4O1HA

Crystal structure of the regulatory domain of ameglnr
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
SHMSLDLLVMTAEADATAVLPALDLLPHTVRVRAPEVTALLDAGHRDVILLDARSDLASAKSLCRMLKGTGEDEAATPIIAVVGEGGLVAVSAEWRTDDILLPTAGPAEVDARLRMVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcription regulator GlnR
publication title Atypical OmpR/PhoB Subfamily Response Regulator GlnR of Actinomycetes Functions as a Homodimer, Stabilized by the Unphosphorylated Conserved Asp-focused Charge Interactions
pubmed doi rcsb
source organism Amycolatopsis mediterranei
total genus 27
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4o1hA00
3O2SB 2L17A 3HUTA 1TMYA 4W5QA 3OQMA 4F3TA 1MVOA 2LUOA 2R25B 4IGAA 1Z13A 4WXMA 1U04A 4EYOA 5B3JA 2FLWA 2GX6A 2MSWA 2GBPA 3KCNA 4ML3A 2X7XA 3JPWA 5EWJA 4ETNA 1WETA 3IPAA 3O21A 3EGCA 3OO0A 3QLTA 3RQIA 5KQMA 3M9WA 4KK3A 2FQYA 1M5TA 1JHZA 2NT3A 2PUBA 3H5IA 1VKRA 3N53A 2O20A 4Z9AA 4LZLA 2FLKA 3QX9A 4UHKA 3RVLA 3MQ4A 3HV2A 2QU7A 1DCMA 3GRCA 4Q7EA 3ROTA 1JF8A 2V0NA 3H5OA 1PNTA 2QSJA 1E6MA 3IP7A 5B3JC 1EWKA 4CBVA 1E2BA 5PNTA 4B09A 5EWMA 3GL9A 4RK0A 1Z26A 3KKEA 3IP6A 2FMKA 4F11A 2RJNA 2A9PA 2P4UA 3DZDA 2FQWA 3JS5A 2QZJA 3LMKA 3OLXA 2L2QA 5EWLA 4D6XA 5I4CA 2IKSA 2MYPA 3NBMA 1DCKA 1F51E 3HSYA 5IUNC 2PE5A 4EUKA 4IILA 4MS1A 4RKRA 3EODA 3FDFA 1DBQA 3N0RA 2R4QA 3CU5A 7ABPA 1QQAA 4EYQA 1Z17A 5JNWA 1Z2DA 3H1GA 3GBPA 3RVNA 3C3KA 4RXUA 4MR7A 1VPWA 2JVJA 3LFTA 4GPAA 4H3HB 4ZPJA 3I09A 3RH0A 4RDCA 4G86A 3K9CA 2RJOA 4LE2A 4P1ZA 3FGZA 3RVPA 4MR8A 5JNRA 3H75A 3IDOA 2PAFA 4MQEA 1PHRA 2VK2A 3I42A 4MR9A 4OATA 9ABPA 4QICA 2JCGA 3DBIA 2JBAA 4G0ZA 4JP1A 2E4UA 1UDRA 3T8YA 2PUGA 4Z0NA 3Q7RA 4RK1A 1K66A 2YHBA 4PE5B 4N41A 3KYJB 5JNSA 4KVFA 1DJMA 5TPWB 2FVYA 4LRQA 5KC8A 3CNBA 1MB3A 1BA2A 5IBQA 1QO0A 1JWLA 2PUCA 4Z4FA 1TJYA 4NICA 4RV5A 1QKKA 2WJAA 1PEYA 1Z12A 1ZHHA 1XHEA 3EQZA 3LUAA 5TQJA 2FEPA 3VNBA 3O1IC 4WT7A 5T7BA 3H5LA 1YS7A 3FFTA 1FFWA 5D2CA 1FSPA 3KJXA 3KG2A 3CKMA 5ED4A 4LE0A 4KQ9A 4O1HA 4QYMA 1CEYA 2JRLA 1QPZA 1QO0D 2AYXA 4XAQA 2WRZA 1PNRA 5JS1A 2CHFA 1RNLA 3DGFC 4WZZA 5KC9A 3HM9A 3UK0A 3QEMB 4YCSA 5FBKA 1U8TA 4LX8A 2YHAA 1JFTA 3SY8A 3HK2A 4RK7A 4OBBA 1YVUA 2QV0A 3LUCA 4EYGA 3OLVA 5C5CA 3R0JA 4JAVC 3Q7TA 2CHEA 1KGSA 1D4ZA 1F4VA 5GQSA 4IF4A 3T6KA 1P6UA 2MYUA 1DP4A 4PEVA 4UHJA 3TB6A 1GLGA 2R48A 2FQXA 3S99A 2RDMA 2RGYA 3W9SA 4PYRA 2J48A 3RVOA 3M6MD 3OLZA 5IEJA 1LJLA 4WWHA 1USIA 3A10A 3RVKA 4TMYA 4IRXA 4D74A 2FXIA 3L49A 2MSLA 3SAJA 1TLFA 1FQWA 4EVRA 2GI4A 4JA2A 3C97A 2PL9A 4Z4HA 4FB4A 1M2FA 2NZVG 5BQ3A 3OLYA 1BDIA 4Z4IA 3HJFA 3JPYA 3F6CA 5BRJA 1D1PA 2L18A 4RY0A 5TE9A 1E6KA 4W5OA 4KNYA 3A3KA 2A9OA 4YS6A 1P6QA 3KSMA 3N8IA 1ZH4A 2ZWMA 4MRMB 2MSKA 4MS3A 3MYYA 1ABEA 1DG9A 1NXPA 2OQRA 1DBPA 1URPA 2KYRA 3H6HA 2IPLA 3TX6A 1EFAA 2F8SA 4QYWA 3SM9A 3Q15C 2B1JA 2IOYA 3LUFA 2F8TA 3QELB 2HQBA 5JS2A 4YO7A 5JNTA 1CYEA 4LDZA 1Z16A 2OENG 1KMIY 4RK4A 1LBIA 5HM6A 2QXYA 2AYZA 1RZRA 4OG2A 1T34A 4L4UA 1DCFA 3JY6A 3LUGA 3B2NA 3Q41A 1M5UA 1XHFA 4N0QA 1DZ3A 4G0QA 4JB0A 3GV0A 3LUDA 2HJ9A 1SXIA 2XDYA 5TQ0A 3BRQA 4FE4A 4EYKA 4RXTA 3OMXA 2FEWB 2LIVA 3TO5A 3KLOA 4DN6A 3HS3A 1C0EA 4JB2A 4PZ0A 3UKJA 3ILHA 1SXGA 5FWXB 5CNKA 4QPJC 3RVJA 5IC5A 3LUHA 1YTUA 3CZ5A 1LJUA 3OMWA 3F6PA 3HCWA 1BVHA 1A2OA 4KZKA 5E3JA 3KTOA 3GBVA 4MLCA 4KQCA 2CD7A 4F06A 2PUDA 1A0OA 1ISRA 1ZY2A 3HDGA 3LOPA 3QEMA 4KK4A 3K4HA 4RK6A 3C3WA 4ZYLA 3GYBA 2IPAB 1SD5A 4W5TA 4RS3A 4F12A 5F64A 2I6FA 3GA5A 1JDNA 3EQ2A 3HZHA 4MS4A 4EGSA 3JVDA 1QNLA 3N0XA 3TD9A 3ROFA 2MYNA 2IDMA 2FMHA 4G0MA 5CNMA 3QLVC 1NTRA 4Q6WA 4Z4GA 4S05A 4YV7A 3JTEA 5FWYB 2M1ZA 1EHCA 1JL3A 3QEKA 4G0OA 1U0SY 4YRZA 5KQPA 2FN8A 1LBHA 1NXVA 3KS9A 3HUUA 1MB0A 3CLKA 1DC7A 3BREA 4N47A 4KRFA 2LP4Y 4XLTA 3EAFA 3A0RB 4ZMRA 5DCLA 4MLDA 4XFKA 4PICA 1QP7A 1GCAA 3Q7SA 4LE1A 4N03A 1YIOA 2FKAA 3NNNA 1Z15A 5HQJA 1AB6A 3N6VA 2L19A 3M9XA 1W9HA 3O75A 3OM0A 1VLZA 3RVMA 4YR7A 1QP0A 1USGA 3O1JC 4KMRA 5IX8A 2W42A 1JFVA 2WB4A 4XASA 5EWLB 2HSGA 5IEBA 2JB9A 1YK1A 4EVSA 1XWWA 2HQRA 3URMA 5GOTA 3O2JA 4MS1B 1P2FA 1DRJA 1EAYA 3CZCA 3FFXA 3LKVA 4IMJB 1E6LA 3N75A 4M88A 5DLEA 5KI6A 1OXKB 2JK1A 3H1FA 3O74A 4DADA 1FFGA 1A04A 3CG4A 3LUJA 1ABFA 3QK7A 4P98A 4E7OA 3SNKA 4KV7A 1QQBA 4RY8A 1DBWA 1NXXA 3JVIA 4HNSA 1GCGA 3MMNA 3H5VA 4KPYA 1USKA 4EY3A 4N0PA 4NCAA 4HNQA 4TLMB 4JASB 4TN5A 2BGGA 3MA0A 4Y9TA 4MQEB 4MR9B 8ABPA 2PUAA 5CHYA 3EDCA 1RXIA 2GWRA 2IYNA 2LBPA 3Q9SA 4G0YA 1ZITA 4Q6BA 5KQLA 4Z4EA 4MQFB 4DQDA 3ILYA 5ABPA 4Z99A 5HKOA 3I5AA 3OQOA 1JFSA 2NZUG 3T38A 2E4VA 1MAVA 2N9UA 3NHMA 1PUXA 4YP9A 6CHYA 4O5AA 3KLNA 2FSPA 1FFSA 4WXEA 3DGEC 3UUGA 5KQGA 2A9QA 1IIBA 5BR1A 2E4ZA 3KHTA 1ZGGA 1S8NA 2CWDA 5DGCA 1ZGZA 3O2QB 4OLBA 5JNVA 1U2QA 3LUKA 3QX8A 1DC8A 1I3CA 3T95A 3QLUA 1OXBB 3OO1A 1ZESA 1J56A 3IP5A 3KYIB 5TPZA 3GWGA 1D5WA 2TMYA 4ETIA 3E61A 2JVIA 1EWTA 2DRIA 1Z18A 1TVMA 1ZH2A 4HNRA 3N0WA 5TQ2B 1DRKA 5TPWA 3H5TA 1NXSA 4O1IA 3CHYA 3FMVA 4MAAA 4RSMA 2LPMA 4EVQA 5FWYA 4HYEA 4RZSA 1P8AA 1U2PA 2H0AA 1B00A 3QLUC 3RVRA 3CG0A 4G0PA 1ZAYA 3BBLA 2FW0A 5TPZD 1RPJA 1RZRD 1SRRA 3NHZA 1QP4A 1C4WA 4KREA 1GUDA 3IP9A 2PLNA 4E7PA 6ABPA 3RVSA 2PL1A 5IUJC 1JH9A 2Q5CA 2FMFA 3NNSA 1D2AA 2GKGA 5CNJA 3OQNA 1K68A 2IPMA 2NUBA 2A9RA 2PUFA 3QLVA 4L85A 3HVRA 4OTZA 4OLAA 4W5NA 1JLKA 5T3YA 3HXMA 4XARA 1ZDMA 1M2EA 2ID7A 4Z4CA 1BDJA 1NXTA 4YWHA 1QMPA 2QR3A 4D6YA 3D02A 3F7NA 3G1WA 3DLBA 2FEKA 1SXHA 1JBEA 4H60A 4N76A 2JVKA 4XXHA 1R8JA 3H1EA 3C6QA 3EULA 1NXOA 2FN9A 1NY5A 3E3MA 5IULC 3RVQA 5JNUA 5EWJB 1PEAA 4JOQA 4MPTA 4NCBA 4MS3B 4H3KB 2FMIA 3P9YA 1VRVA 3GT7A 2QVCA 1YMVA 1D1QA 5DTEA 3SG0A 1GUBA 3D8UA 5C5EA 1CHNA 1YK0A 3CFYA 1ZVVA 4MQFA 2E4XA 4ETMA 1AB5A 1W25A 4G97A 4RWEA 2ID9A 2WY2D 4RKQA 3G85A 4F8JA 3OLWA 2PMCA 3SQNA 4ZMSA 1KRWA 4G0XA 3NNDA 5DKFA 5EWMB 5CNIA 1JDPA 2HQOA 4NV3A 4MRMA 4FE7A 5BRAA 4MGEA 4RU1A 2PJUA 1YS6A 3CS3A 3H6GA 1ZN2A 3LKBA 4RY9A 2PKXA 5KWSA 1JX6A 1L5ZA 4MYRA 1KRXA 2MYTA 5TQ0B 2P9HA 4Z9BA 3QELA 2VYCA 1APBA 2FTKE 2VUHB 3MM4A 4GNRA 4RXMA 3CRNA 3EJWA 3HDVA 4LDAA 1H9CA 3C3MA 3TMYA 1BAPA 3L6UA 4MR7B 3MF4A 4YGXB 1Y1LA 3A0UA 3OM1A 2IPNA 5TQ2A 3F73A 1EWVA 2B4AA 1MIHA 1ISSA 4MR8B 2WJWA 1Z2EA 2ZAYA 2E4YA 3VNAA 3BILA 1BDHA 4W5RA 2WMYA 2H3HA 2E4WA 1YMUA 2JBAB 2VUIB 4IMIB 3DLHA 1TM2A 4TLLB 4RK5A 5FBHA 5HSGA 3H5WA 3BRSA 3O1HB 1NATA 1L5YA 1RXEA 4MS4B 2WWVD 4ZJPA 3I45A 4NQRA 5FWXA 4WUTA 4YLEA 2QVGA 2HPHA 2R47A 2PUEA 3IPCA 1JYEA 1HEYA 3HEBA 4S04A 3FFWA 4KFCA 2QW1A 1LK0A 3MIZA 5IUKC 1Z25A 3HO1A 2NT4A 2M98A 3LTEA 1JYFA 3CTPA 1NXWA
chains in the Genus database with same CATH superfamily
2FH5B 2IHZA 3DT8A 3GN2A 1Y98A 2VTKA 1HE3A 1JB1A 5BRNA 4Q9AA 2OBXA 1FU7A 1QXSA 3TS1A 1D3AA 2OPBA 2A1IA 4F3TA 1RWVA 5LZ7A 4OQFA 2R25B 3SPXA 2VPTA 4JWTA 4E2YA 2GM9A 3N6XA 3CH6A 4IGKA 1L8LA 3EA5A 2XB8A 1E5TA 4H27A 2ADFA 3L9WA 1ZD9A 3H2YA 1R4ZA 3KUXA 3OKPA 2C7OA 1LK5A 2M9MA 3NASA 3EY9A 1TD1A 2P4EA 3BE4A 2JG3A 4QUEA 4KVAA 3L43A 2AJBA 2WJ3A 3LZCA 2RGUA 3NCHA 1HSOA 5EY5B 1PR0A 1KJQA 4N1AA 1OOEA 4NMXB 4HAWA 3GNTA 3D8SA 2ZE6A 1DIHA 1R8YA 4BP1A 4HADA 3ROTA 3PVZA 5BY2A 1I51A 3QW4B 4RM3A 2BKVA 4OYLA 4XEHA 1R4AA 4CMJA 5E0OA 1BROA 2JHGA 2OBNA 4MWOA 2OAP1 3U62A 4B3XA 4JGIA 4AF7A 3AJ8A 4HZIA 3V3KA 3MGBA 3G9XA 4DSAA 1BA3A 1ZLYA 5AW5A 1OHHA 2YL2A 2PT5A 4G5XA 5CG2A 3PZRA 3I5UA 2GD1O 4C7JA 2YUTA 5B55A 5TX7A 1ES9A 3G0DA 5ESDA 4D6XA 3L82B 2Z8YM 2QQ0A 3U26A 3UMVA 3V4FA 1PS8A 4KLNA 4FDMA 4AKEA 2O8FB 3DMTC 4L3VA 3SQXA 5CA1F 2X9GA 4MVJM 4TL6A 4AZTA 4B44A 3WKEA 4F9TA 2J87A 3D5QA 2Q4RA 2Q5EA 4JEHA 5KNBD 4NI5A 3GLFB 3A8TA 3CINA 1RJ9A 1GPMA 2V3WA 5KWVA 1RHUA 2W0SA 4RQAA 2FQ1A 4IIJB 5CXUA 2FSFA 4PXYA 3KJGA 4C3OB 1FPMA 2XQGA 4G86A 2QPAA 3K0AA 1YUNA 5FJIA 4YHHB 1ZI8A 5DM60 4LVCA 1PT8A 1FLVA 4J0CA 3DG9A 5K3OA 5AJHA 5FBZA 5D8DA 1ZAKA 4GKAA 4DDUA 4ZCTA 3PUKA 2GLTA 4L2IB 2ODWA 4UVEA 2B37A 4YAJA 1ZUHA 3RREA 4DNQA 2QKYA 4DNXA 2PSEA 2NXEA 3A6FA 2ZIZA 1XU4A 2X0RA 4LXHA 3Q5EA 4F3CA 3GFPA 5KNLA 1RYZA 5C8VA 5IUJC 4FZ5A 1XMJA 2G77B 1P6XA 3H2GA 3OU2A 4RFSA 4FX2A 5DW0A 4D8YA 4DMRA 5AUNB 1TA4A 1CVIA 1XDGA 2RAPA 4PW0A 4I99A 1L4UA 3NH6A 1PG2A 4NG5A 4U5QA 4CLDA 1KU6A 1LPBB 1YL5A 2RHWA 1XHEA 2NACA 4PNPA 2R8YA 3W6OA 3IODA 6REQB 4OQDA 2FN3A 1CW2B 2IW1A 3INYA 3IXLA 4OFZA 4OL0A 3D8RA 4XW2A 3TZCA 3WLOA 2XT9A 3FWKA 3ZD8A 2PKQP 5ICMA 4FUTA 3EQ9A 1FSPA 1CERA 2W2XA 4RLFA 5AJZA 3CKMA 4Z8YA 1V5GA 3UJBA 1M6VA 1WU7A 1IVYA 2J09A 2KW5A 3OTWA 1SQ0A 2QE7D 4FCWA 4FEAA 4JBWA 2IHYA 1YAJA 1YIDA 4IDPA 4R7TA 1PJBA 4UASA 4EKGA 5A5FA 3M4XA 1T1IA 3MS7A 3RB8A 4UQPA 3ZZ1A 2OZKA 4EFDA 3OFND 5FBKA 1HUQA 5JH7F 3FI0A 1KHTA 4ZQGA 4YYEA 3EMDA 5E9QA 1FX0B 3JAMA 3T7EA 3TUZC 3I30X 1ZIOA 1P45A 1NNLA 3WRWA 2M6KA 4BATA 1G20E 3EQ6A 2R44A 3Q7TA 2ISSD 1SM4A 5EUCA 4LYAA 3BHJA 1K3FA 5H4HA 3TB6A 3U3XA 4CF3A 4PEVA 2ZRMA 3I58A 3W1EA 5FUVA 1G17A 2WU1A 3W5DA 4WECA 1LZKA 4CKBA 4ZO6A 5EJEA 2J48A 5KYXB 4GI2A 5LQAA 1O89A 2QTZA 5DBGA 1PGPA 2Z08A 2YFYA 5CCXA 3CZMA 5HKKD 1NOJA 3U4MA 1CY7A 3B9QA 3RVKA 3MUEA 4OUDA 2HADA 3W6ZA 2DVMA 3H19A 3WHLA 2HD4A 4YBZA 5JIBA 5CCBA 1SIBE 4EGFA 1OW3B 4B8YA 5JECA 3KQUA 4AQ7A 5AVSA 1N78A 4AS2A 4BYGA 3L4BA 2FUG1 2YHIA 4C4YA 1QP8A 1SC4A 2HB6A 2JRCA 2I29A 2PBLA 5C1BA 2XCQA 1PT9A 2D4HA 2IYVA 4UOZA 2ZJAA 3G8BA 3RS3A 4CUJA 1RKQA 1W49A 1Z6QA 5EEHA 3UK7A 3UUWA 4DCUA 5C81A 1EFCA 3D4OA 2L18A 3RWMB 5HQ3A 1E6KA 3CRQA 4B9EA 1WKCA 5E1OA 4KNYA 3D3KA 4MGHA 1E2NA 4OXYA 4ALKA 5GVSA 4KN9S 1P72A 4MGZR 2NU8B 1R5NA 2Y1LA 3GUYA 1G291 5HMMA 3DL4A 5EMHA 2CN1A 1UJ6A 1I7PA 5MDHA 1Z07A 4HNHA 3NEYA 4WVFA 5EHXA 5LZ4A 4LYYA 4D46A 3Q88A 5JS2A 1TUIA 3TW8A 3VKFA 4K9QA 1NKVA 2IXFA 2ZJZA 3RT1A 5LMCA 3K09C 1OKKD 4YAIA 3HY6A 3Q40A 4EARA 4JLDA 2B30A 2QP3A 3VZBA 5BQFA 1BD3A 2HK8A 2ECOA 3LXRA 3WK9A 2V58A 1TK3A 1UPTA 2LVBA 1F6DA 3RS8A 2HJ9A 3SEFA 2FLVA 4IDBA 3HO6A 3ASZA 1F17A 3ASYA 4R2IA 4V24A 5E2IA 2F9MA 3S7TA 4EW2A 3K6SB 4LMBA 2WSSA 3QUTA 3VMFA 3OHSX 4PN7A 3QVXA 3RC3A 1AV7A 5IKEA 3AKDA 1YBHA 2Q1UA 4JITA 3N2KB 4MI6A 1BHQ1 1GAJA 5HTKA 4Z49A 1B41A 3ZR4B 1VKOA 2I3AA 5A5GA 2NVOA 4HGPA 1W2GA 1J2RA 3D7LA 3JW8A 5I3CA 3NEPX 4HH0A 4Z8XA 4MUIA 1ZC4A 3BKXA 1T24A 4DDKA 3T5AA 1NVAA 3F6PA 1B8OA 2Q2OA 4KQCA 4NE2A 5AJTA 1BMQA 4R7ZA 3UT0A 4QDUA 2XITA 1Q0SA 5ILQA 4CMEA 2BDEA 4K6HA 4M8IA 1Y3BE 3K4HA 4BQFA 4Z7QB 1L8OA 2GM4A 3KXLA 2JHAA 2BKAA 4L4ZA 1I6LA 2QIPA 2WM8A 2Q07A 3D1LA 1BQ3A 1CF2O 2IPAB 3D81A 3HB0A 4M9CA 1Y7PA 3JX9A 4OMFG 4WL0A 1YB2A 1H5UA 3V2IA 2V3CC 4ZOLB 4RS3A 1NJSA 3WQRA 5I01A 2AOVA 3PFHA 3QX7A 4RBNA 3DEZA 3X1JA 1OFIA 3TD9A 1OZHA 4GPTA 1KMMA 1P4HA 1W46A 4MCHA 5ERYA 4CEJA 4IYRA 4QGHA 2K7FA 3OESA 1NTRA 3PDCA 4Q6WA 3COYA 4P5EA 2X5OA 2NO0A 1J9EA 1UDAA 1ZM7A 1WEHA 1TKAA 2C2MA 4YV7A 1AS2A 2OZVA 3EGOA 2VT6A 5IK2A 3I9LA 2ATXA 4WK0B 5HQTA 1N8KA 3FY4A 1JEEA 1G4UR 3DOFA 4JC4A 4OHXA 2YOFA 3MB8A 4ND7A 1WZ2A 5AESA 3FCXA 1ZHFA 3PVCA 5IBRA 1XQXA 2K4MA 1IN8A 5TVGA 5AVVA 3VU0A 3RIYA 5FLEX 1WB6A 3QUQA 2HRCA 1KVUA 1DDIA 4PXSA 3RKSA 2ODAA 3REOA 4X64B 1W30A 1L7RA 1RCUA 3SHFA 2Q5OA 2WM9B 3ZEIA 4M0MA 4TQGA 1DJQA 1GV1A 2NYUA 3FVVA 3KKPA 3ZHZA 2YN0A 2NMVA 1Z15A 1OFVA 1M0TA 4BNWA 1B6GA 1W9HA 2YINC 3CCCA 4KMRA 1MEEA 2XE4A 2IHKA 5KYVA 5CB8A 5HFNA 1KIAA 3EDOA 1MXFA 3A1UA 3QV1A 3QITA 3LRXA 4R01A 4BE7B 4CKWA 3WLNA 1YB4A 1R66A 3HKBA 1UBCA 1F60A 1AHHA 1ISIA 1HR0B 3IUSA 1RXSA 2MSEB 3CG4A 3L02A 4W4TA 3TFWA 4ZK6A 1JEJA 4GPD1 3OTHA 1DEXA 1ULUA 4K86A 3WNCA 1VE1A 4JN6B 3INGA 1QIHA 2P6MA 5K01A 1Z39A 1NYQA 2ZVDA 1MC1A 3Q6MA 3UB3A 1KYYA 1SUIA 3RGWS 1F5NA 2HQSA 1IBLB 4FNMA 1NGSA 3AM5A 1WLSA 4P31A 4ZZ3A 1FRZA 4DV2B 1S2NA 2VZ0A 3P0EA 4B84A 3AR5A 4N48A 3GXOA 1ZEJA 1D04A 5ALYA 4ASUA 3O38A 1GGFA 2WUVA 3C1UA 4QATA 4UD2A 1B0ZA 5EHGA 4C4TA 4YLYA 2CT8A 3BUSA 3RRXA 4E6EA 3OQHA 1E2GA 2EJWA 1BWRA 2NQ2C 4IIBA 4Z99A 5E8RA 2WOJA 4I1PA 1KQPA 4L07A 1NE2A 2FPIB 2Z2YA 2Z6VA 4Q4AA 4TRJA 4GSYA 1HDYA 2EHDA 1SCKA 1AURA 2GAIA 5B58T 1XVIA 3NYWA 4WXEA 4M6WB 4I9UA 2E4ZA 1TM1E 2PKEA 1S8NA 3BD6A 4MVJE 5DGCA 4ZYYA 2JKYA 2PL3A 5A5DA 4UTNA 3QU4A 1X38A 5EZ6B 3AP2A 4BP3A 3AWIA 2EW1A 1SG9A 5BUCA 5JXWA 1OXBB 2BR3A 3CO0S 5EIOA 3A31A 4LHWA 1EESA 3DXYA 1A88A 5KX5A 2WAMA 1E59A 1NX9A 1RE0A 3T06B 1V6AA 1TLTA 3EG9A 1E1KA 1AK1A 1J9ZA 3GWGA 2XR1A 2A5LA 3F74A 1YJAA 4OXXA 4REQA 1RE1A 1FQOA 3B3FA 3W34A 1CUVA 3MQ2A 3CBQA 4M7OA 4CMCA 4HLUC 5KYKA 2LPMA 1A69A 4M0PA 3DUFA 1E66A 1PP4A 2VSQA 1D7AA 3B70A 4XQEA 4XH9B 3UAZA 1GSOA 5ALKA 2UUOA 2FW0A 2HU8A 1B6TA 1YNSA 3Q0IA 5TS2A 3ZS9A 1RZRD 1JHPA 2HNBA 1QP4A 2A86A 2ZTSA 2ZTVA 3I1FA 3NBUA 3MQFA 5FF9A 4NV3A 3T7TA 4WKNA 1YHZA 1GAQA 4TZ6A 1XTPA 3ZGOA 1XZGA 3S1SA 3N86A 3TW6A 4L7VA 1PE0A 2ATVA 2BELA 5DM4A 3V7YA 2QYSA 2O23A 2P30A 5T4EA 1Z22A 2PGXA 1XXHB 5HCIA 5GTDA 3QE4A 3KP1A 3L40A 2OY0A 2WSBA 1NMQA 1O4VA 4ER5A 4PS0A 3S8MA 3RHSA 2BSAA 5IASA 5EUMA 1J1ZA 4HQ6A 2ENWA 2R62A 4BBJA 4OSOA 4IDAA 3BOSA 4ZHQB 1V6CA 2QRKA 5IKOA 1AE1A 3ZGXA 4AZ0B 4LDPA 4K5QA 3RAEC 5DE3A 1OFUX 3GNSA 2XYGA 5CVCA 4YJKA 4RVGA 4IIFA 5IMSA 3QOFA 1QHGA 4FFNA 1O9HA 5D3MA 2PX4A 2EX4A 1QJ4A 4S35A 3TBHA 3ZEAA 3OZSA 1XD8A 2R1VB 4D9KA 3TAXA 3VOSA 2H5IA 1SBCA 5BSTA 5ESWA 2JFQA 3PV0A 3A3PA 5CURA 4B3GA 5EE9A 4MJ3A 3ZGLA 4MQFA 1MV8A 1TAUA 3M2TA 2ID9A 2GZHA 1YKSA 4O3MA 1KRHA 2TMKA 3H99A 3MCWA 4S3MA 3CX3A 4L75A 3HLTA 3NNDA 3F8WA 1Y8RA 3FWYA 3OX1A 4N9WA 5M5BA 1HEIA 3BWYA 3KD2A 1FTSA 1OZAA 1PSDA 3DOEA 1RT9A 1M1YA 2BF4A 2WU3A 3CTMA 4K03A 3S0JA 4DHWA 8GPBA 2W0MA 5BYJA 1JX6A 3SQMA 1Q7RA 3BL8A 2V1XA 4JI0B 5F21A 4D8XA 5K51A 1SXQA 2VYCA 4IVPA 2Z58A 3ZHVA 3DQPA 3NW9A 2DULA 1UF9A 3EFHA 3ADOA 4F6RB 2PUHA 1ZGHA 5SYNA 1IJEA 1DOZA 1XRQA 3D7NA 3M6UA 1BAPA 3JSXA 3W5IA 5KYTA 1NN5A 2R3SA 1H3NA 2GEJA 3NHFA 4B34A 4LRYA 3S81A 3OF5A 2ZAOA 1DPFA 3VU8A 1UJMA 4BV9A 5LCXA 4D0NA 2I4MA 4FDVA 3ACDA 3MT0A 5CAEB 3QWHA 1E1NA 2ZQ5A 1UQUA 5K5EA 3KQTA 5EZQA 3W8RA 2CHVA 1BO6A 3G5AA 4LFCB 3BILA 3QHPA 3AF3A 4A2CA 5FHQA 3OCZA 4NDAA 3VR6A 3B60A 5IWCA 1U6JA 1YMUA 2OK8A 4KV9A 4YDRA 3T7AA 4Q00A 4CMBA 4CI9A 3BA6A 1TM2A 4TLLB 3K0FA 5AI4A 3MNFA 4DRXB 1F0KA 1GTSA 1QGDA 3HU5A 4ZJPA 1R4NA 3LT1A 1T3TA 5CFPA 5DLQC 2QQFA 4GP9A 5K8LA 4DC1A 2Q6TA 4KGXA 4E2FA 1SUPA 4W8OA 1M2GA 4XR9A 4G8BA 5GV8A 4R41A 2GHRA 2WINI 3PRJA 5INTA 4FFWA 1B8UA 5DX0A 1VP9A 3T99A 1HG1A 4K3UA 1QDUA 4WQMA 4KQ1A 3X3HA 3E4CA 2DPLA 1E4EB 4OXRA 5CVEA 5LLSA 3SC6A 1QB8A 1GRCA 2V7EA 3BD7A 2RKOA 5BNZA 1OBHA 2Q4TA 5IU6A 2RKWA 3B8EA 1FXSA 4P6VF 3FPBA 3CPSA 3SKXA 1XZ8A 3VPGA 3EZ7A 3QFFA 4QWMA 4YFYA 2L0XA 4M7RA 3RKRA 4CMAA 1S9HA 2AG0A 2J0SA 2ZBGA 5B37A 2JCBA 3DA8A 2HJWA 4A2WA 1TT5A 4GSKA 4N3GA 1HRDA 1QFJA 2X0JA 4IDQA 4UJ5A 2IV2X 4C6RA 1JEQB 3GQBB 1FMJA 2MMCA 4O2AF 4Q3LA 5FAXA 2HA2A 4B75A 2FQYA 3G0OA 4LTMA 1GVHA 1WTCA 8AT1A 3KQKA 1KQFA 3H5IA 1YDHA 2A0WA 5IDVA 3IILA 1J39A 1MB9A 4HBGA 1GU0A 1ZM4A 1G4HA 2C92A 2Y77A 2Z2JA 2WZQA 1VSVA 1XEFA 4AJKA 4R0MA 2QSJA 5EJ4A 3E22B 3BORA 3JYOA 4PGHA 3FZQA 4JI8B 2G8LA 1M6WA 2GPWA 2Q3EA 3CUTA 2PV0A 1DHTA 3E1KA 3PX2A 2VLIA 5DIFA 5ECDA 4RF2A 4TTVA 3FDZA 1TNDA 2R6HA 2BDUA 3AJDA 3GH3A 3MK31 3PPWA 4JI1B 3K7EA 1UWLA 3H17A 4KN5A 3HFSA 3ZJYA 4CEIA 1EB9A 1K8YB 3ENWA 4L28A 1A5ZA 5ECWA 2XRMA 5FT9A 4JK3A 4RTNA 1K8QA 2DJ5A 3HSYA 2AQIA 2YRFA 4H4CA 3BXPA 2ZRCA 3IOCA 3DXXA 1W4LA 4GP6A 3L06A 3OPYA 3R4VA 3ND5A 3N8GA 1I5RA 2ODEA 3HSKA 3TLGA 3COJA 5JBQA 4KXFB 2OMEA 1K2VN 5TC4A 3ZY2A 4LNUB 1I9GA 3C5EA 3UK1A 1XEWY 2QTFA 4LFBB 1V8DA 3STTA 1UIMA 1TW2A 2QVLA 2O2YA 2AG6A 2AE2A 5J47A 2JJ1D 1V11B 4D2IA 1G8JA 4AW9A 2YXNA 4MQEA 3FZYA 3IEVA 1V45E 1CJVC 4JYPA 2W2MA 3DPSA 3EIHA 1PLLA 1TC1A 2BHNA 1EI9A 3NFYA 2ODTX 1PZMA 3ZHOA 3FGOA 1E9AA 3Q1KA 3SDBA 4EABA 4CPDA 2VJQA 3O4JA 4ZI7B 2XB6A 1ZUNA 2IUFA 1E2JA 5KTKA 4BNZA 4PE5B 1PVOA 4FKZA 1YZ3A 2XNJA 1IFXA 2R8RA 1KSHA 1NT4A 5LQSA 1JQDA 5ICGA 4L5BA 1I1OA 3FUVA 2UYHA 3H9GA 3LJKA 3X2EA 2QE7A 1U0NA 3RROA 2QD3A 4CDRA 1SOUA 2NTVA 4ZGBA 3AHDA 2V74B 4B6SA 2BGWA 1IQ0A 4DVJA 3GG2A 1V9LA 1ZHHA 5FTJA 1R18A 4V38A 4UD6A 2YJ4A 3OFNA 3VOTA 1CY6A 3VNBA 2NZ2A 4RACA 5FH9A 2I7VA 3PHBE 4J2HA 3G68A 3BJMA 3BX1A 4TKUA 4MIYA 2VNAA 1EK1A 2BFBA 2OFXA 5DHQA 1B1AA 3JARB 1N9GB 1QQ5A 1HOTA 2XD9A 1JIUA 3GFOA 4MUYA 2GTPA 1E20A 4JJAA 4QEZA 3Q8MA 3UJNA 3CX7A 3P0HA 2NTYC 1GRNA 3T0GA 2I80A 3PL1A 4JB3A 4S2UA 4DYHA 3TJZA 5C80A 4GMFA 1YVUA 4QPZA 1R9NA 2PO5A 3KO8A 2IDKA 4MRVA 4II2A 5KNDD 1KFCB 3F6YA 5CFMA 1G5FA 3EVFA 1LK7A 3DP7A 4RJLA 4DXAA 1ZA2A 3EIWA 3F0TA 3I04M 3IAEA 3K0BA 4G5RA 4CG3A 3RAJA 2YZGA 2Q1TA 4JROA 4RHYA 3D6AA 2O7RA 2V6MA 4DV6B 1KO4A 1U1EA 4RS4A 1XSEA 1UMDA 3IQIX 4WE3A 4CLRA 5IJXA 2IP1A 4CRWB 4BBAA 4QTUB 4B7ZA 4GWKA 4JA2A 5FEUA 1L5HA 3DO8A 3ANYB 3UNXA 2G72A 3IUQA 4JEMA 3A1DA 1PU2A 1JQJC 1LC3A 3V4RA 3PDIA 4YDSA 5L45A 1XU9A 2GBCA 3D3JA 1NYLA 3D3NA 3GZTB 3PUYA 3DV2A 4MW1A 4Y1RB 1G9TA 3SYNA 2YZKA 3CSDA 2FWPA 3TW4A 2X58A 4OQPA 4C4PA 3VTZA 1QPGA 1MCZA 1PF7E 1ADBA 1OKKA 2V7WA 5LMNB 1OI4A 1NVGA 2AJTA 2IWHA 2LR0A 1KDOA 2VHZA 1QRRA 2Q5HA 3GZ4A 4D6PA 1EE1A 4JGGA 1XMOB 1DBPA 3SS7X 4IDHA 2ZW9A 4BNXA 3H6HA 4JLJA 5JALA 4IJKA 1EFAA 4IXTA 4RJKA 2F8SA 3OM9A 1Q7EA 1XTKA 3QELB 3OOWA 1QVVA 1O8BA 3KOOA 1YUBA 1ZRNA 3JD3A 2D8MA 2P4QA 5CXXA 2JJ8A 3G23A 1LFDB 3HYCA 4ZT2A 5SICE 3WL3A 1QOQB 5HM6A 2FK7A 4G8CA 1EGVB 4J9VA 4ZPXA 5LYJF 1T34A 1QU3A 2GN9A 3Q41A 5AHOA 5BOSB 4WKCA 5BP7A 1RYBA 3NWJA 1GGKA 3UENA 2H4XA 3S2ZA 1A9PA 2J6BA 3BTUA 4ND8A 4MUMA 4RAOA 2P5YA 3IA7A 4EPTA 2WVAA 3CR3C 3DBHB 3G8CA 3HFGA 3FF4A 2C5LA 4AUNA 2ERXA 4P3YA 2GEDA 4RANA 4NMLA 5CX1A 3HKEA 3EFBA 3Q11A 1E2KA 5E6UA 4AJLA 1P3JA 4FEEA 2JAUA 2WV7A 3E7FA 4CM7A 2FG7C 3RM3A 2VHJA 1H2HA 2I2DA 4WPGA 5A4FS 2PLFA 4DB2A 3VH2A 2XKAA 4R2MA 1TM7E 4HXFB 2XIJA 2JI8A 3EEQA 3DNPA 3BB4A 1JTVA 3IJRA 4R8SA 4RA6A 5E3JA 4OBWA 3ZWKA 3ZVRA 4TVKA 5AJWA 2OYCA 1A0OA 4ZARA 4MRAA 2BZ0A 1LLCA 4NCXA 1M75A 4EL5A 4ARZB 5DGDA 1I2BA 1TGYA 3C3WA 5JLAA 1ZUD1 3F8SA 5EERA 5BV2P 2ZUBA 2ODNA 5IJ0B 1L7AA 2PQ2A 5L40A 2IE0A 4YJDA 4MJXA 2P5TB 3DQZA 1FSSA 1QHXA 1VLJA 1NSTA 2O5VA 3A9CA 3OTGA 2HT1A 4ZRNA 1US8A 1WLYA 3AB8A 1W1UA 4C0JA 3IDSA 4DTCA 1D07A 3AYXB 3HRIA 1NMZA 3LGXA 3FN4A 3LCJA 3HKDB 5DGHA 3SQLA 4WFJA 2IPOA 4KKVA 4LRUA 1YQ9A 5ALPA 1N6RA 3LHIA 3ZU4A 4LVOA 2FPLA 4YMWA 1OWMA 4G0OA 5EESA 1YRHA 5TT0A 3UAYA 3RUEA 2BCEA 3I2IA 3KS9A 1V1RB 4EITA 5J4YA 2QM0A 4LGMA 1CJCA 1Z4IA 1H0HA 4UHFA 2R7MA 2R7NA 3DZIA 1FVOA 4DXHA 3T0IA 3UBTA 5B7NA 1XQ9A 2D62A 5BYKA 1QVRA 1QP7A 5B58C 2ISCA 4RY2A 3ZV3A 3GF4A 1OF1A 3O7MA 2ZRDA 1E3LA 1BMTA 3S2GA 5DYWA 2Y1OA 3MTQA 2A3NA 3LQQA 3N6VA 3PSAA 4YVFA 2G5CA 1SG0A 4YR7A 1XIVA 3QPVA 1DB3A 1FNDA 3OPNA 4C4XA 1JG1A 3L6EA 3LVQE 2AV6A 2IDJA 4TVBA 1IHOA 2QROA 2XGOA 4UPVA 5H82A 1FDSA 2JB9A 2KJQA 4S1NA 4AF6A 3I9OA 1M1YE 4FMPA 1JUDA 4PZAA 4F60A 1YRQA 5LJLA 5LZ2A 3FFXA 4RJJA 2CMHA 3LKVA 1BYIA 4EHNA 1OXKB 4XM0A 1WIWA 5U9CA 1V8FA 4NYMQ 2DUJA 3NORA 1AOXA 3EMKA 2CNWA 5CGQB 5FV4A 5B2FA 1USKA 2GSWA 4EY3A 3EXAA 3JZIA 2QM8A 2O2CA 4KSYA 4OHUA 3AV3A 1GXSA 5B6IA 1HX7A 4WLOA 5H68A 1G8YA 2BI8A 5BMVA 2EKBA 4GWLA 5B36A 4C01A 4X71A 3LT2A 2PZMA 4B31A 1W85A 3BGDA 4Y6OA 4I3HA 1YE8A 4HV4A 1Z7BA 2PVPA 3TQHA 2XZTA 2VXCA 1FUEA 4OH1A 4H1HA 1WS6A 2D2IA 3P97A 4QSMA 3FCEA 4CMIA 4EENA 3OP4A 4L8GA 4W9MC 3FYUC 3IP8A 3RTBA 1IY9A 1WNTA 2JL1A 3B20A 4XGKA 1PDWA 1GQSA 3SYRA 3D3WA 2ANBA 4F91B 3RFCA 1E1LA 2FZLA 3VM6A 1CKEA 3T38A 3FOZA 2GCNA 2PGOA 2WTBA 3KE9A 2IHUA 1YJQA 4K9MA 5T4FA 4BB6A 1CR6A 4UM9D 3N5KA 3P4UA 5K0ZA 3CIOA 3GLIA 4I50F 1SXJB 3I9V6 2G25A 4AFNA 5BR1A 3A26A 3I6IA 2CWDA 2BGIA 5KAPA 1TYBE 2IZ1A 1YQWA 1ZGZA 2ZWOA 3KYBA 4URWR 3WK6A 1FIUA 4CGYA 1NMSA 5AW1A 4KFUA 3OO1A 2IYXA 5C8ZA 1PCXA 1EYZA 2CL5A 3WGNA 2UZ0A 3B1ZA 4W8GA 1B2RA 4JYCA 4L8YA 3FE2A 3H7IA 3SP1A 1T6NA 3HVIA 4NU5A 4PY2A 2YYSA 1UMCA 1X8LA 3HCRA 2C98A 5H16A 1D2HA 1TUBA 1BX1A 2FOIA 2VQEB 4JI7B 3G9TA 3DBLB 2FEXA 1O95D 3VDXA 1XAJA 1Q20A 5JT1A 4QDZA 3TOXA 2JASA 2GD2A 3PBKA 4R1UA 4BQQA 1HE1C 4BO6A 1MOQA 3F46A 4CTNA 4FLEA 2QX8A 1OH6A 3KVYA 2VZ8A 3K8QA 2DTDA 5BW5A 2EHJA 1RQXA 2WT4A 2IV3A 1GUDA 4WH0A 5JASA 4PSCA 1YONA 1Z36A 2HREA 4U2GA 3KQPA 2ZSBA 4DDWA 1TTPB 5KO2A 4C3ZA 2V45A 2ZIFA 5H0IA 2GKGA 3OEWA 3OFSA 4DLRA 1K68A 3CMCO 1S3SA 3BRCA 5I7OA 1XTJA 4MGIR 2CGEA 4G09A 1QU2A 3JCZA 4PHHA 4TSKA 5LOVA 1J5EB 2VNHA 4KU4A 2IU3A 3PQ2A 4HDMA 1IQUA 1T8WA 1PFYA 2AC4A 2HTEA 2YHUA 1A7AA 3JAKA 3KEGA 2O48X 4AMYA 1JP7A 2BUBA 3P9IA 2QLNA 4TMVA 1DO2A 2HBZA 3VYTB 3UWMA 2BKLA 3D2AA 3U39A 3IDAA 2ZR7A 4Z3OA 3KKQA 1P4GA 5EVJA 4NYMR 4XLLA 3AI1A 3A4LA 2C03A 2HK7A 3IOYA 5J3JA 3MTIA 2HMUA 3BC1A 1UBUS 4HGYA 3RSLA 1CIJA 5ES3A 1ZSVA 4EAAA 2BSXA 3CR8A 1WULS 1UKBA 1LPMA 2BBOA 2GAJA 1Y6JA 2RHGB 4KXVA 2W2LD 4OP1A 1H2BA 1A72A 3TEFA 1IBMB 4QBHA 2ZAGA 1IBRA 3EVAA 4IHKA 4TQUS 3VJMA 4PC7A 3QVUA 1E3TA 1LLFA 1T36B 1CFJA 1M2WA 4IQ8A 4RWEA 4R9SA 1E5XA 1E98A 4KIJA 2IFTA 3SQNA 5C5DA 3P9KA 1U2TA 1CQZA 3BXXA 5BN3B 5EWMB 4KITB 5IAGA 1VMAA 4AO7A 3NBKA 2GAAA 2PZFA 5JWOA 1GGEA 5JAIA 5AW2A 4MUGA 3DW3X 3L8CA 3H9UA 2ZSDA 4XYBA 5M34A 1IULA 2GCEA 3TLMA 4CFSA 1SEPA 4MYRA 3T5TA 4C7VA 4E5UA 1Z56C 2F7SA 4PWYA 3VYWA 4D42A 1H66A 1RYFA 4HMQA 3EGXA 5JBNA 4Z9BA 4QJ5A 4K0RA 1SHUX 3KR1A 1F7VA 1XMVA 3LYUA 2HXYA 4DMMA 1U7DA 4OREX 2H65A 4XI9A 5C3MA 1NV8A 3B1JA 2OSBA 1QX3A 2I2WA 4CM3A 3DHVA 3B52X 1YO6A 5FQNA 1SZJG 5BXYA 5J4VA 5KSZA 3A0UA 4MPRA 1EE9A 5KKNB 1TTQB 3VHXB 1BJTA 4M55A 3GLQA 1NJ8A 1JAYA 2PU7A 3Q9LA 5KCMA 4CM1A 1OYWA 2O05A 3HM2A 3GI1A 4U63A 1XK7A 2R6R1 1KE1A 4WZAA 3WJAA 2F1JA 4D5EA 4LBWA 1I3KA 5EINA 3OICA 5HCNA 2IW3A 3D6VA 3R5KA 5CK4A 1NWHA 2ZKLA 5DW3A 2RGXA 3P4XA 3O8CA 1E9BA 1G3MA 1RWQA 2PGIA 3Q6IA 4K9KA 4HXEB 4LXGA 4AO6A 1DGQA 1P31A 4NQRA 2REXB 1G8HA 2WIJA 4HDRB 2ZDQA 3M9LA 1H6CA 3L1JA 3FAKA 3VNQA 2WU8A 4HK4A 1GPJA 3CJTA 2YZ2A 4ZZ2A 2RGNA 4Q9IA 2DKFA 1DBIA 4H4EA 2ETXA 1M66A 3NX4A 3TTUA 2REQB 2F64A 1K27A 4M1TA 2R1ZA 3IAM1 1T4GA 4XVUA 1UH5A 1Z45A 4OXQA 4ALLA 4E5SA 4JD5A 2P5UA 3SJAA 2DWQA 2ZT8A 3KALA 4AVYA 2BI4A 1DKRA 3DVAA 3GCDA 4DLUA 4NNPA 4U2EA 1P4RA 3I2JA 1BCSA 4NABA 4UEQA 1Z28A 2OO5A 3H05A 3RTEA 2AN4A 3A14A 4D43A 2QORA 1QH1A 4TV9F 3ZJVA 2CSUA 5B3AA 3TIGA 2BYTA 2D7CA 3LPCA 4L8LA 2B2XA 2MSWA 4N8SA 4EYSA 1BEEA 3VR3A 3SK0A 4CM4A 1ADGA 2IXEA 2EDAA 5EWJA 5JCOA 1NKSA 1F2UA 1G18A 1UFQA 2Q3FA 3TKYA 5KQMA 2B78A 2IE8A 4WXYB 2YJGA 1E3WA 2J31A 4N49A 2M1XA 4FYMA 3ZKWB 4KPUA 4OQEA 2BBTA 3ZOZA 3M6XA 1XKQA 3EGDA 3NHRA 1ZI9A 2QU7A 1X87A 4X6YA 5JQGA 2XQVA 4WUVA 2AQKA 1X77A 2VUTA 2TMDA 2WYIA 1A98A 2NXNA 3GGOA 4V03A 4G65A 4G37A 4A6EA 5H3HA 3GDGA 2E9SA 2OGZA 1VHDA 4EHLA 3ZWCA 1IAQA 3OIGA 3ZCUA 1UP7A 1DCTA 1TZ2A 1Y89A 2PWBA 2Q0HA 1H8ED 2WWXA 3E7DA 2OZLB 3DJYA 3M1YA 4KX5A 1N8SA 3CUEF 3SQDA 4MVYA 3W8DA 2JFNA 3EAGA 3A1NA 5AK0A 3PSHA 3LMKA 4RH3A 2LCFA 1IRIA 2PQMA 2QNRA 3V33A 4OK6A 4EG7A 4JUDX 2JJ1A 4Q12A 1LS1A 1Q7TA 2ZSJA 5FOQA 1F0NA 2HEIA 1QYRA 1YRYE 1ZN9A 1CQIA 1ZSYA 4GOXA 3GN1A 1FFAA 1GOTA 2OXIA 3RRBA 3D2BA 1UANA 1Z2OX 2C78A 4XWAA 2IYSA 1PDOA 2QLBA 2EQ5A 3IMKA 3K0HA 5FBWB 5IT5A 3OZBA 3K1YA 1K4MA 2H9YA 2EBUA 1ZZGA 2Q9UA 2X5JO 3GFGA 5DXJA 3SE0A 3VPCA 3WMEA 4BFVA 2Z04A 4LE2A 1S3IA 2GB4A 2G4LA 2I7CA 2G0NA 3G89A 3GUCA 4MR8A 4XDGA 2I2XB 4WRRA 4HDSB 3VPHA 1NBMD 1CG6A 3O3OB 1TYZA 3SSMA 2CNOA 4P35A 3HADA 3BIOA 2OQ2A 3F7MA 1PWEA 1WUIS 1AKMA 4L1KA 5IHPA 1NL3A 2JFUA 4MTCA 3IMGA 4RHXA 2QMYA 1X3LA 4BMSA 1AUPA 3D8TA 4YRNA 1J0AA 4HCJA 1XV5A 3RF7A 2BV3A 2OGWA 4O1MA 5LA6B 1LI4A 1DEAA 1O0SA 1I8TA 4FOSA 4RPJA 1JHYA 3BFXA 4P36A 2R7LA 2JS7A 4YN3A 5JAPA 3H2HA 4ZT5A 2FHSA 2BGRA 2CVPA 1L5VA 2C9BA 1P4AA 2J3EA 1PWYE 2Q50A 3SF8A 3GT0A 5DI3A 4F8EA 3DHEA 3ZGZA 3PFNA 2HIHA 1QM5A 1IG0A 4B47A 1QDEA 5TQJA 4EA7A 5AW3A 2XOKA 4E5VA 3SFZA 4FBGA 1FU8A 3N8HA 1Q19A 4YREA 3S6JA 1JTFA 4J9UE 1QV9A 2JGNA 2WJJA 4DLSA 1VHLA 3G88A 5BN5A 5KNDA 2IV7A 3FYSA 2Q1WA 1E3EA 1LB1B 4R9UC 5J63A 2F8LA 5HS4A 4JA0A 1KSGA 3HBLA 4AL4A 2EKPA 1YAHA 5EIFA 2JATA 4BLSA 3HCOA 2PNJA 2OHIA 5BR7A 1VL8A 4TMKA 4WZZA 5KC9A 1C8KA 2QQEA 2FGKA 1W75A 2CMDA 3R41A 3TRIA 3AEZA 5SY6A 2XT6A 4CM9D 3L05A 2WIGA 3PIIA 4D3YA 4EPYA 2IYZA 4KN6A 4RHCA 3PICA 2GBFA 4V2IA 2HZ7A 4JI5B 2G1AA 2GXUA 4J1QA 4QUHA 4UFNA 1Y4ZA 1O77A 3FCUB 3HSSA 4IDNA 4UHBA 1W96A 5T57A 5JCZA 4X20B 1C81A 3RQSA 4COOA 3Q8KA 4UXHA 4MVJG 4UMVA 1YJBA 1A8UA 3T4PA 4PQGA 1QH8A 3KOUA 3M6MD 3SS9X 4MGKR 3ZCVA 2HL6A 4QU9A 4BNJA 4KDEA 1FDOA 3DBRB 2O0HA 5A3QA 1SOVA 2PMKA 4OK5A 3VR0A 1JLRA 1DKNA 3IQEA 3UJCA 4MVJF 1O96B 1YDMA 5IYZA 3LA8A 1AK9A 1Q77A 3VSEA 1NW9B 2OHXA 1PJQA 4DR6B 4BCDA 2V3VA 1YRLA 2FF7A 3EMBA 3S2SA 3WIOA 3MTEA 4F5WA 4Z4IA 3X1MA 2M32A 5DYYA 1Y6RA 4PO1A 5CK5A 1T0JB 4I6GA 5G0UA 4QOJA 3KLMX 4F4DA 4Y2SA 4GOOD 4RHUA 4WLNA 4MYSA 3KOZA 3KQNA 4OAPA 2MR6A 1QONA 5EUBA 1RRMA 4BJ6A 2P9FA 5JXHA 4XX1A 3BM5A 1JG6A 4UMEA 1W581 3DZCA 3H1TA 5K8CA 4NNOA 1L4EA 2HJSA 3I4LA 1AHPA 4XJVA 4G5GA 1Z4PX 3TTWA 1WPRA 2Q0XA 4YO7A 5JQWA 4V0MA 1AY0A 4WZBE 1JRLA 1P18A 3P9ZA 3SIWA 5I9LA 1HLFA 3GAZA 5REQB 3TN7A 1E2HA 3FNEA 1AKTA 4YV0A 1O2DA 1Z8DA 4GH5A 1NONA 3JYLA 1XC7A 1LPAB 5DMHA 1XAIA 4L4UA 4JSTA 4LS3A 3C39A 4D4JA 5FPKA 2HWYA 2YVKA 4X54A 3T41A 1KI2A 5F9MA 2HZBA 1SC3A 3C6YA 4AUKA 1A8PA 2L42A 1SVOA 4TXHA 5BSVA 3FROA 4HFNA 3OMXA 3W5JA 4UAJA 3JASB 3I2KA 2AW3A 4OHYA 3V4OA 2BMAA 1CLEA 4GLBA 1TEZA 1PTKA 1N3IA 5E6RB 3E9RA 3ZIUA 1LKZA 5AVXA 4DT1B 5C52B 3ESCA 3EIUA 3DCJA 1B8PA 3CZ5A 1QYCA 2IUSA 1MJNA 4PGMA 5AHKA 5DJ5A 5JYEA 1L7PA 1L1EA 2GA9A 2Y2UA 2CYBA 1OJ7A 2QRJA 3T5MA 2HA5A 5DNDA 4KGDA 5EJ2A 3UWSA 3LOPA 3LY8A 4BFTA 4ZIRB 1JIQA 1LBTA 3IQXA 4X9XA 2F90A 2OHJA 3G7UA 1ZICA 3F98A 1OFUA 4I1SA 2R1UA 1JE1A 2H4FA 5CVDA 1H4QA 1TCCA 4X45A 4DREA 4MA5A 4LK2A 4E5DA 1IWOA 1UOPA 2J32A 3N8NA 4M1MA 4D79A 3RE1A 2O2DA 2PY6A 4L73A 4CLOA 1XK6A 5L51A 3G0BA 1XTRA 4ZMBA 4S05A 2VZLA 5AVZA 2X19A 3CWQA 1TU0A 2YDXA 1NQOA 4JVLA 3DQQA 4US1R 3U16A 2PZKA 1EHCA 3PQ8A 3O84A 1P1HA 2BJHA 3QHQA 5EXSA 2Z4TA 2O14A 2VQSA 1P77A 4HMPA 5CB4F 2ZJ7A 3BXHA 2PRJA 3G59A 4RSRA 1MB0A 2BDTA 5HK9A 4IH9A 3SC3A 1L8QA 3B36A 5FNVA 3IURA 2IS6A 2VP3A 4J3NA 2HPAA 2ORVA 3GT3A 2P69A 3K0CC 2Q6LA 3FWHA 1NZDA 2QX7A 5LD2B 2W90A 5DM70 2R84A 4TV8B 2VHQA 2B5OA 2F62A 2CHUA 3KJQA 4UPEA 4M76B 3PENA 1YC2A 2GLUA 2B8TA 4YRAA 1SRQA 1ZVMA 4A26A 1P19A 3EBPA 3F5MA 2EP8A 4HP8A 2LRHA 3RYTC 1UCFA 3N3AC 3TAHA 4MZDA 4P5PA 1VJRA 4K05A 1JFVA 4FXOA 2O6LA 1LCIA 2HTFA 2PBZA 3BICA 3LK7A 4MUXA 3HXKA 3NV9A 1UKCA 4DIDA 1GG5A 3F1LA 2X4LA 1BU5A 1S02A 3OJFA 5LMUB 2WSYB 2GCGA 4MSUA 5DLEA 3S40A 5F51A 2JK1A 3H1FA 1FLDA 5L7TA 2C58A 1ABFA 4WNCA 3U6BA 1OCEA 1ZC3A 4UCWA 4DDVA 3I01M 1DBWA 2XKBA 2ZUUA 4BNDA 2ZUTA 1YS2X 5GJVC 4RFVA 2FPPA 1ZJ6A 5I9SA 5U1PA 3ZQ6A 3E0QA 3IBFA 1M2JA 3JQGA 2QUIA 2I99A 2G06A 1QFSA 2NVWA 1OLXB 4HEJA 1E7WA 1PR9A 4LZPA 2ZS9A 4J29A 2ZBPA 4OQZA 5BN1A 1RPAA 4OQ4A 1IOWA 4OUKX 4BRSA 2ZUCA 2FJPA 3EDCA 2ZR8A 3PQ6A 4AAYA 1HLDA 1Y4DE 1PWZA 2LBPA 2O0JA 1VBKA 4X1IA 4GQBA 1Q16A 3OU7A 1PJZA 4ID3A 4MKXA 3GIDA 3WOVA 5FHRA 1MPXA 4BB5A 5HUHA 1MO6A 3QTTA 4MQ4A 3EUWA 2Q3JA 4F1WA 2FKNA 2WP8J 2OAGA 2BWJA 3NHMA 4N9QA 3SJCA 3SMQA 1BKYA 3IR5A 4P9NA 2ISQA 3ZHXA 4MWGA 4B85A 3O0DA 4ZQIA 4DWOA 4RTOA 3LWDA 4DQUA 3H5AA 4MW9A 1ELOA 1FQKA 3BEOA 4WESA 3DF9A 3DFZA 3SLKA 1O95A 4JQYA 5ALRA 4UE3S 4CT0A 5CIYA 3EXHB 1U2QA 3NS7A 2QJTA 4EO4A 1HK7A 1AHNA 2I1WA 3M4YA 1PGNA 4OMUA 2SBTA 4DLAA 1IM8A 1PQWA 3MUFA 4O4IB 4ABYA 4EB6B 3T7RA 5HFJA 3RG8A 3SC4A 1FYDA 1FFXB 1SCDA 1IC6A 2GCOB 3DMYA 4NZZA 3T3GA 3ZLBA 5AVOA 5IFLA 4F46A 1DAPA 2OGTA 2ORYA 3THXB 3V00A 1GLVA 1QVZA 1A96A 3N0WA 5AR1A 4DHEA 4LF6B 2J0QA 4B87A 2WG2A 5THQA 1WABA 5D84A 3PLAE 1MHTA 4LN1A 1X1SA 4I2NA 1F2DA 4YEDA 1QOPB 3HWX1 5AVYA 2I67A 3ASVA 2QTRA 5CLGA 5E7IA 3IS3A 3AUKA 4ZGWA 1Z68A 2D3WA 2JARA 4IJ5A 5SYAA 4NC9A 2Q5QA 2X4GA 5D5HA 1Y9EA 4ZJYA 3KZCA 1EINA 4YMUA 4P8RA 4RJ2A 1DDGA 2EQBA 2O2SA 1FSZA 3MWDA 2IP2A 4RV9A 4X97A 5C35A 4M0UA 4E21A 4A0FA 6ABPA 4WBXC 4BXOA 4WFQA 3SHTA 1PV4A 2HCRA 2EEPA 1B73A 1PR5A 2FMFA 1RAFA 3OF3A 1P7WA 2I3DA 5DASA 2EATA 4EKEA 4O8CA 2YR0A 4OLAA 4XGRA 1WD7A 4ZEWA 3M4JA 5JAMA 2AN9A 4U7GA 1YFZA 2QMUA 4BU1A 3O9VA 2Z0MA 1NXTA 4J1SA 3TOVA 1JLLB 1Z6GA 3E8MA 1G42A 5CYFA 3TNYA 3EYWA 2AZXA 3NVKI 3JWHA 3WO0A 2O8BA 4HZUA 1Y5RA 1GV0A 3M81A 4TS3A 4HN2A 3T7SA 1IWBB 1T9GS 2XBLA 3G0CA 1RWNA 1VHWA 3AV0B 3EBLA 4E2XA 3EULA 2PH5A 1UK6A 1V1MB 3A3OA 4FHFA 2IWRA 4A8HA 2FN9A 4QASA 5FR2A 2N1BA 3VC2A 2AT1A 1ONOA 1U98A 1YQDA 2BEUA 2HWXA 3R77A 5CH3A 3IAHA 4MYDA 2O8CA 1KYWA 4Q3CA 2DFNA 1X1TA 1Q12A 2H29A 5L3QB 4RLSA 1Z6PA 3ZHTA 4RTRA 3DHYA 2AHRA 4AJ4A 1JKMA 5AO9A 2XRZA 2E21A 2WF8A 1J0DA 2IYLD 2F59A 4NBTA 5CM8B 1O94C 1THGA 2WFLA 1JAHA 1FRFS 3ND7A 1H3EA 4DQLA 2ZXFA 3A7DA 4EF6A 4R2HA 1CUDA 3QXGA 4J2TA 1HTBA 2H2AA 2Q5JA 4INJA 1H3FA 3AYZB 3B12A 4G0XA 4NEHB 3JWPA 1JDJA 5FR1A 4LJ8A 1G8MA 4FJ2A 4KVZA 1QGZA 4LWQA 5TJ9A 2ZUFA 4JB8A 3BRWD 4B6PA 1KARA 4KKXB 4KXMA 4Y9SA 4DLZA 4GRDA 4A6XA 3LX4A 1KRXA 3GQVA 4V2UA 4MDHA 1Q0PA 1MAHA 4KQEA 2XA9A 5DEOA 1INLA 3RV4A 3H83A 4H4DA 4LZAA 4DUGD 3BH6A 1LNQA 1RM4A 2IY7A 1U80A 1U9YA 3K96A 5DM1A 1M67A 1EVLA 2X2EA 1Z34A 2E48A 1H5NA 3FH0A 2O8EB 1COZA 2H7VA 2UYOA 2LCIA 2ZSHA 5HZHA 3CNLA 2R751 2J9FA 3NOVA 4XDZA 3NWPA 2CXRA 3HCCA 1Y8ZA 4RCVA 2R1TA 3PL5A 2O2EA 2OHOA 3O4FA 4ZZ0A 5JEDA 3C6MA 3A6DA 3RIGA 3F96A 1U9IC 1ZBDA 2XE7A 1V2GA 2B4AA 4QARA 4E31A 1L7XA 1RYYA 3AM3A 4JKYA 1X0XA 2IEGA 3NQ41 4LJKA 1KZYC 2DFVA 3OVMA 3LL7A 4DBZA 3V9PA 5A9SB 3L0ZA 1Y9ZA 1RP1A 3RCBA 1U3VA 4NEGA 1V43A 2A0UA 2HJRA 3HY4A 4LYDA 2DQZA 2KS6A 2I55A 4R3NA 3W1WA 5ITWA 1L5SA 5CMLA 1XNJA 4YAKA 2DHRA 1VZ2A 3L5KA 4MRSA 2YWGA 1E6CA 4DBVO 5I8PA 2NPOA 2O9JA 2WJ6A 2R47A 1B6RA 3DDOA 1IEVA 4HX5A 4XSHA 1T3SA 5FPSA 2WJYA 4ARCA 5JEEA 2FVXA 1UXGA 3DW1X 3L04A 3VAZA 5B4TA 1FBTA 1LPNA 3HJCA 3UO8B 2C0PA 3JVEA 3U48A 1NJ6A 3L0CA 3EHEA 1Y81A 2C99A 3ZIDA 4D9HA 3ILVA 1GTG1 1KI6B 4I19A 2V9CA 1M34E 2I22A 2WD8A 4FGLA 2DX7A 4NKRA 5ERXA 3VOAA 1TMYA 4XE5A 2QD5A 2XUOA 3U3DA 4HNUA 2ZULA 4JXXA 4BLQA 1RCTE 4M1EA 4FI3C 1JA1A 1F3LA 5JSHA 3ITKA 5SZKB 2GCIA 4QOGA 1R64A 2YIJA 2QTTA 1V47A 1C8BA 4N5NA 5THXA 3WL8A 4BMXA 4DZZA 3O21A 3DC7A 3QLTA 4F1JA 5LZ9A 3O26A 2FWIA 1H8EA 1N5IA 1TRHA 5E8JA 4FZ3A 5KNBH 1KPIA 3E6AA 2O20A 1HH4A 1PWXA 3NT5A 1KSJA 1XROA 4IDGA 1UFKA 3FZNA 1D0SA 2OCDA 3HB4X 1BXGA 2CCGA 3HP1A 4KO8A 5KYNA 3GRCA 1XG5A 2GILA 3ESZA 2VZ9A 1ZOLA 4QOHA 3F3KA 5A9TA 4INPA 4BVKA 2Z2IA 3ONWA 5EYPA 3R5HA 5JANA 1V0JA 4Y6SA 2X2PA 4B09A 3L0DA 4F2WA 5CA0A 3T34A 1JE0A 2OLKA 5HZKA 5JCOC 1QANA 2GYYA 3HFRA 1JSRA 3LIPA 4RK0A 4D02A 1G2OA 1WVMA 1FFCA 3IP6A 3D5TA 4YJ2A 3OT4A 3QFRA 4UNNA 4YJGB 1VLLA 3I1YA 1N2BA 4MKGA 4TX1A 3TRJA 2IS1A 1CR1A 2VP5A 1ZD5A 3GFVA 2CVFA 3KPJA 4EYEA 1GFIA 3A4YA 3ZJ5A 3D0OA 1TAHA 1W5EA 5IUNC 4O0LA 1IN1A 1YZKA 4B3TB 1N2GA 4FWTA 1P1IA 4O2LA 2J7PD 2PT7A 1Z4NA 3CU5A 2AHOA 4JENA 1E5QA 1GYQA 1U3CA 1C4OA 3RS0A 3OHPA 3I8OA 3VJLA 5LQCA 3U60B 4CM8A 4GUDA 3WNBA 3KZ1E 2IZ5A 2ZE8A 4JJ6A 2NUAA 4KWTA 4M83A 4MLPA 4ZPJA 1J8MF 1VQ1A 1JDVA 2NXCA 4MWDA 4RDCA 3UHFA 3A7EA 1B74A 4HPXB 3T3MB 4C43A 3L5OA 1K7XB 4DGQA 2G9ZA 2JGEA 4OJTA 3GRPA 2EU8A 2NOAA 3IDOA 3R3JA 1ZIDA 3A1TA 2PAFA 4BL5A 1C2TA 1T29A 3FYHA 1Q3TA 2Z4RA 3EZGA 1ZRMA 3TM4A 1A4XA 1DNPA 2JIMA 4GYWA 3ICEA 2E4UA 4BFLA 3L7MA 3W7BA 1WZUA 1MORA 4DQ0A 3Q7RA 3KUCA 2BM0A 2H54A 3LBHA 4ZOBA 4WMLA 2XXJA 3LCVB 2DCMA 3IIMA 4KZPA 5HKAA 1DX9A 4O4LF 3KFXA 4KVFA 2GCPA 3PFIA 1J25A 1XNGA 4PBSA 5EPEA 4B2IA 2Z3ZA 4G1BA 5TF4A 4D3XA 1C1YA 1W4CA 3G79A 3CNBA 3OCWA 1G21A 2FPGA 1DUIA 5E7MA 4OOEA 2X23A 4HSEA 1U0FA 3GA7A 3HCNA 4FFLA 1GPKA 4LUCA 5KTOA 4JI4B 1Z12A 1U0HC 1R3UA 3EXEB 4YNBA 2NNWB 2ZKIA 3V8NA 1QZXA 4CM9A 1SY7A 4LHZA 3B82A 4X62B 4G0VA 2WPDD 3IBCA 1BRTA 3GEPA 1SH7A 5ALHA 3HDHA 5T7BA 4M8KA 4ZJZA 2WD7A 5LPNA 1ADJA 2DERA 3MWKA 3AI3A 3LY7A 2C3OA 3HKCA 4B0OA 4UTRA 1UM9B 4TSRA 4U0JA 5CBKA 1NI4B 2AUMA 5LIPA 3SHQA 3FVQA 5AM5A 3TZ6A 1OXTA 2ODQA 2XGMA 4HEA1 5DT9A 2FSVA 1HYGA 2A88A 4D82A 4J0HA 4RMNA 4FHCA 3M1AA 2IUUA 4XPZA 2CFIA 4IHJB 3BCSA 4RPHA 2NUTA 4CXMA 2OFPA 2DR3A 3C6BA 1GCOA 1FQJA 2G1JA 2WHPB 4M87A 3RBVA 3VZCA 3W2TA 5HM8A 3P9QA 1KQ3A 4KSCA 4U6SA 3KEQA 4LA4A 3WB9A 3T6KA 3HXQA 4UHJA 5IT9A 5DIZA 3W9SA 4Y2TA 3HGMA 3PGA1 1U2GA 1JR3D 2Q6OA 3PEYA 2UXDB 1HLGA 2PRYA 1YU9A 1IDN1 1IJFA 4XRGA 4MVJI 2XZLA 2CL0X 2LDXA 2ZT5A 2C9OA 3A10A 3IOEA 4RQTA 2VNJA 4CFYA 2XXAA 4CLEA 3RHFA 4ZQHA 5ENDA 1CT9A 2O59A 3AVPA 4D74A 1P5JA 1QWOA 1TLFA 4LRWA 4NX2A 4EVRA 2GI4A 5H9WA 2NUPB 3UV7A 4O4HB 5AVRA 4C6SA 4FB4A 1RQLA 4HPJB 1C9JA 2EFDB 3IUEA 1U2RA 5EXEA 3AKCA 2BGNA 4Q9KA 4DFDA 2Z6UA 4Y6PA 1SJ9A 2C1EA 1Z6ZA 3KT6A 3DWFA 3M89A 4J0KA 4IVNA 4QOFA 4PPGA 4RY0A 4UTXA 5TE9A 4KYIB 5MF6A 1GPAA 4EELA 4BFCA 5HKLA 5BQ5A 1KYZA 2Q1XA 3ZJTA 1RLIA 2BJVA 4MS3A 2E87A 2X42A 4TLCA 5HA5A 4AD8A 3K9FC 2J59A 4F4UA 3DT9A 3TX6A 1A9SA 5GZ3A 3IJEB 4QYWA 2WOOA 3H1BA 3K6RA 2HQBA 3MWEA 4RCZA 1AKNA 1KK0A 5J1TB 1FP6A 3OX4A 1G5QA 1AZSC 4HDKB 3MW8A 4O2RA 4OMDA 3DMGA 1E64A 2G80A 2DF8A 4EI8A 2POCA 1JHQA 4FT4A 4MV5A 2EFHB 1OIWA 4JQZA 4Z51A 4QFDA 2D8AA 2VF7A 5IEBA 1YDWA 3SFTA 1YQEA 1KVSA 1T13A 3LCRA 5CT4A 2WKSA 1B3RA 2Y92A 4UU8A 4EWLA 5HW0A 3ABRB 5JWRA 2MSNA 4AP5A 1NVFA 2JLVA 3B38A 3WBBA 1ZU5A 1A2QA 1JMYA 3O8NA 4JC8A 4YAUA 1U0OC 1E3IA 4CKEA 3KKKA 2V4MA 3TTVA 5KU7A 2ZIVB 1BU8A 3I5YA 1X7XB 4J8PA 1JLMA 1W88B 5I45A 4OM8A 1JHUA 3E1GA 3GOHA 2HHLA 3NXSA 5CU7A 1FFEA 3MCVA 1BVUA 3IHLA 2BFEB 4E14A 1RHJA 2W22A 1BGWA 3FMIA 3FR7A 2NU9A 3KWFA 4LOHA 4HX2A 1ABBA 3DH0A 4AY4A 3G5MA 1CY1A 4GICA 5C8YA 1SA0B 3ROQA 2OO7A 4CIYA 3ND6A 1EDEA 1TQ8A 4FD2A 2PV7A 3HVKA 4E6PA 2XUDA 1J70A 2V6JA 4CW7A 3PXEA 3QKRA 3WFIA 3H11A 1D4OA 2DUUA 3E7WA 4HWPA 1SBQA 3A6LA 3LLUA 2XHZA 4IFBA 3L1IA 5HF8A 4CE6A 3KZVA 5A3VA 1DAEA 1NW4A 3PUWA 2C20A 4HQKA 7ADHA 1EGMB 4G1MB 5T64A 5U4XA 1IK4A 3Q98A 2AF3C 1ZINA 3HE3A 2BFNA 3REQB 4P80A 4PWZA 4NOKA 3HZHA 2OCIA 3AOGA 4Q05A 1A1VA 3ABIA 4I4IA 2CMGA 4HQLA 4X63A 1KZ6A 3PUZA 5L3RA 1EFRD 1SHLA 4BV8A 3ZK8A 1V7PC 2J4DA 2IOFA 3IXQA 3PC8A 5DWVA 5EQJB 1BW9B 4ZCPA 3JTEA 4LY0A 2YH2A 3U3KA 4JP3A 1TFRA 1HMYA 2X6RA 4WN9A 4ZYXA 4YRZA 2E18A 1KKLA 3F8TA 2GM3A 3R1IA 4I8DA 1WMSA 4NTZA 4AJ1A 2B4QA 3LHFA 1O1YA 4OB7A 2FP4B 2R8ZA 1O6ZA 3BJZA 4R5MA 1D7OA 3WGIA 1L6RA 4LF5B 3S68A 4E94A 4MLDA 4OU4A 3S70A 3SQWA 2F2TA 2XEDA 3QG5A 4J0QA 1Y9JA 5JDCC 3P9CA 1W5AA 4OX9Y 5F2EA 1XTZA 4BKPA 2ZPTX 1I0IA 1EK0A 1MNAA 1KYVA 1IBCA 5HQJA 4OAQA 3UFXA 2CL7X 3IEIA 4IH1A 5L7WA 1ZJYA 3UC5A 5MFZA 3PHHA 3HJHA 1DX4A 5J2UB 3LA6A 4JSYA 1WCYA 5EWLB 5CA1B 2FFJA 5JXJA 4PIVA 4JMPA 1YR6A 1U8AA 3QKWA 3DMHA 3OZFA 1AQ6A 5AHRA 2ZUVA 3B8HA 3ZV7A 1I7SB 3N75A 1G6Q1 4JLKA 4EHKA 1UKVY 1IWPB 2FPXA 3KVNA 2W6JD 1IPHA 3KE8A 2EARA 1OPRA 4KAXA 1WSDA 2ID8A 1RPTA 4L5IA 4M1KA 4TRRA 4EFNA 3E9EA 4ZOQI 2J9ZB 4P0TA 1CC1S 4F38A 4W7SA 3BA1A 5HEKA 1N36B 4YCDA 4TLMB 3I3SR 2NN3C 2I2AA 4GBJA 4TXLA 5L4SA 2HSEA 3CEMA 2YWFA 1TQ4A 2C4NA 4Z2YA 3U4QB 1NBAA 1K3TA 3E53A 3NO4A 1E2QA 2O8FA 1RC8A 3JQPA 1XA0A 4HGZA 2AXQA 3VDQA 3U7IA 2GWRA 4G0YA 3OQIA 2PGNA 3HABA 1F4PA 1JT2A 2VIIA 3HRKA 2DU8A 2WA2A 1JSZA 3JZDA 3OA0A 1F8XA 4LTNA 4R81A 2AJ8A 4IIJA 1EGHA 4QJ4A 2JIPA 2NZUG 3QU7A 5IAJA 3WJ2A 1PZNA 2OHVA 4LJ9A 1YB5A 5CJJA 7MDHA 1TO2E 4QHTA 3KLNA 1EDZA 4G0NA 3FPGA 4KQ6A 4QX6A 1P1KA 1OAOC 2QL6A 4F3NA 2A9QA 4OOFA 4K1XA 1Q0ZA 4IM7A 4EG8A 3W5BA 1V16B 1N5DA 4NBUA 4F5ZA 1BJRE 2VDVE 4OLBA 1GQQA 4AG3A 5JNVA 3HJTA 1EDDA 4ZCLA 4IFIA 4L2IA 5IABA 1UWKA 2GJAA 1OXUA 4YJHB 4OHOA 1J6UA 2HMSA 3OPQA 2RH9B 4R83A 3PXUA 3IP5A 3SZ3A 4BCBA 3G0HA 1U65A 4CT4B 1P74A 4Q0MA 5DK6A 3E5HA 3LYHA 3MGKA 4YJFB 5K3FA 4C0KA 1T2FA 1JI3A 5K2OA 3PKJA 2WU4A 3T7IA 2EW2A 3I6QA 1Z5OA 5JH7B 3FBTA 5KMGB 2B2CA 1FK8A 3OF2A 1RQGA 1W47A 4NFSA 4MV8A 2VP2A 2J9RA 3BD8A 3TLZA 1G7CA 1M8FA 4XLZA 4GMGA 1YZFA 4WCFC 4U7JA 4FYVA 5FOSA 4ED9A 4MDEA 3BBLA 5GM1A 4H3VA 3H2JA 4MO9A 5EAIA 2W6PA 1VCIA 1YDEA 2P4SA 3JQQA 3VPFA 6REQA 2UUCB 5AK4A 8ADHA 1JVSA 2W48A 3UHJA 5AVTA 4HR7A 1L5QA 2HLHA 3CQ9A 1H2XA 3EA4A 4P83A 1T25A 2APJA 2GEVA 2QW0X 2XWSA 4J3JA 5TGTA 4KNVA 5JO0A 2FSUA 2Q8NA 1XZPA 1EMDA 1V96A 2OBMA 1V3TA 3PG5A 3PQ3A 4P53A 2AN5A 2VSYA 5TEVA 4UZSA 1Z33A 4MO2A 5KIAA 1OJLA 3JQFA 3R0VA 1TQHA 5CFOA 2CXSA 3K92A 2I4RA 4WCDA 2XMGA 1MKYA 1NMEA 3MAAC 4HGQA 3KZOA 3CZ4A 2TRSB 4I6JA 3GP5A 2ROQA 2IHVA 3OEYA 1CS4C 1J7JA 1RQNA 3OJXA 4Y30A 3O6VA 5F3DA 3EZNA 4ARBA 5EFZA 3SR0A 1DMSA 1WCXA 3TZLA 3V34A 3N2YA 4FW9A 1ONNA 1IJBA 2RK6A 3Q3IA 4NBLA 4IMPA 1SPBS 1PBTA 1FJHA 1LEHA 2YBEA 3MTJA 3ZV5A 3ZU2A 5KYXA 1ZO8A 1YJCA 5JSYA 3SU8A 3TSCA 2IU6A 2AI2A 4D9GA 4KRFA 1P7ZA 4QBKA 1OR8A 1N2HA 2PD4A 3RYCA 1WXDA 3UMSA 4KHZA 3SVLA 4LF8B 3G8YA 2GESA 3HN2A 3R8CA 3BRWA 5A62A 5HTOA 4AZ3B 4ZYZA 1QLHA 4ZICA 4D9BA 2FZ5A 1DSSG 2DHDA 2P2GA 4IICA 4M0FA 4K46A 5CEEA 5A06A 3R7FA 1JXOA 2IT1A 3NBZC 4AJ2A 4FM9A 4ZYTA 3KK0A 4D25A 1FYXA 4HL6A 2HMVA 5GIPE 1XQ6A 1TQ6A 3AILA 1EQUA 3PGMA 2DFDA 4GI7A 4BRZA 1O0CA 1K86A 3O91A 3OPMA 3SOPA 4Q7MB 2Z9BA 2EJUA 1YR2A 5LWHA 3L6OO 3K9WA 1NY6A 1DAKA 3C24A 3E70C 1NQUA 3PR1A 4ZC1A 5LDDC 1XHLA 4YAWA 2NU8A 2J5XA 4NULA 2XCLA 3KSAC 4HVAA 4LDQA 3W2GA 4BFSA 1BG6A 5B53A 3N87A 1K3UB 1BC5A 1UDCA 2VH2A 3FLAA 3VVLA 4CM6A 1CR2A 1C1DB 3ZPXA 1W6RA 2VUHB 3UQYS 4EO9A 1G21E 2CF6A 4K8RB 1MABB 2HKIA 4FMCF 1EH5A 2D2XA 3GFRA 3SKYA 4BX2A 1SUAA 4C29A 3O83A 1QYWA 4GGOA 2K87A 4UCQA 2XF2A 4ER0A 1I1NA 3H4VA 4X85A 4N65A 4DCGA 4EJ0A 4F4IA 3DR3A 4PC3A 1GNLA 2FWMX 1EUZA 5G0VA 3TQQA 4C08A 2OG1A 3DE6X 3VZSA 1DO8A 4XX0A 1N3YA 2V59A 3LLVA 2WF9A 2WJWA 3K6SA 1SCQA 4GBED 5G1OA 3WWEA 4HFJA 4HRVA 3VSAA 3D3QA 3SBDA 2VYND 3EG5A 3DFKA 2ZAIA 5KHAA 1WXXA 1JW9B 1XKLA 4V3CA 5I9IA 3N2KA 3P26A 1J8DA 4QXMA 5E4JA 2HDNB 3SI7A 2HRBA 3H5WA 2P4HX 3VNUA 1SU4A 2FF5A 3LQFA 4D8WA 5IBPA 1Y6GA 4ITVA 3BS4A 4ALIA 1SCUB 3PUXA 1UKYA 4YLEA 2Y3IA 4JU9A 4UCFA 5DOVA 2F17A 1NR5A 5TRTA 4ES6A 4RHEA 4HXYA 3SIXA 2NO1A 2IXDA 1Z29A 3PKIA 5BXQC 2WVGA 4ZWNA 4S04A 3FFWA 5A4JA 3JV7A 2RI1A 2QW1A 2V5VA 2AR7A 3KSDO 1GQFA 1JYFA 1NXWA 1Z35A 4JR2A 4MCIA 1ZI6A 3W06A 3EFOB 4GU5A 2OB1A 1AUQA 4ZOLA 5JMPA 2NU7A 2OC4A 4EMUA 1WDMA 5GONB 5LYYA 1SHKA 4TZ0A 1NVBA 5LUAA 1WY7A 4HWOA 4RELA 2ZBVA 5C37A 1GARA 3UJ8A 1X1AA 1TVEA 4FK8A 4TKVB 2GX6A 4XYEA 3KTAB 1T8UA 2O3QA 2PRIA 2W6MA 3GGSA 2NXJA 3KQWA 1LTQA 4NS4A 1EDOA 5C0OE 1GKKA 1UOQA 3PDWA 4QSHA 3CX6A 1JV2B 4P33A 4PLFA 5KVCA 1ZK1A 2HN9A 4JQOA 3R9WA 2PUBA 1Y1QA 2XNDD 1C3OB 2QTLA 4Q1DA 3QX9A 1WXHA 3R3ZA 2GO7A 4Z9FA 3DF7A 4D9IA 3AR4A 1TX4B 1C0LA 2PHZA 1OREA 1RJFA 4XWOA 3RF6A 2IH4A 3EMVA 4YRLA 1IOVA 1E60A 5A9RA 3ZGYA 3KKEA 1KEPA 4B43A 2AEFA 4CEHB 3FTFA 2XH8A 3QBDA 3R5FA 3PHJA 1CRWG 2JFVA 2H5LA 5L8VA 1OH8A 3MERA 1V4BA 2Y93A 4I9NA 5AUQA 3OC0A 2JGIA 2V0CA 3G02A 3QV2A 3HHPA 4LOIA 3SGLA 2H2WA 2JJ2D 3RVDA 1H69A 1DCKA 2IXBA 4RZ2A 2PE5A 1M1NA 2XE8A 1QIFA 2ZBQA 4FZJA 4IHAA 4RKRA 5A0VA 5JAUA 1GU1A 2LIPA 3DVLA 3IIEA 1P0MA 3RSZA 3U81A 4EYQA 4XR4A 1JU9A 4BNVA 4EG6A 2BM8A 3MEQA 3G6KA 3WK4A 4IOKA 2MINB 3DKIA 3ZNPA 4EG5A 2ZZMA 1J5XA 2XNSA 1HFWA 4GOJA 4OFBA 4BO7A 5IKPA 2G28A 4FU0A 1YV9A 1JNXX 1WNFA 4YASA 3K5PA 1I36A 4YA6A 3O2NA 1S8FA 1U0EA 2VKQA 4NH4A 2BEKA 3KDPA 4WNYA 4EMBA 2VJOA 4TRMA 1P4JA 1SUSA 3KZXA 3V8QA 4G1FA 4LNAA 3A27A 4OATA 2CLEB 1C9YA 4LG1A 3TEJA 3MTDA 4BOYA 1OAAA 4NCIA 1W5FA 3PGXA 5DO9A 1YHYA 3N05A 3VSDA 2AQ8A 3QEBZ 4L6AA 4RKYA 4A0QA 4BNLA 2J33A 2CNDA 2AZTA 2H7CA 5FUBA 1O8CA 2RHOA 2WPDA 3ZHRA 3GJ6A 3GW8A 1AKVA 4N41A 1LFAA 3NHAA 4HTAA 1QK4A 5EIBC 2FPIA 2FZCA 3OBIA 1LQTA 3BEDA 4AUMA 4PFJA 1QGYA 3D4IA 3NRJA 5KNDH 3EZ6A 4EG0A 2JFBA 2UAGA 3FUUA 3P9PA 4Z4FA 1JBKA 4Z3KA 2VDOB 1O97C 2XAAA 3NV7A 3SS8A 3WRXA 5A2QA 1PEYA 4BMZA 4KFSA 2WNIA 3BFVA 1R50A 2PWZA 1RFGE 5L7YA 5BT8A 1BOFA 1P9NA 4F3KA 3CUKA 3H5LA 1U7XA 5A71A 3E7PA 4ESVA 1CNFA 2Z5FA 1SZCA 1GPUA 3TBFA 4YV1A 2P3QA 1SXJD 5I8ZA 1JR3A 2R5NA 2OFOA 3CLRD 4UATA 1KR2A 4YUZA 1RNLA 1YZLA 2DQKA 4UM7A 3I5XA 1VBMA 2IQIA 3IBTA 4KQMA 3AVYA 1ODTC 5BN4B 3QQPA 4MQBA 3DE3X 3L0YA 2R85A 1Y42X 4ITRC 4HH1A 4KBYA 5KTSA 2XT0A 1H2EA 1VJCA 3ABSB 3LUCA 4FOOA 1ZJ5A 4PNHA 4BGVA 4C7MA 5JVDF 1F4VA 1OX4B 3M33A 4R9VA 5GADl 1J2UA 3P94A 2PLWA 1T0PA 1X9GA 2FQXA 2RGYA 5EIWA 3THOA 1XCGB 5HZMA 1HLPA 3JWGA 2FUNB 1LJLA 1MFZA 2XKJE 1NV9A 4Q7LA 1YHNA 5JJKA 5I7HA 4QVIA 3IUBA 2A35A 3AG5A 4IZ6A 3DZFA 5L4NA 2OCLA 1R0SA 5KHOC 4JCOA 1SVUA 2IGTA 1SB8A 1P9LA 2ZVJA 3GJ7A 5KKCA 4N7BA 1P17A 4FI3F 4IMRA 2VYVD 4XWKA 5IKXA 1OB2A 1YR7A 2NZVG 1BH6A 3BK7A 1FS6A 1U2GC 4Y2QA 4A92A 5LVAA 4ZHQA 3D59A 3Q2KA 2P68A 2VAMA 1C9DB 1QBGA 3B53X 4RQUA 1NMXA 2DBZA 1DELA 2XLCA 2EGGA 1K1EA 3A3KA 4TXJA 1ZEMA 2QRLA 1PDVA 1P6QA 2GYWA 4HS9A 4B7AA 4DDMA 1QIJA 1ZH4A 1A50B 3AFOA 2SHKA 3C3XA 4GXNA 2DLCX 3M83A 3V55A 1TOAA 2JA2A 2EL7A 1FW6A 2OQRA 2WUGA 1Z74A 3PS9A 5K09A 2R1VA 2IPLA 3Q9UA 1XLWA 3KZKA 5K8JB 3O0TA 4CU5A 2IOYA 3CLUC 2QUKA 4ZTBA 4CVNA 5K7SA 4Q3DA 4KQFA 4PCUA 1KBQA 1RC1A 2HXSA 4MQMA 4UFOA 1REQB 3CRVA 3R6GA 1TCUA 5DHAA 2J6IA 3SJUA 4EHIA 1ECBA 1WP4A 4JGBA 3NETA 4UNPA 1LWNA 1Z62A 3ISVA 3OQ1A 3VC7A 4RNCA 3FA2A 4DJTA 2NYRA 3IFSA 2HU2A 3IAXA 2QHXA 4PCLA 3KOYA 4IQFA 4ZVQA 3FVTA 4NATA 3LUDA 1RPZA 3UB4A 1NUHA 2CLLB 3TI9A 1BFKA 3WGQA 3H65A 2R2GA 4BKUA 4PG6A 2QG9A 3MCUA 1C9NA 2P78A 4PF1A 5MN4A 4Q4HB 4RPIA 3WLAA 5COBA 4RF5A 1EJ6A 4P7BA 4F6RA 3EPLA 4ABTA 2WG0A 1HA3A 4TM7A 3TO5A 4Q1BA 3I2YX 5EOVA 4HX9A 1KXJA 3ILHA 2ZI9A 3U7FB 3F78A 2JBWA 1KE2A 3F97A 3HR4A 3KC2A 3RWBA 4EECA 1I4OA 5L4LA 4RZHA 2Q6KA 1LJUA 4WI1A 1R0ZA 3RSQA 1EFRA 1T2UA 1UPFA 1VSUA 1P3Y1 2W98A 4MPJA 1DJNA 4PVDA 3IKMB 4U7FA 2VSFA 4A0GA 2KPOA 1CUBA 2H1VA 2PGDA 2LE0A 2YC4C 3FYDA 4FSDA 4L74A