3EOZA

Crystal structure of phosphoglycerate mutase from plasmodium falciparum, pfd0660w
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
159
Chain Sequence
NTTKHIILVRHGTKEGCKQADITGKKLKDILNNKKVSVIYHSDMIRAKETANIISKYFPDANLINDPNLNEGTKRINKAYETYFYKPSGDEDEYQLVICHGNVIRYFLCRALQIPLFAWLRFSSYNCGITWLVLDDEGSVVLREFGSVSHLPFESVTYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords putative Phosphoglycerate mutase
publication title Characterization of a new phosphatase from Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 45
structure length 159
sequence length 196
chains with identical sequence B
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3eozA01
1BQ4A 3K4PA 3FJYA 1XQ9A 4GPZA 3DCYA 3DB1A 4ODIA 1ND6A 1QWOA 3GP3A 2DWPA 2YN0A 1DKNA 1FZTA 4ARSA 1QHFA 1SK8A 3NTLA 2EKZA 4JOBA 4PZAA 1UJCA 5AJVB 3QPUA 3HJGA 4HBZA 2GFIA 2ENUA 2WU0A 4AROA 1T8PA 4QIHA 4ARVA 2OWEA 4EMBA 2YN2A 1QFXA 1CVIA 3K4QA 5AJYA 2H4XA 5AK0A 1SKAA 2HPAA 2P30A 4IJ5A 1DKLA 1RIIA 3NFYA 3BIFA 3F2IA 2P9ZA 1UJBA 1DKOA 1RPAA 2HHJA 2IKQA 3LNTA 2P6MA 2P77A 1TIPA 3D8HA 2F90A 3D4IA 1V7QA 2DWOA 3QPVA 1YJXA 3E9DA 1E58A 2WNHA 3LL4A 1BQ3A 1DKMA 3LG2A 2A9JA 4PGMA 2P75A 3EOZA 5AJWA 1SKBA 2HIAA 1K6MA 3MBKA 3C7TA 2OWDA 3IT3A 3EZNA 4MA4A 5HR5A 2H4ZA 5CX4A 3IT1A 4JOCA 1ND5A 2AXNA 2EOAA 2H52A 2P9FA 4FDTA 1C81A 5PGMA 1SK9A 2P2ZA 2H0QA 1IHPA 3MXOA 3IT0A 4D4KA 4D4JA 2I1VB 3IT2A 1FBTA 3F3KA 2RFLA 5CDHA 5AJXA 4D4MA 3GP5A 1H2FA 1H2EA 3OI7A 4D4LA 1BIFA 1YFKA 3GW8A 4JODA 4IJ6A 3E9CA 2EKBA 3O0TA 2WNIA 4EO9A 1E59A 1EBBA 3D6AA 5CU7A 2A6PA 2P2YA 5HTKA 2PA0A 1V37A 4TSRA 4PZ9A 4GPIB 1NT4A 1RPTA 3FDZA 3ZHCA 3FDZB 2P6OA 1DKPA 3E9EA 2P79A 1DKQA 3QPWA 3R7AA 2BIFA 1C7ZA 1C80A 2QNIA 3KKKA 2ENWA 2P9YA 4ARUA 4FDUA 4E3WA 2P78A 5AJZA 3PGMA
chains in the Genus database with same CATH superfamily
4OAPA 3IUQA 2H54A 3P2OA 1NP6A 1X0VA 3LDAA 3LX5A 1KSHA 4W9MC 1W5SA 1RAAA 2X4DA 1K7EB 3W6NA 1SUEA 1RJFA 4AP6A 3CKYA 4JQSA 5AD1A 2Q4RA 4ZOLF 5I7WA 4MUXA 4HCJA 1LY1A 1V16B 3IMKA 1LJUA 3LM8A 4GR4A 2XSZD 3VJRA 5CFPA 2PVPA 1JAIA 1UIMA 1JA9A 5TS2A 4OI1A 4RULA 4HBZA 3FY4A 3FHOA 3A4NA 4LAFA 2W2XA 1FQOA 4IX1A 4JR2A 2ZP1A 4ER6A 5GJBA 5BP7A 1JFFA 2Y77A 3AVYA 4NONA 1M8JA 2IS4A 1E18A 1UPBA 2OB1A 2HUNA 2NLOA 2ODTX 2XCIA 3INYA 3S1AA 4M1OA 1D3AA 3LGSA 1NJ1A 2Y0DA 3HBNA 3U81A 2V98A 3TFQA 1RI5A 1F1BA 2O2YA 3EVAA 2JFBA 4CCWA 2XUIA 1WCIA 2WU4A 8OHMA 1IPEA 4WCDA 1KO5A 3LA6A 1M2VB 1AK2A 1N4DA 4QBTA 3A36A 4H6VA 1SZJG 1UXIA 4JI1B 3ELYA 3RGGA 5LWHA 3S99A 1KPHA 2GSWA 5IW8A 4NABA 4KN8A 2QTFA 4U0JA 5K3CA 3UIEA 4B44A 2VIIA 1P5HA 3LVFO 3LG2A 4Y2HA 3SEQA 2BZGA 2HY7A 1CUHA 3MWGA 4RY9A 2H4HA 4KRGA 1RC0A 1NVFA 4M0FA 3U16A 4HATA 2A1TR 3FH0A 2OZLB 3PS9A 3QVVA 2JAXA 2OCLA 4P86A 1JVNA 3TLEA 1SXPA 3LOPA 4UZSA 3FMIA 1JI0A 2H2IA 2LBPA 1U5CA 2XX3A 1R74A 4KBGA 4LJRA 2WAXA 3KZOA 2HEIA 2X0RA 4KE7A 4YDQA 4BB9A 1M6VB 2R4QA 3PGKA 3PRKE 3ZWCA 3VDRA 1JQBA 5KSYA 3DDSA 2AOTB 1G6KA 1STOA 4BLWA 3FHJA 4AIRA 3EGVA 4LNHA 1TOAA 2VP5A 3S3TA 4NDZA 5HJEA 1CQZA 1V41E 2RK4A 2XVZA 4NBRA 4U7PB 2QYTA 3WBJA 2XA9A 4MR9A 3RU3A 2VPIA 3FYUB 2EX1A 5DULA 3DR5A 2DG2A 3AM4A 2Q5OA 1QYCA 1QZTA 5I9TA 1WF3A 3RW9A 5EZYB 2BFBB 4M83A 1NXQA 2GZ3A 2XNDA 4BMPB 4DARA 2ZSFA 1V8FA 1XZBA 5FULA 3ZHRA 4D8XA 2D54A 3ITDA 4ER3A 4TS1A 1X7HA 2OAQ1 4IGKA 4JP5A 1I7NA 1YNOA 4TYQA 3CY6A 1BO6A 1D6MA 4E7PA 2PX8A 1WXEA 3N0XA 5CA0B 1QUFA 1KI2A 1LPBB 1BMFA 5HGXA 1G64A 3MCVA 1MEEA 2CNDA 3KOYA 1GGFA 1IU9A 3G2MA 4XPZA 3B3QA 1TM1E 3FDZB 3RK0A 4NAUA 3QQ5A 2E82A 4W5NA 4IUBS 3L8YA 4TYPA 1R0RE 3NHKA 1JJIA 2REBA 1BC5A 3GDOA 2VQ6A 1CHDA 3JASA 4JJGA 4KO8A 4BNTA 1SIOA 5I7EA 2J0SA 1R0KA 3SKXA 2PTGA 4RHTA 4MPRA 1UC5B 3F8SA 5JRZA 4RE6A 2QDKA 4LI3X 2LKDA 4FI3C 2E4ZA 4M1WA 2F3SA 4AY5A 2CLKB 2GEVA 3K4PA 5F7OA 1CJTC 3OA2A 2XD4A 1PP4A 4LBWA 3X1DA 4K9NA 1HV8A 2GPNA 3PTLA 5GIOE 2AG6A 2GPTA 1YZNA 5KYGA 1Y8RB 3GP3A 2RCYA 2G9UA 3CN9A 4PX2A 4IFIA 1K66A 4RCYA 1OWMA 2WF7A 2FRVA 1OGYA 1LSUA 1SN7A 5I7UA 3RQIA 3VPGA 2RH9B 4BFLA 2V7XA 2P6RA 1Y1SA 4EGAA 2AFHB 4JNCA 3RUHA 2BC9A 1E9BA 2PANA 3H3FA 2X7HA 4ARCA 1WZEA 2FWNA 3L0BA 1JIIA 1TVKA 3GIWA 3JQCA 4HH3C 4Z4EA 4IDGA 3E3OA 1JA1A 3CVOA 5I9BA 5CLFA 1AUOA 2JK1A 1XNHA 1A9ZA 4TL7A 1RBYA 4LOJA 2WIJA 4F6RB 1H2XA 1GFZA 3UHFA 3EFHA 1KWKA 1DKLA 4BRWA 3WWOA 3NXSA 2E4YA 3EZ7A 3UC5A 4XX0A 5DIZA 1SH7A 5C4GB 3OLCX 4UBOA 2H18A 1JA0A 3FKJA 2ZB8A 4BNIA 1JEOA 5JALA 2A0FA 4H7HA 1NA5A 4UUAA 2YZKA 2GZDA 4JU8A 4MULA 4IDOA 4NBVA 3VSBA 3JAKB 4FYWA 5AM3A 2Y6VA 3LBNA 3V7NA 4URHA 5KX5A 4TTSA 4QXMA 2OBNA 1L5LA 4E07A 1DOAA 3LUBA 1UFVA 3ZNNA 3ZVNA 1IMJA 1Q7EA 1SMKA 1Z38A 2B2XA 2YWEA 3D4OA 1CP3A 3C1UA 3I34X 1QHGA 4MIEA 3HNPA 4UM5A 2GN9A 1UOPA 3J7TA 3FTQA 3C5CA 3IVMA 1G5RA 3UANA 4D0SA 2ZUSA 5SYMA 3EZNA 4OJNA 1NWCA 3KAPA 4GRAA 4NARA 3FYCA 1BQEA 2JJYA 2G06A 1P1HA 4HUQA 1U31A 1QXSA 1CT9A 1FFHA 1ZINA 5KS2A 4BTEA 2V4ZA 1WSBA 1XCJA 2FTKE 3ZWOA 4JROA 5AM2A 4A0HA 5BSKA 2BN4A 6YASA 4RQAA 1TZKA 3RO7A 4HVCA 2OCPA 1UPCA 1C8KA 3BK7A 3KZCA 2C7GA 2ATIA 2VEOA 3P2MA 3DEZA 1II8A 3DDNA 3EIEA 3EXAA 1XZHA 3I3OA 2ZVPX 3LO8A 4YNBA 2P62A 5FJIA 4DLSA 4E2XA 3U3DA 4AZWA 2YDXA 4LRXA 4UAUA 4HT3B 1IK6A 1L7MA 2XTAA 1TRHA 2KSQA 1GPDG 1KRHA 3LLMA 4PZZA 5D00A 2W8BB 4ZQHA 1P0IA 2VOEA 4UOEA 1LLQA 3UMCA 1L7QA 5COBA 4LJYA 5ALQA 5A3SA 5IF9A 4BPBA 5C1PA 1N25A 3HYNA 1LBIA 1RKQA 1VKHA 3H7IA 4M7WA 4YAOA 3UCXA 4DADA 1UWCA 4EO9A 1P2SA 1R3DA 2FPPA 1LDGA 1YCDA 3W5JA 4TV8A 5CITA 2F3QA 2G70A 4J3FA 4P92A 2QM0A 3GGPA 5HOQA 3DE1X 5JVDA 4TSRA 1T5OA 2OV2A 3I8XA 1OVGA 5TV2A 1AU9A 5COQA 2HB6A 3COVA 1Y42X 1JG4A 1T1RA 3A9VA 4LC9A 3LAWA 1DCMA 1G20E 3PQ4A 4TPKA 2GJ9A 2IYYA 3IAXA 4U8GA 3FDIA 3DV9A 1X8LA 2GJSA 1I32A 1QG0A 3GBPA 4HC4A 2QXUA 1DKUA 2O8FB 3ICOA 5FI0B 1SKYB 4FDUA 2QSUA 4ZYYA 1H42A 1KVSA 2HA7A 2NM0A 2RI6A 4QOHA 3QKTA 1LPNA 5LC1A 3VKUA 2Q6TA 3HP7A 4US0R 1A04A 2PH1A 3A9CA 5KYUB 7REQB 2YWJA 4JLKA 3FROA 5LP6A 2CLFB 4WKGA 1NQWA 4C6TB 2HRDA 2IPLA 1XXHE 3QKWA 4RIHA 1EU1A 5IC6A 4EA6A 4L08A 3L0CA 5F3RA 1QH1B 1V43A 2Z09A 3EEQA 4E4RA 5I6DA 3R3ZA 5JLJA 4Y2JA 3HYRA 2PKYX 3BGOS 1VGRA 1BA2A 2WUEA 4NZYA 4RLQA 5BSMA 3VRHA 1SCDA 5A6VA 1S2OA 3CRRA 5CK5A 4BVAA 4I55A 3PA6A 3CF2A 2Z58A 3MRVA 1VHTA 4UEWA 3CYFA 5F77A 1ADJA 2OLEA 3JQDA 1SUBA 1LPAB 1XTRA 4FWIB 1X6VA 3OLZA 3NBXX 1E89A 3RFXA 5HK8A 1X3SA 5B12A 4G86A 2D8AA 1TB4A 3L1IA 2JJQA 2RBEA 2ZSAA 2GZRA 2Z2IA 3QENA 1Q12A 4GRIA 3Q2IA 4PZPA 1XTVA 1IEXA 3M3HA 4QVKA 3KRTA 4EY5A 4G1MB 4WBNA 1JN0A 5ALLA 1VPTA 5B3KA 1LXCA 4MKFA 1NN3A 4L9AA 5HTOA 1F4LA 1OAOC 1L5HA 2XJ9A 5JRJA 1L4BA 1QNLA 2JI8A 3ROTA 3T9AA 1OXUA 2XOXA 3NIFB 5ILGA 2Q5CA 4ZTUB 4WCVA 2IUYA 3PPYA 4AN0A 4BDSA 4ZDIA 3K71B 5CJJA 1MNQA 2IEYA 4XIIA 5TPWA 3ZXYA 4C0HA 1AS3A 1NSTA 3UENA 1L8OA 2GZ1A 1O94A 2UVPB 2WTEA 1SC6A 4RSRA 3H5VA 3L6DA 2F64A 2O8NA 2XNKA 7AT1A 4NV3A 1HDZA 4P53A 1AK1A 2CNOA 2SKDA 1W35A 2EP5A 2YIMA 4RK6A 2E4AA 4IMIB 5T67A 1BH6A 4ZMRA 4JBYA 3V4ZA 3AILA 1SVUA 3F73A 1A8UA 2ZM6B 4M4SA 1OE0A 1JI3A 4F0JA 4F72A 5FAKA 2WF6A 4UATA 2D8MA 5ALSA 3U09A 3R0QA 2VJQA 1OFVA 2YYZA 1N5JA 1DAPA 2W6ZA 3OIUA 1I36A 2Q0HA 3KPWA 3IHLA 2Z3VA 4PPGA 5D3KA 3HCNA 2EHJA 2MWMA 1Z9BA 3KSBC 2GKOA 3KZKA 4RENA 2IV7A 1MOQA 1KO1A 3ASVA 4MNTA 2WM9B 4POAA 3JZMA 4W1PA 5THQA 1F0YA 4NCIA 2GD1O 4PNPA 1H8ED 3CUUA 4TLBA 3VA7A 1FUIA 4DJ5X 4AJ1A 1U8AA 1WMDA 2D1TA 5A06A 5AM0A 1E9RA 5CM8B 5B58C 5TEVA 3SR0A 2C88A 1PK7A 4LK2A 1DVRA 1NAHA 2QRLA 4IICA 3V8QA 5JXJA 4DIKA 5B1DA 1L5ZA 2ZWMA 4ND4A 3VX4A 4EB8A 2VAPA 2EEPA 1GNLA 5HRCA 1LLCA 3PNOA 1EQAA 3HVKA 4RJJA 1V7CA 5FYQA 3HUEA 5NLLA 1EVZA 3RTDA 3EXFB 4X65B 4Y9TA 4BFXA 1KC1A 2QAIA 4Q1AA 1FCJA 3WB2A 4QQNA 3BJEA 3IULA 1G5TA 1EK5A 1R5OA 2C58A 2FV8A 3IEPA 4MYRA 4U39A 3X1JA 3ZHXA 3N2EA 4LTNA 2PAAA 2HBRA 3GP8A 2B69A 2B94A 5LB2A 5P8WA 4BAUA 4EJ0A 1IL0A 4O4HF 3FMOB 3SC2B 3B5EA 2CFOA 5AXBA 1CY7A 4MV7A 4YDSA 3U3KA 3NKLA 2FZEA 1A5TA 4GPAA 5C31A 5BW5A 3T15A 5DP1A 3ENWA 3IDZA 1GZ3A 1YDWA 4L8YA 3C5VA 2QVBA 2O0KA 2VZ8A 4Y2SA 2VP2A 4FK8A 2XZPA 1G3IA 5J4VA 3CBQA 5E6SB 2KJQA 1D5CA 2CCJA 1R4ZA 5IWAB 3IIJA 4LOLA 4KPGA 1ZVQA 2EKDA 2XEXA 1X74A 1K4MA 1SELA 2YVLA 4L76A 4NEGA 4OMUA 1JU3A 4XM0A 5AKGA 1CQXA 3UFBA 3ZWPA 3ORHA 3KL2A 2TECE 3FOEC 1JHPA 3HVJA 2WFAA 4LJAA 1PW5A 4UMEA 4FVTA 3FTFA 2C0QA 2O6LA 4WASA 3SYLA 1QO0D 3T4XA 1K4YA 1GPNA 5LVAA 3X1KA 1QHHB 3X0DA 2IDZA 3CEHA 3FDXA 4J3JA 4N9WA 5IDQA 2P6MA 1MB9A 1GPJA 4L4XA 2F59A 1GKIA 2A3RA 3ISTA 5K1ZA 1BHJA 4X8LA 1ZVMA 4C0SA 5DP2A 2C4UA 4HGZA 4XE5A 1SVLA 4PGMA 1H23A 1U99A 3STWA 3W90A 1VSVA 1JRLA 1OI7A 2QAGC 5F9FA 1CZNA 4HDNA 4JUFA 2Y1DA 3GHYA 4RNDB 3S27A 1DJMA 4P5EA 2CT8A 1UBHS 3Q85A 2R47A 2W22A 3GT3A 3A28A 3R6GA 4GGPA 1Q2XA 4RVNA 4UUMA 1YHZA 3DKIA 4WV3A 4JLOA 1DDOA 1E3MA 5JCJD 1VL6A 5BWLA 1Z7GA 2GNOA 4CM3A 1UXGA 3P27A 4INOA 4MMXB 2QGFA 3QE3A 4C7BA 1KMMA 2BD0A 3OQ1A 2H1FA 3AERB 3DLPX 3OZIA 3K0AB 2EG5A 3AU8A 4UNIA 2I1VB 2OAGA 3KYCA 3FOBA 2ERYA 3TUIC 3QXJA 1PLKA 5CNKA 4M0MA 3TRKA 4LWPA 5L3VA 5A1JA 3PNYA 4GZ3A 2QX6A 4HZIA 2BMJA 2OCYC 4EM6A 1AGRA 1EQUA 1OFIA 1UXHA 2BEWA 2H2AA 2FSPA 1HDYA 2HRRA 6Q21A 4ZCPA 1X80A 4OU4A 3GGJA 5DWQA 3MRSA 4ZOAA 4QHSA 2OBYA 4JBIA 2I54A 2I87A 4WZBA 3PGXA 1KDTA 1JMVA 2P3LA 4UNQA 2O7RA 4ZQIA 1YCGA 1CY2A 4B71A 4IOLA 3JYHA 4NR0A 5E6RA 1ISMA 2HCTA 2XMSA 1U0SY 2C59A 3CLRD 3JPWA 1G17A 4MQLA 3GJ3A 3TLYA 1DKPA 3ROZA 3NJRA 4WUVA 3PCRB 3HWSA 4N8SA 2HMSA 2PM8A 4LFBB 1THTA 2DQKA 3UH0A 1D2NA 1TYEB 1EIZA 2YXBA 5EHQA 4ZO6A 2BCGY 5JAMA 4I9NA 4PLHA 4PYLA 2WKSA 1XAGA 2FU5C 2CHFA 2WINI 4ZHSA 2PUDA 2ZCJA 1NRJB 3FFAA 3OY7A 2PNFA 1EVKA 2QS9A 3CZCA 1AVTA 2XYGA 4Y7DA 2ADMA 4RBNA 4DVGA 2C4KA 2GTPA 3EGDB 3GRPA 3QUTA 4YRTA 4YK7A 4CHGA 2EX0A 5FBWB 4B3JA 1Z2EA 3E5RA 3KB1A 1WRBA 5LXTA 1XVVA 1NVUQ 2EX4A 1YS1X 1NDUA 2Y1GA 4D8VA 3IP1A 4LJ8A 2AWNA 3RC7A 1LDYA 4JQCA 4Q3EA 3ZY6A 5B4UA 3M5DA 1N3LA 2BRUC 3LP8A 4KQIA 5HS6A 1I8TA 4PZLA 1ZGCA 3P4YA 3T61A 5U4QA 1H65A 4B2IA 4QVIA 1BJRE 3SZ3A 4FX5A 1PSZA 2HHHB 1V1MB 1E79D 1H8HA 3W04A 4KQGA 2I78A 1PJAA 3OG9A 3GLQA 2BISA 3L4SO 1HG1A 1T6NA 4WJZA 4AUKA 1R4NA 2Z3WA 1LI5A 2H1WA 1H9BA 1RXSA 2UYCA 2C0PA 2CLDX 1YZVA 3HA3A 3PUZA 4F2DA 1Y33E 1RJWA 5JMTA 1NG9A 3CLRC 3TXXA 2P5TB 2O8EB 2BCEA 5B57C 1Z13A 3NHWA 5AHWA 3UHJA 4CI0B 2ZPTX 3B52X 3DDOA 4RK7A 1TIBA 2VSXA 1VJ1A 4GZMA 3PT9A 4WADA 1VL2A 1HZJA 4I4TF 4DV2B 2PZEA 1C8VB 2DPHA 4FFDA 1DBRA 2CFCA 2JGIA 2OHHA 1FFAA 1YI0A 2RIPA 4KH1A 4CPDA 1T1IA 4ZOQI 2IH4A 1U7PA 5A7FA 3T3OA 2WOJA 2CV1A 1JLSA 2JZOA 1Z0IA 3IP8A 1UJ4A 5K8LA 4A0FA 3ZKAA 3JARB 1NNUA 4OQYA 3C41J 4AN1A 2PH3A 1NI5A 3A31A 3GD7A 2ZYTX 3HVIA 4M1TA 4MEAA 1Z28A 3BSFA 3M1AA 3N8DA 3ONNA 4MMZB 1V5EA 5ESXA 1NPDA 4D2IA 3TCXB 3EW7A 2QE7A 4YXFA 4ZKDA 4V1CB 1ZC4A 4YRFA 4CKBB 3EVDA 2O52A 4V24A 4P38A 1R88A 2DUUA 3RHZA 1VL1A 4LSWA 3B6JA 3RREA 1YQGA 1OFTA 4Y0AA 3PC8C 2CEKA 5B2ZA 1QK4A 1JJ7A 2FZWA 3RBAA 3H83A 4ZK6A 3WC4A 3HXMA 3BS4A 1UAGA 2ZB2A 5CRIA 4RF5A 3SQXA 5BR4A 5D6NA 4XYBA 4P7GA 1WD7A 1FRFS 3NBKA 2KS6A 4TLDA 4IDDA 2FJUA 4DABA 1OILA 5A5VA 1HYEA 5CYFA 3B12A 1KDPA 1ORDA 2K7FA 2ESRA 1QB8A 4FMBB 4DS3A 4D9GA 1JEEA 1YJAA 1TUBB 2JJ8A 2CJFA 3D4NA 4PX3A 5FPKA 1EWVA 1QYIA 3CF6R 3V2IA 1C4WA 2GASA 2HHCA 3INTA 3WTCA 2VUHB 3KBBA 3DW3X 1SG9A 2Q41A 3LP5A 1QHYA 1R5JA 1Z0DA 4G1EB 5G4KB 3A2KA 1I24A 1X2EA 3QIAA 1NMYA 3ND6A 3GCGA 3CXUA 2C7VA 4UEKA 2GEUA 4FFLA 1PD1A 1XMPA 3R8CA 4C05A 2WC1A 4DWJA 3IH5A 2B6NA 2B8JA 1CS4C 2BTQA 2C07A 1XIVA 4FMCF 3PK0A 3JQ9C 1ORVA 4LY3A 1DJOA 5DI3A 3MS2A 1IZZA 4Q4AB 2I29A 1TM7E 4U6QA 5DEIA 2NYAA 1CZKA 3GHHA 4TT8A 4XD7A 4Y8VA 4YRQA 1M2HA 5JS8A 1D03A 4JV5B 1ZD4A 2AV6A 4EKNB 4YAUA 2YL2A 1FRQA 1AX9A 5BWBA 3BZBA 3TL3A 4JN6B 2BH2A 3CRNA 4J7CA 3ABZA 4KAAA 5IDWA 1EWQA 2VAMA 2PMFA 2IXAA 3UWPA 4MOWA 2G28A 2RCNA 2VJBA 2GFIA 3OA0A 3EH2A 2XJ4A 4JKOA 4XLZA 5L6LB 2O8BB 2ZYDA 1OKKD 3TS1A 1MQ8B 3Q8XB 4XUCA 1SBQA 1T1SA 1G7TA 3A27A 3GRFA 3SJBA 4C4OA 5IARA 3PJGA 1S3FA 1QNFA 1XJ5A 2GILA 3DOCA 3HPRA 3IMGA 3ORFA 1J06A 1BFDA 1QE5A 1VP9A 4H7JA 4IWYA 2X0KA 4K87A 1HBJA 3RRJA 4JLUA 2VDPB 1M1XB 1M72A 1HUQA 3ZTWA 2AQ8A 4IZIA 3ROMA 2IS1A 2X0EA 3JD1A 3R7FA 1JDNA 4B76A 5BYKA 4JLBA 2HEGA 3R77A 4QRDA 3O38A 2GNAA 1YBMA 1Y8QB 4XASA 4JJAA 1E9EA 1LQTA 1QE3A 2ZUTA 5JIBA 3R5HA 1AT1A 2IU3A 2W0MA 3WGNA 2NXEA 4CBVA 1QV7A 1I7LA 2NQ2C 2IXDA 4QG7A 5EKSA 3BFPA 3LL4A 3WSWA 4AECA 4QAJA 1N33B 3HMKA 2ZS8A 4XLTA 1QAMA 4I14A 2QMEA 3PD1A 3P5BA 2IP4A 4GLJA 3KHUA 3ZS9A 5FUMA 3E2MA 1B74A 1QTNA 4NAVA 2IOYA 4AUNA 3HC7A 4FYPA 5AI9A 5J2TF 1NOJA 3BA1A 3LK7A 2FQXA 4EGCB 1AKQA 2F43B 3AH8A 1GHTA 1WM1A 2FRDC 3D8UA 4OUKX 3EIUA 4P7FA 4J91A 3UATA 1JPNA 2FWAA 2GN8A 1SQ5A 2PX0A 4GOJA 3PSAA 1Z37A 4L4YA 1Z8DA 2HLHA 2J46A 5BWCA 4R51A 4QLOA 3ONEA 4G8JA 2A8YA 2VCEA 4HWGA 4EATA 3AEUA 2I33A 3Q0TA 4GW3A 1NONA 2GXUA 4LDJA 5JS6A 2J48A 3IESA 3K05A 4PZUA 4IVRA 4KHZA 5DTMA 3PPIA 2OBXA 4E09A 4YBRA 4YB8A 3AXSA 1E3JA 2IWRA 5CB4A 4F8JA 2ECFA 2JKZA 4GQBA 5CEFA 2XZTA 4M89A 4OCZA 3A4VA 3I37X 3K9BA 2A0YA 1BNCA 4DCTA 4F4CA 2VR1A 2ZYRA 2FEKA 1ZA1A 2ECKA 1PSWA 2WM3A 4MIOA 1KY4A 4PPQA 3RHSA 3SFZA 4JJIA 2G1JA 7ADHA 5MFPA 4DB2A 3RC1A 3HP4A 3I9JA 3O8BA 3ORYA 3OZWA 4FINA 3CXRA 3QHAA 3WV4A 4L2IA 1QKKA 2YOGA 2VVTA 1A2BA 2CVQA 2Q1TA 2QTLA 4PSKA 4ZCSA 4A5SA 2Z6AA 1I7DA 1DLJA 3U2QA 2UZ0A 2E1PA 1CP2A 2VA8A 1F9AA 4WZAB 1PUIA 2XE7A 3C8ZA 3DUWA 4XWYA 4H9GA 4CV2A 4LZOA 5KOJB 3M9XA 2I8LA 3OLWA 1F51E 1GL7A 1KOJA 4DCMA 1SZCA 3IQHX 3R4VA 1RAHA 2R25B 1L7EA 3HCRA 3DTTA 1JG7A 4D4GA 4OTZA 1P1RA 3FOCA 3ZG6A 5LZ8A 1PG5A 4Q6BA 2QF7A 1JKJA 2AN5A 2PL1A 3DZCA 1FFEA 3HKEA 3NTLA 3OE7A 2RGWA 4Q48A 1ID8A 1YR7A 4EG4A 3ICQB 4RLHA 4GG1A 1KZHA 1K7FB 3P26A 1PJRA 3DAYA 3U31A 3F9CA 1QE0A 1Z3CA 1OROA 2MINB 3O95A 1ECBA 1RBZA 2ONZA 3RANA 4PCAA 5FTWA 3UOWA 1N5IA 2A0UA 4GGMX 1AHHA 5A4IS 3OY2A 3S5JA 3CR7A 5AWFC 1RP7A 1HA3A 2FEXA 2WMYA 3C3MA 2XRYA 5JROA 4I6EA 4PZDA 3NHUA 1XKXA 2C61A 5LCXA 3RK4A 2EQAA 1ZNQO 2B78A 3BZUA 3BD7A 3H8WA 2Y9MB 1V9CA 4B6SA 5AVSA 3BBLA 2V3CC 2FMUA 2IGTA 4NFYA 4JR0A 1BJTA 3KV3O 4AC9A 3I6QA 4OXYA 4WJKB 1FB5A 3KVRA 3ME5A 3VVBA 2CZGA 1YVUA 3KLBA 4QGGA 1EZ1A 4WNAA 4EI9A 3MTJA 4RVHA 5JOQA 3PUWA 5FLYA 2V45A 4CTKA 4F97A 1HDCA 4C4YA 1CUSA 3NHYA 3JY6A 3WKBA 5FXMA 4N3BA 3FUUA 4JLNA 1GLVA 4DG9A 1H0KA 2PXCA 1FNSA 1KI3A 5DRYA 3PEWA 2NAPA 4PGHA 1ECLA 2XUPA 2ZS9A 2DR2A 3WBKA 3AJAA 3IX7A 3RLIA 3LKVA 4GMFA 1QGZA 5M2QA 2A0XA 4DYDA 3AVVA 1TJ3A 2MDTA 3QHPA 2JNWA 4PRYA 4QT0A 4C76A 4OHXA 1LDNA 1OX4B 4MVJF 2SCUA 2W4IA 4X1KA 4KLNA 3VGPA 4JELA 1UJ2A 2FX5A 2IU4A 1QP4A 1B8UA 5JZVA 1X1QA 2V4UA 4KQXA 3JD4A 5DGTA 1J07A 4EI2A 1ZOSA 4F86A 1NUPA 4DC9A 3LC0A 4BAGA 1Z4OA 2JCVA 3DPSA 3IOCA 4Q7QA 2OQIA 3H1GA 3N0RA 2AX3A 3AKYA 4LC1A 4ZREA 2GKSA 4ZPJA 5HRUA 3BXGA 5BVHB 8GPBA 2IHUA 2VDVE 1UFQA 4TRNA 2ZI5A 1EEXB 1ZISA 2HU7A 4WXEA 2PBRA 3L6EA 7YASA 2ORED 4IIDA 3LKDA 2VXBA 2W98A 3R9KA 2HSEA 1FP7A 3D0OA 3OM0A 4GM1A 3T3MB 3X1ZA 1NV8A 4MGYR 3N8IA 3PDWA 4U2CA 3U48A 3JRWA 1JHMA 1XEXB 2P2CA 4PE5B 2AFHE 3L4KA 2O5EA 1XNRB 3OZ7A 2W6PA 1HWYA 3MGAA 1LKZA 3CFYA 3LUCA 2DXIA 2XVXA 3ITKA 2JJ1D 4LW8A 1Z06A 2D1SA 3P4UA 3BMNB 2X8WA 4Z0NA 1LW6E 3UQZA 4DA7A 5JZOA 3ED1A 1M76A 3RKRA 3WRWA 2IYXA 1OSNA 2JK0A 4HTFA 3LCVB 1K3FA 2OFFA 2Z4TA 4JDUA 5IT4A 4OMDA 1E9DA 1JSXA 2YFYA 4KR7A 1JBEA 4MRMA 2DEUA 1FVHA 4HQ6A 1DFIA 3QITA 1L4GA 1U9IC 3E5MA 3PCXA 4JBHA 4NY1A 4XUDA 4JI5B 2OL4A 1LUAA 4PWYA 1XMQB 1US8A 4RH3A 2H7CA 3TZQA 1TVEA 5LLTA 2XGSA 5AP9A 5DX0A 2QQFA 2C2KA 4Q03A 4ERXA 3D7KA 5LQDA 3WA7A 1K8RA 2L17A 3E3AA 4XCVA 4XJTA 4C9BA 3DZIA 3AUTA 3F9RA 2AFRA 4CMIA 1EWTA 1ZD3A 4CEHA 3DE4X 4BX8A 3W8NA 4POOA 5LM3A 2O3TA 3DPUA 1RI1A 3VM6A 4XFJA 4OJQA 4EOGA 2Q3DA 4E70A 3G88A 5LU8A 1BXGB 4GEGA 4X9XA 3HJBA 4MRSA 4NZOA 3ZDQA 3SC3A 4H7DA 4C0KA 2QLJA 3ZWBA 2OHOA 3O4FA 2DR3A 3KFLA 4XWAA 2OCGA 1OVMA 1X13A 5I48A 3JD3A 1DJNA 2VC2B 2D59A 4JVSB 2KYRA 1Y9ZA 2HU2A 2M6RA 3P2KA 1ZOPA 2XUOA 3MEQA 4PLYA 3SLGA 5AOBA 3KSUA 4KNWA 5IAKA 4B6FA 5EJ4A 2F55A 1T9HA 1HYBA 1Q15A 2HIGA 2HXGA 3TE6A 1CJCA 2QE6A 4XIFA 1M7BA 3HNOA 4G6ZA 3U3JA 3WQSB 2XE6A 4LJKA 4ZAXA 1KK0A 5AOCA 3VXKA 4FYKA 2QBYB 2QENA 4L4SA 3JS5A 3PWZA 5H3CA 4INJA 1W5FA 2HA0A 3L8FA 4BNFA 4XYGA 1NI4B 4RK0A 3GA5A 3GB9A 4GWKA 5EHZA 3V7WA 1GDDA 2P9QA 3UA4A 1U0GA 1U1GA 1JR2A 4BC1A 3L7JA 3F3YA 4N1AA 3DC7A 4KXNA 1JQLB 4PYOA 4R2LA 4XI9A 4ERNA 1IQRA 3I12A 5BN3A 1GA1A 2C4TA 4CTMA 1YB2A 3EOAI 2HJSA 4NV1A 4N5DA 4QJBA 1LRKA 5LA6F 4Q24A 1E0AA 3JQAA 3GA0A 5J58A 3TDNA 5D51S 5JXGA 1SKYE 2Z4SA 4HVAA 1K88A 1NATA 2LRHA 3F6CA 3PYMA 4M8SA 1JLKA 1WR8A 3TX2A 1IMOA 3ADPA 5BPHA 4IGEA 1V6CA 1SXJD 1ZIOA 4HDKA 1YVPA 4OLAA 4J1SA 4DUGA 4MQ4A 3TNDA 4D26A 5IBCA 1FDOA 1SUSA 3GUCA 3U5ZB 5DN6A 2XQKA 1G4UR 1O8CA 2JGLA 3FLMA 3GPCA 4MUNA 3WAKA 2O3JA 3QKRB 4G5QA 2QUIA 5EP3A 1RHKA 3ABOB 4MA0A 3PVZA 2FLVA 2B8TA 2P2NA 1HOXA 1R6TA 3LTNC 2A6PA 1NFFA 2A78A 4I50A 1MGPA 4HR7A 3S8YA 2J41A 1RQPA 3BGDA 1DAFA 3CZRA 1IEQA 4KK4A 3IEXA 3V7FA 3C5WP 5HKBA 3TTYA 4CCAA 3WK4A 3FNEA 2GM4A 2QW0X 2X2FA 3G79A 3UJ7A 1HO3A 3CKMA 1KO8A 1Q3TA 1H4TA 1SBTA 3U37A 2VT2A 3KYIB 4QYSA 4RADA 3B1YA 1SOWA 1JR3A 5F1PA 3SLKA 4R9VA 5REQB 1SBHA 3GC6A 3TB6A 1PR5A 3E84A 3K70C 4D9MA 3U44A 1Z0AA 3NHSA 3UAZA 4O2LA 4EG5A 5A6SA 3R8FA 1RQGA 3OCXA 5FNVA 3CKKA 4GPEA 3UAOA 2ZRPA 1U5BB 4ALMA 2NSYA 4QULA 3BILA 3U5TA 3KHTA 2VDRB 2VK2A 4HGNA 4RQBA 3OPYI 4CIWA 5L3SA 3MVEA 3FFTA 7MDHA 3STUA 3UM9A 4ETMA 4X61A 4Y1RB 3WO1A 3O74A 4RKRA 2XB6A 4C21A 2NSLA 2XE8A 2ID4A 1I10A 2HJWA 1JDBC 4MINA 4BKPA 3TLGA 3HU3A 4EZIA 1JNYA 4DCNA 5MN5A 1SXJC 1PJ8A 2R8YA 3HB0A 3T5GA 4YV0A 4ZZ3A 1MO5A 1Y6RA 4LOHA 1AKUA 1E92A 1TVKB 3V33A 1GILA 3QEKA 1G5QA 3MJSA 4BUZA 1ECFA 2IYWA 1VMIA 2X40A 2XCRB 2ORVA 2AOWA 1FYWA 5JY6A 1ULAA 4KJZA 1Y34E 1T5HX 3IEUA 3MS4A 1A77A 1XRNA 5KUTA 1PCXA 5FL7A 1JG1A 4KREA 4M9UA 2VQ3A 2V0CA 4BU1A 1G0OA 3OEHD 1WMBA 2LE0A 3E3MA 5EJ8A 4UFPA 5KX5B 1ZLYA 4BIIA 2JI4A 1WB5A 4U9HS 3DS8A 1N1DA 3SBEA 2CLHB 4RKQA 3O3NB 4PFSA 4RTQA 1LTQA 3G8YA 5HFJA 2N1BA 1T2AA 5F3DA 4Z7QB 4HAUA 3UMSA 4C0AC 4ZYUA 3UMBA 3JZAA 5BN4B 3MUNA 5C8ZA 1W85A 5HR5A 2AHOA 2EP8A 2HRQA 4BRSA 4DMHA 4CM6A 1MAVA 1GIAA 3DMHA 4LVOA 4TOIA 1SAYA 4WX2B 4DLPA 4OHCA 4CEJB 3VR6D 1UL1X 1XQ1A 4ZICA 4C43A 3KYBA 3ZGZA 5F76A 1UXJA 1G2PA 4MKZA 1SFRA 2D3TA 3E7WA 2WWGA 3LY8A 4IVQA 2AYXA 4OGGA 4WINA 5FLKA 5JE8A 1L5RA 2X4GA 3DWFA 4A3SA 2IXGA 1HTBA 1XB2A 1VHWA 2BGNA 3LS2A 1YQDA 2ATEA 1I2MA 1Z45A 3OIYA 1L7BA 3GL9A 3EXEA 3O91A 3V42A 1V2HE 1FFWA 2C2BA 3VMFA 3EGXA 1AN9A 3DZGA 3B9BA 3I9V6 1C29B 4B40A 4DMRA 3NGLA 1T1GA 2FY8A 2IDKA 2XKAA 3FN4A 1INLA 1Y48E 3WK5A 4DMGA 4S1NA 3P9IA 2B8NA 1E59A 4OQXA 2IHBA 1S8FA 2GJ4A 4WZZA 1E2MA 2FPPB 1DO2A 1VJ5A 4X8MA 4BX0A 3KD2A 1QZZA 2OVBA 4I9FA 1POWA 5F73A 1LCIA 3P94A 2QN3A 1G9SA 4AURA 1C7JA 1HC7A 4K9PA 4NNOA 1JFRA 4ZVRA 5ALTA 4QL3A 2QNBA 4XYEA 2FWMX 4H16A 1U2TA 1USVA 4BGIA 2Q62A 3M89A 1CZHA 1KGDA 4DANA 2GM3A 3I4LA 4W5TA 3EGCA 1OTYA 2YR0A 1FS5A 3AZOA 1YZ3A 1QFJA 3RRMA 3QX9A 1OC4A 1WP9A 4DZRA 2OORC 2VF7A 2BKEA 1GA4A 1QLWA 3A6HA 3KS9A 4N54A 5FWDA 2FR8C 3NEYA 4V2IA 3UPDA 1J0DA 1DOHA 1TYCA 4BNVA 4CLRA 3HQ4O 5HA5A 1JXMA 4B6GA 4IAOA 2AQKA 1X92A 3O8DA 5FUYA 3WRVA 2QJWA 3OJEA 3BJIC 1VDZA 3CM0A 1BZYA 4U2EA 1GKLA 1OWNA 1W0CA 2O6HA 3IKJA 4Q7KA 3MAAC 3VX3A 3M1YA 4BHTA 4LHZA 1NQVA 1YQEA 1E4OA 1TO6A 1HFWA 5CM2Z 1G7CA 1VJTA 1FTNA 1WCYA 1MORA 3BCUA 3IPLA 2C9ZA 2IZ0A 4HF7A 2D7CA 5JNLA 2Y6UA 1YR6A 1YO6A 3AFMA 4GMHA 4HMQA 4P4UA 1IB0A 2WOOA 5LP1A 1U3WA 3VU3A 2FW0A 4GXTA 1RM5A 1YAJA 1A27A 2OWEA 3D4PA 3WYEA 1F7VA 3PXUA 1DAMA 3RPEA 2R1VA 3STXA 1GLNA 4CL3A 1Z7BA 1PHRA 1KK1A 3L4EA 5TQ2A 1SVSA 4KX3A 2VJNA 3OX2A 5HILA 3WK8A 5FH9A 1A98A 2Z9CA 1JFLA 1XZNA 4FD3A 1F0KA 1USGA 1JIJA 3T34A 3TDMA 3RSQA 4OGFA 4R3UC 1YI1A 3KR2A 1W25A 2EWVA 1MJFA 4DR5B 1VG1A 2ZOSA 2RC5A 3CEJA 3FIJA 4YR7A 4UBIA 2F3PA 1Z8FA 4XPIB 2XDQA 4QGBA 2W2MA 3GN1A 3AI2A 1YVRA 3EW9A 4HDMA 4QBGB 3TIVA 3RFUA 3UJ9A 4LYYA 1E3QA 2X7XA 2NO1A 2X77A 2XQVA 5FI3A 4WJLA 1K86A 2X1LA 2PKCA 1E3LA 2XXBA 3CGGA 3E1SA 3FGZA 4R1QA 4S1WA 4AKIA 3JYOA 4MUGA 5EZ5A 5FORA 2J3IA 1R7RA 2ZTVA 3Q5GA 4MO2A 3EK2A 3TPZA 4XB1A 3EFBA 1KKMA 1UMDA 4WXPA 5K01A 3NWBA 1A71A 4ZOLA 3PUXA 1RJ9A 1DBIA 1Z8NA 3LXRA 3ASYA 4E7OA 1DC8A 2UUPA 3PL1A 1BD4A 3QVLA 4AZTA 1OB5A 2O1EA 1QZXA 1XZ8A 2EVWX 1Q6ZA 5AKXA 4WGGA 4W63A 1I0LA 1EX7A 1WKBA 3KELA 1KRWA 3VHXA 4F4JA 2IE8A 4YA6A 2DBZA 3E05A 3GJTA 4IRUB 4EZEA 4FR2A 2NUBA 3CPHA 3D7RA 1R4AA 1XKTA 1K8ZB 1N2BA 1Z26A 3M6LA 4CMAA 2CXHA 1AV6A 2R4UA 4W82A 1FFBA 2FQQA 4G24A 1JSLA 2BGTA 3HCFA 4NYJQ 2CV2A 3OFNA 3KD3A 4Y2YA 4C14A 5C7LO 1D5WA 1PNVA 2C20A 4QPNA 3R7DA 4BCCA 2UUAB 1PFUA 1E1LA 3WYBA 4YY3B 1F4VA 3MSXA 1ZN7A 1CJSA 4LBVA 4Z3DA 3L6OO 2OUKA 2WE8A 3L84A 2HNBA 3LLUA 3M70A 4OQNA 1P4AA 1C9JA 3ZY4A 1SNYA 2UVQA 4G25A 5BV0A 3PQ7A 4PC3A 1GAXA 1ZQ1A 2P0EA 1MQSA 1YQ9A 1J0AA 1RPTA 2V6MA 3HABA 3MNFA 4I1OA 4LUCA 1V95A 3T9CA 3RHTA 3GJ4A 3PR3A 1TJPB 2GEKA 4R9NA 3KR0A 3ZCVA 2RGNA 3ROKA 4BO9A 1XNGA 1W0KA 3R7LA 4RJTA 2PXXA 5IXYA 1MRNA 1GPYA 3WQRA 3B1JA 1MZPA 1V1RA 3O3MB 3G9TA 4BKMA 5DSZA 5JPIA 1BX1A 1OX5A 4MEBA 1NZDA 5DJ5A 1GY8A 3PEFA 3VJMA 4UJ5A 1UDRA 1EDOA 2D4AA 2WSSA 1UBFA 2HK8A 4AJPA 4U4AA 5KKCA 4LF7B 3ESBA 2BFEA 2R60A 1QB7A 1H66A 1KJQA 3O47A 4J94A 1KR5A 2ZKLA 3B48A 3GFTA 3GYGA 2I6GA 4YH1A 3B36A 2P9EA 3DB1A 3MJCA 3MWYW 4OBEA 2ZJ7A 4KO1S 1M2OA 1PR4A 1PQ4A 1JG3A 1VIDA 1BVUA 3LX4A 3VDXA 4EW1A 1CS0B 1W93A 3A04A 4ZGWA 1I1NA 4YMSA 4PAMA 4QU8A 5H3HA 2HREA 5TLSA 3M3DA 3D54D 4WY5A 3URMA 2DBVO 1A5BB 1XFDA 4MKHA 4LHEA 3AG6A 2CDRA 5G3ZA 2HTEA 3MJDA 1UMKA 2GH1A 1O0CA 1FSFA 3I6IA 3R6DA 2QTVB 2ID7A 5EUBA 1O08A 1VBKA 4W9RA 1XGKA 3U7IA 1I1HA 1W8DA 1Z56C 1FFCA 1L5YA 1Y8AA 2OCKA 1JDPA 1ETHA 2YJ3A 2QUKA 3K2QA 4ZVUA 1DELA 1P3DA 4NJEB 4QO7A 3ZE2B 4YRMA 2WG1A 3OQHA 3TTWA 1G5PA 4X66B 4D9NA 2F9FA 5FLEX 3IAEA 4Z8YA 5AJTA 2MHCA 1N2EA 1E98A 2B4YA 2QRVA 3ASUA 4JP1A 3QLJA 3ICVA 1U2GC 2XTJA 2NUAB 3L7LA 3U7FB 4JZYA 1WXDA 1G5FA 2ZGVA 5KYYA 4GVLA 1CU1A 4DEXA 2BGJA 2ZU0C 4S2UA 4ZT6A 2H63A 5C80A 3A6KA 1ODJA 1Y7LA 1W5AA 3I01M 2WDZA 3Q10A 3CX4A 4KWTA 4D9HA 4R71A 2I6QA 3RT9A 2YJZA 3KOMA 4OHVA 2J9XB 3MA0A 1UR5A 2H5EA 4K9RA 5KNDA 3BC1A 4PEVA 2H4YA 1PZEA 4O0LA 4D92A 2PS9A 1E5DA 2JFVA 1QMPA 2Q1UA 2HV9A 3IDQA 3HEMA 4U2FA 4B8YA 1DBSA 3LVBA 1H2YA 1YB7A 2AN4A 3HYLA 3DTVB 4HDQB 3DVQX 3SR4A 2I5PO 2JLSA 4FCTA 5E8RA 1QDLB 4ITRC 3TSAA 4RK5A 1PGNA 1Z2AA 4OKSA 5HDQA 1J99A 4Q9AA 4RMHA 3WK9A 3U7JA 4X64B 5CA1F 3AV0B 2A84A 5ALMA 4DNPA 5HQ3B 3AF6A 2KB0A 5JQWA 2FFJA 2CUTA 3MTBA 4PSAA 2CJWA 3QU4A 3V4LA 1IJKA 2EKBA 3WWYA 3AUYA 1KY2A 4OB6A 3WK6A 1N1GA 2JI7A 2R6HA 3B2EA 1C2YA 1KQPA 2HO5A 1UMCA 4PAGA 4MUIA 2A9RA 5JYBA 4RTOA 1E7MA 3PQ2A 3O9MA 1E4EA 5CBPB 2B9EA 3VO9A 1K7XB 2AFIA 2ZBGA 3JATB 3OLQA 2FSHA 2OXEA 2F8MA 3H13A 4KQKA 4RFSB 5WRFA 2WHXA 3LW8A 4A73A 3QJYA 4BVBA 2H2FA 5E6RB 4FOLA 4ECAA 1SVNA 1U2ZA 4EVSA 5JD4A 3B85A 1JV2B 1ZXBA 1OIWA 2JS7A 5EJ9A 4JX9A 1SUCA 4W1SA 2PUCA 1Q44A 4R1TA 2PR2A 3H5LA 4OO3A 3V8RA 2PRZA 1WD5A 3H1TA 5HBRA 2WHQA 4WNYA 3WB1A 1Z5VA 5BYJA 1NVWQ 4BZQA 5LLDA 4GWLA 1U4OA 3D6HA 4GMXA 2BFDA 4NZZA 4KIWA 2BI4A 2GESA 4D3YA 4EENA 1J0XO 1JHQA 2Y2VA 4QTXA 5EWLB 2QG4A 2J87A 5BR8B 3U17A 2PIAA 3GYBA 3MW8A 3RDPA 3U1VA 3B1FA 4LF4B 3MWJA 5IPFA 1OCEA 4NCKA 4HXFB 4ETIA 1QGDA 2JIOA 3HSSA 1IBKB 3TTXA 1TQHA 5E95A 1NR5A 3ZI7A 5AQEA 1IN4A 5LKRA 5BRNA 5HNKA 4FFBA 4M9ZA 1CEXA 5EHIA 5JQGF 1BRTA 1GFWA 4DLTA 4MI6A 1LJ8A 4MS1B 4ZC1A 2P90A 4UDOA 5H5JA 1Z35A 2VF5X 2O0MA 4JA0A 5F7XA 4ZT7A 4FOPA 5K3FA 1KARA 4HQFA 3WKDA 3L7IA 3HG7A 4WLNA 1OD6A 5CHYA 4NOJA 5DNEA 1SKMA 1P1KA 5EP1A 4RPJA 1YRYE 3Q98A 2Q21A 4R41A 4S05A 2PT5A 2H85A 3X2FA 2RGBA 1P31A 3VPAA 2HZBA 4XKJA 4FJ1A 1DL5A 3SFVA 1UM9A 3RTEA 1I2DA 4QTYA 5BWMA 1KIAA 1JNXX 2H1LA 2JCBA 1ULHA 2FQYA 3H9GA 1V8ZA 3A3PA 1OOEA 3MYRA 4GD3Q 4QUJA 5AI0A 3DAHA 2M98A 5FFMA 4DM3A 3U3ZA 3KLPX 5I4CA 3AVTA 2VH1A 4QFCA 3EWIA 1BDJA 1BMDA 2COUA 2XHEA 3TLMA 1JIVA 1KJ9A 1LSOA 3BKWA 2I9KA 2JAPA 1OYYA 3PD0A 3KVNA 4J1QA 1TLTA 4M98A 3G8DA 3EOBI 4GL4A 3UF0A 3QNMA 2LDXA 2YBEA 4QPZA 4YMGA 3EIOA 3TVTA 4NCBA 3IFSA 2PBLA 3EC2A 1KK2A 5L3ZA 4AKEA 4N65A 1QK3A 2AD5A 5HW0A 3KOUA 3NHMA 2C9CA 4KMMA 1MH1A 4YBZA 4PCUA 2CNWD 1EFVA 3TZBA 2DWCA 4EY6A 5LZ2A 1GSAA 2VHUA 4TS4A 1GYQA 4KPUA 5IBQA 4EX7A 2JAQA 4KVZA 2FSIA 1YUNA 4O4JF 2WV7A 3T54A 3M6UA 4JK3A 4Q4HA 2H5IA 4WZAE 1PVDA 4N4AA 2Z8YA 4JKIA 3KL4A 2PU5A 4TT3A 2E87A 2X14A 4EA9A 4ZMSA 4TSFA 3E1KA 1JXOA 2HT6A 3KQWA 4F7WA 3A1SA 3DCNA 3VYRB 4KH0A 2QA5A 1BEZA 5AFSA 2XT6A 1S7CA 4Q02A 4KV9A 2IYVA 5HKKD 2X86A 1UOQA 3CINA 2X6TA 3GEPA 3IQWA 3ZCQA 4WACA 4E51A 2H59A 3B1XA 2P35A 3RKSA 2X2PA 3C39A 1NJ6A 2EGGA 3HWX1 3RJ5A 1K4KA 2H08A 5K3AA 4BKQA 2ZEJA 5BYAA 3W5HA 1FNMA 5FNZA 2DT5A 2J5RA 4BV9A 1XELA 5TPZD 4J0DA 4O2BF 5J2UF 4DJTA 3GPLA 2E18A 2FUG6 1X86B 1HKHA 2CCGA 1T2NA 1MO3A 2Q45A 1EEHA 2AG0A 2VL7A 4RK1A 4TUYF 2VYND 5FR2A 3I83A 4IHKA 1AKVA 4CVNA 2V5AA 4E0BA 1TPYA 4CDGA 3U7QA 4YRCA 2P4UA 4QJIA 2FWPA 3P96A 3RFFA 4GQIA 1A4UA 2ZE6A 1Y5NA 3CF4A 4V38A 2OXTA 1LZLA 1XJCA 4IG4A 2ZIEA 5DTIA 3T7RA 4ZEMA 2BTQB 2QD2A 2QUJA 3T0FA 1N9GB 4LMBA 4TWAA 2X9GA 4WK4B 1IBRA 3FJYA 1NMZA 1N7HA 4W9NC 3BYZA 3TXYA 3AESB 1RXVA 2HA4A 4AN4A 5EMNA 1CX9B 1T2UA 1JXAA 1QAQA 1CIJA 2G71A 2PX2A 4OHFA 4GUAA 2PQ2A 5DB4A 3CEAA 2EIXA 2W2QA 1PT7A 4HDCA 5EHNA 4ENSA 1WUYA 2IF2A 3OKAA 4UM7A 3IE0A 1ULSA 3GBSA 5EL0A 3LVRE 4IUDS 2EHDA 2IX9A 3OFVA 5IDVA 4WXHA 2EWWA 4CEIB 3HB4X 3OHSX 1NDHA 4G56A 3W3AD 2ZG6A 1WSDA 1P8AA 2FPOA 4DWWA 1GARA 3UV6A 1ILEA 1U6IA 1RYHA 3HU2A 4DMUB 5IT0A 5DCLA 4Y0VA 3MJVA 1FU7A 4IINA 4A82A 4C89A 1VSQA 4DA9A 4XCQA 1FDTA 2WG0A 3MLAA 4JL5A 3T94A 4DV1B 5ESRA 3NH9A 2DWQA 3DGEC 2ZT6A 6ADHA 2DFPA 1CUIA 3ZV7A 4YLYA 5EE3A 3UN1A 1ZHOA 3QVGB 4FKMA 4HYEA 1ZJWA 2IKQA 3DMNA 3EIFA 3MJRA 3OH8A 4IEEA 2AL7A 3G8AA 3BGWA 3GFPA 2C82A 3IJPA 1SPBS 4GBMA 5ITVA 2PLNA 2QJFA 4RO0A 1BSVA 1KIFA 5CK4A 1M67A 3E9YA 3UJCA 4AMZA 4P3KA 2NSDA 4J0CA 3W8FA 2A1UB 1WDTA 3JVVA 3R7WB 1SY7A 1N9KA 1NQOA 4H0FA 3ELWA 5C4IA 1K5GA 3LQQA 4O4HA 1HNNA 2NVOA 3CSUA 1AQJA 3ZGOA 5EWJA 1KRXA 1PZMA 1Q22A 2H4JA 3TSYA 2RONA 1O03A 3MTEA 4QD3A 1ZN9A 4ANFA 2XTMA 2VT6A 2ZYIA 4QU0A 3JSAA 4CMEC 4JLMA 1YSCA 2G17A 1QRTA 1NR1A 3OO1A 1B2RA 5EP4A 5HHTA 2WVAA 1G3QA 2QN6A 3C16C 4JZKA 5LWQA 4HQRA 5DW3A 4HFJA 4KTVE 2ZI4A 5F1KA 1P19A 1VG8A 2C96A 1Z0JA 2AR0A 3CC8A 3KEMA 5CNJA 4DFDA 3SHFA 4NULA 1Z6AA 3A2MA 2QEQA 4OIFA 1DTEA 2C8VA 3QY0A 4IR7A 4RJIA 2NVUB 1M75A 1S0UA 3T1NA 4RGYA 4EWLA 5M7EA 4DB4A 3IBFA 4GI7A 5BN5B 2EC5A 4MYSA 4Y18A 1VKNA 1TK9A 2J08A 4TRRA 2PWPA 3D7LA 2JFYA 2LTAA 2OGTA 2PL9A 2ZE8A 4X45A 4ZO8A 4TN5A 1V6SA 4F71A 3ZNQA 2WG2A 1IBCA 1XMSA 4GT1A 2Z6VA 1PDOA 3K5WA 4YXWD 3RADC 3CH5A 3Q3JB 4KR3A 2GEFA 4OPMA 1WSWA 3R6WA 2PSHA 4ZJPA 2Q27A 1HQDA 1U02A 1NT4A 4Y2PA 1NU8A 4D9EA 2BDEA 2GJAA 4OQDA 1H9CA 2DCMA 3F46A 3P19A 1KU6A 4HP8A 3DR3A 3EEYA 1O9BA 3RH0A 4BTVA 2GPYA 4TV9B 3RUAA 1Q21A 4L2IB 4CW7A 4YX9A 1J0EA 3CUWA 4TTPA 3DOOA 2AMYA 4LRQA 5JH7F 2DUNA 3R41A 4KBYA 1MTZA 2F4NA 5HEKA 2BFMA 3G0OA 1OAOA 1GT91 4D0LB 2JEYA 4LHWA 3LTEA 2ZJOA 2BUBA 2AFVA 4V2UA 4WOKA 1TMYA 1B6RA 3FUVA 2P9HA 3SEFA 1G291 4NYJR 3A1UA 2QRZA 4I4IA 3WDSA 2HYIC 1AQ6A 1SVWA 3WQQA 4EARA 3OICA 4F06A 4NH4A 1Z8HA 4D74A 1Q74A 2G04A 4LSZA 3SYRA 5CTAA 5TJHA 1NXVA 1JQAA 1C3EA 1N6IA 1JZTA 1VIMA 2DFDA 2GMWA 3HKEB 3D4BA 4LX0A 4RCVA 3VKVA 1EDZA 3QEBZ 3OBIA 2PCJA 2KBFA 3S6JA 1PT5A 2JFXA 3TEMA 2XOKD 3WAGA 3G5MA 2IIBA 3NTRA 3TWOA 2HJ9A 4LKOA 3C1AA 2FYTA 5MDHA 4ZALA 5H1YA 3COPA 5G0UA 4JEHA 1CVIA 4QFMA 4URWR 4CTNA 1BJKA 1RWNA 1N3IA 4RA6B 6GPBA 4G4JA 2VTKA 3UWOA 3VPSA 4YT5A 1RYMA 1V3QE 4OHWA 4B32A 2FZVA 2Y0EA 3KQYA 8ABPA 3DWGA 4RY0A 2AXEA 3GZ4A 4BY9E 3LE8A 3EIXA 1BRMA 5CYGA 3DMDA 3BA6A 1VCNA 3L4BC 1PKXA 3FYSA 1NBAA 3HY6A 4LCEA 5JDIC 2RJNA 4I81A 4MQFA 4BDTA 1ZI9A 3OX3A 3FYHA 4IH1A 3NATA 1ANKA 3BMOB 4HYTA 3I9LA 3OZFA 4PBTA 1S3SA 1VA4A 3GD5A 4LVNA 5KNDH 5IZ4A 4KVFA 2OCBA 1QDEA 3PFGA 2P65A 4NBTA 1ONBA 3EFOB 1RAIA 3WE7A 5LBTA 3V4FA 4UTNA 1U04A 1W5TA 3QX3A 3Q8KA 5DNAA 5GP1A 3TM4A 1DQYA 3GNTA 5I5GA 1YFJA 1RZRD 4Z4CA 2OESA 3OFSA 1E7YA 1B8PA 1MH9A 4JP3A 4U00A 1SOAA 3LKZA 4A92A 2ACWA 3INRA 4FUTA 4OHZA 4GFDA 3FZNA 1RLMA 1HR0B 2IYPA 1QCDA 4OQQA 1B6TA 1TTPB 5F7ZA 3FMVA 2HD4A 4MQEB 2HJHA 3KZNA 3OJWA 3R5KA 2VG8A 4JJ7A 5CJPA 3RSFA 4NHOA 2ZSEA 1A97A 3VFDA 4XGRA 4HB2A 5B1HA 5LQMA 2EERA 2QX9A 2PSSA 1FTSA 1QG2A 2ZJ0A 2E37A 3AIOA 1RPZA 3ZHUA 1XZDA 1EI9A 1IM5A 1ADFA 3LC1O 1EXWA 3AETA 2WHRA 4GYYA 4MI3A 5H81A 3F5MA 3AVPA 3RWBA 3EQZA 3G2PA 4C3OB 2CKMA 2YV5A 3FPLA 1O9GA 4JEMA 2FQWA 3DP9A 5LUBA 2XUHA 4A2CA 2WD7B 3L5KA 3UAXA 3FKSD 2NSJA 1SD5A 4I4TA 3ESQA 3LCRA 4MMYB 4DIMA 3GF4A 3G68A 4DCCA 5L95A 3DBRA 4HTFB 2SICE 4X44A 1Z4LA 1BWRA 2DU8A 1MAAA 3WGLA 5JSQA 3FX2A 2JH8A 3ZGLA 3QV2A 4UBMA 1IUNA 1Y9EA 3JAMA 2HFKA 1H4VB 3AIKA 2DUWA 3ST7A 1TKBA 3A32A 1T8YA 2QD5A 1AUPA 1W75A 1WPQA 2B6HA 3FWYA 3UMJA 2OV6A 4OMCA 3UUEA 2VUIB 1US8B 1R16A 3BFJA 3ZDFA 2GK3A 2I2AA 1CG6A 1FNBA 4KAXA 2QAGA 5EKTA 1QLHA 3NNSA 4FILA 3ZLBA 4AJKA 1YF3A 4WPGA 1CJUC 3K20A 1L1QA 4IIXA 2G5CA 2G8LA 2I34A 1DEOA 4OBXA 2VXOA 4PPNA 3ESAA 4LGYA 2YYAA 3RT1A 3IPXA 2DBQA 1OIXA 4BQRA 2QX4A 4QO8A 5M04A 4CEHB 3I73A 3LC2O 5GJWC 1D2GA 1W6RA 3RR2A 4HLNA 3OZGA 5L7YA 3TQSA 3QVUA 4WERA 5K6TA 2CLIB 3GLFA 5AM5A 2BE7A 4L15A 3CLTD 2MSWA 4UXHA 4URFA 1ZESA 3KQNA 3LHDA 3N8HA 3DZBA 4CLXA 1E77A 1VI6A 2VRNA 4K6CA 5FFNA 1NVVQ 2WZBA 5K0GA 2XUKA 1UBCA 1POXA 2F1HA 2WFLA 3ZK7A 4PPFA 5T57A 3R9XB 5DOZA 2G72A 2VZLA 1TCUA 1UZNA 1CQPA 2J3QA 1U2PA 2WHEA 3PQ3A 4LE2A 5IBRA 1G60A 4E3ZA 3SICE 3UW1A 3UQYS 3LSTA 2W5UA 1BCSB 2WP0A 3QTTA 4O6VA 2WTAA 4MVXA 5CCDA 1MDBA 5CP8A 2FH5B 1GTL1 1YJQA 1VCHA 1QO0A 4DSUA 4HQKA 2XWBF 1CRLA 3WR5A 1ABFA 2PX3A 2MJLA 3R2JA 1EUYA 3D1VA 2AJ8A 1PT6A 4LF9B 4KV7A 3SZMA 1WXIA 4UHKA 3ESXA 5HBGA 5LSAA 4DEYA 4KQFA 1N92A 1XPJA 5CFLA 5D3ZA 1HNWB 3GK3A 4ARAA 1HDGO 4KLRA 2J9GA 1TA9A 2BW0A 2IZ7A 4QQKA 4EHAA 5KHOC 5C8XA 2OBBA 3BRWD 1X1BA 1WB6A 2HQSA 4EHDA 4FLMA 1X7ZB 4BWFB 1JT9A 2J0VA 3GEBA 4OG2A 5H83A 4NCXA 4ILEA 3ABQB 4N3CA 1GNSA 5K3SA 2GCPA 3WGYA 3PE4A 1HFEL 1YQQA 2IBTA 1PJCA 2PAFA 3DQPA 1U7UA 2CYAA 3OTQA 1U7XA 1QRRA 3JQEA 1GPKA 2Z30A 3Q6IA 4E5KA 5GTDA 5KDLA 4X3CA 2ZQZA 4BJ6A 5KDOA 1XROA 3BOSA 1DJQA 3KJZA 4WGFA 4OA5A 3QLUC 4HDKB 5JCJA 5B4VA 2AQHA 2OK7A 4DQ0A 4BZWA 1T24A 4IHQA 1T36B 4A27A 2QU7A 4HAVA 1K68A 4D4MA 2NVWA 2PZGA 3HKCB 1ZCZA 2C5HA 4B80A 4J9UE 2WM8A 5EIAA 2GPBA 2BRUA 2ZI9A 1VECA 2CL5A 3BRCA 4PINA 4M1KA 4X97A 4N7BA 4HLUC 4BN5A 1N2OA 4AICA 3OQBA 2A3NA 2B37A 4D9BA 4F9TA 4UFNA 1E5VA 3DB2A 1ZK1A 4IL5A 3VDNB 1I4LD 3FPCA 1JYEA 3GJ0A 2PD6A 3WGTA 4ZT4A 5CFZA 6AT1A 3EF1A 1UK7A 4L8FA 5INTA 1REQB 1VJRA 2QVZX 3GRKA 4XDYA 3P9ZA 1ZL2A 1Q0RA 1ZPDA 3C70A 1KPGA 3EZXA 4E4YA 4HGRA 4LQ4A 4MLZA 1BTOA 1ZZEA 4RELA 4IY1A 2C97A 5DF1A 4CM8B 1R1DA 3HHPA 4CQLA 4DSZA 1O6BA 5CNMA 1XPOA 5JCOC 1D4AA 3CH6A 2E9SA 3ILSA 3RK1A 2XYHA 3OURA 1RYBA 4OHUA 5J2TA 3F47A 3ZDXB 2O2DA 2ZVQX 5F5NA 1EVLA 1VQ1A 2QYHA 1Z6PA 2PKQO 2X9NA 1V5IA 3Q3CA 4JLPA 5C32A 1J2RA 2NW6A 2ZR9A 3GEGA 3MN1A 4ID3A 4MS4B 5B1SA 3W5CA 4O4LF 3OZRA 2ZRIA 1J2UA 5CX1B 1TYDE 3X44A 3UJDA 5C8VA 1A69A 1T5DX 3RRNA 2XKJE 4YPVA 5JAOA 5CR9A 2A14A 1PV2A 4KXWA 1X7YA 2NWQA 3IR5A 4HB3A 2XVYA 2P41A 4CLEA 3EGOA 3JALA 2FI1A 4YJFB 2OFPA 3TLGB 1EK0A 2ZWVA 2EZTA 1FFXB 5J9FA 2W2LD 5HFNA 1PWZA 4CUKA 4RTSA 5CAEB 1X1SA 1R9GA 2NO6A 4M1EA 4Q3NA 5FR1A 1FS6A 3PC8A 3BF7A 1PS8A 4G9EA 2ZTSA 4K88A 1ZH6A 5JCZA 1T3TA 4TTRA 2PUGA 5J4HA 1RRKA 2A1TS 2PWAA 4Y1EA 2DFTA 1F6DA 4HFRA 1LC3A 1P4GA 2Y27A 4IEFB 5I7AA 2YS7A 3NC0C 3QW2A 5HUHA 3R20A 2QR5A 5JXWA 2YJTD 5LYJF 3PFFA 3RBXA 5I7SA 1FFYA 1Z0SA 1AY0A 3DE2X 3F7OA 1E79A 1N5OX 2HMTA 1COWD 3B78A 4RF3A 4XUGB 2KM1A 2ZUEA 4R1MA 3ZVLA 2XE4A 4A5OA 4IV0A 3TOXA 3IS3A 1M5RA 4CLOA 2IPXA 3GMSA 1NW6A 4LFAB 1N2CA 4W7SA 4JLSA 3DHNA 4N9QA 2V74B 3VOSA 2ODWA 3OIFA 3ZHQA 5ADWA 4HXGA 5JJBA 3HB1A 3RVRA 3U6KA 2GI4A 3WICA 3NHAA 2ZBFA 5HK9A 1A4RA 1JL3A 1Q6YA 1KAGA 2ZB4A 5GOZA 1WPGA 4E1BA 4Q37A 3ZJVA 3QBVA 1QONA 2JIMA 2DAPA 5FO0A 3TLBA 4AW9A 4CQMB 1EDEA 4FGJA 2GHQA 1WMFA 1Z36A 2Q2OA 1N5DA 1BW9A 4QNRA 2ST1A 3FCYA 4P80A 2RGAA 2VJYA 5DNYB 3VBEA 3SIWA 2ZIXB 2QTGA 4M1MA 2XY4A 3JQ9A 1UM8A 3FXAA 4D80A 2VNHA 5BUCA 3HVHA 3JQ7A 1M10A 3PNKA 1Q7TA 2Y0CA 2DLCX 3OFKA 2BFCA 3V4SA 2HPVA 2NVBA 4RU1A 2G63A 1C9DB 3E27A 3TOZA 5GVRA 1ZNZA 4CR7A 3VTFA 2WJZB 1O87A 5KTPA 4WCFC 1PQPA 1GPMA 1S2GA 3L0YA 2H4FA 1C1HA 5HVNA 4W5OA 3PDCA 1U94A 4RVUA 1C0LA 3TB4A 2OSBA 4UNSA 2BEUA 2BHNA 1NIPA 1YOVB 1YV9A 2B98A 4F46A 4Q9DA 3TQHA 3CZQA 1B41A 3MK31 2V6IA 1VPVA 2Y0BA 2QP9X 1RRFA 5KB3A 2I0FA 2X42A 1RCTE 2JIQA 1KZ7B 3HXOA 3PWKA 3UHPA 2VAVA 4C4ZA 1J5EB 1DHRA 2JEOA 3RRBA 1Z0UA 2ZXEA 4C0WA 3MUEA 4FIZA 1OF1A 2D1YA 2P0AA 1CJBA 1ZHFA 2XD9A 2J5XA 4NEHB 5DGIA 5H0IA 2VQFB 4RTRA 4M9XA 5ALHA 1XE3A 2FMKA 2YXDA 1R8JA 5DVZA 1GXSA 2IQ5A 4ML3A 3RAPR 4YT8A 1IK4A 2XF8A 4MVJA 5AHRA 5AHKA 1G21A 1AQNA 2IHZA 3CJTA 2QMZA 3CCFA 3F3SA 4BGUA 4QTZA 4DG5A 4KR6A 1YR9A 3HB5X 3Q0EA 3Q9SA 4QXOA 1L3BA 5GMOA 3SOPA 1IJEA 1Y4DE 2ZJZA 5CG2A 3LK6A 1VZ2A 2Z2ZA 3BMXA 1GNRA 1NOIA 2GA9A 2GD6A 4FB4A 1ESCA 2BGUA 4L57A 4BB0A 4YJHB 5EQTA 1E7RA 1PR2A 4MVYA 3IEVA 2IZ6A 2QL9A 2ZRFA 3MAJA 3WP1B 2CMFA 1TZCA 4HFMA 4D3SA 5ITZB 2R3SA 1KEKA 1UJCA 5B53A 4KNYA 5ARBA 4PSUA 5ALOA 1DRVA 3ZGXA 3KXIA 3ETGA 3AWDA 3QPBA 4L7VA 2W2KA 3U3MA 4R2HA 2I7DA 1U0OC 1KF0A 4CZ2A 4MO9A 1DNPA 1NLFA 2ZRMA 3HKDB 3I5UA 5TQ2B 4UM9B 1ZI8A 4H3KB 1XTKA 2I71A 2ONCA 5IP5A 4DQXA 1Z5NA 1Z08A 2NZYA 3VNQA 4J2HA 1RI2A 1WZIA 3OQJA 4TQAA 3C3WA 3F97A 4WTOA 1F7UA 4FSHA 5KNBH 1ZK3A 3O8QB 3RUFA 3TM5A 1KMCA 2DPYA 3H87A 3IAAA 5D7BA 3BJMA 4D02A 2GAAA 4NYMQ 1DKOA 3ZN2A 4PLVA 2O2IA 3RKUA 2BR5A 3RYIA 1YA8A 3NI2A 4OQFA 2M32A 4TMZA 2XDQB 2HA5A 1KDVA 4AO6A 3PJDA 3G1UA 4KACA 1X1CA 1H1TA 4MW5A 1M74A 4R0NA 4UU7A 2JGFA 4BO3A 2Z2YA 3H5NA 2VXCA 1ADCA 5CLJA 2A9JA 2GERA 2IP2A 5B7PA 4YJ2F 5AJWA 4CM1A 2Y1CA 4YJKA 5AI8A 4ISCA 4R69A 3B5IA 2J7KA 2WYUA 3AZQA 3LRXA 2IP1A 1U8YA 3L7OA 3EMVA 3RU7A 4TTQA 1C9YA 2P3OA 3AF4A 3B3AA 4XGKA 3REGA 2BCJQ 4YCBA 4JX8A 4ZC8A 4LQCA 1CF4A 2E7ZA 1O96B 16PKA 4RD2A 1WW2A 4KDCA 1EZ4A 4HX5A 4DIUA 5CDGA 1SBIA 1TRKA 1WU7A 1AF7A 2F1IA 1Q20A 3QMPA 3SZUA 1T9ZA 4GU5A 3ZK9A 4ZQCB 3SZRA 4ISBA 5KCZA 4A7PA 4XDZA 1M1YB 4YONB 1CCWA 3G2JA 3QVMA 3T5BA 1RI3A 1QH0A 1Z34A 4YLGA 4F5WA 5F2KA 3TAXA 5JATA 2GLUA 2XKBA 3HE3A 4JU9A 5KJ1A 4YWJA 1YDMA 4WFQA 2CZQA 1RWKA 4HHEA 4ROSA 1ZONA 2C54A 4EG7A 3OKFA 3VR5H 3FCAA 3MOGA 1A9RA 2NU7B 1CHNA 3PU6A 4C0JA 4II2A 5BWOA 2JJ2A 5EPUA 1MVNA 4GPIB 4MHSA 4NZPA 4UD6A 5IFKA 5CD1A 1N7IA 1SXIA 2B8EA 2HWKA 1EXMA 3N0TA 2HBQA 5DE3A 5DI9A 2QI9C 1R6VA 3JQQA 1GAJA 1SCBA 3E9EA 3H5IA 4DA8A 2NT4A 4DQVA 4E11A 2BZSA 4GKAA 2Q3MA 3RNLA 4ZO9A 1C1YA 3IYLW 1V71A 2B61A 5FI1B 5LA6A 2QNIA 2C00A 3KETA 1BDIA 3O8OB 3SJ7A 2IF0A 4EKIA 2CXXA 3HFSA 2ODNA 2VQSA 3A1VA 3STVA 4BPRA 3KP1A 3NHLA 4LOKA 2DGDA 2G82A 2RJ3A 2ZJ2A 4MRAA 4RV4A 5AXDA 3B60A 3WISA 1E1KA 5LYYA 2HX1A 5K9ZA 5KOIA 3TECE 3MXTA 5FO1A 3GRRA 1LNQA 2XIJA 3UKDA 1TFUA 1DTSA 1RKBA 1SB8A 1G18A 5KIAA 3AHIA 2VDLB 4UNPA 4BU0A 4BX3A 2VDQB 2GXQA 1N3YA 3HY3A 3K72B 2PJDA 2W4MA 3NEAA 1CB7A 3V8VA 4UQLA 3AT1A 4C0XA 3EMDA 3AMVA 1OXTA 3OUZA 4MVCA 1PJ4A 4ARVA 3FZGA 3JD0A 4DHEA 5LOVB 1QFXA 2PWYA 3RYCB 1RC1A 4KR0A 4L22A 4QEDA 5AT1A 1CQWA 1U2SA 3I04A 5AW0A 4CKWB 2JH3A 4MWEA 4YJ3B 2HPAA 4YP1A 3K73O 2GN2A 3PX2A 1IRIA 1HTWA 1PK9A 3LUKA 5K0NA 3MWEB 2CDBA 3JQGB 2JFHA 3I05A 1XRMA 4JB8A 4NE9A 3T3PB 1JX6A 1ZDMA 1W46A 4Q01A 5IJAA 5AVXA 3WZ2A 3C6QA 3MERA 2QRVB 4O02B 3CLHA 3UMFA 4COOA 1FVXA 3OEED 3VYWA 4IM7A 4EHFA 4YUXA 1TU3A 4U3JB 4BO7A 1Q0HA 2Q99A 4TMXA 2C5LA 2WICA 3SQNA 2ZQYA 4GDFA 4K7JA 3MHTA 2ZYAA 2ZUBA 3QWFA 4O0MA 5CXSA 5E9JA 2REQA 1ZAKA 1FW8A 4JC5A 4R1LA 3HBFA 4TKUA 3LFUA 1GEGA 3BB3A 4X85A 1DG3A 1R0ZA 4KXMA 3NDIA 4PLTA 5KYKA 1U9IA 3B8HA 5I7RA 10MHA 3KSZO 1NN1A 1BWSA 2JLYA 1NG1A 2RB4A 2W48A 3G7SA 4XDHA 2XLBA 2CNNA 3R74A 4EGSA 3ZWAA 2H52A 1NVVR 4FYXA 3K5PA 3KQUA 1UEIA 2NO4A 1SK9A 3ICWA 2P2ZA 1Z5WA 4KZKA 5DK6A 5L6MB 1LJLA 2WU1A 1S1MA 3VNRA 1I80A 2NTJA 3B3GA 2CNBA 1CDDA 2ZYHA 2O5VA 2GPJA 1G7SA 1XJ0A 3WLRA 4A8JB 2YASA 1XL1A 2ZRAA 3BL8A 4OIMA 4QUAA 1I6MA 4PG4A 4YLEA 1TE2A 1PEYA 1H2EA 4O5AA 3R44A 1PNOA 3CVJA 1Z5UA 1ZJ6A 4Z4QA 3KVVA 1QUEA 2FZCA 4IBOA 2GAJA 2VS1A 5J59A 4F2GA 1KFBB 3U7GA 1NQAO 1DX6A 1OTXA 2ASVA 5ER9A 4YRAA 1ACJA 4LBZA 1KH2A 1WMEA 3I8SA 4F5ZA 4RA9A 1BEUB 4B85A 3V97A 5BORA 2JZNA 2VK8A 4P0TA 1SJ9A 3T8YA 4D3ZA 2Y67A 2YZNA 1T29A 3C6MA 5HF9A 4KU4A 1GCUA 4D82A 5F98A 2C2HA 5A3JA 1Y1PA 2MSLA 5CFQA 3V8BA 3MHPA 2ZE5A 2VHTA 3KFVA 4X93A 5KJCA 5L3QA 1MOSA 1TW3A 2PMBA 3AR9A 1QTRA 3BWCA 4J7UA 2JIPA 1X19A 5BOSA 1L5MA 5F2EA 1AF4A 3TJZA 1GSOA 3DMRA 4IIBA 1G19A 5DN9A 3HI6A 4DSNA 1DDIA 1M2FA 1Z22A 3LY9A 1DIOB 3PNQA 4MS3A 2FSVC 3WYGA 4D0GA 2DTXA 4EYGA 5IEJA 1C9EA 4LS3A 3HV0A 1A5ZA 3QYAA 2GRUA 4OATA 5BYBA 4YEDA 3G2NA 4ME6A 4E15A 4NJMA 1XRSB 4OM7A 3TLCA 3ES9A 5B64A 5IKXA 2QI9F 3ELDA 1VMKA 4E94A 3E22A 4IIHA 4LNAA 4EVRA 4HTAA 2WMDA 1XOIA 1BD3A 2FJPA 3B2QA 3EH1A 3NPAA 3RAJA 1Q0LA 2V7TA 3QXHA 3R3UA 3QYJA 4B8WA 4QUHA 1R66A 2WUDA 2P11A 1M33A 1LNSA 5ALWA 3UUGA 4ZT2A 1O54A 3H3XA 4BLPA 4M7RA 1Z6QA 4D3FA 2OUIA 2GO1A 3IRUA 3ONDA 5DW0A 5IAAA 1YZHA 1CDOA 3AL3A 1M3SA 3HCPA 4A0SA 2AYZA 4EP1A 1M1NA 3QEMA 3FYTA 1RE1A 1PR0A 2R1UA 5LP6C 2IVFA 4FWTA 4YRLA 3TN7A 3W9BA 1SKAA 1ZLXA 2VPPA 2GQ0A 1ULUA 3A9RA 1K2VN 5JAZA 4OB8A 1SQGA 3VR1A 3WLPA 3NFYA 3OZDA 5C5DA 1XRQA 4JSYA 4LBYA 4Q93A 1EUCB 2MSCB 2JB9A 1OIVA 5A04A 4F8YA 1Q1GA 2R6FA 4M9CA 3TO5A 2FOIA 1U8ZA 5DCWA 1OHHA 2P77A 1PBTA 4A6XA 3EQ7A 4RM2A 2CB9A 2GTIA 4B3GA 4BNWA 3ED5A 1M2KA 4HLCA 3VJLA 4ZFNA 1Z83A 1QRSA 3WOHA 3FTEA 3MWKA 1THMA 1SVIA 5IYZF 2JASA 4M38A 4GMGA 4C4PA 2VJMA 5B3LA 2HDWA 3RVNA 3TBKA 3DFMA 1P33A 2HIAA 3D3WA 1UBSB 3L6CA 4HDRA 3HR8A 4L0DA 1KORA 2IPMA 3JQ8B 4WT7A 3KT8A 2GVDC 2V7WA 5AVOA 4YQEA 1QGED 2D4HA 2ZRCA 2P1DA 3E18A 5D2CA 3ETEA 2OCDA 5JNSA 1EM6A 3TJMA 4HYQA 4J0FA 4KPFC 5JO0A 1XTIA 4Z9YA 3N2KB 1R3UA 3N2YA 2ZRLA 4ZRNA 1KFEB 1NI3A 2P1ZA 2X9QA 4Q4HB 1CRPA 4ARBA 1E3WB 1IBSA 4LY0A 2GF2A 2Y76A 4G5XA 4QSMA 4TWZA 4UTVA 1WCV1 1X7GA 1W36D 5TMBA 3ESYA 1N2ZA 2VNKA 2VHCA 3KT3A 4AWBA 2AEMA 1H6CA 1TEHA 1EUDA 1TJ4A 3WJAA 3O75A 3L18A 2H2GA 2PA3A 4BVJA 1BA3A 3LIIA 1ZM9A 3HNRA 5GGYA 5DWDA 4INAA 1V8OA 4EB6A 4OH7A 3EY4A 1DWUA 1N1EA 2DQZA 2E3JA 1XAHA 4CI9A 3TRHA 1AE1A 3R9WA 3NVKI 1TTHA 3CONA 2OC4A 1VE9A 2AA3A 2ONYA 2QX8A 3LWDA 2FRXA 4RPCA 2DJIA 2XCOA 3P9KA 1OT3A 2CMKA 3VAZA 3IP9A 4AAYA 2X58A 5A4KA 2DHEA 4EX6A 2PT6A 1HGXA 2F48A 2BEVA 1V7ZA 3S4YA 3TW6A 3W6OA 3M0EA 1QTIA 4IIGA 3VOAA 5B30A 4CF7A 2L69A 5EPEA 5JW6A 1OLXA 3AY7A 2WIBA 3CNLA 2LGJA 3EVGA 3OD1A 2HK6A 3UJAA 1FS4A 1Z68A 2NU6A 3PKJA 3ERCA 1KXZA 2H7XA 2GX6A 3U7QB 3MINB 3PNLA 3QWHA 4IJMA 3WLMA 3JR7A 5DK4A 3FG9A 5BOVA 3GROA 5GZ1A 2C2MA 5FTNA 3UFXB 4A6PA 2JA2A 1LRLA 4AXXA 4B3BA 3UPUA 3M4YA 3T41A 4P3PA 1F2TB 4EQ6B 1PLJA 3PD7A 2GCOA 1JKFA 2WT9A 1N0WA 1XN1A 2C9DA 1ORTA 4S12A 5AKYA 2AN3A 4CKCA 2PSEA 3ANNA 3D64A 4XQ0A 4MB0A 2TYSB 3WL4A 5DM1A 1PDVA 3K0BA 4BEVA 4LHYA 4A15A 2C7RA 4ZI5A 4BEWA 5EUCA 3H19A 4UKDA 4WHMA 3W1WA 1SK8A 1SUAA 1HETA 3KKEA 1BCRA 1G8FA 1P2GA 3OM1A 1QGOA 4YRIA 2ONJA 2PY6A 1TECE 1YJCA 2ONKA 1V11B 2A9PA 3IBGA 4Q47A 1B4DA 5G0SA 1M1UA 4G4SO 5EIXA 2NUPB 5KQMA 2CFRA 1J7KA 1MAWA 2K5UA 2NYUA 5G1PA 5J5AA 4YRGA 2PSFA 2Q1WA 4Z2AA 1J9ZA 1QC5B 2CBXA 3P4XA 3UJ8A 1EGHA 3W8RA 3O7MA 1VYVA 4S2EA 5TB5A 1AUXA 1DIRA 1ZU5A 2IELA 3IEIA 4N8DA 1DEXA 2AOXA 5IJ9A 1A9SA 4NZNA 3SZGA 4MPTA 1CEYA 3O4HA 4M0DA 2CUKA 1PGPA 3R6LA 3GLHA 1JEAA 5AYVA 4URYR 3SDZA 3W79A 1OAKA 1QF9A 1FDVA 5FUVA 4FB5A 1GCGA 4D79A 2FMHA 3IJRA 2OGWA 1E4VA 3L40A 1TYBE 2QD4A 5C1IA 2IZZA 2BMEA 3GRAA 4ZI7F 1QLJA 4TMWA 2QLFA 1W9HA 3L05A 3DBLB 1ZK0A 3A1CA 2JAOA 2RBGA 3H6KA 3OEHA 4IIEA 3K15A 2O9JA 3BJRA 3OECA 2OBLA 1H2HA 1YRHA 2WWWA 4LXQA 1S5PA 2TMYA 4HVTA 5F5LA 4A2WA 1S3IA 2WTXA 3CLSD 4JUCA 1M8KA 1OW3B 5FPHA 1NXXA 3OX1A 2OORA 4CIXA 5JPDA 2E6UX 5CCEA 3MCUA 2W6OA 2YMLA 3WMRA 2FR8A 2VYQA 2O20A 3ZE9A 1CIPA 4JMPA 4P34A 3ZS8A 3HXTA 2VHEA 4ALIA 5IVHA 4BEBA 2YMQA 4PLPA 4BMXA 2XAAA 3IQXA 1H05A 3KTAA 4Q1VA 5ICCA 2ZBVA 3O2SB 3WNCA 3DNPA 4WA8A 4MVWA 1DBQA 2HL6A 2IXFA 4IIYA 3KZMA 1RFGE 1Z4MA 3BWMA 5BSEA 3FCSB 4QGAA 5L4LA 9LDTA 4GLOA 1VE3A 2H00A 2J3LA 2Y9PB 2WD9A 2GVNA 4LNUA 4CG3A 5FPPA 4ABTA 1JG6A 3DW1X 1UBLS 1YFKA 3FKQA 4G8CA 1X2BA 1U8TA 3GW8A 1I4OA 3OESA 4G0MA 2FPIB 1E6UA 4IJ6A 5ALJA 4EEXA 2ZRDA 3MT8A 1AH2A 2BEJA 1D2RA 1QQAA 4UU0A 4BJ5A 1P5JA 2FMFA 3W34A 1WX1A 1EHIA 1RHQA 2FX2A 2GK6A 1GGMA 5FPSA 3KKNA 4HWOA 1V37A 4QQFA 3W7BA 4O8CA 5CGQB 4ZQBA 3ZQUA 1UANA 2V6BA 1UBUS 1USKA 2BGMA 2Y1OA 4TRJA 2YQZA 1XF9A 3IR6A 5LZ7A 4G0ZA 2HGSA 2KPOA 2FSGA 2BLLA 1JBQA 4NDNE 4B3MB 1RPNA 3NT2A 3TUZC 1MQAA 4ZI3A 4RSMA 5KPDA 4BJ3A 1QCYA 2V7VA 3HI4A 4LJ5A 2COKA 2QJRA 3R0XA 4YAJA 1JH8A 2P2GA 1D04A 3IIIA 1QORA 1O4WA 1P75A 1P73A 4BMNA 2O1SA 1JPUA 1NF9A 2KLHA 2LIPA 4X90A 2O48X 4JOQA 1Y1KE 2AZDA 4QECA 1LS1A 3CLSC 2NTYC 3DJYA 3OPYB 1UK6A 2IV3A 3JYQA 1UUFA 2NO0A 3M1IA 3R76A 1YONA 2GWRA 4OREX 4Q3LA 3H3JA 4RVSA 1GCIA 2PZLA 4G5YA 4WXMA 1NBIA 5CVDA 1UCFA 5CA1A 3Q15C 2PS3A 3TOCA 3ZXSA 1MAUA 1XALA 2ADFA 2AC2A 2WPNA 3GEDA 4L72A 5GVSA 2C7BA 1EFRD 1UKAA 3Q40A 1W8IA 4KL8S 3KJXA 4MYHA 5DLYA 3T5DA 4A8TA 3FFBA 4BFWA 1AXRA 4AB1A 4PYRA 2QY9A 4ZVMA 3C6BA 1VYUA 2ES4A 5J4KA 4KIUA 2QSZA