4O1HA

Crystal structure of the regulatory domain of ameglnr
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
SHMSLDLLVMTAEADATAVLPALDLLPHTVRVRAPEVTALLDAGHRDVILLDARSDLASAKSLCRMLKGTGEDEAATPIIAVVGEGGLVAVSAEWRTDDILLPTAGPAEVDARLRMVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulator GlnR
publication title Atypical OmpR/PhoB Subfamily Response Regulator GlnR of Actinomycetes Functions as a Homodimer, Stabilized by the Unphosphorylated Conserved Asp-focused Charge Interactions
pubmed doi rcsb
source organism Amycolatopsis mediterranei
molecule tags Transcription regulator
total genus 27
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4o1hA00
1JDPA 5C5EA 5DLEA 4O1HA 3M9XA 2L17A 1MB0A 4EVQA 1ZAYA 4Z4CA 3FDFA 2B1JA 5EWMB 3M6MD 3N6VA 2QU7A 4MGEA 1RZRA 4G97A 3LUFA 4IMJB 4ZPJA 1MB3A 2VUIB 1CEYA 1USKA 1Z17A 4RV5A 2A9OA 5TPZD 1FSPA 4LDZA 2KYRA 3SG0A 1RPJA 4MRMA 1E6MA 4JA2A 4RK1A 3RVMA 1MAVA 4YRZA 4RXMA 3URMA 2F8TA 4EVSA 3N8IA 3OM0A 3Q41A 5B3JA 2PUAA 2MYUA 3QX9A 2P9HA 3HSYA 4LX8A 3RVOA 4EYQA 4M88A 4QYWA 1NATA 3GYBA 1D2AA 3CLKA 2FMKA 2NT4A 2W42A 3NNNA 3R0JA 2F8SA 1YK1A 4EY3A 1OXBB 4D6XA 1M2FA 1DCMA 2PE5A 3JVIA 2AYXA 3IP9A 3CZ5A 3Q7TA 3QEMA 4N03A 3EQ2A 1CHNA 2JCGA 5JNTA 1P6UA 2FMHA 2X7XA 2JRLA 1XWWA 2WWVD 4IILA 2PUFA 1TVMA 1ZGZA 1ZN2A 5TQ2A 4LE1A 4WWHA 1ZY2A 4O5AA 4RWEA 1SXHA 4OBBA 2RJNA 4KMRA 1QKKA 3IPAA 4G0OA 3RVQA 3HDGA 4RKQA 2YHAA 1E6LA 3CU5A 1Z18A 4KK3A 4W5NA 4KFCA 1LJUA 3HUTA 5TE9A 3RVNA 4ML3A 1NTRA 3MM4A 3FFWA 3MYYA 1VKRA 3OLWA 3LUAA 3KCNA 4F11A 4ZJPA 1LBIA 4EVRA 6CHYA 2HQOA 4XASA 4KQCA 5T7BA 1VPWA 3CNBA 4LE2A 1FFSA 1Z15A 3UUGA 1QPZA 3QK7A 5BR1A 5I4CA 2VYCA 3H6GA 5E3JA 1IIBA 5TQ2B 1EWKA 3K9CA 4RY8A 1I3CA 1SRRA 3EQZA 4MQFA 2L2QA 1B00A 3NBMA 2WJWA 3A10A 4ZYLA 2CWDA 1BDIA 3T8YA 5JS1A 3JY6A 4FE7A 1JDNA 4FE4A 3DLHA 2CHFA 2RDMA 4RXUA 2HJ9A 5EWLB 5KQMA 1LBHA 1BAPA 3UKJA 1NY5A 4QPJC 4IRXA 2M1ZA 3H6HA 2J48A 5DKFA 4MS3A 1DC7A 4KRFA 1M5TA 5TPWA 2WY2D 3TMYA 1BA2A 2FW0A 2OENG 2R47A 3LUJA 1URPA 2NZUG 3ROTA 2ID7A 3BBLA 4RK6A 4EYOA 2MYNA 3GRCA 1P2FA 4Z4FA 2FQYA 4RSMA 1ZH4A 1D4ZA 3KYIB 2PL9A 2E4YA 3NHZA 2MSLA 1C0EA 2PJUA 4TLLB 2QZJA 5JNUA 1GLGA 1YIOA 2R25B 3CZCA 3F73A 5FWXB 4TLMB 3HEBA 1P8AA 2QVCA 5KC8A 5TPWB 3H5LA 3QELA 4UHKA 2LBPA 4NCAA 4D74A 3O74A 5KI6A 2QVGA 2R4QA 3GBVA 1ZITA 4E7PA 3OQNA 5EWMA 3JTEA 4MS4A 4RY9A 4JB2A 3OLXA 1JLKA 1EWVA 2FQWA 1DRJA 3I42A 3N0XA 3NNSA 4G0XA 2FXIA 3GV0A 1JWLA 3Q7RA 5IX8A 2FTKE 3OM1A 2IKSA 4EYGA 5ED4A 3SAJA 2FMFA 4RK0A 3CRNA 3MMNA 4OTZA 4N47A 5CNJA 4Z4IA 2HQBA 2GI4A 5KC9A 2QR3A 1VRVA 1JBEA 3O1IC 1TM2A 4MS1B 4EUKA 1QMPA 1F51E 2VUHB 5KWSA 3H1FA 4MS4B 2L19A 4XFKA 1U04A 5IUJC 1NXTA 1NXOA 3LUHA 1YS6A 2CD7A 1RZRD 1R8JA 3L49A 2RJOA 3O21A 3HO1A 1USIA 1W9HA 3MQ4A 3SQNA 4XXHA 2IOYA 3CHYA 3EGCA 3KTOA 1U0SY 3SY8A 3JS5A 4NQRA 4QYMA 3JPYA 5GQSA 3KJXA 4DADA 4PE5B 3HS3A 4HNRA 4YR7A 2JVJA 3KKEA 3DBIA 1J56A 5JNRA 4F06A 1VLZA 3KYJB 4G0PA 4EYKA 1PEAA 2JK1A 4Z0NA 3HCWA 1APBA 1JH9A 3GBPA 4LRQA 4DQDA 3H1GA 4YO7A 4E7OA 1ZHHA 2TMYA 8ABPA 5HSGA 2ID9A 3A3KA 3TB6A 1RXEA 3RVPA 2E4UA 5ABPA 2JBAB 2B4AA 1L5ZA 4NV3A 4JP1A 3C3KA 4KV7A 2GBPA 1PNRA 3H5WA 3E3MA 1Z2DA 1HEYA 5CNMA 2QXYA 5FBKA 3RVRA 3GWGA 2WMYA 2A9RA 2QW1A 2FMIA 1YS7A 3IDOA 3IP5A 1JF8A 1RNLA 1NXSA 4HNSA 5HQJA 4NCBA 1SXGA 5EWLA 2VK2A 4F12A 1QQBA 1UDRA 5TQJA 1ZDMA 4IF4A 4KZKA 4Y9TA 2RGYA 4G0MA 3H5IA 3O2JA 1BDJA 2Q5CA 3QX8A 2FEKA 1JFVA 4UHJA 3OO0A 4JASB 1Z26A 1TLFA 3HV2A 1OXKB 1U8TA 3B2NA 2PUCA 1JL3A 3L6UA 3C6QA 1EFAA 4F3TA 2MSKA 3IP7A 5HKOA 2IPLA 1ZH2A 4HNQA 1TMYA 3O1JC 3JVDA 3DZDA 4OATA 1XHEA 3F6CA 1YVUA 3D8UA 3BRSA 3OQOA 3OQMA 3CG4A 5FWXA 5GOTA 1ZGGA 3H5OA 3OMXA 5JNSA 3H5TA 5IUKC 3HM9A 5IEJA 1E2BA 4EGSA 3EJWA 4TMYA 3M9WA 4O1IA 3LKVA 3TD9A 1DBQA 1DCFA 2FSPA 4Q7EA 5JS2A 3HZHA 1FFWA 4N41A 4RDCA 4CBVA 3VNBA 1AB5A 3F7NA 4WZZA 3Q15C 1QO0A 4MR7A 2H3HA 3A0UA 3JPWA 1D1PA 3KG2A 4WUTA 4ZMRA 2A9PA 4LZLA 5BQ3A 1Z2EA 2CHEA 2E4XA 1AB6A 5IBQA 2LPMA 1S8NA 3D02A 3HK2A 3GL9A 5FWYA 4N0QA 5KQGA 3IPCA 1DRKA 1Y1LA 1EWTA 4W5TA 1JFSA 3I5AA 1YMVA 2PUBA 2PUEA 1FFGA 3E61A 3HJFA 2P4UA 3KLNA 1JHZA 3HUUA 3LUKA 1QP7A 4G0YA 2JVIA 3LUDA 4MS1A 4MR7B 1JYFA 1A0OA 2HSGA 2FKAA 1A04A 2PMCA 1ZVVA 1YTUA 3A0RB 4S04A 3Q9SA 1M5UA 2M98A 3BILA 3N0RA 1GUBA 3OO1A 1ISSA 1LK0A 1YMUA 2LP4Y 5FWYB 3RH0A 1SXIA 4YGXB 3GT7A 5BRJA 3QLUC 4JB0A 4W5OA 5DTEA 2PUDA 3CG0A 5TQ0A 3W9SA 4MR9B 2NZVG 1Z12A 4YV7A 3CFYA 5C5CA 4PYRA 3N75A 4YWHA 4Z4EA 3CTPA 4RS3A 2NT3A 3BRQA 4DN6A 1DBWA 4Z4GA 3FMVA 3KLOA 4YS6A 5CNKA 4RK7A 2PKXA 1D5WA 1E6KA 3LUCA 5PNTA 1DJMA 3OLYA 3EAFA 4ETNA 1RXIA 1M2EA 4RXTA 3O2SB 1Z13A 3LFTA 4KVFA 3OLZA 1XHFA 2O20A 3OLVA 3T6KA 3F6PA 2NUBA 2JBAA 4Q6BA 2JB9A 2GKGA 1A2OA 4Z9AA 3Q7SA 4KPYA 5TQ0B 3MA0A 2JVKA 3HXMA 2PLNA 1EAYA 4PZ0A 1K66A 4TN5A 5CHYA 5F64A 4YLEA 2QSJA 2GWRA 3N53A 1DZ3A 1F4VA 1QQAA 4ETIA 1W25A 6ABPA 3NNDA 1NXWA 1U2PA 4IGAA 1KGSA 2L18A 1P6QA 1USGA 4LE0A 1ABEA 4QICA 5IC5A 2DRIA 5TPZA 5JNWA 3RQIA 2LIVA 1BDHA 3FFXA 3G85A 3KHTA 5EWJA 1JX6A 9ABPA 4PEVA 3OMWA 1KMIY 3DGFC 4KQ9A 4S05A 3LOPA 5T3YA 3H1EA 3RVSA 1GUDA 2AYZA 2FVYA 1WETA 2WRZA 1TJYA 1ZESA 2IPMA 2IPNA 3FGZA 3QLVA 4RK4A 2FN8A 3LTEA 4KK4A 4G0QA 2PL1A 2LUOA 1EHCA 2E4ZA 5IUNC 3P9YA 3O75A 1L5YA 4G86A 3H5VA 1YK0A 2A9QA 4P98A 3NHMA 1DBPA 4G0ZA 3CS3A 1T34A 4PICA 1JFTA 2IPAB 2BGGA 5EWJB 4XAQA 4N76A 4Z9BA 1Z16A 4MR8A 2FQXA 4HYEA 4N0PA 3RVKA 4MRMB 3T38A 4MAAA 4GNRA 4H3KB 1Z25A 2QV0A 3DGEC 2FN9A 5KQLA 4JOQA 3O2QB 3QEKA 4KREA 2ZAYA 5CNIA 3EDCA 1CYEA 4RK5A 1C4WA 3C97A 4ZMSA 2R48A 3H75A 4NICA 4YCSA 3C3MA 5FBHA 2ZWMA 2PAFA 3CKMA 1MIHA 3T95A 4LDAA 2MYTA 1GCAA 3HDVA 1ABFA 4MR8B 2FEWB 3IP6A 3KS9A 4Z99A 3ROFA 3QEMB 3MF4A 3I09A 3GA5A 3QLUA 3ILHA 3LUGA 3N0WA 4MYRA 3SM9A 2MSWA 4L4UA 3S99A 5KQPA 4F8JA 3FFTA 1NXXA 3KSMA 7ABPA 1U2QA 3BREA 4RKRA 4B09A 2FLWA 3QLVC 4MLDA 4RU1A 5B3JC 1KRXA 1PUXA 1MVOA 2PUGA 1PHRA 3RVJA 1H9CA 1JYEA 4RZSA 3G1WA 1K68A 3EULA 4OLAA 1QO0D 1KRWA 1LJLA 2WJAA 3EODA 2OQRA 3C3WA 4MPTA 2GX6A 2YHBA 5DCLA 1BVHA 3RVLA 1DC8A 2FEPA 3K4HA 4RY0A 1DCKA 5JNVA 1FQWA 4FB4A 1ISRA 3I45A 4Q6WA 3TO5A 4W5RA 4YP9A 4MR9A 5IULC 4KNYA 4MQFB 3VNAA 3QLTA 4GPAA 4H3HB 2I6FA 3MIZA 4L85A 1PNTA 4W5QA 1NXVA 2V0NA 2XDYA 4WXEA 1QNLA 5BRAA 1SD5A 3LMKA 5HM6A 4OLBA 1QP4A 4D6YA 4IMIB 2N9UA 3UK0A 3SNKA 3TX6A 4JAVC 4MQEA 4MS3B 4H60A 4Z4HA 4OG2A 4P1ZA 3ILYA 2E4WA 2WB4A 2H0AA 2E4VA 2IDMA 1DP4A 1NXPA 2MYPA 1DG9A 4XARA 1PEYA 2HQRA 1QP0A 4MLCA 2FLKA 3HVRA 4XLTA 2HPHA 3DLBA 2IYNA 4WT7A 5IEBA 4ETMA 5DGCA 1D1QA 3O1HB 5D2CA 3LKBA 4WXMA 4MQEB 1GCGA 3QELB
chains in the Genus database with same CATH superfamily
1ZRHA 4DCNA 4WBSA 4E1BA 3CSUA 4A1FA 2PYDA 1E6UA 1WXXA 4JGIA 1OFUA 1BXRA 3PD1A 1JHAA 3SHOA 6YASA 3OQIB 3GA0A 2FEOA 4Q4JB 3TLJA 3QPAA 1Z06A 2GM3A 3DC7A 3W6ZA 1T1IA 1PG2A 1ZMBA 3UMBA 1ZNXA 1ZCZA 2HREA 4ZAXA 5K3SA 5FPKA 4LXYA 5ICGA 1FUIA 1FLAA 3L92A 3PNYA 2DETA 2WC1A 5CRIA 3ZDYB 4IH9A 4LJ9A 1ZJJA 3DLIA 4DC9A 2W2OA 2A9OA 1CTQA 5L3SB 4O2BA 1U0FA 1OBCA 4E3WA 2BR4A 1ODSA 4MRMA 4TROA 3ETEA 1C50A 4DEYA 3LP5A 1ADJA 4BKQA 3C98A 1P7WA 5E6SA 4X3CA 3DOCA 2NV0A 2H4JA 1Z0AA 3EWNA 5B1IA 1ST2A 2BCEA 2PUAA 4UHBA 1JH8A 2ONKA 4I8DA 3R40A 2YZMA 2BEKA 1U9ZA 2A4KA 3AFNA 4MUXA 2YFKA 3WGYA 4Q47A 3IUSA 3NNNA 4EHAA 3NWPA 2R85A 4I08A 2E21A 3COWA 3I6YA 3SVTA 3E8XA 1HF3A 1BG6A 4V1CB 3BIJA 2WPDD 1NJ5A 4Q7QA 5K6AC 1M2FA 2GF2A 1NJ8A 4FFPA 1WSAA 2FWPA 2GNOA 2X8LA 4LJLA 4H7KA 1N2CA 1QYDA 3ABIA 3WSTA 1TA9A 3F5DA 4TN1A 4YMTA 4FGKA 3EOZA 1JA1A 2OKGA 4MXDA 3AIIA 4ZVRA 4V0LA 2CFSA 1JJ7A 1K9SA 1ZN2A 5EN4A 4MUYA 3RABA 3OEEA 4I5IA 1UJ2A 4B3DA 3O3NB 4YRAA 1XALA 1F60A 1LNQA 1WXGA 1YOBA 3V3KA 4PR0A 3IP1A 2FWBA 4AZTA 2IUEA 5TX7A 1ULAA 3C48A 2XT6A 3TS1A 3UHOA 2XD9A 1I0LA 4CM1A 1ECLA 3AETB 2JZCA 3A1NA 3HPQA 3LUAA 1GSHA 2DM6A 3RC9A 3PEFA 1J24A 4CF7A 2XUHA 1P3JA 4MSUA 2F4VB 2BRUA 1BO6A 3R3JA 4OFWA 3TTTA 3WAKA 4HS9A 2BUBA 1BDMA 2BI8A 3AWDA 3M5CA 4D4MA 3KSUA 1GKUB 3C6XA 1T9ZA 5FQNA 3KEGA 3K6SA 3ZBQA 4A8JA 3TE7A 3FTNA 1BHQ1 4U00A 1Q95A 3FYSA 1E3WA 1IG3A 2L2QA 3AM5A 5JQWA 1MX5A 1ZK4A 4NOKA 1K6EA 3A28A 2PZ8A 1H3EA 4DM4A 1DWUA 2CLLB 5JNLA 3TRJA 3V1KA 4C2AA 4P4SA 1KEPA 4KGZA 3PC4A 4D92A 3DKPA 3PNOA 1DXOA 1BKYA 4IQ8A 3FCSB 2DCUA 1M66A 1RWWA 3LBNA 4KLCA 2CL7X 4U7TB 4BYGA 5CT8A 2KB0A 3GC6A 5DEOA 4ERXA 1E32A 4FDMA 4HPXB 3U3XA 2PVPA 1LCIA 3RSCA 4PSAA 1KSJA 2R47A 1L7VC 3ONEA 4LYJA 2ID7A 5E2BA 4LPSA 1ZKDA 3AKDA 3UMCA 3B1VA 4HXEB 4XLZA 2FQYA 2MU1A 3GF4A 4RA6B 2GCGA 3LLMA 3AR9A 4KNVA 1P0MA 2PA0A 2Q2WA 3CLRD 1JHVA 3GUYA 2RHTA 2Z3WA 3DJFA 3EFOB 3FUXA 3I2FA 4NMWA 2FF7A 3EIWA 3OIFA 1SXJB 1OFVA 4MB0A 4RELA 5DWDA 2P2CA 2DBZA 5JSFA 1ZZEA 1MZVA 2R8RA 2AKAB 5DVZA 3KSDO 3ZCPA 4BLUA 2WA1A 1FNNA 3DJYA 4NCAA 2GRAA 3WK5A 2JFYA 3G2IA 3QHPA 3O74A 5KI6A 1XIVA 3TXXA 3TX2A 1Y5RA 1KORA 1N0WA 3ZXSA 1R9MA 4DSNA 2R4QA 1ZITA 2VHWA 3NIBA 4FP9A 3KB8A 2IITA 1J0EA 2QJFA 3A1CA 4MS4A 3WIOA 5BSVA 1QJCA 4G0XA 1JEYB 2OXEA 4TZTA 2VP4A 1QO9A 4DOMA 2CKDA 2QBYB 5K6RA 1J99A 4HFRA 3SU8A 2IKSA 1BMQA 5FUYA 2VEOA 2YYSA 2ZLBA 3LH5A 2H9AA 3MFQA 4PC2A 2JIZD 3K71B 4LWPA 1HK7A 4NJMA 2HWKA 3TAUA 4EO7A 1SA0B 4R9NA 1HOXA 3ESZA 5E7QA 4OKSA 3KVOA 4L8GA 2ZTLA 1JJIA 2VUHB 4MUJA 4C89A 5I7WA 1YAJA 3U4GA 4LRWA 5KAPA 4A26A 2AJLI 4D9BA 1WV0A 1AJEA 1O87A 4WSOA 2UXDB 3F1LA 5BT9A 5CBPB 5D3MB 1U3UA 3O7MA 4EJFA 5BSKA 4QG3A 2QR5A 5MGBA 3K9WA 1KR5A 1VHTA 2HRZA 2JCVA 4V0NA 4X63A 3E9ZA 1QCZA 4DB2A 2PJDA 3FVVA 1ESZA 2F55A 3VH4A 1BEUB 5F5NA 2R97A 4CIDA 5IVKA 3W5BA 2ZJ3A 2ZDQA 4JR1A 4RL6A 3SY8A 5DT9A 2O50A 4KXLA 1ONSA 3BMQB 3TH5A 4HNRA 2A78A 3C6ZA 1IBSA 1GZHB 2C2BA 4FQ8A 4C04A 1OV4A 2ZIUB 2BFPA 1T1RA 4HY3A 1PEAA 3K0EA 2HJRA 4XA8A 1E94E 2WAMA 3PJEA 1O54A 3HV0A 3OWOA 4D3XA 2YCLA 4GQIA 3RT1A 4OHOA 4FQ5A 4KDFA 4UHFA 3ZHRA 4EX6A 4Y98A 5GONB 4YRQA 1JPUA 1QAMA 1RZUA 2GBPA 5AYVA 3BGWA 4BWYA 3F7OA 3H5WA 2XT0A 2C2YA 2IHZA 2YC2C 4PFJA 1XAHA 2ZYUX 4NARA 5K4AA 2JH9A 4FX5A 5F51A 1CUVA 4IXMA 1KBZA 2QM0A 2VZEA 3A1EA 1JLSA 2AN4A 1TGYA 2FMIA 3CR7A 3SFTA 1C0IA 3KPWA 1RNLA 2FPUA 1ADGA 2C88A 1RQLA 1YOVA 4MPDA 1ZICA 1R00A 1V96A 2PSEA 3CINA 1LTHR 1SXGA 2RHLA 4CM3A 1GPUA 3ZDQA 3HI4A 5ALOA 5CFQA 2D1SA 4JKYA 4E6EA 1PVOA 4LXQA 3O0DA 1G20E 4IO0A 2G80A 3BMOA 1UT5A 2FV8A 5DNCA 2HX1A 2GPSA 3TNJA 4AW9A 2I71A 3FOWA 4IDPA 1J23A 3T5BA 4X7MA 3ORYA 1Z7YA 3G8YA 2HTFA 3Q85A 1KU0A 2D0DA 4YECA 3UVEA 1NF3A 2CXNA 5FX2A 4U4AA 2GCOB 2V5VA 4DRYA 5CJPA 5SZKB 5C53B 4DIKA 4I4LA 3VDQA 2P65A 3GLKA 1YBHA 2EHJA 3FZNA 1UBNA 2DQKA 4QIHA 1I1QB 1AA9A 3L06A 2SNIE 3H2KA 1GDHA 2BI4A 4RA9A 4ASUA 1XA3A 2V4ZA 4ZARA 5EE9A 5ARDA 3OOJA 4BMXA 4LVUA 3K9HA 4BGDA 4EPWA 1L8QA 3AOGA 1I2CA 3KZCA 4PAGA 1DBQA 1Z5NA 4RDCA 3RAPR 4ZOAA 1DTEA 1HLGA 2COKA 5A3RA 1CR2A 3JPWA 3FAKA 1D1PA 4WUTA 2VJMA 3WYAA 2I80A 4TTSA 1TYAE 2QNBA 2ARKA 3KHUA 3QEAZ 4WY5A 5E6UB 1QTQA 3BZUA 2X76A 3CB4A 4I50A 4GM0A 3QBJA 3GL9A 5CCXA 2VZ8A 2RH5A 4EP1A 1NT2A 4FINA 2ADFA 4Q37A 1Q77A 2F2TA 2PS3A 5A5EA 3I5AA 2PUBA 3HJFA 1N2GA 4MTCA 3H4MA 2VPIA 5HGXA 4CI0B 3QKSB 3UV6A 1A27A 4ND1A 1E89A 1HT3A 4CV0A 2Q1SA 2FKAA 4LDPA 1K89A 2A0YA 1MO3A 4RMNA 521PA 1HDGO 4IJUA 4ZEWA 2OEPA 1DX9A 1V48A 3L04A 1MVLA 3H0KA 3OO1A 4GF5A 3D4OA 3KB6A 3IDQA 5BV1A 3W5VA 4BXOB 5TGTA 3WGKA 1LLFA 3REGA 1Y6RA 2JEYA 3EUEA 3ZQ6A 2EP5A 1FLDA 1YZFA 3C6MA 4M0EA 5F5XA 4M7RA 2H17A 1G2PA 1T4MA 2OOSA 1VLMA 2Y1EA 1L5KA 1EP1B 5GM1A 3W9SA 4YAUA 3CN7A 1V26A 1EB9A 3JAWA 5H02A 3RJMA 3ZGVA 2OHJA 2ZBEA 4KG7A 4Z4EA 4RS3A 1Z88A 2VP0A 1Z7GA 2MJLA 1IY2A 1DQSA 2J6CA 4FGLA 3JQFC 3QVLA 2WYIA 3PDIA 4GC9A 4AU1A 2HRDA 1AH2A 1XZ8A 1WZNA 2I6SA 4LDQA 1OLXB 1H8HD 2OCXA 4XW2A 3KQKA 2HA4A 3PFBA 2FZ5A 1PGPA 2CEKA 1OU0A 2XDQA 5DISB 3ZIDA 4EHBA 5CFRA 4JJZA 1EZ1A 4D57A 1AE1A 1MW8X 3UFBA 2ZRGA 1X0XA 2UYGA 3CIFA 5E1DA 2HJSA 2NQTA 1OZ0A 3B1ZA 1DX4A 1IY8A 2NZXA 3MA0A 4GMDA 4GVLA 3EZGA 1J0AA 2QSZA 4QOEA 3RE1A 2BGNA 3CEJA 3H83A 3SP1A 4BO0A 1W5SA 4JU9A 1IPEA 2E4AA 4CQNA 3AC0A 4R31A 1TO6A 2C4VA 4KX5A 3PQ7A 5JJIA 1KBOA 1LPNA 3NAZA 5BSMA 4Z6KA 1NYQA 3CUSA 4F04A 1QLJA 2FLVA 4LE0A 4UDXX 4V3CA 4JI2B 4M54A 5SZHB 2FYTA 3EGDB 1AURA 4B71A 1KDRA 2AJBA 5J63A 3BD9A 3WO0A 4CNQA 1PHPA 4BJ1A 4CUZA 4MA0A 4B8YA 4DC1A 1NXQA 2CVQA 3HXOA 5ICEA 3FCCA 3GO4A 3BXFA 3PC6A 1KKLA 1Z8HA 3B1KA 4FHEA 2IPNA 3H13A 3IAXA 2E5WA 1P4SA 3LO8A 4ZQBA 4EPRA 3NEPX 3HBJA 2ZTMA 3UJ7A 2X5OA 1MFZA 2IIPA 4P22A 4RADA 5ER9A 2JH8A 3QKWA 2WPDA 3BKWA 3CZPA 1RC0A 2BZSA 3IR7A 4G86A 1E6EA 1DBPA 2I34A 3MJSA 3MUOA 1X19A 2GR9A 4LCEA 2C4WA 1W4BA 1N5IA 2ZVPX 4PICA 3AKZA 4M76B 3AVVA 3H1PA 4DR4B 4LOHA 1ZSNA 2XNSA 2HI0A 3QTBA 1ETHA 4XDGA 2NV2B 4W8HA 2FJ0A 5TT1A 2Z5VA 1PJLA 1RHRA 3FOAA 3Q8LA 1TIKA 2QV0A 4YPOA 3FNHA 2QN7A 3OAAD 3QEKA 5JCJD 2VOJA 2XGSA 4EEKA 4ARCA 3P4XA 3CWQA 3SR3A 4MIEA 2COUA 5E4YA 5DXAA 1OXMA 1N5MA 3MC1A 1ZXLA 1V5FA 2Z2YA 4HH0A 4K8OA 3WMWA 3DOFA 4K0RA 5IM4A 1KS9A 4NOJA 3HO8A 2PV7A 1G6Q1 1UAAA 1Y7LA 1SVOA 5E1MA 2A5FA 1WJGA 2O6HA 4TMXA 1SIUA 1WKBA 1OGYA 4FLMA 5B4UA 4EM6A 1MX1A 3QEMB 1VMKA 3NHKA 5JIBA 2FF5A 1IZ8A 3QLUA 4KR7A 5BWBA 2UKDA 2VH5R 5CT9A 3G7NA 3KAJA 4JYPA 3NBYC 3CCFA 1USVA 2KW5A 1T0PA 1V5WA 2PGIA 2VRCD 4PZEA 5AJVB 4B09A 2Z8YA 3FZEA 4H0CA 1RTTA 1ORIA 2GSWA 1CZNA 3QMPA 4U3JA 4I3HA 3D4NA 1TK9A 1J1ZA 1E18A 3DE0X 3DVLA 4ZXPA 3T0FA 1IBLB 1B6TA 4DVGA 5TMDA 4ZP1A 1UMCB 2WJAA 4RTJA 2NTNA 4XRGA 2OSBA 1V1JA 2WZQA 5L3VA 2D5AA 5FOSA 3RVLA 1DC8A 2RKOA 1ISIA 4RVUA 4F2GA 5DI3B 4LRYA 4IG4A 1MO5A 1YR8A 2IZ6A 1D6JA 4NK5A 3W06A 2PANA 4JR0A 3L9XA 1NVAA 1DT3A 5JMPA 4LQLA 4R5MA 1S4MA 2RAUA 4WAUA 3VNAA 3CBQA 1I2BA 4QGGA 1YZQA 3IBYA 3NVAA 2DUWA 3HR7A 5HF6A 1PNTA 1QH8B 3LX4A 3I30X 3ZHCA 1XZMA 2XGJA 1U9IA 5EZYF 1N1MA 3ZHYA 2YYAA 3JZAA 3QXJA 1IK4A 1NYLA 1HQKA 4WZAA 3AVTA 1CUGA 5BUQA 3PR1A 1SUIA 2GTHA 2I4RA 1N0UA 1XG5A 3OCJA 4QEDA 1XX6A 5EYPA 4I6EA 1S89A 1J8VA 1ZM3A 4B31A 4MQEA 5ITZB 4NAVA 1DEOA 4QJBA 3R9XB 3HU2A 1FNSA 2I4MA 4B85A 1SKUA 1UK9A 1X9HA 4MV4A 1K9VF 1I94B 3CZMA 3F5QA 3D8RA 4UFPA 5BMVA 4G36A 4ENUA 1TL7C 5DM2A 1B3RA 2OXFA 5D3KA 1Q7EA 2JGKA 4XLTA 2Q5FA 4NPHA 2BEUB 5I45A 2BFDB 3N2YA 1XTUA 3PCTA 2GH1A 2P0AA 3GAZA 1M1YE 4PYIA 3T7TA 2PJZA 2Y4OA 1EE9A 3KJIA 3W8EA 1ZXBA 2JIZA 5CDTA 4QO7A 2PQ2A 4B6OA 2FHSA 3RRMA 4XJTA 2ZRKA 4F56A 1Q3KA 2HTEA 3WMRA 3MGCA 1HXHA 4F1WA 2PEYA 4GOXA 1C0LA 1I33A 2IW1A 3ESXA 4PX3A 2JGNA 4MWZA 4RLSA 5ETJA 4JXXA 4QWMA 1N34B 4CQLB 3FAZA 5EQJB 1Z5ZA 2G25A 3QJYA 4N7BA 5HOQA 2IY7A 1KFBB 1IUPA 4J0IA 4O8ZA 4XM2A 5HBGA 2AW5A 4CKYA 4MRPA 3TQOA 2XF8A 3LHIA 3Q4GA 1PJAA 4B6SA 4LPKA 3VPBA 1M8FA 4AO7A 4GGMX 2KYRA 3DEAA 2Y92A 1RRCA 1FB5A 4HWGA 2WJPA 5ESXA 3IAEA 5B3JA 5GAJA 1QRUA 3DBOB 3A26A 3PFGA 1R0SA 4H7JA 3SC3A 1NATA 3I62A 2OBXA 1R12A 3PYMA 4EGFA 2WWRA 1KSHA 5HUJA 2QB5A 3IV6A 3EVCA 3V97A 3EF3A 2Z0MA 2Q7XA 5FV7A 1G20B 1PF7E 2EW2A 3GR6A 2H29A 1DAKA 1NVEA 5TQVA 1YK1A 4CDMA 4FE3A 3FG9A 1OXBB 3CUEF 3QVWA 1R6XA 4L15A 1GTVA 4G1UC 1MEJA 1YF3A 1M72A 4GYJA 3DG9A 3RASA 2AYXA 2R7LA 2C59A 1JQKA 2EF1A 4MDFA 4PZCA 1V1MA 1UBKS 2Z4SA 3KIPA 4RX1A 3VR0A 4CW7A 4XWOA 1AC5A 1V0JA 4G5RA 1PJ3A 1EEHA 1T1GA 1G3RA 4JSYA 4QRDA 5JBIA 2WQ6A 1CUIA 2QYOA 1Y4DE 1ZNQO 2PBRA 4YO8A 5TVKA 1U7OA 5L7TA 2AA3A 3PEVA 2NAFA 4WWHA 5IPFA 5GWXA 1CS0B 1LF5A 4CT5A 3T7RA 2DBRA 4YXFA 4YWJA 1YQTA 3GZNB 1JAIA 5EZQA 3L6CA 1BRTA 4S1WA 4XIYA 2ZTVA 4MGHA 4F21A 2CXHA 5A4FS 1N8KA 4WJKB 1QGDA 2PUWA 5K9ZA 3OHPA 1VPWA 2AR0A 4BVGA 2AOXA 1WXFA 2BDTA 3C7AA 4LV8B 2PNFA 3E2MA 3WBJA 1JLHA 2DR2A 3HVJA 3TQHA 2C1ZA 2X0JA 4GDMA 4O4JB 4AYXA 1JJVA 2Z8YM 2YIMA 5ALWA 4YUYA 2H1CA 1C8LA 3GVIA 5DHQA 2E89A 2X1HA 1BQ3A 4FW8A 4HP8A 4IRUB 4JBWA 2HFJA 1FP6A 2OCIA 2OCKA 1X3LA 3E9YA 3WJ2A 4POOA 4KQHA 4MRRA 2CE7A 2ZXUA 1X1BA 3DM5A 3QJ5A 4OI0A 1H1TA 3LGAA 5H16A 1D1TA 1CUWA 1P2VA 3EFOA 1F3OA 2ZIVB 4YJ3B 1YFLA 4OQMA 5BVHA 4ESEA 1MEOA 2A84A 2CHUA 4BTLA 3W6PA 3G5LA 4I1RA 1TTHA 1EA7A 2ZWVA 2G4LA 2ZSJA 3FPBA 4ZJZA 5AW7A 4Q24A 5DKFA 1FF9A 5DYGA 3RIXA 5AVTA 3Q3HA 3OFSA 4IOKA 4X84A 3ZKWB 4MKXA 3DD1A 4B3JA 5KTMA 2OWEA 2IU3A 1WQ1R 2XUGA 2QMEA 3EFEA 5A6SA 4WACA 1V3QE 2BEVB 2F8LA 1E0JA 1UXKA 2IODA 2Q1YA 3LLUA 4HUJA 4O8CA 2VPTA 3ILVA 2H59A 3Q8XB 1JEYA 4JLAA 3LCMA 3FLBA 3ITEA 3NHZA 4L8YA 3M82A 3LJKA 2NO1A 3RIYA 2QBYA 2BM9A 3U61B 1W0CA 2YBEA 2GYVA 1T13A 3K0HA 4MW4A 2R25B 4NE2A 3F73A 4QD3A 5FWXB 1CEQA 1CRZA 1KU6A 1PVVA 2G76A 3H16A 3UT5A 3VBEA 2PRKA 2CN1A 1PBNA 4R1UA 5AKXA 1TFRA 2QXUA 2IYXA 4DZZA 4CTMA 1WVGA 4ND4A 4XUEA 1T6BY 3JCZA 1F8GA 4YMWA 2JIDA 3R44A 2OC9A 3ZCUA 5LQMA 4POAA 3ENQA 3IAAA 5DOZA 5GADl 1RLOA 2QPAA 3N2ZB 1ZD2P 2O8DB 1Q12A 4B5KA 4LCJA 1UBMS 2DFVA 2J3QA 2BH9A 4RDXA 3VKUA 1YR7A 4HDRB 2FXIA 3V4PB 3WXBA 3NYIA 1KPHA 1XQWA 2HKIA 2JCBA 2FTKE 1ZIOA 2P1RA 2F17A 4OP3A 4P3XA 1CDEA 3AH8A 3KOXA 3MMNA 2GOYA 3F3KA 5HJEA 4Z4IA 1YFZA 1E1YA 2D1TA 3G8DA 1XMSA 1EVYA 4ZDKA 3KAPA 1WY5A 5AJXA 2QN6A 2PKQO 4BNYA 1I2ZA 3GEIA 2A9JA 1DUIA 3U62A 3HNOA 4IIBA 1KMHA 3AU9A 4DA7A 3PEWA 1RM3A 1U0NA 3X1JA 5G53C 1SWVA 1F51E 2XH8A 2C2WA 2XMRA 2D7CA 2WKWA 3BX1A 3E3LA 4IIXA 4IUBS 4X95A 4CMEC 3KU1A 1ORTA 3EK2A 3K9LA 1D3AA 1GNRA 1RI1A 1U04A 4FSHA 3BIXA 1Q0RA 2QTGA 4YQYA 3FPKA 1PU2A 4RH1A 1JFFB 2FFBA 4G4JA 1P31A 2R8PA 5L53A 5LZ7A 1HR0B 4RKFA 3HB9A 3A4NA 3KEOA 3GPBA 4JC4A 4PZLA 3DMGA 1JQAA 2V97A 4J49A 4OQYA 2JFBA 2Q1WA 3EGCA 1PV2A 4EPVA 4F2HA 5D85A 2F1OA 1Y4ZA 3H3FA 5DV9A 1A8IA 4HAZA 3A1TA 4BECA 3ZVMA 1Y1RA 2WUEA 3DV0A 4NYIQ 1GCIA 5KVAA 1Y33E 5FORA 3DSRA 2ZM5A 4D3DA 3S8EA 5HIMA 2C7PA 3DUFB 4HEHA 2Q21A 2PJRA 1HLPA 1VG0B 3MLBA 3L84A 4Z0NA 3D7MA 2VDLB 3RROA 3EGOA 4REQA 1QGUB 3QP9A 5DP2A 1R10A 2WDZA 2BGJA 1KPGA 3A3KA 3TEMA 2YICA 4G5YA 3TLGB 5M34A 2XX3A 4ZT2A 5DK4A 4PPFA 4DTCA 4NRDA 4NV3A 2OV2A 3TIFA 2WJVA 2WAXA 4WJLA 4OLJA 3NDIA 2FSUA 4ZT4A 3ZLBA 3AM3A 2RHOA 4AYWA 1SR8A 1BSVA 1P7VA 2CYAA 3KFXA 4JLVA 5AUNB 2RGAA 4P0QB 4XD7A 3CX6A 3GWGA 4I1UA 3QXCA 5AM3A 3IDOA 4URFA 3WYEA 3K09A 1E9VA 1YQGA 1Y6QA 2A35A 1GSIA 1H66A 3CF4G 3LHKA 4YY3B 2FR8C 2W43A 4R2IA 1IDOA 2AHOA 2V7EA 3TSOA 1ECPA 4FHZA 3VR5H 5KOHB 4F12A 1KFJB 2IGTA 5E7JA 1SY7A 1T2DA 1FUUA 3KT3A 2ORED 4Q1CA 4GOLD 4CTKA 4KMMA 4TSFD 1X38A 4W9NC 2PY6A 5BPHA 2YY6A 1JHYA 1Z26A 3BJEA 3VO1A 4YRIA 1SMKA 3B2NA 3HRKA 3C15C 3FRHA 3L8HA 3IP7A 4Z3DA 2NUAB 4BO8A 2D2IA 3K1YA 4DQUA 1ZH2A 2IF2A 1OW3B 1CWUA 4IQGA 2NQ8A 2AT1A 1A5AB 1XHEA 1SPXA 4MDEA 1P9WA 1SCBA 1YVUA 5ALUA 4FFVA 1LD3A 2RHHA 4N3AA 2VRCA 3M5DA 1DBSA 1S1MA 4HDSB 5A3SA 3L8DA 3UUFA 3RSQA 2F9FA 1U02A 4EY6A 1KO5A 5TS2A 3GH1A 1YL5A 4I0WB 1DIRA 4E70A 1EVZA 3FETA 2Z43A 3HC7A 4YT5A 4XUDA 2OG1A 4CBVA 1GL6A 3AR5A 3V34A 1A1VA 4P0TA 3IEVA 4C43A 1AM4D 4D5EA 4EG0A 2ZSKA 3IUQA 2GGSA 1QCDA 3P7MA 3C8DA 4E21A 2J9ZB 3QOXA 1SB9A 2B8EA 3AT1A 3FPLA 1P17A 4MUNA 4RVHA 4XTCS 5CM8B 2WF9A 2NQ2C 2Q8NA 2ZVDA 3DFKA 1NX6A 3BAZA 3C0KA 4MV0A 5CURA 5DB4A 2IHKA 5JAOA 5CEEA 3ORFA 1JQEA 2DR0A 3W6UA 4Q05A 1JHQA 5GJBA 1RMQA 1ZOOA 1G64A 3DDHA 2YKGA 1ZA2A 3DAHA 4GL2A 3MCWA 1KAQA 4XVRA 2QPTA 1M1YB 1PZGA 3KZVA 1Y1QA 2ECPA 2JHGA 4MO9A 4MUHA 5JC1A 1MO2A 3A9CA 4MS1A 5JASA 3SJZA 1D5CA 2BKXA 2WSLA 2FK7A 3A4TA 3KR9A 3N05A 1YTUA 4YREA 3I2HA 2X42A 3IJPA 4MYCA 5DBFA 1GUBA 3I9KA 2LP4Y 4EFNA 1R6UA 3UANA 5JI3E 2BZGA 2WKPA 3DPSA 1KAGA 3QEOA 3OQJA 4QAJA 1O9GA 3VR4H 4CLOA 3AUUA 1Z0JA 1U1EA 2IPXA 3EUAA 2BELA 2VOEA 4OH7A 3S40A 2PQ6A 3PGXA 4B82A 3QFFA 3A6FA 3CNQS 2XE6A 3ZE8A 3DD5A 4CM4B 3SE0A 2GERA 2OFWA 3MTEA 1QRDA 5AD1A 2WYHA 1GAJA 2H5EA 3ENNA 2QLMA 1DJMA 1P0CA 3COYA 2CUKA 1A8UA 2NVUB 2BJHA 3EAFA 4BNJA 1V71A 2XHZA 1PG5A 2XYRA 2P2SA 1HFEL 3IMFA 1E1DA 4GVPA 1XQ6A 2NP6A 5IK2A 3MWYW 2E55A 5EXXA 4DNOA 2NUBA 4YN3A 4FYIA 4C0XA 1CCWA 1WLYA 3CXRA 5BW4A 4HNAB 1BZYA 3DBRA 2F64A 2ZR7A 5AJHA 3ECAA 4RANA 3TJRA 4OM7A 1T8WA 1KA9H 1G5PA 1Y98A 1HMYA 1I7PA 2PEZA 4EHHA 1N0HA 3O92A 4Z7QB 3IL2A 4FFNA 3BICA 3CVXA 4Y2UA 1VDZA 1PN3A 5DNDA 3Q7QA 3EPKA 1G3UA 4N9WA 2ZJ8A 2OE2A 3DE2X 2IDJA 4DJDC 3GCDA 3CV3A 2IUUA 4TVBA 2OBFA 2P9QA 5JEEA 4FUTA 2PS0A 5EA2A 2OGSA 3ZWDA 3FJOA 5C80A 1GG8A 1P1BA 1IJFA 1OXSC 3BH6A 1QIKA 2J0VA 3VSAA 4D9NA 1CDDA 1FP4A 2IIBA 3T3HA 3FSRA 1A8PA 3A6LA 1Z4LA 4I7EA 4UEKA 3SYNA 3H5VA 5A3JA 1EFKA 1IY0A 3NHMA 1KY2A 2NX2A 2PO5A 3A4VA 4CCAA 5HZHA 1L7RA 1EGHA 1BHSA 1T34A 1VLLA 1QUEA 2HUNA 2JFFA 4YPFA 3R3WA 2GAJA 1GUAA 4KO4S 1MXHA 2A6PA 1SOVA 2BJVA 3V8NA 4F4JA 3T1HB 2ZROA 4E2FA 2WG0A 1PR1A 4A0HA 4EHFA 4UPEA 5CT5A 1H1DA 3VISA 2RGBA 4UFNA 4V0ME 2P27A 2VP5A 2H5JA 3FB1A 2ECOA 3UMYA 1S2GA 1JG1A 3LK6A 4Q4LA 4LYEA 3VO2A 1YA4A 3JAMA 2HB6A 1Y3DE 3H8SA 4TL9A 3RBAA 3EHEA 3GBSA 2R48A 3RG2A 3VQTA 4EKIA 3L1KA 4M55A 4QJIA 2CXQA 5KS2A 3VA7A 1T3GA 1EE2A 3HL0A 1UMCA 3U1BA 3EZ6A 1UM9B 4MULA 4PSUA 3SZOA 4QTYA 4WK4B 4YFVA 4JC0A 2XEXA 1ZW6A 1HDIA 1W5BA 5I7RA 2EJCA 2SECE 3OE7A 2Z9DA 2WD7A 4EFLA 2MSWA 1B8UA 3LQQA 3NOOA 1KDYA 4LK3A 5G40A 5HPYB 5K2MA 3R3ZA 3OQBA 4NZYA 5FLXA 1EHYA 1GPBA 1MVOA 2VSOA 5JJBA 1NUUA 1SGWA 4JODA 4KMOA 4IVPA 4YV0A 2HA5A 4JJGA 4PNZA 3SQMA 1NR5A 2CK3D 1J70A 3SKXA 5EUMA 4V0OA 5C1IA 3FDXA 4MUFA 3J7AC 1YQUA 5LM3A 1TE2A 3BL6A 1KYIA 3OOYA 2MTBA 4IIDA 4K5QA 3TL6A 2C61A 3ORHA 3IQIX 3MRTA 3RRZA 4K9LA 3PQDA 1DCKA 2VK4A 4WHMA 2JJ1D 5FOVA 4XVCA 5AICA 2QY6A 3OPVA 4F7DA 1L1EA 1RYYA 3DMFA 1VGVA 2YINC 4OXXA 3PJGA 4YP9A 3ZU5A 5BN1A 4BB6A 1YJ8A 3SZUA 3FPCA 3FCYA 5B7NA 1DARA 2P2DA 3ID6C 1RWVA 4KEAA 4TMWA 5IP5A 1X15A 1DAPA 2PX3A 1DELA 1QK4A 3FLAA 3C8UA 4MWEA 1IEQA 3A3NA 1A9OA 1FSZA 2YJGA 1SOAA 2B3DA 5ALKA 2BEUA 1DKMA 1JG6A 2REBA 1VLJA 4I5GA 5HCIA 3EPLA 3C3JA 2YJTD 3BZBA 2VC2B 1Q57A 3BMXA 3AB8A 3ZHUA 3CH5A 4J43A 3CF2A 4ARBA 2KPOA 3NANA 4LVCA 3A6KA 3CF4A 2F43B 3GRPA 1QKIA 3IBTA 3RC1A 3NZEA 1ZD8A 5IVIA 2QN8A 1VZ2A 2PDAA 1YZVA 621PA 2IDMA 4O25A 1NONA 2J5XA 4MWCA 1X7ZA 3H8JA 1XQYA 3FN4A 1PEYA 3N2GB 5EFZA 3PEEA 4LN1A 2YJNA 4LHEA 1RRKA 1E0KA 1ZLXA 2FEMA 4NR0A 4JDUA 5FNVF 2JLYA 3Q5GA 3GEPA 4WXYB 4B80A 1YQXA 2HMWA 4FIDA 4HUQB 2VHEA 5IEBA 3RS2A 1IK6A 3WRVA 2FDCA 1W49A 1E4OA 2XWJI 1D1QA 4XCQA 1WSDA 4G5HA 5BV2P 3VR6H 1HEUA 3SX2A 4MQ6A 1YS2X 3OI7A 1P39A 4UZSA 5JHHB 4TV8B 5BQ3A 1SC3A 2VQEB 3DHVA 4Q7JB 3THOA 5C5EA 2PYZA 2R6CA 4QRIA 3M9XA 3F96A 3SXPA 4P7JA 4XD2A 3U40A 5LOVF 1ML4A 3WQQA 1DV2A 4HWTA 4JUFA 2IOQA 3FYUC 3URKA 4A23A 2AUMA 3LYHA 1IUOA 4RH0A 3M6MD 2EL7A 2I2WA 2PYIA 3CZ4A 3ER9A 3N8NA 3QXXA 3WKEA 1B42A 5J47A 1NVVR 3LRTA 1TCCA 2ZE5A 3SKYA 4LJYA 3VGPA 4LHZA 2C96A 5IDXA 3D6TB 2JLWA 4RD3A 5DSZA 1X8LA 4D9FA 2IP1A 4UM9B 2DLCX 5HW0A 4ITVA 1LTQA 4JA2A 4ID3A 2C5SA 3CT6A 1I6KA 3ZK7A 4US2R 4TX1A 3OM8A 4TLCA 3ECSA 2EZ8A 1PNOA 3MBIA 3N6RA 3RIGA 3OM0A 3ZNPA 1HSOA 1UXJA 4TZ0A 2G40A 5KAMA 3AVYA 4LNHA 3L18A 4EYQA 1PKEA 2GXQA 4UOZA 4PIVA 3GYBA 4KC0A 1V8OA 1CS0A 3K96A 3PE4A 4U9IS 4UD6A 2W42A 4B8ZA 5J3JA 3OZCA 3GZNA 3UK6A 4BQPA 1PDOA 3CTMA 3ZBTA 1V8PA 1YHYA 3LFHA 2I99A 5P8WA 2CXXA 5F33A 1UC9A 2X2FA 1LSOA 1E4EA 4TQ9A 1Y7TA 4ZKEA 4FS3A 3GJ0A 4ZC1A 4M83A 5EEHA 1OLSB 1VL8A 2MINB 3JTMA 4RW0A 3HB5X 3W79A 2QZPA 4UBIA 1NA5A 4V02A 4V2UA 5T8KC 4PHTA 5LLDA 1QHYA 4O4JA 3U9TA 4A3SA 3GG9A 3HJBA 3M6VA 1OREA 3D5TA 1BCSA 3UG7A 3ADCA 1BU8A 2ZBPA 1FVOA 1MT3A 1QKKA 3RVQA 1V7QA 3UHAA 4MRSA 1KO4A 4B2YA 1I7SB 3LSYA 2QVYX 2W2LD 1UBUS 2H0QA 1R9NA 3LWZA 4FBLA 2IU6A 4ZJPA 1Z5PA 1Z0KA 5JSKA 2B3TA 1YDMA 2VP2A 1DC3A 1E61A 3W3AD 3OOSA 1KOLA 3L3BA 1SVWA 2CNWD 3B9PA 3LA8A 5D6NA 2F00A 4YRFA 3ZKWA 1J00A 4KRFA 1XJQA 2GNPA 2VPPA 4ZVMA 1LY1A 2W6ID 3MJHA 3BQ9A 3CNLA 5BOVA 3EZ2A 1VJ1A 2O23A 3STVA 1YASA 4AS3A 4YMVA 2YZKA 3NBMA 2C58A 3HA7A 1HZJA 1N5JA 2O2YA 2CWDA 3B6EA 2YVUA 4R3WA 3S2EA 3U7IA 5A5GA 1TA0A 3TW6A 1VLQA 1XE3A 1BWSA 2O1SA 4X20B 2QENA 7AT1A 4G25A 2FZVA 1HE5A 3DMHA 3DLAA 4HF7A 4I4TF 3SC6A 3LYAA 4PV7A 5B64A 4BVEA 1U6KA 1WG8A 3PICA 1ISMA 2X7JA 5GINE 3WB9A 3RUHA 1SHZA 3A36A 3TMYA 5ILOA 3KXPA 1VL0A 2P3LA 1TM4E 4EI8A 4MINA 2Q0QA 4MJ3A 2NZUG 1M0EA 2PLRA 1P2SA 1YIDA 3H9JA 1H4TA 5IT5A 2P35A 5EFOA 1KHHA 3PQ2A 1GGKA 3HACA 3LY9A 1OWOA 1CB0A 1ZOLA 4G5XA 4AJOA 2O5VA 1WSWA 5E7MA 2GD2A 1VPEA 1FFXB 4AZVA 2II6A 4YRSA 2A3RA 3WZLA 1M34A 1A98A 1T9KA 4LNUB 4RPIA 5EGSA 3ZLTA 2DWQA 4WKCA 3S6JA 3U13A 8LDHA 5TPWB 3QELA 1YI1A 2H4WA 3ENZA 1JPVA 2XTNA 1Z83A 3R23A 1ZJZA 4DLLA 1F14A 4RZXA 4I46A 1U11A 1D7AA 5JG7A 5K8JB 2HDNB 3BGOS 3EXIA 3D3JA 3SPXA 4ZEOA 4IQFA 1ZVKA 2YXBA 1UMBA 3DCNA 4M7OA 1H5NA 4RY9A 5KTSA 2QP4A 5JTUA 1A9RA 1PJSA 4DWJA 2OO5A 1A9XB 2ODQA 1UPCA 4HAIA 1CFZA 1EVKA 1YDGA 4UMFA 4DLWA 1TUEA 1V4NA 5IX8A 3AIKA 2Z1NA 4YAJA 3X1YA 4EABA 3L82B 3ZW8A 2BCJQ 4IDAA 4NS1A 3ZK8A 5C3MA 4KQJA 3SXUB 2C20A 4QL3A 3WL6A 5KC9A 4ESHA 2VCYA 5ENZA 2FZGA 1T3LA 5CVUA 5LFAA 1UCFA 1OR8A 1M9NA 3BEDA 4YMHA 2WTEA 3KKOA 3L7DA 3JSAA 3AM4A 1CR0A 1OAOA 3B38A 3IODA 3R5XA 4YBRA 1N8SA 3ZHXA 3TSAA 3GHYA 1MGOA 1LKZA 3CUTA 3IOEA 1KJYA 3CJRA 3IP3A 5FA8A 5AVJA 1ULHA 5TEVA 4BO3A 1ZP6A 3ILSA 5JD6A 3ZGZA 2ZUBA 1NXTA 3EW9A 5JW6A 3EVGA 3SHTA 1B16A 3PI6A 1WCIB 4RMGA 4G1EB 4IGFA 4GI2A 4IS3A 3TLGA 3VC7A 4NULA 3V6MA 4C1BA 1F0NA 3GGCA 1P62B 1NBIA 2GEFA 3KQPA 4B44A 4BGIA 3AG5A 4DADA 5DCYA 1JGTA 1FYDA 3HS3A 3U5TA 4XPIA 2VS1A 2FK8A 3NYQA 1WUJS 5AUPB 5EJIA 2AMFA 4HB4A 1NGSA 5GVSA 4GLOA 4FI3F 3E7PA 5FUVA 5HSGA 2X1VA 5KOHA 4NCKA 3PV0A 3U3ZA 2I33A 2H4HA 1DPGA 1SZJG 4RENA 2IUSA 4TTIA 1Q0LA 5GMOA 2B36A 3EAQA 2VBFA 4K88A 5DRYA 2V45A 3CEAA 2AIRA 1XT6A 2QXYA 4RVDA 2H48A 3RVRA 3SZMA 2R5NA 3U7JA 1OLUB 4G5GA 3B5IA 3T3GA 3ZD9A 1PIWA 3F5SA 2EQ5A 4ZCPA 3IP5A 4LC1A 5IN4A 5KJCA 4HNSA 4HWSA 3S81A 2AEJA 4DLZA 4IOMA 2JCYA 1YB6A 2Q3CA 2LNDA 2OV3A 3CE6A 1OB2A 1KOGA 2BM1A 3RTCA 5JDIA 4BVBA 4EY8A 5F2KA 1VE6A 5I4IA 1W76A 5FHQA 3TIVA 1G7TA 3CPHA 2GZ1A 4FZ3A 1THMA 4HDSA 2IIVA 2RH8A 2UYQA 4K6GA 5FI5A 3PIDA 3RHZA 5JROA 3WDSA 1QIJA 4I14A 1N6KA 4JI4B 5CCDA 3TNYA 2IYWA 1TLFA 2J9FB 1QKJA 1HL7A 3L6UA 1T15A 2CHGA 4JVSB 1QH1B 5HZGA 3ZD6A 1FW8A 2WF8A 3F6YA 3A9UA 1P9OA 2ON6A 2QTTA 1IHPA 4DQLA 4GXNA 5BUCA 4IHJF 1M0SA 1W0JD 3WGGA 2ZXEA 3HQ4O 2ZTHA 3ZOZA 3RS5A 4IIYA 5F23A 2ZUSA 3H5TA 4YR9A 4JSTA 1V7PC 3N58A 2VBCA 4L5IA 3IUJA 4F85A 2K2QB 5JS2A 2ZE7A 3HZHA 1M1YA 5ALIA 3VNBA 2PMDA 2CK3A 3H42B 4QBGB 4BC1A 4TVSA 3TL2A 4FGUA 5EZYA 3RYFA 5CFNA 1O0CA 4TVKA 3OE1A 4DEXA 3DMNA 1T1SA 3TM5A 4E5UA 2A9VA 1IUKA 5C7LO 5AVXA 3CZ9A 1PLKA 4QGHA 1PNVA 3X2FA 1X80A 1OWMA 3HWRA 5DW3A 4XUGB 5G1NA 1SOUA 1BH6A 1XD2A 4ADSG 1PWEA 3ENKA 4XIIA 4BLRA 1NVMB 1U0LA 3PYLA 2CDBA 5G3ZA 1KETA 1HY3A 1TC1A 4KP7A 2YV3A 3U44B 3FOFC 4D02A 1SURA 2XJ4A 1MDFA 3AL0C 1JHZA 3BSYA 2I1QA 3M1YA 4LYDA 1VBNA 2PZAA 5EIBC 1ZI8A 3INGA 3VYVA 5K0NA 5AP9A 1GQSA 5CH5A 5FI0B 1UJ6A 2HHAA 3UW1A 2G1KA 4DMGA 3FBWA 3QYJA 3I9NA 1V43A 3G9XA 4X44A 4Y6LA 5B37A 3A0RB 1E96A 5KTPA 3WAGA 3GWZA 4LW8A 2M98A 1MOSA 2V7QD 3GQVA 2GXAA 3T99A 1PAUA 3BCRA 2BFCA 4PRZA 1FSGA 2XYVA 3IEPA 4YAEA 4GH5A 5FJIA 4A92A 5EJ6A 4QOFA 2BR5A 4C2TA 2QI9C 3HDJA 5KJ1A 3ASVA 1RKXA 2BMJA 2EIXA 2CMGA 3CG0A 4CM5A 3L0IB 1W1UA 4HNAA 1BGXT 1N6RA 4MPRA 2NO6A 4WDQA 5H5JA 4NECA 3FNFA 1WWKA 1JDBC 3V4OA 3ANYB 2QRLA 3BTVA 2ZPUA 3I9V1 2H1IA 3S29A 2XB8A 5AKHA 3V4SA 3VOTA 4ZOEA 3V8VA 3GD7A 1WTAA 1QR6A 2MSCB 5KTNA 3ED1A 4A73A 4DR7B 1OBOA 2PMKA 1N3BA 3NUQA 3JQGA 4HL6A 2CJFA 3BCHA 4CG2A 5FBVB 4OPMA 1WDMA 2XKAA 1N25A 3C14C 3U31A 1Z63A 3HCOA 2Z3VA 1CZKA 4Y18A 1AGRA 5IJ0B 3PTLA 5CLLA 2UZIR 1W25A 3NNDA 5COBA 2VT7A 3KKZA 4OHKA 4B79A 1U1FA 2R00C 2RSLA 2DFKB 2BPOA 4LAFA 5IAGA 4C7BA 4D9MA 1BMTA 2PGXA 3HI6A 1U0HC 2DRIA 1XCPA 1YAHA 5HIJA 3WG9A 4OU4A 3L43A 4J4TA 4TGLA 1JW9B 3LZCA 3DDOA 3U7HB 3KTFA 3LXRA 2O7SA 4FHCA 1K08A 1WXWA 3LDGA 4UVIA 4MV8A 4JL8A 3EVDA 5JVDB 1NW3A 3A14A 4AURA 3HJTA 3TBKA 1QYCA 2HHHB 4DL9A 1LDNA 3KRTA 4MKFA 1SIOA 2RB4A 3H4VA 2IVZA 3AWIA 1ORRA 2R44A 3WNVA 1WO8A 2CBZA 5KJ6A 4EJMA 4FJ2A 4DVJA 3BOSA 2XB2A 3V32A 1S96A 3ZYCA 2YQZA 1AGPA 4UHDA 2DT5A 3W5CA 2D1YA 2GILA 3T38A 4FOTA 1T2AA 5CXSA 3UV7A 3CX3A 4EEXA 3UUEA 1BIFA 4G4IA 4UM5A 4W99A 2OGWA 3V00A 5C35A 5KINB 1B6RA 3STUA 5JCZA 5K0FA 5JQGF 3PXCX 3QIVA 3GDFA 1UOOA 2ZYRA 1LH0A 1FXWA 2DP4E 2W4IA 4GHWA 4OQFA 4EJ0A 2WSYB 3T9DA 2W2LA 3UB3A 3H0CA 1AO0A 3KOOA 4PIMA 4YBZA 5ALRA 5FFNA 5LA6B 5FF9A 4B7ZA 2OECA 4DCGA 2PX8A 1JQBA 5CPFA 3PC7A 1GQOA 5FFFA 4HX2A 1XRLA 1HURA 1NASA 5IJZA 1RHKA 2HY7A 2W2VA 3ZWAA 3B2QA 1L1FA 4DR1B 4CR8A 3B6KA 3OHMA 2W6IA 5DT2A 3FFBA 2VP9A 1KNXA 2FLWA 2FSFA 2PLAA 3LVBA 3R6GA 5K0LA 3IPLA 2EGUA 2ZSBA 3PTZA 1OH5A 2OSVA 4ZT7A 2PUGA 4IP0A 4QELA 2ANBA 2HR1A 3THYA 4FFRA 1WUYA 3RFCA 2CLKB 3ZU2A 3QENA 1ZMTA 2P6OA 2E0IA 1RVDA 1RVV1 3K9BA 4MAMA 3I9OA 4U63A 4Y3UA 4DNQA 3AUJB 1C7JA 2W6JD 2YDXA 1AUXA 3BD6A 5J58A 4ZQHA 2QT9A 3IO5A 4OHUA 3RVBA 3ZLVA 4MPTA 3SF8A 3A6ZA 2AXQA 1UXGA 1ULUA 4WKPA 5T64A 3V8MA 3M49A 1EJ6A 4RKEA 4CKXA 3JD4A 3EASA 3D3WB 3IUPA 3Q3JB 4P6VF 4L02A 3G0BA 5ALZA 2F43A 1FU8A 2ZBQA 3K5PA 3LHDA 1Y42X 4FIZA 1XEFA 3J80A 2VQSA 4HO1X 3O95A 4NBUA 1E3SA 5FTMA 1R6DA 2ZWAA 3D4LA 3BL5A 3ZCTA 1XDUA 4BO7A 4C0WA 5HHTA 3QH4A 4WKGA 3ZWOA 3BJZA 1AV7A 3CRW1 4RD1A 4BWVA 3GUHA 5LPNA 1LQTA 3VR6D 3LMKA 4HUQA 1QC5B 4OLBA 4K7JA 4ITRC 1A5BB 1KJNA 5E0OA 3L05A 3SNKA 1A71A 1ZN9A 3SHVA 3FRIA 1S2NA 5FPHA 1K7YA 1W1IA 1DTSA 5G0VA 2XB6A 3TG2A 5BW8A 2AQ8A 3FYUB 3WS7A 3X3HA 4C1NA 5JU6A 3ZQ4A 4CE6A 1CQJB 3TPCA 4XKJA 4P33A 4HX5A 5LZ4A 3IHWA 2O2XA 1CUDA 1E7MA 3G2KA 3LYLA 4P80A 1QLWA 4Y1EA 5DGCA 4R1QA 4UPDA 1W44A 2HMVA 3GLIA 3O2NA 5AQ1A 1DG3A 3G9TA 4M1WA 1OFUX 4U2CA 1LU9A 421PA 1XCJA 4ACAA 1R6AA 4LBYA 4ISBA 5AVRA 1VYHA 3I2JA 1PE0A 1ZOPA 4PPNA 5I9TA 1RIFA 1BE0A 1JBKA 2ISQA 4U02A 1RTKA 5BRNA 1MB0A 4W9RA 3X1ZA 4W63A 5TJHA 1Z0SA 4Z4CA 1MAHA 1T9GS 2XWQA 4U2BA 4WESA 2J4DA 3B89A 3UJDA 5EXPA 4BZXA 1XNHA 5DHAA 4BNMA 2BUCA 2GLTA 4JOCA 3ELWA 3G2HA 1OVGA 4ME6A 2QZZA 1C3LA 1Y3HA 4N5HX 1TZKA 2AN1A 3RRFA 1MAVA 2QD5A 3R24A 4XSGA 4IDDA 3HTXA 2PCLA 4WVFA 5EE3A 2HWYA 1D2HA 4EVSA 2GAAA 3T1YB 1F3LA 1UINA 3S68A 5AM5A 2OP0A 1KK2A 5AHWA 3F74A 3OWHA 1DQPA 2IXBA 2Z1MA 1K5GA 4R7TA 1GQYA 3VR5A 2JAQA 1XDSA 2AQKA 2NU9A 2GN9A 3GVCA 1XNJA 3BKXA 3HSKA 1SIWA 2DWCA 3D7RA 1S2LA 1XEXA 4CTNA 1KYWA 4MQLA 3G5AA 4RVFA 4DWOA 1C3JA 2HXGA 2IXAA 2R84A 1FP1D 2A5GA 2WNIA 2ZQZA 2BHSA 2WFMA 3AU8A 3FA2A 3A1FA 5DM4A 2JAUA 3V7NA 4GLBA 1M6NA 3DCJA 3DOHA 3CRVA 4L5BA 3E48A 5DHUA 1XWWA 2BGUA 2R1TB 2LVBA 2WICA 1KC1A 2V9ZA 1ZGZA 3D0KA 3L0CA 3LWNA 3QU2A 4CL8A 3SS7X 1XWIA 1IG0A 1QHHB 2CHVA 3F3MA 5T4FA 1YJBA 5K0GA 2IJGX 4A27A 4PQEA 3FOZA 5TF4A 2RJNA 4MDYA 5HRCA 1MRNA 3E9RA 1ESNA 1PJTA 1U4NA 3HCNA 4CM7A 1LEHA 4M53A 1AMNA 3LECA 1TPYA 3OFVA 3V6LA 2WHYA 5EJEA 2QUBA 4JKIA 4X20A 2CYBA 3EPRA 4EB6A 3CJQA 3IVRA 4L0MA 5KVQA 2JK0A 2HLHA 2WW8A 4XASA 6CHYA 5T7BA 4J0FA 5AKEA 5LQCA 3UUGA 3PQ3A 1AUPA 5ALMA 1XVAA 1UUFA 5BR1A 3COPA 3RC8A 1XTQA 3I61A 1JG4A 4N40A 4B3BA 5CCEA 3MYRA 5DTQA 5CA0B 1HFWA 1TCVA 4C5CA 1KQNA 1Q1ZA 4KB5A 3E03A 1VP3A 4XQ0A 3WLOA 1O08A 4KBYA 2QTMA 1I6WA 1KAMA 1TF2A 4BKMA 5LP1A 2ENWA 3PNVA 1U8XX 2RDMA 4M8IA 4FGZA 1Q3TA 4RXUA 4OJYA 1ZH0A 1W93A 1XNGA 4FFBA 2PZEA 4LNUA 3Q3EA 5EP1A 2XI4A 5AW8A 4YRNA 1XAJA 1LI7A 4XYBA 3PFIA 2R1VB 2R8YA 5HJ2A 5TPWA 3DTNA 4F9FA 2J45A 7REQB 1BA2A 1NTOA 1D0VA 3KFVA 1IXRC 1URPA 3ZH2A 3TCXB 3RU9A 5K3EA 1M7HA 3LL4A 1A7UA 4FSXA 1VHDA 1H1LA 1VRCA 3VZPA 1QRRA 2HSJA 2XCOA 2ZYVX 3JASA 4Q1EA 1JEAA 3EVEA 4A2QA 3W5UA 2IYAA 3E81A 1QF7A 3VR4A 2WB2A 4Q82A 2FDXA 1R4NB 4PHGA 2VF8A 4TLLB 5T3UA 5JNUA 1U3GA 1YA8A 4YUWA 5C32A 4HTAA 4OBEA 4RD6A 2WNHA 5C51B 1NHGA 2WAOA 3HEBA 1P8AA 4M0CA 2UZ1A 2JJ8A 3LAWA 1WAMA 5AK3A 2A59A 3HY3A 3RANA 5M29A 3U2QA 4F1JA 4YH1A 1JKJB 1JDJA 5AO9A 4YONB 3PGLA 1UJ5A 3N1UA 3LQ2A 4ZI7F 3ZQUA 5EJ5A 2FSHA 4TSKA 2JGJA 4QTTB 3AEUB 4DSAA 5DI9A 4MQUA 2UV8A 2Q50A 3I5UA 3AEKA 2W9XA 2WUFA 4IINA 3BIOA 3ZGOA 4BO6A 2ZAIA 1ZSVA 3QG1A 1ZO8A 1GARA 3OETA 1Z35A 1WCIA 2XMZA 2ZUWA 3R7LA 3KEFA 2Y0PA 3LL7A 1M0WA 3NBQA 4PNPA 2HWXA 2VDNB 3GFQA 4IIJA 2DKOA 1KJJA 1WLSA 2DLNA 1QQTA 4WOBA 2Z4RA 3O1IC 4CIAA 3MNFA 4HXGA 1AY0A 3NAQA 2GKSA 1LGYA 5ERYA 3DBVO 1G8PA 2IW3A 2V74B 2JGIA 1I24A 2I8AA 2V7UA 4V0MA 2A1TS 3HU1A 3PXDA 4Y2XA 5DF1A 3PD0A 4Z0HO 3ZHOA 3ZHVA 3VPAA 4B5LA 4JT2A 4LKOA 1QRSA 2CD7A 1L3IA 2IYQA 2OCDA 4I2NA 1RZRD 4E15A 3ZXIA 1W36C 4JBIA 1XTIA 2BWJA 3HLTA 3QYPA 4R84A 3WKAA 2WMDA 2XVAA 4AJEA 3NTQA 3OCCA 3E58A 4PZDA 4D3YA 1ODCA 2E48A 1PGJA 4PHCA 5KNBH 4AICA 1DRVA 3CH7A 4PE5B 1Z4MA 3O91A 1JIKA 4ZDJA 2ZBRA 5IC6A 4LF4B 1HYGA 1QO7A 2ZYTX 3OKAA 1K4YA 7ADHA 4KJZA 4R6WA 1U2ZA 3IBCA 1N9GB 1TECE 1WUHS 3IHKA 3KQQA 3QMMA 4X6XA 2OQIA 1T5SA 3EN0A 4FWTA 1LRKA 1UZUA 1MV5A 2LKCA 4JT4A 4LSWA 1E92A 2C07A 4OHBA 4BZPA 4FMDB 1RXEA 4HXYA 5BXQC 1EK2A 3AP1A 4ZVQA 3AY3A 4JHLA 1U0BB 3UJNA 1TZBA 2FW9A 5CVCA 4CMHA 5HILA 3I6MA 3T0IA 2GSDA 2PMFA 4DF3A 4W82A 5LNK6 3MB5A 3Q3VA 1PJRA 1R16A 3GRVA 2Z2JA 3IIKA 1EFLA 5CAEB 3RUEA 3ND5A 5ALLA 4M46A 4D0LB 4IDEA 4DT1B 2HJGA 3C5HA 2V7GA 4PLCA 2RJ3A 1XLVA 5IVPA 1YB1A 1FQKA 3D9QX 1QH1A 2B37A 1VYTA 2EV9A 4HVAA 3C5CA 3NCTA 3RLIA 1RLJA 3ZW9A 2RHRA 4P4UA 1QVRA 2V4MA 1W5TA 5JR3A 3R7DA 1X42A 1FNMA 4LOIA 4JYZA 2O7NA 4DV6B 1RI4A 3KBBA 3VAZA 2ZRBA 1UDRA 3AR7A 1ZDMA 4JBLA 5E7IA 1O97C 1TA4A 5CGZA 4RTNA 3IAS6 2VP6A 4BQQA 3H1BA 3ZR4B 4CNBA 2CXSA 2Y9PB 4EUSA 3G2JA 4F6CA 1FUKA 4UHHA 3D8TA 3NIWA 1Q5PA 1OFIA 2OA0A 1JAXA 1RI5A 1L9KA 3KDSE 2IOHA 2FX2A 4FKBA 1EFAA 3L8EA 3RT9A 3OZFA 5DTJA 1XMVA 4R8SA 4EATA 4M21A 1ZGJA 2J5RA 4ZTUB 4JMPA 5KHOC 3LVFO 4NBSA 3THWB 3ISVA 1E1MA 1U28A 4F5DA 1IRXA 3CR8A 3D8UA 1YQQA 1E99A 1T6XA 2F1IA 4K6OA 4Y6RA 3T4PA 3S2ZA 1K5PA 1ZL0A 1XKQA 3WWCA 3K6RA 1FYWA 1S0UA 4DB4A 4JQCA 3U44A 4FW9A 4L22A 4J0HA 3V4VB 1SXQA 2P6RA 3RSFA 4HAYA 2HN9A 2OUIA 2CGEA 2QNIA 3AL3A 4NYJQ 1K4MA 5CYFA 3SK0A 1GV0A 3FYDA 3NUZA 5KIAA 4BX8A 3U4QB 4N41A 5I7AA 3FBGA 1DO2A 3U4IA 1XTZA 2W6JA 1BVYF 2RGNC 1MOZA 1U7HA 3HZOA 3M4XA 3NP7A 6AT1A 4F9GA 4F5WA 4U2FA 4OHZA 3QHAA 5IARA 2C5HA 3G5TA 3RUAA 3DZ8A 3VU3A 1XI2A 2EXXA 3MTBA 4KR3A 4AKIA 1UJMA 3L7KA 1W5EA 1KZ6A 4L78A 1G4AE 3PFKA 4M86A 3C7KA 5DMHA 3VH3A 2WIKA 1CJUC 2LDXA 1AN0A 2HNAA 4L3VA 3RU2A 3WV4A 1E63A 3E61A 3JR7A 5AIBA 5KREA 2KQUA 1LNZA 1I5RA 2GPJA 3AYZB 4PFKA 3V4LA 4IWXA 1JDBB 4GP6A 4QYXA 4EH1A 4EW3A 3FPSA 4ZHQB 4MR7B 1I4OA 2TYSB 4ZI2A 3TPFA 2PGOA 3KP1A 4I5FA 3E5NA 1ZM2A 4NMLA 5FNVA 1KZ9A 4LZNA 3VR6A 4DW8A 4F3KA 4D43A 4YHHB 1EGAA 2YWRA 3CWCA 3R7FA 2J0SA 2W0SA 2WEKA 4YB8A 1NNUA 4QJ3A 3MVEA 3I4FA 2ZUVA 2GBGA 1LK0A 1P60A 1X8XA 3N8KA 4M6WA 5ULLA 3HUEA 2AG5A 4KZPA 1HO3A 1UT6A 2VF5X 5IMBA 3CNNA 3KELA 4CDGA 4ZEMA 1JILA 3FCXA 3CVVA 3ZLJA 4W5OA 2RB5A 3C4JA 5K99A 2EFEB 3AVUA 3WRXA 4N6GA 1UR5A 3TJZA 2RHBA 5DGHA 4Z49A 5F1KA 5LOVA 1Y1PA 4U5XA 3CCBA 4NDZA 4HLCA 5IJ0A 3F4KA 3V2HA 1HBJA 3JQ8B 4BMOB 4DN6A 1Q15A 3FMVA 1J0CA 4WXPA 1FFDA 2PX4A 4KSCA 1P45A 4BKOA 4TWJA 5A5VA 5PNTA 1AO3A 1FRVA 1RXIA 3GJ4A 3IJ5A 3HM2A 3R6DA 2Q6KA 2QP3A 3L0ZA 4YRRA 3ZV5A 4DSUA 1SUCA 1VG8A 1TYZA 5HVNA 3PDJA 3RBVA 2DECA 2P3OA 2DHQA 2GKGA 2JHFA 3GJ7A 3ASZA 4NVRA 2I6XA 3GROA 4XEUA 4FS8A 4CG3A 3V1NA 5DDIP 1XAIA 3ZGYA 4AS1A 1S8AA 1FL9A 4ETIA 1EPUA 2C0CA 1L7MA 4GW3A 1H9BA 1E3EA 2DHEA 5FBZA 1VI6A 1N6NA 2GCPA 1NJSA 3B70A 3G0OA 4P35A 1Z74A 1ZD9A 2VXBA 4X3OA 1DRWA 4Z3KA 1D04A 1YIAA 1XRSB 1PYGA 3HKBB 1YCDA 1WTCA 4NATA 5H4HA 4CCSA 4S05A 1WCWA 1KDPA 2VRNA 4G4GA 1QRAA 2YVKA 3FDZA 4L7QA 4AIIA 5FA6A 1AHHA 3KR1A 4HEA6 4O2AF 3LTEA 4XDYA 4DWVA 4HNGA 1ZNWA 4NQZA 5ITSA 4F4UA 2VRBA 1SHJA 5AVWA 4FJ1A 5F1OA 5LLSA 3KSZO 4NH4A 3AB7A 1UC4B 4ZQFA 1CZLA 4LJ4A 5TEWA 4CV3A 1IZ7A 2XVYA 3IELA 4F46A 5BYKA 3G82C 4E2YA 2EWWA 3FSEA 2XTZA 4JJFA 1FXSA 4KXXA 2HA3A 4PG7A 4NJEB 5IAJA 2WYUA 3RYTC 4PYLA 4AG5A 5HKKD 4L8WB 4TWZA 1O5IA 3VMFA 1BNCA 4O29A 2IPOA 3QWAA 4PLFA 5G3YA 4PG5A 1NUHA 3W6OA 4C05A 3ZIUA 5KQLA 1RQPA 2AQIA 1GPH1 3EY4A 4RNDB 4RK5A 5EIBD 4ZMSA 3MOIA 4TXMA 5TNXA 2PGAA 5ALFA 1EUYA 2J3LA 1YSCA 2NNWB 5LJIA 3AFGA 4MHSA 1GFIA 1PWXA 1TZCA 3MZ0A 4I4TA 2EAUA 2NU7B 3GRYA 5H81A 1Y3AA 5EUCA 3ROFA 1KZ1A 1G59A 4UNQA 4I55B 4GKBA 2OORC 1GT91 1YZKA 1A5TA 3G02A 1VSTA 4KOAA 4MVYA 3ZZ1A 1ZBQA 3FFTA 3SZGA 1GUZA 1PT8A 1P5HA 1K3TA 4D8UA 3V42A 2YIJA 5B58T 4KAFA 3HXQA 3COZA 2X15A 1EYZA 2EWMA 2GPAA 3JX9A 1O5TA 3P0EA 3EISA 5HQ3A 4C7OB 3BJMA 3Q98A 3QITA 4C7XA 4D9CA 2VJDA 2YC4C 2RGCA 3PUHA 4D0GA 2F7SA 1IPHA 4OLAA 2PX6A 2XR1A 4Q3LA 5TS3A 2WT4A 2WU0A 4KFRA 1C81A 4ND2A 4NYJR 1KRWA 1NBME 2VTDA 3FPJA 3IFSA 2Y6VA 4JVNA 4PYQA 5JY6A 3K4HA 5F3DA 3GLIB 3USZA 3KAQA 4OI4A 4C14A 1ADFA 1U8ZA 4PC1A 1L5SA 2VK8A 4E94A 2IWHA 1E79A 4AM8A 2QL5A 2Z9BA 1QX3A 4ISCA 4B6EA 4W5RA 1RXYA 4EI2A 3HCRA 5A06A 3U16A 3AI3A 2B9EA 3P2MA 1X8JA 1FP2A 4OMCA 4DIUA 4ZGBA 4TQAA 1GAEO 4OI2A 4WA7A 5DTRA 3PNMA 3VDNB 2I8LA 4TMVA 1CQJA 2E5FA 2V0NA 2QUAA 5I51A 2DY1A 4RVGA 3KWJA 4KQ1A 3B2EA 4RETA 5JDCA 3WBKA 2HHLA 3IEMA 4DPLA 2G17A 3GDGA 1ZFNA 3T5CA 1HE2A 2ZSEA 3DP7A 4Q39A 2D5CA 3U7RA 4K0KB 4H6VA 1JG7A 4ER3A 1JAHA 3ESYA 3SWWA 1NDUA 5JSZA 4YMGA 4V0RA 2F90A 1A77A 1KP3A 3A2LA 4BE9A 1PW7A 2HEGA 3K70D 2Q3JA 4HZIA 1JR3D 3BHIA 3C3PA 3H8WA 2NW6A 3G8CA 3QZUA 5D00A 3BK7A 3JRNA 3DKKA 4IFIA 4TTQA 4G1BA 4J4BA 4JGBA 2BJWA 3U7GA 4PX2A 1ENYA 2CFRA 4B3XA 3GFOA 2A3NA 1W1WA 1ZRSA 1GGMA 3KUKA 5HKLA 1NX9A 3EPHA 3R75A 821PA 5KWIA 2QTCA 2X8AA 2P9GA 3HB0A 3DFIA 3KNZA 4C0JA 2MMCA 3ZKAA 1IM2A 4AAYA 3KL2A 3W2TA 2OCGA 2AZ4A 1E5DA 3DVAA 3P9PA 1QTRA 1TEHA 3M6IA 5ENDA 5F35A 5C2JB 2B6HA 4W7SA 3MUFA 2PM8A 1KTVA 1ISJA 3SLRA 5CB4F 1D6MA 1K27A 2GN1A 1Z0IA 5ALNA 5J9FA 4JZKA 3AILA 5LQSA 1YJAA 4CM9D 3MCTA 2RFLA 3UENA 4WERA 4QG7A 3FNQA 4ZGWA 1RZRA 2H65A 1UKZA 1GA4A 4QM7A 4KH1A 2VUTA 4IHQA 3SIWA 4BO4A 1MLDA 3Q10A 2VDPB 4LDZA 4BKPA 4JUDX 1LWOA 2VJPA 1EDZA 4ZCQA 3SG0A 3CLHA 1UBTS 1E6MA 4INJA 1MF7A 1RZVA 2RHDA 4XGIA 4ARZA 3USES 3NT2A 1ND5A 1SU4A 3JARB 1PLLA 4BZQA 1EQAA 1ES9A 2ET6A 3TL3A 2Q1XA 5LXTB 1I4DD 3QX9A 2Z30A 4BB9A 2CCGA 1HZZC 1WP4A 3V33A 1QHHA 4QYWA 4EJ6A 3CLKA 4EK9A 4LV5B 5C8YB 3FVWA 4HAUA 2IGBA 4QNMA 2TS1A 2X0DA 5CLHA 4XVHA 3R0JA 4PC3A 2VHQA 3AOEC 1JXQA 1TKBA 1NQVA 1X86B 3GI1A 2E82A 4KYTA 4QYIA 4X61A 4ZT6A 3WL3A 2UXCB 2FSVA 2ZRLA 3WK6A 3W1VA 4CUKA 2H4YA 1XJ0A 2IUTA 2WYWA 1C3OA 3MCZA 4K40A 4PG4A 1UDXA 1UFQA 3MJRA 5C31A 1OH6A 1X7WB 1KQPA 3NU1A 5D8DA 3DOIA 3G1UA 3P0JA 4WNAB 1KI7A 1CVRA 1OIWA 4GKAA 1E5VA 3DAFA 1IPFA 1BMDA 5IXYA 2WSBA 3OPQA 1CC1S 3IQDB 2VJKA 1JA9A 3GEGA 5FNZA 4DIBA 3IUBA 1SXHA 4OBBA 2Q5EA 3ORQA 1A4UA 1GKLA 4RVSA 4Y6GB 3WE7A 2IXEA 3FY4A 2YHAA 2PMBA 4BYMA 2BH2A 5I3ZA 1MOQA 4KFCA 2C1XA 2Z9CA 5FWDA 4LFCB 4BX3A 3L0DA 1XL0A 3ZOKA 1TNDA 1N32B 3LVRE 1N0IA 3K9QO 4RQUA 4G84A 1ODTC 3ZJ5A 2GJKA 1BCRB 2I3AA 3AW8A 4JJ6A 5TMBA 3B78A 3O8LA 3ZWXA 3L7LA 1XRJA 3PQ6A 4C87A 3KQWA 5I4CA 3I28A 4MWBA 3WLRA 4CLRA 2VYCA 3AGPA 4NF2A 5TQ2B 4YRGA 7REQA 2R86A 1T10A 4G5OA 2VHYA 2SKEA 3GNLA 3ICVA 4Q1FA 1N0VC 4XIGS 3UAWA 3ZZMA 4DQXA 1G16A 1GOTA 2GASA 3H2JA 4WTOA 2AJTA 5IH7A 2WJWA 3LC2O 1LK5A 1G8HA 4KWHA 4PRLA 2Q4RA 1XGKA 4B2LA 3ELUA 2YRWA 4LY0A 2H9YA 3RRYA 3UGTA 1UXIA 4TUYB 4JP3A 1EGMB 1U8EA 2J7KA 2JASA 4R5HA 3QUTA 5EHXA 5IJXA 4DV5B 3IBFA 2DFLA 1I3OA 3FVQA 1DDGA 1FU7A 1MB9A 1SZCA 2JS7A 2WUDA 2Z57A 4CMIB 5C37A 2O14A 4REMA 5JO9A 1KZYC 4YUXA 3K92A 4JYCA 3PKZA 2AUTA 1RHUA 2YXDA 2AR7A 1LI5A 3OZXA 4GU5A 4W6ZA 2VP3A 3VTAA 4BLWA 5EJ7A 5KDDA 4TYWA 2EDAA 4HFNA 3B5JA 4DZTA 2B25A 2HU8A 2P4SA 3KYIB 4FKZA 4ODIA 3LQFA 4OCZA 2CW5A 1WCYA 3OZTA 1FRQA 3JQCA 4X92A 4NENA 3A8TA 4OUKX 3E1SA 3NP9A 2F9LA 2W6OA 5HK8A 5F21A 2YXNA 4G1MB 4QDXA 4Z51A 1T24A 3O8BA 3SS8A 3U9LA 4PLTA 1U7WA 2HV8A 2X8JB 1RCFA 2YRXA 3WADA 4A9AA 1KK0A 3NM4A 4ER7A 4UQLA 2LCIA 1H93A 2UUOA 4E4YA 4F5ZA 4RPLA 1MD9A 3I4LA 5JALA 2XVXA 3OOWA 4WCFC 3AERB 4WADA 1QCCA 3S8YA 5C52B 1Z37A 3OLXA 3I42A 2VK1A 3E9EA 4LWOA 4OBXA 1AF4A 3T7KA 1D2EA 3OFKA 3BFVA 5J1SB 3AF1A 1EA5A 1W36B 4PLZA 4IXDA 4OBWA 3UMFA 4EYGA 4G0VA 1I9CA 4RHYA 3C5WP 5BOSB 5C5IA 2VYVD 5KNBD 3HFRA 3WB2A 4JI0B 3PX2A 1AD2A 1QX4A 3TLBA 2K7FA 4M98A 1GYPA 3CX4A 1X0VA 2PSJA 1WF6A 1LS6A 3LUPA 2UVPB 3DZHA 5LKRA 1GNSA 3OSZA 1YKFA 4P5EA 4WZBA 4XWGA 2COEA 2YWHA 1JDUA 4UTXA 3LRPA 1I7QB 3BJRA 4XLLA 1GU7A 3TQTA 4C5BA 5IUJC 3EF1A 4J7CA 2PN1A 3MMXA 5BY2A 1NXOA 4CKBB 4OX9B 1UFVA 4PSCA 3VDRA 3BF8A 1CW2B 4Q1AA 1HTBA 2PSSA 3FWPA 2JKYA 2P4QA 3QW4B 2XTAA 4BNFA 1VKJA 4H35A 4GPTA 5K03A 3LD9A 4EUHA 5K3OA 1DFIA 3S1SA 4QQRA 1GU0A 1V1RB 2HA6A 3PPXA 1JG2A 4W6QA 5AWFC 5GPBA 2PPVA 4PLHA 3T5PA 5CB8A 3U3OA 3BWBA 4C88A 1E5LA 4DT1A 2V96A 1SQ5A 4GKVA 1V45E 4P7KA 4B46A 5KYUB 1K8ZB 1NRJB 4LNAA 1ZGCA 5CBKA 4E7OA 4LRQA 1OQAA 2BC9A 4E5PA 4BKRA 5K3FB 1CUUA 1RQ2A 4JUAA 4MKZA 2BF4A 5G0TA 2E4UA 5ABPA 2OBMA 1G5HA 3GRFA 1XLTC 5HTKA 1PQPA 2X22A 4D56A 5JQGA 4MKGA 3EC7A 4MGYR 2C2XA 3P8ZA 1XN4A 2HQ1A 2YS7A 1VTKA 4DM3A 1NQAO 1TCUA 1LC3A 4CKEA 1S01A 3D54D 2BMDA 1GEEA 1RW4A 4O4HB 2ZSDA 3JQ7B 3KUXA 2GZHA 2GVNA 1VL2A 2VG8A 3EMKA 2A5YB 1H69A 2WG2A 4G0NA 1VA5A 1JYSA 1RRVA 2XECA 5HKKA 3A04A 3L4KA 5HIIA 4JNCA 3LK7A 1CIJA 5A2GA 1E7YA 4P84A 1NC1A 2A92A 4N5LA 1M2OA 3WJ1A 4F96A 2GAIA 2YN2A 4BV2A 3PT9A 2P6UA 3FZQA 4S12A 4RC9A 2B82A 3IKMB 3LV8A 1TU3A 3KWMA 2Y77A 4G0MA 3O2JA 5G1PA 3PWTA 4HDAA 3NT4A 2O2JA 3R1IA 4UHJA 1WCV1 4JASB 4I4CA 4EW1A 3LA6A 5CLJA 1QNFA 1M0TA 2OLKA 2QLFA 4CCWA 4K9OA 1REQB 3AY6A 1UWCA 4F3TA 3LLSA 4OQEA 2IPLA 5EHNA 1GZVA 2WU1A 3KFLA 1IZ9A 4C0QC 1KAOA 1QOPB 4WGFA 3UZUA 1E1LA 3EXHB 1U8UA 3EOAI 2DE0X 4X62B 1ZBDA 1XXHE 4R3NA 5ARCA 5K3CA 4BU1A 2R7AA 2OQVA 1YL6A 5YASA 3TZBA 3OKFA 1SCKA 3CG4A 2QD4A 3QM1A 4NJOA 2W71A 5KWJA 1G42A 3HM9A 1J2EA 2V3VA 1UIMA 2C3MA 4GOND 4YP7A 5L3ZA 4BFYA 1PR3A 2FFQA 4EGSA 3KT6A 4DMRA 1JBQA 5L7WA 1DPFA 4Q7EA 2FP4B 1R0XA 4WBNF 1PL6A 4MB2A 1XPRA 4Z2YA 2AJCA 4MR7A 2D8AA 3R7WB 2C83A