2DR3A

Crystal structure of reca superfamily atpase ph0284 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
239
structure length
232
Chain Sequence
RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKGIIVYPDKVLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0273 protein PH0284
publication title Crystal Structure of RecA superfamily ATPase PH0284 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 74
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dr3A00
1RRFA 5FPHA 3TRFA 2Z6VA 1S9HA 1Z0DA 2CHGA 2QMEA 1FNMA 5FBWB 1G41A 1T0JB 2B21A 2NQ2C 3KJGA 3MWLA 4DLUA 3KJHA 3C7KA 1PJRA 2Q3HA 3PEWA 5DN6D 1OKKD 1ZU5A 1IM2A 1M7GA 4EFNA 2ECKA 4KFRA 3TLXA 1TADA 3W9YA 4OJKA 4BEBA 4D82A 2WOJA 3LBNA 4LHYA 1XTIA 4V0ME 5C46F 5LDDC 1LS1A 2WPDD 3WNBA 1KSFX 1F2UB 3ZVNA 3JZAA 3KQHA 3VNUA 1ONBA 1SQ5A 4RD0A 2CE2X 1WRBA 2DR3A 4PTLA 1CBUA 1YR6A 5J5CA 4KSBA 2EYQA 3PITA 3S1AA 1Z08A 5JS7A 1VTKA 2WTUA 1FL9A 4YMWA 4II7A 1I4TD 2WSMA 5TXGA 1II0A 4E5UA 2VIIA 3UKDA 4DXAA 2NO0A 3SS8A 2FA9A 4PQRA 5C4MA 1QHIA 1Z2AA 1P73A 2ZSDA 2IEYA 4P31A 4R2IA 5CK4A 1W1WA 1P7CA 1GFIA 1OYYA 3I62A 1UBCA 2CK3A 3SHFA 1K5GA 2X8AA 1XXHB 2F43B 3CPJB 1E32A 1KHTA 4DLRA 1RJ9A 4JT4A 2BHRA 3EA0A 4GOXA 3WHLA 2A30A 3DOEA 2QN6A 2YWHA 2ZSFA 3BRWD 4Z1MD 5AWFC 4WXRA 1FTSA 1IBRA 1W47A 2IK8A 3AF0A 4Q9KA 5P21A 3TSOA 5KUTA 1E2HA 4C0AC 3DZDA 5AUNB 5JSZB 2GJ8A 3T5GA 3GFPA 2CCKA 2KI5A 3FGNA 3HU3A 4B43A 2XSZA 2IHBA 3FMFA 4ON9A 4ZDKA 3SU8A 4BRUA 2H92A 4O2RA 1ZRHA 2Z0MA 2C9OA 3VHXA 2ZRLA 3KKPA 2PZEA 2ZRNA 1KO5A 1MO5A 4IFBA 4EQ6A 2R6CA 5DLQC 4P4SA 2FFHA 2IYUA 3M0EA 2R65A 2J0QA 3KQNA 2HF9A 2HV8A 4P4SB 4PHGA 1QG2A 3F5FA 4F4CA 4K46A 2J0SA 1Z0AA 1DAEA 4BASA 1A4RA 2QTHA 1ZM7A 2QRZA 3MLEA 4TL6A 4CYMA 2XOKD 3BFKA 3ICQB 1KTVA 4A1FA 3KXKA 5FL3A 3EASA 1E9EA 2ZAMA 1E98A 1Z0FA 4D4KA 4OHWA 3TIFA 5KDOA 4C2UA 2ZUDA 1TEXA 2OO7A 3SBEA 3R8CA 3REFA 1KI1A 4XJXA 1LV7A 1NVXQ 2QT1A 1A5TA 1EK0A 521PA 5FUWA 3AVOA 4YDHB 4DT1A 2QE7A 4XOIA 3GEEA 4GP6A 4KHZA 2HDNB 4QJ3A 5FOUA 4JKIA 1VG1A 2J7PA 1II9A 1KDTA 4PO8A 2ZRAA 1YZQA 3GJ6A 1H8EA 2WBLC 4MQBA 2OM2A 4MYUA 3PUZA 3LD9A 4GOKA 5BYJA 5JWHA 2G83A 1DAMA 4FW9A 1QRAA 5KNBA 1AQUA 4QBGB 2WIAA 1WMSA 4M1YA 1VECA 2R44A 2A5DA 1Q1ZA 1UBEA 1ZVQA 4OI0A 5GJBA 3QY0A 3FKSA 4FMDF 4JL5A 4JBWA 4F93B 1DAKA 4G5RA 5TB5A 4F4IA 2V55B 4M1WA 4V0NA 2ZI7A 4Q19A 3ICEA 4KXFB 1GKYA 3K53A 4EPWA 2YV5A 2CHQA 4QGFA 1U0HC 1GSIA 2W0SA 4PQYA 3EZ6A 1D2NA 3I1FA 2BIFA 2XTNA 2ZE7A 2IF0A 3L0SA 2PJRA 1US8B 4B3CA 2KWIA 1C9KA 3T15A 4EPVA 4B6EA 4PQFA 1HQYE 4U5XA 4FWIB 1M7BA 4RD2A 1G7TA 2ONJA 1N6IA 2AKYA 3G82C 3X1ZA 1G64A 1Z29A 2V4ZA 2Y8EA 3LBHA 2J0UA 5FPKA 1CU1A 4I1OA 4HLCA 4AWXA 4DZZA 1G4AE 2J0UB 4BPBA 1AGRA 2ZITA 4OQLA 5DN6A 4DCVA 1OKKA 5FTNA 3K70C 1E99A 2QL6A 3AVQA 3NWJA 3VR4A 3IGFA 3U5ZB 1TTTA 2F9MA 1P2TA 2QAJA 2QY9A 4JVLA 4TL7A 3U6KA 5IRCD 1UBGA 1R2QA 2PJZA 1NI3A 2R8RA 1TAGA 2WPDA 2P5TB 2G9NA 4DHEA 2O8EA 3F3YA 2ZE8A 1F3OA 2YWEA 2ZI9A 3AF2A 2KSQA 3K70B 4N1AA 5JJKA 4DLYA 5DE3A 3ADBA 5BN4A 2V1XA 1P60A 3AVTA 1Z6XA 1X1RA 3MD0A 4DEYA 3SNHA 2P6NA 2FH5B 4EFLA 4MGYR 5EUQB 2GKSA 3NXSA 5E7IA 3RYTC 2XNDD 4EUNA 3HP1A 2JLWA 2R9VA 4O0MA 3L0IB 2O0HA 3NTUA 4QHSA 1DPFA 2ZR7A 4G5OA 2QT0A 5FPYA 2E87A 3LLMA 2CDNA 2QQ0A 1Z63A 2RGEA 3P4XA 2W0MA 3MAAC 3SHWA 4URUR 1F48A 4IDNA 4Z1MA 4EFMA 2FN4A 1LS6A 3CX8A 4PR0A 3NHBA 1QHXA 3ZD6A 2VRWA 3RRZA 4M9SA 3AF4A 5CLQA 4D4MA 2WMOB 3KFXA 3X1WA 3P20A 1QHNA 3QEOA 1ZD8A 1JR6A 1G7CA 4M1KA 1ANKA 2DPXA 2ZE6A 3QVVA 2UZIR 2ZSAA 1XWIA 2EYUA 1UADA 4LK2A 3KTAA 1LVGA 3SFZA 1PLJA 4BFSA 1GP2A 2JASA 1P2UA 1KDRA 1KK2A 2OAP1 4BE7B 2B6HA 2QNRA 1O87A 1LW7A 1W49A 3UMRA 1OFTA 1TMKA 4G0NA 4OHXA 5B2ZA 3UIEA 2ZREA 4B3XA 1NIPA 3LO5A 3AF1A 1CF4A 2XOKA 5FI0B 4XH9B 3QENA 5EP3A 4EJSC 5FOWA 1XCGB 4IEEA 1YZGA 1ZC3A 1XZPA 4LWZA 2RCNA 1XB2A 3VTKA 3VX3A 2ZEJA 4EAQA 2IYRA 5DI3A 1SKYE 1DOAA 1MRNA 5KNCA 1KI9A 4N0DA 2O0JA 1WF3A 4R7ZA 2WZQA 2KB0A 4HLUA 5JHGB 5CB8A 1JJ7A 4EJSB 1YE8A 1UEIA 2CVHA 2JA1A 4PFSA 4DC9A 3SOPA 4DDTA 1KKMA 4ZDJA 2CCGA 3CKLA 3HYRA 2WWXA 1KI6B 3JZMA 3GLFA 3DM9B 4D4JA 4QGGA 1KNXA 3SJBA 1NKTA 3W3ZB 3B13B 1BS1A 2P5SA 2PT5A 4D6PA 3TK1A 2PMDA 5H68A 5CB6A 1SVKA 2YVUA 1E2JA 5AK0A 1RRCA 1RIFA 2ZE5A 2WWHA 4QOSA 2H18A 1C4OA 4C9BA 1T6NA 2CLDX 1ZUIA 3ZYCA 2H5EA 4PC1A 5AJWA 2IYLD 1OV4A 4QGHA 5GADl 2YOHA 5E3HA 5FBRB 2FU5C 3QKTA 4MYHA 1XZQA 3GEHA 3KB2A 1Z06A 1UDXA 3TKLA 3W6PA 3KL4A 1LB1B 3EZ9A 1XD2B 1DE0A 4JVSB 4LYJA 4CEHB 4TN1A 1OXSC 3CNNA 3SZRA 4A92A 1U8YA 3AVPA 4JYCA 3RAPR 4AC9A 2ZYWX 1JECA 4LOAA 4KU4A 1VYVA 3CUEF 3SJAA 3L8ZA 1OT3A 2OBMA 2V54A 1RE0A 3R7WB 1T3SA 3VMFA 2R6GA 4IVQA 1E9FA 1N5JA 2O8CA 4OK6A 4PSAA 4POAA 1ZYUA 3KKQA 1XMVA 2CEAA 2CMKA 3GJXC 5G53C 4ZDIA 2C77A 1J8MF 2I1QA 3NKVA 4YMUA 3FHTA 1W2HA 1KSGA 2EQBA 4B44A 1G17A 3KKNA 2GAAA 2BMDA 3AH8A 1M8PA 1VCNA 1G5RA 5JI3E 3R9IA 3PEYA 3OZXA 2D74A 5SZJA 5TMPA 1NN3A 4PHHA 2HF8A 4CGZA 1R5OA 6Q21A 3MWKA 2RGNC 1YHNA 3FMOB 1V5WA 4W5HA 4ILEA 3RRNA 3ZDQA 4EPRA 1TQ2A 3H0KA 1Q20A 2HYIC 2O0KA 1G18A 2C95A 4E22A 2YWGA 2XNDA 3OIWA 4NH0A 4IOLA 3THXB 1YZKA 4ZIRB 1E6CA 2EFDB 1BYIA 2EWVA 4OBEA 4TQ9A 2ZR9A 4MYTA 2DFTA 2NPIA 3IDQA 4QFMA 1UF9A 2P67A 4DWJA 2C8VA 5KPJA 2NMVA 1RW4A 3NH6A 3KQLA 5JECA 2BEKA 2YOFA 1E9CA 2ZRIA 5LPNA 5DSZA 4O3MA 3WYAA 3B6EA 4UNQA 5A4JA 5EE3A 4A6PA 4GI7A 1ODFA 2QROA 4A8JA 4TYWA 1KJYA 4GRAA 3AVVA 4A8JB 1QBKC 1EWQA 4BFZA 2NGRA 4H1VA 4Q4JB 1JXOA 3ADKA 2J87A 2ORVA 1FZQA 2VP6A 3MJRA 1IJFA 2ZRDA 4PPNA 2OCBA 2GEDA 4BUJA 1I2MA 1ZBDA 4KVAA 2IBMA 1N6NA 2QM7A 1XX6A 3CRRA 2ZI6A 4DRZA 2ZTSA 4HZUA 3A1UA 2NIPA 2QPAA 1J99A 1RYHA 1JR3E 3D6TB 1XEFA 1NN5A 3B7GA 4BECA 4LBZA 4E03A 2AL7A 4UQOA 2H1LA 2GXSA 2C03A 3QKSA 4LPKA 1NSTA 4LZZA 1XRJA 1D5CA 4JLNA 2IW3A 2WAYA 4PPQA 4BFWA 3L82B 4JLAA 4BGDA 5AR1A 4PAQA 3P32A 3TVTA 2OFWA 2BBSA 1F5NA 3CH4B 4YXWD 1AS3A 4HB3A 2FV8A 4WW0A 1R7RA 3AB3A 1NMZA 3THYA 4JLDA 1W0JD 3A1SA 2GEUA 2RGGA 2EFGA 3EW9A 3PIRA 3AF3A 2QAGC 2RMKA 3NBYC 5LB2A 3THYB 4B3GA 3MG9A 4C7OB 4I81A 1XTQA 2VTKA 2DY1A 3QJYA 3WRXC 4KBFA 5J4YA 4X8HA 2D7DA 1TX4B 3Q7PA 4IOKA 4OQXA 3GLGA 2K5UA 2ZJAA 2F6RA 5AJVB 5FR2A 1HY3A 1P4SA 2KJQA 4NDZA 3D8BA 5SZKB 5TVKA 2PT7A 4ERNA 1R0XA 2QAGB 3LAWA 2VSFA 1DAGA 1ZP6A 2QSZA 5HPYB 3K0CC 4FMCF 2DFNA 1DAHA 1VPLA 4D80A 4NYIQ 4M1OA 3LLUA 2KBEA 1T9HA 4HLQB 1N6HA 1T4GA 2BJVA 1JPJA 2O8BB 2G6BA 2ZM5A 5L3SA 2TMKA 5KSYA 3HR7A 5CIWA 4RFVA 1G6HA 2IX3A 1UAAA 1J90A 1FTNA 2OXCA 2WJYA 3TE6A 4V03A 3WMEA 4FCVA 4XVRA 4PZLA 1P2VA 1D6JA 4RZ3A 2Z43A 5DYGA 5BQ5A 1DEKA 2ODWA 3WP0A 1D9XA 2ZU6A 1OIVA 1CRPA 2GESA 4L4UA 1YRBA 2WJIA 4B6FA 1YZNA 3W8NA 3QVUA 4DDVA 3LRPA 5C2JB 4Q1CA 2DB3A 3K8YA 1XCPA 5BYKA 2JJ2D 2N1BA 4RVCA 4ARZB 1GNRA 2OSBA 4N0EA 4AK9A 1KDOA 1X86B 2UKDA 3I8XA 4CVNA 4CEJB 2IWRA 2JIZD 3IPYA 1GNPA 2VP0A 5AUPB 1MV5A 2XNSA 2OFXA 1VIYA 3SN6A 4A6XA 4D0LB 5JBQA 3KQKA 4H1UA 4YONB 1N6PA 4IOJA 1RRGA 5B58C 2Q21A 1KGDA 3ZS9A 4A0HA 2HUPA 5D3MA 3RVBA 2ZI5A 2QP4A 1S9DA 1E9RA 5LD2C 1R4AA 2YJTD 1PLLA 2YOGA 4HDCA 1GL7A 1HA3A 3KKMA 4MRSA 5FOXA 5H70A 1R0WA 2NTYC 5KOYA 2VP9A 1IAQA 1L4UA 4W5WA 3V00A 3QXJA 1NNEA 2GXAA 3A4MA 4KITB 3BGWA 3JVUA 3THWB 2PLFA 5LD2B 4R2HA 2V8OA 1AIPA 1DARA 1E9BA 3U3JA 1AGPA 1P9RA 2ZJOA 3UWKA 3TUIC 1NF3A 3GJ3A 3N5CA 2J7KA 3Q3JB 4GBMA 3K9NA 1ZCAA 4MKHA 2FSIA 2BMFA 3JVVA 4Q9IA 3BFXA 2JLYA 2WM9B 1SZPA 4U7DA 2PMKA 1U0LA 3QKUA 3M6AA 3EWSA 4TWZA 2IYTA 1YR8A 4TMZA 4AD8A 4CRWB 4TTRA 1G8GA 3HYTA 1GRRA 1ZJ6A 3QPUA 5GVRA 4MRNA 2Q9AA 1PUJA 3CWQA 1MOZA 2MSDB 3EA5A 3EZFA 3QNUA 4G1UC 4CT5A 3EZ7A 4UJ5A 5E7JA 2VF8A 121PA 3DVLA 1ZNZA 2P6UA 3AGPA 1GNQA 1TF5A 4MRPA 4WIAA 3ZVRA 5KNDA 3PUWA 1NG9A 3CR7A 2IUSA 5KHOC 2WWIA 3GP8A 2ZRHA 1WB9A 2WSSD 5TY0A 2OCAA 1WA5A 1P62B 4IVPA 2AFHE 5JRZA 3DDCA 2YC4C 3KUDA 4I99A 4MYCA 3EAQA 3OAAD 3T61A 3IO3A 4G5GA 2X2EA 4AKHA 3C14C 5CJPA 4HATA 5GVSA 4UXJA 1L4YA 1OH6A 2GJKA 3QKRB 4LCBA 2BCGY 5J40A 2ANBA 4YXWA 1KO8A 1FP7A 1KI7A 3A1VA 2V3CC 2IYZA 1W0JA 2JLRA 2VHQA 3B8HA 2ZSBA 2WJVA 4IDPA 1JI0A 3WNCA 2QORA 1CJMA 3L0OA 1IJEA 1YZUA 1AM4D 4XIGS 1Z2CA 5ELXA 1DAIA 1R0YA 2NO1A 3W90A 2A5JA 3VX4A 4K8OA 3DKPA 4UKDA 2YKGA 4HAYA 4ZI2A 4XSGA 4M8NE 3CWZA 5EXPA 2FOLA 5DI9A 2XXAB 1W44A 2XB2A 2Q0HA 3LNCA 4UNRA 2DFLA 2GJSA 4FINA 2ZETA 4PHTA 2NG1A 5CDFA 3M1IA 1H8HD 2GK7A 4KCGA 4RD1A 4TMWA 1PZNA 2NO6A 2REXB 4BZQA 3AKCA 1ZMXA 5EP2A 2ZRFA 4Q1BA 5HZKA 1F2UA 2ZRGA 3R20A 2IL1A 3GMTA 2QTFA 3K70D 1Z47A 3O47A 3GPLA 4DUGD 3WNDA 5EJEA 1KDPA 3TJZA 4F38A 3T34A 2FSHA 4BRWA 5H1YA 1XMJA 1ZD1A 2VLIA 1ZAKA 1OE0A 4L5BA 4LJYA 3A1WA 2BVNA 3PEUA 2ORWA 1E0JA 1K8RA 5EE5B 3CNOA 3U7EB 1J70A 4G5QA 3FFBA 5JLJA 4R71A 2F3RA 2W2XA 1FUUA 2JJ2A 3U60B 1CKEA 3DMDA 3U3MA 3QSYA 1JJVA 1XXHA 2F43A 3GLIA 1Q0UA 1XMSA 3LA6A 3ZVMA 5EZ6B 4JSTA 4OHVA 2JIZA 1QDEA 3GLIB 1IY1A 2ZRMA 4NPHA 4D2IA 1Q22A 3LQQA 1XD8A 3GEIA 1BO6A 1T8TA 2PL3A 4XD7D 4W9MC 1P9WA 4MKGA 4C30A 5HKKD 3NHAA 1ESMA 4JZKA 3QF4A 3FHOA 5SZHB 4OL0A 1GDDA 1G3UA 1HURA 4B75A 4NL4H 3QF4B 2G88A 5FTLA 2J0VA 1Z22A 3GLHE 4LV6A 3DZ8A 1Z6GA 2FSGA 3EZ2A 4TMXA 4MH0R 1N6RA 3VAAA 4JT2A 5L3RA 1U94A 3IIKA 2BMEA 2DFKB 2IYQA 3A1TA 5L8VA 2BWJA 3AUYA 3A4LA 4B76A 1N5IA 4GMDA 3G0HA 2GWHA 2FF7A 1E9SA 2HEIA 1E9AA 4AY2A 1CULC 1U8AA 3FOZA 1G5PA 1DO0A 4RD4A 1MO3A 3PXGA 1N6OA 2XGJA 4PAMA 3U7HB 3SYLA 3ZH9B 1VCOA 1GG2A 1H65A 1XMIA 3ZQJA 2V1UA 1TL7C 2PCLA 4A0GA 1B0UA 3B9PA 4TMTA 3KXLA 4B3BA 2XB4A 1OXVA 4HZIA 5J4KA 4A0RA 3PV0A 3A8TA 3MRSA 1KJWA 2ZJ5A 1W4RA 2VPPA 2F1JA 1G3IA 4HAZA 4P33A 4WZBE 1SVSA 1A2BA 1KIMA 4JLBA 2ORIA 2WSSA 5JWOA 1YJ5A 2X77A 4FN5A 4QHTA 1QG4A 3ZZ0A 4BZXA 2GVZC 4TT3D 5KO2A 3OAAA 3CR8A 1E79D 3FVQA 5J4VA 5JJLA 1TEVA 2IXFA 3AGQA 4O2LA 5TDHA 1X8LA 5F2EA 3UG7A 2PZGA 4P32A 4HEJA 5CM9C 4RCZA 1ELOA 2ZVPX 3TSWA 2FE4A 4G3XA 4LX0A 3QPWA 1SVOA 1US8A 2C9CA 4V0MA 4DCUA 1E0KA 1BOFA 3UMSA 1MT0A 4V0OA 4NHOA 2GNOA 3LQRA 4TYPA 2AX4A 3B9QA 1J2JA 1E3MA 2CL7X 4DCTA 1W7AA 3WRYC 2ODNA 3K0FA 4LJ7A 5F98A 1BH2A 1YZLA 3RS2A 3FMPB 2AXNA 2WWFA 3V4RA 4QM6A 1DS6A 3K0FB 2OE2A 5CYPA 2BKUA 3ZZUA 1SVLA 1Z0IA 1E2FA 2X19A 4QBFA 5DISB 3VR6A 1ETUA 5JHHB 3R9XA 1Q3TA 1QHSA 4NCKA 1G3RA 2JLVA 4MUBA 4OQNA 1CJUC 2WJJA 1P75A 2HCJB 2XZOA 1H8HA 1P61B 3A36A 3RSLA 4LJ6A 3TSZA 3ZJYA 2CL6X 3I5YA 4D4LA 4D26A 4D0NA 2D7CA 1VCIA 1Q1BA 4PPGA 2OBLA 5FBLB 4AYXA 1VIAA 1DG1G 4DUGA 1TNDA 5ANRB 3VKHA 2ERXA 3CX6A 3RRYA 3OESA 2FPMA 1KY3A 1NG1A 3CH5A 1SVMA 3K9LA 4HUQA 2FPKA 3CRMA 4AKIA 4HUQB 2WICA 5DO9A 1G5TA 2H16A 1KYIA 5FOSA 3T1TA 2D2EA 3Q72A 1E2EA 1SXJE 2HYDA 4QBHA 2CHVA 3QEJA 2WAXA 2A5GA 5K8LA 2D06A 1IONA 4LC1A 5CJ2A 3RDPA 1OH8A 3HPRA 1SGWA 3LX8A 5FTMA 1TF2A 2A2ZA 2YYZA 2GTPA 3Q5EA 1ZM3A 4XD7A 3LBIA 5HKKA 1QVAA 3O8BA 2O8FA 3U2QA 3ETLA 1I4DD 4KYUA 4Q9JA 1ZNYA 2CLCX 2O8FB 4CEIA 4YMVA 4RSGA 3CBQA 3WXMA 2BM1A 4MUAA 2FSFA 4CEIB 1ZD9A 4KLZA 3N70A 3TGPA 4KSCA 3IIJA 4GMXA 3VU9A 4CW7A 1FNNA 1YQTA 3O8DA 1HEIA 3VU9B 1IN4A 1CR0A 1L7VC 3QG5A 4CIDA 1FPMA 1CJVC 4P0TA 2V6IA 1S96A 1BKDR 3FE2A 2RH5A 3HU1A 4F4JA 2VQSA 3ASZA 2F1IA 4WVFA 2VHTA 2OILA 3GQBA 3HU2A 4V0LA 5FL7D 2O8DB 2CBZA 3CRVA 4TQAA 3ONWA 1KI4A 2CL0X 3PR1A 2IYVA 4BLQA 4GT1A 1Z6AA 5C4GB 1AK2A 2AWNA 3VR1A 4EJSA 1YR7A 4TYYA 1RZ3A 3RLFA 4B47A 4NONA 2D2FA 4AKEA 2WWYA 4GL2A 4YLGA 1KI6A 1ZIPA 3TR0A 4A2QA 1AS0A 3B1XA 1F60A 5GJVC 1ZM4A 2JEOA 4HLDA 1U0JA 1V43A 1A7JA 1ZM9A 5DH9A 1XPUA 1MABA 4C0QC 4DBLC 4YQFA 2QGZA 4A82A 1MABB 2YNMA 2FPLA 3U44A 5BXQC 5F9HA 1XCMA 2GHIA 2I1VB 3QPVA 4KFUA 4MKIA 4NYIR 4TT3A 3U44B 3VKWA 1E79A 1GRNA 1U98A 1XEWX 2BM0A 3EIQA 3QBTA 4J0QA 3LW7A 4Q7LA 4Q7JB 1LNZA 1XNJA 1Z07A 2J41A 4L8GA 3HPQA 4LGMA 4B33A 5HR5A 1XD2A 4A36A 1NKSA 3MWYW 2DWPA 1RPZA 4CEHA 4OI4A 4U02A 1OXUA 5FOVA 3DM5A 4Q7MB 1OFHA 1R8QA 5HTKA 4NZYA 1UKYA 4FXPA 1AJEA 3MFYA 1G8PA 4N3NA 2WOOA 4QM7A 2J45A 1NY5A 3VR3A 1XJ0A 3R7WA 4PPFA 3B1ZA 5CK5A 2BV3A 2QUZA 1OH5A 1GKIA 1GL9B 1AN0A 1SULA 1ZCBA 1RC8A 1VG8A 2IXGA 1SXJC 4BFTA 2D4HA 2YZ2A 3SI7A 4DJTA 3ZIAD 2O52A 1E2GA 4GZMA 3BAFA 4WXPA 4L9WA 1TU4A 4KODA 1CXZA 2F7SA 2HT6A 2BBTA 1FFHA 3Q9LA 4WA7A 5CM8B 2JJ1D 4Q9LA 3EG5A 5EE9A 2EVWX 4US1R 3SDZA 3D31A 4PC7A 4PC3A 2OZEA 4M21A 3CPEA 3T12A 3QXSA 3T06B 3KKOA 2ZS8A 1AQYA 4TZ0A 2C9YA 2JGNA 2HT1A 2AXPA 2ZIAA 2HLDD 4LHZA 3ECCA 4HB4A 5FTKA 3J81k 3KJIA 1FX0B 1U9IC 2WV9A 1HE1C 4JLVA 2WMNB 2XITA 3MCAA 4L15A 2GZHA 2ONKA 3I92A 3PVSA 2RGNA 2VSXA 4LJ8A 3THXA 1E2NA 1KO1A 3IHWA 4JJKA 2LCFA 4ZIRA 2G1KA 3OEHD 1NJFA 2Z5FA 1II8A 5DIFA 2QPTA 2R6FA 1U9IA 1OHHD 2RGBA 1JEEA 3TUJC 5JWRA 1II8B 3BJIC 1E9DA 3VHLB 4Q18A 4NE2A 4WBSA 1TQ6A 4IXNA 2GZAA 3LXRA 1W48A 3TUZC 4M53A 1NMYA 4ZDWA 4Q03A 3C5HA 4B35A 3NDBB 4M0LA 2AK3A 2B92A 1OLOA 1JR3D 2RKOA 1N25A 1SKYB 2IEZA 4I4LA 4ZCMA 1HE8B 1Z8FA 2BDTA 3HR8A 4TL8A 5FTJA 4C3ZA 2OFOA 4LJ9A 4Z8XA 4XVUA 1FUKA 5FFMA 4Q4JA 2VHCA 4AYWA 3HDTA 4LJAA 4PO1A 2H57A 3ZVLA 2R2AA 3I8SA 2ZVQX 4DKXA 3P4YA 2ZRJA 2C96A 1KK0A 4UXHA 4C2TA 1YKSA 4DCNA 3Q8XB 1LF5A 1GWNA 1K5DA 2GBLC 4S2EA 5FL7A 3VKGA 3AM1A 1NVVR 3TQCA 1J7KA 3ND8A 3AKYA 5UKDA 4LYFA 4DCSA 1O3YA 1W5SA 4US0R 3E70C 4JLOA 2WWWA 4DLWA 2PLRA 4LYAA 1Z3IX 2GBLA 4IOMA 2CXXA 2ZJYA 5BWMA 2ZJ8A 5D3QA 2ATVA 2NOAA 3D3QA 1NVUQ 2BBWA 2ZRCA 1NLFA 3FTQA 4IDHA 3IKJA 3LV8A 5TARA 5J4HA 3CPHA 1KI3A 3BBPA 3BOSA 2J46A 5IK2D 2RAPA 4Q9HA 3KB1A 1OPXA 4C7OA 1NP6A 1OSNA 2QG6A 4QBIA 2FFQA 1S4QA 1XEXB 2LWIA 3QOFA 2A78A 5G3ZA 2F55A 3W5IA 3K09C 4RZXA 1TQ4A 3LFUA 1EX7A 2RB4A 4LV5B 4LHVA 1RKBA 5HE9A 2G3YA 4C0SA 1G20E 4D81A 1NBME 2N46A 1WBDA 4XVQA 5HE8A 1AS2A 1VHTA 4DVGA 1COWD 2QAGA 2ZS7A 4PC2A 3ZGXA 3PG5A 4NTZA 2XTZA 1DO2A 1FW6A 4M1TA 3BD9A 5KDLA 5KSPA 3P26A 2ZANA 2AR7A 4OI1A 4IHQA 2XZLA 5K8TA 821PA 4TYQA 4TQUS 2GEVA 3U3RA 1Y3AA 4Q48A 1OXXK 3ZLJA 2QP9X 1ESNA 3AP3A 3NC1C 1GM5A 3NC0C 2O8BA 4C0LA 3KX2A 4ZO4A 3KJEA 4LHXA 2FWRA 3DMNA 4HB2A 1Z6TA 3K0CA 2RGDA 2GJ9A 3NDPA 3ZIAA 3EX7C 1P3JA 1P9NA 3LH5A 3ND9A 4MA4A 4OKSA 1UBFA 1ZNWA 4DSOA 3U4QB 2Q9CA 2VP2A 3BH6A 4ZCIA 4JL8A 3O8CA 3BC1A 2G0TA 3OIVA 3WMFA 4C0BA 3AVUA 2R6AA 4PO9A 1NLYA 2MSCB 3AQ4A 3T1VA 4B2LA 2CJWB 1MR3F 4DLXA 1YZTA 2JJ1A 3FFAA 2Z4SA 3OIYA 4Q02A 2QMHA 2GCNA 3SJCA 2J5XA 5JEDA 3F0TA 1K6MA 4PZYA 5JI2E 2VP5A 4C0HA 3NBXX 4ARZA 5F3WB 1LY1A 3C16C 3OIUA 2OG2A 5EXSA 3RC3A 3KUCA 2QENA 1EFRD 5E4FA 3TNFA 3X1DA 3RABA 3WBJA 1GILA 3RWOA 4CEJA 3PUXA 3OEED 2HLDA 4MRVA 4HB0A 2AD5A 3TQFA 4HAWA 2ASEA 1MO4A 1G4UR 2W00A 1T5IA 1NRJB 1LFDB 1WBBA 2ZQ5A 4LSGA 2RGCA 1A1VA 2FGJA 2IYXA 2XX3A 3KQUA 2QEQA 2R62A 3OEHA 4PX9A 1VDZA 1KK3A 1KZ7B 4B3DA 2FZ4A 1OHHA 2JLXA 2DWOA 1AZTA 4QGAA 4Q4HB 4FD2A 4UNPA 2ATXA 1VKJA 1W5TA 1WE2A 1KI8A 3DEFA 1XF9A 3BB1A 3QG1A 1ZUNB 4ZKEA 1OFUX 5A5GA 3PCRB 5DHFA 3THWA 5DHAA 4I1VA 1JNYA 4JLPA 4TTPA 2ZUCA 1XJQA 4MGKR 1QHHB 1JR3A 3LWNA 3B1WA 1KMHA 4XSHA 3TW8B 4URVR 3PQCA 1JAIA 1OB2A 2GETA 5IT5A 2DYKA 1KMHB 2MMCA 3AVYA 2C78A 4JIMA 1DVRA 2GXQA 2ZRPA 1OJLA 3T1QA 5J4LA 1KSJA 2WVJA 3LDAA 1NMXA 3U7FB 2VH5R 1N5KA 5FBVB 5TV2A 4NMMA 5JCZA 4S35A 4KJZA 1ZUHA 1CR4A 2AK2A 3FYHA 4B74A 5IDVA 4IFEA 2OV2A 2VP4A 3AV0B 2FMXA 2XTMA 3L43A 3UXMA 4Q1FA 4A4DA 2EW1A 4TZ6A 4BFUA 1ZW6A 1HH4A 1IN8A 3A4NA 4MGZR 3NBFA 4Y0VA 4RCYA 3MWJA 1G6OA 2E1RA 3BERA 4TTQA 1D2EA 3W8RA 1NJGA 3CF2A 3QKRA 3MGCA 2NZ8A 5EXTA 3V9PA 1T91A 2H8KA 3CZPA 4X8LA 2QRNA 3RNLA 3CW2A 2VL7A 4W7SA 4ZI3A 4KLNA 3AVXA 1NVVQ 4IDQA 1T3LA 5IK2A 4FCWA 4NYMR 4IDOA 1FQJA 3A37A 3QXXA 3AP2A 3K0SA 1SVWA 3L2OB 2BJWA 1ZINA 4QL3A 2Q3MA 1QF9A 4JMPA 4BLOA 1E69A 1XJCA 2N42A 4CT4B 5LBIA 4NCHA 2WKRA 5FUVA 5K8UA 1T5LA 1COWA 1UM8A 3K0AB 1E0AA 1R6BX 3ADDA 3IO5A 2UZ3A 5EQTA 4HYYA 4GPTA 3AUXA 2JCSA 4M9ZA 2XXAA 5C18A 3VR2A 1WXQA 1CS4C 2JDID 3FB4A 3IQXA 1XTSA 4AYTA 1Q12A 3PEVA 1CJTC 1L2TA 2ZR0A 4Q7KA 1B23P 1S8FA 1Z83A 4IXMA 2V7QD 4AURA 5B57C 3DO6A 3EARA 1PUIA 1U8ZA 2NO7A 2XZPA 3EC2A 3TH5A 2FJUA 4KVGA 1E94E 1TF7A 4FMDB 1DELA 3QXHA 3SEAA 2D62A 4BLTA 4URWR 4AI6A 4PANA 1FOEB 3I72A 1W4CA 1MRSA 1TUEA 3RS0A 4EDHA 1OF1A 4B3FX 1NIJA 1NN1A 4M2LA 4OK5A 2F3TA 3GFTA 5EUMA 1YR9A 4NCNA 3TBKA 4QHYA 2C99A 1EFRA 4GNKA 5A0FA 3THOA 3TVDA 4BLSA 4OJQA 4JJZA 3WP1B 3K1JA 3OEEA 3BH0A 4DSTA 4UNNA 2L0XA 5DGXA 2CE7A 1G1MA 4US2R 1NLZA 2QM8A 4R98A 3R8FA 2IA5A 1TUIA 3RSOA 4TLBA 1OXTA 3S1AB 4QXAA 3ZQ6A 5EE1A 5JJIA 1LTQA 4KAXA 1IN7A 2JAQA 4BFVA 2LKDA 4IEIA 3B82A 1G291 4PXAA 1E2QA 1N5LA 3W3AA 4DSUA 3FKQA 3EPLA 3IILA 3HWSA 1NL3A 1N0VC 2E9SA 1NN0A 4OI2A 1E1QD 1T8UA 2JLQA 4V02A 5JMTA 3SFVA 2GCPA 5KPDA 1RJ9B 2DBYA 3SC3A 4XWOA 3QIAA 1D2MA 2V6JA 2W58A 2GRJA 3LVRE 4YMSA 4B73A 5H8WA 4K81B 1SVIA 3KDSE 3OE7D 3B1YA 1GAJA 4DIEA 4EPYA 1XPRA 3B85A 1VG9B 4TSFD 2FX3A 2SHKA 3GJ4A 2ZSEA 3OHMA 4R9UC 3ZD7A 2R6DA 3NG1A 1LF0A 4Q4LA 1IHUA 5FI1B 1CR2A 4EQ6B 1UPTA 3LW8A 4E07A 5FR1A 4MDEA 1Y63A 1W4AA 2D3WA 1EGAA 4ASUD 5KDDA 1BIFA 2IT1A 1AKEA 5JRJA 1HT2E 4HAVA 2H17A 4ABYA 3EIHA 4WAUA 2QZ4A 4LBYA 1F6BA 4PAOA 2B7BA 2WIBA 1Z6YA 3ADCA 1R8SA 4QG7A 2JJ8A 2PH1A 1HV8A 3X1YA 1CJKC 1UEJA 1E2PA 3TAHA 1N6KA 2QPOA 3RHFA 1G3QA 3I61A 2ZJZA 1P2SA 3EPKA 3ZS8A 2ZYTX 1E2DA 1G19A 1VG0B 3KZ1E 2BCJQ 3C5CA 4DT1B 5KSZA 4E09A 1CRQA 4L16A 1EFCA 3SJZA 3DOFA 3CF0A 2IUTA 3C15C 3BXZA 2VO1A 1OH7A 4RKFA 1MKYA 3QBVA 1MH1A 2Z83A 1UDWA 2C5LA 1W2GA 4Q4AA 1S3SA 2V9PA 3CRQA 1GRQA 3M4YA 5CLLA 4EPXA 4LJ4A 4D25A 3W5JA 4XTRA 4DB2A 2A5FA 2IF2A 3Q85A 1EG7A 4Q4AB 4BWYA 2Q3FA 2BEJA 3TW4A 1XU4A 1GIAA 2BKEA 3H2YA 4DLZA 2QQEA 5EZ5A 4Y0AA 4C0JA 3FHCB 4P4TA 4DLTA 4NYMQ 2JDIA 1R5BA 1S0UA 2MSEB 4LC0A 5C1BA 3EC1A 4QNRA 2FEOA 1FMLA 5AJYA 2OUKA 3REGA 1SXJD 3GJ8A 1OW3B 1J8YF 4B2IA 3GLFE 3IQWA 1XPOA 2YC2C 2V7QA 1JQJC 1IXZA 1G16A 3V4FA 5JS8A 1OIWA 5KYKA 4G5SA 2FNAA 3BWDD 2AKAB 1P72A 2WHXA 2Q6TA 2A9KA 4P4UA 3I5XA 3C4JA 421PA 3PUYA 4I1UA 4YMTA 5HCIA 1TU3A 2VBCA 2F9LA 4B32A 3GLHA 5JCPA 1HTWA 2PEZA 1IN5A 4DDWA 2AWOA 2BMJA 1W36D 4MDFA 3GLHB 4LUCA 4PHFA 1KI2A 2PCJA 1GZSA 2IXEA 4LI0A 1JEDA 3BK7A 2FFBA 2HXSA 2W2VA 1S1MA 4CZ2A 4KYIB 4RJLA 4QJ5A 1KY2A 5FH9A 1S2MA 5F9FA 1Z0KA 1SHZA 2GF0A 4B48A 2I3BA 1JBKA 2PBRA 4M1SA 3IUYA 4KO8A 4MKFA 2EFCB 2QMOA 4Q66C 3RS7A 2O8EB 1UJ2A 1SKQA 4IVRA 2P2LA 2B8TA 5LB4A 1M34E 4X8OA 3H86A 2HJGA 2GF9A 4DEXA 1M7HA 4NYJR 4KFTA 4AIIA 4ZCLA 1EFUA 3SQXA 2ZI4A 1BMFD 3RS5A 2ODEA 2GVDC 2QGNA 4PC6A 3CNLA 2ODBA 4U00A 4NCJA 1ZC4A 1X1SA 3CIOA 2GZDA 3UPUA 2ERYA 2NZJA 5EXXA 5HZHA 1NSFA 1E1QA 1RVDA 1Q21A 1X3SA 1GUAA 2NO9A 3BB3A 3K9GA 4FIDA 2OHFA 4Q21A 4FMBB 1N2CE 3I4LA 3TMKA 2OLKA 1IN6A 3U6BA 2F1HA 1CTQA 1Q44A 2Q9BA 2H7VA 2JLUA 2OESA 1KNQA 2CNWD 4GFDA 3EWAA 3MJHA 3OE7A 4WZAE 2O8DA 3MMPA 2ZXUA 4LBWA 2OEPA 2O5VA 1E4VA 2WKQA 4TSFA 3CO5A 1P6XA 4LRWA 1QVRA 3GJ5A 4FCTA 5FPTA 3HJNA 2KBFA 4TMKA 3KTAB 3VQTA 3WHKA 1WDTA 4DLSA 2W6JD 4ASUA 3AVWA 3RS4A 5SZIA 2ZU0C 1U99A 2BBOA 1ZU4A 4BFYA 2RGAA 4C0KA 5JFGA 1VYTA 1MO6A 4HLUC 3SYKA 2IS2A 3I3SR 4KV9A 3CM0A 4Q5IA 2EFEB 4V0KA 5IHPA 2HJVA 2BC9A 2YINC 5EP4A 2CCJA 5DI3B 4EPTA 4TLCA 4BZPA 1UKZA 1N6LA 1W4BA 2QMUA 2XEXA 1G9XA 3QXCA 4ESHA 4A2WA 2ZUBA 4PSVA 3DL0A 1G7SA 2FDCA 2MMGA 2EU8A 4IW3B 3VNVA 1U2RA 4UNSA 2PZFA 1XEWY 5FPSA 3UK6A 4QKQA 3GLFB 2IWHA 3DPUA 1D9ZA 1WP9A 3SYNA 3F8TA 5G40A 1DADA 3PJRA 4JS0A 5E95A 2ZJ2A 3CB4A 4YC7A 2GAOA 3SQWA 2XJ9A 1I2DA 4B34A 1S1CA 1CEEA 2AN9A 1E96A 3EIEA 4AKGA 2BOVA 3FMIA 4MRRA 1XP8A 2J59A 4JL6A 1NVWQ 1Q1EA 2OT3B 4Q1EA 4BFXA 1E2IA 1JPNA 1Q57A 4BLRA 4JVMA 3GFOA 5M04A 2OLJA 2W6ID 2IYYA 4BQSA 1QHYA 3QE0A 1JALA 2QSYA 3IBYA 2QP3A 1YVDA 3FPAA 4RD6A 4UXIA 5JEEA 1YRAA 5BN5A 3GD7A 5G41A 4RD3A 2AHOA 3PUVA 4NP6A 4LDJA 5L3QA 2ZI3A 1SXJA 3W6OA 2WJGA 4A2PA 1VCMA 1A82A 5L3QB 1KZGB 4O25A 1CIPA 1DTSA 1SXJB 2HXYA 3Q5DA 3RRMA 1IXRC 3IEUA 3W34A 3NIBA 3NEJA 3OF5A 1W36C 4A9AA 2NPFA 3C41J 5K8IA 2VSOA 4XWKA 1PLKA 2DWQA 2XAUA 4X8MA 2O8CB 4OYHA 1FX0A 1KK1A 5AUOB 2DHRA 2IS1A 1EWRA 1KKLA 1Z0JA 1R10A 1KJZA 3I73A 3GLGE 1KO7A 5AJXA 1Q3HA 3UWOA 1W36B 3IIMA 4B71A 1GVNB 3QUSA 3B1VA 2ZYUX 1JQLB 4FMCB 4ESVA 1S3GA 2IS4A 1ZM2A 2LKCA 2REOA 3EPHA 2J9RA 4HI0E 4HSEA 4P3YA 4Z51A 1XTKA 1G8YA 1R5NA 3L8YA 2QI9C 3CRW1 2IC5A 1IOZA 4W5JA 1U81A 1Q1QA 3K9HA 2VEDA 3NH9A 3IBGA 4A0FA 1E1RD 2QA5A 1G3MA 1AA9A 1GOTA 1XD9A 4M4SA 3WBKA 3RANA 2GCOA 3R9WA 4NBSA 1BMFA 2P0EA 2GCOB 4ACBA 2GXUA 3ASYA 3E2IA 2GDJA 4CF7A 4DIDA 8OHMA 2PX3A 3P1JA 4UJ3A 4OHYA 3BFVA 4QC2A 1OIXA 3TAUA 3AP1A 2ZPTX 4AG6A 4QRHA 1GITA 4I1SA 2WJHA 2A5YB 1Z5ZA 4A8JC 4NYJQ 1EFTA 3GJ7A 4RKEA 4D0GA 1HUQA 1N3BA 2ZRBA 2RGXA 4Z54A 4F91B 2CNWA 1KAOA 1KSHA 4NKRA 1UKVY 1DBSA 4DLVA 4F7WA 1AKYA 4URXR 1PVOA 3VFDA 1OFIA 1YU9A 4LHWA 1IY0A 4LPSA 2FZLA 4IJMA 1IXSB 1NBMD 4JLJA 3AKDA 2JATA 3NVAA 4HUTA 1OYWA 4LV8B 1X6VA 3C8UA 4GP7A 2ZJBA 2W6JA 1G21E 1JAHA 1QHGA 3NEYA 221PA 1M6NA 1A2KC 2X2FA 3WY9A 4Q00A 1R0ZA 2A7QA 4Q47A 721PA 2F1RA 1EX6A 1HYQA 4JVNA 3LX5A 3H1TA 3BORA 3N2IA 4WOPA 5BN3A 4NU0A 1XEXA 4HZUB 4JYBA 1G7RA 4PSKA 2AFIE 2C2HA 4HDQB 3VR5A 2IYWA 4H9GA 3IEVA 3GCGA 3L0PA 1XFAA 2ZS9A 3PENA 3QKSB 1QZXA 3IPXA 3G5UA 4ITRC 4EKDA 2PEYA 3OFND 4QJ4A 5FOTA 4Q01A 1C1YA 1HQCA 4PZZA 5AJZA 3D7MA 1W0KD 3K09A 3UANA 2C04A 5EP1A 4MITA 1XBTA 1X8KA 5DYIA 3U7GA 4MGIR 4ZKDA 1UFQA 2OAQ1 5FUYA 4DSNA 2B7CA 3U3OA 2OBNA 1JB1A 4TL9A 1GKUB 2FGKA 2QBYA 1M1YE 1VMAA 2P3SA 3SR0A 4M9XA 2W2TA 2KE5A 2IS6A 1KO4A 1M74A 2QBYB 3RC8A 3BB4A 2W6IA 4IRUB 2P6RA 1L8QA 3U4QA 2WKPA 2ZYVX 3H84A 1OB5A 2GILA 3GLGB 2IUUA 3RWMB 4TLAA 2CJWA 4L9SA 4ZPXA 4HAUA 4LJ5A 2CVFA 2G1JA 2HCBA 4OK3A 3WYGA 3B78A 3QI2A 3BE4A 2FFAA 3B5JA 4G01B 3CONA 3X1XA 1Z28A 5CIQA 4JBYA 1E2KA 4JLMA 2EWWA 4TMVA 4Z8YA 4ACAA 5BW8A 3DHWC 2ZROA 3T5DA 2DCUA 3DKVA 3NBZC 3UATA 1JXMA 2AD1A 5FBQB 2XJ4A 4TLEA 2IHYA 2W83A 1IQPA 1DG3A 5HCNA 4BEJA 2Z4RA 5L3VA 4URZR 1FMJA 1U90A 1FP6A 4RZ2A 4CDGA 5L3SB 3K0EA 2I4IA 2X1VA 4JKYA 3GJ0A 3CF6R 2EFHB 2P65A 1N0UA 5FUXA 3QF7A 3B60A 1D8TA 4NCIA 5KU1A 1WCV1 3P27A 5B64A 4EIWA 3I32A 2RHMA 4Q4HA 1F2TA 3B2EA 4XTCS 2YHSA 4GDFA 1F2TB 4M22A 4OHZA 5CDFE 3KXIA 2VHUA 4LY6A 2CK3D 4IKEA 5E7MA 1E1RA 1T3HA 1G8FA 1HT1E 1TPZA 3CX7A 1KOFA 1QHHA 3IHLA 4JBXA 4OQFA 2ZRKA 3ZZTA 5GJWC 3SE0A 3U61B 3MSXA 5G3YA 2JLSA 1AZSC 1FQKA 3U3KA 3SBDA 2FEMA 1UKEA 3TR5A 2PX0A 4GSYA 3BH7A 3O8RA 1VHLA 1PV4A 1CR1A 4FI3C 2XSZD 3T35A 4KI0A 5D3MB 1P5ZB 2GA8A 3A58B 5CITA 2JLZA 3QQ5A 3LVQE 4RY2A 4Q1DA 4B2PA 1E0SA 1XTRA 2J1LA 4GZLA 2VHJA 2VF7A 4URYR 5KSOA 2QU8A 2J3EA 1NY6A 3AKEA 4BLPA 1N0WA 4C4PA 4LYHA 1XXHE 3GLIE 621PA 3LXXA 2FG5A 2CLSA 4AG5A 2B8WA 2VA8A 3WMGA 1RRPA 1WQ1R 2OXRA 2UVQA 1NBMA 1XDBA 4RFSA 1E2LA 4HDOB 5JZVA 3CZQA 4OQMA 3PFIA 3FWYA 1T0HB 4Q1AA 4RFSB 3CLVA 4DDUA 1KAGA 5AUQA 2A3RA 2G77B 2OCPA 4M9QA 5B30A 1M2OB 4LBVA 2QE7D 1E2MA 4RZUA 4KBGA 3UMFA 2QTVB 4JLKA 2J7PD 1CP2A 3BS4A 1RFLA 1EFHA 4TLDA 1GTVA 3EPJA 1KMQA 5GJCA 2GK6A 1H8ED 5CYOA 4YDSA 5JSZA 3N2EA 1TQDA 1X8JA 4M1MA 1XTJA 1SHKA 3X2SA 3LY5A 1RYFA 2ANCA 2ZAOA 4WZ6A 3K0AA 4JSYA 3BIFA 4KFSA 2RHDA 1IY2A 3E1SA 3FKSD 1BYUA 5IF9A 4TYNA 4DB4A 3OFNA 3A6PC 4F92B 1EESA 2VYFA 3H4MA 1W46A 1W0KA 2OCYC 3EXAA 3FDIA 4HAXA 3T1OA 4ZV4A 5DNYB 1G8HA 3Q7QA 1EXMA 1I4LD 3UG6A 2G0NA 2WWGA 3W6NA 3WYFA 1VYUA 2C98A 5EE0A 4GOJA 2YWFA 3RS3A 5J47A 1DAFA 1E4YA 3AEZA 1ZIOA 1GL6A 2REBA 4FWTA 2IYSA 4QNMA 5KTYA 4A15A 3E5HA 3KFVA 2GJAA 3MUFA 4XWAA 1ZNXA 1CLUA
chains in the Genus database with same CATH superfamily
2I99A 3A6GA 4XGIA 5JVDB 2QTCA 4D8UA 4MHTA 1S9HA 2UZAA 3WLNA 4CR7A 5FBWB 4NZPA 1C8LA 1TE2A 2C4HA 3USCS 4TVOA 3KJGA 4DLUA 4IMIB 4ANFA 4OB8A 1BSVA 1NV9A 2ZIXB 4FYPA 2OD7A 3KJHA 4Y2PA 3C7KA 1MJFA 2PX6A 3HE3A 5IM5A 5B1EA 1RAIA 2Q3HA 3ZNPA 4QXQA 1HKHA 1DAPA 5HFAA 1EEXB 1M7GA 2P68A 3ZR4B 3TLXA 3K3PA 5LA6F 1UPBA 3I5UA 2WHPA 2LZ0A 4RA6A 1R6XA 4D82A 1MTZA 1TM3E 2WOJA 3SXUB 1GZ4A 1C3OA 4RGYA 1O6CA 1S01A 5IHXA 1U2DC 3JZAA 3I53A 3QWAA 4NNOA 4RCVA 4B6QA 4EI7A 2YRWA 3EQ6A 2DR3A 5H82A 4PLCA 1D2CA 4PTLA 3BEOA 7MHTA 4JBIA 4KSBA 2XH8A 4BBJA 5BR4A 1R5JA 4YAUA 4J07A 5JRDS 3RV4A 5FULA 3N1UA 3TI7A 1HSOA 5LNK1 3FJ1A 3IKVA 5TXGA 3TM4A 4XXHA 3V7NA 4BVKA 1G8JA 3QKIA 4E5UA 5IU6A 5ES3A 3TN7A 3F6PA 4DXAA 4BJ1A 4INAA 5C8XA 2E4UA 2XB8A 3KJQA 3RI3A 2EXXA 3SS8A 4JJ7A 4UOEA 1ZR4A 4D9NA 1I9GA 2I6TA 4PQRA 5C4MA 2ZSDA 1EUCB 2R1TB 3WDKA 1NX6A 5SY6A 3CVYA 4ND8B 1RHJA 1K8YB 3I62A 3GLTA 2Q5HA 3QX8A 4LY9A 3T3DA 1KHTA 5B1YA 3O1HB 1XNHA 1IUPA 4GYKA 4TKMA 2QN6A 2YWHA 5KTMA 3BRWD 4LOKA 2GFIA 3JARA 4WXRA 2IK8A 4Z1MD 5EL0A 3TSOA 1KBZA 4Y2RA 2M6RA 3PFNA 2WWVD 4RZSA 3DZDA 2ZJ1A 2GJ8A 2JFGA 1IEXA 3GFPA 1J0CA 5DM70 2CSXA 1X70A 5JNTA 1NR1A 1XQ9A 2HU2A 5FLYA 1WHTA 2CBXA 2ORYA 4O2RA 1PJLA 1WTCA 4PGMA 5DCLA 3NVDA 4JN6B 4CIWA 1KO5A 3AFIA 4EBBA 4GXQA 4P4SA 2JH3A 1K0UA 2FQYA 2ZBFA 3N8HA 3L7KA 4PQGA 3TZKA 1QR2A 1ISPA 1Q74A 1QG2A 2IY8A 1DRWA 1NZDA 2WM8A 3PQDA 3TQSA 3JQEA 4FILA 1DAEA 1EUZA 2WD8A 5EPEA 5CDTA 4BASA 3K9BA 1A4RA 1E66A 4YCDA 1X7XA 1O95A 1ZM7A 3MLEA 4TL6A 4AU1A 4CYMA 5CBKA 3UICA 2AXEA 2RG7A 4KQ2A 2DULA 4RPGA 1J8VA 1ACLA 1TZBA 1IHOA 3ZGZA 4R01A 5JD6A 1ZH2A 2VHVA 2VJAA 3EASA 1Z0FA 4AWAA 2VBGA 3TIFA 2V9ZA 3DV2A 3TLAA 4AX8A 4EHKA 5KDOA 4C2UA 2X0RA 1EA5A 1SBHA 2AQHA 3G89A 3QLTA 5J2UB 4RF5A 3R8CA 1K4MA 3K8ZA 4X62B 4I19A 1EK0A 2C07A 4C2AA 5DMXA 3WI7A 3AVOA 2QRVA 2O48X 3WSWA 2B69A 4DT1A 4LF5B 1IQ0A 5KAPA 2IHTA 2VNKA 3CF4G 1NSYA 3OJXA 1ZH6A 1ISFA 4FFPA 2QD4A 3LG2A 3FR7A 4Z7OB 2HDWA 5H3CA 4NICA 4P84A 2XT6A 4PO8A 4BFLA 2WE7A 2BZ1A 3GBPA 3OZEA 5LWQA 3FUUA 2BD0A 3MTQA 4OU5A 4XCQA 3GJ6A 1H8EA 3PNPA 3LK7A 3N7UA 4FQ7A 1RXSA 1V7ZA 2J48A 1XZMA 4MYUA 1EE2A 5CT5A 3PUZA 3LD9A 3OPNA 5C5DA 2I4TA 4FW9A 2XDQA 1C4WA 1AQUA 1B4DA 2VP3A 1M6YA 1G38A 3WLKX 4M55A 4HWTA 1FTGA 2X5NA 2HWWA 4JBLA 4L28A 1VJCA 2A5DA 4G07A 1Q1ZA 4M1YA 3WRVA 5GJBA 1YC5A 4FMDF 2FX2A 3ABOB 4F93B 2GSWA 3GCZA 4BQOA 3DHNA 3T3OA 4INOA 9LDTA 1QTIA 3G88A 3ESBA 1C2TA 2V55B 4F4IA 2HCFA 4V0NA 5AHWA 4JP8A 2D5AA 4CM4B 4RXTA 1OWNA 4RTOA 2PQ0A 1QV6A 4EPWA 2AUMA 1PQWA 1Z2PX 2CHQA 1RWBA 4IIUA 3WIOA 5BW4A 1SK8A 2C61A 1MG0A 2W0SA 5E0KB 3DW3X 4W8HA 4RJTA 1ZOIA 3OQVA 4ZOLA 4NATA 3D4OA 1HO3A 1FS4A 1C9KA 1TKCA 4EPVA 2H9AA 3LT4A 4ZYTA 4J3NA 4LGCA 3EXG1 3OZIA 1M0SA 1Q0ZA 1BZYA 4P7GA 2B1RA 3W4JA 1HK7A 2NU6B 1GZ5A 4XWTA 3K15A 2UV8A 2VT2A 1WZUA 3ECSA 5GM1A 4LOLA 2V4ZA 1G4AE 1S2LA 3AIIA 3FCUB 2J0UB 2XE6A 3SIWA 4DBLE 5K0BA 2W9XA 4JP5A 3IELA 1KJNA 2ZITA 4YNBA 5DN6A 1BGVA 4G4SO 4G81A 4UREA 1E99A 3F90A 2AOTB 1JZSA 3VR4A 3ZC3A 3MGKA 3PL5A 3EEBA 2F9MA 1P2TA 1U2GC 4C4SA 4NCAA 3VM6A 3R3ZA 2QRHA 3DTVD 2NXNA 4EI9A 3PSHA 1T1GA 5IRCD 2ZT8A 3TL3A 3V8VA 1XELA 2PJZA 2WLSA 4RHTA 3CSDA 1E1DA 1TAGA 2P5TB 4P35A 5AIAA 2HQRA 3ZDEA 4UEJA 1KP9A 3PXEA 3VH4A 4DHEA 4OGGA 4Q24A 7MDHA 2OCLA 3HCFA 5GONA 1EXNA 4LJRA 4N1AA 1YQDA 1QJCA 2Q46A 2BTQA 5DE3A 4DLYA 5JASA 4CMHA 3I01A 1P60A 5CPFA 2PXCA 3QTBA 1GV0A 3MTBA 2C9BA 2CXQA 4RGQA 4GWGA 3LUBA 1XDDA 2P6NA 3CNHA 2EDAA 4MGYR 1P7YA 4GE3A 1FYDA 2GKSA 3ICPA 2WLTA 2XNDD 2Z57A 2OCXA 4LYGA 2ZUSA 1JLHA 3A1DA 3O31A 2YYAA 2XKJE 1A9ZA 2OMKA 4BX2A 4CLXA 1V8ZA 2R84A 1DPFA 1VE6A 2XVYA 3T5CA 1G59A 5IPFA 3BE6A 2XA2A 1WUYA 3UT5B 2CDNA 2QQ0A 3NU1A 2PD3A 4LTDA 5DX0A 3GO4A 2JKVA 1T13A 4M89A 1Q7RA 2OV4A 1ISJA 4N6OA 1CUDA 4EFMA 3QK7A 1QQ7A 2IDKA 2JD0A 1ADBA 3NHBA 4QOHA 1UZNA 2DOKA 3ZD6A 2FG6C 4M9SA 3LBYA 1ZESA 2ZUUA 3AF4A 4D4MA 5CAEA 2WMOB 4X5OA 4H08A 3W9SA 5EIEA 1SC4A 1KY5A 1GDTA 3P20A 1QHNA 1Y6FA 3HHPA 3I28A 1JR6A 2YV3A 2ZE6A 4GPD1 1KZ4A 4WEOA 1BWRA 1NJ8A 4R54A 5DDIP 1B76A 3V8EA 3R5HA 2YIVX 1Y1TA 1Z4IA 3NAZA 1GP2A 3RH0A 1QTRA 1JDPA 2JD1A 4BNYA 4D9CA 1M2KA 1MAHA 1Z4NA 2RKWA 2BEWB 4QNNA 4EP1A 5B36A 3V2IA 4M0PA 1Z5VA 1NNI1 3UMRA 1OFTA 3M5DA 4MQ4A 4OHXA 2ZREA 2JAPA 3DBHA 1YA6A 2XOKA 3NKFA 5FI0B 2VTBA 2WKWA 1Y4ZA 4EJSC 2P78A 2A1TR 3HB9A 5FOWA 4IEEA 1XZPA 2JB9A 2RCNA 1XB2A 5REQB 1DFHA 2HA7A 4GX2A 5IVHA 3P9CA 1I0ZA 3ZDAA 3RRFA 4OJTA 6CHYA 1SKYE 4I50B 3PFHA 4M7OA 3OP4A 1CFZA 3AKZA 5ADHA 3O3CA 3TZHA 5CA1A 1ZVKA 3JALA 3TDNA 2P4HX 3E5NA 3THSA 3MTJA 5A1TA 3U5TA 4EB6A 1YE8A 1UEIA 4DDTA 3FVRA 4NV1A 3ZWCA 2Y68A 5C37A 1KKMA 1TDJA 3PDIA 1WUJS 2FR1A 1KI6B 3HB0A 3LF1A 2CY0A 3GLFA 3LC7O 4QGGA 3T3EA 1N2SA 2OBYA 2I8CA 3B52X 4J0GA 4OMFG 3W3ZB 5LZ8A 1FJHA 5EINA 5JBNA 3TK1A 2FJ0A 5H68A 4EUKA 1AQNA 2A9PA 3HBAA 2YVUA 1CZHA 3GWGA 4UHFA 4ZOLF 1RRCA 4GZ3A 3FLAA 1TJPB 2R6R1 1IG3A 3NTRA 2H18A 1C4OA 2R1VA 2C9DA 1J8FA 5K7SA 1T1JA 2DLCX 4EYSA 4FKZA 5H9WA 4X3PA 5JR3A 3TL2A 4U9UA 4L5JA 4L5IA 5FBRB 2ZWMA 3WR5A 4B31A 1U28C 5E3HA 3WO1A 2HJHA 1JX6A 3DEKA 3FPSA 3MIIA 2IZ0A 4FT4A 4S1PA 1XZQA 3TKLA 3W6PA 1Z06A 2P2GA 4RF2A 3HI6A 2PK3A 1OUMA 1XD2B 3UB2A 4JVSB 3BIOA 5BQFA 3M9LA 3GELA 3PRJA 3ISTA 3SZRA 4A92A 5JDCA 4EVSA 2CUZA 4JYCA 5B12A 6LDHA 1Y1RA 1AOXA 4OATA 2ZYWX 1JECA 3FBTA 1ORVA 5F12A 5J59A 1FP1D 2DKFA 5CEJA 1VYVA 4XI9A 5K3FA 2OQIA 2VJQA 2ZTVA 1QUEA 4JDUA 3I04A 1UBMS 3GXBA 3VMFA 1M34A 1BQEA 3C8HA 2A9QA 4IVQA 3WGHA 1GLNA 2BSAA 5B2FA 3WVNA 5LJIA 1NVAA 4KLCA 4R4JA 5GONF 4DTCA 4XYBA 3FOFC 1NJSA 5AMXA 2VF5X 2DQKA 1XMVA 5CLGA 3GH1A 1TAUA 1Z4KA 4OH1A 1OBHA 1VJ0A 2CMKA 3GJXC 5G53C 2EERA 2PZJA 4RHEA 1IBKB 1JL3A 2I1QA 4F5ZA 2XR1A 4M8LA 1N8NA 3KV1A 4GX5A 4M8KA 1USIA 3WLHA 5C51B 1NPYA 3HGTA 4K5QA 5FD8A 2YBDA 2AW3A 2ILTA 1H3FA 2J31A 3EXFB 3TG2A 3MHTA 1Z15A 3ROKA 2OGUA 4BO8A 5BN1A 1ADYA 3HCCA 1ORRA 2JW5A 3I6MA 4BOYA 4OXKA 2XCSB 4LDQA 2PMFA 1M67A 1U9CA 2P3LA 2RGNC 3FMOB 4W5HA 3V4LA 3WLPA 3QM1A 4H4DA 1RRVA 5FPQA 3ZDQA 3QIVA 1HDXA 4FB4A 2O1SA 5C4IA 3HVJA 4R8VA 4DM4A 5I8ZA 2W4IA 1QFZA 3PRHA 3X43A 5HIMA 1LDBA 2PD6A 4MW7A 3TTWA 4Z4HA 5HIKA 4NAHA 2CMHA 3B6JA 3IL2A 1QOQB 1MFZA 3FCAA 2RB5A 3BHIA 1VI2A 1YHYA 2B99A 2AVNA 4R0VA 4DUPA 1NYRA 2EFDB 2WKSA 3KTFA 3Q10A 1RWWA 4OHOA 3CLTC 3STXA 5ICEA 3RVDA 1RZRD 3NTOA 3WWDA 1JEAA 2DFTA 2NPIA 1LI7A 2O2SA 3ESXA 3IFSA 4MP3A 4OVKA 3WQSB 1UF9A 4G8BA 4E2WA 3ZG6A 4YJ2A 1EAYA 1NMEA 2JGAA 5F52A 3RLIA 1Z3CA 3D3WA 1RNLA 4ZA2A 3KD2A 4YJ3A 2CLIB 2GYWA 2HTFA 4HWSA 4ZPJA 5EZYA 3ZCUA 1FTYA 3C85A 1T2DA 2ZRIA 5I47A 5DSZA 5HFJA 5LPNA 4DM7A 1P4AA 3B6EA 3WNVA 1QPGA 2PR2A 2FSVA 3KIPA 1TM4E 4N0QA 5EE3A 3HKDB 5A4JA 2JLZA 4NI5A 2R4TA 3FYSA 5CEEA 1YV9A 4UHBA 4GG1A 4GRAA 5CA1F 1QGDA 3WGZA 3PA8A 4BFZA 2RIPA 3B6ZA 1NM5C 4H1VA 4IMPA 1QFXA 2XF8A 2A14A 3G9QA 3OTIA 4M0DA 5DYYA 5TEVA 1B2LA 2AYZA 1JXOA 1YRQA 3RTGA 1CNMA 2BGLA 3UJ7A 1G8MA 1SELA 2I1WA 2G5GX 1B43A 2VP6A 1IJFA 2ZRDA 3M6WA 3AF6A 3UT6A 2C7OA 1EXWA 1ZK2A 3EVGA 1ES9A 3VGPA 5LP6B 2Q6KA 4ZQCB 2ZJ6A 5I9MA 1N6NA 2YVLA 3OX1A 2B0JA 2PVCA 2X3FA 3HA3A 2LD4A 3PPIA 1T2FA 1GY8A 3QELA 4AUKA 2ZTSA 4DRZA 1XRRA 3WLOA 1J99A 1X1EA 1YQQA 1FP2A 1XEFA 2IPLA 1NN5A 1SBZA 2OSVA 4X85A 4B4UA 1FTQA 3ZHUA 5BNWA 3PYLA 2C03A 4Y2XA 4EKYA 3T9FA 3E2MA 3LT0A 3MM4A 4LZZA 4UUQA 2ZWVA 2BEUB 2IW3A 2WAYA 4YRFA 1L5NA 4EH1A 2BTEA 4MUEA 3KVVA 2V7VA 4XQEA 4JLAA 2R5NA 1Y1QA 5D6NA 5BT8A 4PAQA 2OMEA 3P32A 2QJOA 3KZOA 3W7AA 3U56A 2FPWA 3LXUX 1L5MA 4YXWD 1O1YA 5A6VA 4UCWA 4AKSA 2FV8A 3OF2A 4FJ0A 2OP0A 3RVQA 1QYIA 3W79A 4JLDA 3THYA 4WJZA 1GL3A 3EW9A 4ONEA 3I34X 3PIRA 3MT8A 3KBOA 2RMKA 3CSSA 3NBYC 4ICIA 2JEZA 5J5VA 4DOMA 5LMCA 2BRUA 2FW7A 2X15A 3QFHA 4I81A 4EG7A 1SEPA 5FAKA 2KYRA 2DY1A 3EXIA 1JU3A 3MXOA 1DWPA 1FZTA 4ZMSA 4X8HA 4HV4A 2WM3A 3Q7PA 1CUZA 1QCDA 2EZUA 4OQXA 2AMLA 5AJVB 5FR2A 3RC9A 1P4SA 2QM0A 3OM8A 5SZKB 5JLJA 3FSJX 4R2XA 3ND7A 4JGBA 4UEOA 3COSA 1D4ZA 3G2PA 2DWCA 2QAGB 2GFHA 2VSFA 4Y9RA 1JHXA 2X14A 1APBA 3QPCA 3KYCA 4IAOA 4O8CA 2VYNA 3K0CC 1V4NA 5CLJA 3OWXA 4Q1VA 5DK6A 3QU9A 4NYIQ 4D80A 5CEFA 5AW7A 4F6RA 5LQUA 1ZMTA 2PQMA 3G9TA 4QDZA 3HM9A 1JHUA 2PSFA 1CFJA 3ZE8A 1L7QA 3B5EA 4IXDA 5JQGA 2O8BB 3HXTA 4D56A 5E1DA 5KSYA 3HR7A 2IX3A 3TRJA 1FTNA 4DR4B 5ALNA 4N7BA 3PS9A 3A14A 3PXDA 4Y0NA 4XVRA 5ITSA 4PZLA 3AL0C 4MR9B 1ZR2A 4QLBA 3BD6A 2Z43A 2C4TA 5DNUA 3FX2A 1UWCA 2G9UA 1LLCA 5BYBA 2GESA 3EIWA 3FOBA 1RPNA 2O57A 1JFVA 3TG8A 1EX9A 2QQGA 2V7BA 2V59A 1QIFA 5JS6A 5MN6A 1LK5A 1T5SA 4LNUA 1WPGA 3VHQA 1E2BA 2N1MA 4WNAA 1SB9A 4WLFA 1K3UB 5BP7A 4N0EA 3PUHA 1PEKE 4YJ2F 3U17A 1QHFA 1X86B 3I8XA 5CNIA 4H7JA 2Z2XA 3GLQA 2VSYA 2WVHA 4RKYA 1DJOA 3WGGA 1XAJA 3R1IA 1UPCA 2ACWA 1KAHA 1KVSA 2XNSA 1PGQA 2OFXA 4YJ3F 5EZYF 3U0VA 1PZEA 2PUGA 4PS1A 4H1UA 4YONB 4HWKA 1N6PA 2CV2A 3PHGA 2X2OA 2JI8A 4O1HA 5B58C 3ZS9A 1JTVA 3OLCX 3SXPA 2NU9B 2XNKA 1E9RA 1E6KA 4YMGA 5LD2C 4JEUA 4KX3A 5DK4A 1J8DA 2WAMA 3GVIA 2C2MA 5AXCA 1LBTA 1GL7A 3OBIA 5C0OE 3KKMA 3MILA 3EN0A 3EBLA 2G71A 2NTYC 4N48A 3M83A 1WZEA 1Y4SA 1ZOPA 3IP9A 4W5WA 3BEDA 2F4NA 3WIUA 3MC1A 4RLHA 2A1UA 1I94B 3CF4A 4PVCA 2JFUA 1BJRE 3IP8A 2QRJA 3P0HA 3UB3A 1H0SA 3R0ZA 2NXJA 4NS4A 4R1MA 5IW8A 1B8VA 5JSFA 1NF3A 3CLHA 3ZE9A 2J7KA 4JI4B 4JI0B 2YWCA 1FSGA 3EG9B 5AVOA 3IBTA 3C2QA 2CFOA 4NCBA 3FCXA 1Z7EA 1G66A 4U7DA 2PMKA 1U0LA 1GGMA 1RADA 2A57A 2ZB7A 2ZQYA 3KPVA 4INZA 3EVFA 2AKEA 3OY7A 2IYTA 4K6FA 4TTRA 1FUEA 2QTVA 1AY0A 2IPXA 2IZ5A 3HYTA 4UE2A 4BGEA 2CJFA 4BN4A 2NYVA 1CS0B 4QUKA 1SCKA 4RHCA 1UMDA 3EA5A 4N3AA 4G1UC 4PRKA 3UCEA 3IA2A 4KQ9A 1AX9A 4OXNA 5E7JA 1M1YA 3DVLA 1JQEA 4PYOA 4WIAA 1PE0A 2UYYA 3RSSA 1A5AB 2IUSA 5KHOC 1B3BA 1R9JA 4BEWA 2X5JO 2HA6A 3QU5A 1SCBA 2WSSD 3TOCA 3HCPA 1P74A 3F98A 5TY0A 1QO0A 2G0AA 3IHKA 4LE1A 2B7LA 4ZK2A 1TK2A 3P94A 1PWYE 5F5LA 3KUDA 4AZ0B 3T61A 4G5GA 2X2EA 4LZOA 3O21A 2CXNA 1NNUA 1P7WA 3C14C 4HATA 3TEJA 4UXJA 4WJKB 1XVUA 1A3CA 3GFFA 4G41A 3UJ3X 4DR5B 1J25A 1I33A 4KG7A 1YGYA 4PCAA 1Y1LA 2Q9UA 4Q6WA 1FP7A 2P90A 2QTRA 1T9DA 4YJDA 2IUEA 1YF3A 2IYZA 5JZSA 1JQBA 3D4PA 2HK6A 1NFRA 2WJVA 3KOMA 3M7IA 4G8JA 3L41A 2GK4A 1C0IA 2R2GA 5AHRA 1JMVA 3A1NA 1YSCA 1JAZA 2DFVA 4BYMA 4FHZA 5K3EA 3PKJA 3VYWA 5ELXA 5HA5A 1KEEB 4R8MA 3RU7A 3D6HA 4J1TA 2H11A 4NZ9A 3T9CA 3FWKA 4P81A 3W90A 2QG4A 1J07A 4K8OA 4MHOA 4HAYA 4IX1A 3UYKA 3RFVA 2WUWE 1QG0A 4M8NE 5EXPA 3W3AH 1TO6A 2FOLA 5DI9A 2XB2A 4CIYA 2Q0HA 1E5LA 3S1SA 3OLZA 5CT4A 3OUTA 4XD2A 4X65B 1QIIA 4KCGA 1PR2A 1DTEA 1PZNA 2QW1A 3PRKE 3ETHA 4IQ4A 4UUOA 3PFGA 1ZMXA 3CZ4A 2FZGA 1F2UA 2BTOA 3ZHZA 2IL1A 3DMTC 2QUKA 5JSKA 4E5MA 2HF2A 3GG9A 5FV7A 3WNDA 2R6ZA 1MN6A 3J7TA 4KWIA 1KDPA 1L1EA 1UFOA 2F90A 2JIQA 3BUSA 4F38A 5EPOA 3CW8X 4LHEA 2O2ZA 1T6YA 5DFAA 1A98A 4LJYA 1ZAKA 4QYWA 4A0SA 3A1WA 2BVNA 3PEUA 4P4NA 2QRQA 3EXEB 2IOFK 4RK7A 1OV6A 2G5TA 5EE5B 4FS8A 3C43A 3U7EB 1XPRA 1RYYA 3KV3O 2J5BA 2Z2JA 3TSCA 1OWPA 3UY4A 2W2XA 4EG8A 2JJ2A 4B6OA 4MQFB 3B53X 1CKEA 1YVEI 3DBVO 3DMDA 4I55A 4Z4IA 1NNLA 3ANXA 2F43A 4K9PA 5K20A 3HV0A 3GLIA 1I7LA 3ZVMA 5K8CA 5EZ6B 4L2IB 5KTPA 1IXYA 4IIBA 2JIZA 1GUZA 1QDEA 4NAVA 2B94A 4RVFA 2XE7A 4L8VA 1GLGA 5CD9A 3GEIA 4C4YA 3S2UA 4CKXA 2XBLA 4QBTA 5EFZA 1P9WA 2YXBA 4J3FA 4HMOA 2HM7A 3ZCVA 3BWYA 3M6MD 3IAEA 3GK3A 2CMGA 4DV7B 3QF4B 5GIPE 1H0RA 2DECA 3L6BA 1Z22A 3OKPA 4TS3A 2HEGA 3EQ9A 3HEAA 3WWPA 1N2GA 2ECOA 1YOBA 4IFIA 3L9WA 4MH0R 3N3AC 4DCPA 1H4QA 3VAAA 4FJ2A 2I2WA 2VDNB 1TKAA 5G0SA 5TPWB 3UO8B 4XYEA 4MX8A 5L3RA 4NDNE 4E32A 1LK7A 1PL0A 2P6OA 3PJEA 4ENTA 1RXVA 1SIUA 3GGDA 4NBWA 4ZYVA 3BHNA 3IE0A 4X1KA 4LVCA 3OCZA 1KFKB 1RYEA 1YAJA 4OHMA 3PCXA 3HI4A 1EB9A 1X19A 2HEIA 4WDRA 4WK6A 3SBXA 1RI5A 4AY2A 4KIJA 1FFEA 4HNHA 3N28A 1FFWA 4J6EA 4TMYA 1DO0A 2X0IA 1UJBA 1MO3A 1QJ4A 1CUWA 1DHRA 2F62A 2YWBA 3I05A 1WDWB 3OMLA 4PBRA 2OYRA 4HDRA 1ZLXA 1VCOA 3ZH9B 5GZ3A 1GG2A 3ZQJA 1A8QA 4H7HA 2ZVJA 4IWNA 5BSVA 4A0GA 1Q84A 1UZLA 3B9PA 2TMYA 2ZB2A 5IFLA 3ZQ4A 3KXLA 1Z18A 3GA0A 3F78A 5B3AA 1H1LB 3FTCA 1ZHHA 4E4YA 2XB4A 2VN8A 1R3DA 3H87A 3OSZA 2ZM5A 4RORA 2IE8A 4A0RA 1I6KA 2ZJ5A 2V6BA 3BWBA 4PLWA 3RD5A 1IUNA 1RACA 2VPPA 1SG6A 4HAZA 5P8WA 3NFRA 1QANA 1H0KA 1KIMA 1LLUA 1SVSA 3D3NA 3ZJ5A 5JWOA 4D3XA 4FN5A 4QHTA 2XHEA 3BN3A 3N8KA 2B4QA 3VOTA 4JI5B 3NPMA 2GVZC 3DS8A 3MUNA 3OAAA 3R6TA 3CR8A 3VTFA 3BD7A 3FVQA 4BNUA 5J4VA 4D02A 3NGLA 3I9KA 3M1LA 1MJGM 3UG7A 5TDHA 1DIHA 4JYPA 4ARAA 2ZYIA 4HEJA 1ELOA 4G3XA 2JGLA 3HZRA 1XCJA 4LX0A 2NVOA 3RODA 4JI8B 1SVOA 5AIBA 1A2OA 3FSGA 4JH0A 1GYQA 4D4GA 2HSGA 4DCUA 1XALA 4EB8A 3LQKA 4EHDA 4NHOA 2GNOA 4U9HS 4TYPA 2SICE 3TJMA 3VR3D 1QO9A 2X2PA 1MB3A 4M7PA 3FSRA 5CURA 3RFXA 4DCTA 2HIHA 4MV9A 4JBNA 1YZLA 3MMNA 4OOEA 1F8UA 4ZU6X 4ZYYA 3V4RA 4UOZA 5I4KA 2R751 1U0EA 1SVLA 3L8DA 1E2FA 5JHHB 4C01A 1PJBA 3ORSA 4RTKA 3DAOA 4OQNA 1CJUC 2P9EA 3DDUA 1XDUA 4YRNA 5CW1A 3FCOA 5DNAA 3RSLA 3G0OA 4P4LA 2BGRA 3QVMA 2QSUA 5DNVA 3LYLA 2H1CA 1XZDA 3D8NA 1VCIA 1P9LA 3M2TA 5E8RA 1W0CA 1EINA 3Q0IA 4NPAA 4BO4A 1Q1BA 3G2KA 4I55F 4L27A 5JCOC 4AYXA 4Q9AA 2NQ8A 5E3IA 4YIHA 4HBGA 2P6MA 3E5RA 3U4HA 1TNDA 1FSSA 1NQWA 5DRTA 2Y1FA 1YDMA 3JVEA 3VKHA 1VC2A 3KJXA 3K94A 3RRYA 1N1EA 1V11B 1V3VA 4C22A 1QGED 4R9SA 3W7VA 2O9JA 3H5TA 3T4UA 1FK8A 1XKXA 2BGMA 4E1AA 5FRDA 1EEHA 3LPNA 3U1TA 2ZPAA 4XRGA 1TA0A 2AMFA 2PGNA 3VXKA 2HRCA 1Y6JA 3EYAA 3ONFA 2VF4X 1FDUA 1G5TA 4YT8A 1KYIA 4IQFA 4F3TA 3D7NA 1BXRB 4WINA 1WXXA 2D2EA 3GOHA 5TF0A 5EXDA 1VBFA 1XTBA 3KVOA 1CR6A 2HYDA 4CLOB 1B8NA 1BJKA 1X77A 3KELA 2L69A 2IJGX 1YVUA 3DDZX 3O4FA 1SBNE 3C7AA 4KK4A 5K8LA 4MEJA 1ESEA 3L84A 4UHEA 5FTMA 5JTTA 5KWSA 2WP8J 5B7NA 3Q5EA 4XD7A 4XGQA 3LBIA 2PY6A 3JD2A 5HCNA 4ND3A 5KHAA 3CLTD 2AI1A 1ICIA 4CTMA 4BO7A 2OK8A 4GOLD 4Q9JA 1P0QA 1HE4A 2XMQA 3DBLB 3IH5A 2YS7A 4LGVA 4CIBA 2H1HA 3K6SA 2I55A 3NDRA 2O8FB 2ORED 4BMVA 1N8SA 3WXMA 2IU6A 5L4NA 1M2HA 1T2UA 1BWSA 1K0FA 1Y5LA 1T24A 2VHZA 4QVGA 4RAQA 2EX0A 1U3CA 1XC7A 3D6JA 3IIJA 1YQTA 2P1RA 5KINB 3VJRA 1HEIA 4N7MA 3VU9B 4Q3LA 1IN4A 3QG5A 1CJVC 4A5SA 3Q6MA 3EOAI 3FE2A 2RH5A 3HU1A 1RWMA 4RY0A 3T6KA 2FUG6 4L0MA 5M34A 2VQEB 5C9ZA 1XUOA 3E82A 1E1KA 3I23A 10MHA 3FOCA 2MSKA 5HOEA 2PTGA 2CBZA 3CRVA 1U8XX 1QOPB 5CVJA 1L5KA 5KQRA 4QEKA 4FSDA 5IJWA 2FWMX 4GT1A 1CUBA 2AWNA 2MIIA 1YR7A 3BGVA 1DFGA 1RZ3A 2JANA 2WT9A 4ZKEA 4G0PA 4B47A 4W5RA 1U0GA 3WE7A 1UQTA 5KX5B 1ZIPA 1WM1A 4AJ9A 5DBHX 4I8XA 5I9SA 2VRBA 3SBOA 2YNMC 2W11A 1PI3A 1SUEA 4XLZA 2C1EA 2JBAB 3SLGA 5AM3A 1LPPA 2EJVA 3O9MA 4CLEA 2AOXA 2IEDA 5GMOA 5CXUA 1QH1A 4CCWA 5DH9A 4ZN6A 3TBHA 2OCIA 3LT2A 1HOXA 2I1LA 1L4MA 1RXUA 4A82A 4F3NA 1TZMA 4O63O 4BP3A 1OC2A 2BFNA 5F9HA 3I0NA 3PLRA 3JQAB 1BKSB 2GHIA 2ZATA 3QPVA 4KFUA 3RHZA 3TTYA 1NJ1A 7AT1A 3KYIB 1FVXA 1U2TA 1E79A 5CJPA 3DPIA 3QBTA 1V26A 4Q7LA 5FHQA 4JEIA 1LNZA 3DVAA 3UWPA 2H85A 5DBFA 1KMMA 1UCFA 5HR5A 4LGMA 4A36A 2WJ4A 1R0KA 4RPJA 4KO3S 4CEHA 4YRQA 5FOVA 4YT4A 3HA7A 5HTKA 4JJ6A 2OVBA 4JQOA 1N8TA 4NZYA 4CKZA 5E6SB 1UKYA 2ZJ7A 3AG5A 3MFYA 1WWKA 4QM7A 1G6KA 5DEOA 2Z2YA 1Q77A 3KLBA 1BEEA 2AG6A 2JNWA 3R7WA 5CK5A 3B1ZA 1W93A 3QRWA 3BMOB 1AN0A 3KUXA 3LLSA 3L77A 4U2KA 3KSUA 3ZHQA 3BCRA 4C21A 1CC1S 3GUUA 1MHPA 1RC0A 3N8DA 2AI2A 5H81A 4LDNA 2I54A 3OQIB 1DDIA 2G25A 2YZ2A 1Z7YA 4C3UA 5A3RA 5CVTA 1IEQA 1Y89A 1FFGA 2GTHA 3BAFA 4CKCA 1HF3A 4WXPA 1SA0B 2RCYA 1TU4A 3V8QA 4MI9A 2H1OA 4QTTB 2OORA 3Q9LA 1SUBA 4WA7A 1NFQA 5CM8B 3VU3A 4Z7JA 1S8OA 3VSDA 1N3YA 2QLMA 1RFGE 2C7GA 2EVWX 4IG9A 4G8DA 4OP3A 4US1R 4WXEA 3SDZA 5IXSA 3D31A 4PC7A 2WTMA 1TTPB 3M4NA 2OZEA 4IIVA 4M21A 5H5JA 3R8XA 3W7BA 2X5KO 3ZUGA 4BB5A 4YFYA 2Q8PA 1WDLA 1E3WA 4GLBA 4U2CA 3ED1A 3KKOA 1SC3A 5L6MB 1MIHA 1DJPA 1C7FA 3SDBA 5DHPA 3NV7A 4HFNA 5LBTA 3BBLA 2NNWB 3ELYA 2AXQA 3HO1A 2HLDD 2P2ZA 1J0EA 4HB4A 5DASA 2NYAA 1TCVA 3ER6A 1WBJB 1F2DA 1H2RS 2C8KA 1JYEA 2HLHA 1V4BA 5T4HA 2VS1A 2A0FA 3ABSB 3K32A 4LOIA 1GGHA 1OYVA 3FWHA 1TJ4A 1UQUA 3I92A 2VZ9A 5IYZA 1V8OA 3ZK9A 1E2NA 1KO1A 1UBKS 4EG0A 2LCFA 2PDAA 3ILHA 3N8IA 2HF7A 3MSCA 1NJFA 2Z5FA 1UK8A 5DIFA 5I7FA 5ER9A 1U9IA 4GMGA 1AQ6A 1JEEA 1WVMA 2CUNA 2R8ZA 5IBCA 1II8B 3BJIC 4QWMA 1GEEA 2D2IA 2G36A 3C3XA 3DEHA 4MUJA 1PL7A 2XKBA 1QZUA 1XSEA 3G0BA 2C57A 3A9RA 1PG5A 1QLWA 2AEEA 4IXNA 3RU3A 3WQHA 3E8XA 4EJ2A 4ZDWA 1K3TA 2HBQA 3C5HA 5FBKA 2JBWA 4CU5A 1Z73A 3H6HA 2WUVA 1M1XB 1U7OA 4WFJA 2IRWA 3K1AB 2B92A 5E4TA 5FB3A 2CNLA 1N25A 1SKYB 5AKJA 4JB2A 4EY3A 1HE8B 3K2QA 4NULA 3TW6A 3O94A 3DT8A 5AKKA 3HR8A 5E4JA 2OFOA 1BW9A 1P1RA 2QVZX 4NFHA 5GIOE 3LRTA 4Z8XA 7ABPA 3C8MA 1Y3HA 3RSGA 1N5MA 4Q4JA 4Z9XA 3K0KA 5FLKA 5KTSA 5BSMA 1FF9A 1P9OA 4LJAA 4ML3A 2CLMB 1X0XA 4PO1A 3JASB 2AJCA 2H57A 4LFBB 1QXSA 5KQPA 2JVKA 3PXXA 1V35A 2CXSA 4ECAA 1PNQA 5C80A 2ZRJA 3Q3IA 4J1NA 4C4ZA 3BXOA 5DP1A 1YD7A 3NOOA 4WY2A 1T1RA 3Q8XB 1LF5A 4X71A 3FVWA 3N86A 2HI0A 3DC2A 5KVQA 5FL7A 3S40A 3AM1A 3UMJA 2FZVA 2GLXA 1T2EA 1OD6A 3HO8A 1L7NA 3OCUA 4RLSA 5AVJA 3TQCA 5IUKC 1FNSA 2BHNA 5JNVA 3GQVA 4CMIA 3D5EA 4G9EA 4IJ5A 4LYFA 3B3QA 4R2JA 2WWWA 3BSYA 3MELA 3MT7A 5DX1A 3SQLA 3VOSA 4F2PA 2F8SA 4DLWA 2OOSA 2PLRA 1PZHA 1W29A 1Z3IX 2P41A 3W06A 2CXXA 5AQEA 5D3QA 4XVCA 4MSUA 1H9CA 4YJFA 1ZGGA 5FYQA 2NOAA 1EK1A 4MO2A 3ODGA 1HMPA 2ZBRA 4NU8X 2BBWA 2PBZA 3FTQA 3GLKA 3HR4A 5C3UA 3IP5A 3LV8A 4P2GA 5TARA 2GM3A 1FMCA 1H0HA 3ICCA 1KI3A 1YZVA 2C3YA 4MIKA 1MXFA 1H9BA 4Y98A 1OPXA 1U8UA 1KC1A 1K2WA 4NBTA 1NW8A 1Q19A 3W5IA 4P34A 3EFOA 1C29B 4D81A 2Z95A 5LZ2A 1GAXA 2VKQA 3AJ8A 4XVQA 1SUWA 1VPTA 4B5KA 3CISA 4UMEA 1AS2A 4GH5A 1L5ZA 4CFZA 2QD5A 3TM5A 5TIIA 1M2FA 1N7GA 1OTHA 2FWBA 3SS7X 4IKOA 2PBFA 1ZBQA 4NTZA 1DL5A 3ILSA 4GBGA 5CCBA 3C3EA 3EXHC 3WRXA 1A77A 5CP8A 3S6JA 3VO2A 3AFNA 4PICA 4DMLA 5DNEA 4PN7A 1AA6A 1NOJA 2IV3A 4PWZA 4EW6A 821PA 2AG0A 3WK9A 5AKYA 4TYQA 4R9NA 5TGZA 3U3RA 1Y3AA 4HS9A 4IJKA 2NO4A 4UATA 5AK6A 8GPBA 2P4UA 1WV1A 4R2KA 3T4XA 1OXXK 1T2VA 2QP9X 3DONA 2BUAA 1SU6A 3DMNA 1Z6TA 1SCDA 2Y6UA 3GMSA 3G17A 4QDUA 2RGDA 3ZIAA 3EX7C 3ND9A 1XLWA 1YQGA 3A10A 1DMSA 1MBZA 1ZNWA 5JXJA 2IQ5A 2VP2A 4JL8A 2FWNA 1CSEE 2DFPA 1EVZA 3AQ4A 3T1VA 5KOJB 3WL6A 4Y2HA 5BQXA 1O8BA 2QDXA