3EOZA

Crystal structure of phosphoglycerate mutase from plasmodium falciparum, pfd0660w
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
196
structure length
159
Chain Sequence
NTTKHIILVRHGTKEGCKQADITGKKLKDILNNKKVSVIYHSDMIRAKETANIISKYFPDANLINDPNLNEGTKRINKAYETYFYKPSGDEDEYQLVICHGNVIRYFLCRALQIPLFAWLRFSSYNCGITWLVLDDEGSVVLREFGSVSHLPFESVTYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Phosphoglycerate mutase
publication title Characterization of a new phosphatase from Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 45
structure length 159
sequence length 196
chains with identical sequence B
ec nomenclature ec 5.4.2.1: Transferred entry: 5.4.2.11 and 5.4.2.12.
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3eozA01
5CU7A 4EO9A 3IT1A 3PGMA 2P75A 1V37A 3E9EA 2DWOA 2P9ZA 3EZNA 4ODIA 3BIFA 3LG2A 3FJYA 4PGMA 1T8PA 2P2ZA 3K4PA 4HBZA 3QPWA 1QWOA 4D4MA 3F2IA 1RPTA 4JOCA 1RPAA 3IT0A 1C7ZA 1E59A 1YJXA 5AJZA 5CDHA 5HTKA 2H52A 2WU0A 4GPIB 2WNIA 2AXNA 1EBBA 2HIAA 3GW8A 4FDTA 3ZHCA 1SKAA 5CX4A 2P30A 2P79A 2OWEA 3NFYA 2I1VB 2P2YA 2H0QA 4JODA 1DKOA 1QHFA 2RFLA 3IT2A 4ARSA 3MXOA 5PGMA 4ARVA 1DKLA 3LNTA 1DKNA 3QPUA 4EMBA 3D4IA 3D8HA 4PZ9A 4GPZA 1ND5A 4TSRA 1H2EA 3IT3A 4JOBA 1BIFA 2YN2A 1CVIA 5AK0A 3E9CA 2EKZA 5HR5A 3EOZA 5AJVB 2P6OA 1ND6A 2DWPA 5AJWA 1V7QA 2HPAA 2H4XA 4D4LA 3NTLA 3MBKA 3QPVA 4PZAA 4ARUA 2P78A 1DKQA 3K4QA 4IJ5A 1NT4A 2WNHA 2HHJA 3OI7A 1IHPA 1QFXA 2OWDA 2A9JA 2ENUA 1C80A 1TIPA 3GP3A 4D4JA 1FBTA 1SK8A 2H4ZA 3E9DA 2F90A 2QNIA 4QIHA 3HJGA 4AROA 2P77A 1UJCA 2P6MA 4IJ6A 5AJXA 3O0TA 1C81A 2P9FA 2YN0A 4D4KA 1BQ3A 3KKKA 5AJYA 3F3KA 2P9YA 3D6AA 1RIIA 2PA0A 2ENWA 1E58A 2IKQA 2EOAA 1SKBA 1SK9A 4FDUA 3FDZA 1YFKA 2EKBA 1DKMA 3GP5A 2GFIA 1K6MA 1H2FA 3R7AA 2BIFA 3LL4A 1BQ4A 3DCYA 4MA4A 1DKPA 3C7TA 4E3WA 2A6PA 3DB1A 1XQ9A 3FDZB 1UJBA 1FZTA
chains in the Genus database with same CATH superfamily
3G02A 2FKNA 5IKOA 3KE8A 4AP5A 1K5GA 4ZQEA 5A04A 3TOXA 1IU9A 1BX3A 1VG8A 2PS3A 3G17A 3LX5A 3T3GA 3W2FA 2QHXA 2AWNA 1S2MA 3OJ0A 1W36B 3ZWMA 2WU4A 1EEXB 2CC2A 3IJPA 3I72A 3O21A 4M7RA 3VNVA 1KZ1A 2X5KO 3OUTA 4JJFA 4CF7A 3K1TA 1S2NA 3SKYA 1F8YA 4CODB 1N2CB 2UXDB 1RQPA 1G2OA 3ESQA 1LVHA 3ZY4A 3MVEA 4J2HA 1QCDA 2AFIA 3JVDA 3PE4A 2JAOA 4KDRA 2WMNB 5GPBA 2C42A 4BCDA 1RI5A 2NQ8A 1NHWA 1OXSC 2Q0HA 3CVUA 2QX6A 1IUKA 3ORQA 4CQLA 4MV6A 1CJCA 4MXDA 4JITA 1HM5A 4TKUA 4Y2XA 2CT8A 2GZRA 4O4HB 4HJRA 4ARSA 1XF1A 3LY5A 5CA0A 4L8WB 1IXKA 4HQNA 4I5IA 4PLWA 3RSFA 2ZBDA 4GQIA 2CXUA 3R7WA 4AJNA 5JT1A 1JJAA 1UMBB 3H1BA 4J7AA 4YHBA 1NF3A 2DFKB 4CQMA 4IVNA 5I3ZA 5FUBA 1Y1LA 4V0NA 3PVSA 1TLTA 5AW6A 2VJLA 4ZAVA 4IVQA 1JBEA 4C3UA 1I0IA 3H18A 4G0PA 5TB5A 1CY2A 3G79A 2VP0A 3CMMA 4J16A 4YP9A 1OX6A 4ID9A 1V6AA 1X7WB 4E32A 4QU8A 4BO8A 4UE6A 4WE3A 1EPUA 5K6AC 2O5VA 2OBBA 3HP1A 4KX5A 4BAUA 3N6XA 1NGSA 1TLFA 1G8FA 3F6CA 2QT0A 3RAGA 4D44A 1GL9B 1SB8A 2FN8A 2XNKA 2P3LA 3E5NA 4I50A 5FI0B 3FETA 4KNVA 3VV2A 5JCZA 1ONBA 1NT4A 1M2JA 3SAJA 3LZCA 1HLFA 1PBNA 1GILA 5F3DA 4KO1S 1KZ9A 2PSSA 1YJ5A 2G9RA 2OSBA 4TMWA 1QM5A 1C80A 1LFDB 1LB1B 4QAJA 3ZDBA 2NP6A 3GDWA 4EEZA 4ALJA 5C8YB 3MIIA 1K98A 4GNKA 5L3VA 4DIBA 1BEZA 1SNYA 4FHZA 1PRYA 3L7BA 1UBEA 4MRPA 1E66A 3C43A 2CHEA 1X1RA 1GV1A 3SJUA 4GOJA 4M3NA 3ZY6A 3U0BA 5L3QB 4O3MA 1TU3A 3GNSA 3PNYA 3WLOA 4H1WA 1IN1A 5DULA 4OVKA 4MK4A 3G0CA 4L08A 3LSTA 5FOVA 4K88A 1M1YB 3O3OB 5C1DA 2AC7A 3MMZA 4EI9A 4P6VF 4PWZA 2G4LA 4KPGA 5IANA 4HFNA 3LVRE 1DBQA 1NW3A 4ESVA 1M2EA 3U09A 3U7GA 2QV7A 4CFYA 1NQXA 2RGAA 1JEQB 1M1NA 4JT9A 3HDYA 2DQYA 3S8YA 2A0XA 1ZVVA 3ZBTA 3PUYA 3WBBA 1CEYA 4MWGA 2VC2B 1LI5A 2WSSA 3IRUA 3VOBA 4AW9A 4ZAGA 5D3MA 1U8AA 2DT8A 3R7AA 4XX1A 2G5GX 4ZV4A 2ZYGA 4MV1A 3FHTA 1VL8A 1R5JA 3E82A 6REQA 2PD4A 3BX1A 4LF6B 1ZMBA 4J7CA 3QHAA 2VPYA 3SG0A 3PC7A 4HVTA 4YT5A 3PEYA 3KSUA 5BV8A 1J00A 3ODGA 2ZPTX 4WLOA 4LYFA 5F5NA 1UFOA 1N3YA 1U7PA 2A7QA 2WMOB 4O1IA 1VIDA 1IYZA 3O47A 4YO8A 2X8WA 3IHKA 1OFUX 5DYYA 1DC6A 2FQXA 1T8PA 3G2IA 4NMMA 1HT0A 4OCZA 2HNKA 4KI0A 5E0OA 4IUBS 3I01A 1QU3A 3K2BA 2O2HA 4NENA 4R8SA 3TD6A 4GP7A 4Y8VA 3BQNB 4G0YA 2PH5A 1QR6A 2XGOA 4ETIA 1S9HA 1SUIA 1J06A 3LOPA 5D7NA 2I7XA 1RRCA 2JFGA 4K28A 4DRXA 1A69A 4TTJA 3UCFA 1DCMA 2NXJA 5EINA 3VC7A 5E9QA 3SF0A 3AT1A 1AUVA 5FA5A 4QM6A 4TMXA 4WLFA 2A5DA 3ZU6A 1JKMA 2V1XA 1ZK0A 1U8ZA 1G16A 4HQFA 5AM5A 1ND5A 2HC9A 3HGQA 3L0DA 3VUEA 1VE7A 2CY0A 3HCBA 4B76A 2IPOA 3FF4A 4IJQA 5BMVF 2QMOA 5FDFA 3D3WB 4AJ4A 1ZD3A 2GN8A 2K7ZA 5A4IS 3SZGA 3PUJA 3R4VA 4OJMX 4BN5A 1X8KA 4OM7A 1NDQA 3GZNA 1Y1RA 4WZ6A 2WEKA 4LPKA 3MUFA 3HCDA 4JAVC 1QB8A 2EZ8A 1Z4LA 2BFWA 1HZJA 2BKXA 1FU8A 4I5FA 2CNNA 2VDUE 3ZH2A 4BP9A 4LZNA 2HCJB 4KK3A 4PE5B 2Y67A 4F4JA 5EQFA 2XDYA 1DC3A 2JASA 4Y9UA 2GHIA 1JV2B 1M2OB 2OHVA 4L5CA 3ESXA 2HNAA 1EGVB 1ORHA 5KSZA 4RZUA 3ELBA 4QOGA 2BT4A 1N5RA 3WL7A 2AJBA 2ENUA 1DV2A 2W4IA 3N59A 4FE7A 5KYUB 1OBVA 1QPBA 2P65A 4O4IB 1IM5A 1VJCA 2B7LA 2NO6A 3REQA 3WB1A 4IKPA 2BPOA 3B5EA 4ZQBA 3F5DA 4D96A 4QDKA 2XUZA 3EG5A 4QEKA 1KETA 1NLYA 1ESMA 1XZLA 2QJOA 2W2LD 3HYTA 1FBNA 3OCWA 4NVRA 4AZ0B 4K9LA 4GVLA 5K51A 4W5QA 2V3WA 3GFPA 3C1TA 4B31A 1PL6A 5AI6A 4K8RB 5FNVF 3TM5A 4WVFA 1FL9A 2Z3WA 2D2IA 3F1KA 5JSYA 3CIOA 3FWPA 3W05A 5A4KA 1KARA 4HGPA 3NONA 3H65A 5E7IA 2HK7A 4CRWB 2VN8A 1GSHA 2WPDD 2R8PA 1TD1A 1YOVB 3F5SA 3E8MA 4ARZA 1TVMA 1KQOA 2WTAA 5I5EA 3R0IA 1ZITA 3D3EA 3H2JA 4MVJM 4RZXA 5FO1A 2X42A 5FHRA 1SXPA 1SPXA 1X92A 3KKZA 4AUNA 1QZTA 2A35A 4MCJA 2ATCA 1PX0A 3KVNA 3W4JA 3WNZA 5F23A 1G5PA 4WAUA 3TSAA 1QIKA 4DDUA 4RF3A 5A05A 5T4EA 4OHYA 2R11A 1CJMA 4BFVA 4NOJA 1C8VB 1TZMA 3UV6A 4RZQA 3ROMA 2P4UA 3T7IA 4D9MA 3DSRA 3E23A 2HJ9A 1FUIA 1WY7A 4MWCA 4DXAA 3DMYA 3EIHA 3UH0A 1I4EB 3K94A 1VMDA 1M5TA 1F8XA 4CKEA 1WDWB 1XX6A 4IO1A 2V7UA 3C6YA 3IUYA 3LY9A 4R3NA 5JCXA 4XDGA 3LMKA 4QGHA 4RGVA 1J39A 2N42A 2QUKA 3H4TA 4B0PA 5JRDS 1UOEA 2VHUA 3KD2A 4X91A 4TPKA 3UT0A 5TPZD 4DADA 2LE0A 3FN4A 3KS9A 4LXGA 3WGVA 1PGJA 3GPIA 1GLNA 1NSFA 5KYXA 2QLTA 1R6VA 2KBFA 1AO3A 1I5RA 3WNDA 3U39A 3L4JA 2HD4A 1UBRS 3RIHA 1JG7A 2F62A 2FMFA 5BWLA 1B6GA 2H1HA 5G1PA 4ZJZA 5BORA 5KWJA 2GPJA 2WM8A 3OOYA 1QH9A 3TW4A 5DT9A 4DSZA 4HT3B 1F51E 1VE9A 1RWKA 2OEPA 1JDBB 3GOQA 4QUBA 2X15A 4TYQA 3C6XA 4NCAA 2FZEA 2IY9A 2QAGB 5EZ5A 2Y3IA 1D3AA 3GVPA 1RCUA 4EK9A 3KC2A 1C9JA 1GYQA 1TT5B 2CVZA 3NT4A 4MUKA 2NU9A 5CYFA 1U81A 1N2ZA 2P0EA 3W34A 2OCPA 2XB2A 1NUSA 3NOXA 3CRVA 4L5AA 3OJXA 1A4XA 2CXXA 5GZ3A 4DLZA 2X4GA 3ZG6A 3C8ZA 1AMUA 5ER9A 4S35A 2JFQA 4I6EA 1A04A 4NEQA 4IDHA 5FF9A 3QEAZ 2Z8YA 3N2KB 4DNFA 1X7DA 2WJPA 2ZSKA 5CH3A 1KERA 1K8QA 2XOEA 3OG9A 5DSXA 5EWMA 4LIPD 2VTBB 2VPPA 1TYZA 4YYEA 5AR1A 5HSGA 4H3HB 2WUDA 2GESA 1OT5A 4FYWA 4IIYA 2GCEA 2HU5A 1O57A 2MMGA 1G17A 2VYQA 2ZJ5A 3C2QA 3K0FA 5HJ2A 3BD7A 4O0LA 4DM3A 1ZOOA 2RI6A 3BGSA 1GFSA 3ICQB 1RNLA 4BMOB 2FB9A 5EEHA 3RRZA 2EARA 2REBA 4C22A 4D9EA 3OM9A 4BQOA 3WOVA 3DMPA 1N2XA 2NPOA 3OKCA 3JQ7A 3NBMA 4IINA 1YDEA 5FXMA 1MEEA 2XMSA 1Z4KA 4D5EA 1A2QA 1C9YA 3U4IA 4RO0A 2YV5A 3ACDA 3G7UA 4M1QA 1JLHA 1NG9A 1MENA 4QU9A 5TX7A 4BFTA 4LDAA 4PFSA 2JGNA 5KCMA 4KIJA 1ZH8A 621PA 1PCXA 1Y8CA 2XXAA 3ECSA 1QK5A 4INAA 2B20A 1WZ2A 3CS3A 5DIFA 4TM7A 1CLEA 2GXUA 2H7XA 1A8IA 2GRUA 1CY8A 1QVRA 4BNGA 3SZRA 5JZMA 2V6BA 1DUSA 2HK6A 5LP1A 3ZLJA 4C1NA 3HCOA 1PG5A 2GJKA 1D0SA 3HJCA 1NYQA 4JQSA 1NU6A 2I2DA 1T3TA 2W6IA 5EXSA 1N0WA 4HDMB 4ZWNA 1DKPA 2ZS7A 1IPFA 1CIVA 2CGEA 3C97A 5DHRA 5JSZA 5KX5F 2JJ2A 4RF4A 4WKOA 4HPXB 4LJLA 3T7TA 3FPLA 2N9UA 5D5HA 2IXDA 4NYIR 4CMEC 4AK9A 1Q15A 2D3TA 4PO3X 4DQUA 3UATA 4L9SA 4AJHA 1HA3A 4DV4B 4K81B 1URPA 3UVEA 3PIRA 2GZ1A 5EUCA 3O9ZA 4PICA 4PLFA 5DVZA 3TL3A 5FUMA 4OX9Y 3E2PA 5H81A 2AFRA 3BZUA 1E0KA 4MQFA 3QPWA 4ASUD 2C96A 2FH5B 4C7JA 2P2DA 2Z5FA 3A1TA 3DLAA 1FYEA 2I2BA 4IDQA 4O2BF 4PZ0A 3FGZA 4G85A 4L8LA 4E4YA 3SJBA 2XQVA 2EX0A 2RAUA 3HYSA 5DBGA 2XTAA 7GPBA 4R4JA 4BV9A 4RK1A 2Q2OA 3RR2A 4MRVA 2HMTA 2JFYA 4Q7JB 1E6CA 3ZU3A 4JUIA 1BE8A 3FI0A 3IUBA 3ZDQA 4EB0A 4UD6A 3ZZNA 1VJRA 2W00A 1TZKA 2XTZA 1P7YA 4YRMA 2UVDA 3KOUA 3INTA 3BB1A 2Z2JA 3BH7A 3D8TA 2VAVA 1EFKA 3J80A 2XCRB 2WAYA 3W3ZB 1R88A 1O6BA 4F8JA 3PI7A 3MFQA 1NJ2A 5H3LA 3TKAA 4WDRA 1KP3A 4LQ4A 5FEMA 1YBHA 4G0ZA 3VNSA 1KDZA 2WWTA 3HUTA 4CIDA 1E2PA 1SCUA 2EDCA 3EEBA 2R62A 3F7MA 3VJLA 5AW2A 3I05A 1ZVKA 2J46A 4C43A 1GPBA 3AONB 4M99A 3OA2A 3UBTA 2XRZA 3ER8A 4BLOA 1V3UA 2VQ3A 4X66B 2VWQA 3GRRA 3K0KA 1N2SA 3K70C 2ZIFA 1LVGA 2IE0A 3ZCQA 3EYAA 3MJSA 4GBGA 1WDMA 1DKQA 1LDBA 4U3JB 1LZKA 1L8QA 4CKWA 3TRDA 2UDPA 1UF9A 4MQ5A 2XJ9A 3OPVA 2BFCA 3COYA 4DV2B 2PCLA 2FPOA 3KM0A 3M8KA 4HAOA 4B2PA 4YAKA 5J4LA 3EPKA 2JVKA 4PO8A 1ZEJA 2BEUB 3ONEA 2JFXA 1L5KA 4KX3A 4HN4B 4Y2VA 1EGHA 2QROA 3GGJA 3WLJA 4EW6A 4YR9A 2W7TA 4XQEA 3JZAA 3MBOA 3QQPA 4LZPA 5HBRA 1L4MA 2XR1A 5B3LA 5BWBA 1QK4A 4UW9A 4IAOA 1N8SA 3U19A 3AHCA 4HDRA 1XDBA 1K27A 1KDRA 1RBQA 2BHLA 1ETHA 1S2GA 2ZI9A 4HAUA 3PC8C 5ALOA 5F76A 4DILA 1JEYB 1B00A 3KR1A 4DJTA 5CFOA 1VPEA 3HLTA 1Y6GA 1FFWA 1NLMA 4Q9AA 1HFWA 5EE3A 1N0UA 3LYLA 2I4LA 4C3VA 1NXTA 2KX7A 1JDPA 2HRZA 3ZEIA 3IIJA 4D57A 2A9OA 1ISIA 3TZLA 5ALVA 5REQA 4K3VA 4XDHA 1M6NA 3OF3A 3GLQA 4OXIA 1ZHOA 4ER7A 1ZSNA 4BEJA 1YZGA 5K4AA 4NJMB 3AFOA 1M83A 2HJHA 1BDMA 1ULHA 2J67A 3LHKA 4TV8F 5TQ0B 4C0HA 3NHMA 3P4YA 3RVDA 4F4UA 5JQGB 2O8CB 2VR1A 1RHKA 3VDXA 3B3QA 3PPXA 2GTIA 1P5FA 1RRMA 3HI6A 5AVQA 4EO9A 4U39A 3ZWPA 4TLAA 2ZWMA 3U49A 4EPTA 1SRRA 2QX7A 2B35A 3C3AA 4KQJA 3ZQUA 4F56A 4JQOA 4DBZA 1VA5A 4WK0B 3ZE1B 3HDTA 2Q7XA 4DWWA 1L4HA 4OXQA 2HO4A 3LG2A 3NVDA 3FJYA 3R6TA 2ZJ4A 2B8JA 1JBKA 5IC5A 221PA 4ZREA 1MO2A 1AKMA 3JARB 2QTBA 2BBSA 2GJ8A 4HDNA 1MABB 4RZIA 4AJ9A 2HJGA 1ZQ1A 1ZNZA 3NBYC 5L3SA 3V2HA 2AC4A 4LRQA 2EL7A 4BO3A 3INYA 5DLPA 1GOTA 4S1OA 2ZR8A 1Z5OA 3M49A 4DCOA 3GLGA 1TQ2A 2WT9A 2Q0XA 4Z4FA 4CBVA 4HUQB 2NIPA 1SC3A 2HLPA 3KL4A 1E6KA 3IVGA 1NQVA 3H4IA 3LNTA 2DH6A 2ECOA 4EMBA 5EZ6B 3IEIA 3PVZA 2HK9A 4J0HA 4NU5A 1HYGA 1W49A 2H54A 2L19A 3BT7A 4PRLA 3WK7A 1T0BA 1ZSYA 4KFCA 3DOJA 4PSVA 4W8OA 5AK0A 4C4YA 5C32A 5AK5A 5A2GA 3K53A 4NOMA 3F9IA 2QVXX 5D3ZA 3AESB 3LZDA 3UHFA 4BNHA 2FSVA 3DFMA 1V26A 3S2IA 2PCJA 4K9MA 4Q02A 5INTA 4LNAA 4J9VA 4CG0A 1BXRA 3N0TA 3MSXA 5EWLB 4UC0A 1XWWA 2OK8A 4V39A 1N0IA 5F7ZA 3BTVA 1G41A 3MMXA 5E7JA 2IU4A 2VRCD 1F6WA 2YQZA 5JDIA 2W58A 1XU4A 3IAXA 1UC4B 3UYLA 4NYJR 4KE6A 5AVRA 1XSEA 3KQOA 4LWQA 4D7AA 5DRYA 1M74A 3T0GA 4C3ZA 2V7QD 3Q5EA 4GICA 1KI6B 1XRPA 1US8A 4OHXA 4ILKA 4EL0A 4CM1A 1G21E 1XRMA 3DBRB 3VJRA 3FRHA 1RRVA 2JGLA 3DM9B 1JFTA 4J0EA 3C3MA 2AIRA 1DEKA 1E6EA 3EISA 5AHXA 3ESRA 3KXPA 4URVR 3ZCXA 5IHPA 2TMYA 2R7AA 2ECPA 1CF9A 2CUZA 4ZVPA 5K1ZA 5GZ6A 1RBYA 3L43A 3FPFA 1AHIA 3FTFA 2BTQA 4HWSA 3GWZA 1LPOA 4U8HA 2HWKA 5ES3A 2C7BA 3QMMA 1O9HA 4PSCA 4N18A 1TOAA 3BGOS 3CPSA 3JQ9A 3JYNA 5HQJA 2YWBA 2VJMB 1Z2EA 2YHSA 3QPAA 3CURA 421PA 2YS6A 2AT1A 4QAQA 2E4AA 2PKYX 3B12A 2XH8A 4U7WA 3K9GA 1PSWA 1E5QA 5B2FA 3N53A 2PJRA 4PQGA 1ESDA 2UYQA 3V1LA 5ER6A 4LV5B 1KDTA 2GHTA 3NALA 3PXUA 4FW8A 4LHVA 2XVZA 3E81A 5DOVA 2QNBA 4BB0A 3R5FA 4DCGA 3OPMA 1HL7A 1JT9A 1LF0A 2A84A 2OTCA 3BK2A 4Q7KA 4DIMA 3GEMA 1QHYA 1O7JA 2C31A 2A5GA 3ME5A 3R0JA 3UJBA 4C29A 2HK8A 2PUWA 4Q39A 3UCXA 3A7DA 1ZCZA 2YINC 2LIVA 4JBGA 1AUPA 5D5PA 2ICAA 5HG0A 3EWAA 1SUBA 4S1VA 4EY6A 4XQ9A 1FX0A 1U5BB 4Y1FA 3QE3A 4BLPA 1U2SA 1FTQA 3OCJA 1ZKDA 1XR3A 3N2ZB 3TZQA 1W36C 4DM4A 4L4SA 1XIVA 2C5LA 4FSXA 1ZK3A 4OHRA 5FOSA 5E2BA 5GONA 3ZV7A 5B6IA 3OFJA 4R2XA 1OLUA 1SBQA 1NBME 1ZN9A 2VJQA 3DKIA 2XYHA 3K0AA 1KA9H 2ZK7A 4KE9A 4LZZA 5EJMA 3SC6A 4QM7A 5EI5A 2ZT6A 1XQVA 1KOFA 4GPIB 1TECE 4HFMA 3RT9A 3UBMA 3SVTA 3BUSA 4OLBA 3LOQA 3U4CA 4FGKA 2I34A 2N47A 1G20E 3N2EA 1ZMOA 2LIPA 3F1LA 4O4LA 1NW6A 3VR5D 2B92A 1QHEA 3FW1A 4NHEA 2Z30A 1LPAB 3EN0A 5LYYA 1NURA 2NUBA 3RH0A 4J07A 1FFHA 2PT7A 3D0KA 3EUAA 3O3NB 1XEXB 2HHCA 2QM7A 4MO9A 2LDXA 1QNLA 3KV1A 1T4GA 1DEOA 3PNKA 4FIZA 3TLXA 3DVAB 3I6IA 3HB5X 1RWNA 5ULLA 4JI1B 3RRYA 5DBIA 4UOEA 1KFBB 3GMDA 5C35A 1TK9A 3F8SA 3ZHZA 4EKEA 1A9PA 5L4LA 4D6XA 1DC8A 2AUMA 3MAGA 1OBFO 5HKOA 2P4HX 4P0QB 3BIXA 5LVAA 2ZSJA 1G20B 3DB2A 2WYIA 4NK4A 4GG1A 4CEIA 1VSVA 3PIIA 2O8DB 4MUFA 4KREA 4KHPB 2XB4A 2B98A 5FOQA 2PZBA 2B8WA 2VF8A 4B33A 2F64A 1KJ9A 2HY7A 4B3IA 2QUJA 1H2ZA 2P6UA 1SCBA 2EW8A 2QYOA 1PT8A 3HVKA 1Z22A 3HKEB 3L8EA 4X84A 5GJBA 3H9UA 1QFXA 5GP1A 2H0RA 2HWXA 3KU1A 1DWQA 3SZ3A 2PSDA 2PX3A 4MV9A 1NZJA 3ZNOA 2H4ZA 3ABQB 3BF7A 2WF7A 3NC4A 3QNWA 1E5TA 2QYSA 2NO1A 4B5LA 3EVGA 3EIFA 4MW2A 1Y4UA 4IY1A 2DQ4A 1SXGA 2CZQA 1QGOA 2FOXA 3M70A 2ZYVX 4RL6A 3PQ3A 2X0JA 3CE9A 1NVBA 1JNYA 2NTNA 1RWWA 3FSJX 3IAUA 5I7FA 2B5WA 3I01M 1B0ZA 5F98A 4A2PA 4EQ6B 1PTKA 4K0KB 1L1FA 1FSGA 2P9YA 2VEOA 1F8FA 4O3FA 3T5TA 4E21A 1PL0A 1DARA 3PQ2A 4K9OA 2XW6A 1KOGA 2Q1TA 3TAUA 1II8A 3VR3D 5EKTA 1M7BA 2W2KA 1X2BA 2Y4OA 5MN6A 4JX9A 1RXUA 2WTUA 3KQYA 2WIAA 3GP5A 3PR3A 3K6SA 4HAZA 1GTSA 1CFJA 1SXJB 3LL4A 3NNNA 3BH0A 3I52A 1DKUA 4CZ2A 4EO4A 2BGWA 1POWA 3D7RA 1H6DA 3HLYA 3TQHA 3FDZB 3VU0A 4G8CA 3DE5X 1ZUWA 3DKRA 1C30A 2IP1A 1BKDR 1XD9A 1N75A 1IEXA 3F3SA 4JI4B 3FPJA 3SHTA 3VTAA 4U0KA 2IDKA 4XX0B 5JCJD 2IHUA 2IEBA 2RHHA 2RBKA 4CGYA 3UHAA 3K70D 1MJHA 4CLOA 5LZ4A 1QBGA 1RHUA 3IESA 3EZ6A 2G0AA 2C61A 2DQSA 3L4BA 1V4BA 4HGQA 2HWUA 4K05A 4P38A 4WY2A 1T5TA 1ZVMA 2NVUB 5HZGA 3MGKA 2RBEA 4BE4A 2JLVA 1MAVA 1XCGB 4AT1A 2MTBA 4UHCA 2L2QA 3S1AA 1Z6AA 2GK6A 4YRFA 2RDMA 2O0JA 3GEPA 1DZ3A 1S2LA 4AXXA 3RRNA 3W6UA 3RSQA 3P4XA 4JI8B 2Y93A 4MWEA 3H8WA 3SOZA 2I66A 3WL4A 3DC7A 5ADHA 5ALTA 1P5RA 3L8ZA 1M6VA 3O1HB 4NLLA 2YW2A 1VGQA 3FCAA 4JCCA 3NM6B 3IXQA 2VYVA 1ZD8A 4I55F 4V1CI 1BIFA 4XYMA 4BNLA 1X80A 3QA3E 3KEMA 5KOJA 3R5XA 3X2FA 1MA0A 1P73A 2IZ7A 4ED9A 5FYDA 1U2GC 4HDOB 3AZPA 3LX4A 3I2JA 1CY6A 3PQ8A 1QP4A 2HF2A 4PGHA 2AKAB 5CAEB 5JXWA 3OZGA 1Q7EA 1WXXA 4GLFA 1OZ0A 4HATA 4MUIA 3X0DA 4CM5A 1A9XB 5JRJA 4L3VA 3UJCA 3UAXA 2PAFA 3DF9A 4ARUA 5F1YA 4RVDA 1E9VA 3HADA 1GQSA 3AERB 4KN8A 1XMVA 1Z33A 2YC2C 3GUZA 3IELA 1CZHA 3TEFA 4ARBA 4XDYA 5J2TB 1SWVA 1UJ5A 2WICA 4KTTE 3NTRA 1USGA 5LN1A 5M2QA 1BRMA 1FRNA 1B16A 4KQIA 4I1PA 3UK6A 2CFSA 3ZDRA 3M6UA 4YXWA 1NUUA 4YAUA 4QTXA 4GQAA 4N5LA 2V6JA 4MGIR 1VA4A 2AL7A 4O4HF 2D1YA 1C2YA 1L9KA 3ZU2A 1HK7A 2VHVA 3O2SB 3KT6A 1N6PA 1SZPA 2IIBA 3P52A 4OGLA 2G1KA 3GLIE 1DLIA 2F1KA 3EH1A 3GN1A 4J94A 4J1TC 4NONA 1W47A 2NXCA 2M9MA 3DPUA 3G0GA 3MTDA 1NBIA 2YW9A 1PFYA 1YL6A 4PAGA 2JFNA 4D3XA 5DM0A 5BP7A 4V0ME 1QHNA 4DBLC 4BMCA 5FUQA 5JARA 5A9SA 1HGXA 3AB8A 1R6AA 4QDUA 2ZYRA 5TQ2B 5B53A 3SQNA 5KNBA 4ECAA 4ZYWA 2POCA 1YRAA 4DGSA 3HWX1 3R9WA 2ERCA 2A92A 3BKWA 1TYDE 3JYOA 3RVOA 2VH5R 1BQ4A 3O8BA 5IDXA 3WG9A 3MWDB 3AETB 2GD2A 4BP1A 3IEVA 2NVOA 4NKRA 3VAAA 3E3LA 3JVEA 2QRZA 3MB8A 5KQGA 2NPFA 2VPWA 4UTRA 3GLRA 3P0FA 3SHVA 3SK0A 4EYOA 1QFZA 5ARBA 1W9MA 4JUFA 1DUVG 4E51A 2C8KA 1X9HA 5BNIA 5IT9A 3THXA 2CV1A 2XT6A 2RG1A 1JHUA 2OMKA 2WJIA 3IAM6 3LFHA 2YXEA 1A8QA 2HA4A 5C8YF 2PKQP 4R1QA 3UMSA 2HBYA 1G0OA 1TKCA 2WWIA 1MC4A 3G9XA 4UNPA 2Z8YM 1DHRA 1Z8HA 2RGNA 4MO2A 1FXWA 2I6TA 4ZT6A 5THKA 1T5DX 4JA0A 3DW1X 3RUDA 3GP8A 4GMDA 2QRUA 3DFKA 4FWBA 1YJXA 4E4RA 1XA3A 5CLHA 4LG1A 5CGZA 4WZBA 3FE2A 2L17A 2VNKA 5HE8A 3VX4A 2BW0A 3TCXB 2J0EA 3AX6A 3OH8A 2EQAA 4JJ6A 4YROA 4AX8A 2XZLA 2AF4C 1QVZA 2BV3A 4KAJA 2ZVJA 3EQ7A 3SF8B 4HWTA 3JV7A 3DMDA 1M34B 3HSSA 5JR3A 4ARIA 2XDWA 3TZCA 1J0EA 2ZSFA 1UKEA 1RAEA 1WU8A 4YJFB 1RTTA 4YAOA 1Y37A 1JDBC 4CM4A 5D85A 2FLVA 3IJ5A 3ZV3A 1Y3CE 2Q5OA 2QAGC 2QTRA 4P3PA 4MWOA 2AR9A 3C1AA 3JD3A 1N5JA 4YJ3F 2P9GA 3BMNB 2GUWA 1VMIA 1N2BA 1YQUA 1C4WA 2DTDA 1H3FA 1KBOA 2YV4A 3NJ4A 2Q4TA 3R9IA 4TS9A 2X7HA 4M7PA 4QODA 3L01A 1XTVA 3G2OA 5BN3A 3H9CA 5BQPA 8ADHA 5JV5A 2NSHA 4ZCIA 3AF0A 1D2RA 3INNA 2HREA 3PPIA 1M0WA 2HPAA 2P3OA 1L7DA 1QV6A 3KFVA 5BMOA 1I2MA 1XALA 1XCBA 2ZROA 4QBTA 1V35A 1ZLXA 1GWNA 4D3SA 1WDTA 3ENKA 3R7FA 2J6BA 4E03A 1Z4NA 4EFDA 3C6MA 2K2QB 4MW5A 2GPNA 4DQKA 1UEJA 2PZGA 2VRWA 3RGWS 3RVNA 3HVRA 1WVIA 3F6EX 1A95A 4QE3A 4IRXA 4IZHA 1DG3A 4ZDWA 3V8NA 3KWFA 1SN7A 3A06A 4RW0A 5K4HA 1W36D 3N8HA 2OPBA 3B3AA 3V2GA 1OI2A 1WXQA 2W98A 3MF4A 4EHHA 1ZY2A 2RB4A 4YASA 1LLDA 1X7XA 5AKIA 3RTDA 3WQRA 4EKYA 2PJUA 1U31A 1ZD9A 2Y92A 4RL4A 3W2TA 5DEIA 1Y9ZA 1DQYA 4XFDA 3KQPA 4NS1A 4R2WA 4B40A 2VK1A 4YQZA 4LMAA 2PAAA 2XVXA 4N0PA 5F4ZA 2ZE5A 1OFGA 3EGWA 3M3PA 4D4IA 4JK3A 4PPNA 4C2BA 2RAFA 5KPJA 5E9AA 3N7TA 2J5KA 3L7MA 2ZYDA 1TZBA 1JXOA 5DNVA 5F1OA 1Z7GA 1WHTB 1RACA 1OI4A 3T7AA 3UTDA 4B35A 3NJ8A 2D59A 4UVIA 5FTNA 1JKJA 1H2BA 3TJRA 5IYZA 1T3SA 1PTJC 2RHDA 4TVBA 4MIKA 3SQMA 3GOHA 2QPAA 3AU8A 5B5SA 3MCAA 1LLUA 3PVCA 2DUUA 1YSCA 2VDOB 3GH1A 4EKNB 2ZULA 4JIMA 3PFWO 1D6MA 1PEAA 2H00A 2YYAA 4DEYA 4KDFA 4UTOA 4YTEA 5KTNA 4IFBA 4FPXA 4PLCA 4KLNA 3D4LA 4E2YA 1ULBA 4LBYA 4YGXB 4KMOA 4BQFA 2PLAA 4PG6A 1EZ4A 1KFJB 3P27A 5LM3A 2A5FA 5JW6A 2Q8PA 4O4IF 2R1TA 3M5DA 3QVMA 2DBYA 4GUAA 3RANA 4DLVA 5BVHB 1VL2A 4CVNA 1ELOA 1Z15A 3SZLA 1E3DA 2F43B 2PU5A 1AQYA 2XWSA 3JQAA 1TA9A 3TE7A 4CMKA 1R6DA 4KQMA 2AD5A 2ZUDA 1UADA 5FEUA 1CRZA 2GTHA 4V2IA 4WUTA 4IS3A 4KRYA 4NU6A 2HIAA 2PJZA 3E84A 5C8ZA 2ZSBA 1PJ8A 1SCDA 3L07A 4JDUA 4PINA 2PU7A 4PG7A 4C7OB 3K8ZA 1SQSA 1LWNA 2OFXA 1OLXB 1PI3A 2MMCA 1A8UA 3GXOA 5J43A 2WJ3A 4PTYA 4FBGA 4RCVA 3RJMA 1R66A 1IBCA 5FULA 1Z4IA 3U4GA 3P0RA 3SIXA 2GZAA 3CZ4A 1S4QA 3Q11A 3HJNA 5K0ZA 4PN3A 4L3WA 1PGNA 4F5ZA 2D62A 3FMFA 4RS4A 4J2OA 1PU2A 1UIMA 4P54A 3PNOA 4XGNA 2REOA 3N05A 2ZBPA 3QH4A 1E4VA 5ADUS 1FVOA 4GF5A 3THYB 2M1XA 3IDOA 1YE5A 4YRZA 3QF4B 1JIIA 3L49A 3UT5B 4CMBA 5HF9A 3ETHA 1BEEA 1OXMA 4ZGBA 5HYVA 4Y2YA 1WMBA 3DE0X 3C4QA 2JCYA 4IDNA 5JBQA 2FMHA 3SFVA 1NNI1 5IZCA 1R5OA 1EWKA 2ADFA 2H7YA 2OFPA 1GQFA 4G1EB 3KAQA 4H1TA 4O59O 4RXTA 3AIIA 4CCWA 3X1JA 4RH3A 1MVLA 1ZMRA 3AEKB 3VU9B 2HEIA 2O6HA 4LGMA 3UFXB 4BECA 1ZUNA 1OGJA 3H2IA 5A5EA 2IELA 3UWPA 1XZBA 2QBYB 1R4NA 3DZ8A 1HDRA 4WXPA 2F90A 5AJTA 1RTKA 3GFOA 2B0CA 2X7XA 1WF3A 4G5RA 3GRZA 3ZDFA 2O59A 2VP3A 2YRFA 3RNOA 1DIHA 1QAQA 3BEOA 1VXRA 2QT1A 4ML3A 3B36A 1A7KA 3F3KA 3H5NA 3Q88A 3WB0A 1MTOA 3TPZA 2GRAA 2OV3A 3FSGA 3M33A 3ACBA 3M6VA 4CM7A 5AVVA 5MF6A 4INZA 3G6KA 3GCGA 3SNHA 4PYRA 3KUUA 1X1SA 3JAWB 2MT9A 4OQPA 5DWDA 1Q0TA 4KCGA 3KAKA 1KAGA 4HB0A 4NZYA 3RLFA 2ZOSA 1SHJA 3EWSA 3PNVA 3WK6A 2J9FB 3U4QA 4OL9A 1SG0A 1YQXA 4DJ5X 1GM5A 1J2JA 1P3Y1 1U9IC 1ZR2A 4YCAA 5IN4A 3WLAA 3RT1A 3OHSX 1U0NA 2QGNA 4I99A 4QVIA 2OP0A 4L9WA 2I33A 5LMUB 4MVCA 2WQ7A 1SFRA 4U8GA 3G9UA 4DHWA 3HFSA 2ZITA 1OXVA 1G3MA 1UXHA 4AYWA 2QTVA 3BM5A 1N4DA 2YBDA 4XDZA 4GM4A 1CXZA 4TMYA 4UTZA 4IEFB 1F4PA 3NCTA 4PGMA 5CJ2A 4EVSA 2G1UA 3IQIX 5DPMA 4FP9A 2R6JA 3UJDA 2A9RA 2EAUA 1XROA 4TT3A 1YFZA 3MRVA 4GOND 2O4CA 4O1MA 4LXIA 3RRBA 4AUMA 1OA0A 1J0BA 4QYSA 3U5ZB 3AUFA 1A71A 1GN9A 3C5CA 4Q4JB 2JHGA 3W2EA 1H23A 1FNSA 5DV9A 1HLPA 5D84A 1XMXA 2C98A 2D4AA 5CLQA 4P3YA 4R2KA 2CLIB 4MW7A 1GCAA 2G83A 3LT5A 2ON6A 1DKLA 3CY6A 1AXRA 1MTZA 5E2AA 4UXJA 4BVEA 3PGA1 3D6TB 3I37X 3ED5A 4V1CA 1LS6A 4BNIA 2VRBA 1IBMB 2GSDA 1HX7A 4A36A 1YIOA 4PLGA 1QLJA 5JSKA 1LBEA 1SU6A 2IYRA 1N6HA 4NMXB 5K3AA 1BU5A 2M2IA 2ORYA 4MUMA 5DH9A 4BNDA 3ROFA 2R1ZA 1Q3HA 1PS9A 1Z7BA 4DQ0A 4F9TA 3C6QA 4P22A 1EVEA 4PZCA 1MRNA 2O2EA 4V03A 4F0JA 4Z7NB 2NP7A 2G6BA 1XMIA 3WJ2A 1FNCA 4TQGA 4GL4A 3ZKWA 1IVNA 5CNIA 4BB5A 2O3SA 3TPFA 1O6GA 1F7VA 3IEKA 4CWAA 3WGHA 1NNUA 2PGAA 4ZP1A 3PXGA 3BILA 3L40A 4FEEA 2I55A 3A4MA 4IS2A 1EHIA 3OM8A 3BGVA 5CTJA 1PR4A 1YGPA 3A28A 3K4QA 2HR1A 5DISB 2EGGA 2ZB8A 1CJUC 1ZW1A 2I4IA 3JTEA 2QSJA 4BASA 3STWA 4WHMA 5H4GA 4B87A 2YV1A 2QPTA 1VIMA 3DNMA 3ETDA 5BSVA 5AW4A 3AUTA 4E11A 1OILA 1QH1A 2FW9A 4DTCA 4KMSA 3FNEA 5HKAA 1XEFA 3QVWA 4HRAA 4L28A 4RFSB 2DBQA 3AIOA 4RQAA 4C0XA 4EJMA 1PDWA 4Z4HA 1YR6A 3BHJA 3RB8A 5IULC 3IYLW 4G0UA 3I1FA 1K06A 1M2VA 1O96B 1UJCA 1BYIA 2DPXA 4HGZA 1PUXA 1WOYA 1CUAA 1G4HA 4AZWA 3Q9UA 3TXYA 1KEUA 3LLMA 2VDQB 4KNYA 2FUG6 1DJQA 2AEFA 5DE3A 3PUVA 2CLHB 1Z2PX 4BLUA 3MBIA 4KQEA 4QNNA 3UGQA 4Z0TA 4ADSG 5L95A 1KP2A 5DHUA 1O95A 5AD1A 4FU0A 1T9AA 2VDWB 4KHZA 1T8WA 4EARA 1E3SA 1FOEB 1GGVA 4K9KA 2B36A 1HDIA 5IVKA 2WINI 1P91A 1IM2A 3OEYA 4JB8A 4RPKA 2QMZA 3WK8A 5TF0A 1RQGA 1QGUB 1RCTE 5JTTA 3TFOA 1KS2A 2CD7A 2H9IA 3MWJA 3NNSA 4C2TA 5JJIA 3T5CA 3WLFA 1WABA 2YWRA 3NIBA 1MA3A 1C4XA 4CG3A 2UZ1A 2VQDA 3F0TA 4HNHA 1OIWA 4DA7A 1UFVA 2YQ4A 2ZUEA 3A1WA 3QWIA 2Y68A 4RKQA 5WRFA 2QSZA 1FMCA 2W6JD 3B6MA 4YMWA 1KYWA 2C78A 3KJXA 2V58A 4H1HA 4PG4A 3ZX4A 3NUGA 5SYMA 1DPFA 2B8TA 1QFJA 4BMPB 3F67A 2Q1SA 3T6KA 3WQSB 2Q29A 4KXYA 2Q0QA 1IBRA 5A9TA 4O6VA 1DFGA 2GGSA 4OATA 3GAAA 3OO0A 3JXEA 4G1FA 2I78A 2JS7A 3NQ41 4OAOA 3ZHVA 3RC1A 2E5LB 1L7XA 2F3UA 2WWRA 3CISA 4QFCA 1QYCA 2UVPB 1JG6A 2D5BA 2H18A 4RNCA 1IY2A 1IL0A 4O2AB 3C3XA 5KQMA 3H97A 2YJ5A 1J99A 2ZSHA 2QW1A 3DV0B 1MFZA 4Z7OB 1B93A 1F38A 4JQZA 4N3GA 4QBGB 4RZSA 3QMWA 3OESA 5K0TA 5JHHB 4IYJA 1BGVA 2CFTA 2YFHA 3P9RA 5B37A 2PZJA 1ZLYA 2Q3FA 3DO5A 4BLWA 5JDCA 3EQ2A 2YWGA 1L7PA 3AI3A 3DXFA 2VF5X 3KR2A 4OQEA 5IN5A 3HYCA 5MFZA 3DW3X 4JB0A 1AKWA 3M4JA 1TM2A 3H87A 3IBYA 4Z2AA 5JQGF 5KQSA 1KOJA 3HDJA 2JANA 1XXHA 4JIGA 1XHFA 4YV7A 1OE0A 3CGGA 3AXTA 2BMDA 4TRJA 4OSOA 5CM8B 5FCDA 4Q4LA 1Z0FA 4LBZA 1FCJA 5IJ0A 5DHPA 5TMEA 1GKKA 4K9QA 3DG9A 1EU1A 1Y5IA 2XMGA 4M8NE 1BN7A 1C0EA 1DRJA 3ET4A 4DUYB 1ONSA 3I6QA 4WBNB 5FO0A 5EJIA 4KV9A 4E1BA 2EXXA 2PZ8A 1YFLA 1WRBA 2QI9C 3UB4A 4B6EA 3M4NA 2H2HA 4H1VA 1L7MA 3GL9A 5L51A 3GLUA 3HKBB 3R23A 4PHHA 4Y18A 4EWLA 5FAXA 5AIAA 4B9AA 4CKBB 1P39A 1OYWA 3FPHA 1FNBA 2XHZA 3QY0A 3RV4A 3T4UA 4BTEA 1NYLA 1BFKA 5EG5A 1CK4A 1EFPA 1NLUA 2WFZA 4N5MA 1M1ZA 4I14A 4XAQA 5DI3A 1TZJA 2ST1A 1IXRC 3FWZA 4M0FA 1UKZA 2EG5A 1IOVA 2XIQA 3ZWNA 4EUHA 2JDID 4C5CA 4LEIA 4DV0B 3K8QA 4LQCA 1PHPA 5JXHA 3H5RA 3R40A 4OUDA 2PQMA 2HWWA 2XA1A 3MJVA 3EDYA 4GI2A 2OGUA 4RGYA 2GUGA 3R3HA 4QXMA 1A5SB 2PX0A 3BC1A 3HJFA 4JC0A 2CLLB 2GYUA 5H9WA 3R0XA 3WTCA 2EKPA 3LSYA 1OTHA 2VT6A 3M0EA 1MEJA 2UZIR 3PUKA 5D3MB 4AJOA 3ADCA 1NLFA 1DJNA 2HMYB 2HUNA 2Q9UA 2VP9A 3OIFA 2GK7A 4P7FA 3U7IA 2QTCA 3MTIA 1P2VA 3MTBA 1E89A 1ZD5A 3P26A 2JI4A 1BD4A 1P80A 1YDFA 2EBHX 2IX3A 5K7SA 4CPDA 1R2QA 2RHBA 3LBAA 1CUWA 4GXRA 1Y9AA 1NQAO 1HTTA 2GDZA 4UAJA 4BWVA 1P2FA 1SXJC 5ERGB 4YAJA 1D1QA 1VLJA 3U17A 1JTEA 2Z1MA 3ST7A 1R64A 4MKRA 1YR7A 5AI5A 1FLAA 4MPRA 1IZYA 4UBJA 5JLAA 1ZGBA 2BZ1A 2FEOA 3H17A 4IH4A 3LKBA 4LOJA 3SQXA 1NJGA 4L72A 3WYDA 3PP8A 3CRZA 4AFNA 1GPAA 1CUBA 1KIMA 3VSBA 5ELMA 4B71A 4CV1A 1GA1A 3CZ5A 5CBPB 1I3NA 2XPCA 3T7CA 3EGEA 1EWVA 5PNTA 2IUEA 2JD0A 2WKWA 1NJSA 1CUCA 2BI8A 3GDFA 2H06A 3BRWA 3LF2A 5JMPA 1UBGA 5BR8B 1YBFA 4FBLA 1REQB 4JJ7A 4QNMA 3UWOA 1G7RA 3ESAA 3HQ4O 3MRSA 4LJ7A 5DXJA 3F73A 4K26A 2H48A 3IAHA 3UA3A 3EF1A 2QR5A 4MR8B 4H35A 2W2TA 1GNVA 1TQHA 2W6NA 2BZ0A 1AUOA 4PW0A 1S96A 3JPWA 4PY2A 4YI5A 3UMBA 1KAEA 5KREA 4CFZA 3UWDA 1DAEA 2QTGA 1AGNA 3P9IA 1Q20A 2GBGA 1OX4B 3AXSA 1MB3A 4KAXA 4JKYA 1UPTA 3RTEA 1Y9EA 2QWXA 3ILHA 4R1PA 3CA8A 1DFHA 4GMKA 4K6MA 4QXRA 1MZPA 3SJ7A 4G0QA 1G6Q1 2BH9A 1LI4A 3IDQA 1Q0PA 3GZNB 3O4JA 2Q5EA 2ZRHA 2WY2D 4KEAA 2PR7A 1VPTA 1UBSB 3H5VA 2O5RA 4QNRA 5SICE 4J1SA 2OUIA 2MJLA 2WG2A 4R31A 1OMOA 2JBWA 4EUSA 2DF8A 1JFFB 2FVXA 2P9TA 4G1BA 4G65A 2YY6A 4ZIRA 4KACA 4R9NA 2WK1A 4IEEA 2IPNA 1PT7A 2BELA 4RD2A 1IN6A 2WU1A 3BD9A 3G5UA 4KVGA 4Y6OA 4KAFA 5LSAA 1I5OA 1PR1A 3IXLA 3OO1A 3GJ8A 3O26A 4ZU6X 2OO7A 5AHOA 3W7BA 4KITB 2FZWA 1SMKA 3AI7A 3BWEA 4TT8A 4CQJA 2E3JA 4R83A 2BFOA 4ZU1X 5CGQB 1ZA1A 3CLKA 2NUPA 5SYNA 1PZFA 3M6LA 5EXPA 3ROXA 4D8TA 4OGFA 1UKCA 3PTZA 1BJRE 1B8OA 1AKVA 1K5HA 1J1IA 3ZD7A 3NWOA 2H5IA 2C7OA 1IE3A 2B78A 3GP3A 1O5OA 1OI7A 1DDIA 1T8TA 1FQOA 3BIJA 4LY3A 4UCFA 4M0MA 4DCNA 1EIZA 2QL9A 3TSZA 2X3UA 3AWIA 1LTKA 2YIMA 4AROA 5EHQA 1BZYA 1HQYE 3FYTA 2AR7A 3MCZA 1V1JA 5BOVA 2O8FB 1M8KA 1J0XO 5EHNA 4M22A 3DKKA 5DM70 1Y8RA 1UOQA 1B8UA 1V11B 3VPBA 3DZBA 1M0SA 3OWXA 2Y71A 4CU5A 1TM4E 3UC9A 2C1ZA 4KO4S 1Y3IA 5C81A 4GDMA 3PLNA 5BMVA 3D31A 1OBHA 2VJAA 2IWRA 1AY0A 1QUEA 3KXIA 4AKSA 1NXPA 5A0TA 4ZYLA 1PJZA 1UEXC 3NBKA 3G8BA 4IDPA 3TSYA 1AKNA 2V0CA 4MUAA 4Y6GB 4BNMA 4YMGA 4Z1OA 3WHKA 3PJRA 3T99A 4GMFA 3JQBC 1E5XA 1YVDA 1CZOA 2FEAA 5EIFA 1GUBA 1UMCA 1CQZA 4IIDA 1KMCA 3I5UA 4PYQA 1UT6A 1UPCA 3ZY5A 1Y7HA 1SQFA 3B78A 4Q00A 3RCBA 1WPGA 4N5HX 3HP7A 4XTRA 4D26A 3S81A 1G1MA 1QF9A 5CD9A 3IR7A 4XIFA 2XYGA 3FFBA 4YC7A 1NU8A 3RYIB 5KYXB 1G3UA 1N6OA 1PDVA 2MSLA 5JROA 4XWWA 3L02A 4WKNA 1Z7EA 3NOQA 3M1IA 2QSUA 1C1YA 2EQBA 2W48A 1FF9A 3QV1A 1IWOA 5JASA 4PVCA 3QEJA 2NU8B 2ZPUA 3ZGVA 2OZEA 2W0MA 3T7EA 4JWKA 5E6UB 2PSEA 1BMFD 1P5ZB 1GGMA 3UFBA 2WZQA 2JLUA 3BGWA 2A9VA 4ZTZB 1A98A 2E5WA 2NU7A 2Y2VA 3ORHA 4XTCS 3RHTA 3E4DA 4CTMA 3U3DA 5IUJC 2F8MA 1VB5A 5HS4A 3IPCA 4IMRA 3ZVMA 2NNWB 2VNIA 3NTXA 4IQGA 1SKAA 5FNVA 4DKJA 5LC1A 3EIQA 2OWEA 4JX8A 1D1PA 1QYDA 2QE7A 5G53C 3DBHB 1UT5A 3WGNA 4BWYA 3T1YB 1Z2DA 1OTXA 1LPPA 5FWYB 2W2OA 1M2HA 1IOLA 2C54A 4OXKA 2YRXA 3X2EA 4I4IA 2BR3A 4FFSA 1PG2A 3PL1A 1ZX1A 1DAPA 5ICFA 1NW7A 2Z2KA 5LUBA 2R7LA 2CK3D 4IGFA 4M98A 1SPBS 3QLUC 3R5TA 4WKPA 3W1EA 2EFJA 3M5WA 3CLSC 5K6AA 1PK7A 4URWR 3UZUA 1SUCA 1B43A 3HKDA 4YX9A 3COJA 4DMLA 5EE1A 2QTNA 5EMJA 3S2YA 3BCRA 4ASUA 3KPJA 5G02A 2AYYA 4I46A 3W2IA 5GADl 3TQCA 4TTPA 5IKPA 3GFRA 1ZSVA 3K8YA 1DKRA 3N9IA 4R69A 1R0XA 3JVIA 3R3UA 1JPNA 2IYSA 4NECA 1EAMA 1T9KA 5LZ2A 1P1CA 1L8XA 1P0MA 1XVTA 2OAGA 4RA6B 3KXKA 3QFTA 1UFKA 2QIOA 3B3JA 3A9RA 5JNSA 2DUWA 5E4YA 4YA6A 5JU6A 5IBPA 3NVMB 1AM4D 2FK8A 1N2EA 1E2MA 1XYGA 4RKWA 2V55B 5FWAA 3K0EA 2FLKA 3QVTA 4DSAA 1ZI9A 1WHSA 3DEAA 4AD8A 3DAHA 5E4FA 3HXPA 4OKNA 5HFAA 5FV4A 4LY9A 1KEKA 1IHXA 3BVPA 4NP6A 4YDSA 2R68A 4QYIA 4EAAA 2CCKA 2Q45A 2QYTA 4UARA 2CZGA 2YJ6A 2V3VA 4H1UA 4DCUA 1XRJA 2CD9A 3NRCA 5IDWA 1ISHA 2Z83A 4IUYA 5AJYA 1P2BA 5IJXA 4BNZA 3BGDA 2GS9A 1LFAA 1SC4A 4MRMA 3BBLA 2P4SA 5CLLA 1PNQA 2BFMA 4MQEB 2WJVA 4MINA 5EJFA 4UBIA 2IWHA 2ATEA 2N3ZA 5HJ5A 1A9RA 2HIHA 3SYNA 4MDEA 5G1OA 1OXUA 1MDFA 1QOPB 1QO9A 2PVCA 2QZJA 1LBHA 1KI9A 3KTAA 1DO8A 1X8LA 3DOFA 4KYVA 4PXYA 4R1SA 3RU7A 3TNLA 4D41A 4UUQA 2GJ9A 3JQ8A 4WCFC 2J59A 4JENA 3ZWWA 3A9SA 3UV3A 3RF6A 5BY2A 2X8JB 5E1OA 4Q9DA 3ADBA 1ZO8A 4R3UC 5FL7A 1XTQA 1RC1A 4EY7A 1T0PA 1E62A 4XD7D 4QUHA 2IYPA 3CW9A 4NEHB 4UBKA 3EOBI 1Z83A 4J76A 5J2TF 4OXYA 3WVNA 4AWXA 1C8KA 2CVFA 3EZNA 2ZJFA 3S5JA 3DWFA 1K6IA 1CY1A 1Z5GA 1U1GA 2DULA 2Q5LA 3KZVA 4HMOA 5DEOA 1P19A 5J3JA 4RSGA 3K30A 4WI1A 1L8OA 2ZJ0A 3VVCA 4PXSA 2VJPA 3FUUA 1IN5A 1F1JA 2JH3A 3E8SA 4X71A 1T6YA 5EJ7A 4QTYA 1LEHA 4M1MA 3PR1A 1TKRA 3R3YA 3GLFA 2OFWA 4GI7A 2BCJQ 4NJEA 3A1UA 4GSKA 3VI4B 4YMIA 5SY6A 1BW9A 1H4TA 1VG0B 4Q1VA 1GJRA 3CZAA 5FFNA 4PBRA 1JHYA 3TIGA 3WLPA 4CU2A 5EESA 1YJQA 1SVOA 2OGWA 4P32A 5FPHA 5AXAA 3U80A 2PMCA 2D0IA 2GEUA 3M6IA 5G4KA 4E5MA 5I7EA 2AH5A 1EVYA 3V8BA 1AKRA 4HGNA 4GPZA 5I7HA 5F2KA 2P9CA 5F9MA 4IOKA 2ZJZA 1IDOA 1X70A 3ZH9B 2QR2A 1W25A 4BFUA 5E6SB 3CZPA 1LUAA 4KKXB 5LP6A 5L6LB 2RGYA 3THWB 3FLEA 2YVUA 2ZAGA 4KSCA 2IOQA 5BW5A 1H9CA 3CBQA 5KX5A 5KYKA 1CHNA 2VHJA 1JQKA 2X0NA 4UFOA 1GTG1 2GCNA 1MJFA 3L82B 3M6FA 3SDSA 1FJ2A 1KI2A 4KFSA 3MWEB 1HFKA 1ZD1A 4R9VA 4REMA 2WP8J 3E5RA 4FNAA 4FR0A 4IGAA 2Q6OA 3KEOA 1SXJD 2I2AA 3N8KA 1T26A 3IBSA 2ORWA 2TMGA 4LJ4A 5IJ9B 3SQWA 1B41A 1J8QA 3FD8A 1TQDA 3GJ4A 2ZE8A 4LMPA 5DMXA 1B26A 4EHDA 4WXEA 5EIWA 3FKSD 1EUCB 2PLFA 4Q1AA 3GVIA 4QGBA 3PJGA 2LCFA 4O2BA 1V25A 5TJHA 4QTUB 1N1GA 1PBTA 2Q28A 2W6OA 2XDQA 1Z13A 2Q7OE 2CJWA 4V38A 3EH2A 4WW0A 2CVHA 1U0SY 1J7JA 3U7JA 3UWSA 2ABWA 3UJPA 3ROPA 4B48A 1RLIA 1WA5A 5FPQA 1O0CA 3LUFA 4FB5A 3KCNA 4KSYA 1OROA 5HF8A 5JJCA 1G5QA 4OYLA 5KYGA 3I9KA 3WDLA 1Z63A 3AFGA 1OAKA 5KTPA 3C45A 3N28A 2H1WA 3D6AA 4DA4A 2ETVA 5A3SA 3UW1A 1KP9A 3FMOB 1ZA2A 2J1LA 4IX9A 1Y3DE 1FTGA 1Z4QA 3PDWA 5IC6A 1AUXA 3FBWA 1K9SA 2O2CA 1VIAA 3U0VA 2GN2A 2QD4A 1NMEA 1KSJA 1Z36A 1Q7BA 1FQKA 4HLNA 4UBMA 2WVAA 1TEZA 2WTEA 5JNTA 2INGX 1OWMA 1Q57A 4L5IA 1CUIA 4M9XA 4NOLA 3E9YA 4BMZA 5IXJA 2XNDD 1TVCA 4MDHA 5KYYA 3EGOA 3WGLA 4B3JA 1XDWA 2FRXA 3H04A 2YFKA 2VHYA 4G8DA 2GYVA 4RKRA 5GV7A 1PJLA 3ASYA 5GTDA 5CU7A 3UT6A 2C4UA 2IUTA 2QTAA 2HCTA 4ATNA 2FDXA 1I3CA 2IYAA 2D7JA 1CYEA 4FMBB 2B61A 1VJ0A 1BYUA 2B4QA 1FDWA 4WBSA 5HMMA 3PRKE 4AY2A 4DANA 5D8DA 4QRHA 2FR1A 1DJMA 5I9BA 2QRHA 5K3FB 1N9GB 2QL5A 1NVKA 3LDAA 1CUJA 2R751 4YACA 4RTPA 1E0AA 1E2HA 3D64A 2CEKA 3OPYI 2QVGA 3E7DA 1KFCB 1THTA 3TNDA 4CM9A 4FDTA 3LWZA 5FD8A 4DF3A 1PO7A 1JLLA 3EPLA 4NJOA 4AJ1A 2J07A 4MROA 1KC1A 2VT3A 3KJEA 1KGDA 2R6CA 4Q4AB 5DGHA 4CT0A 4Q15A 3U1TA 5KZMB 1OAOC 1GPH1 1U2QA 2C04A 2ZRKA 4MMYB 2RGUA 1R9NA 4C4TA 4EKDA 5JVDB 5HKKD 3KLPX 3C6KA 4BVKA 5LOVB 2CNLA 2OUKA 2GH1A 5DU2A 5KNDD 3CVYA 2QVLA 4FJ2A 2VWHA 2XGMA 4JLBA 1UODA 2W90A 2WHPB 1VFNA 4PFQA 5L7YA 1E2BA 2HMWA 2QXUA 3A9WA 3EMBA 2FZGA 3NHKA 4LYAA 4TV8A 4FSHA 1HY3A 5LJIA 1CRWG 1WO8A 1W30A 4QXPA 3JATA 3WL8A 4BJ3A 2IEYA 4PX3A 1ODJA 3RVPA 3WBFA 4LF8B 4V0SA 2D06A 1QZ3A 2BN4A 1MAWA 2W4QA 1LLCA 3PZBA 3SHOA 2ZSUA 2C20A 1ES9A 3RV3A 5LBTA 1NQOA 3EA5A 5DX0A 1TADA 3ORYA 4US0R 4EI2A 3W5AA 1YI8A 5LQKA 3VR5A 4X62B 1UDBA 2D6FA 1NM5C 1JQDA 1Z9BA 4EBBA 3N8IA 3V80A 4D0GA 4QPDA 1HE1C 1W8DA 4IQ0A 3O91A 2YJ4A 4D4HA 1AQLA 1X38A 3KKEA 4KU4A 5FLKA 1YVEI 3GZ4A 1ZGZA 1N5KA 1HO3A 4JGIA 1GT91 3BK7A 1ZZEA 3F4LA 3H8VA 4TSFA 3ZX5A 3EPJA 3VC1A 2BFFA 2OC9A 1NFQA 2BGIA 4KQFA 4YJHA 1DX6A 1GTL1 3IULA 3OE5A 8LDHA 2GPWA 3MTEA 1AURA 2W93A 2WM3A 2QIPA 4KWCA 4MVJD 1G5RA 1G98A 3OLXA 3KQQA 2Q1YA 2WUEA 4KTVE 3A1VA 2M1ZA 2BTOA 3PXEA 3M9LA 3EZLA 3ZV6A 1GAWA 1FU4A 2C7VA 5BSMA 1QANA 4JHXA 4I4LA 5FWNA 5GOTA 3OETA 1L3IA 4RPCA 2D2VA 4BFSA 3NKLA 5DJ5A 1TUBA 3D2LA 3LT2A 4N7MA 3DUFA 1RYMA 1HYHA 2R4UA 4FKBA 5K9ZA 4NZ9A 3GRFA 2FP3A 3L2OB 3NRJA 2KQUA 2ZRQA 3I1JA 3LDUA 4MS3B 4Y2RA 1GZDA 3H5LA 1R7RA 4NFHA 2FSIA 3IQGX 1GPDG 5EHIA 4X1KB 3ZHBA 2Q3EA 1W87A 2CKMA 1ADFA 4CHGA 5L8VA 3O74A 3OZTA 4P4GA 1W5BA 3LHIA 4L7QA 1H2YA 1X1EA 2O05A 1B2RA 3F6RA 1BCRA 1SG9A 3OFND 4LOIA 3ZI0A 4C14A 5EJ5A 1E96A 2ZYAA 1EA5A 1IONA 2BFBB 1W48A 2PX6A 2C5FA 3ABRB 3MHPA 3UJNA 5SZHB 3P32A 1YJAA 3DE7X 3I12A 2G67A 4HI0E 3N5CA 1Z16A 4B5KA 1CT9A 1ZM9A 1SVSA 2BKEA 3PPVA 3BXOA 1FLDA 5ALGA 4MGEA 4OH7A 5GY7A 1W35A 2IUUA 3SS8A 1IY9A 2FAXA 2DKOA 2QD2A 1GPWB 2BMVA 3U16A 1RYEA 4PX5A 1SVWA 1Q2XA 3FOAA 3IX7A 4U63A 1Z0UA 3ND7A 1A9SA 3JWHA 5CNKA 4U2FA 2NZUG 2WKQA 4HY3A 1A8SA 1K8XB 4MUEA 4C76A 1EX1A 4D9NA 4UTPA 3D54D 2F9FA 4ES6A 1DQRA 1QKJA 2IQIA 3AEQB 4K6OA 3Q0TA 4EFMA 4YJ2B 4UTVA 4UCQA 1WB9A 1BS1A 2QZZA 2IH4A 4L5JA 3L0ZA 4BV2A 5G40A 1J23A 3ENQA 5B2ZA 1E2LA 1TQ8A 1W52X 2OCIA 5LU8A 4FQ7A 4G56A 3V1MA 2V9PA 3VR5H 3OIUA 4YRPA 3HACA 3WGTA 1JVBA 2NPIA 4GD3Q 4N3NA 4LHZA 5KNCA 3EQ9A 4IG9A 1JFVA 3LJKA 3NR2A 1XCLA 3DF7A 1NUHA 1P1JA 3Q5DA 3CUKA 1HDGO 1JSLA 3O8OB 3PX7A 4CQNA 3E6AA 3BFKA 1WB6A 2QRKA 5HK9A 1EB8A 3F5MA 1QCCA 2R2GA 4FYXA 3DLPX 2EFEB 2AN3A 4QSMA 5DWVA 1M8JA 1BE1A 3CB4A 3KOXA 2P2NA 4OHVA 2NT3A 4H0FA 3FHOA 3UENA 4W8HA 3MRTA 1I32A 5KJ6A 5AH0A 4EPWA 1PNTA 3NTLA 4HLUC 3VDNB 1YFJA 4Q0MA 3OWHA 2P91A 4NE9A 1QRRA 3KTFA 2PS0A 3IE0A 3ONWA 3ZVLA 3BZBA 4TQUS 4YVFA 5EY5B 4B6QA 5KTTA 2H5LA 1KO8A 2G7ZA 2CXRA 5FTMA 4URUR 5CDFE 4ER6A 2HHJA 1JMVA 3IEXA 3W9YA 1O08A 4HF7A 5BPFA 4ICIA 3LK7A 3RPEA 1MX9A 1Q6ZA 1AB5A 3CR8A 3PHIA 3PC8A 4X1IA 1I9GA 1E32A 4OI4A 4Z3OA 4IWXA 4LHXA 4Z1MA 1G5FA 3NEYA 4CTKA 3A4LA 1XNRB 3CRRA 1R5BA 4DAOA 4YT2A 1ZVQA 1CLUA 9LDBA 1NF8A 1WSBA 3ESBA 5BOSA 2IITA 4LK3A 4LOLA 3LBYA 3GNQA 4DE5A 3HRHA 4TVOA 3AW8A 4XCXA 1F4LA 1BQ3A 3BMCA 3QQ5A 2R8RA 2MSNA 1NJ1A 4O2LA 1V41E 2C5AA 2QN9A 2YRWA 1E3QA 5E1BA 4N76A 2J0QA 1JS1X 1T3GA 3TDKA 4U1RA 3QITA 1EK6A 3DDZX 2UYYA 4HAVA 3NZEA 1PWYE 3Q8XB 1KRHA 3WGMA 4GRDA 1Q2UA 4EZBA 3SXUA 3TFQA 5HGXA 4YRKA 4MUYA 2QAIA 1GUFA 4HFRA 4N3BA 1E79A 1EXNA 2ZYIA 1UBHS 3JASB 1DT3A 3OAAD 1UDXA 3W5IA 4OMUA 3WDSA 1L3CA 4ZZ2A 2XMCA 3RVLA 4DLAA 4N6NA 4EENA 5HUHA 1RKXA 3EXEA 3B7GA 4EPXA 1RFGE 1Z47A 2QRPA 3UXYA 5T4FA 1BE0A 4F2DA 3V3KA 2CFIA 3NWJA 1ICEA 4HLQB 1O1YA 5EQTA 3TYXA 3M3HA 4N49A 3CC8A 1XAJA 5FNZA 3M3DA 2O3UA 5B1HA 4HNAA 3E70C 5BWCA 3UANA 2X6TA 2WPNA 4ZA2A 4DNQA 10MHA 5CCEA 3ZDCA 3CKLA 4RY0A 4CMGA 1W0CA 4EATA 2HFJA 1ZD4A 4V02A 1L7QA 4HYQA 1B73A 1D03A 2A33A 2AHRA 4KVZA 1MAUA 1QJ4A 1SBTA 4LMRA 5AOVA 3RVBA 2P2GA 1L4FA 3T1NA 1YRYE 3QXJA 2HYIC 2XSZA 1XN1A 4IMIB 3I76A 4REOA 3OVMA 2HMAA 5C8XA 1T36A 3GLHA 5DTJA 4BZXA 3SBOA 5B1IA 4HSGA 1CRPA 3EGCA 1QNFA 1CY0A 1DVRA 1TCAA 1NL3A 2V7VA 4E46A 5KOJB 4R05A 4YP1A 2FWIA 1VHQA 2GZMA 3T9CA 4P92A 1YU9A 3AKZA 1T25A 5L3RA 1B0PA 3D8HA 2Y4NA 2WR8A 3OZBA 4ND7A 1U1EA 2WWGA 1I94B 2H11A 2YN2A 1DWPA 2UV8A 3O2QB 1DUIA 2PRKA 4MHSA 1V7PC 1AGRA 5HXAA 2JRCA 5FORA 5JAPA 3CFYA 3KYDB 1WX1A 3IIKA 3O9MA 1Y7LA 4HAIA 1AG9A 2GRJA 1YE8A 1O87A 2C9ZA 1W0JD 2R85A 3OLQA 1N0VC 4PTZA 1HDCA 4LXQA 1ONNA 3G1TA 3W78A 2MR5A 1E5LA 1K0UA 5LDGA 2X3FA 4GPBA 4R6WA 1PR3A 4OY3A 4LGVA 5LBIA 2C4TA 3NEPX 1PLKA 4IGIA 4L0CA 1AHPA 2BJWA 1L5FA 1Z0IA 3O3CA 4QVGA 3TTSA 4OP2A 3QWHA 4PC7A 4YP7A 1TMYA 2BHRA 3RYHB 5MGNA 2XRFA 5HP4A 1Q3TA 2JBAA 2G5TA 2NV6A 1U3VA 1RABA 1F9EA 1Z29A 2O3QA 3OE7A 4PZLA 2Z4TA 2JBHA 5EVCA 2NACA 3SYMA 4EM6A 1LBTA 5HRAA 1P9NA 4O2AF 3IPLA 4EB6B 4GEKA 2R6R1 3GGCA 1QRAA 4C0BA 1KAOA 1L4BA 2VTKA 2OHJA 1SAYA 1QAOA 2A0YA 4GECA 4Y1RA 1L5SA 4FYJA 5AJHA 1ZM7A 5KWIA 3PTAA 1BS9A 1HH4A 3K96A 3RIGA 2CVPA 3OJEA 4JLAA 5FPYA 1V16A 4QJ4A 1DC5A 1Z4JA 3Q72A 2ZJ3A 1HNNA 2XEXA 1E2QA 2JK0A 4LMBA 2JEOA 2AMVA 4A15A 1PZXA 1VL0A 2XUKA 4U6NA 4XRRA 3VU3A 4D4GA 5IK2D 3QUSA 2GPTA 1FTSA 2FX3A 3GROA 3RSZA 1N3BA 1XO1A 2EIXA 2BMAA 4HFJA 2E4WA 4J03A 4LC0A 2O5CA 4XPIB 3VAYA 1OHHA 1H94A 1QBKC 1N2JA 2DKFA 1GGEA 3KPUA 4UNRA 1YR8A 3NETA 2PK3A 2ZIVB 3NPAA 2VBCA 4LJRA 4RSRA 1KI8A 4JL8A 4IFEA 2Q5IA 4WBNF 2YJZA 3A70A 4UDOA 4A1OA 1DI0A 2XDAA 5LCXA 5HKBA 1V8DA 3AF1A 4J0IA 3GXBA 5KSWB 4D8YA 2GQ0A 4G4GA 3CZQA 2VBFA 2PIAA 1TF2A 4C6RA 5K09A 3FOEC 2E4YA 4XGRA 1XVLA 2G6TA 1RQ7A 1N2CA 4G09A 2F17A 3A27A 5ANRB 3SQDA 3KWMA 3ZTWA 3L7JA 3ONNA 4D9IA 4RHYA 4AO6A 3CNHA 3GEHA 3E9EA 1A2KC 1FFAA 4I66A 1YR1A 4R9SA 5JZBA 4W82A 1F5SA 2QV0A 5C1IA 3AKYA 3A6PC 4ESOA 4WOBA 1HEIA 1UKVY 2I8CA 2V9CA 5FX2A 5E3HA 1RM3A 1TF7A 1T4CB 4O4HA 1T2VA 4OQMA 3OJWA 4FUQA 1KDYA 3SMQA 3T3IA 2Z95A 3GJRA 5CW1A 2Q2QA 3IQZA 4UM9B 4LJ8A 1Q0HA 2M6SA 2V6FA 4ZYUA 1UMBA 2O2ZA 2RAVA 5DNUA 1NXOA 2UVQA 4RIEA 4RF5A 2X8LA 3ZOKA 3WO1A 4UFPA 1YONA 2JLBA 4M8KA 4F5YA 1KI1A 2H0QA 2EKLA 5J4YA 1Z8DA 1MB0A 3OIDA 3D43A 5TMDA 2ZQ5A 1U99A 2DSTA 1HOTA 1F12A 1RQRA 1T8UA 1X7WA 3V8QA 3ZWAA 5J47A 1ZOPA 2IHYA 2R00A 4EYSA 3AUXA 3V8PA 4LF7B 2OD2A 4P7GA 4TQAA 2ZZKA 2WWYA 4E4TA 4M0LA 4BV8A 1FDTA 4M8IA 1U0TA 3RBVA 3P9PA 3OUUA 4MVJE 4NIMA 4FI3C 4XVRA 2AS0A 1P0IA 3VSEA 2VHWA 1WZNA 3GUCA 4C30A 1JKFA 2PH3A 2JVIA 2ZU6A 2H3HA 5IC4A 1B6RA 1TRHA 2W6PA 1OXBB 2H1LA 2AMFA 3IOMA 4C4AA 1J4AA 3N2GB 1BMDA 3A4NA 3NHZA 3VTKA 1DU4A 2GF9A 1P2SA 2HH9A 1S7GA 2D74A 3B8HA 3H11B 4PCUA 1TU4A 4AVYA 3T3NA 1F60A 1MBZA 1FFEA 3ETEA 1KQGA 4R54A 1JA1A 2W42A 2GO7A 5C8YA 1UBLS 1Y4AE 4IQ8A 4DJAA 3PGVA 1PNRA 3BJIC 4AF6A 2NX2A 1MHPA 4WEQA 5AICA 3IEUA 1QYIA 1C8BA 1XK6A 2DY0A 2H4HA 2V7EA 2I54A 4FLFA 2FN3A 4FDVA 4FEYA 3R2JA 4TMKA 4B6FA 1R9MA 3VR4A 2CNWD 2VF4X 2NSJA 2CLFB 4R6XA 4ZO8A 4E1AA 2J45A 1ID1A 4QDTA 3GZJA 3KOWA 4Q4CA 2HFKA 2OO5C 1M1YA 4QOHA 3SQOA 4H16A 4ZK2A 1EXMA 5TGDA 1N2IA 4RC9A 1WXHA 1HMPA 4ZAYA 3FVTA 3W0LB 1GARA 1X1CA 4NHOA 4QBKA 4F45A 3OLYA 5CFLA 5JANA 1JEQA 1RDFA 4Q5IA 1JKJB 1UC5B 2HX1A 4PFKA 2VAXA 3CR3C 1SUPA 3DAYA 3KKPA 1XWIA 2NM0A 3IOYA 4JBWA 3A04A 3RRJA 3UAGA 3V33A 1ULSA 4CM3A 4YDQA 3DVRX 2XKJE 2QMYA 4F06A 3NV9A 4JLPA 4A5SA 2XMQA 1RJWA 2AI3A 4I9FA 1DPGA 4GMGA 1SIOA 3IB6A 1A9YA 4YCBA 4IJMA 3BORA 4GXQA 5IT5A 5D5QA 1CDDA 4Z7QB 2RC6A 3NWPA 2JHFA 1NVFA 3F71A 2EQ5A 4MP3A 3WSWA 1EZZA 1EX6A 2HT6A 4L50A 3SWWA 4KQ6A 3C7TA 4IVPA 3LV8A 4E3WA 2O1WA 4RY2A 1WP4A 1Z3IX 4BLQA 3DZIA 4FFVA 1Y0BA 4RABA 4UFNA 3OX4A 2QTHA 1RJFA 2QG9A 2P7HA 1JJFA 3FWKA 3TEJA 2G8NA 1JJ7A 4DUGD 4BLTA 1SGWA 4LCJA 2X6RA 2X0RA 1K2WA 1NN0A 1EQUA 2AUNA 3IAEA 4GVPA 1R8JA 3K4PA 2WZCA 2E1RA 1U2TA 5H83A 1GYPA 1E5DA 1CSEE 3YASA 3QYAA 1M66A 4B8YA 1GG8A 4M87A 4J4HA 4MQUA 2J3IA 1KWGA 4CEHB 1QX3A 3Q85A 3EMKA 3UMGA 2GKOA 2E4XA 3FNHA 1T5SA 1KHHA 1XD2B 4TX1A 3NC0C 3OT5A 3MUOA 2RB5A 1NWHA 4ZYVA 3Q87B 3I1IA 5JBIA 4HEQA 4CDMA 4DIKA 5EP4A 2R3SA 1MT0A 3LL7A 1Z5UA 3IAFA 4KYIB 1PQUA 1W2GA 1ZGHA 4QWWA 2ZS8A 3EVNA 1H2RS 4KJZA 4Y6QA 2IW3A 4Z9XA 2YXDA 1VZ2A 3HZHA 4J8PA 4F12A 2IH2A 3UMCA 1NXVA 3QI2A 1BXKA 1UAYA 5CIYA 2WSSD 3H5AA 3JQQA 1X14A 3ICWA 4ZN6A 2NSYA 1E8NA 3AB3A 4C78A 1J2UA 1R16A 3RTBA 1RJ9B 3EQ6A 2AFHB 5DYIA 3TQSA 4D0RA 3VR4H 1QUFA 3RC2A 4LC9A 4TMTA 4CL8A 3D7MA 2BFDB 3GFQA 4ACAA 2JW5A 4DGQA 2QL6A 3PC6A 4LRSB 3R0QA 4OGWA 4RTKA 3U61B 3GFSA 1VRCA 1U7WA 3EBOA 4FHDA 1CHDA 1LCIA 4G4SO 3STTA 1MO5A 1K5PA 4O4IA 1KWKA 1FA9A 1RWPA 3NH6A 1DRWA 2YMQA 3OZDA 3NAGA 3RSSA 3DO6A 4C4ZA 3OQNA 1NVMB 3PJFA 4RYDA 2CE7A 2FRDC 2WA2A 3WGYA 1ZGCA 2VSOA 4W1QA 3VR0A 4EMSA 4AZ0A 2G72A 5IKEA 3VO8A 1TQ4A 3L8YA 1YT5A 2JGAA 2OT3B 1ORVA 1R15A 1XTUA 2JAUA 1FFDA 4M46A 5T3UA 3A6JA 1OAAA 4J1TA 4ZI5A 2BRUC 2ZUVA 4GKKB 2A3NA 1T1SA 2FMKA 2GN0A 1ENYA 2Y1LA 3OKAA 5H02A 1RHQA 1IB6A 1MKYA 4RD3A 2GPSA 1BN6A 4KSBA 5DKFA 3UWKA 4EL5A 1MEOA 1YOVA 3F3YA 4YCCA 3P19A 4FFDA 1QS0B 2JH9A 2SNIE 2W8BB 3CTPA 1E2EA 1TU0A 2F1IA 4J0DA 2GPBA 1WXDA 3W2HA 5EKDA 3E0QA 2C9CA 1HE8B 2NZJA 1E18A 2WLTA 1QFSA 5B1DA 4RSHA 4J29A 4FI3F 3A2LA 5BQ3A 3TB6A 2IZ1A 1NBWB 4E5PA 4F71A 4YAGA 3R5SA 1D9ZA 1QKIA 1JU3A 1G60A 1ZAKA 2IRWA 1U3TA 3AQIA 2BVNA 3BE8A 3GY0A 4IFIA 4U00A 3D59A 1PWZA 3RU9A 3NTOA 3RHSA 1CDEA 5H59A 2O19A 3E3OA 4EY3A 3HR4A 2ZM6B 2BI7A 2JD2A 3AZOA 2ONCA 1AGXA 3SLRA 3WIEA 1ZS9A 2XB6A 4LJ5A 4ZVVA 3HY6A 4GIBA 4PX9A 3I45A 4PANA 4ZK6A 4UVGA 1NW5A 1ZIPA 2B8NA 4WFKA 4Z9FA 2IFTA 4FZJA 3AC0A 3SYTA 1E63A 3LA6A 2IV3A 2CV2A 1M54A 4BIIA 1FYWA 5CB0A 1JTVA 1WW8A 3EF3A 3EZ7A 3WXMA 3P94A 1ADCA 1HYQA 3CM0A 1UXIA 5H80A 1OIXA 6ADHA 3I4FA 2DJIA 3OUZA 3TEMA 1WD7A 1G66A 2H08A 3AJ8A 3HDHA 4KIUA 4AXBA 4EGFA 1HTWA 2PGLA 4OLJA 4PLPA 3UPDA 1U0EA 1B4DA 2NZ2A 2IK8A 5DGDA 1V45E 2O1EA 1SKMA 2V6GA 1JLRA 1X1BA 2PD3A 3NLLA 5L45A 1ENPA 1D4OA 2FMTA 3O1JC 1ESZA 1P4RA 3ZD9A 1QIDA 3VOTA 4WBXC 4AC9A 4F8EA 9GPBA 1S1MA 3VHQA 4LRUA 5LU9A 2PUEA 2QAGA 2XV1A 4KWIA 4AN4A 2X2OA 2X23A 3TRKA 1TT5A 3HB1A 3OPNA 5CYPA 5A4MS 5ED0A 1QHFA 1RJGA 2RFLA 3KAJA 1QAMA 1SEVA 2Z4SA 4FMDB 4K1XA 3A3KA 2Z8XA 3WLQA 1WVMA 1SUSA 4MYRA 1NTOA 4ESHA 1PVDA 4KXVA 2NYVA 1EVZA 3ZKWB 3UTCA 4BX0A 2FSPA 3FWNA 4AQ7A 4B3BA 3N2KA 1XZHA 4RPIA 2C2OA 2ZLBA 1HT1E 1W44A 1O97C 1KJQA 1XFAA 2COEA 2VTBA 3HJRA 2VLIA 3WIVA 4RMHA 5AOCA 5DHAA 5FUWA 5JJLA 4KK4A 3HUEA 8AT1A 3JQFA 5DXAA 2Q9CA 2HA6A 4H6PA 4RH1A 2OVFA 3PPYA 5AXDA 3ZY2A 1EM8B 1EFDN 1U6IA 1UPUA 1ODSA 2EEPA 4ZZIA 2ZRJA 1W7AA 2XAUA 1VGRA 3H83A 4U7PB 4W9NA 4EDHA 2QNRA 2PHZA 4P9NA 3TTWA 2AK2A 2OLEA 3C39A 3HWRA 4X1YB 3UK1A 1I0LA 3ZE8A 3TRHA 2X2FA 4EF6A 2C7PA 2CBZA 5DIZA 3E05A 1UZNA 2BFPA 1O77A 1WTAA 1CZRA 1J9GA 3LUGA 1KQFA 3I61A 4LFBB 2EP8A 2GJ4A 3FOBA 3PCRB 3E22B 1J7KA 5B6PA 5T5QA 2ZXEA 1J20A 5JI3E 3DE2X 1JYEA 2YS7A 1XNQB 5JQWA 1TI7A 4X6UA 1IB0A 2Q5JA 3LECA 2ZFUA 2ZJAA 3JX9A 4ZC8A 3FCUB 2Z6AA 4ENRA 4LJKA 4ERXA 4URHA 2OGSA 5JAQA 3ZI4A 2I71A 2YY7A 3EBLA 2BF4A 1HE4A 3PX3A 4GW3A 3QVGB 1W4AA 3CUSA 4G0OA 4L0DA 1Z0ZA 4HDMA 1KK2A 2VTEA 1K66A 3KELA 2Q9AA 3D1VA 2KE5A 4INJA 5HA5A 3G2PA 5H8WA 5D1HA 3R9XB 3F74A 3B60A 3ZNNA 3BDAA 7MDHA 2O7QA 2DUMA 5DCLA 1Y7TA 3FFTA 2KW5A 4GGOA 4ERNA 5AW0A 2XB9A 3O9VA 2WHEA 2J0VA 1EINA 1GCUA 3MMPA 1IIRA 5DASA 3PNSA 1K68A 2Y0BA 3LCUA 3WZLA 4MEJA 2ZIGA 3M9XA 5CYGA 1TC2A 3TOZA 1KEEB 4RLSA 2JFVA 3PV0A 5EN4A 1F3LA 2Q2VA 3TCKA 2EERA 3FRJA 1R9JA 2AC2A 4MS4B 3D3QA 4LE2A 1WF6A 4LTMA 3G9QA 4MDYA 3O0DA 2V54A 4PNPA 5DTMA 4ZTBA 3HNPA 3OE1A 4NCBA 1L4LA 2AEEA 1FYVA 2H51A 2LBPA 3ITDA 5CNMA 5JCOC 1H3EA 1SB9A 3A1CA 3G82C 1PG0A 2C5HA 3PWSA 4PGFA 3ZE9A 3WYGA 5JS1A 2JIRA 2X5XA 1JDJA 2H31A 4CIWA 2RH8A 5HW0A 5KVCA 1PGOA 2QT9A 2PS1A 2YVAA 3RLIA 4RLQA 4ZVRA 3A3NA 3HRIA 3INRA 2VTVA 3LQYA 2J9RA 3QRWA 4MW4A 2RJNA 3HP4A 3IFSA 2JGKA 3SXJA 4AMGA 4HNUA 1LDYA 3PF9A 1ZD2P 1G1AA 4YCLA 3PK0A 1DOAA 1TTPB 4XR4A 2VDPB 4Y9SA 3UJ8A 4MRAA 3HE3A 1OWPA 3NORA 3FY4A 4UZFA 2BEKA 2FSGA 3I73A 1NLZA 4G9BA 1R37A 4GWKA 4O33A 3RIEA 3PUHA 5CVEA 1NQUA 9LDTA 1MXFA 2VPTA 5I9IA 2OCKA 8ATCA 1IWBB 2W6ID 3WLHA 3Q9SA 4DN6A 1X74A 4TS1A 4EKIA 4F3RA 2IYZA 3MWYW 4U3JA 2VPIA 3RFUA 2JJ2D 4TXHA 3LWBA 3SSAA 1ND6A 2W11A 2I2WA 4OBWA 3ISTA 2IKSA 3B89A 2JGRA 1YTLA 1G42A 3R75A 2QMHA 2ODEA 4G07A 4XE5A 4G4SP 4CE6A 1LJ8A 2BEUA 2EWWA 4MKHA 4M6WB 3HNOA 3AFIA 2OY0A 1INLA 1DJPA 1HDZA 3GT3A 3HVUA 1J0AA 2EFDB 3U62A 2B1GA 1R50A 2Q5HA 4XJSA 5JSFA 3JZFA 2Y27A 3GHYA 3OI7A 1P1BA 1KFKB 3EA4A 1FRFS 1WAMA 5BYJA 3UAZA 1GL7A 1C7JA 1YB4A 1YJCA 3GJ3A 3MT0A 3L46A 1TRKA 1QOQB 2WZBA 1T15A 1JEYA 2Z8ZA 5E8JA 3LDHA 2JFPA 1WMSA 1S9DA 2HMVA 2IIQA 2JAWA 1E6UA 3G0BA 4X00A 2HU2A 5L53A 1ZESA 2QQGA 1G8SA 2V0NA 2BHTA 3EULA 3OJCA 5JVDF 5LOVF 2EEZA 4I9HA 1RKBA 5COBA 5LZ5A 3OD1A 1ZI6A 1U9IA 4MCIA 4KQKA 4IEIA 3KKQA 2GMWA 2HNBA 3EEFA 4WADA 2ENWA 5K3BA 5TQ0A 1IEQA 1TZCA 1NZDA 3U4DA 1PFUA 1ACJA 2HA7A 5TSDA 4CMHA 5JQGA 5IKXA 3WP1B 1AF7A 3F3MA 2H1RA 1WDLA 2KWIA 2YX1A 2F8SA 3UGKA 1TUGA 4E2WA 3FUTA 3A9CA 3GUYA 2GFIA 1FJGB 3R44A 2C03A 3P96A 2J4CA 1E2JA 4NMWA 4RV5A 2ZUUA 5ALZA 3H19A 4MVYA 1N2GA 2CLCX 4Y6RA 4POOA 1AKTA 2HADA 2EZ4A 3BEDA 2YVLA 3L4BC 4KMRA