3HCNA

Hg and protoporphyrin bound human ferrochelatase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title Product release rather than chelation determines metal specificity for ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 134
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcnA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcnA01
2Q2OA 2HK6A 4KLCA 2DJ5A 1N0IA 3HCNA 1DOZA 1C1HA 2XVZA 2Q3JA 1L8XA 2XWSA 2PO7A 2QD4A 2XWQA 4KLRA 4MK4A 2QD2A 1C9EA 2PO5A 2H1VA 4F4DA 1LBQA 1HRKA 1LD3A 2XVXA 3W1WA 1AK1A 4CCSA 3M4ZA 4KMMA 2HRCA 2QD3A 4KLAA 2AC4A 2Q2NA 3HCPA 2H1WA 2XWPA 2C8JA 3HCRA 2QD1A 3AQIA 1QGOA 2AC2A 2HREA 2XVYA 2QD5A 2JH3A 2PNJA 1TJNA 3LYHA 3HCOA 3GOQA
chains in the Genus database with same CATH superfamily
1M5RA 3BHMA 3WL5A 3TNDA 2WAAA 4KO8A 5FKJA 3TBKA 2IV7A 4ACAA 4PZUA 1XK7A 1WVIA 2WY2D 3WA7A 2GN8A 4XD7A 1K2VN 1ORIA 2O7NA 3CG4A 4WZBE 4EHAA 1WO8A 3PHIA 1C8LA 3ZDEA 1TTQB 4R1TA 5K4AA 3I1IA 2G83A 2VZEA 3FOCA 3RJ5A 2HLNA 2NVWA 4IILA 3TQIA 2A2ZA 5KQSA 4FKMA 1NI4A 4YUWA 3QE3A 1N2CA 4NMLA 3BXHA 4DMMA 1X92A 3TD6A 4WK2B 3HRHA 3PTLA 1HE8B 1B3RA 2PUCA 1GT6A 3WB0A 3RRMA 4D9NA 8AT1A 1RTTA 4KQFA 3HJGA 3PD1A 5AKHA 3C7KA 4MPTA 1V3VA 2H06A 5BOSB 2QOEA 3MC1A 1HFJA 4J7AA 5FNVB 4WOCA 1OYWA 1VBFA 2C5HA 2ZITA 3QF4A 2NIPA 3LGXA 3EIEA 5T57A 1UDBA 4RDCA 4N5MA 4ES6A 1DXHA 1ZHFA 1UPCA 3B85A 3D0OA 1YL5A 4NBWA 5EN4A 1PG0A 4ZO7A 1L3BA 2R11A 1GTRA 1RZRA 3CWQA 3GGJA 4B0PA 2AJ8A 5JISA 3RW9A 2AQ8A 3GROA 1WCV1 5DM70 5C5CA 4ESHA 4INPA 3IAAA 4MWGA 2Z6AA 1W19A 1LQ2A 2G0NA 3RS8A 2B2NA 3OUTA 1T1JA 3K0FA 4FDVA 4XQGA 5BMVA 4UREA 2R00C 3O8DA 1DQSA 3WGGA 2DPMA 4B4KA 4DM4A 2HADA 2ID8A 1CR0A 3S2SA 3W2HA 3BRCA 4JOSA 2R8XA 2O2EA 7REQB 4C43A 1GRVA 1Q0HA 1BYUA 3RK4A 2GK7A 1L0BA 4C2AA 3ZDAA 4I5GA 2JHGA 2EBFX 2PZEA 3CX4A 3B82A 3FNIA 1BE1A 4JHXA 4OK6A 3L0PA 3CLHA 1KFBB 1NIPA 4TKZA 4AUKA 1VG1A 3T0FA 1U3UA 2ORWA 4MW4A 4EKDA 3RUHA 1W46A 2O4UX 3TM4A 2VDOB 3E0QA 1IAQA 2FW8A 2FLVA 1MC5A 5ALRA 1AUQA 1Y5NA 3ILXA 5D5PA 5IXSA 3NBZC 2CXSA 2R44A 4EFDA 2XB8A 4W6ZA 2UXDB 1NMQA 2V97A 3SZUA 2VPXA 4H1HA 5ALDA 3MRSA 1E9EA 1TNDA 4QOFA 3WV5A 1GSOA 4Q0MA 1NF2A 1MRSA 2XVZA 1C3OB 4YP0A 1SUPA 5DGDA 4DA7A 1ESNA 1E4EB 3OAAA 1X7DA 1NN5A 4XGQA 1THMA 3CXRA 3V8VA 3RRZA 5HIKA 4JDPA 1E2MA 1EGHA 2XVMA 1L7XA 2HN9A 1U7DA 3VFDA 3K0EA 5KTMA 5DHPA 4HMQA 5AHKA 3OPYB 2VHQA 2X0JA 2ZRKA 4LJSA 1JAZA 4MDYA 1TZJA 2CHGA 2X6QA 1PWZA 4MPJA 3AVTA 1G21E 1Q11A 1UAYA 2VZ8A 4UTXA 4AURA 4WZAE 1KQFA 3SQDA 3EGEA 3ZWNA 4FSXA 4IEIA 1KSHA 4OJMX 1KEUA 5JVDF 5AW6A 4BWVA 1QK3A 3AESA 3L41A 1CQPA 2YBDA 3DTYA 1NMEA 2ERYA 4QULA 4ITRC 4D74A 1WPQA 3QVWA 4NG5A 3M6FA 3TZLA 3NASA 1ZD9A 4TQ9A 5BV8A 5IXJA 2YWXA 1U28A 1IBCA 4ARVA 2IY8A 2IBMA 3SSMA 3OPQA 4Q1AA 1OSNA 1BJRE 1KRHA 2WP8J 3KQYA 1M2KA 2JB9A 2BUBA 1A5ZA 3GMSA 4QOJA 4XPIA 3I5XA 1B8VA 4BVHA 4U7JA 3NGMA 3IAHA 4KXVA 1TTTA 3K20A 4OHOA 4E5KA 4KXLA 1EFPB 2EERA 3FGPA 2BP7B 4QAQA 4CTJA 4D4GA 1JALA 2PRJA 1KQGA 1IHUA 5JHGB 3AFOA 3PWZA 3Q9LA 4R84A 2FX2A 4Y6LA 3TKYA 1IXYA 2P11A 4BVBA 2GZHA 3EW9A 4IJKA 2C7PA 3FUWA 4AZ0B 3CX3A 3OZIA 4N6GA 3GGPA 3QM1A 1TUBA 5LZ9A 3KXKA 3DMHA 4PGFA 3U9LA 3ZWOA 1X8KA 3TSCA 4CF5A 4YR9A 1IHXA 2HHAA 3N0VA 4YFVA 1UF9A 2QXYA 4B1FA 3V4OA 3TLBA 1VCMA 2EFDB 2H1LA 4XVUA 4HR7A 1K3UB 4FFWA 4OXIA 4L9RA 1FDTA 2UZ1B 4J3NA 1NR7A 3IQGX 4UUNA 4X1KA 5EMHA 2A1UA 2HF9A 3HGTA 4X00A 1ND5A 1NASA 1GAEO 5BW8A 3FKSD 1ISRA 3KXIA 3GVIA 4YV2A 3AI7A 1W2WB 1NSFA 2J0VA 1AX9A 1V47A 3MINB 4P5DA 2YVUA 5DNCA 1Z34A 3GUVA 2C9BA 2H85A 3ZC3A 1WOYA 2PH5A 4EELA 4U2BA 4RVOA 5LXTF 4F6RB 5FO1A 3Q7EA 4KFRA 4P7FA 2H16A 3H5RA 4TRMA 1MW9X 4B9AA 1M8GA 1XNHA 1LZKA 3PNLA 4G81A 1RDFA 2E3JA 1RYDA 2VJQA 3EEQA 3QZUA 4N3BA 3U62A 4WVFA 1VI2A 4XTRA 1ODJA 2ZSKA 4POAA 4RV4A 3ZIDA 3USES 4X62B 5BWBA 4JIMA 2VSYA 2PJZA 4RIFA 4Q9IA 2GO1A 3PGJA 3IKLA 2F90A 4S1NA 4BO1A 2JRLA 1V41E 5JNUA 2FP4A 1KEVA 3UB3A 5AQEA 2P6UA 3K8ZA 1X80A 5EZYA 2H59A 1EDEA 3V2IA 3GPDG 4OJNA 2Y1OA 1NOJA 4LY9A 3GARA 3VNVA 1KY5A 1L8XA 3B5IA 2XCRB 3A6EA 3K6JA 1NG9A 3ILHA 4P84A 1E2DA 1Z25A 5K3BA 2J9FA 4ZV7A 4WLNA 2V6JA 4CEIA 5I8ZA 1IVSA 2QD3A 3Q10A 1OROA 3GJYA 1V16A 2P5YA 3SKVA 3U3ZA 1YIAA 3LWDA 4XM1A 3WKDA 3UUWA 1ZAKA 1CFJA 1NAIA 2ZAYA 2C3YA 1WKCA 3LWBA 4PR0A 1YZ3A 3AKZA 3QE9Y 2LPMA 4YRPA 4YBRA 4NU5A 4I4NA 4XIFA 4CKEB 2W8BA 2AEMA 3RS2A 3R5FA 4RTNA 4IRUB 1NW4A 1XDZA 2JATA 3IQWA 4N5NA 4Z49A 1JXMA 3OZRA 1EUCA 3NAGA 3ILYA 2XDWA 1SUDA 2HSEA 1CHNA 1OXVA 2J31A 2V9ZA 3QUSA 3V3TA 4HZGA 3UKDA 3KU4A 1G21A 2VEOA 1F2DA 4L6AA 2JLQA 4R8LA 1SVOA 1OFUA 4E7PA 1Y4DE 3L6EA 4KWTA 4QX6A 3LBAA 2XDQB 1D7OA 4IX9A 2E7ZA 4HDQB 1XL1A 4HFMA 5GV7A 5AVRA 2HPVA 3U09A 1E96A 2W6OA 3CRQA 3P2MA 5BR8B 1WHTB 3MIIA 4HX5A 3MWEA 3JQPA 1HLDA 1HC7A 5CEJA 2A0YA 1PZFA 2P4QA 4GLFA 4UATA 5DV9A 3TRJA 3U44B 4LSWA 4TKLA 3E84A 4WINA 4XJXA 2BGUA 4GI5A 1NW8A 2OHGA 1DHRA 2IHJA 3HG7A 2QXUA 1O5OA 4HWKA 4EARA 4UBOA 2JK1A 2R1VB 2VJNA 2W6ZA 3L79A 3REOA 3ZI7A 3TB6A 2ZSBA 2WFZA 1JAYA 2QUHA 3O94A 4W5RA 3H11A 4RMIA 3DLBA 1W76A 3PCRB 4RV5A 5AK3A 4AN0A 4LKOA 4U9HS 4R71A 2VHCA 4QUDA 3SBDA 3PFFA 2AR7A 3AHIA 2NQ8A 1XT6A 4IDNA 4ZK6A 2AXQA 3VOBA 2O1XA 3I0MA 4KE7A 4PHGA 1UKYA 2ZPUA 4X6YA 4FFBA 2ZM6B 2R8YA 3FTPA 1JG6A 1N33B 2P4EA 3CA8A 3FFXA 4UM7A 3X2EA 1QP7A 5FBKA 3IUMA 2JFFA 4K26A 3NBUA 3RRNA 1F4LA 1E77A 2XD9A 4K3UA 1FB5A 3EA5A 1M67A 3ZU2A 3RNOA 1L3IA 5FUWA 3GFRA 1UJCA 1VSUA 1D8AA 1TLLA 1CUGA 2ZJ3A 4YCNA 3FHTA 4IMPA 2BFCA 5B2EA 2CVFA 3ZE6A 2Q6TA 3FD8A 2IUEA 4JA0A 2VVTA 4OAOA 5D01A 5LYJA 3IP9A 3G2QA 4G2NA 3GD7A 1TO6A 4BUJA 4PZZA 4G1VA 5BSVA 3K71B 3HPQA 3RS3A 2BR3A 4H3HB 1TMOA 2ATVA 2ERCA 3BMOA 2RHGB 1Z2OX 2W5UA 3FJYA 1JDZA 3M4YA 3MAGA 1D3AA 4TV9B 5BP7A 3QFHA 2QQ5A 1VLLA 2GM5A 2HV9A 3EFEA 2EC5A 4RHXA 3PQDA 3SSOA 1JDBC 3RAFC 3C3PA 4R9NA 2O0HA 4EAQA 1Y6FA 3IEMA 5CYPA 4A2WA 3CX8A 5JH7B 4PYRA 4B80A 4KITB 1P1JA 1LI5A 2LIPA 1DWOA 4FOLA 4X20A 4YH1A 4C78A 4C7OA 1F3OA 1E2BA 1ZH6A 1J8FA 3BWDD 4K8OA 4CCYB 5LKRA 5M29A 1T0JB 1MVOA 1G5RA 3QI7A 3EN0A 4RHEA 3ECSA 4H7DA 3DW1X 4HJRA 4U6NA 1TIPA 4UMDA 2O2XA 4WXRA 3FMPB 4C4YA 2R87A 3SX2A 1C4WA 2IRWA 1ADGA 1R3DA 3DV0B 4JBNA 3U26A 3X1WA 1UP4A 2JASA 1SVLA 1PTKA 2C5GA 2J6CA 2H2WA 4OXNA 1OU0A 4BJHB 2Q50A 3M3DA 1M6VA 3VR3A 1SXIA 5K2MA 2BLLA 4FFNA 4MKXA 4A91A 1TT5A 1XNQB 4G1MB 1PJQA 3KQPA 4ALIA 1GQ2A 3B1FA 2DPXA 5CGQB 4F45A 4J43A 2VHYA 3SLKA 2PMKA 2A5LA 1Q12A 1U90A 1ADFA 1E66A 4YLGA 5AOAA 4TZKA 5EP2A 2QTVA 4EMUA 4D6XA 2AX3A 3O2QB 5J3JA 2GERA 2GETA 3V1TC 3AFNA 3H05A 1OI4A 2GBFA 1Q22A 4Y9DA 2G0AA 3AM4A 3PEFA 3A1SA 1O4WA 5KNDD 5H8WA 1EP9A 3QBJA 1K08A 2XZOA 4E31A 3THYB 1GA4A 1Y8CA 3G23A 3H1PA 5D85A 4BO6A 4EHFA 3H4TA 4ZQEA 1VL5A 1XRMA 4NJEB 2X4GA 5AJWA 2VWHA 2V3CC 1UWKA 3CN7A 4GOLD 4KJXA 2VJPA 1IN6A 2PS0A 3NH6A 4X63A 2AUNA 1N5OX 1XJQA 5CK5A 3DEJA 3TINA 2ZCJA 4HWTA 1B0PA 4WDQA 3SN6A 3K05A 3WWOA 4DG8A 4YAKA 2BFBB 5IM4F 2JA2A 2KE5A 3ZNQA 4F3KA 7MDHA 3PPXA 5B1EA 1BVUA 3PQ5A 1JHDA 1QLJA 1QYDA 1TCVA 2W98A 4INJA 4UVGA 3NV7A 5YASA 1ULSA 2FKNA 3LPMA 4IRXA 4JLAA 5TPWB 1D0IA 3TAXA 3DDUA 2YVKA 4PHHA 1HDCA 1Z39A 4LNUA 2CWDA 1E0AA 4W5NA 2W83A 3K0BA 3PSAA 5DCUA 1KOLA 2TMDA 4RTQA 2E82A 5CEFA 5A3SA 4Z4FA 1NT2A 4B8WA 1FQKA 4BAUA 2LIVA 3DKVA 2XQGA 1M3SA 3EZLA 4NARA 2H4XA 2O48X 4X3PA 4C04A 3QKSA 4JP3A 4DCGA 1RWVA 4MGZR 2WIGA 3GT4A 4NESA 4CQLB 4HN4B 1P75A 3Q3VA 2L17A 3ZW8A 1DT5A 4FNAA 1MRZA 3H8JA 1RZRD 1KAHA 1RAHA 2C03A 2I6FA 1SHLA 2L19A 3A9UA 2WWYA 4EP1A 4W7IA 3TW8A 1IQPA 4JLKA 5I47A 2O0KA 3RVQA 3V46A 5C4MA 2BWJA 1TCBA 1XTIA 3NETA 2XKBA 4G1EB 3LZCA 4I55F 4EZEA 1FX0A 3QUAA 1ADJA 1SQSA 3JD4A 4KQGA 5E4YA 2IEAA 3C7CB 1GG5A 5HTOA 1IPEA 1QSGA 3HXLA 3HYRA 3SP1A 3FYSA 3AC0A 3CNEA 3MWJA 3JD2A 3O6VA 1X1SA 1U2TA 4OYYA 5CVTA 1I1QB 2VT6A 3IUJA 3ZQUA 2Y99A 4RH3A 3WFIA 4EY6A 5KTRA 3OTOB 4NPCA 4HXGA 3TTSA 3RBAA 3UZUA 3V6MA 3HDTA 3EGWA 1G2PA 5DU2A 3MJDA 2H1IA 2Q5LA 1RWKA 3S8EA 4C29A 4C7JA 3OWHA 1F12A 2A35A 3QHPA 4ZOEA 4HEJA 2XWJI 2WKPA 3IP6A 1HT3A 1BXKA 3HNRA 4CYMA 1RHQA 3MFQA 3PS9A 2XHZA 3FKJA 4K9QA 5A3VA 1UT5A 4PRLA 3G8YA 2R7AA 3LC7O 3DVRX 5FL7D 1WSBA 1ZGBA 1ZN8A 3FSEA 3S2EA 4ZVNA 4FP9A 3L9XA 1R2QA 2ZTLA 4O08A 2WIAA 1E1DA 1O6CA 1P2GA 1S9DA 1WXXA 1XD8A 1Z4KA 4QBHA 2WI8A 4YRJA 3TNLA 2O20A 4BX0A 2OENG 1AIPA 3WVNA 3LRTA 3S1SA 3RDPA 4CI0B 1E2NA 1QIKA 4R9SA 5DH9A 2Q1WA 4JVLA 1O8CA 1R10A 1RXEA 2I8LA 1Y3FE 1CUXA 2ZVQX 3EZ9A 3ZZMA 1Z4NA 4I50A 1II8A 2IHNA 4J0CA 2PN1A 5ILQA 5IP5A 5DT9A 3AP2A 5TX7A 2R1TB 3A9TA 3G9ZA 4YCCA 5C18A 2K4MA 1BTOA 3FYUC 4CM9D 4JENA 4AUMA 5C4GB 1QNFA 1IVNA 2MSNA 1VBKA 2YV2A 3DMYA 5EXSA 5KNBA 1PL6A 5HNKA 2VXCA 2CHUA 4B3XA 1OX4A 2CMFA 3NDPA 2Y1EA 3P19A 3F9RA 4NBUA 3AIMA 5JAQA 1THZA 2LKCA 3AUFA 4QRIA 6Q21A 1NXSA 3Q9SA 4GRDA 4V24A 3R3ZA 3ZU5A 1LY1A 3CBGA 2GLUA 2Z9BA 2X5NA 3DKRA 3QF4B 4IDEA 1KR2A 3C3BA 5E3IA 3NRBA 4OHZA 3WGVA 1ESMA 2OUKA 3Q8LA 2EKQA 3KEMA 2D3WA 3HUFA 1NXTA 4WTOA 4YMLA 1WUHS 1Z47A 1KY2A 4DF3A 1AV7A 1K8RA 1LQTA 1XHLA 4BV9A 1RRKA 1AO0A 4Z3OA 4C21A 3ZS9A 1QGUA 1G5TA 1QQBA 4KMOA 3KSZO 5FTKA 5I9LA 1QF7A 5GZ6A 2QW0X 4OB6A 2QDKA 2MINB 3E35A 4HDRB 2Z6QA 2R4QA 4DR6B 5ALKA 2JARA 3A27A 4GAEA 1XRJA 5TQVA 3I2FA 4JN6B 4L02A 1T2UA 1ZVJA 2EEZA 1HQYE 5EFZA 5BMVB 1SUEA 3AETA 1FTWA 2I33A 1DQPA 3HL4A 3LBYA 3HA2A 1E0JA 4KO2S 2R5WA 4GFDA 4C0QC 2J3DA 3F6RA 4LJ6A 2BJWA 3KTAB 1SB9A 4CODB 5BSHA 5DTEA 1BYIA 3HB0A 3IS3A 4ZAWA 1V2HE 5A6SB 4AUEA 2FRDA 3NVMB 3WQSB 2C9ZA 3EUEA 2PXCA 3V4RA 3CR7A 3DBHB 1YZFA 2QV7A 2ZIWB 4ENUA 4DDVA 1IK6A 2FN8A 2GGSA 3WS7A 2G77B 4Y1FA 1X87A 5K3FA 1X1BA 1X13A 1DWPA 4AZ3A 4BMDA 3F5SA 3BMNA 1MUUA 5K0NA 4BNHA 1I2AA 3QXGA 2OOKA 1XQYA 2CF5A 1HQKA 4LHYA 1SWVA 3NR2A 3K9WA 4RGVA 1R0BA 3EHEA 3PX7A 4RA9A 5HZHA 2XQFA 2H2FA 3LBNA 2Y27A 2FSIA 2J3KA 2QTHA 5ESXA 2W93A 4C4AA 5LP6B 1YJ5A 3JAKB 4F97A 1CNMA 5C8ZA 5GV8A 4EM6A 3IUQA 3LX5A 4XFJA 3OO1A 2OHFA 1CY0A 3A70A 5FD8A 2GBLC 2P79A 1TRHA 3L8MA 4PZDA 4M60A 2ZT5A 1BZYA 1P72A 4YDQA 3HZZA 4XW2A 3OOHA 2FQWA 2P1DA 1T4CB 2PUAA 4BV8A 3LUGA 2NVUA 4BFXA 3ZW9A 3Q3JB 2DLDA 4QSMA 3RSFA 4BKQA 5B1YA 2H4WA 1NLUA 2JJ2A 3LXMA 1M8FA 3PNSA 1X14A 5LZ4A 1Q2UA 2HF8A 3AESB 1BN7A 3V4PB 1SH7A 3CZ4A 5EGSA 1RBMA 4JP5A 1VHWA 2ZVPX 2YZNA 4B4DA 5B36A 5CLJA 3Q0IA 1NNUA 3KQUA 4UVHA 3DAYA 3WGNA 2XYHA 5HQTA 3H3JA 2QTTA 4QOEA 3RS9A 3CPEA 1KF0A 2R6CA 4E08A 4MTLA 1ML4A 4MDHA 5F78A 1YA4A 3BWEA 3T12A 3AGQA 4TSRA 2CV2A 2OKGA 2WVHA 4BYGA 3WGTA 2X8WA 2AXPA 5JAOA 3OT5A 4EGAA 1A9PA 4J3FA 1ZNWA 1IJEA 3G0BA 2RKOA 2VF4X 3ABIA 1E2HA 3MHPA 2FV8A 3NTUA 2ID9A 4DJ5X 4CDMA 5ENZA 5DISB 1UM8A 1W6RA 3K5HA 2PS1A 2ZJ1A 5KX5B 3BZBA 2PO7A 3G5TA 4Z7JA 3PEUA 3O38A 3R7NA 3DOCA 1GYQA 1X1AA 2IDKA 4KJZA 2PSEA 2QORA 1K75A 1KZYC 1Z33A 2EFJA 1MD9A 2PBZA 4B79A 4D3YA 1KJJA 1Z8DA 3LT0A 5LQUA 2CD7A 2JDID 3W9UA 2Y4OA 3N7AA 2ALJA 1J7KA 1R6XA 3F9CA 3U3KA 4HRVA 5I8WA 1VIAA 2QZJA 2RARA 3C24A 1MTZA 2A1UB 4ZT3A 2F43B 4TYWA 1W5TA 2JI4A 4FBLA 4E1BA 5B5SA 1PR4A 1W4ZA 4G09A 4N7RA 3OLCX 4MO2A 1DARA 4QQNA 1OAKA 2AR9A 2FPGA 5AVVA 4U02A 5FV4A 1WXDA 3DAPA 5IJZA 3GI1A 1P18A 2SNIE 4X8OA 2EF0A 1QHNA 2XUGA 2IWRA 4EY7A 2WE8A 4GVPA 3U7QA 5K8LA 4XE5A 3G5UA 2C31A 4X1OA 1TM4E 5AW0A 4M8LA 2C98A 1WF6A 3PQCA 4MRAA 1CZHA 3TEFA 5MGNA 2J67A 1E5LA 3HVJA 3QH4A 1EDDA 2K2WA 4R6WA 3JZDA 1FYFA 4M21A 4MHOA 5FF9A 5LU8A 3VKGA 2GN9A 4PV7A 4EBFA 3CW9A 2D2IA 4GRIA 3I3OA 5F1YA 2W11A 1P4JA 4NNJA 1S3IA 3FR8A 2QVCA 3WLNA 5CFRA 1X80B 4G0ZA 4O2BB 2GCIA 3OIVA 3LDUA 4NATA 3OT1A 2C3OA 1QPGA 2QPOA 5C7YA 2OV4A 3I8OA 4LI3X 4XM2A 1PNTA 4MITA 4ODIA 2DWQA 5ECGC 1K86A 2Q07A 3R7SA 3V00A 4KI0A 1A8IA 2FPPB 4C7OB 3E9YA 4DT1A 3HXTA 3I6YA 2HDOA 5HTKA 3KHUA 3PUWA 3DBRA 3KZ1E 4HLNA 3A2LA 2MIIA 2PLAA 2RBKA 1VLZA 5DYGA 5FWYB 3B3QA 1E1QD 1Z5WA 2CC2A 2FDRA 3MA0A 4U9IS 4ZYWA 3SKYA 1V16B 1MH1A 2HA7A 3V8RA 4YAGA 1RYNA 2YV1A 3FNQA 4J0KA 3WL8A 1US8A 5FPSA 2KBFA 4TV8A 5IMBA 3K0CA 5EXDA 1DAFA 3DBLA 1TZ2A 4Y2RA 5JSQA 2J7PD 5ITVA 2J0UA 5KYYB 4IZIA 1G16A 1ZCJA 1E6MA 1U0SY 1XP5A 2ZYRA 3K9LA 2FZCA 3OZVA 4NOKA 5CX4A 1JR6A 1SXHA 1DQRA 1EUCB 1CR6A 1KEEB 3TN7A 4E13A 1YA6A 2XUQA 1CV2A 3AM3A 3SE0A 3BTSA 1A9ZA 4CEJA 5CA0B 1TVKB 2PPLA 4CFYA 2F1OA 4Q9AA 3OUUA 4YRNA 2Y1GA 1YVRA 3ZHQA 1ORTA 1WF3A 1JR4A 1AA6A 1L6RA 1L7EA 2H51A 2CB9A 1JH9A 5M2QA 1CUJA 2QK4A 3I58A 4N41A 3EVEA 4PSVA 4YAOA 4LFCB 1EEXB 3N05A 3RWOA 3TAUA 5L40A 5JTUA 4RELA 4DNXA 2PUFA 2BAGA 3ORFA 4JBIA 4E11A 3GGSA 1HQDA 1PS0A 2E5WA 1OMOA 3MWEB 3MMSA 2JGDB 3N53A 4D8WA 3D8SA 3T1VA 4HAUA 3E5MA 1KE2A 1C7EA 1EGVB 3H1GA 4RADA 5EEGA 2O1SA 1IY1A 1HZJA 2VTBB 4OJKA 5K0TA 2ENWA 3Q8WA 4PQFA 1D4AA 1Y7HA 3K9HA 3ZX5A 2XUFA 3LLSA 3IT3A 4ICIA 3P5BA 3L93A 1JTEA 4EFKA 2R8BA 1BRTA 3CURA 2JF0A 5B3AA 1RBQA 1USVA 2VP3A 2XI4A 3PXCX 3EASA 3H6HA 5BQ5A 3BEOA 1HORA 3NV9A 4Z1MD 4TZ0A 2BCJQ 5TIIA 1RS0A 2V7GA 2O5CA 2BZ1A 3A6JA 1CIVA 3TFOA 1JFTA 3AZPA 3HEMA 4YJ3B 3Q8KA 4XYGA 1CF4A 5C8VA 2B8EA 4MVJP 4M1YA 3WLLA 1IUOA 1UWCA 1Q19A 2RI1A 3O47A 1SIUA 2GTPA 1R1DA 4TS3A 4NULA 3RUIA 2PKQP 1RHRA 4G4JA 1RM3A 2GPAA 1J2EA 1O57A 4ZCPA 2YNMD 1TVCA 3OA2A 4Y6OA 4GMFA 3U6BA 2WJGA 4JV5B 4D4KA 2W70A 3NOXA 2JKVA 2GEBA 4PTZA 2EKBA 3NHRA 1E2EA 3RU7A 1Q7CA 1RJWA 4J0QA 1L7QA 2Q6IA 1AGRA 1QQAA 5AW5A 3F9IA 4JB8A 2C2YA 1RHMA 1TAQA 3BMOB 1RQXA 1QWOA 2EP8A 2C42A 2QM8A 1GNPA 1Y1LA 3SDSA 7AT1A 1W4AA 4N0EA 4DWJA 4LBWA 4BEVA 2NSDA 4MLZA 4B0OA 5BW6B 2A8YA 2DFVA 1NFRA 1N0WA 3C8HA 4HMPA 5HDQA 4BO8A 1GY8A 1BEUB 1Y9DA 2GB4A 4KWHA 3I42A 5IMSA 3EIWA 2R7KA 4UD6A 3SQLA 4MKFA 1XKTA 2QLTA 4HZUB 4LY3A 1FEZA 5EQJB 4LDAA 2Q7DA 1XA3A 3JU3A 4K7JA 4CDNA 4K0KB 2P3LA 1V9CA 1IZZA 1JA9A 2ZYVX 3DUWA 3P2EA 2YZ7A 4I7EA 4MUBA 4ZXFA 4YRZA 2Y1XA 4XYLA 5ICCA 5IT0A 2QX9A 3QWFA 3VJLA 4M6WA 4MVJI 3KEQA 5FJIA 4HEA6 2FSVC 2A84A 1KWGA 3UJNA 4JMPA 3IC5A 5DM2A 1M83A 1BU8A 1OILA 1JRLA 1J4AA 1EX6A 3TJZA 3ZR4B 2FW7A 4GLBA 2WFLA 5DM4A 3OD1A 1XZMA 3KV1A 4EG7A 1OYVA 1AVTA 2V7EA 3Q4GA 4MKGA 4TQUS 3BIXA 1QMPA 3LCRA 4MVWA 3I9NA 5SYNA 5HZMA 2PNJA 4D9KA 3IA7A 4K9KA 3AVXA 1QOQB 1SCUB 1Z3CA 3CONA 3IB6A 3OMXA 4FT2A 5JQGA 3QKIA 5K8CA 3N58A 1TT5B 1MB3A 1R6TA 2N1MA 3CLRD 5FTNA 5B53A 4EQ6A 4ZI2A 1SXPA 4JL5A 5G02A 5FI3A 1KJZA 5AW8A 5FWNA 2NWQA 4I9FA 4KAJA 4YR7A 3C16C 2V5VA 3CPSA 3DQQA 1K7EB 2GFQA 1BO6A 2QTVB 5KKCA 3KKPA 1TADA 4YONB 3BL6A 5CTJA 2P2SA 2QN3A 4D8TA 3T7KA 3KETA 2XJ9A 5TSDA 1I51A 2WG1A 3EISA 4JZKA 2D4HA 2HMUA 3REFA 3K8YA 1C9YA 3FCAA 4Q7LA 3LLVA 1V0JA 1ZI9A 5JXGA 4I9UA 2COEA 1KS2A 4IG4A 3VXKA 1K89A 1N34B 4PN7A 4U7FA 3RJTA 2XWBF 3FVWA 2VJAA 3S2YA 4E51A 5AKIA 5GONF 1QRTA 3MJFA 1E94E 3OC0A 4Q4HA 4S3MA 3ZBTA 5MFPA 3ZGZA 2B4TO 2VNIA 4EGJA 3L07A 1KDPA 3KE8A 1GGVA 1M1YE 5IBRA 1XEAA 3EYAA 4Z8YA 1ZONA 4K9OA 2XEDA 3AVWA 2ZIVB 3QQPA 4DCOA 3H1BA 2C2GA 5CVVA 4BB6A 4DMRA 1XAIA 4L73A 1Y89A 4EA6A 3A9SA 2HLHA 3FPHA 2P6OA 3HA3A 4KQ9A 2MSWA 1P1BA 3HDJA 1NUTA 1MJHA 4S04A 2IYPA 1NW7A 1UJ2A 5AUQA 5JNSA 3NTLA 2I2CA 2YDXA 5FI5A 2CJPA 4BBJA 4YA6A 2C9OA 5H81A 3GLGB 3D6JA 4CLDA 5TE9A 5JBNA 3BWYA 2HNAA 2IZ0A 2NM0A 1MVNA 2VRCD 3K0AA 3ORQA 4OQDA 3LYLA 5ISMA 3TYXA 1JWLA 1T2DA 3PFIA 4D0NA 4BASA 1ZG3A 3EDMA 2HIMA 1C9MA 1TA4A 4H0FA 1GG8A 2IIPA 3VVBA 1CE8A 3OY2A 2WMYA 5AK5A 4H4CA 1PGPA 1FX0B 1DRJA 3EUFA 4OQQA 5K0ZA 1KRWA 1GL6A 1KEWA 1Y80A 2DT8A 3CRRA 4XB1A 3ZE9A 1QBKC 4C3UA 4A9AA 2EJUA 1UMDA 3AF5A 4WY8A 2O4CA 2I34A 4EK9A 5KCMA 2NQ2C 3NZEA 1TFRA 3H4VA 2EG5A 3L02A 2NO6A 1KO8A 4FYPA 1FRNA 4HXEB 5IVKA 3K30A 3ZGVA 4QE3A 3PQ2A 5CB4F 1XU9A 4ZEVA 3KB2A 2YBEA 2A59A 4QBFA 4FZJA 3OHMA 4D9BA 1SVSA 2W71A 1QAOA 1XZQA 2JFGA 3GEGA 1Z16A 3F4KA 5T4HA 2WK1A 4FDLA 3S5UA 3MT8A 5C1DA 4P53A 2H48A 1YR8A 4P22A 4Q18A 1VIYA 4W8GA 1P4AA 1FNCA 3LCUA 2O8VA 4JK3A 4MR9B 2Q5CA 5J5VA 2X7HA 4ZQCB 1BG6A 1ZC3A 4D8VA 5EUCA 1N9GB 4R31A 4TROA 3CLTD 4GDFA 2CK3A 1P5HA 1YC2A 3CGWA 3HCBA 1YUMA 5J2UF 2CFOA 4IIYA 4O4LB 3VU1A 1WMAA 1D09A 1XI2A 3AP3A 3H3FA 3MWLA 2YHUA 3FNGA 4LZZA 2OTCA 1GWNA 1I5EA 2O0LA 1SCAA 1BX0A 3IT2A 3IVGA 2QV0A 1ZNZA 3PVSA 4FQ7A 4I50B 4N5HX 3EAFA 4US1R 4RTLA 5L4NA 3QLUA 1WNTA 4KV7A 3LHKA 3WMEA 4FWTA 1T4BA 2OFWA 3IQIX 4J07A 1LLUA 2BE7A 1YDGA 4NZZA 5JMWA 1KDOA 5HDBB 3VI4B 3FBTA 4RULA 1UWLA 5ICGA 1GZVA 1NUSA 5ED4A 1JDJA 2WWRA 4CMCA 1GAQA 5AOBA 4BB5A 2GF0A 3U13A 4LVOA 2KX7A 3WFJA 1H3FA 5KVAA 4CU2A 1U7WA 3HZHA 5DGXA 4F1JA 2I03A 3CIOA 3NHMA 4MMZB 5MFZA 2OCKA 1PQ4A 1Y4ZA 1EI9A 1YVUA 2DQYA 5FPTA 5LMCA 3NOQA 2JCXA 1RLOA 3ZLBA 3FUTA 2C4TA 1QPBA 8ABPA 1KEKA 4BE4A 2HPHA 4QGAA 2I4TA 2GX6A 4R1QA 3T4UA 5BUZA 1Y9AA 4WFJA 3BT7A 1PJRA 3PKJA 3B9RA 1L8LA 5DJ5A 1GXSB 5DHFA 1JTVA 3UG7A 4C0HA 1KK2A 4FWIB 3CXUA 5BPHA 4PINA 4QNMA 3S1AA 4LW8A 3UWKA 2G9UA 3H9JA 2ZJFA 1SELA 3L7KA 5CG1A 1ATIA 1QE0A 3CJTA 3G5MA 3W3AA 3VYUB 4ZYLA 4MIKA 4BLPA 1PZEA 5ITZA 3BFVA 4Q1BA 4DDHA 4LCBA 1T1IA 4ISBA 4BLUA 3ACBA 4A36A 3LF2A 1M2JA 4CLRA 2GN1A 3ST7A 1O89A 2O2GA 1GKYA 4NZYA 1CNFA 2GFIA 3HRKA 3PZBA 4XR9A 1B74A 1P7VA 1C3VA 1ZNYA 2GK6A 5DYYA 5IWCA 2C58A 3OZSA 3E9MA 3HYNA 3ME5A 4C30A 3DL4A 3QE0A 3R5JA 2VPPA 4YUYA 4AXXA 3QA3E 1JPUA 5KU1A 1JHAA 1I4TD 2VSQA 4L6CA 3VC1A 2OCAA 3GRPA 5EZ6B 3CS3A 1NNLA 3TZEA 1OIXA 1OZFA 4YPOA 2X77A 4NENA 4PSKA 1HNXB 4TKUA 4A6PA 4AMZA 4RVFA 3EWIA 1JIUA 2YYSA 4G65A 4QNNA 4JXZA 5G41A 4CLOA 5I5EA 4P98A 5AXBA 4MWEA 1K4MA 1UOOA 2BI4A 2J4FA 2LR0A 3D3QA 3UHFA 2JEYA 2VG8A 4I1SA 2Z5GA 5AKGA 3DULA 3FMOB 2BT4A 1V1RA 4U2GA 1WWKA 3TZCA 1WU8A 4F4HA 1Y3IA 1DIGA 1E6CA 4R9UC 4BMNA 1CUUA 3T5TA 2BBSA 2EW2A 1KC3A 3R7WB 2KWIA 4V0KA 1O03A 1GNQA 1L8OA 5IARA 4PR3A 5LC1A 2OYSA 4KO3S 3WMWA 5C8XA 1DAPA 5FPKA 4YRQA 5J1TB 5K99A 2F4VB 1IIRA 4F5ZA 4Y2VA 1BW9A 1RABA 3RROA 5G1OA 3SVLA 4G2TA 3TOSA 2NU6A 3EEFA 4D57A 1AY0A 2D2EA 1JLLB 1CDDA 2QYSA 1JFSA 2V59A 3ZCPA 4OYHA 1OFGA 4JNKA 3UW1A 1PRYA 2IE0A 1DO0A 1P1HA 3F3SA 3ZXIA 1Y37A 1W5BA 3K31A 5BT9A 4Y1EA 3SJZA 4H4DA 2RJNA 1U7PA 4Q00A 1PSDA 3BMXA 5KHLB 5JSFA 5KJCA 5DNUA 1W36B 3EIXA 2PMCA 5THKA 4BV2A 4EI7A 1PJTA 1ZMRA 3JALA 4JBYA 2I7DA 4JHLA 2FW9A 4L95C 5E6UB 1BIFA 2JFWA 2HGSA 4WJZA 3ZIAD 4C6TA 1XDDA 1KDTA 2R6DA 1XXHB 4B3BA 2HJ9A 3R75A 1HY3A 1JJ7A 4EI8A 1UKCA 3CKLA 1U7OA 3D54D 4U6SA 4C4ZA 5JD5A 1X2EA 3TL6A 3F6SA 2APJA 2OMKA 3QBEA 1GTG1 2RMKA 1XU7A 2RC6A 4F4CA 3ED5A 4NCJA 4RIIA 2J09A 1VP3A 3QY0A 5AK4A 2I2DA 2QROA 4I2VA 4WQMA 4M0UA 3SIXA 4EW3A 2O1WA 2ISCA 1PO7A 2X7JA 4HB0A 4O4HB 1XPJA 5KNLA 3OZFA 4LV6A 4J0EA 2EQBA 2WVJA 3KJHA 5IJ9B 5KNCH 1Z18A 4TKMA 3Q7SA 4HPJB 3ZHXA 3EGVA 4W7SA 2O3SA 3HYLA 3MS2A 5EXPA 5K3SA 3HQ4O 4GP6A 3VHQA 3IEVA 4WA7A 4CKXA 2BF7A 3CUWA 3GFBA 1OXMA 3X2FA 5EYPA 1X7YA 2QA5A 1LPNA 3CE9A 2PDAA 4ZT4A 1UXKA 2D2FA 3IVMA 4ITVA 3L7JA 1PNVA 1E7YA 1M34B 3FKSA 1W5EA 2F17A 3VZDA 1YCHA 2VYND 3ENWA 5K3AA 3W6ZA 4WW0A 2FPGB 1AQJA 1MZVA 4PIVA 4TLCA 2O2ZA 4JLOA 1BMQA 2EKDA 3OPYI 2Q27A 3OZDA 4D43A 4DIUA 1P2FA 2QW8A 4AUNA 3BDVA 2VXOA 4B6FA 5K0EA 4N03A 2X2PA 1H85A 4PLPA 1GPBA 1XCOA 5AXDA 5C3UA 3U7QB 2OD7A 3JASA 1N7HA 4X44A 1YE3A 3ZNNA 4YUAA 2XVYA 1BS2A 1XMJA 1BS1A 4WGFA 4TRNA 3G5LA 3A6PC 1AU9A 4TL6A 3SJBA 1ST3A 1Z29A 2VT7A 5ALNA 4ZD6A 4J1NA 4QT0A 4AP6A 4CVNA 1ATZA 1T0UA 3TOXA 5K5EA 2JBAA 1NUUA 1P45A 2VRBA 2A5DA 3A37A 4HRXA 1CVIA 5IYZF 2N0SA 3W2FA 3IVXA 3CISA 1V48A 1T43A 2VJBA 1NDHA 1M1UA 1Y63A 2Y1WA 3O8LA 4OQXA 3F7OA 4CUKA 1IEQA 3CR8A 3NNNA 4ALJA 1Z7EA 4RMHA 4XEUA 1QIGA 2V55B 1JXQA 3LP8A 3Q12A 3GEHA 2JGEA 3FPBA 4HLDA 4M53A 2WT9A 2JAOA 4GW3A 4Q9KA 1CYDA 1YU9A 5L3SB 1DKUA 2PKWA 1E79A 2FU5C 3VR6D 4JI5B 1P9RA 5FEMA 3DBRB 1GDDA 2X1VA 1W2HA 4MQ6A 4NYIR 3RUAA 3U3XA 1K97A 4ZEXA 1JNXX 3QWBA 4YAEA 5FYQA 1ZA2A 4OSEA 3EZXA 1T3HA 3H9EO 2YC2C 1L5VA 2BZSA 5IHPA 5E9JA 5EXEA 1EDOA 4PYLA 1NMZA 4CLXA 4HO1X 2D4AA 1V1MA 3CF4G 3INNA 3OEHD 1EQAA 1ZIYA 3HH8A 3IXMA 4MAAA 1KK3A 4A26A 4EFMA 2XBMA 4IDFA 1E0DA 4ZOBA 4KSYA 4RA6A 2WYHA 3VR5H 1GM5A 3JS5A 2OBXA 2B25A 3UPTA 3PRKE 4NP6A 3RFXA 4YJ2F 4MZDA 2VT2A 1M5UA 1Z0ZA 2KB0A 2CMKA 3G85A 1IU9A 3WLMA 3W5SA 4DQLA 1KGSA 4FC6A 1H0SA 1ISSA 1OZHA 3D5TA 2WYIA 2FTKE 2XRFA 4N8DA 4CMJA 5AW2A 4YCAA 2ZSDA 2Z2YA 3CN9A 1E3QA 3VTZA 4E6PA 2G08A 2YFKA 5TEWA 3RIEA 1BEEA 2JHPA 3T0GA 4CF3A 4CKBA 3H1TA 4US0R 3DNPA 4RHTA 2JVIA 2G7MC 3AJ9A 2H6EA 1M6YA 1O7JA 1YJCA 5CHEA 4EBBA 4EO7A 2C4WA 2JLVA 2P1RA 4V0SA 1FTQA 3VOSA 2G80A 3PD0A 3H19A 4ZO9A 5DK4A 5A5DA 4RENA 1GLVA 4OSPA 4RVUA 4URYR 3T7JA 2DWOA 5LD2C 4ILEA 3K1YA 5ELLA 5ADWA 3RC2A 3TSOA 4ZGWA 1JW9B 1X42A 3TMYA 3GEDA 4JGIA 1Y98A 4TXHA 4D44A 1UPXA 3FYTA 4EG3A 4LK3A 3OPMA 3KAQA 4EB6B 4EHKA 1GQYA 1ZLYA 2A1IA 3WLJA 2HMTA 2X40A 4J4HA 5CYFA 3RTAA 2JAHA 1OZ0A 3QFTA 4XYEA 5IEBA 3HB5X 1P0CA 2CUKA 6PFKA 1CRQA 4TWRA 3HBAA 3VNBA 4TTTS 4XFDA 2E1PA 1DTWA 2BMJA 3KB1A 1DWUA 1J07A 5FQNA 4BFYA 4MKRA 2JGMA 4QM7A 2CJWA 3HWX1 4JP1A 3R0QA 3GB9A 3AO0B 1A7UA 3CE6A 2EFHB 3RIYA 3FTCA 4KP7A 3NC1C 4G5RA 1EAYA 1R8JA 4G9EA 1LRJA 2BDTA 1E2IA 5PGMA 3RFTA 5JYCA 2I7TA 2ZRBA 3F98A 4IHAA 1U7TA 1GFSA 3B70A 4ZT5A 1ZUNA 2G3YA 1BDHA 1ZVVA 1U4SA 2AVDA 1H8HA 2ZP1A 4CM5A 1E5TA 2NN3C 4M7WA 5AVTA 1P31A 4X8HA 4E2ZA 1TI7A 3BBLA 1ULHA 5H4HA 1CQIB 1FS4A 1LLCA 1M2WA 1HEYA 3L8GA 3BHIA 4W1SA 5EPEA 4ZMSA 4BLQA 4D4HA 3Q88A 2FQYA 4EA8A 5A2GA 3ELUA 3K9GA 1DMSA 3T5BA 3PF8A 3FFTA 4QL3A 2DM6A 2IYQA 2VDPB 1RQ2A 4RFVA 4CF4A 3W4KA 5AMXA 3BD7A 1KFCB 2DQZA 4JLWA 4UAJA 5IN4A 2FPKA 2WU8A 4BQIA 3L1KA 4UCWA 2OFFA 3CUEF 3N1UA 1FA9A 1NR5A 3O4RA 1G8MA 3PQ7A 3D6AA 5AVXA 1D6SA 1T8RA 4AMBA 4KPGA 2WFLB 2E1RA 1SKUA 1ZEJA 2EOAA 1QIJA 2C3PA 3OZCA 2IZ1A 3OY7A 3EGXB 1AKTA 1A7JA 1UBTS 4GM0A 4PZPA 4UBKA 5CFQA 3DE6X 4MGIR 4YRGA 1XEWY 1QOPB 4YMWA 1JQEA 4WERA 3IQEA 4EUEA 2IHBA 3QMVA 5F1KA 1G6KA 3BKWA 3TIIA 1Z12A 3BWMA 1RCUA 2CNBA 1ZHHA 2ILTA 3PKZA 4IZOA 4W4TA 1EU1A 2ENUA 4WOKA 3ZW7A 1PYDA 2AKEA 1SBZA 5DSXA 5COBA 2V7QD 4ZOLF 4LAFA 2NOAA 1JLMA 1PK7A 1DUVG 1SCQA 2VSXA 3TR6A 1KQPA 1ZM7A 4AO6A 3RRYA 2QX6A 1ZX1A 3G2LA 4BVFA 4EL5A 3AVVA 2PBLA 1KMIY 1CRLA 3EE6A 2YRFA 4FW8A 5KNDA 1Y5IA 4N5LA 2AKAB 4OATA 4AX4A 1M10A 4G67A 2JBHA 2VHZA 2WJAA 4I1UA 1PJLA 5GZ3A 1NPDA 1Q84A 1Y9ZA 4NF2A 1CUVA 4FEGA 4OH1A 1OA1A 1Z0SA 1II9A 1AK2A 5HCUA 4PZ0A 4HWOA 1GFWA 2W48A 2BKAA 5JD3A 3OIUA 1A98A 3LAWA 4HYYA 3ZDZB 2FHSA 1YZGA 4Q4HB 4KYUA 1VFPA 2C77A 1RC1A 3GF4A 3TDMA 4UEJA 4EHBA 3F73A 2FDCA 1MT3A 1KVRA 4KYIB 3WXBA 1Q1AA 1DKQA 2XXAA 2X19A 2M6LA 1NFQA 2ACWA 1MO4A 4QM6A 5JI3E 5K7SA 3L4BC 5EKDA 5LLSA 3G3EA 5JVDA 1UXIA 3GAZA 2C2XA 3P9CA 5CT4A 1XQ6A 1CZRA 1V9LA 4L4RA 3ZHRA 2Z04A 4L0CA 1CG6A 3AXTA 1F4VA 1COWA 2L2QA 1DJPA 3KZKA 3AVOA 1YONA 1IEXA 3HKBB 3ROEA 3H17A 2YJ5A 2EXXA 2XCUA 4M1KA 4QOIA 2CW5A 5DHQA 1AHPA 4X7RA 1P6QA 2BSQA 3TKLA 3MBOA 1Y3DE 1AG9A 2ZUVA 3EMBA 1KDZA 1HT2E 2OMEA 4HEA1 3Q5GA 2IGBA 3B6IA 1K88A 2YXLA 4D45A 1V1JA 1GR0A 3WGIA 1MQ9A 2PKRA 3IEUA 4J0JA 4DW8A 1MW8X 1JHZA 4PSUA 3DH0A 1QHGA 4XX0A 3UO8B 4JITA 5IC6A 2QP9X 3GT3A 4AY6A 4K1LA 3DHNA 2P2DA 3FPLA 3PE6A 5JJIA 1JKJB 4DADA 2WABA 1O96A 1VGQA 1ONBA 1X8XA 3A6DA 4CKWA 3QVLA 1E7SA 2G40A 4G9GA 3IP7A 4KIUA 5H82A 4CT5A 5JCXA 1WU7A 1YZLA 1XTUA 1BVYF 1OTYA 3G9QA 4HAOA 3KC2A 1R66A 1RXIA 1PZHA 5BUQA 3NDBB 4LNAA 2Q3CA 3QFRA 5ELXA 5G3YA 1ZFNA 2PAAA 1J0BA 2Z5LA 1CDZA 1HM5A 3NLLA 2DHRA 5DLEA 3SNHA 3WJ1A 4E6EA 5BYBA 4H4EA 3MGGA 3KQOA 2PD3A 2P2GA 1WCYA 3RG8A 3TD2A 4JASB 4PZLA 1BHQ1 3QV1A 2GPTA 3RVJA 3TXXA 4M0FA 4MVJH 1G4UR 4MPRA 1WHSA 1JDPA 1WJGA 2EQ5A 1T5BA 3KCQA 3DT9A 5K4HA 5LXTA 5A04A 5JATA 4QHTA 2VEDA 1G291 1NX9A 2CLLB 2VIIA 1AKVA 2Y1CA 1VMAA 5JZOA 3TRFA 1KMCA 4N48A 1JFRA 1Y81A 3WWCA 1H69A 1UBGA 4Z5XA 2BI7A 3PYMA 2RHRA 1J8VA 1SFRA 2R47A 3SR4A 2OGTA 4PU0A 1H0RA 2I4RA 2JHCA 3F8TA 4UQLA 3PGVA 4P7GA 5IKXA 1A9QA 2XQJA 4HK4A 5EMLA 4C0KA 4EW1A 4D0SA 2RCYA 5IC4A 2OL4A 2P9BA 4P4LA 3HJCA 3QUCA 3DCYA 5NLLA 3WLHA 1XD9A 3OTWA 5FI1B 5JYEA 1O94A 2OFOA 4EOGA 2XAUA 5T8KC 2DBQA 4F93B 4DR7B 4HNGA 2OR3A 4IGIA 3GOQA 4H60A 1QGYA 2GZ3A 3FI9A 2PV7A 3IKTA 1I4OA 3RSOA 4DIKA 5HF9A 2WHEA 2NAPA 1ZRSA 5COAA 1KRXA 1QAQA 4XIIA 4J1TC 3RIGA 1R4MA 4HZIA 3OX2A 4W9NA 4D8UA 1O6FA 1UZUA 1DZIA 1Z9BA 3EXAA 1BE0A 3HN7A 1DIAA 1RU3A 2C2KA 1YJBA 2Y1KA 2Q6KA 5FUVA 1P62B 1G7CA 4BQOA 3B9QA 3K9FC 2PV0A 2RGEA 4EUFA 4OBBA 3ZEAA 3SVZA 1CULC 2EJTA 3P9XA 4PG5A 2QR2A 2RAUA 3QNMA 4ZGGA 1JF8A 2KW5A 3CCFA 1PVDA 3ZV3A 3ZJ4A 3I9V6 1XDWA 1B93A 2YJTD 1ZZEA 3M1LA 3O93A 4L5YA 2C84A 3EVFA 3WNQA 2J3LA 2Y0DA 3C7DB 4P93A 1VLVA 2RG1A 4BWGA 5K6AC 3OOEA 5A1JA 4DRXA 5BNTA 1GGKA 5EIFA 3ER8A 4L28A 4A8TA 5EHXA 5AM1A 4OREX 1IHDA 2IOYA 1D1SA 4UUBA 3VVLA 3K0SA 1PR3A 4PYMA 2PXHA 4CLRB 1O95C 4O3MA 2ZRGA 3HR7A 2AFVA 1NHWA 3HI4A 1KK0A 4GQAA 4RKYA 4U2EA 1FTGA 3HNOA 5ADHA 2PS9A 3PQ8A 4L8GA 3WY9A 3SYKA 2H8GA 5IDVA 4BYMA 3P7MA 1L1FA 5I7WA 4JVSB 3DPUA 5SYAA 3DEAA 1ORWA 3QX7A 4KQMA 1D1QA 5JSYA 1O77A 4E2XA 5JSZA 3AUTA 1IOVA 3N70A 1MC1A 2P6NA 3ECCA 1FMFA 3MWDB 2KHZA 3DZDA 2AI3A 4HPWA 4R2IA 3V33A 5DEIA 5J63A 3FTEA 4PVCA 2YC4C 3JVDA 1PT7A 3N74A 3G0CA 1RVDA 7MHTA 1C7FA 4NENB 5K8IA 1TKBA 4QEZA 4CE6A 3L8CA 3TWOA 5AJVB 2B6HA 1B4DA 4F3TA 5AW7A 3E9ZA 3WQRA 1F7VA 2WHQA 1A5BB 1YKSA 1ZW6A 2AG6A 4NVRA 4M1QA 1DC3A 1SHZA 1BSVA 1TQ2A 2PPVA 4U00A 2ZI3A 2H4ZA 2VTVA 2MR5A 3FNBA 4ZEWA 1SUSA 4AKEA 5KIAA 5KTYA 2ZBPA 1CJMA 1TQ6A 1QH0A 3R3UA 4OBWA 2NXWA 4M37A 3RAGA 3Q6MA 1S3GA 3K4HA 2FSGA 3ORYA 2QJTA 1VOTA 3DD5A 4YO8A 2DQ4A 5FADA 3T5MA 1H2EA 6NULA 1YQDA 4HX9A 4D6YA 4OHKA 5LN1A 2NXNA 5MDHA 1SVIA 4R81A 2YXBA 4Q47A 1P2SA 2X8JA 3ZCVA 1W49A 4RZIA 4PPYA 4JSYA 4AG3A 5JS7A 1G59A 4MUAA 5K20A 3DVLA 3GJXC 3GVXA 2XD4A 8MHTA 1U9JA 1SUWA 5FWAA 3D6UA 3W9BA 1IBLB 3OWOA 4TPKA 4GX0A 1TEZA 2CDBA 4ABTA 3V9AA 3P9YA 3TQCA 2I54A 2ADOA 2Z4SA 3IE1A 4U7TB 4H3KB 4AF6A 3RTDA 3V4ZA 1XTRA 1JZSA 2XUZA 4NCHA 3LQYA 2EJBA 1GU0A 3A7DA 2VZLA 4IO1A 1E2PA 1TEXA 2X2FA 2XCLA 3L4SO 1QX4A 3M89A 3PGA1 1SPBS 3QJGA 2XVXA 4RLQA 1UK9A 1XQ9A 2AD5A 1U5AA 1OFUX 3L0YA 3ZUGA 1Z35A 4JUIA 4AO8A 1HTBA 3INYA 5HUJA 1ZJ4A 2J5BA 5E9WA 1Z88A 3O1IC 4ZZ0A 1N6HA 4PCVA 2PZGA 3NYWA 2IHZA 3J81A 1IUPA 1PNOA 1KJIA 4FJ0A 5AI0A 2ETVA 5CDYA 3G49A 4HQ6A 4LQCA 4MSUA 2GCOA 4D56A 3AL0C 2M1XA 3HCFA 3QFCA 1ZITA 4X60A 1LNQA 2X5KO 2Q8NA 3F4LA 4RU1A 5LQDA 3FOFC 1HX7A 2VYVD 1LPOA 4U7GA 2Q5FA 3EQZA 2IP1A 4JT8A 3HBLA 3W5DA 5D3ZA 4MOWA 4YCLA 3LVQE 1NVEA 5EIBD 3ZJUA 1VPWA 2GAJA 2CMDA 4KVZA 4IGEA 1R4NB 4EZIA 2YWBA 3FYCA 3ENKA 4F06A 3T94A 4B3FX 1X7YB 2Y4NA 2P2LA 1A50B 4HFNA 1LF5A 3KSBC 1MPXA 2WSIA 2WG0A 1X0VA 1GP2A 2FE4A 4CV1A 1OU4A 2SKEA 5DSZA 3C14C 1M0SA 5D3QA 3STHA 4C1BA 4N7JA 2X86A 1GQQA 5AUOB 3KZXA 2Q3DA 3JD1A 1QCYA 3CZ5A 4J1SA 4OU4A 5FBVB 2R0QC 5D6NA 3N0RA 5KVCA 1RZ3A 1UDRA 3MUEA 3V55A 1W1IA 1XJ0A 1VB5A 2PHZA 3DFMA 2IYVA 5LQKA 1NJ1A 2QMUA 2VAVA 3IMGA 3G17A 3KFLA 3T8YA 1OPRA 1UBCA 2VBFA 1M73E 4HAVA 5FL3A 1YNSA 3WV4A 1WDTA 1ZS9A 1WY7A 1F38A 1T29A 1F8YA 1ODSA 2HRZA 3IH5A 4J16C 3GLFE 4P35A 2OM6A 4NC9A 3HXMA 1QXSA 1NQXA 4GOKA 3IV7A 4Q7KA 2FEKA 1VKHA 5IM4A 2HKIA 2ZJBA 3DLPX 4UBLA 3RBVA 1NYRA 3ADCA 4H7PA 2QAIA 2IYWA 1DKRA 2GAFA 2PH7A 2R84A 3KT0A 1MX3A 4KE9A 4KXXA 5DI9A 1WMBA 3B3GA 5F64A 5TF4A 3MNFA 3T52A 3I2IA 4QXQA 5LZ7A 1LSUA 2P2YA 3ZOKA 1Y9JA 3I0ZA 1XZFA 4IIEA 1KL7A 3SIPA 3U7FB 1Y6RA 2NZUG 4RE5A 4ARSA 4EF6A 4NE7A 5E3HA 5FUXA 4Z4QA 3EQ2A 1UIRA 1CXZA 1RKVA 4Q9DA 1BA3A 3DE1X 4J49A 2PRIA 5JCJD 1TKAA 1EWVA 2R48A 3T3HA 4PWYA 4TMWA 5ADVA 2DP4E 2WZQA 3S55A 5FULA 2ZWVA 2QJRA 4NQRA 3OJEA 1NJ2A 3GLSA 1QJCA 4QDTA 4UEWA 2FMXA 1C7IA 3MERA 3RRJA 1EBBA 2VSFA 1DKMA 3V3KA 5FOVA 4M0PA 4AZVA 2D5IA 1E1MA 1WZIA 2QJWA 2ZI6A 4J0GA 1VKRA 2J7PA 2HU2A 1UMBA 4RZUA 5FO0A 3P9QA 3UXHA 4I55A 2QMEA 4FGUA 1R0YA 3NWOA 5B37A 3N2EA 3SQNA 3G1WA 1NRXA 3OLZA 4MLPA 1QV9A 2WM2A 1Z56C 2P30A 1P91A 5H02A 4FFMA 1B42A 1Y8AA 2A57A 2ZXEA 2TSYB 5IKEA 3OKAA 3QVUA 2X76A 3ZWQA 2QY6A 1YA8A 4L15A 1SC6A 3LQQA 4F7WA 1LDMA 2C1XA 4PNEA 1BCRA 2F64A 3B9BA 3VC2A 2GJSA 3E9DA 3VUFA 1YS7A 3M70A 4DCPA 1BQ4A 1YMVA 1NP3A 2QL5A 4FE4A 4ND8B 2VJCA 3ZQKA 4J6FA 4KN8A 4MV0A 3EFBA 1SCBA 3HCRA 3NONA 5A4IS 2Q46A 2FEPA 3AKCA 1W7AA 3EGDA 1AMNA 4ZYUA 2WUDA 3BGDA 2FSSA 3AIOA 5THXA 1THTA 2WD9A 3EWAA 2OESA 5HQ3A 4QQ8A 2AN1A 5JTTA 2GSDA 3UPDA 2CL0X 2PJRA 1JT9A 4ZHQF 1W2GA 2K6GA 3E6AA 4YP7A 5JJKA 4FX2A 2VBGA 1OGJA 2E5FA 3N8KA 4RY0A 4EABA 1PAUA 3CKMA 4LA4A 1L5FA 1A77A 1HT0A 2RGAA 1Y1SA 2YXDA 5JZSA 2ST1A 5G0UA 1MJ5A 1T6NA 3G8BA 3MWKA 3VHXA 4AJLA 2UXBB 4M4SA 2ZYAA 1BWSA 4PGMA 2POQX 4ZOAA 3SHVA 2ZZNA 1CUZA 4UKDA 5HIAA 2IYNA 2XA1A 4KZKA 1NSTA 5TVGA 3JYPA 1E60A 1X74A 5DE3A 2WPNA 1G17A 3BFPA 3KYCA 3HCOA 1EK1A 4GC5A 2HHLA 4UUPA 5EP3A 5K05A 1GPWB 3ONFA 3NOVA 2P68A 1QE5A 3MWYW 1TUEA 3DMFA 3OE4A 4Z1OA 2ZRCA 1NN0A 3UICA 2R1ZA 3UENA 1V5IA 3Q2KA 4MS1B 5KYTA 2WJZB 5C5IA 3ZTYA 1LBIA 2V54A 3IJ5A 3NQ41 2QI9C 2RGDA 3GVPA 4LE2A 4KCGA 1LLDA 3QYAA 2BJHA 1Y6ZA 3UT5A 4AJ9A 2BFEB 1T10A 2GCGA 3D7RA 1SK9A 1DB3A 1Z4QA 3QU9A 2IYYA 1YRBA 4MICA 1PL8A 4L8LA 3FOBA 5JJLA 1ZK1A 1U0TA 3W78A 3Q72A 1IEWA 2CNLA 2WQZA 2C4KA 3K2BA 2ZUWA 1F17A 3KJZA 1EVKA 4ZQFA 3FVQA 2YWEA 4C7VA 2G63A 1P2UA 4PO3X 4BRUA 3DZBA 1G0NA 1XXHE 2XIQA 3K2EA 4YIKA 4DEYA 3IIIA 3DFZA 1D4FA 1SZPA 4N0PA 2CNNA 1QVZA 1B1CA 5AESA 4HGRA 5HCNA 1RAGA 5KOJA 2XR1A 2NGRA 4BP1A 1GTSA 1CJBA 4PE5B 3B1KA 5KYWB 1P39A 3P9SA 4NTZA 1ECBA 3PTZA 4H31A 4I3HA 2FWMX 5DCWA 1JIJA 1MQAA 2Q5QA 2QRHA 4Z7QB 3W8FA 1M9NA 1WW3A 5JMPA 4ETMA 3NB0A 3VU3A 2ZIEA 4DILA 1G5QA 1KZGB 4ECEA 1Z68A 3R7BA 2VOJA 3NHJA 1DRUA 1VCHA 2HWKA 4JR1A 4OLJA 5B3LA 5A9SB 3DEIA 3KQHA 2O7SA 1ZZGA 3FSGA 2H52A 3FN4A 4DC1A 2V6FA 1CR4A 3GJZA 2OBYA 2XUJA 2PWAA 3O8OB 3VU9B 1JQDA 3JR3A 3D43A 5FH9A 1PL0A 3CLSD 2OBLA 2ASVA 2VJMA 3WG9A 3O2JA 2ZYWX 3QEMB 1TD9A 1JDSA 3OX4A 3R6WA 1N8SA 3JQDA 1M34E 3AB7A 4MGYR 3EIFA 4MWDA 5DYIA 3S7TA 3T4EA 2B7LA 3UH1A 2O7VA 1ZJYA 3IAEA 3QSYA 4DLUA 4CTNA 3U3JA 3MEQA 1UC9A 1E9CA 2KI5A 4NY1A 3KDSE 2Q99A 2VS1A 4RKRA 5EE9A 5JXIA 2BEUB 3C3DA 5BRAA 1CJCA 1PSZA 3TEJA 3ETGA 2YOGA 4QYWA 3GUZA 4V0ME 4A2QA 1RI2A 1VPEA 2WHRA 3AEZA 2IZ6A 3T1YB 1N2GA 4M3NA 2R5FA 5G0WA 1NTRA 3FMGA 4RAQA 3WNZA 1C9EA 1MOZA 2EQAA 5DM60 2AEJA 1RTKA 1GZ4A 4ETIA 4A6XA 4MX8A 1AK1A 2H4HA 2I2BA 1DCTA 3HE3A 1S7CA 3O0TA 2OBBA 5LUBA 3ZE8A 2COKA 1QQ6A 3FWYA 5FP0A 1J1ZA 2HUPA 3KHTA 1ZP6A 2P9TA 1FVHA 1KMMA 3N8NA 5EJEA 1UUFA 3O91A 2V1UA 1UXHA 4OGWA 2C88A 3PJDA 2ZREA 4NQZA 4JWTA 4R2LA 3HO8A 5BV2P 4X6UA 3FPGA 2QBYA 1HYGA 2QP3A 3RHTA 2I8CA 3SG0A 2OO3A 4WFKA 1TFUA 3GLHE 2VNSA 3ZH2A 1V5FA 2RGUA 2N9UA 3INGA 1P9NA 3EK2A 2AJBA 2C99A 2XJ4A 5HIMA 4V2IA 4Y7CA 1A2QA 4KODA 4EG6A 1O96B 2BMWA 4MQ4A 4UJ3A 1T1GA 4CKWB 4NK4A 2IZ7A 2YS6A 4P7KA 2ICAA 4ZT2A 4ZV9A 1S1MA 3WHIA 1E2FA 3GRUA 4UFNA 1O4VA 4BTVA 2F59A 4LBZA 4EHIA 3Q9UA 3G0OA 5FOUA 1AM4D 3N5CA 4KN9S 1RYYA 1GHTA 1VGRA 1YB4A 5AKXA 4BNWA 4KPYA 3FDZA 4KGZA 2X7XA 3NHWA 1XRNA 4M9XA 1HPLA 2GZDA 1PHPA 5IBCA 2X1LA 2FEOA 1PR1A 4PS1A 5LA6A 4WCFB 4PGHA 1HSZA 1X0XA 2PU7A 4YJHA 3VH3A 4ALLA 3ZHOA 1N0IA 1M6HA 4M46A 1DJLA 3SU8A 2PD6A 4DA4A 3FLMA 5J4HA 1WHSB 1IN4A 1M0TA 1DJNA 4TLMB 2D2XA 3B5EA 3HL0A 5I6DA 1OVGA 5CD1A 4GZ5A 2YFQA 5I5GA 3UJBA 1SKYB 2W22A 4DMKA 3AM1A 2FPLA 4WLUA 1AUXA 4MQEB 3UHOA 1LA2A 2DX7A 3O74A 3ML1A 4J94A 3I45A 4DWWA 4LMPA 1J20A 3M8KA 1B0ZA 4MQ5A 3NIDB 1ETHA 5ABPA 1LEHA 4BNKA 5B7GA 5ERYA 1ID8A 1ZIOA 3Q41A 3R6LA 3SNKA 2C5AA 4OUDA 3T3EA 3HM2A 3NHZA 1P74A 3WLFA 5HIIA 1Q16A 3IBTA 1JQLB 1L6IA 4JOCA 4BLSA 4YMVA 4KVGA 3ZVKA 3TQHA 1V8ZA 3QPDA 1S2IA 1HE5A 1U3GA 3DDZX 1ABBA 4FU0A 3IJRA 1DEOA 1RIIA 1G8AA 4PGAA 2HU7A 2G17A 1K98A 1CJSA 2WLTA 2XUDA 4L5AA 1S3FA 1Q7EA 2P4UA 3EBLA 2F1RA 1BMDA 3FF4A 2QZPA 2H5EA 3O83A 4BPBA 4CM4B 3U5ZB 5KKAA 3S27A 2P75A 1R4MB 1E6LA 4CTOA 4JCCA 1GLGA 4BP3A 3L8DA 3LSTA 1DPFA 4X66B 3U3OA 3P71T 2JHAA 4R5MA 3UAOA 5AHXA 3DPSA 2WA1A 3E48A 4B6QA 2X41A 2O7QA 4J75A 2HQ1A 3VZSA 4RDXA 2IBTA 2P5UA 5BQOA 1RJ9A 5HJ5A 3H6GA 3NHFA 2OHIA 5GVSA 2DHDA 1V45E 3X1JA 4RJ2A 2WWIA 4ZO4A 3TX6A 5JPIA 3RIXA 3JQBA 4B85A 1KAGA 3E9CA 3N75A 3IHLA 3GPBA 1VYHA 4TWJA 2I4NA 3L0SA 1E32A 1RQGA 3LTEA 4BVJA 3QPWA 3IAXA 4IF6A 4OXKA 3A9RA 4DLZA 1NKSA 2AOTA 2AUMA 1I32A 1N0VC 1ZRMA 4IGKA 4M8SA 1Q20A 5E4JA 4OLAA 3DQZA 2ZE5A 1ORDA 5KB3A 4V0MA 1ZD2P 3RSHA 1NGSA 1ZUIA 4V39A 5JSZB 4P6VF 2AZ4A 3RK1A 1UKZA 5B4UA 1T9CA 1SRRA 2ASEA 2JHFA 2V7XA 4UEKA 4KBYA 5ALJA 2J0QA 4F71A 4YLYA 2FUKA 4RF5A 3OHSX 4AM8A 1QG2A 1U5BA 2GTHA 2H57A 1ZOPA 2XDYA 4AMVA 5JAUA 3GVHA 4K28A 1EUZA 3TLGA 2PM8A 4AVYA 5C37A 13PKA 1BHSA 1OLUB 1PDVA 3QLVA 4NPHA 5IW8A 1LI7A 3KQKA 4GI1A 1JKMA 3NGXA 4PXYA 2QRQA 1TCUA 4MK4A 4KLRA 1U2GA 5EIEA 3BMQA 3ZGYA 3PBKA 5BVHA 4ENQA 3K0HA 3FNRA 5TMBA 1H94A 1TX4B 1XMXA 3KPYA 4FPXA 4M36A 4UU7A 1H66A 1ZH2A 4KYVA 3GLHA 4GYYA 3M6LA 4ZANA 2B7BA 2HBYA 3WK6A 5AI8A 1E5XA 3E3LA 4X41A 1IOWA 3R7LA 2Z9DA 2CL7X 4QO7A 5EWJA 3M6IA 2QUKA 2OQRA 3B20A 3JPWA 4KV9A 4PPGA 1GVNB 1HZZC 4L08A 2OEPA 2C1ZA 2WW8A 3AUKA 3DO6A 2EWMA 1KAMA 2NUPB 3OCXA 4LZLA 2I6TA 5CXUA 2RI6A 3B1WA 1UFVA 2G1KA 3GRVA 5CYOA 1W4LA 3I9OA 3K16A 4BEJA 2I55A 3B5JA 3ODPA 1GNSA 4MWTA 4GYJA 5CVDA 3WQHA 1SD1A 5IK2D 1RP1A 4NBNA 1ZXBA 3UXMA 1J0AA 4RMNA 5JXJA 4H7KA 1CP3A 5EMMA 2IXFA 1UEXC 4GNRA 3MUOA 4AO7A 4KRFA 2PXXA 2OLEA 2HM7A 4TLEA 1VIVA 2PL9A 3BHJA 2YXEA 5DN9A 1KMNA 3W0LB 2Q0SA 3LRXA 2VHVA 3DCNA 4BFLA 3OQBA 4KUEA 3I9V1 3T3NA 2J5QA 2Q1UA 3B6EA 1XCMA 2OORA 3NJRA 1Y3BE 3HM9A 4A15A 2BMEA 2MMCA 1BFKA 4GPAA 5EJGA 1K68A 3GLFA 1U63A 3HSKA 3IV6A 5EA2A 1A5TA 3T9CA 4CWAA 3JQ8B 3N28A 1RI1A 4MJXA 5KSPA 1Z06A 4FI3C 1X1TA 2PQ2A 4DAOA 5L4LA 5LR6A 5KOYA 5F77A 4C4SA 5C80A 3QUTA 1PFWA 1PT8A 2L0XA 4ND1A 2V8BA 2A92A 1V7QA 1J39A 2VBIA 4KR7A 2ZJ4A 3COZA 2CMHA 3GUUA 4AU1A 4DZTA 5DN6D 5CLHA 1O0CA 2YASA 2YW2A 1QVAA 1WXQA 1XYYA 2AKYA 4DIDA 4F4IA 4LJ9A 1G6OA 2XMQA 1FTSA 1QANA 3TOZA 1C3EA 4JYCA 2QMQA 3ZLUA 5IUKC 1TAUA 4A6EA 2EV9A 4J7XA 4HY3A 4X71A 5FEUA 1JG2A 2IF2A 4RPKA 1B43A 2D5CA 2ZB7A 3KKLA 3LO5A 3KD3A 1QZTA 3BIOA 4L8WB 4S1TA 2EAUA 1ZIPA 4Y2JA 3BS4A 2HWWA 1CT9A 1WMEA 2I76A 5CH8A 5T64A 3WA6A 5K8TA 4B3RB 1TF2A 1R00A 2FK8A 3O4VA 4D96A 5C32A 3JAWB 2P77A 4CM8B 2AS0A 4BTLA 4E4TA 1TM5E 1CR1A 1XVAA 4WY5A 1WSWA 4FT4A 4REMA 1J09A 2VJLA 3TAHA 3AMVA 4Q1EA 2Y93A 4RJKA 3WP0A 4DNFA 1TEHA 3QV2A 2HX1A 2VFAA 2H31A 3DKIA 1VJCA 1CJVC 1B7GO 4PX2A 4WCVA 2BGWA 3PGKA 1QONA 1VDMA 4L2IB 4NJMA 1BDBA 4XGIA 5FFFA 5GONA 1J2UA 4CIDA 4K1XA 2FFRA 3ROMA 2FFAA 5IAOA 4YCSA 1Z4JA 5JCOC 4YO7A 2RD2A 3AR7A 2M98A 3SMQA 4DEVA 2PMEA 1F7UA 1EQ2A 1MX5A 4L5CA 1P19A 3F7TA 1EM8A 1WXGA 2PT7A 4GMXA 3TJMA 4KR9A 3DXYA 2G9NA 1Y6JA 2Q21A 2P5TB 2W2KA 3WAKA 2ODAA 3GZNB 2VF5X 1VJ5A 1XRPA 2EEPA 3H5TA 2OO5A 1XROA 3VR6A 1D7AA 1O0SA 2QRZA 2WHPA 4NZOA 3SPXA 4EJFA 4N76A 1N3BA 2V7WA 1RMYA 3ZKWA 3A3YA 3VZBA 4YMGA 1ZJ5A 1CUWA 2NYAA 2QYTA 4E30A 5HKLA 4MW1A 3PL1A 4BVKA 3O8RA 1CUDA 3B6MA 1I1HA 2BEWA 2FA9A 2WTXA 4Y1RA 3FZGA 1TXGA 4NNOA 3D4IA 5LSAA 4P4SA 2ZSAA 4TT8A 3OEHA 1J33A 4D4MA 3RWMB 5JAMA 6AT1A 1R6UA 4Y9TA 3G02A 2C5BA 1NLFA 2Z30A 1Y4UA 1G0OA 4JL6A 3KUCA 4IZ6A 4NU0A 2YJGA 4MLCA 4RHUA 1MHPA 2YYYA 4U7HA 1NMXA 1OE0A 1LWNA 1S89A 3BGWA 4MGHA 3VR0A 3GAFA 1PUIA 1XYVA 1GPJA 1VL2A 5JS6A 1IUNA 1QH9A 2JIPA 5EVCA 1Z62A 4ER6A 4ZJUA 1R0SA 1Z07A 4UXHA 2ZCUA 4Y2SA 4MUHA 4ROSA 1OFIA 4C0SA 5CB4A 2XCSB 2JG3A 4Q1DA 1ITZA 5DXAA 5FHRA 4BRSA 2AYZA 4QLBA 4RE6A 3WSWA 3RYCB 3TQOA 3SC6A 3IEXA 4HDNA 1N5DA 2A1TS 1J5EB 3EGDB 2C2OA 3LBIA 3VDQA 4JUCA 3DWGA 2LCQA 1XBTA 2WF7A 2IHTA 3VPCA 4GL2A 1DS6A 3TCKA 4DKJA 1H5NA 4YT4A 3FGNA 4KE8A 2ADFA 1W29A 2HQBA 1INLA 3P20A 4UBMA 3ZHTA 2O5EA 1JDVA 1DC8A 1S2OA 3KJFA 2J5RA 1RIFA 1EE1A 5H1YA 1MNQA 2CFIA 1I3LA 4FR0A 3VMFA 3X1YA 5J2UA 3DZIA 2GD6A 3AHFA 5H59A 3C6ZA 1R5JA 4CFZA 2ZWPA 1UAAA 3MCTA 4EMBA 3F4BA 3N8HA 1E1CB 4YI3A 3WNBA 1BH6A 4O4JF 3JARA 3R7FA 3V8PA 2B1GA 1ACLA 1Z15A 3FDFA 3W8NA 5EWLA 4RD0A 1UMCA 3G68A 3RIMA 1SIWA 4HAXA 1YRWA 1WG8A 2BBTA 2FQ1A 4KACA 2UZIR 1NL3A 4UM5A 4C14A 5AKEA 4EDHA 4X94A 1Z63A 2UUOA 3AOGA 4QYSA 3DWIA 3ECAA 4JWKA 4TVSA 3A9WA 3LDAA 3PJFA 1RAAA 4YCDA 2D0OB 1YV9A 4BMCA 1OLOA 1BWQA 2OK8A 4Z2AA 2HRDA 3DCIA 5EPUA 4OMDA 2RGCA 2FDXA 3HPRA 3NBMA 1LJLA 1Y6GA 1YJ8A 4CQJA 1GRQA 1E0KA 3ET4A 4QUBA 1LDEA 4P3PA 5LDDC 4M76B 3AEKB 1TGYA 1ZXXA 4QSHA 2W6JA 5CPBA 3H5NA 3UT5B 2ZRMA 5C1BA 2V4UA 5KSWB 3T1QA 4DSUA 4POOA 2HK9A 2QVXX 3KJEA 2B8WA 2OT3B 2V9PA 3HDYA 4U3JA 4KOAA 3W9YA 2PZ8A 4JXJA 2X0EA 3GFOA 1LDGA 4MTCA 1T4MA 1RQLA 5EQDA 5DYWA 3JCZA 4QJ3A 2H4FA 3TPFA 3GLIA 1DUIA 4BNUA 2CLKB 1Z7YA 3H42B 5ALSA 1C5KA 3QXJA 4BQNA 3T9BA 4ZI7F 1X1QA 4L27A 3CRMA 5TEVA 3DMTC 2RH4A 4QUEA 4ALNA 4ECAA 2XGOA 2FR8C 5KEIA 5EP1A 4IIJF 3WDKA 4YECA 4JKYA 1P1KA 1JGTA 4LMAA 2L69A 1GZSA 2DHQA 1XN1A 3Q11A 4Y2UA 4V1CA 2JJQA 1EGMB 2CY0A 4MUYA 1H6DA 1PL7A 3N2ZB 1JVNA 1V2GA 2WYOA 4R1UA 1J90A 2EWWA 1DBPA 2A0WA 3WB1A 1FTNA 3H5WA 1XCLA 3LPLA 3SJUA 1I7QB 1JAIA 2Q3JA 1N4AA 1Z5ZA 4CTKA 2XE8A 1H6BA 3HKDA 1K8XB 1LZLA 2IWHA 1GGNA 1BOFA 5KYUB 3RNLA 3HKEA 1QYVA 4QUJA 2AGVA 3VPAA 1ZN2A 3JQAD 5KU7A 2JLRA 1E59A 1VKJA 2MDTA 3DDHA 3QNWA 5REQB 2AMVA 1LXCA 4K0RA 2C29D 4YJGB 3OZ7A 2XX3A 1EVJA 1NBMA 1POXA 4US2R 2ES4A 4IR7A 2PSSA 1G8SA 2XAAA 1QH8A 1G8YA 1UK8A 3DOFA 4OM8A 1MENA 3E82A 3UXEA 4O2AB 4F84A 3DEHA 1FJXA 3MBIA 5INTA 3ZHYA 2N46A 3BWBA 5BRJA 1EVZA 4D41A 4EUSA 2VLBA 1F2TA 1F9AA 1U1FA 3IHWA 1P5ZB 2H8KA 3HWSA 3T99A 2JJ1D 4KXQA 5LP6C 4G89A 1YCGA 3O1JC 4G0VA 2P7HA 1C2TA 1WM1A 4HCJA 1ZR4A 5I7FA 3KQSA 1Z2PX 1U3TA 1IXSB 3IDFA 1OWLA 2W2LD 4P7BA 4M1EA 3SKXA 4BQSA 3PEWA 5KYXA 4WBNA 5JPDA 4EFLA 3D8NA 1I1OA 4BIIA 1Q14A 2ZBFA 4TSFD 3MJCA 1QIIA 2OOSA 3RARA 1PWEA 3C48A 4BUCA 4INOA 3SOZA 4JC8A 3DPIA 4GKVA 3R8FA 7ADHA 2CE7A 4J0DA 3KP1A 1FSSA 6REQB 4H08A 4MUJA 1CJKC 2ZVJA 3VPHA 3C5HA 4QDKA 1XCJA 1SC1A 2GWHA 3QRWA 5SZKB 3U9SA 3UPUA 4JY7A 4YP5A 5KWVA 1SD2A 2WTNA 4K6HA 3AT1A 2BUCA 2EIHA 2QTCA 1D2HA 1Z13A 2EL9A 1X15A 4EHLA 5KS2A 2V7BA 4AS1A 3BJEA 5CUQA 2HZBA 3NTOA 4DBVO 2P9GA 3VZPA 1JHYA 4X7PA 3EVAA 3K9CA 3G89A 5BO5A 5DW0A 1XQXA 2EP7A 4LY6A 4U2KA 5GZ1A 3B3AA 3P4XA 5TMDA 2B5VA 4ZYTA 2PUEA 1GILA 2P40A 2P2NA 3QELA 4L50A 4PX3A 1I94B 1USIA 1H4VB 2M1ZA 4NH0A 1AGYA 4QPNA 4Q7QA 5BPFA 4MZXA 1L7NA 2ZE6A 1P2BA 3MCVA 4IO0A 3EIHA 3FDZB 1R37A 4NAUA 5CW1A 3BMCA 3W6NA 2FOIA 3C3MA 1C9DB 3GEIA 3GJRA 1NW3A 5LA6B 4H77A 3OE7D 4ZU6X 4FJ2A 4I4TF 5BN4A 2O7RA 2BHTA 3DZ8A 4MWZA 1OXKB 3ENVA 3D3WB 2CJFA 2V74B 3KVVA 1Q3TA 1U8YA 3DP7A 4B71A 2HRCA 4MWBA 4RAOA 1P4RA 3HR4A 3GW8A 2C96A 1KK1A 1E0SA 4NAHA 2A9PA 2WTUA 1U4NA 1PG5A 2GJ9A 2IHKA 3Q3GE 4RLHA 1ODFA 3ZK9A 2EARA 1WSDA 1YRAA 2PU5A 3CC8A 1ST2A 3U19A 1YVDA 1JT2A 1ZSVA 4QU9A 3TQRA 5JW6A 3AUSA 3IMEA 3PITA 2NO7A 3P4YA 5A3QA 1IONA 1QORA 1LTHR 4P7JA 5IYZA 2YN4A 2IZ5A 3LX6A 2H1HA 3MMXA 2Y0PA 1GYPA 3V2UA 5F2OA 4BBAA 2V03A 3B7WA 3BTOA 1Z6YA 2UDPA 5DCYA 4BXOA 5HS4A 2PMBA 4GWLA 1VPTA 3OPVA 4BMXA 5EIHA 1ENYA 1YAJA 5B55A 2W2NA 5B7PA 2BHSA 3JWPA 3THSA 5C46F 4H3VA 1RPZA 1B16A 1BWPA 1QYWA 4ND5A 4ZVSA 3VNUA 1H1LB 1Y7IA 2CYCA 3G1TA 2EL7A 4WFIA 4HI0E 2D0PB 2C8JA 2IEBA 3KHKA 1RVV1 3ONWA 3Q5DA 4I1VA 2PTHA 2QMHA 4LRUA 5CCXA 3AW8A 4OI4A 4K87A 3I1YA 4RABA 2P3OA 3LYHA 1KJ9A 2C8VA 4GP7A 4CNBA 2Z2JA 1IN1A 1DRVA 3ETNA 4G0QA 5CXQA 4LHXA 1ICIA 1YBMA 1DXQA 5DLQC 1CQWA 3B48A 2PWZA 1YZQA 4HDSB 4FONA 1CUCA 1N9KA 2JL1A 1T13A 4H1VA 2WWFA 5CGZA 3S4YA 1ZCAA 3TCXB 5A6VA 3HN2A 3EVBA 4NL4H 2GYUA 4K6GA 2BGRA 2M6RA 3JR7A 2D7DA 3M5WA 1QHFA 1HKUA 2AOVA 3LWNA 4G1CA 2ZSIA 4J0IA 2W6IA 2ERXA 1PR6A 4OV6B 2CLHB 2IITA 3SDZA 3WWDA 4YJ2A 2A5GA 2O05A 3P9NA 3GLRA 3VAZA 5HYVA 3BILA 4MA4A 3THOA 4WKCA 4C2BA 4J8PA 2GM4A 3PHGA 3VGPA 1NXXA 2JKZA 3KT3A 1FFSA 1VRVA 3ABRB 1TGVA 2QENA 3OZEA 3HA7A 2VP6A 5JMTA 2C0PA 3LLMA 3L1IA 2G82A 1PK8A 1QVVA 1K0UA 2ZI9A 1EX1A 2Y6UA 3AJ8A 4GI7A 3FJOA 4R54A 3I39X 4ZOCA 3EZ2A 3T3PB 3V2GA 1VBMA 2R25B 3V42A 1YKFA 3L6RA 3LG2A 2F1IA 1KPGA 2RCNA 3TLGB 3ELBA 4BGVA 2WJ4A 2Z2KA 4DCTA 1E8MA 1TZKA 2PBFA 4ZZ1A 1LI4A 3L8FA 5KJ1A 1I4LD 1GKIA 5EHNA 3U4QA 1K5DA 1AHHA 1O9BA 2FFHA 1CRWG 3P97A 4R01A 3BMQB 1OAOC 2BC9A 1AGXA 4RPHA 3UK0A 2OYRA 3ZZ1A 5KDOA 4FSHA 2AV6A 5J43A 4MI6A 1JEQB 5A5FA 2NSLA 3GG2A 1OXTA 2BW0A 4NMXB 5A03A 1LW6E 2R00A 3K6SA 1VG0B 4A0GA 2ZBUA 3BF7A 2C7VA 1N8NA 1DMRA 1Z2DA 2O3JA 1IJFA 1A8HA 2RONA 2BKVA 3C4QA 3EUAA 1CZOA 1XZIA 1B8OA 4RH1A 4TL8A 1VBNA 2IUTA 4DSOA 1P5JA 4Q1FA 4AF8A 4ARUA 1H2AS 1K8ZB 3CLKA 3ZUPA 4A3SA 1F0KA 1HLGA 4K9RA 3KO8A 1ES9A 2OLKA 4R8MA 5AXCA 5CCEA 1JMVA 2C9MA 2GARA 1IN8A 3I6IA 1G3QA 1I0IA 2PT5A 1DC6A 3FF1A 3O7MA 3Q7RA 4XOUA 3MM4A 3EXEB 5IXYA 4YAFA 1RADA 3KAKA 3PFKA 2W37A 3ZCQA 5LM3A 3NIFB 2Z8ZA 3L5OA 4Y2YA 1E64A 2JCYA 4XCVA 3V1UA 2GM3A 3ZE7A 1Q0ZA 3EVDA 5CA1F 3M81A 2FCRA 4G5YA 1LF0A 2XUOA 2X1MA 3R8CA 4ZT7A 1WPXA 2FG6C 4MIOA 1JG3A 1L5RA 1V96A 2KM1A 3K8OE 1J0DA 2W2MA 3OJXA 2QSYA 4RYDA 1J2TA 2NZWA 3GT0A 5B12A 1XXLA 3W7AA 4CIYA 2HV8A 1Q1NA 4YP9A 1JSXA 3E4CA 1XEFA 4QDOA 1Q92A 1T5OA 1R6BX 2H1SA 3FB4A 4QQKA 5DHSA 5E7JA 3VSDA 2CCGA 5KYGA 4LEIA 3VYWA 4BZPA 1S01A 3U0BA 3EPLA 1RC8A 2Y67A 3PDUA 2ECFA 4IKOA 2H1RA 2P6PA 4N3GA 5ESWA 1MEOA 3WLOA 1MLDA 5CITA 3EDOA 1XZPA 3ROTA 5BWCA 3QVTA 1E1RA 4YBZA 1QNLA 4M8NE 2ZBQA 4PHFA 3TUZC 2JGFA 4Q24A 4DV3B 3X0DA 3L8EA 1JKXA 1U9ZA 5EQTA 2PL5A 4QVIA 1WXHA 1YOVB 3DXXA 1KU0A 5FA6A 1NXQA 1NKTA 2WU0A 3DMNA 5JSKA 1K0FA 4LXGA 3HKCA 3DMGA 3PT9A 1STOA 2GT1A 1V7CA 2XUAA 3E22A 3M9LA