3KS9A

Metabotropic glutamate receptor mglur1 complexed with ly341495 antagonist
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
478
structure length
445
Chain Sequence
QRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLSIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTERYDYVHVGTWHEGVLNIDDYKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metabotropic glutamate receptor 1
publication title Metabotropic glutamate receptor mglur1 complexed with LY341495 antagonist
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 163
structure length 445
sequence length 478
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ks9A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ks9A01
2PL9A 1JYEA 2NZVG 5TQ2B 1WETA 1USGA 4KK4A 3KSMA 4D74A 1YMUA 4MLCA 3URMA 4G0XA 2B4AA 4Y9TA 4EVSA 3P9YA 2PUEA 3DZDA 1J56A 2N9UA 4Q6WA 3E3MA 2E4WA 2FKAA 4HNQA 1L5YA 1KRXA 3OO1A 2J48A 4RKQA 5FWXB 4GNRA 3HDVA 4XLTA 3O2SB 3EQ2A 2R4QA 4JP1A 3IP5A 3LUKA 2M98A 2PMCA 2YHBA 5T3YA 1QMPA 3RH0A 1MB3A 1P6QA 3I45A 3IP9A 3QELB 4RK5A 1C0EA 2WWVD 5C5CA 4L4UA 2QXYA 2IPLA 4PE5B 2A9RA 3OM1A 2L2QA 1Y1LA 3H6HA 2IPMA 4NQRA 3IP7A 4EUKA 2E4ZA 2E4YA 2E4UA 5CNJA 1ZY2A 1NY5A 3TX6A 3O75A 4PYRA 1DRJA 4JOQA 3OLXA 1LJUA 2HQRA 3LKVA 1URPA 5TE9A 1D1QA 1D4ZA 1NXWA 3LUFA 1LBIA 5HQJA 1ISSA 2AYXA 1RZRA 3I09A 5KQPA 5JNSA 1YS6A 4KFCA 4YCSA 1QKKA 1MAVA 1NXOA 2VYCA 3OLVA 2A9QA 2FLWA 2MSLA 4N03A 4Z99A 4N0QA 1Z25A 3TD9A 4F11A 2VUHB 5JNRA 3C6QA 5D2CA 5EWJB 2PJUA 2FTKE 1JDNA 2V0NA 2FEWB 3W9SA 3H5TA 3EULA 1EHCA 4MS1B 3T6KA 1TVMA 4W5NA 1CEYA 5TQ0A 3Q15C 1P2FA 2M1ZA 4MRMB 3EAFA 3N0RA 3GWGA 1Z2DA 4RK0A 3HEBA 4O1HA 3QEMB 4Z9AA 5FWYB 3S99A 1JDPA 4Z4CA 5IULC 3H6GA 3IDOA 3MYYA 4RS3A 2JB9A 1BVHA 2FMIA 4PZ0A 4KRFA 2LUOA 5ABPA 4ETNA 1XWWA 1RXEA 4RZSA 3RVJA 4MR8A 3O1HB 1ZAYA 3LUJA 4YGXB 5IEBA 5KQGA 2QVGA 1JL3A 3O2JA 1FFGA 4IMJB 5HM6A 5HSGA 4DQDA 2FQYA 4OG2A 5EWMB 2HSGA 3T8YA 2FLKA 1QP4A 2GX6A 4KREA 2PUAA 4MQEA 2HJ9A 1YTUA 1Z13A 3N75A 1FFWA 3SG0A 1EWKA 5KWSA 1JFTA 3CU5A 1L5ZA 2JVKA 4RK7A 1D5WA 2P4UA 3KLNA 2MYTA 1U04A 2PL1A 3GBVA 4YWHA 1DJMA 5IUKC 4W5RA 4ZYLA 2JK1A 2L19A 2P9HA 4MS4B 1IIBA 1NXTA 4LX8A 4MYRA 4MGEA 4N0PA 4EGSA 1HEYA 5FBKA 3RVOA 5JNVA 2NZUG 2YHAA 1DBQA 3O1JC 1JBEA 4EYOA 3D8UA 4KZKA 4DADA 2A9OA 4H3KB 4MS3B 2DRIA 1LBHA 2WJAA 4YLEA 1AB5A 3C3MA 2FW0A 1BDJA 5TQ2A 1U8TA 2FVYA 3KYJB 3Q7RA 4XAQA 5TPZA 5JNWA 3UKJA 4Z4EA 4JB2A 1ZGZA 4QPJC 4KQCA 4RDCA 1FSPA 4LE1A 3RVRA 2ID9A 2TMYA 5FBHA 2CHFA 4MR7B 4RK1A 2F8SA 4LDAA 3CZCA 3MM4A 3OLWA 5FWXA 5T7BA 1M2EA 3L49A 4TLLB 3BBLA 1UDRA 3LOPA 4YO7A 3VNAA 3OQOA 2PUGA 4WT7A 2GBPA 5IBQA 1YIOA 3OLZA 1C4WA 1P6UA 3BRSA 4G86A 4QICA 5IUJC 3I5AA 1QP7A 4RSMA 2ID7A 3JY6A 2FEKA 3IPAA 4H60A 4P98A 1GCAA 2PLNA 3H75A 3QLUA 3JVDA 3OO0A 4JASB 4N76A 3ILHA 2LBPA 1RXIA 4WUTA 4E7OA 3C97A 3N0XA 3R0JA 3HO1A 1FFSA 3QX8A 4OATA 1A2OA 3NHMA 3FFTA 2E4VA 4LE2A 4Z0NA 4IGAA 2X7XA 1U2QA 3GA5A 3H1GA 3HS3A 4TLMB 5KQLA 1VLZA 1JH9A 4Z4FA 5ED4A 1DC8A 1BAPA 4RK4A 3BILA 2JVJA 5I4CA 4LDZA 4NCAA 2PAFA 3CKMA 1RNLA 2JCGA 1ZGGA 1YMVA 5BRJA 1RPJA 3CS3A 3DBIA 2VUIB 3D02A 5E3JA 3BREA 5EWJA 3NNNA 4MAAA 3UUGA 1GUBA 4MS1A 1GCGA 1I3CA 2FQWA 3FFWA 3HDGA 4MRMA 4ETIA 1ISRA 1EFAA 3KHTA 3LKBA 4HNSA 1XHFA 2PE5A 1F51E 1PEAA 5DKFA 5FWYA 2GKGA 2JVIA 3O21A 3CHYA 3VNBA 3RVKA 5EWLA 1PNRA 5CNKA 1DG9A 2PUCA 2FQXA 4G0MA 3A10A 1JYFA 3M9XA 3OLYA 1ZVVA 4KMRA 4L85A 4XXHA 2ZAYA 2FN8A 4KV7A 2QSJA 3CLKA 1MIHA 1A04A 4TN5A 2XDYA 2GWRA 2WRZA 3JPYA 3M9WA 4IMIB 3EQZA 3SQNA 1PEYA 2OENG 3F7NA 3I42A 3QLTA 4XASA 3JPWA 3KTOA 5TQJA 5GQSA 1ABEA 1SRRA 1BDIA 4D6XA 2VK2A 5KC9A 4FE4A 5PNTA 2BGGA 3GT7A 3DLHA 3HK2A 1CYEA 2I6FA 3KLOA 3IPCA 4MS4A 1D2AA 1QPZA 2HPHA 5JS1A 4YR7A 5JNTA 4LE0A 1DCMA 2IYNA 3SNKA 2MYUA 4MS3A 4EVQA 5DGCA 1DCKA 4IRXA 3SM9A 4ZMSA 4YS6A 3K4HA 3Q41A 3DGEC 4G0OA 2H0AA 1QP0A 3HZHA 2PUDA 1NXVA 3Q7SA 4YV7A 4MR7A 4FE7A 3KG2A 3QK7A 3EGCA 4G0PA 1ABFA 1Z26A 4GPAA 5BRAA 1QO0D 1SXGA 2FMKA 3SAJA 3HUTA 4WWHA 3T95A 1U0SY 1USIA 4QYWA 3KYIB 1LJLA 4RXTA 1DZ3A 2QVCA 3CG0A 4ETMA 5C5EA 2LP4Y 2B1JA 1ZN2A 3FDFA 4EYGA 4KVFA 1JHZA 2QU7A 4MR9B 4RY8A 5DCLA 2PUFA 2NUBA 5JS2A 2H3HA 4Z4IA 1PNTA 1TJYA 3FMVA 3NNDA 3RVNA 4W5OA 2CWDA 3UK0A 3Q9SA 3ROTA 1JLKA 2QW1A 9ABPA 4RXUA 4N41A 3LUCA 3ROFA 2WMYA 3NNSA 3CNBA 1GLGA 3RVPA 1E2BA 1YVUA 2JRLA 2MSWA 1PUXA 5IUNC 2O20A 1B00A 4G0ZA 3H5LA 2FEPA 4Z9BA 4S04A 1EWVA 2F8TA 2FMFA 1VKRA 3JVIA 4MQFB 1QQBA 4E7PA 2QR3A 3QELA 3B2NA 3KKEA 3DGFC 2W42A 2A9PA 3C3WA 4NV3A 4F12A 2RDMA 3HSYA 3CTPA 3LTEA 3OQMA 3M6MD 1KRWA 3CZ5A 1Z12A 3H5OA 1Z18A 4PICA 5JNUA 1VRVA 3TMYA 1QQAA 3OM0A 5CHYA 3N53A 4CBVA 4TMYA 3MMNA 3RQIA 4Z4HA 3LUAA 3CG4A 4RKRA 5TPWB 2FN9A 2LPMA 4Z4GA 1K66A 4G0YA 3GV0A 3NHZA 7ABPA 1NXPA 3BRQA 3H1EA 1GUDA 4O1IA 3F73A 4RWEA 1PHRA 1USKA 2IPNA 2FMHA 1YS7A 2CHEA 4HYEA 1AB6A 3F6CA 6CHYA 2AYZA 2IPAB 3HXMA 1Z17A 4RV5A 4P1ZA 4KNYA 3GL9A 1JFSA 1T34A 3DLBA 2IKSA 3FGZA 4G97A 3Q7TA 4IF4A 1SXIA 3OQNA 5KQMA 3QX9A 3QEMA 3MA0A 1EAYA 1S8NA 2FXIA 2WJWA 4KPYA 3F6PA 4EYQA 4G0QA 1W9HA 3H1FA 1ZH2A 2WY2D 1DCFA 4EVRA 3H5VA 1QNLA 1M5UA 1W25A 3CRNA 1JX6A 2JBAB 2GI4A 5EWMA 1R8JA 4MPTA 1ZH4A 3KCNA 3A3KA 5BR1A 1NATA 2R48A 3O1IC 1LK0A 4W5TA 5HKOA 4RY0A 1KGSA 3JS5A 5F64A 4EY3A 2ZWMA 4NICA 3L6UA 2KYRA 2R25B 3HV2A 3HM9A 1VPWA 3A0RB 3JTEA 8ABPA 4RK6A 4OBBA 1XHEA 1P8AA 4F8JA 5GOTA 5CNIA 3QLVC 4PEVA 3GBPA 3EODA 3G85A 1MB0A 3N8IA 1DRKA 2Q5CA 1NXXA 2HQBA 4QYMA 1RZRD 2R47A 2NT3A 3MIZA 3H5WA 2PUBA 2HQOA 4WZZA 4MR9A 1A0OA 4MLDA 3OMXA 3OMWA 1E6MA 1ZDMA 4XFKA 1DP4A 1K68A 2PKXA 1QO0A 2QV0A 3O74A 2OQRA 4YRZA 3RVQA 4RXMA 1SD5A 4DN6A 4UHJA 3A0UA 3FFXA 4B09A 4LRQA 1ZITA 5B3JC 3KJXA 4OLAA 5IC5A 5EWLB 3C3KA 3QLUC 3LUGA 4Q7EA 1E6KA 1Z15A 3LFTA 3O2QB 4F06A 4KK3A 5BQ3A 1OXKB 3NBMA 4NCBA 2RGYA 4MQFA 5KC8A 3HJFA 1DC7A 3IP6A 4RU1A 1BA2A 2MYPA 3EDCA 2RJNA 1ZESA 4KQ9A 2E4XA 1DBPA 5IEJA 1E6LA 4F3TA 1YK0A 5KI6A 4HNRA 4ML3A 1JF8A 3LUHA 4WXEA 5TQ0B 3ILYA 3G1WA 4JB0A 5DLEA 5CNMA 2MSKA 1JWLA 1F4VA 4ZJPA 1OXBB 2L17A 2WB4A 3N6VA 2L18A 5DTEA 3GYBA 4UHKA 5TPWA 5IX8A 1NTRA 2QZJA 1KMIY 2CD7A 4YP9A 4S05A 2NT4A 1D1PA 3QEKA 4N47A 4OTZA 1EWTA 1TM2A 1YK1A 6ABPA 4MR8B 1Z2EA 2LIVA 3HVRA 4ZMRA 3EJWA 3LUDA 1DBWA 4XARA 3N0WA 1Z16A 2MYNA 4O5AA 3RVLA 3QLVA 3K9CA 1FQWA 1TLFA 4LZLA 4MQEB 1TMYA 3TO5A 3CFYA 1NXSA 1SXHA 3HCWA 1CHNA 1JFVA 4RY9A 5TPZD 3T38A 4W5QA 1M2FA 4Q6BA 2IOYA 3LMKA 3RVMA 3TB6A 1U2PA 4EYKA 1ZHHA 4M88A 4OLBA 1M5TA 1H9CA 2FSPA 3SY8A 4JAVC 3H5IA 3MQ4A 1BDHA 3GRCA 1APBA 4ZPJA 2IDMA 3HUUA 4H3HB 3KS9A 3RVSA 4FB4A 2RJOA 1MVOA 4IILA 3E61A 5B3JA 4D6YA 4JA2A 4WXMA 3MF4A 2JBAA
chains in the Genus database with same CATH superfamily
1S2LA 3UFBA 3AUYA 3B8HA 5LP6C 4BFSA 1QH0A 3ISJA 3HBAA 3INRA 3F9IA 3URMA 5C8YF 3DZJA 4I36A 2GZ2A 4PIPA 3P9YA 3TCXB 5JJLA 3ICPA 2DQZA 4GYKA 3A2LA 4MVYA 4E5DA 2GHIA 3B7WA 3OCUA 2EKZA 2FUG6 2VSNA 5AKLA 4YI5A 4P7KA 3UMVA 4D3SA 1FZQA 2J8ZA 3FSGD 4L57A 4LJLA 4YAOA 2M9MA 3E53A 4J0QA 3UJ8A 4C2UA 5LOVA 1WF6A 4O08A 1ZJ4A 4ESOA 1ATZA 1M67A 1MC5A 2VT3A 3RYFA 3LDUA 2HY7A 1GNRA 4TVBA 4UCQA 3UNXA 5CT4A 1K7EB 2QM3A 4KQFA 2YHBA 1QMPA 3KKMA 4EQZA 2DYKA 3H2YA 2KM1A 3FCXA 1F3LA 2G82A 2WW8A 5EJ4A 3W8FA 5AW2A 2ECFA 2ZJZA 5JO0A 1I3NA 3LBFA 3AG6A 1QRSA 5K3SA 1F2VA 2NNLD 3SYRA 4EUKA 5C80A 1EP1B 4C6HA 5LL6P 1EH5A 5LC1A 4MRNA 4REQB 3LC0A 3QMWA 1NT2A 2J9FB 4KAFA 2WKWA 4WL0A 1A5SB 2ZJYA 5AKEA 2E6KA 1RFGE 2HBRA 3T9BA 2VR1A 2J3IA 3L1KA 2O2DA 3ADBA 5JXJA 1KIFA 1ISSA 3C3BA 2C82A 2FWPA 1AD2A 2XT9A 5KQPA 1DAFA 2YXPX 3ELDA 4HEJA 3LHFA 2V3CC 1T9HA 2NO5A 3MERA 4YROA 1FDOA 2FLWA 3T0FA 4UHDA 1J9EA 5IHXA 1UAYA 4GBJA 2VFAA 1XYGA 2HF8A 4KDRA 3T3OA 3AT1A 3QV2A 4KIFA 5L3VA 1Q7EA 1JLMA 1XTTA 4ND8B 3Q7PA 3KO8A 4RZIA 4W9NA 3RC7A 3SZMA 1GDTA 2Q4RA 2V54A 1VZ2A 4BX2A 1XA3A 4CUZA 4C88A 2J67A 3DKIA 3F4KA 3TSCA 1W5TA 3QEMB 4IDPA 4JBNA 3HDYA 5SYAA 3DCIA 5F4ZA 2P0AA 2ZT8A 2WG0A 3H04A 4JSRA 2WG1A 4EZIA 2IIPA 1TC2A 2YFHA 3OQVA 5FTKA 4GOLD 3ON5A 4ZGBA 4OREX 4B3MB 4PSAA 3EUFA 2QRMA 1V37A 3JWIA 3I0ZA 2HM7A 1R0KA 4ISBA 4YRSA 3BGVA 2O3SA 3KQQA 4XEUA 2CHQA 1IJKA 4YMLA 3PIRA 4HQFA 4GSYA 4FB5A 3GZTB 3RSGA 1UJ5A 3L1VA 4JBIA 2XBMA 3UK6A 1EA7A 3RFCA 4RM3A 4CYMA 1BJKA 3I2YX 2B4YA 5TF4A 1KVTA 3SXPA 4EEKA 2V0GA 4EBFA 1DQZA 3ELYA 2QMEA 2BF7A 2NVUB 4WRRA 1CUIA 3QUCA 1M9NA 2XUAA 4KYIB 2JEYA 4HF7A 2EBHX 3OEWA 4B0OA 1L5WA 1DJMA 3GBVA 1NP6A 1TQDA 1FDIA 1M2OB 2JJYA 3OQPA 3W1VA 2IU0A 1NURA 2P9HA 4HWSA 3TAUA 4LI3X 3DKPA 4OQLA 4V2UA 3WLKX 4EKYA 1UQRA 4UD2A 1ADBA 2B99A 3PGVA 1PLJA 3JZDA 5C0OE 3K0SA 5H1YA 1QHHB 3K9LA 2QE6A 2IH5A 1RE0A 4UW9A 4GWKA 2P69A 2Q1WA 4P0TA 4L27A 2XUKA 3PC2A 4QJBA 5ICMA 3H5AA 3JQ9C 3OPVA 3RBAA 4AT1A 5IF3A 4CEIA 3BJRA 4XAQA 4DCUA 4D9CA 3OF2A 3UENA 4GFDA 1IY8A 2RCNA 3WL6A 2C4KA 4B3FX 4U2FA 4BX0A 3ZX5A 3GQBB 1K88A 5CM9C 3R6TA 2K7FA 3O6VA 4AZWA 1DKNA 2NPOA 3F2VA 3CZCA 1NQ5A 5KJCA 5FWXA 1MNQA 5G53C 2BGWA 4ZK2A 3PBKA 5ED0A 4LV5B 2OHXA 4I4TB 2I1QA 1WKBA 2H2GA 3DDUA 4MVJE 1RRKA 4PO8A 4ZEMA 3W7BA 4MW6A 1JAHA 4QOFA 1V4VA 3A8TA 4R40A 1GTMA 2B6HA 3CTMA 1T5TA 4KAJA 2QXUA 3OJWA 3VBEA 5IUJC 2C7OA 1E2MA 4R54A 2DE0X 4F91B 2LR0A 1A4UA 3GQVA 3SBOA 3ODPA 1NAHA 3H75A 4YCDA 3SSMA 3EEIA 2E48A 3V34A 2ZJ7A 2DTXA 4IDOA 3SQOA 4F45A 1Q1AA 2Y77A 4YO8A 1OSNA 1GRQA 2QUBA 3AHFA 2EKBA 3N07A 4FKBA 1VL6A 4S2EA 3RSHA 5TB5A 1P3Y1 2ZWOA 2OESA 4B4OA 1KEPA 1GT6A 2W00A 1L3IA 3VZPA 3GLGB 3NBFA 2IXTA 3S2FA 3EXFB 5F35A 3N58A 1BAPA 3EUEA 3HR8A 3D3QA 2P8SA 3W90A 4A3SA 3X1MA 4AMZA 1A71A 1JKJA 1WPQA 1Q16A 3I58A 4JT4A 4LJKA 2PAFA 3PNLA 4KUHA 4AJIA 3I9JA 4YRBA 2NQ2C 1IN8A 4NCNA 5F7XA 3K0CC 1CKEA 5E3JA 2I71A 4OI0A 3NYIA 1SBIA 2LIPA 3UAYA 1UK9A 4P36A 3D2LA 4B1FA 3W6UA 2L82A 4A5SA 4BVJA 1EDEA 2XGMA 4BZPA 2VNKA 1Z68A 5ALGA 3DULA 3TINA 3JAMA 3QLJA 2H1HA 2JA2A 3MCVA 3EVZA 2ZBGA 3EVCA 4RTOA 1OI7A 1ZW6A 1LK5A 3QHQA 4G09A 4HAXA 2GKGA 2GWHA 2JVIA 5KOIA 1MTOA 2AJTA 3KT8A 3K8OE 5BMVF 1EBBA 2MHCA 3DTTA 1NUUA 3U26A 4PNHA 2VF2A 2O19A 5K8TA 2QX7A 4TTRA 4D25A 3ZWPA 3B12A 5H80A 2H4ZA 1RHQA 1LV7A 3RTDA 3TD2A 1LDNA 2WTUA 4BO7A 1KP9A 4NEHB 2GEFA 4RPHA 3W77A 4GZMA 1XG5A 2ST1A 4TYYA 2CHUA 3JYHA 4D0RA 1OYOA 1NKVA 2GWRA 3AEQA 3AY0A 2ZJ2A 4AS1A 1PZXA 3LQQA 2IF2A 3QLTA 1QHXA 4MGIR 3ROGA 2ARKA 3GGCA 4YRRA 3W5BA 4DLRA 2GPWA 4XVRA 4Q4HB 4RVHA 5HE9A 4XD2A 3BXZA 4JLUA 1SRRA 4PNPA 5AXBA 3AVUA 1M1NB 2J7PD 2Q9UA 4BNLA 4O02B 4BU0A 1AMUA 3UWDA 3DO6A 3PJDA 1IVSA 5LP6A 2EBUA 1RHRA 2ASEA 3ZY6A 5DN9A 1KSHA 1DPFA 5CHEA 3G0OA 3LYAA 4EPVA 4CM5A 2SKCA 3MTIA 3C7KA 1I13A 3U7HB 3R40A 2LXNA 3TLXA 1QIJA 4UTNA 3CR3C 3GRRA 3T1QA 1KI7A 4LJ4A 4ZV4A 2IS4A 4X95A 4HWRA 1QNFA 3U44B 2HF7A 1UFQA 1WS6A 3QYFA 1Y7PA 5EAIA 1F1BA 3GG9A 1UPFA 3M6VA 4JH0A 4M0DA 1U7UA 3B1WA 1K4MA 2OC4A 4ZOEA 1ZMRA 1FNCA 1NFRA 4Q3AA 3CW2A 4MWBA 1QC5B 4FE7A 5G1PA 4ZCIA 3KG2A 2OV2A 3DMRA 1ZOOA 3QK7A 3QFCA 2W8ZA 3H4TA 4BKRA 1YU9A 5B4VA 3HR4A 1NVKA 2G4VA 1SXGA 1X14A 2F8LA 3L84A 3NWEA 4PAQA 4RMIA 4X1YA 1QHSA 3SLKA 5KTYA 3PQ4A 2RKBA 3ICWA 2WSSD 2NUPB 2PUJA 4U6NA 1SG0A 3I04M 5DHUA 4MV6A 3S0JA 1UT6A 5CVVA 1RXCA 4JBLA 1X77A 1KZ4A 3UWKA 1RIIA 1AMOA 3IUEA 2OG1A 2WU0A 2PGXA 3K9QO 4GOKA 3DT6A 3H9QA 1GG2A 2X8JA 2AQIA 3AUSA 4MR9B 3ICEA 2BFEA 2H3HA 2BKLA 4OXXA 1ZIYA 2AMYA 2HCRA 1EVJA 3ZEAA 1I7PA 1VA4A 1N2BA 4BGDA 4YGYA 3E3LA 1OBHA 5LSAA 2F6RA 4PO3X 1NJ5A 3HTXA 3SI7A 2QL9A 3R8FA 4D2IA 4AXXA 1H0RA 2BI8A 4UE2A 5JCOA 3RC8A 5I48A 1PR1A 2AG6A 2Z5GA 4M21A 3VNQA 3AVYA 5AI8A 4GDFA 1MX5A 2FEPA 5A71A 3HE3A 2H17A 4C4TA 4MW0A 3HA7A 1EWVA 4RZQA 5AI5A 3IOYA 4X7PA 2GAAA 4BNWA 4ZVVA 1O6FA 4X1KB 4YJ3F 3W8DA 1XRNA 1LSOA 2IKQA 2B4KA 1TD9A 2PKQO 3TVTA 1ESDA 4NV3A 3D7RA 1KKMA 3DMTC 4J0CA 1CDOA 2NVWA 4X8LA 5AKGA 2ZJ6A 5EIOA 5J2UB 2HIGA 2XPCA 4II2A 3KE8A 1PWXA 3W34A 1GZ5A 2C7GA 2IV3A 4G9EA 4P3YA 3D3KA 4TT3A 2C94A 2W6ZA 4OQQA 2O7QA 3ZYCA 3F4LA 3PF9A 3VTAA 2A33A 1GPWB 2HPAA 3LC2O 3PP8A 4W1SA 4LAFA 3BB3A 3RQIA 1IEXA 3AYXB 3OF3A 1Z0JA 3VX4A 2NU8A 2JIOA 4GGMX 4F2PA 1VCNA 1CPYA 1WU8A 4DDVA 3O0DA 4CKEB 1XK6A 4N5HX 3ISTA 1YS7A 3SF0A 1AB6A 3F5QA 2BBWA 3P27A 1PF7E 2PNFA 1RC0A 2Q0HA 1C5KA 2E2WA 2AQ8A 2CNDA 3EG5A 4IOKA 5K01A 1ODKA 2XVYA 4O2AB 2Q1SA 3NHYA 3MRTA 4PFSA 3IXQA 4N82A 3V8QA 5ERXA 4QAQA 3AHCA 1W5SA 1KE2A 1C8KA 5B30A 3LS2A 1JV2B 2HLHA 4R41A 4DRXA 1A9RA 2W8BA 1B2LA 5KOJA 1Y9DA 1EAYA 3RV4A 2BHNA 1CQJB 4MW7A 1OXSC 1ZW1A 2QVLA 3IUBA 3EZGA 2P67A 2V7XA 2WF8A 4HFNA 5D1HA 4LOIA 4FSDA 2XXAB 1AVTA 3B6KA 3LT0A 4X1OA 4YBZA 4DLTA 2AMFA 3B3QA 3QYJA 1QTQA 1W25A 4OQFA 5IH3A 2B1GA 5IKOA 4C20A 1UK6A 3HA3A 3HN2A 3Q3CA 1DQRA 3PV0A 2JBAB 1W49A 3OKCA 2WLTA 3WMWA 4EG4A 5CEFA 3O03A 2HFKA 4P58A 1AV6A 1NATA 3PIIA 4NMMA 4JVSB 4AMGA 4X90A 4W5TA 5JWRA 4IDAA 5EZQA 5B12A 2OFXA 2F1JA 4QEDA 1KJNA 1XIVA 2CB0A 2QG9A 2O4CA 1T1JA 2WAYA 5CXXA 1FUUA 1U7DA 1VPWA 3CF6R 3A0RB 4CTNA 3KEQA 3ES9A 3IEVA 3GJTA 3L7BA 1WHSA 5K09A 1UBOS 3A9RA 5KJFA 2D7CA 3HVKA 4AY3A 3GIDA 2AG0A 2V5AA 2VLIA 4PHCA 1WW8A 1ZD4A 8ADHA 3GDOA 3IVXA 5ILGA 5K8LA 1DELA 7MDHA 4ZCQA 2FHSA 2WM9B 1HMPA 1ZSVA 3BTVA 3TVYA 2I0FA 4WZZA 3UMYA 4UDXX 3S55A 4GM1A 2JGIA 2YNMC 1AKNA 1YRWA 3FJYA 3JARA 4KQJA 3OQIA 4P92A 2DU8A 1SUPA 3OMWA 1ZDMA 4TL6A 2WF9A 4H27A 4BHTA 3GRFA 4E5MA 5EJ8A 2ICAA 1ADJA 5BUZA 3MK31 3IL2A 3DLCA 1RMYA 5KWEA 3KAJA 3RG2A 5JDCC 4E3ZA 2D2XA 2WM2A 3VHXB 1N1EA 1J39A 4XQ0A 4LF8B 3K9HA 3MCAA 3KOMA 2JG3A 3VKFA 1UFKA 3X2EA 2REBA 4C0HA 3A1CA 1EK0A 1T6ZA 2I4NA 3UJHA 2QRJA 4L78A 2A84A 5EVJA 1XFDA 4CMHA 1TEXA 3T5AA 2JKZA 1G55A 4RFVA 1NQVA 3WQQA 4G0UA 3CCBA 3EXAA 1VG1A 2VIIA 4NATA 3VR4A 5DBIA 4IDBA 2ZAGA 4GU5A 3DAFA 4I4IA 3Q3EA 4YYEA 2G7ZA 1YRBA 3IPXA 1CXZA 2W6PA 3JRWA 4ME6A 3HQ4O 5K4HA 4BBZA 4BP9A 2O8BB 4CIBA 1K3UB 2HLPA 3BGDA 1KORA 1OFVA 2OYRA 1G3UA 4RE6A 2I33A 4CG2A 3ZIUA 1VJDA 3K5WA 4FC6A 4HB3A 4K9DA 4JR2A 5A7FA 3L0OA 4NQZA 1SULA 1KMIY 3H2JA 4G8DA 3LQYA 2PMKA 4TUYB 4XCQA 3LNCA 5FLXA 1N3BA 2H7VA 3MFQA 1UKYA 2XECA 4LYGA 1MH9A 2BEUB 4MR8B 4EJFA 2BP7B 5K0NA 3SEFA 4LVOA 5KO2A 2FGKA 1OH7A 1P7PA 3HP7A 3PXDA 4JEMA 3LXRA 1YR6A 4RF2A 4DJ5X 3ESRA 4XCXA 1G41A 4CKCA 5BNTA 2EP8A 2ZATA 3K71B 1D4FA 1J70A 3ZS8A 4C07A 2Q5FA 4UMEA 3KQMA 2FW8A 1KOGA 4K1XA 1J7KA 1PBNA 3E27A 1L4HA 3PENA 5DWQA 5KKCA 3C5WP 5B4TA 3AIOA 1LLDA 4NMWA 5AW3A 2ID4A 3PC8C 2CDRA 1M6YA 1E0KA 3I01M 1PO7A 2JPDA 3G0CA 3B82A 3OCYA 4HNHA 3UV6A 3AVVA 4MXDA 1RPNA 2HV9A 1UDCA 2AOVA 3CEAA 1S2IA 3H5IA 4HZUB 5E7IA 3I5YA 1WHTA 3SJBA 5DI3B 2AE2A 4L5AA 1C0LA 3HUUA 2IHYA 3G5LA 4FYPA 4H3HB 3TBKA 1DGQA 1TCUA 5G40A 4S0ZA 3DDCA 5E1DA 1QVZA 3TI7A 1AN0A 4DCMA 3QF4B 2Y8EA 2GCOB 5IVHA 4A9AA 2PL9A 1W52X 4WN9A 3A1DA 4WECA 1U2ZA 2TRSB 2G25A 2QTHA 3V2GA 2JCXA 2ZTMA 3AC0A 2P1ZA 4MLCA 5ITZA 4L5CA 2G1KA 3SX2A 4CN9A 2V97A 1JEAA 5EKXA 2PRSA 1K5DA 1NWHA 4NJMB 3ASZA 4GR4A 1B23P 3P20A 4LZJA 1J5XA 2AA3A 4IVRA 5KTTA 4LRSB 3ZJYA 1Q12A 3GLUA 1Z38A 3FCOA 3P0HA 4QU0A 4NAHA 5E0KB 2ZROA 4QHTA 4ZCLA 4ZO7A 1WCWA 3EC7A 3AY6A 4XLTA 4B33A 1WW3A 1Z6YA 3CH5A 1Z0FA 2ZUCA 2B9EA 3KVYA 4YK7A 3UAWA 1SQ0A 2O23A 3EEBA 1B93A 3L93A 1VPDA 4GVPA 3BSWA 5T3YA 1ZMBA 2GMWA 4FN4A 4I1SA 2JGMA 4XYGA 3I45A 5HS6A 3SBDA 3USES 2JL1A 4IGIA 2PGNA 5CFMA 1HFJA 4PE5B 3PF8A 3OM9A 1Z0AA 2Q49A 2IK8A 1LVUA 2YX1A 1DIAA 3F71A 4J0DA 4KZPA 4Q00A 2VL7A 3V6MA 3IBSA 5I7FA 5JAMA 1RYHA 5J9FA 2F1RA 1QZUA 3T5DA 5FPHA 4I50F 4CLOB 1EZZA 3RSLA 4AI6A 1G0OA 2AG8A 3AJRA 2XB6A 3U7EB 4BY9E 3F6RA 3LT1A 3NVMB 3A70A 4HG2A 5LWHA 3N7AA 2IBSA 3DMTA 1ZUD1 5G0SA 3NANA 4IWXA 5FNVF 4BQSA 4QZVA 2H5JA 3JQ6A 4Q18A 1Z29A 2V9PA 1MQSA 1GUYA 2WUGA 3ISVA 1LDGA 2VUHB 1K5HA 4BAZA 4RPCA 1UC4B 1LWOA 1P2UA 3RRXA 3EJ6A 4W5NA 4OJKA 2P2NA 1SOAA 3JQGA 1YQ9A 2WJVA 3UTCA 2BGMA 2V7QA 3L8DA 5BV0A 4BDSA 1K8XB 1C9JA 3PA8A 4F9FA 2FP3A 5BQFA 2FWJA 2ONJA 1E99A 2PZGA 3C7CB 5BSRA 2XKAA 1P9RA 4TLAA 4KQEA 2O5RA 3PPYA 5ALTA 2GILA 1VSTA 2FX5A 2GCPA 1JR3D 1NN5A 3LY9A 4E1BA 1T26A 1RXEA 1JA1A 4DANA 2ECOA 4BMOB 1FBNA 4Q0MA 4B80A 4GE3A 1FUYB 2F67A 3O2JA 1QMGA 3SVLA 1OWLA 3Q0EA 2BTEA 4F93B 2Y0DA 2YZNA 3FPLA 2Z5VA 1KHTA 4KITB 2PVPA 3RADC 1QP4A 3JYNA 2LVBA 1B2RA 1SOWA 3P19A 2Z95A 1XQWA 4B71A 3OFND 1T8RA 2G9QA 4L51A 2D5BA 4Q9DA 5DYNA 1Q2UA 3GXOA 4KWEA 4C0SA 3N2LA 3SHTA 3RB8A 1JR3E 1QIFA 3R8XA 1R64A 2FMTA 1EGAA 2B37A 2PSJA 4HDSA 5F9MA 3PQ2A 4FJ1A 5BW6B 4WA7A 4YP6A 2PJDA 2HHCA 2Y68A 3K4PA 3T99A 4MROA 1T2NA 4J3JA 3PKIA 1OLSB 4BC0A 2A9OA 1V7CA 3TS1A 3P2KA 4TVKA 1BTOA 5BUSA 5JNWA 1M73E 3L0CA 4YV1A 2ZRMA 1FB5A 3R7LA 3TEFA 4EMTA 3CEPB 4JQOA 3TTSA 5JXGA 4ID3A 1TADA 2BZ0A 2EKDA 2VF5X 2B82A 4LE1A 3T9FA 3OZUA 3SC2B 3M4NA 5G0VA 4DV7B 2CHFA 4KVZA 3VU9A 3KSZO 3MM4A 5FR2A 4B8YA 4DBLC 3DE4X 5MF6A 4ZI7F 2RK6A 2YNMA 5AK6A 2AZXA 3MZ0A 1O95D 4FYYA 1WCV1 2NYAA 1MXHA 5CAEA 2Y1FA 3F2IA 4Z8XA 4AU1A 2M6KA 1VYUA 2UVQA 1YF3A 2PVCA 5G1NA 3LGAA 3T1NA 1GTZA 3E8XA 4PVDA 5BN5A 1RBYA 2PQ0A 5G1OA 5JDCA 5SV2A 3Q3IA 3X3HA 2ID7A 2FEKA 1FK8A 5AKJA 4K3VA 5J40A 5C5DA 1SQFA 1OLOA 3WOVA 3GOHA 2CLFB 3JVDA 5AKIA 3BMCB 3DWIA 1RXIA 3CF2A 4DT1A 3F74A 3L0YA 3RSFA 4OXNA 3LJKA 4M9UA 4F4JA 2OCIA 2J32A 4E5VA 3ZDDA 3D6MA 1P4RA 3IXMA 3NETA 5AT1A 2FPGB 2H4HA 2WHQA 3PUZA 1JH9A 2CB9A 4MHTA 4ZT3A 5UKDA 3VHLB 1O96B 3NYWA 2RONA 5LA6B 3D7KA 2QG4A 1DIGA 2ZVPX 4B8ZA 3T3NA 1U9IA 3CKMA 3ESXA 2OPHA 1ZGGA 2E0IA 2WWHA 1RWOA 1ZUNB 3H2KA 1XJ0A 1KAMA 4R2KA 3KSBC 3U13A 3D02A 1K6MA 1B8UA 2A1TS 2K2QB 2PUVA 4C6SA 2OCKA 4AM8A 2FSSA 3BH0A 2QI9C 1L5MA 4KX5A 4EPYA 3KPUA 1BNCA 5JTTA 4FONA 4MS1A 5LP1A 5K20A 3H16A 1I3CA 3ZHTA 4DDKA 3IIIA 3PSHA 2FZLA 3D4OA 1YKFA 4G5QA 1ISRA 4IDGA 3SC4A 4NXMB 3ZW7A 3F3MA 1G6HA 1PX2A 1ZJYA 2POCA 1PEAA 3EXHA 3NJ8A 4KE8A 5B37A 3OOSA 3QH4A 3T15A 5LQMA 3O21A 3K1AA 2EJCA 2NAFA 3K96A 4QHSA 2IITA 3I3SR 4J9VA 4QRDA 3WHKA 3ZHYA 4HQRA 5JBNA 2A5YB 4XSGA 3T7TA 1UFOA 4E33A 4HTFA 4MEAA 1DT3A 3RIMA 1ZJ5A 4MMZB 2OP1A 4TMTA 1F2TA 3A1VA 3QEAZ 4EPWA 4CT4B 3NVAA 1WOYA 4MUKA 1VE3A 4RVOA 4XXHA 2AVDA 2PFGA 2JI7A 2XOKD 4MVJP 4ZYUA 4NFHA 4DZZA 1UXOA 1QIEA 3MQ2A 3MWDB 3JPYA 3SGLA 1A3CA 5BUCA 4O0LA 1KS2A 1Y9AA 3V8EA 4Y9UA 4GBED 3UBMA 1SRQA 2YWEA 2HBZA 3OBIA 4BATA 4ESVA 1U0TA 1X15A 2UU9B 1SUSA 1LCIA 1I7SB 4QUGA 2GAOA 4BZXA 3QTLA 1BDIA 3N39C 4LHZA 3HEAA 4K9QA 1HYQA 1EXNA 4ER5A 2VI5A 4MIOA 5KC9A 1FLAA 4R3NA 5PNTA 2FDCA 4XKJA 3T5CA 3OIWA 3PXXA 3UJ3X 3K70C 3Q9NA 2XDQA 1PT6A 2XE4A 4KPUB 4JZKA 4BQPA 4V0ME 5FPSA 4YLGA 4GX1A 1U3UA 1WUHS 5KJ6A 3FKQA 1XZKA 1HDRA 1H5NA 3U17A 1N8TA 3QOYA 3MXOA 4LJSA 4NESA 1YDEA 5K0GA 4RIIA 4DR6B 3GLIA 3MN1A 1BZYA 1GJRA 2A9JA 2FSIA 3O5AA 4Y8VA 4ZMSA 3S2EA 1P0PA 3EVGA 5CA0A 3WBKA 2X13A 1GNTA 5DM1A 1KYWA 5IBPA 1NQTA 3DF9A 3JCZA 2XD9A 1RYEA 2OB1A 2AFIB 4IJMA 2C5SA 2Z2ZA 4HLUA 2XMPA 1T0BA 4YDRA 3S7ZA 1KBOA 4B6RA 3PUYA 2CLMB 2IODA 4V38A 1O03A 2FWBA 1C81A 1KEEB 1Z26A 3NBXX 4ES6A 1LV8A 1R0LA 2LE0A 5JC1A 1L5FA 3ML1A 3HYCA 4NYMQ 4WWHA 3VISA 2JLXA 1VKNA 1E8DA 2R00C 3RVBA 1H2XA 1JALA 5B57C 2H1CA 1M0SA 4GI2A 1S9HA 1U65A 5AVVA 4B9EA 1Q1QA 3EVNA 1THMA 3NTLA 3VYSB 3ZGOA 4HVCA 3UYLA 2ZKIA 2X8LA 2C2MA 3JQ8B 4HDKA 1WZUA 1CJUC 1QCCA 1E1QD 1TZCA 1XXHB 3FPHA 3NAZA 3TLAA 3DPIA 1X1QA 1RQLA 5M29A 5IPFA 5JMWA 1HF3A 2DOKA 2FZ5A 5FUQA 4MWOA 1E92A 1PJ8A 2PT6A 3ZXUB 4N41A 3I32A 1RTKA 3CZRA 1COWA 4DJFC 1QXSA 1KQPA 1LI4A 2LV8A 3EQ6A 3PQEA 4CFYA 4DV2B 3F3SA 1MTZA 3CF4G 4QQFA 4JJ6A 1E2HA 4O3FA 8ATCA 1OZ0A 1SC3A 2FRDC 2FRXA 4TMZA 4S04A 3IUMA 4UOQA 4MQFB 1VKRA 2Z6UA 1NXQA 4LKRA 2DVMA 3PT5A 4E51A 1FX0B 2QNIA 2VPWA 5EHGA 2VPPA 2X7JA 2A9PA 4CF6A 4RVNA 4ZQGA 2GM9A 3Q10A 5A3QA 1ZBQA 3ONVA 3CTPA 1WSBA 4HAZA 4MULA 4AJ4A 4EEXA 3ZZUA 5JRDS 4NBKA 1JHRA 1H2RS 4Q1DA 5FTMA 2IZZA 2JW5A 4ZYXA 1IY2A 3F6SA 2UUAB 1N8SA 4R71A 5JALA 4MJ7A 3MMNA 4WASA 3DBHB 4ZN6A 5ALFA 1S1MA 3QU2A 1OLUB 1XCOA 3MXTA 1YKSA 4L9AA 4BKQA 1DFHA 4WZBA 5EE1A 1YR9A 2RHGB 1NXPA 5E0OA 1YVRA 2VDJA 3ZC3A 4OX9B 2AN4A 5ALZA 3VAAA 2NGRA 4MKHA 4F60A 5C8YB 1KMQA 3FA2A 2DBRA 1EK6A 2OY0A 3R1IA 1WZ2A 4WIAA 3JYLA 2BTQA 1RDFA 1KXZA 4AW9A 3OTIA 3DLBA 3NIGB 1MBZA 2V7UA 3Q7TA 3AHDA 3U7IA 2OBFA 4IIJA 4HY3A 1WZEA 2RBKA 4B45A 2CMHA 2ZR9A 2LCFA 4V0RA 3KHSA 5KYWA 1V48A 3ADKA 1WP4A 3EGXA 4N3CA 2HDHA 1J9ZA 4X3PA 4D9HA 2ODQA 1M8KA 4TROA 5FNZA 3OM8A 2C07A 1JG2A 3ZIAD 2NYUA 4MP8A 2X15A 3UH0A 1RPZA 3S7TA 4PQFA 2C7QA 2ZRLA 1XJCA 1AK2A 3DFZA 4NS1A 2GPBA 3T4XA 1FFXB 3P45A 1FTYA 2O0MA 1CG6A 3UMFA 3TPFA 3SR4A 5TLSA 1VJGA 3IE2A 1P3JA 4MPTA 3A3KA 1EDDA 3C1TA 5BR1A 3WYFA 3F5DA 3KUKA 4GYYA 4BO3A 1Y8ZA 3E82A 1G3IA 2WYHA 5F64A 1SOVA 4L0QA 3N8HA 5HRCA 3PFIA 4GVXA 2ZBEA 2JFQA 4TWBA 4YV0A 1XZIA 3EE6A 3MJEA 3P9KA 3C6KA 2NP6A 4E1AA 3QKIA 1ZCZA 1HQDA 2WJIA 2M6RA 1KJQA 3FYUB 3IBFA 3MJHA 1PT8A 4WFQA 3IQWA 3WL3A 2A6PA 4EL5A 5KTMA 1R9JA 5JPIA 2ZUTA 2Q5CA 2IF0A 1OIVA 3E03A 1NE7A 4URXR 3TN7A 4YNBA 4C76A 2DWOA 3WGZA 1TRHA 1Z4LA 4R31A 3L0IB 1G20E 2WAMA 3E1SA 5FO0A 4CLRB 3OCJA 3QZUA 1Z4QA 4M8LA 1FSSA 1EM8A 3U3KA 4F38A 3PHBE 1RM4A 3GCWA 3VPGA 4L8VA 4QBIA 3ZR4B 5C18A 1LTKA 2P6OA 4CETA 4BNXA 2IHKA 5FBRB 4WBSA 1E1LA 3C3KA 1YBHA 3DP7A 3KLPX 1JSCA 5KVAA 1QTRA 1Z15A 4F06A 1D0VA 1KJWA 1QG2A 1J06A 3W2FA 1B1AA 5I7AA 4OF4A 4UU0A 2XODA 3DE3X 4DR7B 2HK8A 2VRWA 5AJTA 1T36B 5C7OO 5CVUA 3SQWA 3RJZA 3NGXA 4DPKA 4LDNA 1JHUA 1Y5LA 2RHCA 2W2PA 3SR0A 3M0EA 4E03A 5AO9A 1TGVA 4ENWA 1J2UA 2EQAA 3O8RA 3ZVMA 2OHOA 4J75A 1EYZA 2QTZA 1DAPA 1RWBA 3ZHBA 5CNMA 1MG0A 4BP1A 2C04A 3N6VA 2CV0A 5JS6A 3JAWB 4L0DA 1UBSB 2REQB 2ZJ5A 3QKSA 3BFVA 4WFJA 4HGZA 1Y7HA 2XE6A 5E3HA 4D98A 5JCJA 3FHLA 3BEOA 3NM6B 5KTKA 5I9TA 2BIFA 3SQXA 2O8CB 1EHIA 4ILEA 3O4GA 5DM2A 4EDFA 4DNFA 3ZVNA 1PG5A 1SAYA 2OFPA 8GPBA 1VSVA 3F96A 1XRRA 4DILA 3FAKA 2EFGA 3DVAA 2VC2B 3MMZA 4Q1FA 3RVLA 2W2VA 4M60A 4TV9F 1TDJA 3L6BA 4LZLA 4HDOB 4GC9A 1QE3A 3ZK8A 4JELA 4W5HA 4S1VA 3OA2A 3PWTA 3COYA 4FD3A 4EPRA 5IM4F 3DBLB 4IM7A 3LMKA 1U3DA 5CVCA 2BGIA 3H8JA 3T5MA 4OLBA 4I2VA 3KOZA 3N74A 1XKTA 3JZIA 4CQLA 2I62A 3GLGE 3O91A 1O9GA 4CTJA 2VZ0A 4XIGS 3RC1A 3AETB 2IDMA 3KSUA 3O95A 1EKXA 4D42A 1S2DA 1N2JA 5FYQA 1M6VA 1X70A 4B7CA 4RD2A 2HA5A 2HI0A 3PL1A 4D6YA 4OX9Y 3PDCA 4JLBA 4CFSA 1R6DA 3CPHA 3KVOA 2A1IA 3IJ5A 5LZ9A 5C52B 4HLCA 4KK4A 3WQSB 1BFDA 4AVYA 1NW4A 2PUHA 2G5TA 4BCCA 3A4TA 4M7PA 1Y3IA 2MSEB 2C4TA 4DS3A 3WIDA 5D7BA 2ZRNA 3HVHA 1FSZA 3D4PA 1EB9A 2XNKA 3LX6A 3CVOA 3NVKI 1N57A 2CE7A 4OSPA 4GEGA 4HNQA 4RCVA 4UE6A 521PA 5SYNA 4BX8A 4L7QA 4EKDA 5JADA 4NOKA 1LSJA 3MCZA 3EEQA 3ZXSA 1K75A 2K6GA 4US2R 1RAFA 1ZCBA 3N28A 3T0IA 1VCMA 4I99A 2M98A 3QE4A 2PA0A 4Y6PA 1NASA 3A4YA 3RH0A 1W44A 3EA5A 1GGNA 2RK4A 4RZXA 1TQHA 2RGRA 2PO5A 4RK5A 2CBZA 3PX2A 1PWZA 2R65A 2GXUA 2HU5A 1Y1LA 2GERA 2FUKA 3H6HA 4MHOA 4UJ3A 4YCJA 1RCUA 1JAYA 1SIUA 2XQFA 1QYXA 3EEYA 2EHJA 2PH7A 4PVCA 1NBWB 3R77A 4WFKA 1IBMB 5TT1A 3PNVA 2X0NA 4BDTA 1TF2A 3IALA 2IUSA 1E2IA 1FTSA 4OGLA 1G4UR 4CEJB 4H7IA 4AKEA 1J97A 4C7BA 1FP6A 1R88A 1L5NA 1EUDB 2XF2A 1W88B 2INGX 3LUFA 4MZXA 4XIYA 4B3CA 3NYQA 3U39A 5E8JA 1TEVA 4TTIA 4BLUA 5JNSA 4ZYZA 5KDLA 2HC9A 5LMZA 2JGEA 4HWGA 1Z06A 4N03A 1JEYA 3MJ4A 3Q9LA 4L28A 3WFZA 4V24A 5D2CA 5C1PA 1G8PA 2EATA 1QOPB 2JGAA 1N9GB 1R27A 2XNCA 4H9GA 1JDNA 3EPJA 2DT8A 2CXPA 2FEWB 2R68A 4CKXA 1VHQA 1FNBA 5C34B 4I1RA 1YOVB 1JYSA 5B1DA 5HK8A 4R84A 1X80B 2Z2YA 4X91A 1CEQA 1O3YA 2CJWB 5DNCA 4L9RA 3ECSA 4TLEA 1Y1KE 3JQBA 4DMCA 2HA4A 1P91A 5FWYB 4YPVA 1JQEA 2EJTA 1ATIA 3E0XA 4P9NA 4U9UA 5AIAA 4QECA 1R37A 1V1RB 3LBAA 4UBIA 4EUSA 3GI1A 3NHAA 4H18A 4V0SA 1L3CA 2IU3A 2QE7A 5HTKA 1DAEA 1ODCA 4W5WA 2IYUA 1TA0A 4HH1A 2OUIA 1AQIA 1PJSA 5CBKA 4YMIA 1AKRA 3M4ZA 3SE0A 3PKZA 2O5VA 1J00A 5EWMB 3SBEA 5LLTA 3FHTA 3T8YA 3BE5A 2CDAA 1IUNA 4CGZA 5FV7A 4TSFD 4C1BA 3K6SB 4X94A 4Y2VA 1WXIA 4OHRA 3GX1A 4FHCA 1QX3A 4EHNA 3SG0A 1NMSA 2XGSA 4XX0A 3AUUA 1G7CA 2V59A 4UHBA 3HN6A 1W581 3MW8A 3KQKA 2HREA 1A9XB 2WMOB 2HWWA 5F12A 3UJ9A 1JHAA 4UMDA 1WDKA 1ZC4A 1IIBA 4PZ9A 5CIWA 2RGWA 5EXDA 4YUZA 5LP6F 2CXOA 3C16C 4KRXA 4DA0A 1TYDE 5I9NA 3STHA 5IJXA 1U63A 4GICA 3GUUA 1VG9B 4QYXA 4Z1MA 2CHVA 1LLFA 2NUAA 2Q2NA 4PZPA 4Y2UA 5TQ2A 4IIYA 4YCSA 1U8TA 4QUIA 3TKAA 2GBIA 4LNUB 3FYTA 3NORA 1NLZA 3H8VA 4Y0AA 1GV0A 1LBSA 4JU9A 2GO7A 2XUHA 2DHRA 1Z0DA 1ZJJA 2A78A 4GE0A 1UOQA 4KOAA 4PYIA 4RK1A 3RPEA 3UJAA 4RNDB 5JAHA 2X2EA 9LDTA 3KQVA 3EZ9A 1A72A 4PPNA 2DBQA 2GYYA 4XJXA 2B20A 2H16A 4HH4A 4I1UA 3DBRA 1IN5A 1WCIB 4YJ3B 3CSSA 3TMKA 4TQAA 5IKMA 1N2XA 4TRRA 1NLYA 3HB5X 1YIOA 1U2RA 3QU4A 3RFTA 4W6ZA 4ZODA 1HETA 3VR5D 2OSBA 2ZJ1A 2Q29A 1C4KA 1Q0PA 4X54A 3N6XA 2X5NA 1C0PA 2Y1OA 3N59A 4P83A 5CX1B 2O8NA 3S44A 4BO5A 1OYVA 1OOEA 1FPMA 1FFSA 1O5IA 1NOKA 2VWPA 5KMGA 2WC1A 3GT4A 5A9SB 2J31A 1BG6A 1V6AA 3D2BA 1DU4A 1BHJA 3NX4A 1ZSNA 2GVNA 4G1FA 1C2TA 4GMDA 5CLGA 2GLTA 3BILA 3WG9A 4EMSA 1VBKA 1ULBA 1FNMA 1L7BA 4OP3A 1KH1A 4NENA 3A6LA 4YRTA 3R9KA 1FVOA 3RAPR 3OJFA 3SXJA 2UZ0A 3V4OA 2GGSA 3KTFA 4MITA 1B6GA 1ZINA 2HD4A 2R79A 4KQ1A 4CIAA 4CV0A 4EB0A 3VRHA 3KPYA 2BBSA 2YXEA 4HJRA 2ZI7A 4MQBA 5DTIA 4AF8A 3FFWA 1MJHA 4GOOD 4ETIA 4URFA 5HQ3B 4KXUA 4FVTA 1HZZA 5HEKA 3LE8A 3RUDA 2PE5A 4NARA 2OGUA 1NBMD 4X92A 3A9SA 1XDDA 2GZ3A 2QJTA 5JSQA 3M83A 3SZRA 3BGWA 2G83A 2XLCA 3FPGA 2H5LA 3FTQA 3GDFA 4J4BA 3VNBA 2W6MA 4NH4A 4OJQA 5FLEX 5B2EA 3WVNA 1Q77A 2D54A 4JOSA 4O4LF 5CNKA 1OAOC 2XR1A 5AVZA 3Q2KA 4R1MA 4L74A 4CCYA 1VL0A 4KXXA 3E22B 3U7FB 2VHEA 3TF5A 1L5OA 4CTOA 3OURA 2AI1A 2YV1A 4JODA 1ZD9A 4WNYA 1ZA2A 1UCFA 2OTCA 1XJWA 1PEYA 1PS9A 3F7NA 2H9IA 4JOBA 1DOZA 1CP3A 4Y7DA 5EQTA 3TKYA 5GQSA 3N2GA 2QTRA 4W9RA 3C8UA 3HB4X 3WJ1A 5L6LB 4P4SB 5JYCA 1TVKB 1T6YA 2RGAA 2VPIA 2H1WA 3HWSA 4J0IA 1PTJC 1J1ZA 1G5FA 1TCVA 2NU6B 1IOZA 1IZ7A 2Y1XA 4IEFB 5AUQA 5EZ6B 1D2AA 3ZZ1A 4AURA 3UMRA 2Q9BA 1J2TA 1Y1RA 5AM4A 4GX0A 5IJ0B 1VHJA 3OZRA 1Z8HA 1A9QA 5DSTA 3SJ7A 4B84A 3S1AB 1B74A 1NUHA 1DADA 3GAFA 1BWQA 1OFUX 4TTAA 3L8EA 5JI3E 1QLWA 1IN7A 3K4HA 4IINA 3DGEC 2P4QA 3KYDA 4EOGA 1A88A 1TJ5A 2QNRA 4KYTA 1U2SA 3OT1B 5B6PA 3FKSA 1AKQA 4C06A 3TPCA 3LX8A 4I4CA 4ZVTA 3TJZA 3M5WA 2J3EA 3W2IA 4ZVKA 2TSYB 5L40A 1IBKB 4G0PA 2CJYA 2DB3A 2H52A 1QRDA 3NEPX 3OUZA 1QO0D 2FWAA 5DHQA 1Z22A 3NT4A 4D3ZA 4HFMA 3T95A 4GL2A 1PGPA 1M7HA 1IXKA 4K9MA 1V5IA 4IICA 4XPZA 2C78A 2J33A 4JROA 2AR9A 1WXEA 2WUWE 5NLLA 3CONA 1JB9A 1PNQA 2UZIR 3DR5A 4D43A 5DYIA 4B82A 3PTZA 4RIFA 2Q8NA 1GTVA 2Q0QA 3FLMA 2CNNA 3C3XA 1ZISA 1XE3A 2EFYA 2R3SA 2X1MA 4FOSA 3LA8A 4J0GA 4XSVA 4W5OA 4PPFA 4V39A 2C8KA 3EWNA 5CB0A 5GONA 4G26A 4BJ6A 3TRFA 3WK4A 4GR5A 4F5WA 4EY7A 4D9BA 1PS8A 3I6BA 1NHWA 5EFZA 4YMUA 1SD2A 2SBTA 5AHKA 1NF8A 2QWXA 3KOWA 3GGJA 1DXOA 2QXTA 3SDBA 3RUHA 1FS5A 2TS1A 3B3FA 3C41J 3D8NA 1EUCB 1AXGA 2WZQA 2IZ5A 1GYRA 1W87A 2QR3A 1B0ZA 1R18A 3NDJA 3ITDA 4CKWA 2AW5A 2JZCA 2KJQA 5IAEA 3JALB 4DV4B 4CF4A 1G8JA 2PZJA 4RABA 4WEQA 1ZD5A 3A25A 1N2CA 1NUSA 4C3VA 2CXXA 1GSOA 2IWRA 3L0DA 3QXSA 2C3UA 4NV1A 5L9AA 2QUJA 3CCCA 1SUBA 4B3BA 1R6AA 1FUEA 4TMYA 4TMFA 1QDUA 2X22A 3DOUA 3ZCSA 5JMTA 3GJ4A 2HKIA 1D6MA 2H59A 2PV0A 1SELA 4J4TA 2XGJA 1O9BA 2PBRA 4M83A 4AF6A 2DY1A 4KDEA 3A37A 4H16A 1GUDA 1YULA 2GB4A 2HSWA 2QGZA 3EHEA 2VWHA 5SY4A 1N34B 4JQCA 4UAJA 4UFNA 4JEHA 1XDWA 2QAIA 4RM2A 3TAHA 3U40A 4R0MA 1J0CA 5JS2A 4P3NA 3KQUA 3P2IA 4BV8A 2BSAA 2BI4A 1KVQA 3E58A 3NOQA 4ZCSA 1YHZA 4QGBA 4WACA 4YRMA 1SXJE 3DLPX 1V1MA 3GL9A 3IPRA 4QKQA 5BVGB 2UVPB 4XDGA 3JQEA 3COJA 2B9VA 4UAGA 1L4NA 4X3CA 2JFBA 2BELA 5DIZA 3KZVA 3NEJA 1K0UA 2X0JA 3ZE6A 4JJFA 1GLNA 4RESA 2OK7A 4KPYA 2KLBA 1KPIA 1JLHA 2Q3DA 4Q37A 5ERGB 4BKMA 4M0CA 1GM5A 1I0LA 4D56A 4JDUA 1MA3A 3RBVA 3EXG2 1I4EB 2OFFA 2OPBA 3QLEA 2ZYAA 4BJHB 1T4MA 1JX6A 2ZI9A 3CKKA 3JQCA 3MTEA 3QVLA 3UT5A 4I50B 4OQYA 5DSXA 5JO9A 4Q34A 1D4AA 5B64A 1K6XA 1TYAE 4LHYA 1WMEA 5DVZA 2JJ8A 2PD4A 4FIDA 1QUFA 4CMBA 5CVTA 4KX3A 1X3SA 1OZFA 2WE7A 5EIHA 3GVPA 2Q99A 4I1VA 1Z9BA 5FNVB 1G6KA 2IEAA 4AD8A 3NIFB 2O8FB 2E89A 2BFCA 1NX6A 1P9WA 2W2KA 4JD5A 2RIRA 4BMSA 4EG3A 2OCGA 4PCAA 4Q9KA 2B8EA 4F8JA 3GXBA 1JLRA 2I2AA 1PG0A 3G85A 3R3SA 3SSOA 3G8DA 1ZNQO 3R0XA 1JFFA 4ADSG 1N9ZA 4FW9A 4JKIA 1UUFA 3I05A 4FOOA 4NSNA 2I4MA 2OHFA 4RD1A 3JV7A 5FBWB 4BMCA 5IZCA 4NXNB 1EE9A 5CM8B 2J5QA 3O2NA 1PG2A 5CLJA 1S5PA 1YH3A 1KAGA 5D00A 4FZJA 1J4AA 1GTG1 2H7CA 3SXUB 1ISJA 3O74A 4FCTA 3MS2A 1MP0A 2JI8A 3WIUA 2C8JA 3ZG6A 4B6FA 1SY7A 2CGEA 2F3PA 4UQPA 3C3YA 3BJIC 4BO8A 3AKDA 1CFJA 1LI5A 2F9LA 2EHDA 4XWKA 2A4KA 1CS4C 2BRUA 3F46A 3QNUA 4RKFA 4B17A 1XGKA 3ADOA 2IQ5A 1NJ2A 1THZA 4IIXA 4LOKA 2OZVA 1YI0A 4NCKA 5CDFA 4D8WA 1OXKB 2VSFA 3PC7A 3A3OA 3OCVA 4TL7A 1P33A 1FYFA 2P35A 2V6JA 1MJGM 2FOLA 3THRA 3V7UA 3WNDA 5CYOA 3ZJ5A 2BZSA 5A5DA 1L3BA 3OQJA 3WBBA 3WGKA 3NBKA 4XVHA 2VDVE 4D3YA 4E4TA 3RW9A 1L2TA 1SUEA 2GYWA 3IBCA 3NKLA 16PKA 3ACDA 3TLBA 5EPEA 4DAEA 2JLSA 5JSKA 1VHTA 1M1YE 1GRRA 2XZTA 3FFBA 3BZBA 4D9IA 3GA0A 3I73A 1F4VA 2NX2A 3CZQA 1ECBA 5IYZB 4UHKA 4EW1A 1J21A 3K2QA 1IPFA 4RUKA 4HGYA 4TKMA 3NVDA 1S2GA 3OPYB 1WRBA 1KY2A 2QZ9A 4OHUA 1E3EA 1PGNA 2QZJA 1FXWA 4KVGA 1XO1A 2XE8A 2Y2VA 4DQ0A 3BMNB 4N47A 3TK1A 2IHVA 2YV3A 1T8UA 2R6ZA 4OTZA 4BS9A 5JARA 3V00A 3G7NA 5LVAA 3LLUA 4RJIA 1A5TA 5JDIC 3NTUA 4AK9A 1WWKA 3HWRA 3QPDA 4FHFA 3B38A 1JMKC 1S89A 3FNIA 3HKEB 1T2FA 2C96A 4LC1A 5T8KA 3SF8B 2V7GA 5ALVA 1Z16A 1TJPB 1CE8B 3B78A 1P74A 3BRWA 5DN6A 3V8PA 2VPQA 3C14C 1TW3A 3PDJA 1TMYA 1ZBDA 5C8VA 1HWYA 1CHNA 4MJLA 4ZI7B 5TPZD 4Q1EA 1JSRA 1NKSA 2I6TA 2I4IA 3AJEA 3FYHA 6ADHA 2YL2A 3NT5A 2XKKA 5F3DA 5A04A 2ZYVX 1JDBB 1U2PA 4RV4A 3ZE0B 4ZZIA 1CBUA 4KFTA 4RFSA 1P7WA 5L3SA 2ZI6A 4GMGA 2W0SA 1HY3A 5DTQA 4QAJA 1APBA 3A4VA 3M70A 3THWA 4ZPJA 3USZA 5ANRB 1E2LA 3MB8A 3SS7X 4C3UA 4DL9A 4ZI2A 4UC0A 2J3QA 3VC1A 1DEOA 1H6BA 1ACMA 2B1IA 1LBQA 3ADDA 2YDYA 3LPDA 2NLOA 1Q91A 5GGXA 2F3UA 5AP9A 2W6JD 2IT1A 3C5HA 3VC7A 1GLVA 3OE1A 4HUQB 1Z47A 4IWNA 4F9EA 4IZHA 3T1HB 3P71T 3SHQA 2PUEA 1EVLA 5J23A 2JD0A 1R9MA 2E4WA 3QEOA 3KR1A 2J5RA 5F51A 4QGGA 5HGXA 3DNPA 3PYLA 3GMDA 4AZ0B 3EQ2A 2FOXA 4JUBA 3E7PA 3EA4A 3IP5A 3L1UA 5DPMA 4YAKA 2A1UB 1GXSA 2BGLA 2DC1A 2R66A 1L7NA 5LZ4A 1VMKA 3SFTA 3GFBA 5DMHA 1WO8A 2H9YA 5K3AA 5JZMA 3F5SA 5AJZA 3KXLA 4HJXA 2CDNA 4D0NA 1TT7A 3WDSA 2AXPA 4C6TB 2O6HA 2UV8A 1EGVB 2VK4A 4ER7A 2Z56A 4AB1A 1P1CA 2XKBA 4LWOA 3KQOA 3RFXA 1ZS9A 2IYYA 1UJNA 2QKYA 3NHPA 3DKVA 4DCGA 2VP9A 4B44A 2H2WA 3BD9A 3FWNA 2JDIA 3JRXA 3KT0A 4X0EA 4F9GA 1D09A 1YS6A 4UVGA 1X9IA 2BFAA 5I5GA 2FG5A 1Y1PA 3OLVA 1K2WA 3A6DA 3GOQA 1FRVA 1H6AA 4HH3C 1Z39A 1IG3A 2JGJA 4I7EA 4KWHA 1SM4A 4PSVA 1R0ZA 3IURA 2EGHA 4ZCMA 5K6AC 2V65A 3W9SA 3HI4A 4Z86A 1EHCA 5L51A 4HB4A 4X62B 3EGDA 4Q4AB 5JS1A 2F55A 4EWLA 4HYYA 4OUDA 4UTXA 1DMSA 4TM8A 4OBWA 2J3JA 4PQYA 1RWWA 1Z82A 3LYHA 1Z2DA 4HEA6 2SNIE 3DR3A 2XCOA 4RK0A 3V4VB 3ZHUA 3LK6A 2E1RA 4I55F 3TLEA 1LPOA 5KQRA 2V6BA 3CRMA 1XZJA 3NC0C 1R1DA 1DHTA 1ZOIA 2F9FA 3ZWNA 1FFCA 1R74A 2AX4A 1PKXA 2YCBA 2FJUA 2RHTA 4QDUA 1F2UB 2CLDX 4BNMA 2IXDA 1IDN1 2O07A 3KB2A 1QHFA 4QDZA 1JIJA 4S1NA 4YGXB 2KPOA 3DEZA 3V3TA 1L6RA 4RDHA 2IYAA 2B0CA 1FMTA 1YAHA 3SR3A 2ZE5A 3W3ZB 3Q8KA 1V0JA 2ZRCA 2O0KA 4UVHA 5A7GA 4A6PA 4U39A 1YTUA 4WZAB 3CW9A 5ALDA 3CUUA 2ENUA 3E5HA 3MGGA 2IUEA 4FMCB 1MN6A 3HZOA 1XZLA 3LIIA 4FHGA 1DG1G 1OA0A 4V3BA 4KPEC 1HNXB 2V6MA 5K0FA 3AF1A 1N5DA 4KB5A 3T1YB 2VHJA 2CW5A 1VTKA 2L19A 5ESDA 2YOHA 1QLJA 3ENVA 3D4IA 4UVIA 4BEWA 2M6SA 4N0PA 3W4KA 3G02A 4RKEA 4Y6RA 5FBKA 4AAYA 1HOTA 1Z4MA 2AUTA 2JJMA 3O3MB 5FA6A 1I3LA 4CM9A 1J90A 5IKXA 4RVGA 2IYXA 2VHXA 3GBSA 4CU5A 4MS3B 4YLEA 1X9GA 4BQOA 4XWYA 1QIKA 4B3XA 1Z33A 1U9ZA 3LT5A 2W6NA 1RYNA 2Y6UA 4NYJR 3BQMB 4R2LA 4M36A 4D8XA 5CCDA 3CO0S 4EABA 1T4CB 2AEJA 2ID9A 2QY6A 2G76A 3C8HA 3F6YA 1GVNB 4QTUB 5ALLA 3HSKA 4GSLA 4CDRA 3GAMA 1CUYA 4AZ3B 5AJWA 1PZNA 1OB5A 3JASB 3ZTWA 4YDQA 4UCFA 3BBLA 1SC4A 3TJRA 6LDHA 2PMBA 2G9RA 2J4FA 5D6OA 1AHNA 3ROKA 1DDIA 2QP3A 4OHVA 2FEOA 4GI7A 1WXGA 1LPBB 4K5QA 3AVOA 5CCBA 4JUIA 1MMFB 3KZXA 4GL4A 4QXQA 4DKXA 4HEHA 4JASB 2QLFA 3B52X 4EEZA 4P4UA 3BERA 1HZJA 1H2FA 3LCMA 1YQQA 3EW7A 5K3EA 4REQA 4CR7A 3ANNA 1KI6B 2VXBA 3FPBA 2J9FA 4QFCA 4OXYA 1Q22A 1GNVA 5EXXA 4ASUD 3TL3A 3P9RA 3H87A 3KJNA 3PE3A 4IFEA 1IAQA 1HXHA 4GOMD 4J0EA 4MICA 4ZQFA 4DZTA 3UZUA 4JYZA 3H4IA 3L02A 5B2ZA 3HHPA 1NAIA 3WWDA 2Y2UA 4ZAYA 5ITWA 4PHGA 5IC6A 1H2EA 2VK8A 1JHYA 1FYVA 1RNLA 3EUAA 4UVEA 2XCQA 4AECA 3IJPA 1G2PA 3KU4A 4K0RA 4MZDA 1WXXA 1PEKE 3PTAA 1UMCB 4N0EA 1B8NA 3DFIA 5E2IA 5CDYA 3PLAE 1CJTC 1RBMA 4K2AA 1G8GA 3VNUA 5BURA 3Q1LA 1FLNA 1XAHA 1W9MA 2OG2A 3HMKA 3JWEA 1KJZA 1ZONA 4FLEA 4ND8A 5JJCA 3OVMA 4JJGA 5JXWA 3PRYA 4C4PA 5ALOA 4H6VA 2PSSA 3DFUA 3RV3A 5JDIA 3FPCA 4RBNA 5F52A 1A8UA 1P9OA 2FZGA 5IT5A 3U7JA 5E1MA 3GLRA 1WSWA 3S2SA 3L7KA 3UICA 5L8VA 5DEIA 2PBZA 2GQ0A 2OM6A 3FROA 4CNBA 5TY0A 2HIMA 5HCNA 3KQPA 1H23A 4ITUA 1PVDA 5FCDA 2PUCA 1P2GA 1PS0A 2X3YA 5DXJA 2PTHA 3IOMA 1VLMA 1G98A 3CLKA 3KT6A 2FPXA 3QY9A 1Q7CA 4LRWA 4C6RA 3M9WA 1TM4E 2Q3BA 1CR6A 2X42A 2CNWD 5C81A 3LD9A 3FPAA 4LDPA 2ZRKA 1DTEA 2NVUA 3V32A 1GKYA 5JWHA 2WIDA 1NBAA 2YYAA 3GVCA 1CUBA 4N49A 1VMEA 4NC9A 1VECA 2VXOA 3GEGA 3GT7A 4N1AA 3KXKA 1M2OA 2Y71A 3UV3A 4IIJF 1AJEA 4N8SA 4NH0A 4BNNA 3OT5A 1BN7A 4LRYA 2X3UA 4XUGB 3WK6A 3Q0TA 4MWEA 1EFKA 3TEMA 3VR4H 3FR7A 5FLYA 1QHHA 3RO7A 2FR0A 2XYPA 3UJCA 3AR6A 2GXQA 1JECA 3QITA 1XMPA 4JENA 3EOAI 1PQWA 4H6PA 5GMOA 3GR6A 4EVQA 5BYAA 4MYTA 4U7GA 3IUNA 5C1DA 3OFKA 4FHDA 2BFNA 4XZ3A 4CCAA 1XI2A 2HAEA 4FDTA 4Z9XA 4C78A 4CF7A 1QP0A 3GQBA 4MPPA 2CCGA 4YRLA 3UWMA 4ZT4A 3WLRA 1R6XA 4YV7A 4YR9A 1C7JA 2FJPA 3IAM6 3ZBTA 3PFBA 4JEIA 1RTTA 1MRSA 1BDBA 2IXAA 4LGCA 4NJOA 1SZJG 4BNKA 4I4TA 4YRGA 1EFTA 3KELA 5SZHB 1AQJA 1K63A 2B92A 2FDXA 1USIA 1UDXA 1VP9A 1LJLA 1DAGA 1FQJA 1NYLA 3G23A 3L5OA 3LL4A 1QR6A 4OXIA 1KMMA 2AC4A 4Q3KA 5AOBA 3DXYA 3HDJA 4FU0A 1R8YA 3O47A 4BO4A 4CU2A 1RU3A 3MVEA 3PD0A 5IAJA 1H1TA 4JHXA 1X42A 1SVOA 2H1LA 1XZFA 4GLLA 3RSZA 4EMBA 4I8XA 1SO8A 2BR4A 4OBXA 4UFPA 4OB6A 1RYZA 3BJMA 4JGGA 4P7FA 5HHTA 1NNI1 3ZNOA 2OZLB 5IRCD 1JFRA 1O0SA 3EXFA 2Y1KA 5FUXA 2PH5A 5G4KB 2XOEA 1DBSA 3WKBA 3K1YA 3R09A 2OP0A 2ZJ0A 2PJZA 4HNAB 4OMFG 3UJ6A 1YVUA 3ESCA 5KKNB 3GUCA 2XXJA 1RI2A 2QI9F 4IFTA 4DY4A 2XI4A 1NNLA 1FYXA 2CLLB 4TV9B 2IYRA 2JH3A 2ZUWA 3C3WA 2RC6A 3A14A 3ONFA 4L50A 1VIMA 3FSEA 4KQXA 4F2WA 2ZSUA 3VZRA 4HAVA 2Q62A 3R6GA 3ONNA 4R1PA 1M8PA 4UNNA 5ITSA 2FPLA 5JNUA 2WEKA 2EW8A 3KT3A 3N53A 1CY4A 2GASA 4U2EA 2X5XA 4MHSA 1VI2A 1ELOA 5IC4A 3PI7A 2VK1A 2XKJE 4G8JA 1AS3A 4HBZA 3M89A 2P11A 4AL4A 2MIIA 1CY1A 1W4BA 2P0YA 4H4EA 3LP8A 4MMXB 1TCCA 4TPKA 2WHXA 4MQMA 5FUWA 3BK7A 1KE1A 5KDDA 1PHRA 3QF7A 4J16A 1IEVA 3T7SA 2RE8A 1QFYA 2BUCA 2NVOA 3HMQA 4OOEA 2CZQA 3TZLA 4G23A 1BH2A 3T61A 1H1DA 1KU0A 2PEZA 2VQ6A 3CRQA 1Z17A 4GMXA 4RV5A 4L4XA 4Q4HA 3TTTA 3P9SA 3OETA 4BVAA 2Q6OA 3KK0A 3GFSA 3P0FA 3AHGA 3NH6A 1M1NA 1U0FA 2PX6A 1CV2A 4X97A 4UOEA 1ENYA 2J3MA 5B53A 2WJZB 1TU4A 4H3SA 1UOPA 4LJ5A 1PR5A 4G0QA 4DGSA 3NDPA 4BZZA 1ACJA 4HDAA 4Q7LA 2ZBPA 2IIQA 4WCDA 3VNRA 3VO9A 3A1UA 4A8HA 4J1SA 4U2CA 3IUYA 3MRSA 4EITA 4FX5A 2QYOA 2GPAA 4OCZA 2WFMA 4ZAGA 2XMRA 2AEMA 3U44A 3ROXA 3IC5A 1RKVA 2ZCUA 3D0OA 5HDBB 5EJ5A 1ORIA 4PC2A 3H9UA 1OAKA 3O0TA 4E4YA 3AVTA 1I32A 3FOBA 3NOVA 4MWCA 5KX5F 1QC5A 1H4VB 1R66A 2PAAA 5T4FA 4FYKA 1SB8A 2E5LB 2KYRA 3HM9A 3MC1A 4BMDA 3ZV7A 4OY3A 4XFDA 3ACCA 4N7RA 4RK6A 4FNOA 1N6HA 4M38A 5JRJA 2D0OB 3FOCA 2NUPA 3OSZA 1XAIA 3X1ZA 1M34B 2RHJA 2OHJA 1ZGHA 2ZYGA 4G9GA 3WGMA 2C98A 1VSUA 2PWZA 2VLBA 3RHSA 1JSLA 1OCEA 3WYEA 1M2HA 4WGFA 4BFLA 5HZHA 3AB3A 1SD1A 4Y9RA 2A94A 1ID8A 4Z2YA 3ZDXB 1LW7A 2P9FA 3KB8A 1FFDA 3S3TA 1I30A 1MF7A 4MR9A 1OW3B 2OOSA 3WK5A 3QUSA 2JLCA 2HXGA 5LQDA 4ZQCB 4MLDA 3LDAA 4J9UE 4QYSA 4XLLA 2UUBB 4YRKA 4RQTA 3GEPA 4IFIA 1SD5A 2A5GA 3GPIA 1UK8A 4UBKA 2G28A 4C7XA 1G38A 2QK4A 4NBNA 5DYWA 2O2YA 3MFYA 1W1UA 4QPDA 1E6KA 4EKNB 4HLDA 5HKBA 2FWMX 4IUBS 2PRJA 1T2UA 4BTVA 3Q8WA 4X6LA 1NQXA 5THQA 1JXQA 5CJJA 3VFDA 4X1KA 2RGUA 3L77A 1H2YA 4FR5A 1PYOA 4M6WB 4J2OA 1P1JA 3A6ZA 3O26A 3QXCA 4KQ9A 3SICE 5EJEA 1XZEA 2J0VA 1N0WA 4NF2A 4Y9SA 3VR6D 5KI6A 3VU8A 3M5DA 3M9LA 1JR4A 1SVLA 4ML3A 3MINB 4IG4A 1AOXA 2H63A 2Y1CA 3N8GA 3N2EA 4HPJB 2QV7A 4Y6SA 4TWZA 3PHGA 3V6LA 1I7LA 5HW0A 1LC3A 2BR5A 2L18A 3R7SA 1NX9A 1FUIA 3DEJA 4JR1A 1O8CA 1EFHA 2CMGA 2FFHA 2QENA 4BUJA 4D97A 1JEOA 3NWBA 1J33A 4ZYYA 5LP6B 3BA1A 1KOJA 4HXFB 5TMEA 5AIBA 3DV2A 2AOUB 4RQBA 5BSVA 4D0SA 4CKEA 1XZHA 4O8CA 5I7RA 2RHOA 2HHHB 4RA9B 1KIMA 3C8ZA 4ZMRA 1VCHA 1JEDA 1CIPA 2X76A 4RORA 1AGRA 3EF1A 4FGJA 4O2AA 3UATA 1RI5A 1DVRA 3P9NA 1V26A 5JC8A 1K6JA 1NYRA 1P72A 2YUTA 4PTLA 4QU9A 3CZMA 4MB0A 4W82A 4BLOA 1F5SA 3B1KA 1CQJA 4F6LA 1JWBB 2C4NA 3OKPA 3F8SA 3GLKA 2P75A 4CR8A 1F17A 4JJEA 4YDSA 2XXAA 3HJCA 2RG7A 3EZXA 2G17A 1EFVB 2VP3A 1C4OA 1BVYF 2EEPA 3WK9A 4UEKA 2ODPA 3O4JA 3BULA 3GUVA 1FEZA 2JEZA 2P6NA 1J1IA 2HXYA 3U3DA 3ZLVA 2PFKA 4A16A 2W2OA 3BXFA 4JA2A 4OYLA 3IA7A 5B7GA 2JBAA 1QJ4A 3KD2A 3WA7A 3H84A 3PSAA 4IDCA 1IH8A 3WXBA 2CL5A 4CIYA 4AWBA 1XA4A 1LDMA 1HDYA 2RAPA 1TUIA 2WNHA 4YT8A 2O3UA 2WOOA 4G9BA 4EA7A 1IJEA 1J56A 3ZNNA 2A57A 4BO6A 1YDFA 1QBKC 1CQZA 4S0XA 2QQEA 2X6TA 4KQ2A 3K0BA 3DL4A 1VHWA 2R5WA 4DMHA 1E3TA 1W0CA 4GO1A 3CLRC 1L4BA 4PLZA 4W4TA 2WV7A 3QSYA 2OECA 4F7DA 4A8JC 1A5ZA 1XN4A 3EF0A 4X6UA 3F78A 2JGRA 4GRIA 3J7TA 4F0JA 3CV3A 4LQCA 3BAZA 5EZSA 4HLQB 1RYFA 4L3WA 5ESXA 2LRHA 4P3OA 4RVUA 4XI9A 4E5SA 4E6EA 621PA 3J81k 1US8B 1KFCB 1Q0UA 1YJXA 2D2FA 2EJVA 2XSZA 2YY7A 4K87A 2W6IA 4W1RA 1RXVA 4FEEA 1RMQA 3IEXA 2QLBA 3L82B 1P73A 4KH0A 1CSEE 3A28A 1M3SA 1U5AA 2G7MC 4PYRA 4TS9A 4PTYA 1USVA 1O4WA 4O4LB 1GTJ1 4K6OA 3M8KA 1REQB 2AQHA 3IUPA 3PDWA 2VWQA 3VHXA 1D1QA 4EB3A 1D4ZA 2ZUEA 1KDRA 2IOHA 2PZLA 3V4RA 4BQNA 1LBIA 2NXEA 3L07A 1BE0A 1O1YA 5A6VA 1U8YA 2UAGA 2CLHB 4WESB 1QF6A 1D0IA 1ODFA 1ESZA 2YASA 3HY3A 2ONKA 3U0BA 1NXOA 2QN1A 5H0IA 5L3RA 4CCWA 3JYQA 5CURA 4LWZA 5D3ZA 4OJNA 4Z99A 3DXFA 4JWTA 1QIIA 4MUNA 1EP2B 2NG1A 3E9CA 3ORYA 4OVKA 4X84A 2FFBA 3PGLA 1U1FA 5GP1A 4NBWA 4RW0A 4TOIA 2MJLA 1JNYA 4TL9A 2GJ8A 1HFKA 4KH1A 4XVQA 4TYMA 2LWIA 3DL7A 4A0QA 2M1ZA 2O8BA 1XOIA 1K0FA 1Y9ZA 4KQKA 2R1TB 4RPJA 1G21E 3FTDA 3SYKA 3VDRA 3BL8A 3CX6A 4IJWA 5HBRA 5IJAA 3ZDCA 1XU9A 3PD7A 3GAAA 3KJZA 4TUYA 4MEJA 3IEKA 1MHPA 4XB1A 4ZRMA 4ETNA 1EX9A 3N2NA 3QNWA 4F4FA 1FOEB 1J0BA 1SCNE 2BEUA 4MR8A 3D4LA 3V48A 4AS3A 4D4LA 1L7MA 3K9GA 2A35A 5C7LO 4XQGA 3LECA 4Y2RA 4UTPA 4GWGA 7YASA 3VKGA 4BB9A 4EFLA 1D8TA 1P60A 2CUZA 3IA2A 4OM8A 3VR0A 3EH1A 3G82C 4BV9A 2D1RA 4FYXA 3AH8A 2D74A 2HT6A 2W4QA 3C7AA 1AQLA 4KXFB 4R2MA 1GGEA 2AZMA 4DXHA 4YPOA 5JUWA 1F0KA 3IE1A 5HZMA 1Z5PA 3CU5A 4GPBA 4J29A 1GITA 4XIIA 5IXYA 4K0KB 2QL6A 4RK7A 4G63A 2P4UA 1SXPA 1LFDB 5THKA 3UYKA 1X94A 2EW2A 2PX3A 2RGCA 3GEDA 2B1RA 1TYCA 4HZUA 5DI3A 1CUAA 5ALJA 5JFTA 3CRW1 1NM5C 1V7QA 4OSOA 4A15A 1YE3A 2WA1A 1DTSA 2R8OA 1U1DA 2P27A 2Q41A 4AP6A 3QF4A 1B76A 3D8UA 1HE4A 1TF7A 2FG6C 1AB5A 1QWOA 2YS7A 1GPH1 3KD3A 4G24A 4NABA 3Q7RA 2BGRA 1OT5A 2XQIA 2ZB2A 1JDTA 2EU8A 1E2DA 4KLZA 4BKPA 4EHDA 3UAOA 3KQWA 1N1GA 5COBA 2PS3A 1ZI8A 3PVSA 3ZZTA 4K05A 4NJMA 1R9GA 4RDCA 2DJIA 1ZM2A 3E8SA 2LKCA 1TFRA 3PFGA 4KFSA 1T8SA 1SBTA 4MR7B 1H9AA 2FEMA 4OA5A 3TLKA 3WWOA 3PXEA 4O4IF 4ZRNA 5JS8A 2YXBA 2C20A 3MPOA 1QO7A 4ACAA 1CEXA 2IOQA 4TLLB 3ICCA 4UM5A 4KIUA 2Z4SA 3IB3A 3L46A 1YU6A 3G0DA 4YO7A 3UAXA 2I7XA 1L9KA 2YZMA 3KDPA 3NT2A 2VSYA 2D8MA 2ZXEA 3LO8A 3LVFO 3AB8A 5DBOA 3RWOA 2HJRA 2ZRPA 1QH1B 1EVKA 5P8WA 1P1FA 1HLGA 1A77A 3FHOA 4KPGA 4K3UA 3OHMA 1ONNA 3OO0A 2R84A 4N76A 2VRNA 2LBPA 4Q05A 1LY1A 1UWKA 3FSGA 4INOA 3UUWA 4B2LA 1C14A 4DSTA 4ESHA 4EJ2A 4YP1A 4C0BA 4CLOA 2ZB3A 2C1ZA 2EJBA 2Z58A 1Y42X 1ZWLA 4IKOA 2RFLA 1L7OA 4FNMA 5C7YA 5E2AA 4PR3A 2ZUVA 4LJ8A 3V1KA 1E2EA 4HN9A 4L8GA 2P8JA 3E4DA 5EXEA 5AW1A 3HKDB 3OZXA 1W0JD 1XKLA 3BT7A 1CW2B 3MWJA 2PKWA 3TW8B 3HBLA 3P5BA 3U5TA 4PZDA 2OB2A 1PNVA 2C83A 3CS3A 3DBIA 4N3BA 3KM0A 1YB5A 3H2GA 3UFXB 4DHEA 2CYAA 2VUIB 5H81A 3QW2A 3NWOA 4MDYA 1ZXXA 1RQPA 3BREA 1UIRA 4OQPA 1UINA 4ZI5A 4ZV7A 1YS2X 5DBFA 5H68A 4P3PA 1B16A 4ND3A 1FU7A 3BJEA 5HGJA 2E85A 4CKCB 3BVPA 1TEHA 3BM5A 5L4NA 2ORWA 3ZVLA 1KJYA 1K3FA 2IBTA 1QSGA 5L4LA 3TW0A 1EFAA 1D5CA 2A59A 2CL0X 4H7JA 3U3ZA 2VRBA 5G0UA 2O8VA 4RWZA 5J59A 4TVOA 4DNPA 2YWDA 5DKFA 5DRTA 1VG0B 2YWJA 3X43A 2GFQA 2ZQ5A 3IHLA 1JVSA 1W5BA 4ODIA 1DG9A 1N6RA 1ODSA 4JKOA 4ZVUA 4BBAA 2E18A 5AHOA 4C5BA 3AF4A 4URYR 4BECA 1ML4A 2C2BA 3ZY5A 1CEEA 1JYFA 3WRYC 3AEUB 2YY6A 5AVRA 3SSAA 1LJ8A 4L85A 2G0TA 2R6FA 1CUHA 2FG7C 5ADVA 4XWWA 3HYSA 2X6RA 4LI0A 5CH5A 4WN9B 2XDYA 1WLYA 1JIVA 4I9UA 4JLMA 4YACA 1AUVA 3WADA 4A2PA 1JIKA 1NFFA 2A2ZA 2GZDA 3O90A 4UEOA 3SP1A 1U9CA 5EA2A 1PCXA 3UW1A 3LK7A 2J7KA 3MHPA 3ZK7A 4LMRA 5IASA 1PJAA 1R0SA 1X7HA 3E3NA 4LY6A 3KWMA 2NV0A 4FCVA 1UDWA 4D6XA 4HBGA 5C3UA 3RTGA 3ZNPA 4DCVA 1M2WA 3C3AA 1R0CA 2VJAA 2NXNA 1CYEA 3MWGA 1Q92A 2YH2A 1K7YA 4YUVA 3IV6A 4JBXA 5EJ2A 3AL3A 3WV5A 2F3TA 2H1IA 3JD2A 1QS0B 5KU1A 3ZU6A 4X85A 2QHXA 3ADCA 1G16A 3FHCB 5PGMA 4YIKA 2GPJA 2ZWPA 1OLSA 3GDWA 4PYQA 4Z0HO 3VSEA 5MN6A 1TVCA 3OOEA 5EIFA 2JGLA 1FY2A 1P1IA 2ZBFA 3BXPA 2ATEA 4KQMA 2YXLA 4G0OA 2H0AA 2Z8ZA 2D7JA 1ZA1A 1JTVA 2C92A 2LTAA 2HWUA 3LX4A 4ZARA 2QL5A 3Q7SA 4AJJA 3BDVA 2WVJA 3G7UA 3LGXA 4GI1A 3SC2A 3T4UA 4AMUA 1E9FA 1Z0IA 3AJDA 4M0FA 3FI9A 5DX8A 3HXTA 2I65A 1MC8A 3NXKA 4FS8A 3U80A 1G5HA 1OILA 2BEKA 1KQNA 4BLVA 3PVCA 5SZJA 3Q11A 1TAQA 1U0SY 2Y76A 5JMPA 3SCZA 3V8BA 4RXTA 4NFYA 3I8SA 2WR8A 1DKMA 2AS0A 3CVXA 2Z1DA 1E7RA 2BHTA 1Q0HA 2XUFA 3BMCA 5KYXA 3AKZA 5DT9A 1JQBA 2LZ0A 5DB4A 3S27A 2D1SA 3ENZA 3KEMA 5CUQA 1IBCA 1ZGBA 2NZYA 3GRKA 4GKVA 2B7CA