4O1HA

Crystal structure of the regulatory domain of ameglnr
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'SHMSLDLLVMTAEADATAVLPALDLLPHTVRVRAPEVTALLDAGHRDVILLDARSDLASAKSLCRMLKGTGEDEAATPIIAVVGEGGLVAVSAEWRTDDILLPTAGPAEVDARLRMVTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulator GlnR
molecule tags Transcription regulator
source organism Amycolatopsis mediterranei
publication title Atypical OmpR/PhoB Subfamily Response Regulator GlnR of Actinomycetes Functions as a Homodimer, Stabilized by the Unphosphorylated Conserved Asp-focused Charge Interactions
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4o1hA00
4KK3A 2X7XA 3NNDA 2FKAA 3SQNA 2MSKA 4PICA 4WXMA 4EGSA 3CTPA 4FE4A 2PUEA 4LE0A 1ABFA 2GBPA 3G1WA 5T3YA 3N0RA 4MS1B 1JWLA 3EAFA 2QXYA 1K68A 2OENG 2OQRA 4LDZA 5JNUA 1HEYA 4XXHA 1U8TA 3Q9SA 1C0EA 4ZYLA 1VLZA 1ZHHA 2FMFA 4FE7A 3KJXA 5JNRA 5JNTA 1LBIA 4IRXA 3H5TA 3OO0A 5TPZD 5JS2A 1ZGGA 1I3CA 3CLKA 3O2SB 2KYRA 2JVKA 2PUAA 4MR9A 4S05A 1YMVA 1PUXA 4KZKA 2WB4A 1DC7A 3I5AA 2PL1A 2ID7A 3ROFA 4L4UA 3NHZA 4MR9B 3M6MD 3OM1A 2GI4A 1XWWA 3GL9A 3GRCA 5CNMA 4QPJC 5TPZA 5FBHA 3E3MA 3LKVA 2E4WA 3CS3A 1YK1A 2HQRA 3FGZA 4MS4A 4G97A 5TQ0B 3H6GA 4MS1A 5CHYA 4N47A 1QP7A 2FXIA 4XLTA 1PEAA 3DBIA 4NCAA 3JS5A 1NY5A 4MS4B 2P4UA 1NXSA 4KVFA 4YWHA 7ABPA 3C6QA 3JVIA 2CD7A 4ML3A 2MSWA 3FFXA 4TLLB 3NNNA 4JA2A 4KNYA 3GV0A 3ILYA 4FB4A 2NT3A 4PYRA 3T8YA 3N0XA 1SD5A 1QMPA 4G0PA 4EVRA 1FFSA 4MGEA 3MMNA 4H3HB 2FEKA 1DCFA 3JVDA 4RK6A 5DGCA 2HSGA 3A0UA 4KV7A 1JFTA 5HQJA 3H5VA 4JP1A 3MQ4A 1M5TA 3RH0A 3OQOA 4YR7A 1JDNA 3TO5A 1JHZA 5DCLA 1P6QA 5IX8A 4MAAA 1BAPA 3CKMA 5IC5A 4YO7A 1Z12A 1NXPA 3DZDA 1LBHA 3MYYA 4LDAA 3P9YA 4RY8A 1YTUA 5TQ0A 4DN6A 1YIOA 1J56A 5C5CA 1VRVA 5F64A 1NXVA 1TJYA 3KHTA 4IMJB 4F3TA 5GOTA 3O2QB 2JCGA 1NXXA 2PAFA 4H60A 1KRWA 4KREA 3H1GA 3IP7A 3ROTA 2FEPA 4W5NA 2IPNA 3LKBA 4W5QA 1TVMA 3OM0A 5IUKC 3RVKA 1Z18A 2IOYA 5JNWA 1D4ZA 3EQZA 5DLEA 3OMXA 3UK0A 1QP0A 3GYBA 4O5AA 4XFKA 2LBPA 3MA0A 4MR7B 4RK0A 4MQFB 3QLTA 2HQOA 1A0OA 4LE1A 5JNVA 3EQ2A 3CU5A 3GBVA 3SG0A 4H3KB 4WT7A 3FDFA 3EULA 5CNIA 2MYPA 5ABPA 5TQ2B 1W25A 2QSJA 1GUDA 1DCMA 2IPLA 5FWXA 4RDCA 3QELB 4G86A 4MLDA 2J48A 3FFWA 1JDPA 3IDOA 1MB0A 1NXWA 5HKOA 1USIA 5GQSA 2B1JA 1RPJA 2GWRA 3OLXA 1C4WA 3N6VA 2JVJA 3H1EA 3OLZA 3TD9A 5KQGA 1ZH2A 5FBKA 3QX9A 1B00A 4Z4FA 4EUKA 3T95A 2JVIA 4KRFA 1F51E 3HDGA 5KQPA 2ZWMA 3G85A 1LJLA 4OATA 5EWLB 3GA5A 4MR7A 4W5OA 2GX6A 5TE9A 4HYEA 2WMYA 2QVCA 3KTOA 2WY2D 1D2AA 3A10A 5E3JA 2RJOA 1GUBA 3FFTA 2QR3A 3SNKA 4N03A 3QK7A 4MYRA 2W42A 1U2PA 1ZDMA 2JRLA 5DKFA 1JH9A 1QO0D 3KG2A 2Q5CA 4Z4CA 2PUGA 2H3HA 3CHYA 4RS3A 4RSMA 2NUBA 1U0SY 3I45A 1JFSA 4D6YA 1RXIA 1DBQA 1EFAA 1DRKA 4G0QA 4HNQA 4RKQA 4WUTA 3LUHA 3I42A 3VNAA 3Q7RA 1MIHA 3DLBA 3HJFA 1QPZA 1P2FA 3CG4A 3MIZA 5IUNC 4MS3A 4ZPJA 9ABPA 1JFVA 4HNRA 2VYCA 4EVQA 3SM9A 5DTEA 3Q15C 1BDHA 1DJMA 4KQCA 2JBAA 3H5WA 2FW0A 3RVPA 4MR8B 2WJAA 3LUAA 8ABPA 3K4HA 3KLOA 2ID9A 4D6XA 4EYQA 4E7PA 4P1ZA 4TMYA 3F6CA 3KKEA 4YP9A 1PNRA 1SXHA 1A04A 3K9CA 3OLVA 1ZH4A 4PE5B 2JB9A 1Z16A 4JB0A 4Z9AA 1F4VA 2E4XA 2FQWA 1FQWA 2IKSA 2NT4A 1ZITA 4OTZA 4KMRA 3M9XA 1LK0A 3A0RB 4MLCA 3RVRA 4XARA 3H5IA 2L19A 2LIVA 2QV0A 3LUGA 1FFWA 1CYEA 5BQ3A 3LUKA 5I4CA 2IYNA 3QEMA 3IPAA 1FSPA 4EYGA 3OO1A 4DADA 4IMIB 4JB2A 3Q7SA 2LUOA 4E7OA 3LUCA 4G0OA 4MQFA 4DQDA 1A2OA 4RY0A 4NV3A 4N0QA 2AYXA 3Q7TA 4S04A 4RXUA 3QLVC 2O20A 2DRIA 3RVNA 4NCBA 3MF4A 2WJWA 4W5RA 2ZAYA 5EWJA 2FN9A 5IULC 1SRRA 1BDJA 2FSPA 4OG2A 5IUJC 3EODA 3Q41A 4NICA 3LTEA 3O21A 2IPAB 4ZMRA 1WETA 1E6MA 5KC9A 4Q7EA 3L49A 2PLNA 2FMKA 2QVGA 4YRZA 4G0XA 4F11A 2A9PA 4RU1A 3UUGA 3A3KA 3HS3A 2V0NA 3F73A 4L85A 3OQMA 2FN8A 1L5YA 5C5EA 3JPWA 2FQYA 1ABEA 3KLNA 3NNSA 1TMYA 4JAVC 2F8SA 2CHFA 2IDMA 5B3JA 3RVQA 3JY6A 4ETIA 3GBPA 1NXTA 2FMHA 5BRAA 5CNJA 4MR8A 4ETMA 3QEKA 5KI6A 1EWVA 2YHBA 2M98A 3OLWA 2FVYA 3DLHA 1VKRA 3IP5A 2N9UA 2NZVG 1AB6A 3EDCA 3H5OA 4N41A 1R8JA 1GLGA 2RGYA 1QQBA 3FMVA 3QELA 4D74A 3BRSA 5HM6A 1Z2DA 4LX8A 1EAYA 2NZUG 4P98A 2RDMA 3BILA 1BVHA 4KQ9A 2GKGA 4YV7A 4IF4A 3URMA 4YGXB 4HNSA 3HUUA 2QZJA 2A9OA 2PE5A 3H75A 6ABPA 1DBPA 4Z9BA 1PHRA 1NATA 2P9HA 3LUFA 4IGAA 4RXTA 2WWVD 2PL9A 4TN5A 2HJ9A 5EWMA 1XHEA 3H5LA 1URPA 4ETNA 1KGSA 3O74A 5T7BA 4Q6BA 1ZY2A 2TMYA 4YCSA 4QYMA 4OLBA 4G0MA 1XHFA 1QO0A 5TPWA 1TLFA 3LFTA 1ZN2A 2R25B 1D1PA 1DCKA 1MB3A 4RK5A 4MQEB 1Z26A 4Z4GA 5KQMA 3LUJA 5TPWB 1EWTA 3C3WA 5BRJA 2BGGA 3HO1A 1JBEA 4RK1A 5IBQA 1EWKA 1T34A 3QLUC 4Y9TA 2MYNA 3D02A 4QYWA 3H6HA 4G0YA 1H9CA 1CHNA 3D8UA 3HVRA 4N76A 1MVOA 3F7NA 4Z4IA 3KCNA 4XASA 1RZRD 3TMYA 2PJUA 2VUIB 5KC8A 1JL3A 1USKA 3RVJA 4EYKA 3EGCA 1QKKA 4Q6WA 2PUCA 2QU7A 3CG0A 3OQNA 6CHYA 2FTKE 3EJWA 5EWMB 3IPCA 3IP6A 4UHKA 2H0AA 2JBAB 4RK7A 1PNTA 2A9RA 4XAQA 1M2FA 2HQBA 4EY3A 1BDIA 4KPYA 5JNSA 5TQJA 2PUFA 4GNRA 1W9HA 4O1IA 3C97A 1UDRA 3OLYA 1GCAA 1JYFA 2E4YA 4LE2A 2LPMA 3SAJA 4UHJA 1P8AA 2I6FA 2R4QA 3KYJB 3N75A 3JTEA 2E4ZA 3RQIA 2FMIA 1D1QA 5KWSA 1USGA 4RKRA 3RVSA 1VPWA 2PUDA 1SXIA 3HDVA 4WXEA 4B09A 5PNTA 1Z15A 1L5ZA 4RV5A 1D5WA 2PKXA 4RXMA 5B3JC 1YS6A 2M1ZA 5IEJA 3CZ5A 3CNBA 1E2BA 3O2JA 3W9SA 3HEBA 5JS1A 3T38A 1MAVA 1YMUA 3JPYA 2FLKA 2RJNA 3N8IA 3OMWA 5EWLA 1YVUA 1ZAYA 3DGFC 4QICA 1DRJA 1JX6A 3RVMA 4WZZA 1E6KA 3CRNA 3BRQA 3N53A 4JASB 1DC8A 1M2EA 1Y1LA 4F06A 4Z99A 4YLEA 1RXEA 1JF8A 1DBWA 4F8JA 2PUBA 3KYIB 1Z25A 4Z0NA 2MSLA 5D2CA 3VNBA 2L17A 4NQRA 2L18A 1YK0A 5FWXB 2JK1A 3N0WA 3IP9A 5FWYA 1TM2A 1NTRA 3O1IC 1PEYA 1QNLA 1U2QA 1JYEA 2R48A 1NXOA 3CZCA 5KQLA 1OXBB 1CEYA 1QQAA 2FEWB 2F8TA 1K66A 2L2QA 3C3MA 2FQXA 4KK4A 4TLMB 2CHEA 4JOQA 1IIBA 2AYZA 3QEMB 4YS6A 3QLVA 3E61A 1DZ3A 3KS9A 4MS3B 3TX6A 4KFCA 3GT7A 3HM9A 4LZLA 5IEBA 1DG9A 2CWDA 4GPAA 5ED4A 2PMCA 3HZHA 3I09A 1RNLA 3QLUA 4MQEA 4RWEA 3HUTA 2E4VA 3NBMA 1BA2A 3L6UA 4PEVA 2WRZA 4EVSA 1ZGZA 3S99A 4F12A 3C3KA 4Z4HA 4RK4A 2FLWA 4LRQA 5BR1A 3M9WA 3O1JC 1SXGA 1EHCA 3F6PA 1Z17A 1E6LA 1GCGA 1JLKA 1Z2EA 1QP4A 1AB5A 3TB6A 3O1HB 3SY8A 3ILHA 1APBA 3NHMA 3B2NA 3LOPA 4CBVA 3RVLA 4O1HA 3LMKA 4OBBA 1KMIY 4ZJPA 1ZVVA 3T6KA 3RVOA 4ZMSA 2YHAA 3HV2A 4M88A 2A9QA 4RY9A 4MRMB 3O75A 1KRXA 4EYOA 2VK2A 4Z4EA 1ZESA 4RZSA 1LJUA 2HPHA 1U04A 4IILA 2XDYA 3CFYA 3R0JA 4MRMA 5CNKA 5EWJB 3HSYA 3LUDA 1RZRA 1OXKB 2E4UA 4W5TA 3BREA 2MYTA 3QX8A 3KSMA 2MYUA 1FFGA 1YS7A 2LP4Y 4N0PA 5HSGA 3DGEC 2B4AA 5TQ2A 3HK2A 1Z13A 1DP4A 3MM4A 1P6UA 3UKJA 4PZ0A 1S8NA 4WWHA 2VUHB 3H1FA 4OLAA 2IPMA 3HCWA 4G0ZA 4MPTA 3HXMA 2R47A 1M5UA 3GWGA 5FWYB 3BBLA 1ISRA 2QW1A 1ISSA
chains in the Genus database with same CATH superfamily
2CNDA 5KCMA 2MSKA 4RKWA 4Q34A 4RHXA 4D6PA 2QQ0A 1UBNA 3JARB 1DG1G 1IB6A 2H4FA 3JQPA 4GQIA 4HUQB 4QHTA 5L7YA 2Z6UA 2VTEA 1FYWA 4NH4A 3U61B 4EO4A 3ENKA 4QUGA 4B85A 1E66A 2ZTVA 1SR8A 3WNBA 1I3NA 4HUQA 3H04A 2EBHX 3Q9SA 2HJVA 4MUEA 1S3IA 2B35A 3ZNQA 1AKVA 4BLPA 1SMKA 4BJHB 1FP4B 1P17A 1R5BA 1N6IA 1U5AA 2P4QA 3EPPA 3PQDA 3I5XA 4C01A 3OQPA 1ORDA 1J8MF 1ACJA 2O2CA 3A4IA 3EARA 1OVMA 3K9WA 4UU7A 2EATA 4B7AA 1Z2CA 3QYPA 4MR9A 3HMKA 3H4MA 3T9AA 1YMVA 3WB2A 4UXHA 3WIBA 5AWFC 3TNYA 3DTNA 3WKBA 4QJ3A 4XVUA 5J4YA 1TM4E 1V41E 5EAIA 1YE3A 1Q74A 2C99A 3I5AA 2ECKA 4TXLA 5D3ZA 5EZYA 4EL5A 2NO0A 2O6HA 5LLTA 4Z4QA 3M6MD 4Z8YA 1GD1O 1VDZA 3BSWA 3OM1A 4ON9A 4BO2A 5L3SA 2JG3A 4Q1BA 4RD6A 1YI1A 5CB8A 4J8PA 2VJDA 3OA0A 2WJYA 3KTDA 5DOVA 5FAXA 3V8RA 5EHZA 2AFHB 3EHDA 2PSDA 5H0IA 2E4WA 1BYIA 2UYQA 1SXQA 1X1DA 1YB7A 2J3KA 5TQ0B 4RA9A 2RB4A 5IHPA 1SVMA 3L7BA 2WJHA 4AP5A 1E18A 3NDRA 3TQSA 4BKUA 4AY5A 3HP4A 3WSTA 1I94B 1W0KD 4CXMA 3KHSA 3REQA 3A4VA 4TT8A 5M5BA 1W34A 3EF1A 2DFVA 2DZDA 3OY7A 3JQDA 5J4HA 4MUJA 4ETWA 1L5HB 4M7WA 1GPDG 5DHRA 1N1GA 3R7FA 1GUZA 4BLUA 2F9FA 3GV0A 3Q7IA 3W05A 3EEFA 3HFGA 1FMCA 4IWNA 2VBGA 5JSQA 3L8HA 4DJJA 3EX7C 5AKXA 1IXRC 4MRSA 4JR2A 1FUYB 4LA4A 4ZDIA 2JFFA 1AQLA 1T5OA 1LTQA 1EJ6A 4F6LA 3O82A 1CZRA 3IKVA 3GCDA 4GYJA 4WK2B 2J0QA 4JP1A 4YH1A 1CUUA 5G1PA 5ICGA 2H1CA 5K0ZA 3EOBI 2D8MA 1UQTA 3H8WA 4C6TA 3DCJA 3A3OA 4G5QA 3EZLA 1Z36A 1JIIA 1R9JA 1X8JA 1F8UA 1ULHA 1E4EA 2CBZA 4ZAZA 3WK4A 3R5KA 3OQBA 3ZUPA 5KWJA 1CETA 1HRKA 5TV2A 4NMLA 3FPEA 1ORIA 1PYGA 3OX1A 3ZHBA 5CYGA 1JTEA 2GARA 3PNVA 4YI5A 5GOTA 2JCGA 4H08A 3N7AA 1XTTA 5JV5A 4DFDA 1Q3KA 5J1SB 2FEPA 3AXSA 2ZYSA 1XF1A 3LVQE 4ZJUA 1WR8A 2FEAA 2EKPA 3MINA 4DPMA 1EQ2A 5L7WA 4J90A 5K4GA 2VL7A 4EFLA 2Z2ZA 2VWPA 1YULA 3DHYA 2BTOA 3DHEA 3OFNA 4KXQA 3I28A 3MA0A 5AXAA 5F5NA 4F1KA 2VAVA 1TU3A 3P0JA 3KPUA 4LF8B 5FNVA 3VC3A 1QP8A 2A67A 4H3KB 3FDFA 1Z62A 4FUTA 2WF9A 5H16A 2Y2VA 2ZAMA 4DMLA 5IFKA 1FFHA 5CA1B 4PYQA 3H17A 3OFVA 1CR0A 1KYYA 3GRYA 4UTPA 4IXTA 4ZV4A 1SUEA 1DADA 1WE2A 3EEIA 4KEAA 4WAUA 4AJNA 2ZEJA 4FYHA 3H3JA 1NXWA 3WLOA 1VL6A 1Q17A 3HY4A 3NPMA 821PA 5GQSA 2B1JA 2EFDB 2NWQA 2FSFA 2R5WA 3ZW9A 2PZBA 3SMQA 1GLVA 1R15A 2JVJA 3P9QA 2C04A 1X1SA 2X0FA 1QIJA 2CHGA 1Y8ZA 4CM1A 1B00A 1DEOA 2WWFA 1JNXX 2M2IA 2SECE 2ERXA 4FE3A 2A5LA 1ZHOA 1FP7A 4OHXA 1ONNA 2QTHA 1R0RE 4CU5A 3HCAA 1TM1E 2HFKA 4RTKA 3KQHA 4NFYA 1W75A 4DJEC 1S9DA 1JA9A 3GLHB 2B1IA 3ETCA 1WEHA 4AG5A 4QQRA 4HQ0A 4CF6A 1P45A 1Z06A 4NF2A 1R0CA 2G9UA 2YIJA 3L6EA 1D8AA 4CMGA 2FFRA 3MBIA 5IDYA 3ZDXB 4Z4CA 4OKIA 1NFFA 1VE6A 3Q3CA 2G28A 1Y6RA 1BMDA 2F1HA 5TARA 1XKXA 2WUVA 2PGDA 2WA2A 4IFTA 2BFMA 2PRIA 1IHXA 3KJNA 4CKWB 1TO1E 4YQFA 2ZBEA 1J39A 3KV1A 3TEJA 4YJHA 4L0CA 3DW3X 1KR5A 4JUCA 4NLLA 1Z7EA 2QX8A 5NULA 4V39A 4DYVA 1JEQB 4WFJA 5EIWA 5A03A 2H1HA 3ITKA 3MWJA 1NIJA 5JAIA 4WACA 1VL2A 3EZGA 4DDTA 4EVQA 2GXAA 1E99A 1W88A 1U1IA 3CX4A 3FW1A 2G67A 3TLAA 1E2PA 2P7IA 2JBAA 1BOFA 1AN9A 2BELA 4PLYA 1GXSA 4EO7A 5CD9A 1FLNA 1KO1A 2J3HA 4PPNA 1WSDA 1R18A 3EHEA 2D4HA 2W6ZA 2VJAA 3TINA 4D6XA 1NAHA 5KWIA 4JBNA 2J6IA 2FPIB 3KVOA 3Q2KA 2EHDA 4P1ZA 2R5FA 1DT5A 3M2TA 4RUKA 4B2YA 4A0FA 1L5WA 4L7VA 1CERA 3MJSA 4G0NA 4MYSA 4ZVOA 5DNUA 5CX1B 4QTUB 3N0VA 3PX2A 5F4BA 3SBXA 5AKHA 3ZH9B 4EGQA 4YMGA 5FOXA 5AUOB 2X22A 2G09A 1Z2AA 3WGUA 1F7VA 1NNI1 1QZXA 5TGZA 1JJVA 3HGTA 3ZOZA 3M0EA 4MIOA 3AR7A 4FJ2A 3L18A 1YIAA 2AC2A 2GM5A 1CP3A 1IN8A 4A6EA 1WKBA 3PDHA 2C5LA 3LUKA 1CIJA 4RF5A 1BHO1 3GWZA 2O57A 3VAAA 3LVFO 3TKYA 4KBGA 2BJHA 1XQYA 2BFDA 1T9HA 3I9NA 2PWPA 4E7OA 1ULZA 5KVSA 2DR3A 5JD5A 2WG2A 1NYRA 4NZOA 3PIIA 5FNVB 2RGAA 5HTKA 5ENVA 2D2FA 4GEGA 5IKOA 1WX1A 4PC6A 3ADBA 1KI6B 1NRWA 4QODA 4J3JA 2OBBA 5C37A 3ZH2A 2EFCB 1WUHS 1YQWA 2Q29A 3A1VA 2ZBVA 3ESQA 4X1YA 4E2YA 1HE1C 1SRRA 1OV4A 1JI0A 2R8EA 3LHSA 1BDJA 2EGUA 3BS4A 5LMNB 4Y2GA 1T8PA 1UP4A 4U39A 3LDHA 1EI9A 2DT5A 2XWSA 4OM7A 1SUIA 3A2MA 2AXNA 4B31A 3T3OA 3GRAA 3NUZA 1VSBA 3HUFA 1D4OA 4WLNA 4LXYA 1UBSB 2HU5A 4BQEA 3AYZB 5IZCA 1RAFA 4PZAA 3GXOA 4AIIA 3B60A 3NDPA 4D02A 4UM7A 5C5EA 1ABEA 2W8BA 4FQ8A 1U7XA 1QZZA 1F4PA 3BMCB 4G8JA 3S7ZA 2HR1A 2AG0A 4MYHA 5UKDA 1XNJA 4I81A 4WZ6A 1VJDA 1ISJA 2FMHA 3SJUA 4AKEA 1HNNA 4R7GA 4L5BA 3TBHA 4AF8A 3MTEA 3E18A 4G26A 1ZBDA 4RVHA 3AY3A 1X77A 2XRYA 4MW5A 1WF6A 2PT6A 2C29D 3OQ6A 2OZVA 2WI8A 1V16A 1O89A 1PZHA 4QGFA 1AKTA 2XZDA 5A0TA 4LC1A 3GJYA 3W2TA 4P36A 1ZXLA 3OOEA 1XCLA 3FKSA 2FK8A 2DY0A 4ZOAA 3L6BA 4H7PA 3U4AA 3FXAA 5DX8A 1W5FA 3LYHA 4I50B 3B70A 5THXA 4DE5A 1GP2A 1WPRA 1JEOA 2G72A 2O8CA 4EY5A 3O4VA 3TZHA 1NSTA 1L5KA 1TUBB 2JH9A 3FA2A 3ZCXA 2Q1SA 1MAUA 1QCDA 4B32A 1DCTA 2ZTMA 5CR9A 1SQ6A 3PC2A 4UNNA 3VOTA 5CEFA 4KITB 4OK5A 2W6JA 1N78A 1NDHA 1E61A 1DBRA 3DTVD 3G9QA 3NPAA 3PRJA 3RG2A 1G8KA 4PZDA 3AZOA 3O74A 4WJKB 1HTTA 4I9NA 4XM1A 4Z5XA 3RIEA 1DIOB 2LDXA 2P9CA 4BVGA 1IOWA 3D6FA 3QKTA 4OMUA 1V35A 1ZLXA 3KELA 3PC7A 2RFLA 4G0MA 5DM2A 3LA8A 3QYJA 1NVVR 3W4JA 3QWIA 4J7CA 3T7JA 2FI1A 3OOJA 4ZMBA 1X7HA 2DULA 4YT2A 3VKVA 1HH4A 2IH4A 2RGCA 4TQAA 3K32A 1JZQA 2IYQA 1EP2B 1NG9A 1WSWA 2PZJA 3HRKA 3D4LA 1X9IA 5BRJA 1D2MA 3HO1A 4A91A 4L7QA 5KHLB 3D02A 3H65A 4EPYA 4EUEA 2A78A 2Y1GA 4RV4A 2FJUA 1RWMA 3AVPA 2ENWA 1TU4A 3E9CA 4CV0A 4I6GA 1X7YA 5KC8A 3VU8A 3GLGA 3RT7A 1USKA 3WKAA 1DUVG 1QKKA 1WTCA 3MJVA 1ZJ6A 4XI9A 2XT0A 3OQNA 2QJRA 5AW3A 2XCLA 1KEVA 2X7JA 2VQEB 1QK3A 3WGJA 2H0AA 3PT5A 2PQ6A 4HATA 3WSWA 1RM0A 2QX6A 3FB4A 1B74A 2G70A 2O7RA 5AUQA 3G9XA 3A26A 3IEKA 3D4IA 1N6NA 4IX1A 1NULA 3PTLA 1ZIOA 3DMTC 4KNVA 16PKA 3SAJA 1N2SA 4LQCA 3U3ZA 3C14C 1TB4A 2K2QB 2JGIA 1ZD8A 4RY2A 3G13A 5JTUA 3HEAA 2V58A 4QGBA 3ZQUA 1ACLA 1I4EB 1R37A 2WF5A 2FV8A 3BPSA 5EGSA 5FJIA 4BZPA 1NVEA 3DVAA 1RRCA 2QYOA 4ZK2A 4G5XA 4C6HA 5BOVA 2FNAA 3HTXA 4NY1A 3KZMA 2AKYA 1GADO 1AKYA 1U11A 2GR9A 3OKCA 4YGYA 2XXAA 2WWXA 2NP6A 2V7GA 1FB5A 2P8SA 3CZ5A 3M5CA 4DEVA 2OCIA 5E9WA 3AVQA 4WESA 3HEBA 4P4UA 3ZD7A 1QG6A 2YBEA 3KKKA 1QE5A 4BNDA 1JDUA 1YMUA 1XQWA 3OZDA 4J07A 4DGSA 5LQRA 3KLMX 1ODSA 1S7CA 3IR7A 3Q0EA 4GSKA 3N8IA 1XLWA 4E2FA 1AX9A 2XECA 2QQGA 1JX6A 4F6RB 1H0KA 1TIKA 3FY4A 1V11B 2A7QA 5KX5A 3BRQA 1RM5A 3IOCA 1GSOA 1JDTA 4P3XA 2DU8A 2NIPA 1Z22A 4XRRA 2VRWA 3MS4A 4IIJF 1GKYA 4CKCA 1U0GA 2VAMA 2OG1A 2QY6A 2VS1A 3KQKA 4CDRA 1RQLA 4YJ3F 1Z34A 4FR5A 2OGZA 3DXXA 1JAIA 1PFYA 2XV1A 3MWKA 1QPBA 1K1EA 2NXNA 3UBMA 1Y80A 3EW7A 1K7FB 4MJ7A 3UBTA 3SJAA 2JIRA 1ZEJA 4RH3A 1SU4A 1B23P 2WTMA 1NJ1A 1Q1QA 2VJCA 2LCFA 3WV5A 3ZV7A 5FAKA 2ZSIA 5IASA 2BYTA 2CHUA 5BQOA 1CEYA 1DINA 4YASA 5ICEA 5T64A 3TGLA 4LRWA 1RQGA 3NBKA 1UXIA 4TLMB 3SQLA 4DGQA 3LS2A 2AYZA 3F78A 2G9QA 4JOQA 4PNPA 4RJIA 3R5TA 4XW2A 2DXIA 1IZYA 4YECA 3WA7A 3O4FA 4MV9A 3I3OA 4LHSA 3TX6A 1ZUIA 2PQ2A 2QYSA 3OZBA 1SBQA 1SU7A 1ULSA 3L7IA 3W3AD 3EMVA 2GERA 1UEXC 2HF8A 2OVBA 5D87A 4EF4A 4QM6A 3RIHA 2ZYHA 4ENRA 4OGWA 1P9RA 3IAXA 1YI0A 1PQPA 5EQJB 1YDEA 1AGPA 5HMLA 3K9BA 1AV7A 1O5TA 1UT5A 2J9FA 1FTQA 2HLDD 4PVDA 5F7OA 4OQ4A 4LWQA 4XTRA 1QKIA 3G2LA 4LRQA 4XFJA 3KE9A 5E7JA 4A2CA 3VPXA 4CR6A 4AG3A 2QPOA 2XWQA 2IHBA 2QRGA 4I08A 4WBXC 2ZBDA 2R6R1 3BCRA 4OB8A 2PIDA 4ZO9A 1IZ0A 3ILHA 4P92A 4ROTA 1NBMA 3ZTTA 1GRRA 1JR6A 3JZMA 3HDHA 2NO6A 4HG2A 4KTVE 4EKYA 4RMIA 1SVIA 3JD1A 1KMIY 3RGGA 1JEYB 1NLUA 1J2JA 1Y8AA 3PRYA 4H7IA 1Q92A 3UMJA 5DYIA 4D1YA 1LPMA 2FZGA 2V55B 2WUWE 1LPNA 2QN7A 3B3AA 3FNBA 2HWXA 4MW2A 4K1XA 4MUFA 3NAQA 1SKMA 1S96A 4KNWA 3U3MA 4HAZA 3R0JA 2WHEA 2ZPTX 1UQRA 1XD2A 3D7MA 3MG9A 4QBGB 5CLIA 2MYTA 3NONA 3OSUA 3SHVA 4W5TA 2XMZA 2QRLA 5DNEA 1GG5A 2QTVA 1U0EA 2C7QA 5HRCA 3D8TA 1VQ1A 4DR4B 3WK8A 1ODKA 1ZOIA 1IMOA 1FDVA 4B7CA 4PBSA 1ZAKA 2FW1A 3A7DA 1A8HA 3KR2A 5IMBA 4NDAA 4P3KA 3E27A 4Q4JB 4YBZA 2Z9CA 1M5UA 1KEUA 3GAAA 1FNDA 1XEAA 2QTWB 3KOZA 5EUCA 3RT1A 1O08A 1JJBA 4IIGA 4Z2YA 4F8EA 3LDUA 1PWHA 5FV7A 1NNUA 1N6LA 1V48A 1Z88A 1P7YA 4LHEA 4WINA 1V8BA 3LWNA 2PNFA 2BEVB 3LI2A 5I7WA 3B36A 3M70A 4O4IA 4INOA 4UNPA 5C1DA 1IEVA 4PVCA 4X64B 2R2GA 2WFLB 1OILA 4FMDB 4G01B 1U8TA 2HRCA 3HA7A 2JCYA 1MAAA 4FFBB 4R9SA 5EJAA 3PV0A 1YASA 3K09C 1KJJA 2I5PO 3AJEA 3HYSA 2XUAA 4KG7A 4LJSA 4QOJA 3GU3A 2E6KA 4PNHA 3NHSA 1FY2A 3QWAA 4MPJA 2QL7A 3S4YA 1DXQA 4JBGA 1YB4A 2PL1A 4WSOA 4O1MA 2P0AA 3IERA 4R8KA 2F1RA 3NC4A 4L4YA 2ZE6A 4BX3A 1DQYA 3VPBA 2LWIA 3GRCA 2JD1A 2OCPA 4M1MA 5BR4A 3BAFA 3LKVA 2OZLA 4XQEA 5LZ9A 1Q7CA 2BHLA 2YN2A 4C0HA 1MV8A 5C7YA 1J0BA 1IHOA 1PQUA 4JJZA 4L57A 1P0MA 2IK8A 4R8SA 1FYDA 4Q1FA 3UJBA 4CU2A 4D9EA 5CB4F 1ZGCA 2ZSEA 2WVHA 3RUDA 3KB2A 1LBSA 1QVZA 1D2CA 4OXNA 3RPEA 1C3VA 2VZEA 3FFXA 1O6ZA 1ZGAA 4MV1A 2FR8A 3TSZA 4NIMA 4QM7A 1LDMA 2NT3A 2XQFA 3T7EA 2JNWA 3IDFA 3NOOA 4IDPA 3W5UA 3BJIC 1KZYC 5JCJD 1FFSA 3DYVA 4I55A 4BQSA 2FA9A 1MAHA 4BN0A 4BCBA 4BVBA 3ONVA 2HRRA 1AZLA 5ALFA 3VPAA 4EI9A 1ZJZA 3M7IA 1G1AA 1RD4A 3OPVA 1P9LA 1JFFA 4Q1EA 3T5CA 2YS7A 1IQ0A 1XZKA 2F43B 1XFAA 1YZFA 3OWHA 1XF9A 1JDNA 1TO6A 1VHJA 3CUWA 2J41A 5JEDA 3KJFA 2ODAA 2WYVA 3TKAA 2NNLD 4NBSA 5HTOA 1DUIA 3MJ4A 1IN4A 1XN1A 1LSUA 2VF5X 2F3SA 4LDAA 2HSJA 5HILA 1RYFA 4D99A 5FWDA 5LA6A 5H8WA 1KAHA 5TQ0A 2C3UA 5EZSA 3VMMA 1YIOA 1G66A 1AN0A 1KP3A 3H8SA 5K8IA 5G4LA 1Z6XA 4ENVA 2RJ3A 1EAMA 2ADFA 4HNAB 2WZCA 4B6QA 5B58T 2ZPAA 2P9TA 3KOWA 4C4AA 1Z18A 4IVQA 4PLCA 4YAJA 3VC2A 1D4ZA 3Q2IA 2LV8A 4U4AA 2BEWB 2JAWA 3CNHA 1PD0A 5TIIA 3VH2A 4GGPA 1T25A 2XMSA 3IHKA 4IAOA 4D45A 3SWWA 1NVGA 2O3RA 2HK6A 2DAPA 4MPPA 5I48A 4RD1A 3CU5A 4TV8A 2J7KA 4WT7A 3OJFA 1QV6A 2Z5LA 2XDQB 3SVLA 3QBTA 2QSJA 4K40A 4S1OA 3RC3A 5FWXA 2Q3CA 2X19A 4PO8A 4LISA 1Z7WA 5DCUA 4ZZ0A 5EZYF 4QQ8A 4H7HA 4IWYA 1YBMA 3ZTWA 3D2CA 3JQEA 4A5SA 2GN0A 2YWRA 1DBIA 1USIA 2RG7A 3D31A 2HADA 2BEVA 3GP3A 5KDLA 5BN3B 4JUFA 1RPJA 1Z6QA 3OLXA 3CW8X 4DZRA 2ZJ3A 2CLOB 4UPEA 3O84A 1R0XA 1LPOA 3K0AA 4Z4FA 3NIBA 4EUKA 4LF7B 3F3KA 2ORIA 1QGZA 2IRWA 2EX0A 2EBUA 1VLMA 1T5BA 4UHEA 5SICE 4CT0A 4URZR 4RMNA 4HEA1 3GLFA 4NOLA 2ZRHA 5TE9A 3CH5A 1UBEA 3OIFA 4MWCA 4OJQA 3TAUA 4DCVA 2OHJA 4KRGA 2X9GA 1SK9A 2I6UA 5HGJA 4WEQA 2JRLA 3O47A 3KG2A 1QKJA 3DVQX 2EJVA 1H3EA 4MHOA 4AAYA 4JY7A 4WOJA 1RXIA 2CMDA 1RLTA 3W5AA 2X9LA 1QUEA 1U3VA 2Q0QA 2Q5HA 4JX8A 1SC6A 3JQCA 3E2MA 1STOA 4I9GA 2B8WA 3WQHA 3DLPX 2PKWA 1VBFA 3JQQA 4MV8A 3VZPA 5BMOA 1WPQA 1BS9A 3H11B 4TXNA 4MQ6A 4GKKB 3TGWA 5AVSA 5LSAA 1XJCA 1Y42X 4B6JA 3KTAA 3HO6A 1GA6A 2NTNA 4HNRA 2FPPB 3AFNA 3DYBA 3A9SA 1NONA 3KPVA 5LLSA 2IXAA 4US2R 1VA4A 4M0PA 4BO8A 4EW6A 1M7BA 3CLUD 5AFSA 3O31A 5AVVA 5FA8A 2NO4A 5C7OO 1JI3A 4QRHA 5AVXA 3OEED 4CLEA 3K9FC 3KC2A 3L1VA 4B47A 1GZUA 3WJ2A 4G1UC 1VL1A 1X7GA 4OSEA 5EPOA 3ZE7A 1RM4A 1ZH4A 4N5DA 2QHXA 2X9VA 3NC1C 2HMSA 1AS3A 5AJYA 5HE9A 3GDWA 3L07A 3UGTA 4R3UC 3CUTA 2H6EA 3QKSB 4IJ6A 2E4XA 3V2IA 4BV3A 5JR3A 2Z6AA 5CPBA 2CVHA 3B1WA 1GRNA 4DRXA 3M9XA 1BWRA 3PSAA 4X7PA 1TA4A 1MB2A 4XARA 3RVRA 2HD4A 3IEIA 3QFFA 2Z8YA 1HFEL 4A15A 5ESDA 4YJ2A 1V8OA 2XVYA 3WGOA 1U1CA 4WN9B 1XAGA 1JSRA 4R8VA 5HIIA 1G3IA 3LFUA 1FBTA 1N92A 3VAZA 3ANLA 1YJBA 4S0ZA 1PR5A 1GAWA 5BY2A 4NFHA 1N8KA 4PZEA 1YL6A 3C8UA 4MQFA 4U3JA 1Z4JA 2HXYA 2WJGA 1A2OA 3SNHA 2NZWA 2A88A 2EJCA 2J0UA 4PTZA 5JS8A 3TDNA 1SUSA 2OCYC 2O07A 4MRVA 1CFJA 2OAQ1 4P81A 5BSEA 3G0HA 1SXJA 5IK2D 5KTMA 4FWTA 1C0KA 2F1JA 4QUEA 2EZ9A 3P2YA 4AD8A 4JX9A 4E30A 1SXJE 4NICA 4WOKA 1X7ZB 2IPAB 3DKPA 2ZR8A 4ADSG 5IF9A 2J3IA 1LKZA 1C1DB 4KXYA 4P22A 4CQMB 4CEJA 4NBKA 1I6LA 2CUNA 1EJ0A 2QVGA 4QGAA 5E2IA 3L0DA 3A3KA 4FEEA 3RI3A 1HE5A 3F73A 2VP0A 1OWOA 2J5BA 1MN6A 4BRUA 3OJLA 1PP4A 4PQFA 4PYIA 5B1SA 3JPWA 5JVDF 3GH1A 4JAVC 4RE5A 4GQAA 5LZ4A 4R2HA 1SCUB 1TW3A 2A1UA 1PS8A 5IANA 2NYUA 2RAUA 1OI4A 2GS9A 2Q41A 1A71A 4XPIB 1KYZA 3DVSX 2P2LA 2HCBA 3K53A 3VISA 4DV3B 4WA7A 3H6KA 2QVZX 4NU0A 2IBTA 4FCWA 3U40A 3EVFA 1R6BX 2UUPA 3OLWA 2YJNA 3MXTA 5FI3A 1FP4A 2EAUA 3ZWCA 4IXNA 2B8NA 3LGSA 5FR1A 2ZBGA 2ZZKA 4TKVB 1Q20A 3SC2B 1U8FO 2G9ZA 1M76A 2PS9A 3ESDA 1XYGA 5BV2P 3F7TA 2PEYA 4PZYA 4JUBA 4UCWA 1BE1A 5I7SA 1QRRA 3ABSB 3KFLA 4GPEA 1SD2A 1ZXBA 2C3OA 1HL7A 4D44A 1N6PA 1Z4KA 3VM6A 5L7TA 1EGVB 2BMWA 3TTTA 4N5IX 2O3QA 3HUUA 2QZJA 2VH2A 3BCSA 1AXRA 2CNNA 2XBUA 3FLMA 5L3SB 4CQJA 3IIKA 1IY8A 4LVCA 3L0CA 1CDDA 1QIEA 4ZA2A 2AE1A 1GZ7A 2Z5VA 5C1PA 2JI4A 5TQVA 2VUUA 5EYPB 2HKIA 5BPHA 4MUNA 4EECA 5I6DA 1T9GR 1AU9A 4A2PA 1JZTA 2XB2A 1N1MA 5G0VA 4FYJA 4A16A 4UATA 1L8AA 3W5SA 2RHWA 5HE8A 1OJLA 4BRSA 4R2KA 3D8RA 2M9MA 4TYPA 4U6QA 1YB5A 4BE4A 5EJ7A 2IYPA 1O97D 4QYMA 1NM5C 5TMDA 3MAGA 1BVUA 4WXYB 2Q2NA 3P9XA 5LZ5A 1D1PA 2WOJA 1U2DC 1L5HA 3DVLA 1H1LB 4BNNA 1KZ7B 5DISB 5A5VA 1A9YA 2XE8A 1VE7A 1GPWB 3S81A 4NE9A 2YDYA 3AEKB 3R0XA 4Y9TA 5IJXA 4YAKA 1LRKA 1E9RA 5CX1A 4OI2A 1Y5RA 5JNLA 3C7DB 1QCYA 3CF4G 4HDSA 2GUWA 1XO1A 5M7EA 5C1IA 5LJIA 2OORA 3R3VA 5HZKA 1WXDA 5AI9A 4QPCA 3ZU5A 3GRPA 4B0OA 3MTDA 4XEUA 3ELBA 3ECAA 4NS4A 1RRVA 2UZ1B 5F78A 1EHIA 3FD8A 3GQBA 3K6JA 3LGAA 4LNUA 1YRHA 1PNTA 4HGOA 4YAWA 4B2LA 1CC1S 2HQBA 3R9XA 4CUKA 1Q83A 1MO4A 2QRVB 1DARA 4URWR 1G7RA 1IK4A 1BG6A 3DE7X 2PUFA 5H83A 3NT5A 1N36B 5BURA 1P4JA 2N47A 4LE2A 5IT5A 3LW8A 5EP4A 2V98A 3LWBA 2RGUA 3RE1A 2W6OA 2Q3DA 4LS3A 1B0ZA 1VHQA 3IEXA 5E6UB 2JAHA 1EPUA 2FMIA 2C94A 1TPZA 2H5IA 3QTBA 1I6MA 2WAMA 2QQ5A 3FAKA 3BICA 4R7TA 1ES9A 4NVRA 3TLBA 4PPYA 3GGDA 3PQ3A 3OECA 1TQDA 2VJLA 2W2PA 4L8GA 4PQYA 1YR7A 1Z8NA 4PLPA 4ENTA 5HVNA 3NH9A 8OHMA 5K6RA 4BMNA 3LG2A 4NECA 3GLGB 2LKCA 1G9SA 1GTJ1 2AI1A 2V7UA 4KGDA 1BKYA 1PFQA 3D8SA 4RACA 2WW8A 1SCUA 2A1UB 2FW7A 2CJYA 3R3YA 4WJZA 5B4UA 4E31A 1LQUA 1OZGA 4HDRB 3BK1A 1BCRA 1PJLA 1F20A 3U17A 3IAFA 3MC1A 1OLUA 5L95A 3ND8A 2FPUA 3PZBA 3TXAA 2ZIUB 2QLJA 1VIAA 2OQIA 2EVWX 1WXIA 3W8NA 1TQ2A 4IXDA 1RXSA 3EMKA 4E46A 4IIDA 4LZOA 1WP9A 5E9JA 1UMDB 3WGIA 5LDGA 3EUAA 4P54A 3SICE 5B1YA 3L04A 4E1VA 4WZBB 1VLHA 4F4HA 1KYVA 1Y6ZA 3U4HA 2WJ6A 4XIGS 1QTIA 3KVNA 4OSPA 1N8TA 1YK0A 1N2XA 1VYVA 1Y8QA 3UW1A 5AW4A 2VTVA 5B1HA 4C3ZA 2VCYA 3ZVLA 2BZ1A 4IZHA 1PSWA 3PGKA 1GRQA 1Q1EA 2FUEA 3QH4A 4FILA 4AO7A 1RKXA 5IAOA 4L78A 2AC4A 4URFA 4YYEA 4B33A 5J43A 2QQEA 4PAQA 2RGNC 3SXPA 1BA3A 1J20A 1LJ8A 4LBWA 4BNKA 1TADA 4J3FA 1LNQA 2ZYRA 4UFNA 5A4JA 1NUQA 4FCTA 1PT7A 2ACWA 1VBKA 4IQFA 4YVFA 3B5JA 4B4KA 4B5KA 1YH3A 2IXDA 2XH8A 4WHMA 1M5RA 1CB7A 1NVMB 1BRTA 3LP5A 2NU9B 4XX0A 3CRQA 4MIYA 1T4GA 3LLMA 3LQKA 4KX5A 4A8PA 4TTVA 4PSAA 1F1BA 3ZGNA 1DEXA 1E8DA 4RFVA 3IMFA 5BT9A 4B1FA 4EVSA 4JP3A 5ITZB 1PR0A 4CEHB 1YDFA 2O1WA 4N6GA 3B8HA 3H7AA 4PN7A 4ZIRA 9LDBA 2QWXA 4QT4A 3LT0A 3GZNB 4DCCA 4HUTA 3L93A 2E37A 3J7TA 3NAMA 5DCYA 1T6NA 5CB0A 4JJAA 1IRIA 4ZAXA 1NFRA 3RUCA 2I7XA 5L4SA 5L8VA 2XUKA 4JI3B 1QP4A 3U7RA 1J1IA 1UZMA 1ANKA 4BQPA 4I50F 1Q14A 1YVDA 4E22A 4QJ4A 1THMA 3RUPA 1OW3B 3FLAA 3P0RA 3KAPA 1T1RA 3O3CA 5EHIA 3REOA 3WP1B 3M6XA 3JZAA 2TSYB 2ZRBA 2FRDA 4IDBA 2A30A 1E79D 4XIFA 1CE8B 1YT5A 1E1RD 4I1PA 3LHDA 1IZZA 2VK2A 3PC4A 4NAHA 1LJUA 2FYTA 1O5IA 4NATA 1K7SN 5HHTA 3OJXA 2ZTLA 4QXAA 3F6BX 4JH0A 5E9AA 3VOSA 1EJBA 1AH2A 2IX3A 4OHYA 4YRNA 1HE8B 1ZR4A 5HSGA 1V4BA 2OXRA 3RYHB 1OA1A 2Z6QA 3LQ1A 4MIKA 3UKJA 2AZMA 1L7NA 4PG8A 3CM0A 3M83A 4E13A 5E1DA 1XTBA 1WEKA 4U2KA 4AJPA 2P4SA 2HWWA 2Q9BA 2AH5A 3HCWA 2VTBA 5F52A 3JASB 4DR2B 4OLHA 3OPXA 1OH7A 3IAM6 4FMDF 4RZQA 1G5PA 4OEHA 4UREA 1NT2A 2YMMA 3AKEA 3BL5A 3C43A 1JE0A 2GAOA 4RNCA 2ZVQX 2WSSA 3VR3D 2OFFA 3VU9B 1ABFA 1QPGA 4BRWA 1W19A 3GA7A 1K68A 2GNOA 3HBJA 3A36A 5HZMA 2ST1A 2OQRA 3ETHA 4ER3A 1QJ4A 1V1MA 4UBNA 4XXHA 3QVJA 5B53A 3SZLA 2XE6A 2E55A 4MZDA 1LX6A 1MNQA 2H17A 1PT9A 2BCEA 3EXFB 4FEAA 2FEOA 3SJ7A 3WTBA 4HH4A 4JP2A 2QN9A 3O2SB 2WU1A 1T4DA 3K7EA 4IV5A 5ALTA 5HQ3B 3F5QA 2C8VA 5JADA 3RR2A 4S24A 4LMPA 5DBEX 3U3DA 4YHHB 1TEZA 1Q2XA 1KE2A 4BKMA 2FWNA 2PXAA 1G2PA 3UG6A 3CEJA 3OP4A 5CYOA 1Y4ZA 3JAWA 3IESA 2V1XA 3FUCA 3FNFA 1XC7A 2XOXA 3JW8A 1ZNYA 4DMCA 1Z6ZA 5FBHA 2B4RO 4YUAA 3EBPA 4EB3A 2ZE5A 3BHMA 2HQRA 3D3JA 4OHFA 4EUSA 1KJQA 3EISA 2CUTA 4M9XA 3EASA 1WDWB 1TYDE 2FF7A 1O95D 2O5VA 2FXIA 4KIGA 1DAEA 2GAIA 4RD4A 4OQZA 4X1KA 4PTLA 3C6QA 4AF6A 1KHHA 4TLLB 1Q7TA 3KKQA 4RIIA 3ECCA 1GY8A 1IPHA 5G4KA 2CEAA 4WZBE 3U56A 3UB4A 1OAAA 1SEPA 3E5MA 4FDUA 4PYRA 1PZEA 2CN1A 3U6KA 2JFWA 3R0VA 2MMCA 2JI7A 2BAGA 1SZCA 3PFBA 1P7CA 2NP7A 2VSNA 4YXFA 1MCZA 1UMBA 5F9HA 2ZZNA 2HBZA 3CSDA 2W6NA 3WGYA 4EG6A 5L6MB 3EGVA 1LVGA 1NTOA 1D4AA 3KSRA 1T4BA 2VDPB 5C7LO 3DR5A 2IV7A 4M55A 4QVIA 3M82A 3OQOA 2AJCA 4UD6A 5DCLA 1FNMA 4DJAA 1RKBA 3EFOB 1K4YA 1MH9A 2GHIA 3MYYA 2Y05A 2I1LA 1NW9B 2Z83A 2CXOA 2CLKB 3U31A 1QCCA 5LBUA 4LWZA 3BMNB 3UUFA 3W1VA 1VRVA 4I4IA 4LTMA 1TJYA 1FYEA 2BRUC 3ZNPA 5CB4A 4RTMA 1EA7A 3OI7A 4A36A 4Y9DA 3KNZA 4MKIA 5KSWB 2P35A 4LXGA 4RESA 3ZZMA 5FPKA 3TZCA 1NW7A 1JEYA 3AL0C 2I4IA 1SUAA 3PVCA 4U1RA 2RHHA 1YGYA 2C96A 4PR0A 3UM9A 2Q8PA 4F2WA 4NYMQ 2IU0A 1J2EA 3FCXA 3CN7A 1L9XA 3QA9A 3GDHA 4MV0A 4O0LA 4TMWA 2B8TA 3PWTA 4TTTS 5ILGA 1KDYA 3UMBA 3U5TA 1Y7TA 5ULLA 1X0VA 3B9PA 2BEUA 3AT1A 5DXAA 3I6ZA 1YR8A 5FOVA 2PRYA 5K0JA 1OXXK 1N6OA 4XM0A 5CNIA 4AP6A 3FMGA 4C4YA 1FLAA 2JLQA 4WBNB 5ABPA 1F2UB 2BFNA 2HK7A 4ESEA 1PKXA 2IEDA 1D6MA 1QMGA 3RYIA 4V0NA 1JIVA 3UAVA 2GESA 1ZK4A 3G7UA 1UC9A 3BHJA 3IDOA 3ROEA 4R3NA 1Y6FA 1TVKB 4O33A 3W8EA 2Q0XA 3S29A 5BNWA 1CX9B 4PONA 2H5JA 3JZFA 2CCJA 1QIKA 4MQMA 2QUJA 1E0SA 4YX9A 2HRZA 1EYZA 4TLEA 3RIYA 3HDGA 3TD2A 2IF0A 4PLTA 3ILXA 3I9LA 1ISFA 4Y2YA 5JANA 3A9VA 3QBEA 1R8QA 4RLQA 1JLSA 1E3SA 2YC2C 3FB1A 4BAGA 2IHNA 2GX6A 1PW7A 4HYEA 4NOMA 3E03A 1KBOA 1VJCA 1E3WB 2VF2A 5E3JA 5KQSA 1WDLA 3H2IA 1DTSA 4DNFA 1J8QA 1RKUA 1KQPA 4CM4A 4TYWA 1MG0A 2IEAA 4M1YA 3AEUB 3IPLA 1VG8A 1Q19A 3AP1A 1EDOA 2A0FA 2FKNA 2HPAA 3L02A 1SCDA 1CJUC 4CKCB 1DRKA 2G80A 1U8AA 2GUGA 5I9SA 5JYCA 5KYWB 3EGDB 4Y67A 1P74A 3Q2OA 3RODA 3G88A 5LJLA 5C8XA 2JJYA 1HDXA 2PGLA 1LSJA 4DDKA 1KO4A 4HY3A 4URXR 1V3UA 2PX0A 3AUAA 1M3SA 4TLBA 1ZCFA 4RJJA 5GGYA 3SX2A 3LYLA 4CFYA 4D4MA 1JKMA 3ZHRA 2VLBA 1FTSA 2X3FA 3IV7A 1DLJA 2XD4A 4AZSA 4HMPA 1I7SB 1UMBB 2XNCA 4GXRA 4HPWA 1N6RA 1ULAA 1XMVA 4RSRA 5H02A 1UODA 4RTSA 1V6AA 3EGXB 3I1YA 4KLZA 3OTWA 4YQYA 2PFSA 2OESA 3WQRA 4MO9A 3EIOA 4EQ6B 5KJEA 5EJ6A 1RHQA 4IFIA 4B7XA 3FIJA 4RZ3A 4C07A 2BTEA 3G2JA 3N59A 5KAMA 2E87A 1KFKB 1YACA 4ZVVA 1KFCB 3FDJA 2WE7A 1QF7A 2H1IA 4ZN6A 1X3SA 3BMNA 3A2KA 3A1TA 1AQUA 2W2NA 1CYDA 2ZRGA 3L3BA 4E33A 2BGTA 5F51A 4M8LA 3A3PA 2Y1OA 4OGGA 4Y2SA 3IMCA 5JY6A 5HZHA 1EESA 3VUEA 4F84A 1FVOA 1ZCBA 1ZVMA 2FZVA 3IMGA 1D7OA 2XVZA 2CVQA 4HGPA 2WUFA 4KLCA 4UVDA 5BORA 1FSPA 1OB2A 4K26A 2C54A 3BDIA 3DE3X 1F9AA 3K70D 2ZJFA 3UHAA 1CRZA 2DWQA 3QF4B 4G0OA 4NU5A 4RTNA 5A6SA 4C20A 3QOXA 4OBEA 1D07A 3H2JA 5DWQA 3GFSA 1UBJS 1KI1A 5KTKA 3IODA 3E0QA 1PL7A 3QLVC 4HK4A 3D1VA 3NVAA 1IEXA 2YQ5A 1UKZA 1KQGA 4Z3OA 2HF2A 2Q7OE 1A2KC 2QUBA 3BWBA 1Q0SA 2DFKB 2A58A 3F1KA 1I30A 3KU1A 1OZHA 3EZYA 4MTCA 4J0HA 2IYWA 2DG2A 4CFSA 1MO5A 2F9LA 3IT0A 4G3XA 4GRIA 4U5QA 2HU7A 3A6FA 5IKEA 4DRXB 1QTNA 4C4XA 2QVYX 1KR2A 3GT0A 3TM4A 4JT8A 1MX1A 2JLRA 2O05A 1X0XA 4Q7EA 4YWJA 5ALIA 3LY9A 3TCKA 4TKUA 1Q0TA 1FSSA 3FE2A 4K0RA 1NI3A 4C4TA 4LFAB 3EBOA 4JLNA 1NPYA 5F1YA 1GFIA 4DJFC 5DBGA 2X5XA 1YZHA 1L3IA 1M2KA 3A6EA 3R3UA 4ZZ3A 1IUPA 4EABA 1PW5A 3DO6A 5KNDH 4RVFA 4BGIA 2AZXA 1OGIA 2I78A 1VG1A 4HWOA 4BN4A 1QB8A 2AMFA 4UAVA 5CCDA 2YH2A 3OIVA 1T3GA 1VHTA 4EPTA 4F5DA 4ALMA 2OD7A 3G0GA 4O2BA 4O4JA 5DBFA 2AUNA 1REQA 3R7BA 1JKFA 3ABZA 3A1SA 3F4KA 5BXQC 3IT1A 5ER6A 3OEWA 3G7NA 1EVKA 2RBKA 3OEHA 4DCOA 2R3SA 3KVYA 2X9NA 3OZFA 2FX3A 1REQB 5HM6A 1KSFX 5DWDA 1JJFA 2Q5FA 1SPBS 1GCOA 1UKCA 5DEOA 1XXLA 4MDYA 3D5EA 4JXKA 1NV8A 3WMEA 3ZHXA 3EFOA 4YV7A 3K2IA 3GGCA 4O2AA 5FRDA 2DWUA 4MQBA 3T15A 1Q7GA 3KQOA 3K96A 8ATCA 1ESNA 4KQJA 1W6UA 1Y4AE 1TF7A 2DFTA 1B2RA 1XKTA 2JGDA 3I1JA 4HWKA 2C9CA 3JSAA 3K5PA 1X8LA 4KSYA 4TN5A 1VLLA 1XCMA 2D3TA 4KFRA 4RGBA 5GGXA 1G7TA 1PYOA 3OMLA 4RTJA 4YJDA 2QBYB 4F60A 4HX2A 3FMPB 1EBBA 3PQ2A 4GOLD 2BGLA 4KQKA 2QEQA 1B6GA 1ZZGA 1XVTA 2Y9MB 3KSZO 3OJEA 2O8EB 1YZUA 1WBBA 2CFCA 2W2LD 1H2AS 3BWXA 4IMPA 1TLFA 1YJCA 1YB1A 1ZGJA 4RK5A 4ME6A 4JC5A 5TEVA 2DGDA 1R0SA 3G68A 4AY6A 5EG5A 2RHBA 2VXOA 3NV7A 3GEMA 4BKRA 1RWPA 3D4OA 4AB1A 1JQAA 3MWLA 2PZKA 2YJ5A 2VIIA 5JH7F 3OJCA 2I1QA 2L0XA 2FPOA 3F7NA 4G1MB 5EJ9A 3EXAA 3IIEA 4V0SA 2JLWA 2CXNA 1BHQ1 2QRUA 2VDLB 3N05A 4YMWA 3QE9Y 3FAZA 3ZWNA 2AOVA 3MWEA 3DAGA 3R24A 1HC7A 1HT1E 2IYLD 2F48A 2A5FA 2P67A 3MTIA 3RSQA 3NRJA 2I29A 2IEYA 1WOYA 3RTCA 3OZAA 3WDMA 4BMZA 1Z4LA 3TLYA 3JD2A 1IVYA 3VVCA 1BDIA 1CUCA 3WIEA 3JTMA 1Z37A 2ZR9A 3GNQA 3L8GA 3RRBA 4DDUA 1F0KA 1XXHE 4DLPA 5CBKA 2FPLA 1QM5A 3OLYA 1OBOA 2HNAA 2P9JA 3PNLA 3LLUA 3QE0A 1WMBA 3E05A 4AZWA 2JLXA 3G6KA 4QYIB 1CUEA 1F6WA 2ZATA 3LXUX 5I4IA 3DB2A 4CTKA 3VZDA 4ENWA 1D1QA 1FFXA 1USGA 2H16A 5I7HA 1VPWA 4AMUA 3B89A 4GWGA 2BONA 4K86A 4CKXA 4F04A 2EL9A 2IXFA 2I7CA 1SXJB 1TUIA 3WA6A 2XUJA 2R8YA 1ZJWA 3T52A 3FUWA 3R5FA 2BFWA 1SVWA 4WZAB 2QSZA 1OH5A 2CNOA 3MUFA 5JE8A 5A1TA 4I1UA 5C1OA 4BU0A 3EGWA 2P3OA 3CNBA 1QS0A 3H2HA 4E07A 4LXQA 3DKVA 2PVSA 5PGMA 5C4IA 4IVRA 3NYIA 2BMAA 4J0GA 2WZDA 3CX3A 5FV4A 4CJXA 4PIPA 3TTXA 4TMZA 1EFPA 1T4CA 2OUIA 1H2XA 1V39A 3F3YA 3LCRA 1RCUA 2PX5A 2ZJ0A 2FLVA 2GLXA 3O8QA 4BFLA 4D0SA 1DB3A 3ORSA 3A9RA 5U4QA 1KI3A 1JRLA 5EJMA 4FLMA 1OYYA 1U2DA 1RTTA 1H4VB 1JG7A 4HQ6A 3TZ6A 4JI8B 2Q6LA 3I72A 3K2BA 4RHYA 4TLAA 2FE4A 4L72A 2MT9A 4OXXA 4C30A 2Z1NA 4QRIA 5IBCA 3T7IA 2IEIA 2XODA 3MS2A 4DCJA 1HKHA 4AJ4A 2IYXA 1NTRA 1EUZA 5AK0A 3QW2A 2CFSA 3ZK9A 4BLQA 4LCBA 2YUTA 1UPCA 4C3UA 4UARA 4WDRA 1ZSNA 4ZKEA 2BH2A 1RACA 2PDAA 4PTYA 3SU8A 2NAFA 1W5AA 3DKRA 4GWKA 3OLQA 5HPYB 2I65A 4AJIA 5J2UA 3FMFA 2C3MA 3KR1A 1XZPA 3IPXA 3KS9A 3OZWA 5FUMA 4ZKDA 2GD6A 1T29A 2FQ1A 1R0LA 1TA9A 5LP6F 2ZUEA 1R0KA 2PMCA 1RNLA 4NEQA 2X8WA 2C5AA 3D3EA 5ARBA 1G4UR 4FCCA 3NOXA 4LZAA 2WSBA 1PSZA 2YY6A 2R0QC 3WKCA 3VJRA 5F2NA 4IEIA 2W2MA 4GRDA 3VRHA 1R00A 4Q01A 4YCJA 2AN3A 1MJNA 2B83A 4JJ6A 4BMVA 5AJTA 5DN6A 3E7FA 1UJ4A 1KK0A 2FLWA 2ODPA 2OFOA 4CLRA 4FBLA 2HRQA 4LOAA 4PC2A 4Q15A 5EQDA 4QG3A 4WFQA 1O95C 1DUSA 1AQJA 3R3HA 2PH5A 1E6LA 2EG5A 1ZD4A 2ON6A 5FUYA 2CJPA 3B1FA 2NX2A 2BBOA 1CEXA 1JHMA 1N2CA 4BQRA 3G8CA 2B34A 1WZEA 5C51B 2E5FA 4ZQBA 3PX3A 4MINA 1OYWA 1X8XA 4PU0A 3IC5A 3RVLA 4YMVA 3BH7A 4CCYA 3ZWYA 4GP6A 4LRXA 4QNNA 1BVYF 4KQEA 2QNIA 3WAKA 3F9IA 4GOJA 2VT6A 1RQ7A 1FNCA 1QFJA 2X15A 3OT4A 4IH9A 2JGKA 2WFMA 1TVCA 1U31A 2ID4A 1SRQA 1IFXA 3LUDA 1U5BB 2QY9A 3RAFC 5CA0B 4MHTA 3QX8A 3BGDA 2Q1WA 1IWBB 1CTQA 3A06A 3L1JA 3PXXA 4HRVA 3EXIB 4K5QA 1B8UA 4L51A 4N0PA 4DQVA 4PC1A 1KYTA 1OREA 1N6HA 1KDZA 1VP9A 5CIYA 2B78A 3P1JA 1TYEB 4EY6A 5KJ1A 5KNLA 4KU4A 4X71A 2NVOA 1Z38A 2J45A 4B9EA 3BBLA 1OH8A 2UVDA 4J1QA 2HIGA 5K3DA 5JAOA 5T3UA 4FS8A 4WXMA 3MUNA 2EJWA 1Z5WA 5KOHB 3WGLA 4C7OA 3WLJA 5CB4B 1SM4A 2JFNA 4C0WA 1U3DA 3N0RA 2GBLA 1B2LA 2HMYB 3HN6A 1KIAA 3RRNA 4D4LA 4N6NA 4E88A 1X9HA 3IQZA 1DG3A 2BMJA 4Y2TA 4ZI5A 3ISTA 4JCOA 2B9VA 4FBMA 4A6DA 2FMFA 1NHWA 3COJA 4P4NA 4IRXA 1PFVA 4TKVA 4J0JA 4DYHA 1ZGGA 4C5BA 4UCQA 1FVFA 1K4MA 1KDRA 2P6MA 2YWJA 3F9CA 2WB2A 1NMXA 1CY6A 2VFAA 2UYCA 4MEJA 4QGHA 1PWXA 1NYQA 3T99A 4HTFB 3WLMA 4PZZA 1DC7A 3F49S 1VKNA 5CDYA 1Q6ZA 2VHWA 4JKOA 4LJ5A 4TMXA 3RV3A 2PK3A 4L50A 3S8MA 2Y67A 3WRXC 4EAAA 1E6EA 2CBXA 1RI5A 1IVSA 2YW2A 4YRMA 5CYFA 4YRKA 3E81A 1UPTA 3AKCA 1IN6A 2GJ4A 3MTQA 4MS4A 3R8XA 4FW9A 3I52A 4WNYA 4MW0A 4NBRA 5B2FA 2DUJA 2P9YA 1AKMA 5AT1A 3VYRB 2NM0A 2DPHA 1M8GA 1KF0A 4GNKA 3K70B 1NY5A 4MS4B 4Z9FA 5HBRA 4F3RA 2XVXA 4D0RA 5CFQA 2BFCB 2Q3MA 5LU9A 1E1KA 2AEMA 1E94E 2P1RA 2Z95A 2A1TS 3IR5A 4K2HA 4L9AA 5B55A 2GWHA 3ILYA 5F12A 2B5VA 3C3CA 2YXNA 3L5KA 4YRRA 3ZWPA 2YS6A 2EOAA 1FDTA 2F55A 4LYFA 2N46A 3UANA 1E96A 1TD9A 1U98A 3TFQA 1JFTA 3PI7A 1KC3A 4JXJA 2P0EA 4NOJA 1DZIA 1GPLA 5KNDA 3U81A 4CEHA 3UJNA 2V4ZA 2V6FA 5I7RA 1CQJB 4R2XA 4Z0TA 2V6IA 3AEKA 2B3DA 4TMKA 4AT1A 1EE1A 4JU9A 1IRXA 1MG5A 4GICA 5DTMA 1SKBA 3DQQA 3EXG2 4I3FA 4EPVA 1S3GA 1HEUA 4JD5A 4MQUA 2LE0A 1CQJA 3KU4A 1YGPA 4F97A 4LEIA 4GXTA 1RRFA 4NU8X 3LQYA 4G5SA 5B64A 4KXLA 4LSWA 1JB9A 3BWMA 1T4CB 4QIHA 2H54A 3S1AB 1DAPA 5BQ5A 4BX8A 3QKRA 3UK0A 3NETA 4XFKA 3UB3A 2F90A 4F4DA 4DMRA 2HQOA 2C82A 1B1AA 1FDSA 3SYNA 5A3SA 3BB4A 3UWKA 3GRRA 4UEWA 2XX3A 3U09A 3DE1X 3BDVA 1ZICA 1CULC 1WO8A 1Y9EA 3KM0A 1XDZA 5TQ2B 1ZCZA 2GILA 1EDBA 1PNVA 1GUDA 2IPLA 3OE7D 2O8DB 3DDHA 2QXTA 1XE3A 1RW4A 4JGBA 4PNEA 2VRBA 4R1LA 5KKAA 1ZN7A 4NNPA 2X1MA 2WU3A 1LDBA 2QT9A 3BVPA 5LA6F 4CG0A 2G5GX 3ZJ5A 2GWRA 2C5SA 3CY6A 1I9CA 5K1ZA 3R3JA 1U2EA 4H6WA 2AN5A 4D82A 1OPXA 2PFGA 4GPBA 5HF5A 3RC2A 3ZWMA 1CV2A 4CIVA 1E5TA 1VPVA 4MVJP 1ZX1A 1OC4A 1TDJA 1U80A 3ZY4A 1PR1A 1TCVA 2ZT7A 1ECBA 3PI6A 2D74A 1TTPB 1N7GA 3IQEA 3LRTA 1PGNA 1ZH6A 5K01A 3ZU6A 4GL4A 2R44A 1U1DA 1U2SA 4BJ3A 4ZTBA 5AW0A 4FINA 3FRJA 3LC7O 4RQBA 2C03A 3IUQA 1J8FA 1O54A 1PFUA 1PGOA 2IOHA 1W93A 4IOLA 2IU4A 2NUBA 5ALKA 5C7IO 4D6YA 3LUBA 3GJ7A 4Q9AA 3RAJA 3ZPXA 1BN7A 1RKQA 3DTYA 4G0QA 4QARA 5GZ1A 3ZEIA 4M0CA 4NENA 5BSKA 2CL6X 4IJQA 2ZJ4A 4DLVA 3OU7A 4JT4A 3W6PA 1B42A 3CRVA 1T43A 3BFJA 2R00A 1VXOA 3IHLA 4Y3UA 1OFUX 3P19A 3ZWVA 5IYZF 4Z1OA 1EP3B 4B34A 2IOFK 1SFRA 1J8VA 3SVTA 2ZSBA 1VJGA 2RGWA 2OO5A 4FFOA 4ZPJA 2OXTA 3B48A 4FFDA 3HABA 4JMLA 4KQCA 1FDOA 3SDBA 2E9SA 3KPYA 4Q18A 3DAFA 4JVMA 2Q4BA 3LUAA 1F2DA 2WMDA 3DL2A 3A9UA 3H2SA 3MSCA 4JEUA 4KQFA 4BO4A 3CTMA 3ZGZA 1W9MA 1A69A 3LSTA 1MPXA 2R9VA 2XEXA 3HJAA 3OZVA 1W87A 3KUCA 5E4JA 1E2JA 1KC1A 1HUQA 2QLLA 1U0LA 2ZIZA 5E6RB 4IFEA 5FBRB 1KMHB 2PU7A 1Y82A 3CX7A 3Q8MA 4JBIA 4FZ3A 2XLBA 3QOFA 3S2FA 4XX0B 3WGGA 4PLFA 3RLFA 3BCHA 2QN1A 1FVHA 3IQIX 4RMHA 5H59A 3HBLA 1R0WA 4QDTA 1WHSA 3VYSB 3DP7A 2GZRA 3R7NA 3A6HA 1XALA 3I4FA 3PR2B 4KMRA 4UMFA 4DLLA 3EXEB 2IP4A 3CCBA 3ND7A 4L0MA 5CCEA 1N2HA 1YRYE 4JLUA 3WAJA 3WS7A 3V5NA 1AKQA 1W0CA 1FFWA 1CYEA 3P2IA 3B3FA 1DX6A 2HSDA 2C61A 3HR8A 3U6BA 4OMCA 2Q6VA 2QRPA 4GP9A 3HKDB 4R69A 1ZM3A 4UUNA 5A71A 3A25A 1ZNXA 3CLHA 4PLGA 4W5HA 3FETA 1XLUA 3I5YA 1QHHB 2CK3D 1GQYA 1V7QA 2M1XA 5FP0A 2ODTX 1HQKA 1YOVB 3N7UA 3GRKA 2QMQA 4IR7A 3A3YA 4TMVA 1W36C 2I1WA 4FYWA 4LKRA 1BXZA 4RXUA 3RYCA 3NU1A 3ONNA 2CXXA 3I62A 2QAJA 1BMFA 1G5FA 4Q3DA 4QDJA 1FDIA 3RVBA 1KVRA 4QUIA 3CV3A 1QO7A 1H2YA 3O7MA 4B8ZA 1PLJA 1T35A 2V59A 3LXRA 1ZW1A 3IBGA 3NBXX 4NJMA 1O1YA 2OPHA 4DCUA 3B2QA 3U3XA 2CKMA 1W73A 4BNXA 1NF8A 2PUJA 2HNKA 1E6MA 4ND2A 2QYHA 1NMZA 1SHUX 2BWJA 3FWYA 2IWRA 3K4PA 3KEQA 3QWHA 1KEZA 3QUSA 2QMHA 4GGMX 1OMOA 4U9IS 3L79A 1DWOA 3GRFA 4AKTA 2C83A 4R1QA 1PK8A 3NLLA 3OX2A 3H4IA 4G36A 3TZEA 2ZQYA 5GJVC 3IDZA 1Y9AA 1UINA 5B3KA 3GPBA 2PZAA 1MIOB 5FULA 4AURA 1EVEA 2AQIA 2JAXA 1A7KA 4TYNA 5TPZD 5GV8A 4ISCA 2H00A 4Q4LA 1OX6A 3QEKA 1TLLA 2ZIFA 1O58A 1JDSA 1P1FA 3K0KA 3N76A 4R9NA 5BW6B 5CEEA 2YWBA 4QDZA 2BTQA 2NV0A 4K6KA 5AH0A 1YR1A 1KJ8A 1QRUA 1CJSA 3E1GA 2X5JO 5EMLA 1JN0A 3UOGA 1YR9A 4P4SA 4BQNA 3T3GA 4HLQB 2HC9A 4AS3A 4MUXA 3F2VA 3ZNOA 3MPUA 4BMDA 1W85B 4EFDA 1MV5A 2FWPA 3M4YA 1RHJA 3QTLA 3H75A 1J24A 2CL5A 1I0IA 4MP6A 4Z9BA 5JD6A 1HR0B 3SKVA 4C78A 4E94A 1CQIB 2CE7A 3LUFA 1FTYA 4RXTA 2H7VA 3FOWA 3QVKA 3BG5A 4JIMA 4CM5A 3H5LA 4E6EA 4YONB 2DH5A 4N5MA 3DLCA 1X94A 3HKCA 4IG9A 4IDOA 5F4ZA 4HDOB 5A62A 3AG5A 3HKEA 4QAJA 3M3HA 2QV7A 4KBFA 1RPTA 4KWHA 1OCEA 1TRHA 3OPQA 3UJDA 1JJAA 5LNK1 4UHHA 4YCSA 2WABA 3GGSA 3VDNB 1J9ZA 1U3UA 1SA0A 2OKCA 1KK3A 3G5TA 3IHTA 1HBJA 3LFTA 2KW5A 4QXPA 4G4JA 4GOOD 2SBTA 1OU4A 4PR3A 2Q07A 1C7FA 5AXDA 3E9ZA 4Z1MA 3RV4A 3KEMA 4P9NA 2V6JA 1XKQA 1P62B 4NBTA 4JJ7A 4RK1A 4B2PA 3CT6A 1GYRA 1K5HA 3IP1A 2OM2A 4CQMD 5EINA 1LCIA 9MHTA 2H8KA 3HGQA 1MVOA 2HA5A 3K1AB 4BNIA 2OHHA 5FR2A 5H68A 3VI3B 3WDKA 5KTTA 1MZVA 3TMYA 4CHGA 1YQTA 2A6PA 5F9MA 3OICA 1ZOOA 3DDCA 2VHEA 4C4RA 4KFTA 1DHRA 1E5QA 2ZUCA 4R81A 3DMFA 3AZQA 2FZ5A 1RRPA 1YZLA 4M1KA 2DHRA 3SDSA 3AF5A 2VH1A 1DIAA 5EMKA 4AJOA 4B71A 3MRSA 4OVKA 5BYAA 4B3RB 1ZONA 5JLJA 3I2FA 4EA7A 1JPUA 2ZDHA 3V9PA 4DV4B 5EKXA 1Z83A 1O96A 3MFQA 2XMCA 3RB8A 2I80A 3MHTA 1XAHA 4Z49A 4XUGB 5I8WA 4M1QA 4D8WA 5BWNA 1FLDA 2J7PA 2YJTD 1G18A 3V34A 1O96B 4TRRA 2NOAA 1PFKA 4XIJA 4ZHSA 3TIXB 3VNSA 1THGA 3EGOA 4ECAA 5KEIA 2R7LA 2PU5A 3ZK8A 2GT1A 3C24A 1HL3A 2DLDA 4QG7A 5JZVA 3A8TA 3UATA 4RXMA 3TW8A 3ND6A 1V9LA 1N7IA 2YXEA 4HADA 2X6RA 4AYXA 3AUUA 1MIOA 1GFSA 3BHIA 4C7VA 1RC8A 4BLVA 3FPLA 4FX2A 2FX2A 4OCZA 4OK6A 4MUHA 3KEGA 3OMWA 3TCNA 4OJNA 4HX5A 3D4BA 4U8GA 3C3BA 4MHSA 1LQ2A 1LWNA 5AJHA 5HZGA 1ZAYA 2EZTA 5AKJA 5DNCA 2WPNA 5HWSA 3P96A 1BMQA 2WHRA 3N6XA 4FHZA 4XD7D 1EP1B 1MT0A 3QF7A 4ZEXA 4TXJA 1NLFA 4OHZA 4KE6A 4DV5B 1DBWA 1W2GA 3RU2A 3AHEA 5H7XA 5A4AA 1RWKA 2X2FA 1A5SB 3AKDA 1OA0A 2GM3A 2I6QA 4N6OA 4QASA 3WQBA 3ZKAA 3WLAA 4NTZA 3ERCA 3AHIA 5EZQA 5FA5A 5I7FA 4IDEA 5K2OA 2B82A 3EDYA 3TZQA 4GL2A 1NBHA 1Y8CA 3ITDA 1ODJA 2JGEA 1QS0B 3VU3A 1UWVA 4L08A 1U2QA 1JHUA 3M4JA 1NW3A 3CZCA 3MCZA 4J9VA 4BB9A 4RM2A 1WBDA 4BMPB 2PS3A 4HR7A 2ZB4A 1RI3A 1TE2A 3HFJA 2FSUA 4MWOA 4PRYA 1HZJA 3ESBA 4CCWA 2AN1A 2FQXA 2CF5A 2BD0A 2CHEA 2HH9A 1YCGA 2JJ2A 3KALA 5AXBA 4BO9A 1YJQA 2VJPA 4F2DA 5JSHA 1NPDA 3DWGA 3LRXA 1NJ8A 2GEVA 2MTBA 4WDQA 2A0WA 2RHGB 6REQB 3GLIA 5JCOC 4CF3A 4DANA 2B5OA 3HZHA 2C4MA 1MA3A 3H2GA 4JITA 521PA 1US8B 3KUDA 2FF5A 3SM3A 1NZFA 4DQUA 5GY7A 3NEJA 3FN4A 2P5SA 3PC3A 4G41A 5D3MB 1JR3D 5L3RA 6REQA 3JRXA 5AVRA 3CVWA 4MKXA 4BNWA 3LK7A 1C8KA 1M0WA 3P9RA 1OT5A 5CK4A 3L6RA 4FZVA 3TSOA 1HFWA 5L3QB 3CNEA 4J9UE 1V6SA 3E82A 3JASA 3X1YA 1YONA 3UPDA 4DQKA 2EDCA 2CJFA 4BX2A 5EIHA 2ALJA 4O4HF 1YL7A 3H16A 3QVWA 2HJGA 5ALSA 3WWDA 2LTAA 3AK4A 4FN4A 1C2YA 3HU5A 4P3NA 4D3FA 4D57A 3SVZA 3T0GA 5KNBD 4RTPA 5ADWA 1NV9A 1SC3A 1J97A 1R3UA 2P6OA 1I4OA 2VH5R 5KHAA 4M88A 3BH6A 2CL7X 1CW2B 3CZ9A 1YC5A 3KOUA 4MRMB 3RRYA 1WUYA 4DMUB 3EEOA 1DAKA 2FUNB 5MF6A 3KT6A 1FS6A 4CIAA 1QYIA 4G2NA 3CISA 4FYKA 3ER8A 1XXHB 2ZYTX 2I3DA 2R97A 3QXGA 4J16C 4MRMA 2R79A 1NNLA 3B6IA 2UUOA 4NJEB 1R9MA 5K8JB 1UEJA 4OU5A 3GLIE 2RD2A 1CQZA 2D00A 3Q6IA 4D9GA 5K8UA 3NHFA 3GR6A 3FCCA 4OLJA 1UBLS 3IB6A 1P91A 2HFJA 3HUDA 3W8DA 4R2MA 4WY5A 3W6NA 2XB9A 3KJZA 1GPAA 4JB8A 1DEHA 2AJLI 2GH1A 2ENUA 4D46A 4AJ2A 1R6DA 1ID8A 3OU2A 5F2KA 3OEYA 3AW8A 2UVPB 1U65A 4AN4A 3RFXA 1NUSA 4CTMA 2ZRCA 4RAQA 3UFXB 1N8NA 4WK4B 4KK3A 1T2FA 3REFA 1IOLA 3S2GA 1L8LA 2O3JA 4I50A 1I01A 1UADA 1NC1A 2EGHA 4PRZA 4YJ2B 2IOQA 2F1KA 4ACBA 2RK6A 2Y8EA 1TUBA 1THTA 2BE7A 2FUCA 2Y99A 2OBYA 4GZ6A 4K9RA 4TKUB 3G1WA 3P27A 2JCXA 1DXOA 3U3JA 1Y8RA 2PX4A 5IKPA 2ZJ8A 2QTGA 4U9UA 2OXEA 4TV8F 1ZMXA 3NIDB 2W90A 3GPIA 3BDAA 1HEYA 3GZTB 3LO5A 1LU9A 3ZV3A 3CZ4A 1C0EA 1I6WA 3QXXA 5JNTA 1U1EA 5TF4A 2FQQA 4TYMA 2Y9PB 1T5HX 3PDUA 2H4HA 3CLKA 3X1MA 4ZAGA 2KYRA 2XRMA 3V9AA 5FL3A 2BM0A 1OYVA 2PWZA 3DBLB 3R20A 4X1IB 5T6MA 3UV3A 4BP9A 4EMTA 1UAYA 3QUCA 1MTOA 4QXOA 3SFVA 3WFJA 5DV9A 5JZBA 1KDOA 2B1GA 4RABA 2C2MA 2XDWA 5CNMA 1T1JA 2FZLA 3T1QA 4AVYA 1VFPA 4H7DA 2JGLA 5DM70 2OBFA 3BK2A 2PUHA 4OQMA 1AO3A 3H3XA 3EMBA 4M46A 4MI3A 3LIIA 5A4DA 5IKXA 1NYTA 3K70C 3D8BA 3PNQA 3BXFA 3L9XA 1YDGA 5EIOA 3INYA 5CDTA 4HL6A 4MXDA 1TI7A 3EZ7A 4IO0A 1F3OA 4DT1A 2CFRA 4KO3S 3P0EA 4KQ6A 4L02A 2MJLA 3T3DA 1WMSA 2H2FA 2HNBA 1BX1A 3STHA 4CUZA 4IDHA 5MHTA 1ZR2A 3T9CA 1P1CA 4CDGA 1Q0LA 2UXBB 5TVKA 4ZYZA 2B8EA 3WICA 4MGKR 3IAS1 4BS9A 1MEJA 1U99A 5A3RA 5JASA 1SZDA 5CBPA 3IL2A 4MW1A 1PVOA 5TX7A 1A5AB 1KZ6A 5KWEA 4D4IA 4HB0A 2QKYA 3HE3A 3ZV4A 5I47A 2X8AA 3QLJA 4Q3BA 1OD6A 5LOVB 2N1MA 3VVLA 5YASA 1JJIA 2WPDA 3KXPA 2Z8XA 1DAIA 3LP6A 1WB5A 5K8CA 4ER6A 1ZN9A 3OCZA 4XVRA 4QTZA 2QRQA 1EX7A 3I6QA 4GQBA 2E18A 4A27A 5AW5A 4DN6A 2QRMA 5COQA 4OIMA 4QEKA 2IV3A 3TQOA 4YT8A 2ZI6A 1N2GA 3PUHA 4L5AA 1NX6A 2O3TA 3B38A 3PTZA 2PAFA 3DEJA 4MLZA 4WVFA 3PNSA 5E0KB 2ECFA 4U6SA 4E51A 1RBQA 4CCSA 2JGJA 1G59A 4PWYA 1DO8A 3LZ6A 5IJZA 2YRXA 1DELA 1W4CA 2OG2A 4P4TA 4D8XA 4IYRA 3L8CA 3RTGA 1NF3A 2GPTA 2XCUA 4EPWA 2WINI 5EXDA 5JMOA 2B98A 4MQFB 1I5RA 5JZOA 3O8CA 3SHFA 1R50A 3EVTA 4DR7B 3WL3A 2W6MA 3FYUB 1POWA 3O92A 1L1EA 1SD1A 3QU7A 1G0NA 5H9VA 3DS8A 2HV9A 1EUYA 3EULA 4D0LB 2H1VA 3LT2A 3EDRA 3EXIA 4KO4S 3PP8A 2MSEB 3G59A 3DL7A 4OOEA 3ZWDA 3RK0A 4B82A 4CLOA 3MTBA 3QELB 3R76A 2PLWA 1XQXA 1KAGA 2GAJA 2WJZB 4G86A 3TZKA 4EWLA 4L5JA 5J3JA 4JGIA 6PFKA 5TB5A 3O3NB 1E5LA 5I8ZA 4YRPA 1C7IA 3NWOA 3GXBA 1B0AA 1W0JA 1KO5A 1U8ZA 2IDKA 1CBUA 3IUNA 2IJGX 3ZK7A 1ILEA 5G53C 2WWTA 3OLZA 2OFWA 3H1EA 4YBRA 3WLQA 3G2MA 2HX1A 4BHTA 1DTEA 2AX4A 2OLJA 4J2OA 5LZ8A 5JS6A 4A0SA 3N8DA 2ORVA 1T0PA 3H2YA 3L0PA 1JIXA 3EY9A 2QRVA 4BNGA 2EARA 3DMYA 3QNWA 1TF5A 2NADA 2ZROA 1YNSA 1MC5A 2WJIA 1KZ1A 2G4LA 2GOYA 3PVSA 5A06A 4M0DA 1P5HA 2XHZA 3CUYA 3V7FA 2RJOA 4K87A 3NJ4A 1C7RA 2GO1A 4N12A 2GCIA 1LS6A 2C07A 3QVMA 2XT9A 3WBBA 1J0EA 4MV7A 2PUGA 4PCVA 4U7HA 2YJGA 5AJZA 2C3YA 3DMTA 4BFVA 4HFMA 4EGCB 4O4LB 4XCVA 2JGAA 4M3NA 1GGMA 1NVFA 2WU8A 1W30A 1Y4UA 4IJWA 4WK6A 3VNAA 1UBCA 3UENA 1P2FA 2DTDA 4A03A 2VNHA 1O9HA 1P1KA 1T9ZA 1VI6A 2JHCA 5BSTA 2BHTA 5HCUA 5FD8A 5IKMA 3TSWA 3R6DA 5JAZA 2COEA 5CHEA 3IBYA 3D54D 5DXFA 2DETA 4DVGA 4CM8A 1Y98A 5HKBA 4LMBA 1DJMA 2HXSA 1AHIA 2BPOA 1GTSA 5DRYA 3RRZA 4R9UC 4RPIA 1GITA 4MR8B 2Q5EA 4NBNA 3RVPA 1OKKD 2I76A 1M33A 1M1XB 3G2PA 1NOKA 1M74A 2WJVA 1GL3A 1ZG3A 2ZRPA 1SQFA 2QQFA 3FNHA 1Z0KA 3INNA 1KY5A 3GDOA 3HJRA 1XL0A 4W6ZA 4RSGA 3CINA 4Z9AA 1RWBA 4ZC8A 4B79A 4P4SB 3MGCA 5E1BA 1L0BA 2L42A 4QOSA 5FIUA 5IG2A 4ZQFA 4J4HA 1V8DA 2DX7A 1ZITA 3PSHA 2QX7A 4S3MA 1H1TA 1Y1RA 3BGOS 3AGPA 5EHNA 5K0EA 3CONA 1EM8A 3T9FA 3LUGA 2JH3A 2P2ZA 4J7AA 4ZO8A 5B58C 1FUKA 3KZVA 4JBXA 4OXKA 4QXQA 2ZAIA 3VO2A 1HSZA 1VMDA 4N9QA 3LQ2A 3ZQJA 5I4CA 4GGOA 4AU1A 1ZYUA 3IE0A 4IKOA 3OO1A 2EW2A 5D01A 4LVOA 1SG6A 1G4HA 1P19A 3S5JA 3MYRA 1LDGA 2C9YA 5C8DA 2ZKLA 1JMYA 3ED5A 3WHLA 2C57A 2KLHA 1QV7A 3PF9A 1NR5A 5IJ9A 4GFDA 5CK5A 2X58A 3Q7TA 4MVXA 5B36A 1JBKA 4ZI3A 3A6DA 1RYDA 1U2RA 1AV6A 1C30B 1YCFA 4UBMA 4ARCA 2DRIA 1CUWA 3GUCA 3MF4A 3Q12A 1Z33A 2GN6A 3FVRA 3H9GA 4NQZA 3ZDEA 4NWIA 3INRA 1VLQA 6YASA 4LXHA 1MUUA 5EJIA 2E1PA 3EODA 2FW8A 1OPRA 3C7CB 4PS1A 4PPQA 3O21A 3DP9A 3IOEA 2XIJA 1L1FA 1C9MA 3WBFA 4A26A 5KOHA 3L49A 2P91A 4YRZA 2HPVA 3KR0A 3PPXA 5KNCD 1MOSA 2CLFB 1JSXA 5AP9A 1PU2A 2O8DA 1UWKA 5EI5A 5LU8A 1PT6A 1ZNWA 1YF3A 1ZM9A 1N5MA 1B8OA 4QPDA 3OQMA 4HX9A 4NMXB 3ASVA 4O4HB 3WK7A 2PVCA 5FUWA 3RTDA 3EWAA 4KV9A 3FCSB 2FY8A 1DFHA 3OEHD 5CFLA 2ACKA 1IM8A 2BSXA 3ZWAA 1IWPB 2R6HA 5IHXA 4HBZA 4G85A 2KQUA 1HLDA 3DZ8A 4L4ZA 2GMWA 1LEHA 1HQDA 1QLWA 3AB7A 5J5AA 2IQ5A 3S2EA 3PL1A 5DE3A 3NW9A 5FFMA 4DCGA 4XDGA 1BWPA 1SUPA 1NUAA 4GZMA 9LDTA 3TLCA 1QGYA 2IZ6A 5DP2A 2NZVG 2GF9A 2CNKA 5J2UF 2DTEA 1JR3A 4M76B 1CJVC 3MK31 5JC1A 3KUXA 1KAQA 5TMBA 3W79A 4BBZA 4WZBA 2BKXA 2IBMA 4EHBA 4E5SA 1VBNA 3VOAA 1FXSA 2RH9B 4ZANA 4U02A 2NZUG 2RDMA 4RELA 2YKGA 5DHAA 1QR6A 3TRIA 4ZXFA 3PQCA 1CRLA 1DBPA 3GNTA 4UEOA 4JI4B