBA 2GUWA 1SUCA 4J0JA 5FUXA 1SQGA 1L0BA 4JVOA 2KBEA 3O4VA 1CX9B 1FDVA 2XZOA 3IUYA 1CP2A 4HYTA 5B7NA 2RHCA 1REQB 2B8JA 2QORA 1N3LA 3BXHA 4NBRA 2HREA 3EVNA 3Q3CA 4C0XA 4NY1A 2NYUA 4JJGA 1Y1RA 4YACA 3ZU2A 1RPJA 1AKUA 3G68A 3NTXA 3U7EB 3IKVA 2EP8A 2CCKA 3UV6A 3O8CA 2R00C 1ZMXA 1RQPA 2YJ4A 5HFJA 5LBTA 1R8XA 4CG2A 2V7BA 4FE3A 4MQ5A 5BV7A 5KHOC 4BCBA 1N5MA 5KNBD 2OG2A 1KTIA 5LOVA 5K0FA 2O8BB 5KQLA 2V0NA 2X3UA 2D2EA 1Q7GA 2CB9A 2QLMA 2WLSA 3AR3A 2YINC 3BTSA 3IT1A 4DLPA 4WXYB 4B8WA 4OI4A 4PQFA 1L5KA 5H3CA 3X44A 1UWCA 2XYPA 2JC3A 4I55A 2DY0A 5ERXA 1PFUA 2YHUA 1HR0B 1E59A 4DDUA 1GSIA 2JJQA 1RKBA 1PR3A 3LCUA 3OFSA 1X7ZA 2Q4EA 2HHAA 2ZRFA 3CO0S 3NRJA 5BNFA 1ST2A 1S6YA 1Z7WA 1NW4A 3HDQA 3IA2A 2VF7A 5E2BA 1XTSA 2ZWPA 1GADO 3ORRA 3T5MA 1OT3A 2ZBDA 2FJUA 4KHPB 1ZJZA 2XHZA 3BMNA 2HLNA 2IUTA 3CLSC 1Z0IA 2XLBA 3PHJA 1Y4AE 4FT4A 4GQIA 1UJCA 3BSFA 3HUTA 2Q7OE 3T3DA 4RTMA 3KQYA 1E9CA 3K15A 4GO1A 2V9PA 5CU7A 1V8PA 1E1CB 1Y8AA 1BROA 3L05A 3MJTA 3NHRA 4HGPA 4JHLA 4MIOA 4TUYB 2NVUB 2AR0A 2WAAA 2R86A 1IHYA 1ZSYA 4WA8A 4RTLA 4NCAA 1V1JA 1PX0A 2B34A 3NPAA 5A4JA 2YQ4A 3C5HA 3U4IA 4EGSA 3O3NB 4KO3S 1IBCA 4DJFC 1N75A 1YRLA 5B4TA 3A4IA 4KPFC 3EXHA 5IFLA 1SHUX 4JVNA 4CKWA 3IO5A 3IUBA 2RHRA 1E32A 1U5AA 2FPXA 2J4FA 3ENVA 4WEQA 3LC7O 1XXHE 3SEAA 2I71A 3KYCA 1HURA 1DPGA 3R8CA 4IW3B 1YU9A 3LBAA 3ZDBA 2NU6B 5F1OA 2FZWA 1UBKS 3VHLB 2C58A 2XQVA 2WOOA 1UT5A 1CF4A 1T5BA 5E3IA 1E92A 1BCSA 2KM1A 2RB4A 4K8RB 3AMVA 1E1LA 2J9XB 2IFTA 4GZ3A 2XBLA 4K0RA 4FILA 4DLSA 3WP0A 3IP5A 3OM1A 4O4HB 1GN8A 1DT5A 4OATA 3KSBC 1KMHA 4I50F 2AWNA 2JFQA 5HIMA 1LBQA 3GWZA 4Z9AA 3V8EA 1D0SA 2EFJA 4R5HA 1MB4A 1XROA 5DWQA 1E2MA 4PCVA 5K3SA 3KHSA 5K05A 4EW3A 2NU7A 4I8DA 3UV3A 1D7AA 1T0JB 1YFKA 4NV0A 1NI4B 3BICA 4MV7A 3DOHA 3FHOA 4ZHQB 5BWCA 1M7HA 2QF7A 5D8DA 1CY0A 4C04A 4EARA 1GTRA 4G8BA 3SFTA 3T4XA 3HCRA 3AQIA 3T3HA 1CUGA 1EP2B 3RRZA 4QGAA 3RFVA 1LVHA 4DY4A 1VMEA 2RBKA 4E08A 4F6CA 2GA9A 3DBLA 6GPBA 3STXA 1RFLA 3GK3A 4HNVA 7MHTA 1O95C 1MIOB 5HIAA 3QYAA 2HOQA 4TS9A 5JD3A 4M0LA 2NUAB 1VL8A 3GDHA 1M8FA 3VJRA 5TVKA 1J8FA 2LTAA 1ZEJA 2FW8A 1C3LA 2Z3VA 3FWKA 3S55A 1EGHA 3V80A 3BGSA 5HZKA 3AVVA 4B3RB 2HO4A 3KD2A 4H17A 3OC0A 2NYRA 4HWTA 4QL3A 2BI4A 1YU6A 4ZI7B 2PX2A 1CIVA 2Q50A 2QMZA 4TTTS 4LSZA 2D8AA 4P4UA 4RKWA 3RSFA 1RM3A 2WUWE 4NDAA 1I2CA 1W47A 3K0CC 3QZUA 3U3XA 3EXG2 3QPCA 4YRRA 1AUPA 3WBJA 4RLSA 2P9HA 1LSSA 1NHGA 1ECGA 3P2MA 4KN5A 4REQA 1VKNA 4MNTA 1USGA 4ZKEA 5JXIA 3U4QA 4P53A 5EXXA 1QP0A 4I9UA 3GY0A 2CNKA 1J5PA 2PMDA 4RD1A 1UXOA 5ESWA 5FWDA 3X1DA 4DARA 2PUJA 4C4PA 1IEQA 3DHEA 4C21A 1CEQA 1HLGA 1SCJA 2VKQA 2XUAA 3GX1A 2HRCA 4LXIA 4R54A 3HJGA 3S5UA 4O0LA 4QM6A 4OAOA 5CXUA 3BSWA 3H5NA 2Q6OA 1Q0SA 3H11B 2VJKA 3R44A 1X77A 3RBXA 5BSMA 2BMWA 3UUWA 3P52A 2GAIA 4TZ0A 1EE9A 1BWRA 3AEUA 1WY7A 3KSRA 3L7IA 4YGYA 1GWNA 1YR3A 2NZJA 3T0IA 4BNFA 3U1BA 4V0ME 2X8BA 1X7WA 2CMDA 3LY8A 1L5YA 2NT3A 2R8EA 2GJKA 4Q4JA 3LLUA 5E95A 3TVTA 4IMJB 5B2ZA 4UATA 4RORA 5FO0A 1P2BA 3R3HA 2XGSA 4MVJG 1K89A 9LDBA 2IYXA 2P9ZA 4GC5A 1AMOA 4HDMB 1EE1A 4XCXA 4AZTA 3MCVA 2XNHA 4WN9A 5GADl 1YMUA 2I7CA 2JATA 3ZY6A 3DOIA 3PCTA 3AF4A 4CJXA 1XDBA 4D8VA 4E4TA 1PWXA 2FI1A 3IODA 1X7DA 3F73A 3B5EA 2YC4C 2WHXA 2CJWA 3RLIA 1O6BA 4CCWA 1FP4A 2P7HA 2AF4C 2G1JA 3OBIA 4V3BA 2X8LA 4O0MA 3UW3A 5KHLB 2C3YA 1Y1QA 3SEZA 4DT1A 2Y9MB 2FMKA 3G8YA 3TO5A 4AP5A 2RD2A 1VBFA 2A5DA 2H2WA 2WWWA 2P9JA 3KD3A 4G56A 3ZC3A 4IOLA 3RSZA 3HBAA 4MRRA 2O5RA 5K0SA 4D25A 5F7ZA 3IAM6 2QPTA 2YX1A 3DOJA 3UJ3X 1G9SA 1N2CA 2GPYA 5KVQA 2R6CA 1M6WA 4YQFA 5EL0A 4EY3A 2ONJA 1P73A 5EQTA 1K6IA 2YQ5A 4PZPA 1FUYB 4UEKA 2OKCA 2AFIB 3HXLA 3HXPA 3PXBA 5AKZA 3UYKA 1W4LA 1LW7A 4YN3A 4Z7OB 2R7KA 1CR2A 4QYXA 4BLSA 5I01A 4RVHA 2P9FA 3HVHA 5EE0A 1P9RA 1C0EA 1JVSA 2C5SA 2OGWA 2PU7A 4B6PA 1B6TA 1F51E 1CS0A 2G1UA 3FBWA 3ID6C 5CMLA 2OP1A 4CM9D 1RAFA 4DUPA 3ECCA 3UJ6A 3QPAA 4BB6A 1ICIA 3NHZA 3QPWA 2C9CA 1FUIA 3GFSA 2R3SA 4RUKA 1E4EA 3NDIA 4P4LA 4DJEC 3GH3A 3OAAA 4KFTA 3AJDA 2F3UA 4ZT7A 4CEJB 1Y3IA 1TM1E 5EZYB 4P3OA 3ZDYB 2XCSB 4RHFA 5HS6A 4I8IA 2JA1A 1LNQA 1PJAA 3TTUA 5HF9A 4X64B 3COWA 4O2BA 3GLHB 1GU0A 1WL8A 3LHFA 4HGOA 3U9TA 4V1CB 1WCXA 2FWRA 1IHXA 2NSJA 4MJ7A 3TEMA 3GLGE 3RUIA 1NVMB 1FE8A 2WILA 3F9IA 4MQMA 4DREA 5DGHA 2FG7C 2JAXA 2L42A 4WZ6A 3B89A 1FTQA 1WSBA 2EFEB 3L79A 1UWVA 3NBYC 3E0QA 4FDTA 5HIKA 3OEHA 4ARZA 4P93A 1QZZA 5LP6F 2ODQA 4WRRA 3D8BA 1NBHA 3ET5A 1F4VA 1POXA 4EUKA 1BE0A 2PWZA 3KQMA 5H3LA 1W5TA 3TOVA 4KMOA 1LI5A 1A2BA 1S3FA 1XALA 3D4OA 2PZFA 3PQ2A 4JOQA 4YAOA 1S9DA 2IPOA 2VNSA 3NYRA 4I7EA 3SDZA 1JUDA 4MW7A 1IXRC 1M8GA 1S96A 3K96A 1E3JA 3S44A 1RLMA 4XFJA 2V4ZA 4YBZA 3VSEA 1DO0A 1HLDA 1MX5A 3CTMA 3ST7A 2R7AA 1ZM9A 4TXHA 1MO4A 3IOEA 3V8RA 2ZI6A 1A8IA 3C3MA 3EOBI 3KSMA 3P2KA 4JL8A 2ZU6A 1GNVA 3A4YA 3G0DA 4BNDB 2G0TA 2DYKA 4NRDA 1IJFA 1DAMA 3A11A 3OE7D 5KYNA 3QVOA 2PD6A 1VKZA 3TJRA 5AJZA 2JGJA 4F5WA 4GPEA 2HWYA 2VRWA 3HY6A 4HNRA 4BNUA 3NXKA 4WKCA 2X5JO 2J5QA 1W0JA 1NQAO 2PNJA 4BVFA 3HCPA 1OB2A 1BH6A 2RI1A 5DB4A 3AETB 1XGKA 4F3CA 1EUZA 3EVBA 5KX5B 1E7WA 1PJTA 2OHJA 3QKSB 3TEJA 1IONA 2ZYUX 1W48A 2PVPA 2ACWA 3AHJA 1KAHA 1G8AA 1MX3A 3AUSA 4RZUA 3TFOA 1WBBA 4FR5A 1Q1GA 2ABWA 3SZGA 4D8TA 8MHTA 5ALVA 4YCAA 3KETA 2W0MA 3SZ3A 2O2EA 2QSJA 2LCQA 2Y6UA 2WU0A 2FSUA 1UP6A 5ARCA 4D74A 5HQ3A 5M29A 3D4IA 1IN7A 1YOBA 2BGRA 4Q3BA 3FYUC 2IBSA 4CMIB 1Z8NA 4GOJA 5BQPA 1FUKA 3VUFA 3EPJA 1BW9B 3JYLA 1P77A 3PT9A 5IK2D 1RRGA 4N9QA 4P0QB 2Q41A 2VK4A 1J09A 2JZOA 3MIZA 3LPNA 4FYWA 5A06A 3VV3A 5E38A 4GU5A 3E2IA 4KN9S 1TQ2A 4XR4A 3ODGA 4E5NA 1YZVA 1J21A 5FWNA 5KWEA 1L4LA 1WQ4A 1N36B 4RXUA 1P4RA 4ALIA 2HLHA 2OXRA 1X7XB 1N3YA 3U48A 1A5AB 5DIZA 4ZOQI 2H4YA 2KYRA 3J7TA 1HYHA 3M6AA 1YZKA 4N65A 1UPBA 2XW6A 4YP5A 3JZIA 2ZE6A 3KP1A 4QUBA 1Q92A 4MTCA 4GM0A 4DA9A 4J1TA 1H0RA 1J8YF 2ZW9A 5IUKC 3BZWA 2BOVA 3E22B 1BS1A 1VKOA 3DC7A 1P4AA 3FJYA 3KVOA 4XLTA 3EGDB 4URVR 5HUHA 5BRJA 2H59A 2ZJ2A 1LTKA 1S02A 1EGMB 3G7SA 3O9VA 4EW6A 2NX2A 3A1NA 3WGZA 3ELWA 4AULA 3W4JA 2GK7A 3B13B 4R9NA 2C7PA 4NOMA 1MT0A 5JO9A 3F8TA 3OJ0A 1KZ7B 3B7PA 1AKMA 2PIAA 4CEIA 1W52X 3OIYA 5IYZF 1ZUWA 2ZBRA 3PQ6A 4OQFA 4OI1A 3T4UA 2H57A 3ZVRA 4ZCLA 1DBIA 3PWZA 1TYBE 5LU9A 3PPWA 2HIGA 1JB1A 1E94E 4BU0A 1B76A 5EIBD 1RJFA 3KZNA 5FFNA 3GIDA 5G4KA 1I2ZA 4M6WA 4DV6B 1ZM7A 2BMDA 2IHJA 4XIFA 3E5RA 1O5TA 3JQ9C 3M4YA 4R9VA 1DAIA 3D02A 2JFFA 1SCBA 1G8GA 1KNXA 2HPHA 2ACKA 2PJZA 4KE9A 2IX3A 1D7OA 3FYCA 2VJQA 4C1NA 2FN4A 4ZC8A 4YREA 1V3TA 3ZHOA 4M21A 3SS8A 2ZYDA 3DHYA 3QWBA 3N8GA 4J76A 1WZUA 2BRUC 1MC1A 1EQAA 1ZCAA 3N1UA 4LXHA 3UN1A 1QDLB 5BN5A 2PL3A 3BYZA 4UBNA 3RWMB 5GJWC 2X3YA 3AJAA 2PZKA 1A2OA 4KR6A 1QKJA 2Q3FA 2QMHA 1FNBA 3V00A 2NU8B 3GEMA 5C5CA 1HUQA 4FCWA 4Q0MA 5ILOA 3DAHA 1F0YA 1YE3A 2FQQA 4C0SA 1J20A 2H1RA 4IZIA 3HABA 4HAOA 1IY8A 3EF1A 4N01A 1A9ZA 5DRYA 3WL7A 4BN5A 3EDMA 1S3GA 2B1IA 3COZA 3TLMA 4DEYA 1R5JA 1R5NA 1RYDA 2GKSA 3KB8A 1J2UA 1TU3A 3KR2A 2ZRHA 5K3FB 2ODPA 3MXOA 3NKVA 1CR4A 1HKHA 4KTVE 1TQ8A 1OBCA 1MH9A 5KJEA 1BO6A 4DTCA 3W2FA 4U00A 1SBNE 2BKUA 2QW8A 4MDFA 3PC8C 1G4HA 3P0HA 3M0EA 1PEAA 2Q8NA 4FDAA 2D0PB 4H7KA 4D92A 4W8OA 3B9RA 2E6KA 1OYOA 3KKZA 2C7VA 4QIHA 5DF1A 3KLMX 5IHPA 1Q21A 1XRLA 4NFYA 5BQ5A 1V45E 1ZVJA 4XIYA 3RIXA 2AS0A 4D1YA 2YHBA 3EXFB 5C8YB 5DM60 4BQPA 2PX8A 4YR7A 4HZUA 4AWBA 5ITVA 4ZEXA 2AMFA 1XCPA 3HDTA 4MA0A 3ESRA 2Y0EA 1YRBA 1ZS9A 3OIUA 4WVLA 3RKSA 3T7AA 3OJFA 3ZWNA 4CL3A 3HWRA 3UFXB 4AW9A 1A77A 2NT4A 2IU0A 5H8WA 1PE0A 1Z0AA 1M6VB 3NP7A 2B69A 4M49A 4AJ2A 1IPHA 2D13A 3U39A 2QVYX 5CIQA 2VSXA 3GFRA 4XQEA 4JB8A 5EPEA 3DXFA 5I4KA 1RPNA 2FRXA 4ADSG 3ILVA 1XC7A 1IAQA 3QENA 4IKOA 3DLPX 1CHNA 4OQPA 3KPVA 5F5LA 4JP1A 4BQRA 3D6MA 2GO1A 2H08A 3HKDB 3RIEA 4W5QA 4IUCS 3TSOA 5J2TA 4FMDB 4M1ZA 4ABYA 4HH0A 1G5PA 3LP8A 4KH1A 2SHKA 4N0MA 1DC7A 4K6GA 1T8UA 3AL3A 4HB0A 1YS2X 1SKUA 1YS7A 3B3AA 1KJWA 3DTVA 1N1GA 3S1LA 1FFXA 5C34B 1KF0A 3A7DA 1SXJB 3H87A 3VKVA 1XMVA 3BL8A 3C14C 3IBSA 2HLDA 4FE7A 3M7IA 1XEXB 4XGQA 4O3FA 3UXHA 3VYWA 5ALWA 4MUYA 4C05A 3ORSA 2JF0A 1GPWB 3FPBA 5F3DA 1EXNA 1GNSA 1R0LA 4HQ0A 4OYYA 4QELA 5CT6A 3N75A 5DM2A 1CW2B 4JCOA 3WYGA 1EUDA 3UJ8A 4MR8B 5ALIA 1DG1G 4W8HA 2CUZA 5TX7A 3P0IA 1LLUA 2Q62A 4QBIA 3RVRA 3ZDEA 2NAPA 3HRHA 3RFCA 3HXMA 3THWA 3GUUA 3UQYS 4OREX 1BMQA 1DWQA 5AT1A 3KC2A 4JI3B 1ZOIA 5U4XA 5KJ6A 2VT6A 2HRZA 3FCAA 3GROA 1C1HA 2YTZA 2NSYA 3CN7A 4TL8A 3MWEB 1TM5E 1OAAA 2QT0A 3AUKA 2LBPA 1JA9A 4ND8B 3L0CA 4FHFA 1KZYC 3S2IA 1SBQA 4U4AA 3LNCA 3PRYA 1CJTC 3A1TA 3QQPA 1AIPA 1OSNA 2IXDA 4XDYA 3TPFA 1C9JA 2I22A 2NU9B 4L4XA 1Y48E 4YXWD 3QVXA 4I9GA 2FZCA 2YL2A 3F5DA 4YRCA 2WJZB 10MHA 2IHNA 4CWAA 1V8BA 3OBBA 2P9EA 3KO8A 3PVZA 1OD6A 4KXLA 1T9DA 4ALKA 1A1SA 4BE9A 1CJSA 4BNGA 4WFJA 4CHTA 5JYBA 1XHLA 3N39C 4BECA 2YV2A 1QP7A 2B36A 4L5YA 4ISCA 1FYFA 1K75A 2V5VA 3OEWA 3VO2A 2OV6A 1ONOA 1GOTA 3EIQA 1EVIA 3LH5A 3U7IA 3P71T 5CITA 2Q8QA 2WJ6A 5IN5A 5LL6P 3MWYW 4E31A 1JWBB 1OZAA 3B70A 1KYTA 1NF9A 2YFYA 1BXGB 2H2AA 3QW4B 1AKEA 4KQJA 1EDEA 4A16A 5CFZA 5EE3A 1ZY2A 2RGXA 3ICWA 3JV7A 3SJCA 4DNOA 5BSFA 5CBPB 2DSTA 3RJZA 5G1OA 4N5NA 4PLPA 5D5HA 2C4UA 5B12A 2E0IA 2CZCA 1TZJA 3G6KA 4P58A 1VLLA 2OZLB 2YXDA 4Q1VA 4OTZA 2WAXA 3MWGA 1IHDA 2GZHA 5DXAA 4ZWNA 2XE4A 2Q2WA 2QX8A 3J80A 1CQIA 5G0WA 4TYWA 4RH3A 1UCFA 1QHXA 3H1FA 2YVQA 2EW1A 2ZR9A 1ZUNB 3E4DA 5JSKA 1N6NA 3TAHA 4CUKA 5F3WB 2JAPA 1FBNA 1T9HA 2FMXA 1CUWA 1OYWA 4HXEB 2P90A 3EGWA 1EDBA 1PIWA 3HCBA 1CVRA 3A1CA 2P68A 4O4LB 3DMTC 3MFYA 3I39X 4HSGA 2RHOA 2OG1A 3SR3A 5CVDA 1OY1A 3RS7A 3T94A 1E1QA 1KI8A 3LT1A 1RRCA 5ALXA 2PG3A 3JS5A 3KQUA 3OZGA 1XDWA 4B82A 3PJRA 4M8NE 5AUOB 1GG5A 2P91A 3TW6A 3LO5A 2JCGA 1FPQA 2V4MA 2QRKA 4BJ1A 3D6NB 2ADOA 2HBYA 2HWWA 2J9GA 1R12A 3PEEA 1MHTA 3HXTA 2O20A 4V0OA 1L5FA 2G4LA 5JCJD 3DW3X 2GHTA 1K2WA 4JEMA 1VL1A 1W1IA 3LV8A 3U9LA 5C7OO 2ZAOA 1ZUIA 2HQSA 3IB3A 1VYVA 4B85A 3FGPA 3TW0A 1XMXA 3TDKA 2BP7B 2GH1A 1GNQA 1GPLA 4KR0A 4XM1A 1Q0LA 5B6PA 1NDHA 2RCNA 3HC7A 4L2IB 1N2SA 4OJTA 3SKVA 4G2TA 4BJ3A 2PMFA 1JECA 5JDIA 3LLSA 4DUGA 5A3QA 2M6RA 3WTCA 4HC4A 4DLWA 5J4HA 5KVAA 1B16A 3AGQA 3FD8A 3PNVA 1E6EA 4MW5A 1BDIA 3C43A 4RSRA 4WXPA 4BO3A 5JSUA 1DKQA 1YFJA 1JAYA 4U39A 1N2OA 3ZBUA 1OXSC 4A7PA 5CDTA 3SHTA 3KXKA 3KXIA 3GMDA 2AQHA 3N2GA 4BFXA 2Q5LA 2R25B 2ZIWB 1BQ4A 1GU1A 4EMSA 3N3AC 3BJIC 1E0SA 2F3QA 2ZTHA 1JZTA 3DWGA 2WABA 1Z0UA 1Z8DA 1XHFA 5C4GB 4BCDA 2AT1A 2RH4A 3D2LA 4B4OA 1Z28A 2OSVA 3AHDA 1QX4A 4IDNA 1QCYA 1MHPA 3NO4A 5ENDA 1AXEA 1N8TA 2A4MA 1KRXA 3PCRB 5IWCA 2VJPA 2GNPA 2C3MA 5BN1A 5FBVB 3LBIA 1R4NA 2BFOA 3G2OA 3NHJA 3R5HA 2NPOA 4PZDA 3ROEA 1UJMA 2WSMA 4F4IA 5B7GA 3P9YA 2QAJA 2AXEA 2PX0A 3BHMA 1TC2A 1NJ5A 3EH1A 5FBKA 2EERA 1TK9A 2CBXA 5CW1A 3WMGA 2VK8A 2DUUA 2ZTVA 3NWOA 1G38A 2PQMA 1R9JA 1TYDE 1UDCA 1WXQA 2FEMA 2GLUA 2YS7A 4MCHA 3U7RA 1F5NA 1P7VA 4FNAA 3PFBA 4FYYA 4YCSA 1ZN7A 4YXFA 4GPAA 3V8MA 3AI3A 1I2BA 2OHOA 3LT4A 1WCYA 1NURA 4K88A 3ONNA 3GN2A 4KUEA 4EZBA 3JALA 1WDKA 1O9BA 5GM2A 2BE7A 3I0NA 5LUAA 1G6KA 3ZV4A 1X8KA 1TKBA 1GG8A 4WOCA 2E4WA 4I1SA 1UC8A 4ECEA 3TG8A 2HU2A 2HXGA 3TEFA 3VZBA 4D0SA 1B0ZA 2QLLA 2H2IA 2OQIA 4PNPA 5EINA 3H6HA 3X1ZA 4A0SA 1ZOPA 2H00A 2NIPA 2PV0A 4X90A 4RL4A 1ULUA 1M2NA 3QU7A 1U0TA 2B4QA 2R44A 2AQ8A 4NKRA 5JQGF 3GDOA 4TS4A 5ALNA 2OZPA 3C8ZA 1PNOA 1VIYA 5JH7B 4J16C 3T5DA 4DV0B 3D54D 2IWHA 1QFYA 3WWYA 4KITB 2BSQA 3RU2A 2ZB2A 5LMZA 2PT9A 5HF6A 6YASA 1MTOA 1KJYA 4MUJA 1OYYA 2RGBA 2J6BA 1BXKA 1DRKA 3S0JA 4D26A 3IOCA 2A9OA 3TQIA 3UMJA 1NXTA 2GJ4A 2ZIFA 2IU6A 4CETA 2PZEA 2CNLA 1R0RE 1NJSA 1RPAA 3EUFA 4GOLD 1MO6A 2K7FA 2BH9A 2D74A 2NZVG 3MJFA 4E6PA 3LCRA 3QE0A 4BEWA 1Y8ZA 1IK4A 2DP4E 2GWRA 2W9XA 3LUDA 3RCBA 4RL6A 4BNXA 2OCKA 1XMQB 4RA6A 4LJLA 1PDWA 2APJA 4Z0PA 5B1IA 5IJZA 5JNWA 1FFYA 3O1HB 4GBED 1Z6PA 4JLDA 4Z4HA 5I7EA 2QRHA 2OBYA 4KG7A 2OMEA 4U0KA 2XNKA 4QUEA 2VQDA 3EQ7A 4ZU3A 4ZARA 1ZJ6A 1EFCA 2OKGA 3MRXA 3QKTA 3NS7A 3FHLA 2B4AA 2PSSA 4YO7A 2Q3EA 3P9QA 3OLXA 2EJCA 5FPKA 1WA5A 4IPTA 1PEYA 1VQ1A 2QS9A 3OAAD 1UWLA 4XB1A 5U1PA 3UUFA 2DPHA 2O2DA 5ENVA 3W5VA 1J2YA 1VJ0A 3SC4A 2M6KA 2ORWA 4PTZA 5CD9A 1S4QA 2DBZA 4ITRC 5C8XA 3OM9A 4DR3B 3LFHA 5JD5A 3HZOA 1U1FA 3TQQA 4EEKA 1ZESA 3DAGA 2QKYA 5B30A 1RJ9A 4TL9A 3GBPA 1MBZA 1W88A 1YOVB 2IOFK 2W6OA 2ZSJA 3JQQA 3ZU4A 1HE3A 2NO9A 4BHTA 1OH7A 5DULA 3T7JA 2ZSAA 4FGJA 3RNLA 4XKJA 1QS0A 1HE8B 2IIVA 3DKVA 4IIBA 1GKIA 1T2CA 2RI0A 3JSAA 2COEA 2UZIR 2JFYA 3LUCA 1KR5A 3QIVA 2AEEA 4ND1A 1FTSA 1DB3A 3T52A 3OEHD 3HKCA 1F1BA 2WTUA 2KE5A 1AGNA 5TEWA 1CZKA 3FYDA 4B76A 4QGGA 3EDOA 5IBPA 4LWQA 1HT0A 2A9RA 1RXYA 1NE7A 4P2BA 1G8PA 1EFPA 2R8YA 3KKNA 4FW9A 1NVUQ 3G89A 1W9HA 4R2IA 2G9NA 3RGWS 4AN0A 2HXSA 5KSWB 5A9RA 1PL7A 4KR2A 2UYHA 3BH7A 2QGNA 3SLKA 4CL2A 1Y5NA 1M0WA 3TPCA 4CKXA 1JWAB 3D8SA 1MAAA 5M04A 1TB4A 2QI9C 4YHBA 4EB3A 1YI0A 4LC9A 4Z6KA 3DZHA 1EA7A 2DSNA 1DC8A 3LUGA 4D6XA 3CX7A 4INAA 1D8TA 1KFBB 4PR3A 5K09A 5LQKA 1QH0A 3AC0A 5CRIA 4GEGA 3AILA 4GKJB 2MJLA 2FCAA 2ID4A 3TVYA 4BTVA 2OV4A 4Q12A 4M1TA 4US0R 3V1YA 1NY6A 4Z9YA 1QHIA 4EYEA 2GM9A 1JHMA 1D1SA 1BXRB 3DE4X 4RELA 3QXGA 1PSZA 4XTCS 2GNAA 2AJLI 3UO8B 1W0JD 1TUBB 3MXTA 4CQMA 4X71A 4L73A 1NMXA 1YRYE 1RLJA 2WMDA 4EUFA 2YKGA 2VPPA 3L1KA 1C3XA 1N0HA 1QIIA 2X0JA 1F2TB 3I8XA 4MW0A 4OQZA 1T2DA 2FQXA 2MYUA 3HJRA 4DA8A 5A3JA 2B2NA 4AYXA 5AK6A 1N1EA 2NVBA 3KEFA 1UR5A 4PF1A 1PSDA 3B20A 5CCBA 2JFNA 1DWPA 1PJ3A 1XKTA 2Z5LA 3JAKB 2YN4A 3ONVA 2JGEA 3KQQA 1E4VA 2L82A 2OGZA 1ADFA 2PKEA 1NW8A 3QKWA 1XFDA 4RPIA 4G5HA 2J6HA 3MT0A 4IXTA 1A4XA 3RHTA 3SXUA 4HPJB 5MDHA 4CEHA 5EPOA 4WKBA 4LUCA 1AB6A 3PDHA 4G0NA 4LBYA 3VGJA 3EISA 2X7XA 4Q66C 1I51A 1RC0A 4C2UA 1O2DA 2OL4A 2QVZX 4CU2A 2WHQA 2J3KA 1S8AA 5A7HA 4YJ3F 3TIXB 2Q8PA 4R84A 3R9XB 1XJ0A 1GXSB 3A2KA 2D0DA 1GFIA 1Y8QA 3GU3A 3C3AA 5F9HA 1QF6A 2EARA 2GD0A 1NR7A 2BFWA 1E3TA 4J4BA 4NULA 5BOVA 2ATEA 2N3ZA 3S1AB 4DRZA 5KREA 2Q1XA 2RGEA 1NU8A 4MAAA 2IUUA 2J5XA 5EXPA 1X87A 1CUDA 5H9WA 5TARA 2VYQA 4F97A 2WIFA 3VZQA 1JFLA 3A2MA 2YZNA 3RUEA 4CKEB 2QRNA 3G8DA 3EEOA 3TD6A 3OD1A 3VU1A 4UBMA 2XNCA 3FKQA 3F3KA 2E21A 2O52A 3K0AA 1V7CA 4KSBA 5CVTA 3RHSA 1GKLA 2CYBA 3RT7A 1B8NA 4EPXA 1YQWA 1H69A 3AVOA 3CEHA 3HPQA 4JLWA 1JJVA 3KX2A 1G7TA 1GJRA 3AESA 1VPLA 3RB8A 4EFDA 4RABA 4M8IA 3WTBA 1QLWA 2IRWA 1IY0A 5AM0A 4EX6A 2EGHA 4IIJA 3ABQB 3W9UA 4R3UC 2VTDA 2FJ0A 2I99A 3HBJA 4ALNA 4CI0B 4LJRA 4A92A 2SCUA 2IDKA 4N3CA 4QHYA 4AICA 4IIFA 3MGKA 3T5AA 2E89A 3NOVA 4PO8A 3T9EA 1DJMA 2WUVA 1PT8A 3H7IA 1N2EA 4U2KA 4R1QA 1ZNWA 2O3UA 3EAGA 5FXMA 2Q7DA 5E2AA 2V54A 1YDWA 4TYYA 1BS2A 4PZAA 4GGMX 4Y2UA 3ROQA 2WHYA 2Y77A 3IIKA 1LK5A 1PW5A 4LC0A 5FOVA 3VU9B 1Q7BA 4PINA 1TGYA 1HNNA 3QMVA 5IBCA 3JXEA 3C85A 3LQRA 4KC0A 1C2YA 1OIVA 3DKRA 5DGIA 5D1NA 2OCXA 1NW9B 2VUHB 1OI2A 2WT4A 1ZXBA 3B36A 5DEOA 3OCVA 2Q99A 1Y5MA 3W3AA 1DAKA 5THKA 5JAHA 5LZ4A 1U94A 2XYRA 3HUEA 1L7PA 3QEMB 5TPWB 3U2QA 3NIDB 2MSLA 5ICGA 4HB3A 5JPDA 1ONSA 2A8YA 3WL6A 1J1IA 3CA8A 4HWGA 3F5MA 2QMYA 2PK3A 4UASA 1A98A 5FPHA 4E1VA 4EAQA 3KSUA 3CSDA 4RFSB 3IAS6 2B9VA 4BGVA 4C29A 4DMLA 1HDGO 1WB4A 2ZS8A 1G9XA 8ABPA 3K71B 1I7DA 3N86A 3FVTA 3WE7A 3A6JA 5ADHA 2IUEA 1RDFA 2PUVA 5FBRB 1YZTA 4J2TA 2XVXA 5EQFA 3LA6A 4LHWA 2VXBA 4AMZA 4MUNA 4IGKA 5AVXA 1LJ8A 3K1JA 2ACVA 1FJHA 1KOLA 5FJJA 2Q6IA 4XE5A 2OHXA 1KJNA 1NLUA 2I3AA 2WT8A 3WLTA 2E82A 1AUVA 2YFKA 4X7MA 1JDSA 3B7WA 1LK0A 1QP8A 1KO4A 1PFQA 4F46A 5KO2A 1Z5PA 3COJA 1FFHA 4O4JB 3VSAA 2IXEA 1YQDA 5C35A 1GKYA 3CZQA 4L85A 3JASA 1DKRA 3AL2A 1C3VA 3BMCA 3T0GA 1EMDA 4X1IB 2W2LA 3QX9A 1XT6A 4GMKA 5JAOA 4WFIA 1DKNA 3LF2A 4JFRA 1P6XA 4UD6A 1EUCA 4JBGA 4LWZA 4R8RA 3ANLA 4IFIA 2VWHA 4AKEA 5LIRA 3FTQA 1FMFA 1YSCA 4YH1A 3RRBA 3D6AA 1PV1A 2Q07A 1IM2A 1NMSA 3HCCA 3OCXA 2ZSUA 4ZO4A 4YJ2B 1Y34E 3LAWA 4IF4A 1ZC4A 3TTXA 3HI4A 5JSFA 1Y3CE 2ZRDA 3LXUX 4CMJA 4EUEA 2PGXA 4FB4A 3F5SA 1KA9H 1OLXA 4FFSA 4QOEA 4H7PA 2ZUBA 2FA9A 2VDRB 3NH6A 4M7RA 4LCEA 4NPHA 2HF8A 2PUWA 3COVA 1LCIA 3H65A 3T35A 3HO1A 2IVZA 3H5LA 4NLLA 4BP8A 1HOXA 5KDDA 1NBAA 1QYRA 1PJRA 3TZLA 1CNEA 2J3HA 4HPXB 4GF5A 1TUIA 2V7UA 3BMOB 5C2JB 1B14A 1E2PA 1DMRA 1AO3A 2IYTA 1WAMA 1P1BA 3CF4A 4GVXA 1SVSA 1M73E 1GFZA 1G4UR 1E2FA 1Y9JA 4PRLA 1QH1B 1NXVA 1FJGB 4Q4CA 3FWPA 2AQIA 2B35A 4HN9A 2XUDA 3TQFA 1M2VB 1TCCA 4UNRA 1V96A 3P9RA 1U0LA 4X8MA 3T3NA 1ZO8A 2WUEA 3B51X 3GP8A 3Q7QA 4LZJA 4XI9A 1IXZA 4X24A 5FL3A 5AUPB 1DIAA 1J33A 3AM5A 3T12A 3WGQA 1YCDA 4FYVA 4DCPA 1BWSA 1BVYF 1MQ8B 4XUCA 1LZLA 2YV5A 3NVAA 1KAMA 1IUNA 1MAUA 2PCJA 4GYYA 3TXXA 3E15A 3W3ZB 4MHOA 2I6FA 3WXMA 4WW0A 3PC6A 2HC9A 1G7SA 3EY4A 3LXMA 3Q9NA 1THTA 1IDN1 1K3FA 3TFWA 5DNCA 4Q1CA 1XTUA 4MGKR 1IN8A 2QZPA 1G20E 3P0FA 1KY3A 4MCJA 2VQEB 4KREA 4QPNA 1FB5A 2JLVA 1EWRA 1W59A 3L1HA 4LE2A 3F5QA 4OQYA 4RQTA 4NCHA 1IBRA 1G0NA 2C5HA 5KKAA 3GQBB 4LRTB 4G0QA 4EFNA 3V5NA 3OMWA 4EUNA 2V7XA 3FLEA 3MAGA 3LOPA 2JARA 4KK3A 4W63A 3W8RA 4CUJA 2O3SA 3BT7A 1YBHA 3SOPA 4OYHA 3QELB 3TZBA 3AR8A 2E1PA 1ZOLA 1B26A 5LYYA 4MYTA 4NAHA 4OL0A 3R3JA 3K9WA 1UFRA 1K0UA 1OLUA 2NZWA 2J33A 5IVPA 1WWKA 1XB2A 3EMBA 2B78A 2C9ZA 4P31A 4RTKA 4WV3A 4PAQA 4UNNA 1Z82A 4UTXA 3NG1A 2P2YA 3A4TA 5K6AA 4AJOA 5KTSA 1OI7A 1XZGA 3ENNA 3T1VA 1RZRA 1W36C 4N5HX 4ZVOA 4X7PA 2JCVA 4GMGA 5M3BA 3WDSA 1CERA 3KZVA 5K3AA 4C6TA 1XPRA 2I6UA 2ZZMA 5B1YA 1TAQA 3E9ZA 4UNQA 1BFDA 1ZI9A 3EF0A 4Z0HO 1CZHA 4D80A 2AUMA 2D3WA 1LNSA 1ID8A 1DG9A 1X1TA 3LYAA 2JLCA 1JQJC 3OQBA 3Q0IA 3VYTB 5LD2B 1S2GA 3DHNA 1YE8A 2ZIVB 3ADOA 1EG2A 2NXJA 4CL0A 3OUZA 5IVHA 5EKSA 3R3SA 4BJ6A 2R2AA 4UJ3A 5LXTA 2IGBA 1AK2A 3CZRA 3PRKE 4H60A 4Q7EA 3U7QB 5ADVA 1NULA 3NFRA 1E2IA 3P32A 3KT3A 2NOAA 4EA9A 1ZNYA 1VG0B 3BDIA 3QY9A 4JYPA 2F6RA 4GC9A 3MOIA 4H31A 1NVVQ 4JYAB 4NH0A 2P4HX 2QM7A 1L5VA 3C7TA 3INGA 2PZ8A 3OIVA 5DZSA 4X1KA 1U6IA 3F4LA 4OQNA 3FNRA 4ZVQA 1N8SA 3RC1A 2ZDHA 3VJMA 1JHDA 2BFBB 4FJ2A 1JR3D 1E1QD 2Z57A 1NZFA 3K9CA 3OESA 3EN0A 4NF2A 1X1CA 4RF5A 1U3TA 4WL0A 5IP5A 5L4SA 3ZCQA 1HX7A 4FYJA 3S2FA 4BNMA 4EP1A 1OI3A 5GZ1A 2I0FA 5DM4A 3LYLA 1WOYA 3PTAA 3IMCA 4KGXA 5DN6D 1KH2A 1NQ5A 2OVFA 4X94A 1AQYA 4UJ5A 1U8EA 3FSEA 1AKYA 1QU2A 3G23A 5AK3A 3FSJX 4MGHA 2WMOB 1OI4A 1ZGHA 3TM4A 4W5HA 1F8FA 1EFVA 3VH2A 4X66B 4ZFNA 2HMWA 4OXIA 5LCXA 1Q1AA 3QHAA 2ZITA 2PCLA 4QEDA 3DZJA 3KHUA 5GP1A 3WYBA 3FDJA 5DX0A 4R81A 4FOSA 1F5SA 1I5OA 1KS9A 4DUGD 1GZHB 2FXIA 5KNBH 3I83A 1T6BY 3MQ2A 4R9UC 3RYHA 4RCVA 4TV9B 2NO0A 1NN0A 4MPRA 1PZXA 2WTMA 3GGOA 3HN7A 3MLBA 2AK3A 4LOIA 5MGBA 2HY7A 2Z09A 2VR1A 1TM2A 2I2DA 4P2GA 2DHQA 3QYPA 1JG3A 1B42A 3QBVA 4JENA 2HFKA 4OXNA 1E2LA 4NC9A 1GCUA 2J5BA 2H65A 2H8KA 3RROA 1CY8A 1GCGA 3GLIE 5E7IA 4I6JA 1QJCA 1FX1A 2D0OB 3D8HA 5I4IA 1GZ7A 5BSVA 2HIMA 4WACA 3GZNB 3ZPXA 5EJ9A 1PNRA 4R2LA 1Q83A 3KKPA 1AQ6A 3TZHA 3DV0B 2NV6A 4H6PA 3EB9A 3H2HA 1VLVA 2BGNA 4H0NA 3ZV3A 4URXR 4YRKA 2YJ3A 1J97A 1HNZB 5LIPA 3SHOA 1QFXA 4RA9B 2CLLB 4CLRA 3ZXUB 3AV3A 2A5LA 3SJ7A 4A23A 4OMCA 2FB9A 3ZUGA 1U3GA 1J5XA 1VZ3A 2J30A 1Z8FA 2J3LA 2G82A 1ZD3A 3GJRA 3KR1A 3VR2A 2P3OA 4AX8A 4ZKDA 1E64A 3WLMA 4G09A 4RTSA 1DL5A 1I5RA 4U2CA 2D1FA 1JEYA 3RUAA 3L0OA 3LC0A 4MEJA 4DQXA 1LTQA 1II9A 1UK8A 5I9NA 5IWAB 1S2IA 4B6SA 3UGKA 4PSVA 1FQOA 2B4RO 3QUQA 1QJ4A 2Q5CA 5I9LA 4LOHA 2WM3A 4U6NA 3SPXA 1X7YA 4OXKA 3RT1A 5KNLA 4WLEA 1QX3A 3GJYA 2PUBA 2WYHA 1FPMA 1RM0A 4Y2SA 4XGRA 5J2UB 4JI0B 1YDGA 2GPBA 3WYDA 1PG0A 4HX5A 1VFNA 1YQTA 4UTOA 5CFRA 3AYZB 1Q15A 1XUOA 3TQHA 1I2AA 2G9RA 1JEAA 2H4JA 3RKUA 4LHXA 3V42A 2M1XA 1W5BA 1X7HA 3D5EA 1JPNA 1P81A 2B2CA 4WNAB 4JP2A 3U4QB 3UIEA 3CEMA 4OQMA 3S28A 2YIMA 2JD2A 2PBZA 1M1YE 1WF6A 3EYAA 1F8YA 3A2LA 2EFYA 3D9QX 3HBFA 2C8KA 3I0MA 3LI2A 4WLUA 5FI3A 3RSHA 3DYBA 1N25A 1J70A 3AR5A 4YUAA 4MICA 1WNTA 5A02A 1LPAB 2GK6A 3ZHRA 1YB5A 5CA0A 4DPLA 3SYLA 2ALJA 4AJ1A 2ESRA 3M6IA 1ESDA 1G5IA 2IL1A 1H5QA 4G1CA 4MWBA 4Q03A 3W6NA 2GTPA 2D0IA 1MOSA 2ZUFA 3IILA 5ER6A 5LA6A 1G21A 2JBAA 3OIGA 3G9ZA 1FXUA 2QG6A 3UWSA 2VTKA 2QNBA 3OLWA 1PYGA 5SICE 2X76A 2IGTA 2A3NA 4LTMA 3BWXA 3MA0A 2IOQA 4FNMA 1JBKA 4K6CA 5CH3A 1SBZA 1C30A 3VR5H 1YVDA 4FFVA 4W1RA 4MR9B 3H2YA 1PR0A 1SOMA 1TZBA 1GAEO 1Q1NA 5DNEA 4BPBA 4D41A 1FFCA 1AUOA 2MTBA 4GQAA 2QE6A 4LRXA 1R10A 3BMQB 2IXAA 5DN9A 3PNMA 1KJZA 1TADA 1VGVA 2D7DA 3U4MA 1JQ5A 4OJKA 3HI6A 4JYZA 3V4FA 4YDRA 2A0KA 3N59A 4KR7A 3K31A 2RH8A 1L7AA 4PG7A 5ICEA 1MUUA 1WMFA 1ZNXA 4HDKB 2EF0A 4Q7JB 4AECA 1YKSA 2JW5A 2YWBA 1KQGA 3KL4A 2FSIA 4Q1AA 3IESA 1BFUA