3HCNA

Hg and protoporphyrin bound human ferrochelatase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
publication title Product release rather than chelation determines metal specificity for ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 134
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcnA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcnA01
2Q2OA 2XWQA 4KLRA 1L8XA 2QD4A 2XWSA 4MK4A 3HCPA 3LYHA 1C1HA 1HRKA 3GOQA 2C8JA 2XVYA 4KMMA 2PNJA 3M4ZA 4KLCA 2QD5A 1DOZA 1LD3A 2QD2A 2HK6A 3W1WA 2HRCA 2HREA 1N0IA 2QD3A 1TJNA 2Q2NA 2AC4A 3HCRA 1LBQA 4F4DA 1QGOA 2H1VA 4CCSA 2QD1A 2PO7A 2H1WA 2DJ5A 2XVZA 1AK1A 1C9EA 2XVXA 3AQIA 2Q3JA 3HCNA 2AC2A 2XWPA 2JH3A 3HCOA 2PO5A 4KLAA
chains in the Genus database with same CATH superfamily
2CXSA 4UUNA 4DA8A 1A50B 4EAQA 1ZOPA 3FYUA 4D4IA 2BDUA 2FFJA 1PJ2A 1TF5A 8MHTA 1JLMA 2BR4A 1TO2E 2QGZA 2AN9A 2BLLA 5KQMA 5K01A 3I28A 5DHSA 5JCOC 2XRMA 3OAAA 1WMBA 1LV7A 1HZJA 4H3KB 1TMYA 3I5AA 3KTFA 4QGBA 3NHJA 3CURA 3RVMA 3U4AA 3MCTA 3NC1C 4DR4B 1PGJA 4AP6A 1AB5A 1C7JA 4DDUA 4LNHA 3QYPA 4XIYA 1VKJA 2EYQA 5A9SB 1B0ZA 1N1EA 1XVLA 4JR1A 5I3CA 1ZIXA 5CG2A 1XRSB 4UTXA 4KE9A 1U99A 3DBVO 1BMFD 3L8FA 3I58A 2TYSB 2QQ5A 2NX2A 3E0XA 3WA7A 2FSVA 3CJRA 4ZAZA 3FCUB 5K0NA 3RVNA 5A9RA 3V42A 2GJAA 3T54A 1C3OB 2NV2B 2FWBA 3GEGA 3LT0A 3SJAA 3NGXA 4DV3B 1CRWG 2XCRB 2JGFA 2AUMA 5KO2A 2CZQA 1JEEA 1HYQA 1PS9A 2X5KO 2YVUA 2OGSA 2Z1NA 4ZJPA 5I9LA 3LU1A 2BIFA 3RYHB 4OI1A 1A76A 1C8KA 1FYWA 1ZC4A 2A1IA 4FI3F 1SNYA 2O05A 5CA1A 1XYVA 1G4UR 5F12A 2QHXA 3KHKA 3SC2A 2ZSIA 1HGXA 3U9TA 4DCVA 2ZBVA 1OTYA 4FIDA 4R2IA 3V7YA 3OQ1A 5F4ZA 2OWDA 2GTHA 3FUTA 4HAXA 2J09A 1KDTA 2VHTA 5IZ4A 1YS7A 2IPLA 4BVGA 2YY5A 1ZIOA 2FPXA 3ZY3A 4OAQA 2DBVO 3KM0A 3TSCA 3BREA 5EI5A 2WWYA 1Y6RA 9MHTA 1B41A 2C8VA 4HD8A 4NL4H 4UZSA 3L4KA 1P77A 3NT5A 2EBWA 2YS7A 1NMQA 3D0QA 4OY3A 5C32A 1TCAA 3GFSA 3P5BA 1LH0A 4HFNA 3T5AA 4IG9A 2Z2JA 2C61A 3MJSA 3V9AA 1KGDA 2RK6A 3CPEA 5K3AA 4N7MA 2CEAA 3VR2D 1GCOA 1RYHA 1UBRS 4REQA 1M5UA 1W36D 4L28A 4BX2A 3CJTA 4WI1A 1MENA 1C9DB 3DC2A 1NKVA 3TCNA 5L4SA 2OZKA 3G6WA 2HJWA 5TARA 1H8ED 3NBFA 1HETA 2C5FA 1VDZA 2P9JA 1DIHA 5SYNA 1H42A 2QENA 1JLHA 4Q01A 3KV1A 3SHVA 5ALQA 5AD1A 5K8IA 3K1AB 2I4LA 5DYGA 5F1KA 1JEOA 3OY2A 1Q0QA 3BSYA 3OLZA 4NPCA 3CPSA 3MTDA 5DCWA 1GCUA 1N1DA 2OCIA 3F3SA 4OFXA 5G0TA 3L1HA 1GYPA 5A7FA 3KQNA 2Q0SA 2QUIA 3PFFA 4JY7A 4I81A 1E3SA 1Z2OX 3RSZA 1KI4A 3N3AC 2HU2A 3QE3A 5DM60 3FR8A 2IRWA 2DWUA 2Z5LA 4DC1A 2H48A 4BYGA 4KACA 3I2KA 5E1MA 1N4AA 3RVDA 1ACMA 1L5HB 2YNMC 4P36A 1ZAYA 3EZNA 1FYXA 3FMFA 1DLIA 1VYTA 3QHPA 3RODA 2FZGA 3SICE 3X0DA 3I5UA 4ZYZA 4N0EA 4DDTA 2ZJAA 4M9XA 3JQPA 4PRLA 1P7YA 4TSRA 1R0ZA 3UMMA 2BMAA 3T41A 3C6MA 1A9RA 1T8UA 2I33A 3PB3A 3RSHA 1ZJWA 3D6AA 4M0KA 1XZGA 1DO2A 5GV8A 1ZM3A 4B3RB 4OI2A 4AG3A 5EZSA 4K6GA 4E30A 1QOZA 1XMXA 2QYOA 5B3AA 4QGSA 3W4IA 3OZAA 4HDNA 1RBMA 2IEIA 1XTIA 1L4FA 1Z0ZA 2PV0A 2VK1A 4GPZA 1LJUA 1MTZA 2HK6A 1UEIA 4IFIA 2JLVA 1AD2A 1A7UA 3MGBA 5DLYA 1OI4A 5JASA 3T35A 1OBOA 1Y1KE 3LVFO 5FPPA 1XZEA 3NPAA 4MKGA 5C80A 4UEWA 4D9NA 2YRXA 4UC0A 3ETDA 1OBVA 4FOOA 1WXDA 3GC6A 3WI7A 3SHQA 3AQ4A 1C9MA 3C6QA 4BIMA 2HRQA 4B31A 2LTAA 2ZWAA 4RD4A 4Y6PA 5DU2A 1Z0SA 2H2HA 3AKCA 3BE4A 3PDCA 4FBLA 5B5SA 1CJSA 5IT0A 5K05A 4PWYA 1QGZA 1INLA 2D5CA 1KARA 2Q2OA 2Q9UA 1S89A 3PVCA 1TZCA 4YREA 3MWEB 3QVXA 1GPH1 2ALJA 4KN8A 1K8QA 4LZJA 2HX1A 3IQXA 5C4GB 4P5EA 1WMEA 2A84A 3PEUA 3DQZA 4DRXA 2PLFA 1UKYA 2QTRA 1Z37A 4RKEA 1DXYA 2P5YA 5DWVA 3KJIA 4R3NA 4KIFA 5K3OA 4S12A 4XM2A 1AURA 3TLZA 3ZH9B 3ED1A 2I4RA 4CBVA 1G2IA 2BM1A 5AJWA 5IULC 4YPOA 1XNRB 2IH2A 4WGGA 3Q10A 5FLEX 1WUIS 3TTXA 3VYSB 4M1QA 2XVZA 2ERCA 1T8SA 4GWKA 4PZUA 3CVUA 10MHA 3V7WA 4QDKA 1DRVA 4KIWA 1ZH8A 2H29A 2YRWA 2LDBA 2VTDA 1HK7A 2Z2XA 3IXQA 4CCAA 1TM7E 2L42A 3OOHA 4JJ6A 2TS1A 4ZU3A 1MH1A 1AZLA 4R31A 4BNTA 1V11A 5EPEA 4ZI7A 2BZGA 4R05A 3VAAA 1X15A 2HA5A 4MUEA 2JIPA 3DR3A 4C22A 5IHXA 4B7UA 1VLJA 1E9BA 4X3CA 1RMQA 1K06A 4LYAA 1QP7A 4UTRA 3FHTA 3OO0A 3AX6A 5KTYA 4WNAA 3JSXA 1YMVA 2QQEA 4HNAB 1GA4A 3G0OA 4B79A 1CY6A 3A9CA 3A1WA 4TSFA 4TWRA 4AF8A 1SXJD 4PPQA 3A1UA 1Z63A 2AOTB 3JD0A 4XARA 1EP2B 3DMDA 1PZHA 3PRJA 3LUCA 5ALUA 2AEFA 5B3JA 5EMJA 5CDTA 3BGOS 1N6RA 5KC8A 3AGPA 1S4QA 5E7IA 2R7NA 2G25A 4XFKA 4ZJUA 1Y1SA 3UG6A 3G9XA 4LN1A 1OJ7A 3T3NA 2DKNA 2D1TA 3HBJA 3TG2A 4U8HA 2MINB 3GCWA 3K2BA 1N25A 1T15A 2H2FA 3K0EA 3KXKA 3O1LA 1G20A 5EWMA 3VKUA 4Z3OA 1I8TA 2PVSA 3DTNA 2X4GA 5LQJA 3ZDZB 1ISIA 3KT3A 4U8GA 5CHYA 2DPLA 2J33A 2Y2VA 1EG7A 4PM4A 4W5NA 4QDXA 3HB4X 4IXDA 4WFJA 4XCQA 4IX9A 3D54D 1U2PA 2HM7A 2JIRA 3TE6A 1YQ9A 5FQNA 1YJAA 1OX5A 2E4WA 1I0ZA 2H0QA 1Y3FE 3DZCA 4K6KA 4PZ9A 2MSLA 4R8VA 4TYQA 2NO6A 5E1OA 4B74A 4CM7A 1TI7A 3TNJA 4NDNE 2Q1WA 1NOJA 1WEKA 1RNLA 1B93A 3G17A 4QRIA 4Y1RB 4D57A 2GBLA 2GMWA 3UFXA 5ICMA 3AHCA 4AY6A 4K0KB 2B1IA 1BXRB 1WPGA 3TS1A 2P65A 2HA4A 4GBGA 3DFMA 3RAJA 3UF0A 4LHSA 4JH0A 3OFKA 2HRDA 3IR5A 1PYDA 3GCGA 2ZSEA 1VJCA 1FTSA 4IR7A 4OHKA 3DEKA 4I50F 3V8RA 4UBOA 5YASA 2VF5X 5CFLA 2QMQA 3PEVA 3RS3A 1UZAA 3BWYA 1I2BA 1IHPA 3BAFA 3D7SA 3M81A 1T8TA 3N8DA 4KFTA 2IS6A 4GOND 3TZLA 1QQ6A 1NVWQ 4UM9D 3RVKA 4GOXA 2NU9A 4NFHA 2HNKA 2O3QA 4O0LA 3TLGB 5I5GA 3KYDB 3PCXA 4DAOA 4TYYA 1SKQA 4MI9A 3C3EA 1I4WA 2RHDA 2BFCB 3AXTA 3FZEA 4A2QA 2B8TA 1E4EB 1OB2A 3PX7A 4DLBA 5EY5B 3NKVA 3IUNA 1AKNA 5AKLA 1QB7A 1QIFA 1Z0FA 1EESA 1YTLA 4KQ2A 4LNUB 4P3YA 2ZRMA 1QLJA 2JIQA 5CLJA 5KZMB 4CCYB 3PJRA 4C0QC 4R1LA 1PNRA 1HYBA 1OV6A 1P73A 3N7AA 4CF6A 4IICA 3CF4G 2AJDA 4RHEA 3F98A 3R3WA 3IB3A 5JDCC 1GLGA 1NG9A 3GVHA 1Z62A 3FE2A 3HA7A 1D8TA 5BQ3A 5T64A 2IUYA 3E58A 4LVUA 3AL2A 3MW8A 4CN9A 1MVOA 1FSGA 2IODA 3FTFA 3VH2A 1S01A 3NIBA 4WV3A 4M37A 5E3IA 4UBKA 4N8EA 1H4QA 1N5OX 1PT8A 2YHAA 1P60A 1QMGA 5CB4A 1V1JA 1DJLA 3HDYA 1II8B 3M6XA 1QGUA 4TTAA 2D2VA 1QFMA 1WTCA 2E9SA 3H2KA 4QOSA 3ZBTA 1S3GA 4DG5A 5H1YA 2H5IA 3A05A 4L8WB 1WOYA 2FEKA 4QPDA 4Y67A 4HRXA 1AQUA 3G1TA 3VOSA 2IYUA 2IUUA 4QYIB 3BBLA 4M38A 4Z4FA 3ZDFA 5M7EA 2IIVA 4RK5A 1SC3A 4CR7A 6YASA 5F64A 5LQNA 3KL4A 2Q99A 3ESQA 4PNZA 3HCOA 1IY8A 1DLJA 2BFPA 2PG3A 3NKFA 3AHGA 4PO3X 4YDRA 1X0VA 1PJZA 2REXB 3HLKA 1GQOA 1D3AA 1YIAA 4GGPA 1GYQA 1UMDA 2PX2A 1E2JA 4J4BA 4ZD6A 5HG0A 5CEEA 2C2OA 1B16A 1QGED 2IYFA 5IF3A 4B8ZA 2WA2A 3HB0A 3OX1A 5BN1A 3I9V6 5FWAA 1R6TA 4NOJA 3VPAA 1QMPA 4FVTA 1O8CA 4FC7A 5CYGA 2WP0A 3P4XA 2NZXA 1GVHA 4L4SA 1L5OA 4BUZA 4QUKA 1ULBA 2LPMA 4GM0A 4NLLA 5JYEA 4J29A 4LC1A 4YALA 2XZTA 1HNZB 2F17A 2Q1YA 3VX3A 1QZUA 3PVSA 4ND8A 1I2MA 2PUCA 4M2LA 2NP6A 3FNRA 4YRPA 3LCVB 3RFVA 3ZHOA 3EGVA 5TJHA 3D4PA 2DLNA 2MT9A 5JO9A 5MFPA 4CTOA 1GKLA 3U5ZB 3ENZA 4HJXA 2VATA 4WEOA 1NATA 2O3TA 5L3RA 3B3JA 5CM8B 3HACA 2BFAA 4G0ZA 4HAOA 3TL3A 2OB2A 3SX4A 2X9LA 3K0FA 1UFVA 3OJXA 4LXGA 5ICFA 3SSNA 1TA9A 1TT5A 2QD3A 5MN5A 3EG5A 2WJVA 1E1KA 2NTEA 1R00A 3KJGA 2PKEA 5E2BA 3PI7A 4X0EA 3KPWA 4FCWA 5JCJA 4DRZA 1XMOB 2J0EA 1N8TA 4BBZA 3CPJB 1IJBA 5J59A 2RAPA 2Y68A 1JV2B 4HZUA 4DUGD 4GMHA 4TLEA 3B1YA 1CUIA 2ZIXA 4J1QA 5CNKA 2QTHA 4NABA 1WA5A 3BQNB 4B4VA 3H2GA 4KWHA 2XMDA 2QX4A 3BHNA 1PJ8A 1M2HA 2ATXA 3LOQA 5DXJA 2CBXA 3MINA 2QI9C 2GA9A 5EJ5A 1OGJA 2VYVA 4AWAA 3MUOA 1E2MA 1N2GA 3PQ6A 4MHOA 1E66A 2IOHA 5BSVA 2IYVA 3L06A 1VSUA 2JIOA 1PGOA 2I3AA 5TPZA 2VBIA 1GPYA 3IL2A 2ESRA 4JI7B 3UGTA 5FIUA 3GEEA 3RRXA 3VTFA 3G1WA 4B47A 4B6EA 1U31A 3AYXB 1UBFA 3RC3A 1ECFA 3DFKA 3GVIA 1R4MB 3HEMA 1RWXA 4H1HA 3UOWA 3AB8A 4RY2A 4INOA 3RSSA 2XTZA 4Q7EA 4JWKA 1JL3A 2ZEJA 1P6UA 1OILA 4JWTA 2AKYA 5JYBA 3DDSA 2POCA 5L4LA 1JMKC 1ZXLA 1BS2A 1SHZA 3HO1A 4OQEA 2MSKA 1T9AA 2F3TA 1RBYA 1JALA 4EFKA 3DF7A 3VDMA 2HO5A 3WGTA 1ZUNA 3FDIA 4BZPA 3EHDA 1WABA 3CKLA 3IIJA 5BPFA 4K9LA 1AOXA 4H7PA 3KOWA 1XD9A 4HRAA 1ZIPA 3MT0A 2QLLA 1KEWA 4X7MA 3UJAA 4CZ2A 1JHMA 1ABBA 3AFHA 2HXYA 1WB5A 5CDSA 1KJWA 2JBHA 4GM4A 4JU9A 3WWDA 4TWBA 3PGA1 2P2LA 3E53A 3HSYA 1TVEA 4L22A 1FNSA 4DLTA 4RMJA 3TF5A 5HIMA 3REQB 3RCBA 2GPNA 3IP3A 2A2ZA 4FFOA 2O14A 5KYXA 3LLMA 5E6RA 4OLHA 4IJ5A 1ENPA 5T8KC 4EITA 1E3DA 1U9YA 2IDKA 1X7YB 4Q1AA 4GP9A 4FEEA 1ZGJA 3RJMA 2PYDA 1TU3A 3FDZA 3T0FA 3FCOA 4IV8A 2PFSA 1Q3KA 2QROA 4QGFA 1J06A 3B5IA 2F3UA 1BH6A 2FU5C 2CJYA 4K6MA 4H1WA 5HUHA 1K9VF 2R8PA 2Y0CA 3Q0TA 3ZHTA 1BXZA 1HFEL 3AHJA 4B43A 5LMUB 3LKDA 2C4TA 4NK4A 4KAJA 3SZ3A 3ANTA 3P96A 2XGMA 1XBTA 2A5YB 2VF8A 4OHMA 3QWHA 3JQ6A 4RFSA 2OT3B 1LZLA 3H1GA 1T1RA 5K2OA 5IH7A 1N92A 1QJCA 3CC8A 3EZYA 1JZQA 1M6WA 2V7TA 3IBSA 4KVFA 4TN5A 1PD1A 3QV2A 5KAMA 1RJFA 5DN9A 2GAFA 3GPCA 5J1SB 4BU0A 5ENVA 3WGYA 3S2EA 4LZAA 4PHGA 2BC9A 3KAPA 4JEHA 2E85A 2WABA 4UNIA 3SQOA 2CXTA 4Y2XA 3M4ZA 1T9GR 2VJBA 3PUWA 3DM5A 3JQRA 1H2ZA 3L7LA 3MMPA 1C7RA 4BVFA 4XE5A 2C9YA 4LKRA 4OHCA 4R9VA 3PJFA 4U6SA 4PINA 2Z57A 1A9QA 3F0TA 4JOQA 4MRAA 3OZRA 4YLGA 3OQNA 2ZB7A 1NQTA 5ALTA 2LV8A 4B6JA 2OG1A 3AVPA 3GJ4A 3KQSA 3W8NA 3AC0A 4CKBB 4PC1A 1PV4A 1QH1B 2ZR8A 1PK7A 2X8BA 3GZNB 5ALLA 2D0DA 3GJ0A 4RD3A 2BKUA 4XGIA 3V3TA 4C5AA 4FR0A 4G8JA 4BFUA 1D04A 2ADFA 3G8DA 4F56A 1P0FA 1XVIA 2YIDA 1WO8A 3JYNA 1M8FA 5T4BA 2DR2A 1JZSA 3U16A 3W4JA 3MUFA 4E5SA 1LPAB 3CRNA 3O8BA 4P3KA 4HAZA 1DWPA 4U7WA 1V39A 4JI8B 3FWYA 2PMBA 3CX4A 1Q20A 1DO8A 2BDEA 3NHFA 3WR5A 1V7CA 1XZPA 3CG0A 5FBZA 1RYZA 4JJAA 1E63A 1VMEA 2YYSA 1H2BA 4R3WA 4URWR 3WGOA 4URXR 2QX9A 5JMWA 3ND6A 4P7JA 2JJ2A 3JYQA 3UW1A 3VVLA 4L16A 2HPZA 3O73A 4DCPA 4D4KA 4ZO8A 1A8QA 4Y2HA 5KHAA 4BJ5A 2W7TA 5LNK6 5CT6A 3NHBA 5BWCA 2BRUC 1GRRA 3HFRA 3GT4A 3H9EO 4JL6A 4OLJA 3GIDA 5JQWA 2WDPA 4W9NC 4ZOLF 1FU8A 2PCLA 3FPKA 3ZHBA 3NEYA 3Q2KA 5JMOA 1WZEA 2I8AA 2WWTA 1ZK0A 2E0IA 3FKSD 2F00A 5AM2A 1YUBA 2HLDA 4G25A 1KY4A 3JYHA 3A1NA 4NZZA 3AONB 4MVCA 3WYDA 4DIOA 2O9JA 1XHLA 1US8A 2XYRA 2R8RA 3DBHA 2H1HA 2NYVA 4EQZA 4CEHB 2OORC 3I92A 3L82B 4M0PA 4KRYA 3LQQA 1HDCA 2OP1A 4Q6WA 1CE8B 2N75A 4Q4HB 3TL2A 1PJAA 2IX9A 2QN8A 3JWHA 2AZXA 2QLBA 4E13A 5E7JA 1J5EB 2ZIEA 3ELYA 3ROMA 4OQFA 1PUXA 3TMKA 2FHSA 4LX0A 1B7GO 3FUXA 4HDOB 4IJWA 4OBWA 2XXBA 1G8HA 1SUWA 4NZMA 1N6HA 3NT4A 5H0IA 1OUMA 1R4AA 1JUDA 2EZ4A 2FMXA 4MDFA 5JJKA 2GFQA 4ZEVA 4CTNA 3DT9A 3BJMA 4J9UE 3RTGA 1G41A 1R50A 4OU5A 1NRIA 1VGQA 3QF4B 4KBGA 4YLEA 3ZVRA 4D9BA 3U7EB 3H42B 4RMIA 2QY6A 5CB0A 5CBPA 3KAJA 4NAHA 3M5WA 3TZBA 4HVCA 2W8BB 3L7AA 5IXYA 1GNSA 4ATNA 1L2TA 3WOVA 3SR3A 3GLFA 2PMFA 3OQIB 2FW1A 2VBCA 1VL1A 1PJRA 3DGEC 3IT1A 3LBNA 4WY8A 5HMMA 1XZFA 4N01A 1ZO8A 5CD9A 4RVNA 4AAYA 2WFLB 5GAJA 1SQ6A 2W2LD 5DISB 3SC4A 2YDYA 1OMOA 1IRXA 2PCJA 3OP4A 4YP7A 2IV2X 3VR4A 5I47A 3GT7A 4KQGA 3D64A 2EGUA 4LI0A 3TW8B 3OUTA 2QTLA 1DRKA 2X2OA 3OESA 4DSZA 1BWPA 2CXNA 5J4LA 2AV6A 3LGSA 3ADCA 2DPGA 4AZ3A 4F1WA 2ZUEA 3ROEA 3S2YA 1X70A 4MPDA 1CUYA 1LRKA 5IP5A 1ENZA 1TC2A 3H4TA 4J0CA 1GFSA 1ORDA 3O75A 5F3RA 1GYRA 1GPBA 5K8LA 1JG1A 3IV6A 1V48A 2CLHB 4LC0A 1LC0A 1V1MA 1XRNA 1D6NA 3B6KA 3F7OA 1ZXBA 4HVTA 2B8JA 4ZVKA 1MX9A 4KAAA 1RWMA 1GZ7A 2WPDA 3DA8A 4FX5A 4RK0A 3NCHA 5AH0A 4M46A 4D9FA 4BFWA 1OXSC 2NUPB 3DLPX 2PWPA 1QR6A 3C70A 3FRHA 4PQEA 4U63A 4ZAYA 2PGNA 2JJQA 3DCNA 2M6RA 1KL7A 3DW1X 3PR3A 4DCSA 4C0WA 1Z0UA 4UNPA 1H8HD 1THZA 2JH8A 4FN4A 3QE9Y 3NVAA 2ERYA 4NZNA 4RDXA 2SKEA 4H08A 2P2SA 4MVJP 1E2HA 3NGLA 3CFYA 5CNIA 5ICSA 5KYUB 2GK4A 3OT1B 4LZWA 5AW3A 5C1BA 5HMLA 2WC1A 1CR1A 1KXJA 1Q7BA 4KAXA 1T0IA 2PL9A 521PA 5JNTA 2XUHA 3PQEA 2REQB 5JZOA 1TLFA 3O2NA 3FTCA 2SHKA 3KE9A 1V37A 5FR2A 4DLYA 1VRWA 3D0RA 3P20A 1I0LA 1OQAA 1XTQA 3LXRA 1DAFA 2WYHA 2ZE8A 3Q7QA 1ONOA 4UASA 2QJWA 1N6IA 4MQBA 1E62A 2MIIA 4WK6A 3ZZ0A 3IMGA 5TE9A 1Z6GA 2QUZA 3F96A 2J5XA 1D8AA 2DH6A 1RRKA 3A3KA 4HB3A 3ETHA 1E2PA 1U0HC 2G0AA 1JH9A 2CVFA 2O3UA 1UPBA 1N0WA 1SK8A 5IBPA 4LCBA 2CSUA 3PEEA 2DQZA 1PFWA 2JAOA 2L82A 5BV2P 5FL7A 2OSBA 4ZT6A 4WD3A 4QD3A 3EGIA 5DVZA 5FL3A 3UK6A 1NMSA 4EVRA 3FJ1A 2NAFA 2OV8A 5ADUS 5IRCD 1GSIA 3B13B 4XD7D 1HKUA 2FPPB 2XGOA 3VOBA 4HAIA 2A0KA 1T9DA 4UMDA 1N2JA 1Z36A 3WNVA 2H4WA 5LZ7A 5F98A 1COWD 1P19A 3N8NA 2RK3A 4Z86A 3JU3A 5T4FA 4R1QA 4BFXA 5AW6A 3RARA 2AX3A 2EJBA 3NP9A 3VJLA 4TWZA 2Q4DA 1MG5A 3BVPA 4EY4A 1QAQA 4RA6A 1R0RE 4FSHA 4OMFG 4Z9YA 5L3SA 2CE2X 3O91A 1SZPA 1VHJA 1KE1A 1NSFA 4LV6A 4YV7A 1EEHA 2CFRA 3R4VA 1N8SA 4ZGBA 1CIJA 1TD9A 1ENYA 4KO1S 4NCKA 4UCQA 3QUCA 4IZOA 4MS3B 5FLYA 1W9HA 4HUQA 2IK8A 1U1CA 5IKEA 2UAGA 3OFJA 2VRCA 5F3WB 1R6UA 3H9CA 3DOJA 4E7OA 1JILA 3CLKA 1JJBA 1NR1A 3EVFA 1CUWA 1J00A 3PG5A 1OFUX 4S3MA 1XZCA 1X7ZA 1T4MA 2MMCA 2OMEA 2IF2A 1ND6A 1VLZA 1L5YA 5DWQA 1JBKA 4LJ4A 5GJCA 5K4GA 3M3PA 4DWWA 1VE1A 1W0JA 2VTBB 4HBGA 2O1XA 2XB9A 4NZOA 1KSFX 4N48A 2ONZA 2P1ZA 1ZK3A 3LHFA 4LGVA 4TTPA 2IWHA 2BKXA 3KUXA 1RZUA 4AQ7A 4OHOA 4WOKA 2A5LA 2J4DA 3R5HA 3PSAA 2JK0A 5U4QA 4HXFB 1VG8A 1ISRA 1ZN8A 2C9BA 2ORED 3L7YA 4KXXA 5D00A 3FN4A 6ADHA 2VDWA 1RIFA 4F06A 1JBEA 1KZ6A 1O2DA 1XZAA 2YV4A 3CW8X 4GBED 4O33A 1IY1A 4U7GA 4A8JB 5BV1A 1VG0B 2DXIA 1ZJYA 2W2KA 3G5AA 3STVA 3EYWA 1OV4A 3NHUA 3D3NA 3B3AA 4YFVA 1E1RD 4DMLA 3M5CA 1V3QE 2XOEA 2B20A 2VQFB 1JI3A 3OURA 4DV5B 2GVDC 2KLHA 2VFAA 1SXPA 3M4NA 1RR6A 4HEQA 4ER6A 3RS4A 7YASA 2XZDA 3R5TA 1YAJA 4NXMB 1G9SA 1F9AA 2N1MA 5JBNA 1AN9A 3GH3A 3T7DA 1QUEA 1E2BA 4GLOA 1T9ZA 3D7KA 3DMGA 4YYEA 3FJYA 1ZBQA 4HLDA 4A2PA 3D3QA 1E9EA 2XTAA 4HDCA 1PZGA 1J2YA 2X2EA 1KJNA 2EG5A 1JR3D 3AF0A 3BMNB 4GAEA 4RAOA 4PF1A 5IZCA 1V9LA 5DGHA 2FY8A 1OXXK 3BL8A 1Y82A 1WOMA 2QTAA 3DVQX 3N5CA 4K2AA 1JYFA 4MRVA 3ZNPA 1E6LA 2AQIA 4L76A 3V1NA 1T9KA 1Y5LA 5E8JA 1FNCA 1WVGA 3U44B 1Y7PA 5KYVA 1J1ZA 3Q9NA 4X94A 4AJEA 4Y2GA 4D8VA 4EELA 2GXUA 4OHFA 2EBFX 2FR1A 1IEXA 3O26A 3TRIA 4PX3A 4UZEA 4YAGA 2H1VA 3FVTA 4Q9KA 3WIEA 3R5JA 1D4AA 4LOIA 2CL5A 3T0IA 2IIBA 3K1JA 4NJMB 5TMEA 1KYZA 3F3YA 2ZRJA 1FDSA 3MWKA 4ZI5A 2DFNA 1Y8AA 2Q8QA 3SQWA 2XPCA 3GXBA 1IXSB 3BQMB 4NQZA 4NONA 1P2TA 1R5JA 1EX6A 2VAWA 3OX3A 4UBJA 1U7UA 1XALA 4JI3B 4OQPA 2VH1A 1MJGA 3ILVA 4CR6A 4ECAA 4UCFA 4XWWA 4FNMA 4MVJE 2X0FA 2GAAA 1UZMA 2ILTA 3C1OA 1X8KA 4HGYA 1KY5A 1NTRA 3LX5A 1MT3A 4YUWA 4TT8A 3TG8A 4QOGA 2J9ZB 4GPBA 2HA0A 1O94C 2C98A 4N0MA 4MMZB 3U1VA 1PNOA 4BEWA 5BVHA 1CNEA 5JRZA 3AESB 2YMPA 3L8YA 3EY4A 2DZDA 5CFRA 1EXVA 4OXXA 2H8KA 3Q8MA 1HDGO 1SVSA 4FSDA 2NPFA 3PC2A 5MN4A 1BOOA 3C6BA 2H1CA 2R86A 1BKDR 3NV7A 4TS1A 3VR4D 5AYVA 5FUQA 2GYYA 3H9GA 1V9SA 1VE7A 3AZOA 3G5UA 4MPTA 2VDKB 4YRGA 2XCSB 3EGOA 2B5OA 3OZSA 4QUJA 2R11A 3DUWA 3ZWVA 3JAMA 2AJ8A 4KQXA 4HEHA 4QOHA 4JLVA 3D3EA 3PRYA 1JPUA 3VR5D 4ZQGA 3A7DA 2BFNA 4YNBA 2XLCA 1Y3IA 2CFIA 1A7KA 1HL7A 5KQRA 3AJ9A 1Z12A 4N7RA 5CR9A 1RJ9A 1XXHA 4PGHA 3TTUA 1DUVG 2GWHA 1PZEA 1CJKC 1PQ4A 2X4IA 3K9WA 5FUYA 5BSUA 4WZBB 2FMUA 4DLRA 5JQGF 3WK8A 2A86A 1IQPA 3FGZA 3AUTA 4R2JA 1AKTA 5I5EA 3CG4A 3VI3B 5DBEX 4QUGA 3KZVA 3U40A 1CWUA 3WJ1A 3TLAA 4AYXA 1KNXA 4L9WA 4C7OA 3IOCA 3RSGA 3RKSA 3ZGNA 1YDGA 3ZD8A 3OOWA 3TYXA 2ZAGA 4YT2A 3CE9A 1T6NA 5LQRA 1KIAA 2OESA 1OX6A 4Y9DA 4MYTA 5J9FA 1RQXA 4POAA 4DUYB 5JR3A 1A69A 3QEJA 1NJ2A 1ORIA 1Q91A 1GDTA 3UV6A 1E92A 1HNWB 4D4MA 4RGVA 1LK5A 1RBZA 1TB4A 3GZ4A 2Y1GA 4MGYR 4OP3A 1LSSA 2C2KA 3NHAA 1LTKA 1NN0A 1IN1A 5LD2B 4UOEA 3PPXA 3BIFA 4ZOLA 5EWLB 2O8EA 3VO8A 3ZY6A 3VOTA 3GRKA 1M6YA 3F97A 1DBVO 4YBRA 2RJOA 1JF8A 3DWGA 1Q3HA 4DLPA 2C7GA 1GLVA 4GX2A 3T1OA 4CIWA 3BRQA 5IDWA 4UNNA 5CDFA 2HA2A 1YDMA 2LIVA 2C2MA 2RH8A 5ADVA 1O95A 3OAAD 4R8RA 1YJXA 2ZP1A 2QU8A 1F8XA 4J43A 1C8BA 1YRHA 3EVEA 3HJUA 3PFIA 2GVZC 5KDLA 4XR9A 1C7QA 4F3TA 5AVJA 3ZV4A 3EIWA 4OQYA 5ITVA 3NH9A 4FCCA 3S28A 2FDRA 1EFPB 1FRZA 3BPSA 5BWLA 1G8SA 4EPVA 4A0QA 2FLKA 2QIOA 3ZIUA 4MW1A 3RVSA 1JQJC 4OATA 2E6UX 4NBSA 5AKYA 4FFLA 2QBYB 3IXLA 2JH3A 3TQSA 4Y2RA 1V8OA 2JFZA 2F48A 2O57A 2WOOA 4GLJA 3ZUPA 1B1CA 2JLAA 4GYKA 1WD5A 2JI4A 1C30A 4FILA 1DRUA 2Z4SA 4GRDA 4WN3A 4ZVNA 4J3NA 3CHYA 3T9DA 3W77A 2P9BA 5LYJF 3IEUA 4Y2UA 4NJEB 3H04A 1XEFA 4HLQB 4EI7A 1PU2A 4YCSA 1UM9B 2QMHA 4PLTA 5CLQA 3IPRA 2FQXA 4US0R 4D3SA 1DT3A 1CY4A 2GNAA 3SHWA 3ZWXA 1AM4D 2I1WA 2ZJ5A 1U7ZA 3JASB 5BQ5A 4DOMA 1Y0BA 1KEUA 2XSZD 4I3FA 5FOWA 3S2SA 1HO3A 1JXOA 3WICA 1NN1A 2ZU0C 1WCV1 2AUTA 4F6RA 2FMTA 1FFYA 1IUPA 3IMKA 1MQ8B 1YR2A 3D1VA 3VBCA 1FFHA 3ABQB 1W4BA 3AJEA 3GLGB 4LJLA 1EGQA 4ZDJA 3H11A 3TIFA 1EE2A 3DQPA 3ZHVA 1NT2A 3PS9A 1HYHA 1E8DA 1JEJA 2WFMA 3HCWA 5IDQA 4DCTA 1FVFA 1G1MA 3SNHA 2CNBA 4OGWA 4COOA 1YZTA 4OHXA 3LWNA 3OU6A 5I51A 4MTCA 2YOGA 1LQ2A 1YSCA 1V26A 1G8GA 2H7XA 4H4CA 5DF1A 5SY9A 2UYQA 1KK1A 2K7FA 2YINC 4JI1B 3FW1A 3O8RA 4BNDB 5K20A 3R24A 3RHFA 5BW8A 2GN8A 1XL1A 2YYZA 4ZWNA 1XELA 4G1CA 1IDOA 3KVVA 3ROTA 4RHTA 4DMCA 1CJCA 3ZY2A 1ADGA 1Z2EA 2I54A 3ONDA 2BE9A 1G3RA 4O2RA 2GFIA 4C4TA 2FPIB 3V2HA 3AP1A 2HNAA 3KJZA 5DI3A 4D6PA 4B3GA 1PL0A 2VYFA 4MVJH 5G4KB 3O1JC 3P2OA 3T1QA 1KZ9A 2R4QA 2ACVA 3QIVA 4BNWA 5K0TA 4POOA 1OZ0A 1U5CA 2GNPA 4YJHA 3LLSA 1YQXA 3L3BA 2ZGVA 2D7CA 2FF7A 5ESWA 3WAKA 1XE3A 2AG6A 3GMIA 3EMKA 3RV3A 4AG6A 4EI2A 1JTEA 4KE6A 1ZS9A 3ZE0B 3KFVA 3O2SB 4R1TA 1NN3A 4FTWA 2JEZA 4DV6B 4IDCA 5BY2A 5SZJA 3EBPA 1U0LA 1G8FA 2OOKA 3EIOA 3VX4A 5D84A 5CH5A 2C5HA 4KFUA 4D8XA 2F64A 5K3SA 5AHXA 3W8DA 1XLVA 1XRQA 3O82A 1EWYA 3CIOA 4MINA 4MVJG 3VAZA 3L4BC 3JS5A 4HB0A 3W7VA 5AW4A 4RLSA 4KC0A 1R6XA 4TLDA 2V4MA 2B2CA 3AG6A 3PIRA 4YXWA 4DPKA 1T25A 1YR8A 5C31A 4JXKA 5AIBA 1U2QA 2R4UA 3VU9B 1M67A 1Y6QA 3DL7A 1HE8B 1K4YA 1TEHA 1HNNA 5AK0A 5L51A 1AO3A 5HNKA 4NBNA 4E2YA 1W19A 1FFXA 1Y8QA 5JAZA 4ECEA 3BM5A 3PQ3A 2QW0X 2W2OA 3DL0A 4Z53A 1XMJA 1PWHA 3OSUA 4CVNA 2CUZA 2OY0A 3QBEA 1XCLA 3DCJA 3QQ5A 3GJ5A 1RXWA 1JIJA 2XJ4A 4REOA 2V45A 4K26A 4TTSA 4OUDB 2J85A 4ASUD 5KYYB 4BLPA 5C0OE 1FS5A 2WSYB 1XYGA 3BHMA 3LX4A 4WH0A 4KPFC 2PIDA 4UHHA 2YWHA 4O2BB 3F9CA 1DMSA 2GM5A 3JAKA 2D2EA 3N2KA 4PGMA 4BB9A 5KYWB 4O0MA 1NAIA 3HDJA 1U2GA 2DTEA 3GDGA 2SNIE 3AOGA 1L8XA 1WW8A 3CQ9A 3HP7A 2XQFA 2OL4A 1ONNA 1XD2A 1U8YA 1XTRA 1NC1A 2VSQA 1ZPDA 3IAM1 4RLFA 4B73A 1BIFA 4L0QA 1S8AA 2PGLA 5D3KA 4AJ4A 2J0UA 2WU1A 3TDKA 4L0MA 3RJ9A 3LHKA 3KC2A 4JHLA 1C3OA 2FPGB 1T3TA 2CLSA 2Z9BA 1XVTA 3LXMA 3P26A 2OVBA 3ZLTA 3DWFA 3RS5A 4R0NA 1SUAA 2ZWMA 4CM3A 3ABRB 4ZCTA 2PT9A 3RYHA 4BASA 4B8YA 1YT5A 1DUIA 1WV0A 2HBRA 3EC1A 3FZGA 4RPKA 1OXBB 4U02A 5JCZA 1A9XB 3CY6A 2YJGA 4B6GA 3ER6A 4B80A 3F5FA 2QG4A 3OJEA 2QLFA 4JMPA 3J81k 4X6UA 1E9AA 2Y1XA 1YKGA 3L4SO 3IKMB 5LQCA 5T3UA 1Y5RA 1KVQA 3C7AA 1ZH0A 2HLHA 2JAUA 2Q4TA 4I08A 1SAYA 1MU0A 1PR0A 3LIPA 1PW5A 4ZRMA 3G0CA 1JZTA 3L93A 3QPAA 3VHXA 4GWLA 3PPVA 3L92A 3N2IA 4NE7A 1ZK1A 3BAZA 3U7IA 3GD7A 1QYVA 4MV8A 2G1KA 5IC5A 3STUA 2SBTA 1VMAA 5F73A 1ZJ6A 5JWHA 3P27A 1X9IA 1OB5A 4F0JA 3A25A 1V16B 5KJFA 1SCQA 1L1RA 2AXPA 1GPUA 3CLSD 4K6FA 5M3BA 5J63A 2GESA 1KHHA 2GTIA 3E1SA 2QJFA 4IIYA 1Z38A 4QBGB 1XTTA 5BQXA 2WM3A 2B35A 1OKKA 3LUJA 2RGNC 2ZWVA 1WB6A 3S44A 2YRFA 4B87A 2EQBA 3BWMA 2ZJ3A 3I53A 1M3SA 1GM5A 1H9BA 2IFTA 5J5AA 1Z68A 3AF4A 1A8SA 3A2NA 3WL8A 2E3JA 2G5TA 4MRPA 5TVKA 2NSYA 2Q5JA 3OKCA 3Q3JB 3D59A 2QL5A 1ODCA 4G5OA 4DF3A 5LOVB 1AVTA 3HMKA 1MBZA 3MRXA 5HKKA 3CEHA 3H6GA 1IOZA 4IDHA 4LRYA 4I6GA 2A5DA 3L1IA 3TQQA 2VJKA 4U2KA 3MWDB 3A37A 1H5QA 4Y6SA 3V4VB 4A8JC 1EX1A 3ZCQA 4ZYLA 5B2EA 2GH1A 1GT91 2GUWA 3CH7A 2J32A 3TNYA 2XITA 4Y6GB 4ZXPA 4B4UA 1FOEB 2UYOA 2Y76A 3HADA 1UFRA 2XQIA 3RQSA 2ZBQA 2J3DA 2XNSA 4DV7B 3HE3A 3JAWB 3SD7A 1ESDA 2WB4A 3C0KA 3I2YX 1NWHA 4YI5A 2Y1DA 3E9DA 2B25A 4XTRA 4L95C 3JCZA 2UZ4A 5BUZA 4N12A 3HUUA 2QR3A 4UD2A 2H5JA 3K2EA 3EODA 1LFDB 1XRPA 2CVPA 3MMSA 3VJKA 4Z5XA 1OLXB 2W5UA 3C8ZA 4XQCA 1VE6A 4RK4A 1SXJE 1Q0TA 2BZ1A 5C4MA 4K86A 3QVTA 4YHHB 4XGRA 4XRRA 3LGXA 4QG3A 4BGDA 2HA3A 4NMLA 4C01A 3ZD9A 4G37A 1XZBA 3TEJA 2EHJA 4TYNA 1YQGA 2PQ2A 5JVDF 5J2TF 1U3UA 2XEXA 1YB1A 1Y5NA 5FA6A 4LZPA 3DUFA 5F3DA 1YQEA 4E4YA 6GPBA 1U7XA 5E4FA 1AUXA 4Y1GA 3OQ6A 4PAGA 3RUHA 4PW0A 3AETB 4MITA 2E2WA 3SZRA 4X20B 4KSBA 4BQQA 3OPVA 2D00A 3GBVA 5KNDA 2ZT7A 2EKDA 4DCMA 5CEFA 1YFJA 4OB6A 2BI4A 1YACA 3L6UA 2CK3A 2F3PA 2Q62A 5F1YA 3WL4A 3WLOA 2YMLA 1YVDA 4FHEA 3T7TA 3CUKA 5F2EA 3QI2A 4MB2A 1O54A 4G9GA 1YUNA 1OFTA 4S24A 4D1YA 3MWEA 1GTRA 1Z6YA 3O1HB 4I6EA 3CXUA 4MUBA 2Q5FA 3DLTA 5E4TA 1R9NA 2GEUA 4M8LA 4BYMA 2PYIA 4L85A 2DWOA 3T3GA 1QO0A 1OIVA 4UBIA 2APJA 1ZMXA 4XWTA 4ZHSA 3DJYA 2W9XA 3QITA 1GNQA 2Q28A 1JECA 1HYEA 2AEEA 1VL8A 5DHFA 4H3HB 3W6UA 1ODIA 1SIWA 4P4UA 3BD6A 4XIFA 2BELA 1QC5B 4HMQA 3UBMA 2EFGA 2RHOA 4R83A 1GADO 2YCBA 2G4CA 1LKZA 5A4KA 2BFDB 4O2LA 3C98A 4YUYA 5JQGA 3S5JA 1EUQA 3FROA 2WWFA 4N5HX 5F21A 1XMSA 1E5QA 2HA6A 4S0ZA 3W9YA 2Q1TA 1YMQA 5JZBA 1UMCB 1ZRMA 1U1FA 1Z29A 1ZLXA 1HXHA 2W98A 4LC9A 3RG2A 3VHRA 4CMCA 1Q6YA 3KKNA 4US2R 2VYCA 3D6MA 1RKQA 4DNFA 1TE2A 2O07A 1OBHA 3UK2A 2A7QA 1F8YA 3E23A 1EBUA 4P81A 1T10A 2JPDA 3P0IA 4UQPA 3UIEA 4BLOA 1LZKA 2C83A 5FDFA 1GUAA 1R64A 2GKSA 4GSKA 1Y6GA 5A5VA 1NR7A 4QUDA 3RRMA 1T0UA 3BWCA 1XDUA 4HH3C 2BFBA 4TM8A 4HNQA 5B1IA 3UT6A 4BLUA 1QQBA 1YOVB 1ZH4A 2VUTA 2HQ1A 2ZS9A 3AILA 3ZWKA 1P3JA 4J6FA 2BFMA 3VDNB 1XMQB 2FWJA 4HEA6 3IQFA 2P4HX 3RAGA 3C5VA 3TKAA 4C3UA 3B7PA 3KEMA 3KQMA 5A6SA 2HSDA 3G88A 3QX3A 1WM1A 2FPKA 2Y0BA 3G79A 5EXPA 3TWOA 4TVSA 1CUUA 3W3ZB 5I4CA 2CCJA 2A1UB 4EEZA 2VC2B 2NSJA 4MB0A 4ZZ1A 2G1UA 3QVGB 1K1EA 1SBQA 2EGGA 4GC5A 4NDAA 3TBHA 4MPPA 3AO0B 3HUDA 4JBYA 1HFKA 5COBA 4F3NA 3G0HA 4EMTA 1EXNA 1GCAA 5IH3A 3AFGA 5EUMA 2BBWA 3ABSB 4BV2A 3RUPA 3VFDA 3R3SA 3KEGA 2IIQA 4JFRA 2H2IA 4W1RA 3UW3A 4A82A 1HFWA 2YQ4A 5DYNA 1T6XA 1ISSA 3BC1A 5LBUA 3TECE 4A15A 2PWZA 1OTXA 1B6SA 4OK3A 4IGFA 4RNCA 4X93A 5I9SA 3I73A 3D3WA 4EYOA 1GT6A 3DFIA 3MJ4A 4TT3D 3RTEA 1P8AA 1FL9A 1YE3A 3ZIAD 4JBNA 4LJSA 3DMRA 3SS8A 2IWRA 4CF5A 3AERA 2X40A 3S2ZA 1Y6ZA 1K88A 5IT4A 1GZVA 1TUEA 4Y1RA 2FVXA 2BD0A 5BNTA 3P9RA 4GSLA 4HC4A 1FDTA 1BXRA 1L3CA 3C6XA 3F8SA 3JZIA 4MICA 4Y2TA 1S2OA 1WMDA 2G0NA 2XZPA 4ISBA 4MR9B 1SN7A 4II7A 2P90A 4RGQA 2Z5FA 1NXPA 4N6OA 1FTQA 2NYRA 1JHZA 1SJ9A 2FPWA 2JIZD 2PU7A 2WLSA 4HS4A 2Z8YM 4G0YA 4IDNA 2OD9A 3N2LA 4X41A 3BEOA 5EC8A 4WX2B 4NBKA 3SKVA 1G98A 1U5BB 3E4CA 2ZROA 3DDCA 3VQTA 4WZAB 4YUAA 1S2LA 3KAKA 4EGJA 5LC1A 5D86A 5KC9A 3CZ4A 4K8RB 3C74A 3PFNA 1D4OA 3DOHA 1MJFA 1QIGA 4JIMA 2HJGA 2N9UA 3B7WA 4KQ9A 4AW9A 2X4DA 1JLKA 2UZ1B 2Y9PB 3U3JA 4CQLA 2FPUA 4BFLA 2RHJA 4JNCA 5DSTA 2NU7A 3M4YA 4BKMA 1RC1A 3QV1A 3DG9A 3VKVA 2FN8A 2X5OA 4KQEA 1G4AE 4DLNA 4EA9A 2ZBUA 1BMDA 2QKYA 2BHSA 4D81A 1QHHA 3NAGA 3OSZA 1DX4A 3TXXA 3F47A 5EJ4A 4BEVA 3Q3IA 3QLEA 2SICE 3UNXA 1ZUD1 3TD2A 1UBOS 1W2GA 1PNVA 4FE4A 1CDEA 4CKYA 1BWRA 1YVRA 3G5TA 2P41A 4L5BA 4DEXA 4BLSA 4EX6A 3G2PA 3EQ9A 4U6NA 3PXXA 1WV1A 1N2XA 2ZRQA 4PLFA 4EVIA 3OFVA 2XYVA 4O8ZA 2JAPA 4RTNA 3FUCA 2D1RA 1JIXA 3UHOA 1WP9A 4XVUA 1II8A 2QTTA 1I3OA 4UKDA 3NOQA 4ABYA 4KGXA 1JJIA 1THTA 4K0RA 3VVBA 4JJEA 4QBKA 2IEDA 2JCYA 1CLEA 1TU4A 2K4MA 3C3AA 2P79A 1AHHA 3PLRA 4HNSA 4TV8B 2NNLD 3GDFA 1GG8A 3GWZA 3C41J 3FPSA 5CB6A 3M82A 4YRTA 3DXZA 3EGDA 3NO4A 4MV3A 2B2XA 4OM7A 1L4EA 2NYAA 4P53A 5KTOA 4HYYA 5CCXA 1R9GA 2ZB4A 2CHUA 2AH5A 1M54A 4IGIA 3K70D 1J39A 1ICEA 1CTQA 1D5CA 1N3IA 5KDOA 2G82A 4RVDA 3PNSA 3QU7A 5BWMA 2PKQO 4ESVA 1FU4A 3NH6A 1RYFA 1UJCA 1VQ1A 3WBBA 1E7WA 4MP3A 4XWYA 2K87A 1O08A 4Q12A 1GD1O 3RBXA 3ZU6A 2GBFA 3EH2A 3F74A 3LYHA 3U7FB 1EIWA 3JQ7A 4YP0A 1DCMA 2RGYA 3F3MA 4YJDA 3ESZA 2C3UA 2GZ3A 5AKKA 4DBVO 4AMZA 2PUGA 3AEKB 5F2OA 3HVHA 3IMEA 1MC8A 2H1SA 4H7DA 3UT5A 2FR8A 4DL9A 1RWPA 4BAGA 2XMRA 4WOPA 1THGA 1O6BA 1REQB 1PBNA 2PLNA 3HG7A 2X9VA 1ZM2A 1S3FA 1MPTA 4NCHA 1KI1A 3D7MA 2ABWA 2CKMA 3A32A 4CDRA 5CCBA 4CM8B 4HDMA 1CPYA 2F8TA 3MWYW 1WPXA 1SZJG 2VJYA 1OPRA 3JATB 3L8DA 5F5LA 4M1MA 5FAXA 1QHIA 3DYBA 5CEJA 3C6KA 1NXVA 1PJTA 1MABB 5K4HA 4DANA 4FGKA 2Y66A 3TIGA 4GGMX 4BVEA 1R18A 2HNBA 1PHPA 2D13A 2XB8A 1M2FA 2FP4B 3KZOA 4ZHQF 5ED4A 7MHTA 2ANCA 1DIGA 1JLLB 5A2GA 2VPXA 4V24A 4D6XA 3HGTA 2WWIA 3I9LA 2G70A 4G5QA 4MRSA 1K6JA 4ZVVA 4FINA 2WT8A 5DSXA 2ZJOA 2H3HA 3EPPA 5LZ5A 2IZ1A 1QU2A 2VPTA 3S27A 1N0HA 3PYMA 5EP1A 1XZMA 2JKZA 3GU3A 2ZOSA 1G64A 3HYTA 4LAFA 4OMCA 4R1NA 4IFTA 4RS4A 5GZ6A 2NP7A 2X9NA 1H2EA 1GU0A 2FFBA 4OLFA 2XKKA 2HMWA 1DP4A 1N2ZA 1V7ZA 2ZRPA 2VDJA 4LE0A 3WZLA 1XPUA 3CRW1 1MVNA 3BXXA 2OXIA 5AFSA 4N3CA 9LDTA 4IZHA 4OGFA 3UOGA 4MEBA 1UZNA 4HO1X 2ACWA 5AMXA 2GWRA 3A06A 1N75A 3QLVC 1JSXA 1B6TA 4FFRA 2HLDD 1N5IA 3QKSA 3TSAA 1V5EA 4BRWA 4HY3A 1RABA 4LMRA 1CYDA 3ZHQA 5B58C 5D85A 2B2NA 2I6UA 4M8NE 4C21A 1W47A 1E89A 1KOLA 2J3KA 2HA7A 3GUCA 3C8MA 4LV5B 2YUTA 5AW7A 2GN1A 1SQSA 5AI9A 1P0QA 1OROA 1R4ZA 2DF8A 2OXRA 3E9QA 1YB4A 2FUKA 2R6HA 3WB2A 3SK0A 4FQ8A 2I55A 4FHGA 1OC4A 2QL9A 3MHPA 1TGVA 3OM1A 2PIAA 4DVJA 3CR3C 3R0ZA 5ALXA 4ARAA 1XJWA 1MEJA 3NW9A 4R2MA 1OSNA 1V1RB 2ONKA 2WIGA 1LS1A 1W5BA 3AI7A 3D8RA 3L1KA 4MVWA 4DBLE 5GTDA 4LF8B 1SVNA 2H07A 4Q82A 1Z8NA 3EGXB 3REQA 3HDVA 4CQMD 1E3IA 1RZ3A 2NO7A 3T3EA 5BN3B 1IN7A 1UWLA 2HWWA 2SKCA 4DNOA 2I4TA 4UHFA 1FB5A 3A1FA 2WFAA 2Z56A 4MV0A 1TIPA 1X7YA 2VNHA 1VA4A 2GJKA 2JHFA 3KLMX 3RKUA 4PYRA 2WM9B 3RF7A 4B9EA 4LDZA 1E9CA 3B1FA 5GWXA 3DHNA 2J3MA 3KX2A 4FYPA 1X80B 1TQHA 2C2YA 4MQEB 4D3ZA 1EWKA 5CLIA 3ZCTA 5AM5A 2FB9A 5HJEA 3UXMA 1PVOA 1EUDA 1W88B 3I6BA 1P4JA 4NTZA 1IE3A 1NBMD 1ZINA 2EZ9A 1U4OA 1VOTA 1NF2A 2G83A 3AIMA 2FWNA 3H1EA 3QG5A 4PSDA 5DNYB 5CFMA 2C5AA 4NCIA 2ZUTA 3FHOA 1NX6A 5ILGA 3W6OA 3F90A 3AI1A 1R10A 3QUQA 3TOZA 4TN1A 2AC4A 2W2VA 3W04A 2IPOA 4YHBA 1TFRA 2EZTA 3U4QB 1U7OA 1UT5A 3AHDA 2AMYA 1ZITA 2VLBA 1EDBA 1WXGA 4HDSB 4J1TA 4WXRA 2IX3A 5FO0A 1J0DA 2CFSA 2W37A 2F8LA 3JYLA 4X6YA 4EFDA 2VPZA 4H77A 5JVDA 3TFQA 2Z30A 4G1VA 2V74B 5J2TA 2I78A 1RWWA 3IQWA 1TCUA 1IEQA 3U4CA 4MDYA 1YRYE 1QIEA 4XX1A 4LX8A 1JSCA 3U0BA 1X1RA 1NV8A 3R20A 4PICA 3K6RA 1NZDA 2R7KA 4KYVA 2B21A 1YHZA 2HTEA 1PJBA 2PA3A 3I39X 3JALB 4FKZA 4D0LB 5U9CA 4N5DA 3ENWA 4A2CA 5LA6F 1D03A 2HL6A 1T9HA 3OTOB 1DJPA 8GPBA 4JVMA 1L5FA 4O5AA 2QVLA 1DBIA 1G21A 1I9GA 1IBSA 1WDTA 2VJDA 2XHEA 1E8MA 5B3KA 1JHVA 4GNRA 1LX7A 3H9JA 3GLIB 3EPKA 2RCNA 1PR9A 3PXAA 4BO6A 4RC9A 5D3QA 4LS3A 5LNK1 1NMXA 1SY7A 4A0SA 1ZK2A 2IC5A 2V6IA 2HDOA 5J43A 2XOXA 1RQRA 2KI5A 3L46A 2DC1A 4AK9A 3WLJA 2GHRA 4PPGA 4ZCQA 2PXCA 4MGIR 3VO1A 3OZEA 2CNNA 3CKKA 4IIGA 1E1QA 1XKQA 1A96A 2VIIA 3KFXA 4LY0A 5H70A 5CLFA 5EJEA 5KOHB 1MA0A 3BGVA 5JAPA 4DB4A 1LNZA 4JR2A 4QXPA 2IXTA 2QP4A 4LRSB 4AVYA 4P83A 4WJKB 3SF0A 1T5LA 2ODPA 2PEZA 1BDJA 4Y9SA 3I62A 1KO1A 2XVAA 1Z2CA 2ORIA 3E9MA 4HDAA 5FL7D 3KR9A 4C43A 4C04A 2WUGA 4WK0B 3DV9A 4P3OA 1M83A 4UW9A 2ORYA 5EQFA 4A5OA 3KYJB 2ZETA 4CMAA 1TW3A 3OLYA 1XTJA 5EKXA 2NO4A 3NDIA 3QHQA 3PNBA 2Q5HA 5AJZA 3IQZA 1G66A 4WBXC 3LPNA 2AJBA 1ZZGA 2O2JA 5DCYA 4KXYA 1XRJA 1U0OC 4J4TA 3LBIA 4PR3A 2AK3A 2Z98A 3DT6A 5FI5A 3OTWA 2A9QA 2P5UA 1OZAA 1U0JA 4RE6A 3HBLA 4LHXA 1TA4A 2ICAA 1N0VC 3NANA 2DKOA 1K9SA 1C14A 4Q03A 1XEXB 2FTKE 1YRBA 4EPTA 2OQ2A 3LY7A 1CE8A 2F3QA 5G40A 5B53A 5K7SA 4MA5A 4DVGA 2G88A 3MTGA 1YDFA 2AZDA 4MRMB 1N2CA 4IW3B 2X1LA 4RVFA 4TMFA 1NW7A 1BGVA 3TBKA 1HFJA 4KWCA 3G7UA 3OQVA 5L9AA 5AM3A 1LJLA 2XUIA 3CRZA 4R2XA 3JARB 1QVWA 1E7SA 5B4VA 1Z22A 1JAZA 1TCVA 1GOTA 2VHWA 2WJHA 2AF3C 4JA2A 4P84A 1V6AA 1YRLA 3MCAA 3N87A 5P8WA 2YZ2A 1P44A 2BWJA 2HZBA 1YQQA 4Y6RA 5H83A 3ZWWA 4C6SA 4J7AA 3K9NA 1EJBA 5HUJA 1CJUC 1O58A 2Z04A 5BSGA 2C99A 4RV4A 2QT0A 3EXHC 2HUNA 4IOMA 3ANMA 1LY1A 2JEOA 1ES9A 3ESAA 3DPSA 3O2QB 3NGMA 2J30A 4URUR 4F72A 4LGYA 4W1QA 3RYFB 2R44A 1L1QA 4YMTA 3TQCA 2K2QB 5LIRA 4LJAA 1NQOA 2CW5A 4RZUA 3EEIA 3N2GA 3D7RA 2FQYA 1QHNA 5E1BA 4BMOB 4F9GA 3OJOA 1HDRA 1T9BA 1V35A 3AFMA 2XT6A 2EIHA 4EYKA 1Z07A 2ZRIA 2PL1A 3M49A 3VBEA 5EIWA 3KEOA 3H86A 3KYCB 2JEYA 3MRTA 3EMBA 5HSGA 3AU8A 3QX8A 1YHNA 2PRKA 3T4EA 3CA8A 1CU1A 1SVIA 2P3SA 5GP1A 1IZ0A 3E61A 2GXSA 3FGOA 3S55A 4F11A 1TZMA 3GMTA 3OJLA 4ADSG 1G7CA 1D6JA 1SEVA 4R1UA 3E3AA 1NVMB 4MWGA 3VNVA 1ECCA 4FBMA 1RS0A 5IT9A 2PQ0A 5DCUA 4P54A 2NUPA 4PYKA 5E7MA 3TMAA 3IJRA 4GYJA 4TKVB 1XDSA 5JS1A 4IO0A 4F5EA 1QTIA 2AUNA 2GCEA 3H2ZA 4JVLA 4NX2A 4TZKA 2OFFA 5A2QA 2PGAA 5AUOB 2IYZA 4MYSA 3STHA 1VBKA 1B8OA 3EVGA 3K2IA 4NE9A 4JJZA 3LCRA 5BNFA 5KYUA 3HGQA 3VUFA 3VYTB 4IIHA 5LJLA 2RHCA 1QH8B 3HBAA 4LRWA 3OFNA 5BWOA 2I34A 1H4SA 3A2KA 4PSVA 1XZJA 2HRRA 3ZGXA 2ZB2A 1WDLA 1OWNA 4X62B 2WG2A 2CYCA 3A1CA 1Y5IA 1Z5NA 3KKPA 1UDWA 2GEDA 4CG0A 3F6RA 1KTVA 3KOYA 3N0XA 4H59A 2ODEA 3RIYA 2ZKIA 3IVMA 3WLIA 3R0JA 3O8DA 1HNXB 1M34E 2KJQA 1SHKA 1UPXA 3KPUA 2JLSA 2R1VB 2CNWD 2FF5A 3HJAA 3NDJA 4DLXA 1P91A 1J56A 1N5MA 1OR8A 1KO4A 2Q3FA 1KETA 4P4LA 4PGGA 4YCCA 3IEPA 5AVSA 4EBBA 4ZAXA 5AKGA 2D6FA 4MV9A 1EB8A 2Q5EA 3W78A 4W6QA 3MUEA 4KFSA 1Y1LA 1RWNA 2RIRA 4C87A 2PLRA 4A2WA 3L9XA 4ZREA 3A58B 5J4KA 1N9KA 4BS9A 4ENWA 5AP9A 3BFJA 2ACKA 1MB0A 1OHHD 2RGWA 1TKAA 3SJUA 5JYDA 1KAHA 1LDYA 1P6QA 2W6IA 1W36C 2HMAA 2XTJA 3NHMA 4EW2A 3LK6A 2AEJA 5JAMA 3P2YA 1G6Q1 5AI8A 1QDUA 2PVCA 4P7KA 2Q45A 4Y2JA 4PLVA 4YONB 4AU1A 4C1NA 5FPHA 3UTCA 2D2FA 8AT1A 3K31A 4G81A 4ZZ2A 3LOPA 3A6EA 3PA8A 1YC5A 4ND1A 3MTQA 2QYSA 4L9SA 5AK5A 1CR4A 1NM5C 5F76A 5C81A 4RCYA 4L4XA 2QAGB 4HP8A 4KEAA 4FYVA 2BGTA 5HRAA 3U9SA 4ZA2A 4X1IA 1VKHA 3B70A 1DRJA 3D02A 2IDMA 3RRZA 1QG2A 3ZX4A 1C9EA 4E5NA 1LVUA 4AKGA 2Z08A 2RHBA 3IH5A 1H9CA 1AX9A 5KTTA 1FTNA 4G2NA 2XDQB 1TVKB 3QKRA 4BNIA 4PCVA 1B3RA 1Z7BA 5LXTB 1KSHA 4P80A 3DLBA 4IRXA 4FLFA 4ZHQA 1LPNA 2VSNA 1I4LD 1U28C 4RSRA 3S7ZA 3OPMA 4GOOD 3UUWA 2ZI6A 4DA6A 2W71A 2ZVDA 4YT8A 1D2GA 3KD3A 2R6JA 3DYVA 1Y5MA 4XSHA 1VZ2A 1H0RA 2JGKA 1EFLA 1G6HA 2IQ5A 3C3XA 1MB2A 5BWNA 1NI4B 3I04M 3QJ5A 5HA5A 3TLYA 3Q8LA 1R6AA 1IZ7A 4EENA 4PHHA 2WJJA 2WU3A 5HRCA 2ONCA 2DT8A 5DM0A 4QA9A 3EFBA 4B5KA 2ZSFA 1MOZA 2CZGA 5IVKA 1SCUB 1YDWA 3OMXA 5JMTA 1W1WA 5CM2Z 4CT0A 3I3SR 4R51A 4X63A 1T2VA 2GXQA 4MZXA 4E2FA 4UUOA 1VLMA 2YYAA 3EN0A 2OHGA 4D8UA 3MWGA 4CMIB 3RRJA 4J0DA 2J3LA 1SCAA 3EARA 3ZDCA 4CLXA 5HXAA 2JRLA 5JTTA 2X76A 4TVKA 2RMKA 5EE1A 4XJSA 4BTVA 4QKQA 4XWOA 2E48A 1G8MA 2JGMA 3PXUA 3T5TA 1ESMA 3D2CA 2H1FA 4E0BA 1MB9A 1CEQA 1U7DA 3FYDA 4RCZA 1SUIA 3NTQA 4BFVA 3KSMA 2F1HA 1H3FA 4IXMA 3MMNA 1JFRA 3B36A 3OH8A 4RMNA 2W6MA 621PA 1IQ0A 1E58A 1GFZA 1RAIA 3LCMA 5DB4A 4BQSA 5ERXA 4C88A 5IK2D 4GDMA 2OYSA 1JFLA 3CMMA 2GR9A 4Q4AA 3QPDA 1P9RA 1RIIA 4WOBA 2GN4A 1KWGA 3U44A 5FBHA 2QT9A 3IBYA 1TLTA 2CB0A 3UAVA 1KYIA 1I6KA 2QRZA 4RVGA 5G1OA 5GM1A 3TQFA 3T3HA 3KU4A 1YUMA 1Z7WA 1GRCA 4FLEA 2IUSA 1DARA 3AIKA 1CZRA 3JRXA 3C3YA 1LCIA 4GX0A 1QF7A 3PF8A 3UH0A 3W5JA 4F3RA 5M2QA 3UICA 3OEED 4KR0A 4NJMA 3ZEAA 2I67A 1JQDA 4AS3A 3C45A 3BG5A 4RH1A 4D8WA 2A8YA 1UDBA 1MTOA 3TQIA 2LCQA 3E7XA 4LJKA 2C1EA 1LLFA 1UDXA 3WG9A 3LPDA 3SEAA 4M0FA 1ZU4A 3DPIA 3TB4A 1GZ5A 3OZ7A 1RYEA 3HA2A 3O03A 1EDOA 1VJ1A 2AWOA 4IDGA 5LYYA 4BNVA 3M6FA 3C7CB 5KOJB 3TX6A 1G7RA 2QZJA 4HS9A 1W4RA 2XBLA 4EG1A 1VKNA 3P4UA 3B20A 1I10A 1SXJC 3RNLA 2C8JA 2WHQA 3MG9A 4MVJI 3SHFA 3PYXA 3CJQA 3V4RA 2J31A 1ULUA 4FDUA 4MAFA 2JJ8A 2P2CA 1VGRA 4BMSA 1AF4A 5J4VA 1S4MA 3IAXA 5KVQA 3WLFA 2OXTA 4DE5A 4EI9A 4FSXA 2E5WA 2BUCA 1IBKB 1W87A 3NJ8A 4A6PA 2WHXA 3N74A 3PUIA 1OY1A 2O2HA 3GJRA 4Z0PA 1OWPA 3WLHA 2BUBA 1TUBB 1D6MA 2QL6A 3F6PA 4H31A 2GK7A 1A4XA 2B5WA 4EYEA 1P7WA 3JZFA 1BD4A 1VDMA 5BORA 2W2NA 3GJ3A 3DLIA 4TLCA 2HO4A 3BORA 4WKNA 3OWOA 5C5IA 1C9NA 4LISA 1A77A 1I4DD 1AB6A 5LA6A 3TW4A 3KQYA 4HATA 3ECSA 3FTQA 3ZV5A 3SFVA 2A94A 4QDZA 3EWNA 1M33A 3HVJA 3THXB 1GSOA 3ODPA 3EVCA 1W2WB 1J0CA 1IIRA 1NKSA 4HH1A 1P2BA 1M2OA 2C2WA 4F3KA 2Z9DA 2VF2A 4ALKA 1SUPA 1UH5A 4B4DA 4FIZA 1CEEA 2W93A 1EVZA 4KK3A 2QUBA 4MARA 1TYCA 4F12A 4TQAA 5TS2A 4W5RA 2OA0A 4ENRA 1T36B 1Z4MA 2CMHA 2VDVE 2XKBA 4FE7A 2FRVA 4PG4A 3OLVA 2Q9CA 4L27A 3TVDA 1I2ZA 3TTYA 2P2YA 4AQDA 4X00A 4CLRB 3NU1A 4C0JA 5BV8A 1CZLA 5BXQC 1B1AA 5JCOA 3R7DA 5F51A 2ZRFA 3M6AA 3FWNA 1THMA 2RHRA 5D3MB 5D87A 2Q5QA 3IVGA 1Y34E 2PFGA 4M6WA 3F73A 1MO5A 2FW8A 5ELXA 2GN9A 1DPFA 3OTIA 5BVGA 3AL0C 1N2HA 5AHRA 5BSMA 3FA2A 1ST2A 2BW0A 2FOLA 3PUKA 5EYPB 3BL6A 1FMJA 2HBYA 3KTAB 1RLUA 2Q49A 2QRQA 2QOEA 2OD2A 3H2SA 3U3DA 2BMVA 1JHOA 2V7BA 3LD9A 5EWLA 3FMIA 3A4LA 1MAUA 2XNDA 3DHVA 4NH0A 4WXMA 5DCLA 1Q1NA 1U5AA 3BWXA 4P31A 2P7HA 3VH3A 2ZSAA 2A9KA 2GAOA 2PUVA 4BFYA 4OIMA 4ACAA 1CZKA 2VSXA 5JY6A 4F86A 4HAWA 3OA0A 1DXQA 3P2IA 3BEDA 2QI9F 3LT5A 3PK0A 2XD4A 3TMYA 3HCDA 1I7QB 2G5PA 4YCMA 4DMFA 3BCRA 5HM8A 1JA9A 1Y3HA 4I9GA 4UZFA 3OD5A 1M2KA 2VJOA 2W2TA 1MXHA 1HLPA 1C3XA 2G4VA 2WG0A 3BBPA 2QQGA 4H9GA 4LOJA 4X1YB 3GLUA 3ZUGA 4EG6A 2YW9A 5FWXB 4KR6A 4IOLA 5IN4A 2YX1A 1BE0A 1NHWA 1BTOA 1ZI8A 2Q6OA 2J3IA 3IDOA 3KSRA 3RUIA 3H84A 3VGJA 1CUZA 1D1QA 1EVKA 2NZ8A 1VIVA 1TC1A 2R25B 3OFSA 5FTKA 3LWBA 3VMFA 3PUVA 2ORWA 3TQTA 4UDOA 3A6KA 3VVCA 3U4GA 1ZAKA 2G9VA 3QPCA 1PRYA 2H7VA 2HSEA 1KU0A 1GSHA 4J49A 1UM9A 2QD4A 1JHPA 3BXOA 4TV9B 4YMWA 3DTVD 5LZ8A 3WKCA 4BE9A 1FP7A 1ORHA 4O2AF 3JASA 4Y6LA 2FKAA 2I99A 2JFOA 2VHQA 2WVAA 1SM4A 3IT2A 4MUGA 1F5NA 3TTWA 4ZICA 2ZITA 1MC5A 2B82A 2QX8A 1RACA 2NQ2C 3HWSA 3SYNA 3VR5H 1ECJA 2WQ6A 1XDBA 3PEWA 2G76A 3I4FA 1ZMRA 1KYQA 5ALZA 1U1IA 5K6RA 1R74A 4QX6A 2XLBA 4G0OA 4LYJA 3K0AB 3TDMA 4B7XA 3EBLA 1UXIA 1HY3A 1NI5A 2OHHA 2OGZA 1P74A 4IHJF 1E6CA 2HHLA 4IWXA 4NS4A 2NGRA 2D0OB 4C5BA 4HF7A 3OCJA 1NLYA 3I9FA 4Z9BA 2J41A 3QEMA 4DY4A 1A8IA 1V7PC 4AO7A 4TKLA 1AQJA 3CZPA 1GGNA 2DTDA 4RCVA 4PQRA 5B7PA 3F46A 4FGZA 3QVKA 1RM4A 3A14A 5K0CA 2YNMA 2XNJA 2GO7A 2OK7A 3NHYA 3COSA 3NEPX 1B8UA 5DLQC 4EY5A 1OKKD 5AT1A 1EE9A 3IUQA 3W1WA 1V5GA 3AR4A 5D7NA 4F4CA 1FYFA 3AI2A 4KU4A 4I46A 4RXTA 4C0XA 3AF1A 1K6XA 3ROQA 4GKVA 5EIFA 2QX7A 3NVKI 2FPIA 3JTMA 4G4SO 4ZO9A 2EZ8A 3ROXA 2B92A 4LMPA 2XB4A 4GI7A 1B15A 4I4TF 3IUMA 2FK8A 2V97A 3OZBA 3EFOB 1UKBA 4CF7A 2A0UA 2X8WA 2C5GA 3ABIA 2WFZA 2R62A 2EX0A 2IHJA 4GMFA 3TZEA 2OHIA 4LXIA 1FUYB 2DTXA 3DTTA 2O4CA 2YW2A 3GI1A 4CIBA 3NYWA 4TQGA 4DG8A 4UBNA 3ZE2B 2H16A 4D5EA 5BSFA 2WJGA 4Q1DA 1E99A 3OWHA 3TUJC 3TK1A 1R5NA 2DERA 2PL5A 4GX1A 1JE0A 3EMDA 2W2XA 4KP7A 4LJYA 2O2DA 3OPNA 1XQ9A 2R8BA 4H7FA 4HLUC 5ALOA 4C4RA 1XKLA 2I2XB 3GFBA 1PQUA 1RFLA 3UB3A 2P91A 4JUFA 1NOKA 1Y7TA 3Q6MA 3S8MA 1AHPA 3LM8A 3COWA 1F38A 2RDMA 3DHWC 3GUUA 3LHDA 4UMFA 3TM4A 4C3ZA 5A02A 1VHTA 5LZ9A 4CTKA 4IBOA 3T7SA 5FH9A 2NTYC 3VSCA 4YJGB 1E32A 1EPUA 2OBXA 2HUPA 4TZTA 2YH2A 5HDQA 4CG3A 3E7DA 3GLTA 4EHLA 5CU7A 4Z4IA 3DEYX 3H3JA 5KQPA 1UEJA 1MJNA 2CVZA 4MPRA 3GZJA 3SXJA 2O23A 5THKA 2N3ZA 3SIRA 4B2IA 5KYYA 5ALPA 4OAOA 2AFIB 3CB4A 5KKAA 4L1KA 4NCJA 5A5FA 8ADHA 4ER0A 2VPWA 4MW4A 3V2UA 4D9MA 4O2BA 3QNMA 4A73A 1PEDA 1G20E 1YJCA 5AW8A 3ENKA 1DG9A 3HKEA 4WBNB 2ZYVX 4OHPA 2AGVA 2MU1A 4D41A 3MF4A 1G59A 4H7EA 4G4IA 2GRUA 1J9ZA 3K5WA 2QLMA 1CP3A 4GO1A 4ZVLA 1KXZA 2C4MA 2ZBGA 1NHGA 3WFJA 3D8HA 5JHHB 3DB2A 2EFYA 2YDXA 1XU4A 2BF4A 3I61A 3GGDA 1JPNA 3H1PA 1B00A 2VPIA 2JLQA 2YIMA 4E3WA 4MV4A 4UHJA 5T5QA 5E3JA 4D97A 4Y2QA 1SFRA 3QVJA 2Q7XA 1W0KA 1XQYA 3MMXA 1X1EA 2FPGA 1NW4A 3BJZA 4JT8A 5FOXA 5J4HA 1ZR4A 2ODWA 4P38A 1R4NA 4RM2A 5JNLA 2HIAA 1E61A 1WDKA 1CEXA 3C8HA 3RVJA 4Z8XA 4CFSA 2VF4X 4I55B 4O4IB 4BEBA 2MHCA 3ZH2A 4J4HA 5JLJA 3QFCA 3DMYA 1Z2PX 1FRQA 1GRVA 3M1LA 4UFNA 4RTLA 3PNMA 1J21A 2IJGX 3JQAA 1RHUA 3ZG6A 3M6VA 2ZYWX 4LHWA 1U2ZA 4JU8A 1JX6A 3PL5A 2X77A 1CFJA 1WNTA 4H18A 4UHBA 3L6CA 5IXJA 3TW0A 1XKTA 1PE0A 1G2OA 1KQOA 2QTNA 4G0UA 5BV7A 1BN7A 3DW3X 2A4MA 3DVSX 5EXSA 1U3FA 3HXTA 4WSOA 1IM5A 5I4BA 1KYWA 2VA9A 4TKUB 2MWMA 3TX2A 4K6OA 3OKAA 5EVJA 1U63A 4PS1A 3L0IB 1Y7HA 2PKXA 4F8EA 3STTA 1PR6A 3LUHA 4DBZA 1JQEA 2Q3DA 3KJEA 5C8YB 2YUIA 3DHEA 1V16A 3AV3A 2Q6KA 2YZNA 3CINA 1ZG3A 4KBFA 1HDYA 4RD1A 3ZE1B 3FVRA 3VR1A 2FUCA 3FGNA 4PZAA 5EJ8A 5C53B 1QG6A 1C4KA 4NMXB 3LO8A 3LY8A 4RY9A 4FX2A 4AKSA 4COKA 3NUGA 3ZWBA 4W1SA 3ZBUA 2QLNA 3LECA 4Y9UA 3QE0A 4GT1A 3GDWA 3F49S 1FBTA 4UUPA 3EUAA 1QFYA 3WRVA 1K6MA 1Z7GA 1B6GA 1I9CA 5LOVA 3CF0A 4QSMA 4ID3A 3VGPA 2BHNA 2GPJA 2AW5A 4DBLC 2BAGA 1NSTA 2BCEA 1YFKA 2F6RA 2F8MA 2JHAA 5HK8A 5TGTA 3A3YA 5FFNA 3UMBA 4YXFA 3CLUD 1R0YA 2DQSA 3JWPA 4Z8YA 4UBMA 1XJ0A 2Z83A 3Q40A 2OV4A 2J4CA 3QYFA 1E9DA 2FSGA 4XGQA 5E6SA 3P9NA 3CXRA 1FFAA 1SUSA 2JKYA 2Q29A 4M7OA 2XE8A 3E48A 1K7EB 1PZNA 1Q74A 3FBGA 1XEWX 3DKKA 4HV4A 1AK9A 2R6AA 5ICCA 4G0VA 1BC5A 2ET6A 2D1SA 3GB9A 3K4HA 2Z1DA 1LU9A 4F3CA 3H6KA 3QKTA 2WA1A 2PPVA 1CUJA 4OP1A 4W99A 5E4JA 13PKA 1ZCJA 2YC2C 5A1JA 3BILA 5LBIA 4Q9HA 2RONA 5JDCA 1YBMA 3HJTA 2D0PB 4JC5A 3R2JA 5EE3A 4EUHA 5CA1B 4URVR 3N8GA 1RLTA 1EVLA 3AM1A 4MO9A 4MJ7A 3VNBA 4EG7A 3SC2B 4IYJA 4HWKA 1SXGA 3BFVA 3CZMA 3KPVA 3SVTA 3G6KA 2PGOA 1W4CA 2VHEA 3FMVA 5CXUA 5H4GA 5CX1B 4JP2A 4H7KA 4U2CA 2NZ2A 2Z5GA 3ZZUA 2SCUB 3HU3A 1VB5A 1DV1A 3VSBA 3UZUA 3ICPA 1ISMA 1GU7A 1UBTS 3KO8A 4A6EA 1OIWA 4A8HA 4M0EA 5IAKA 4BNXA 1GCIA 2Y67A 3CLVA 3N28A 1C0IA 4DCGA 4W7HA 2GJSA 3R1IA 1VIMA 1H69A 1KAGA 4GBMA 2UDPA 2NO9A 3T5MA 3D2AA 5H16A 4BQRA 2WF6A 1JKMA 2OB1A 5LB4A 3B3GA 1D6SA 3F4KA 4H3SA 3LZCA 3OOEA 1T0BA 3ND5A 4REQB 3OVMA 3T7JA 4LGCA 3V8BA 1A2OA 1CRLA 3HNPA 5L45A 5CA0B 1Q1QA 1VA5A 4YRDA 1ULSA 1Z5UA 3ANSA 3TNFA 4XW2A 4QOJA 1FX0A 2CGEA 3FPHA 1CRPA 1XT6A 2ZTUA 1QBGA 1A71A 3P71T 2E1RA 4IQ8A 4UUBA 5JH7F 2JGAA 2BFDA 3OCXA 4RDCA 5AIAA 4TWIA 3RS9A 1P18A 1ISJA 4DLAA 3TH5A 5HTOA 5LU8A 5DLDA 1HYGA 3EBOA 1RC0A 2H1OA 1WVIA 3CH5A 5HQTA 3ZJ5A 1POXA 2JGJA 1ZZEA 4YUXA 1UMCA 1JP7A 3AP3A 3OIUA 1GZ3A 2YWBA 2IA5A 2O1EA 5ALNA 4RIIA 3KS9A 4K6HA 1TEZA 1KYYA 1VRVA 2BLNA 1ZD9A 3H75A 1BDIA 5EFOA 2BGMA 2VXOA 1FRFS 2G6TA 5GY7A 3DV2A 5JLAA 3GGOA 2R6CA 4IZ6A 4BMYA 4MYDA 1IULA 2VHZA 3FFWA 3H18A 2LBPA 4DLUA 4NYIR 4Q19A 4S1OA 4E5UA 4YR7A 4I2NA 1G6OA 1FYEA 3D4IA 3FNBA 4DA4A 4OLBA 4DWJA 2BSAA 4JV5B 4KK4A 4ZQEA 5LP6C 2OQVA 4E31A 5EJ7A 5SZKB 2J46A 3U81A 3UMFA 2YICA 2WWGA 4Q0MA 5C8XA 1IZYA 4EO4A 1M75A 3D3KA 2JBAA 2JB9A 1L4UA 1MRZA 2FOIA 4HDKA 2C96A 5IUKC 4CLDA 2O2CA 4HDNB 2B0CA 1IPFA 3HCRA 2AN1A 2BM0A 2O0KA 2VJMB 1U7HA 4OO3A 3X1ZA 3H5OA 2CD7A 2BPOA 2IE0A 5B2ZA 1R3DA 3W8EA 4CL8A 1L4HA 1SMKA 2CFOA 2NM0A 3OHMA 5J5VA 4LY9A 3UCFA 1P4AA 3QVGA 1P1KA 3NKLA 5UKDA 2HMVA 1X1DA 2CXXA 2AR0A 2ZJ8A 3V2GA 4DKJA 5A4JA 1ZD8A 3M4XA 3NB0A 3DVRX 3LHSA 4PZEA 1XTUA 4R9SA 4U0JA 3SOZA 4EKGA 3R5SA 3I1YA 2QM7A 3HI6A 1UBHS 5CT5A 2OYCA 2QDKA 1A3CA 2JL1A 2WJYA 3OPYI 4N8SA 1KMMA 3V32A 5BQOA 3WIVA 5K0EA 3OQHA 1GJRA 1BWSA 5LU9A 1BDHA 1RC8A 4W6ZA 1JAXA 1ZQ9A 1V5FA 2O7SA 4XX0A 4FFWA 4ALLA 4KQ1A 3IOYA 2WWVD 3PHBE 2ONJA 2CMFA 3TPZA 1NUPA 3GFPA 1SXIA 2FG7C 3LV8A 4DCCA 3CZAA 4RV5A 1T2FA 4NEGA 3LQKA 5AQEA 3EXFA 2WTMA 2XH8A 4Q16A 3UGKA 4BMDA 1HQYE 3LYAA 3SSAA 4YO7A 1FW6A 1P5RA 2OCBA 2W11A 3KB2A 1ZD3A 2V3VA 1J8YF 2ZDHA 3ZR4B 4I4IA 4MR9A 4O2AA 3E22A 5BR7A 3Q5EA 4EMUA 2NTVA 2WPNA 3DXYA 3HN6A 1G2QA 3OD1A 1UT8A 4GOMD 1VL5A 1IRIA 1M6HA 3ET4A 3GL9A 3OCUA 2ZIFA 3Q2OA 1YONA 2WF9A 3JQBC 4WKGA 3OQBA 4HXEB 3QBVA 1U5BA 4ZI7B 1V11B 3B51X 1JPVA 3DQQA 4QTUB 1A9TA 1T5DX 3RHZA 2M6SA 1SURA 4E32A 2X8AA 3E2IA 4RNDB 3KVYA 2C2XA 2WDZA 1TEXA 4Q39A 4IDAA 3QU2A 4BV8A 4AJ1A 1RMYA 1Z3IX 4ZCPA 1J1IA 2HJSA 5ISMA 1V5WA 3QXSA 1I13A 1RXUA 3JQEA 1KDVA 5IX8A 1NP3A 2FW9A 2JGEA 1O94D 3ETLA 3HB9A 1L9KA 4I8IA 4MW7A 4WK4B 5EL0A 3VR6D 5ICEA 1CY7A 1GUYA 1KZ7B 1JHXA 5ECWA 4LK3A 2QTCA 2B1JA 2ZW9A 1VJ5A 3PIIA 4R01A 2OZPA 4O3MA 4UMVA 3H83A 3NQ41 2G8NA 4P93A 4GOLD 2R8YA 2ZWIA 3DF9A 5KSOA 2BI7A 2DFKB 4I4TA 3FXAA 2VQ6A 1GTVA 3AL3A 3Q0EA 4G1BA 4HQRA 4XYMA 5AW5A 3JRNA 2CHGA 3GLQA 3V2IA 1M0WA 1TAQA 4OMDA 3VO2A 2I6QA 3WRYC 1CQJA 3UTDA 2BBTA 1EBFA 4G9EA 4BP8A 2P6OA 3AK4A 3DDUA 3RTBA 2WAXA 1OU0A 1M5TA 1Q77A 5SY4A 2C95A 2VNIA 3SKXA 1Y8CA 4N03A 2LGJA 2V5AA 4TV8A 4PCAA 1L7VC 4RIHA 2XODA 3WWEA 2GCPA 1S5PA 2W8ZA 3HM2A 3WB1A 5GVSA 4TZ0A 3NM6B 1GPNA 2ZE7A 3EIXA 3ILXA 4RPCA 1LPSA 1RVV1 3FSEA 3F6SA 1XA0A 3EH1A 3ERCA 2B4YA 1A2BA 2A3NA 2G3YA 3B5JA 3F8TA 1POWA 1E5LA 1T9CA 1WPRA 1ZGAA 2VSYA 4ME6A 1M1YB 4QOIA 4QTTB 4YVFA 3ZWYA 4FCTA 3F67A 4IJKA 1CQWA 4P33A 3U6BA 2FUG1 2HMUA 2MOKA 3LDFA 3UGQA 3IPXA 3PHIA 2BMFA 2PBRA 1Z82A 3KELA 4PC3A 3JQ9A 2ZTSA 2AG0A 2TMGA 3CNBA 2C2BA 4R8MA 2IIPA 4ODIA 4F5ZA 2PO5A 2LP4Y 1FDVA 2GZSA 3A2LA 2C9DA 5EWJA 3V34A 2NTNA 3LC1O 1LDBA 1XVVA 1OYVA 1ACLA 3VV3A 3EA5A 3OZTA 4QLOA 2CVQA 3IGFA 2UUOA 1JG7A 2BVNA 2R1TB 1VJTA 4Q02A 5DYYA 4CV3A 2ZIGA 5C8VA 4UTNA 3O9MA 4DCJA 5JSZA 3RADC 2NU9B 3AVYA 3I2JA 1DFHA 2WMDA 4IAOA 1DJQA 1AGNA 3JW8A 4GLFA 4E5MA 1E69A 1JQ3A 5KNCA 2BRUA 5KVSA 2GLXA 3Q6IA 4CM8A 1R3UA 3HTXA 2X1MA 1JVBA 1MHPA 1MMFB 2NVWA 2XUFA 1QRRA 1RI4A 2ZAOA 3PQ7A 2RGAA 3W3AD 4W9NA 1O6FA 1LPPA 3OA2A 3WHKA 4A6XA 5BR4A 1MABA 3ZJYA 1VC2A 3T9BA 1GGJA 3CB2A 3O6VA 1XQ1A 3K9HA 1FJXA 1YD7A 4DMMA 2QK4A 4Y9TA 4WKOA 4WNYA 4LXHA 4XIIA 1XWFA 4MGEA 2PJZA 3HCBA 3KFLA 3DMHA 3NTVA 5HIJA 4AYTA 3WZ2A 1QH9A 1OD6A 2C7BA 1F2VA 1FLAA 2GGSA 2OBBA 3BD7A 1ZQ1A 4LWOA 3EK2A 5C1PA 3W5BA 1NDHA 1E1QD 3KG2A 5J58A 3PP8A 4RTQA 2LKCA 3QVMA 5TF0A 2BFFB 3IKTA 1J2TA 1HTTA 2VNKA 1QGUB 1CUHA 1FUEA 3N76A 5U4XA 1AHNA 3PR2B 1Y3CE 4WLFA 4OM8A 4H6PA 4ZQCB 1QE5A 1F20A 4WXEA 5L8VA 4BQOA 2BT4A 4HGNA 4MJ3A 1SULA 4WCVA 1N3YA 3PDIA 1M2JA 2DM6A 2EP5A 2Y2UA 1R8XA 1P9WA 2JNWA 1Z5PA 2AW3A 3MK31 1YA6A 3HFJA 4BMXA 4Z0NA 4QYTA 3WISA 1KORA 2D5IA 2Q9BA 3OZUA 5F1OA 1CJBA 2IZ7A 3AW9A 2B4QA 5K4AA 3ZXIA 4KO4S 3UQYS 4BECA 5DT2A 3UA3A 2D74A 4W7IA 1W75A 3EAQA 1B2RA 3JQGA