2DR3A

Crystal structure of reca superfamily atpase ph0284 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
239
structure length
232
Chain Sequence
RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKGIIVYPDKVLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RecA superfamily ATPase PH0284 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords UPF0273 protein PH0284
total genus 74
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dr3A00
1KI3A 3CONA 2IS1A 2IYRA 5TB5A 2O8CA 2QPTA 2LKDA 1E96A 4RFSA 1E2HA 1N3BA 1N0VC 4XVUA 1OSNA 1OF1A 5L8VA 1IN7A 2VSFA 2H7VA 3MCAA 2C77A 4Q01A 2PMKA 3KUDA 2H5EA 1M7GA 4GSYA 2BOVA 3ZS8A 3CZQA 2ZAMA 3NHAA 2FU5C 3K9GA 1HTWA 2NO1A 2R6FA 4MRPA 2XITA 3D31A 4JS0A 4N3NA 1AK2A 1VG0B 2YWFA 4NH0A 1JJ7A 2VEDA 3DMDA 2NO0A 5DI3A 3SFZA 3VR5A 1ZVQA 1KK3A 2WAYA 3FMFA 3WMFA 4UXHA 2R8RA 1DOAA 1UDWA 5EE0A 3WYGA 5K8UA 4V0NA 3IUYA 4KXFB 1YVDA 4DWJA 4DEXA 4Q7KA 2ZRCA 3RRMA 2WJYA 1E2KA 2FNAA 4LYJA 3KQNA 4D4KA 5JRJA 4LX0A 3CX7A 2WJGA 1JR3D 2GEDA 2VP5A 2FEOA 3AH8A 3QBVA 3E5HA 2ZR9A 5AJVB 2J0VA 1L4UA 2F3RA 3LXXA 1HE1C 5GVRA 2NQ2C 1TF2A 4JSYA 2EWWA 2CL0X 3LLMA 1N0WA 1OXTA 2GETA 4LHVA 4RD1A 4BLQA 2AFIE 1XJQA 1MO5A 1TEVA 2WPDD 2ONJA 2VHUA 1KKLA 1W44A 3FKSD 4PSAA 2K5UA 4LGMA 1Z83A 1RJ9B 3CUEF 1COWD 3LNCA 3PV0A 3THWB 2PZEA 1CEEA 3H4MA 3GLFA 2VP2A 4JLAA 1ZUHA 1UPTA 4H1UA 2AK3A 3G82C 4R2HA 4ZCLA 4A6PA 2PX0A 4AWXA 4KI0A 4MYCA 2H17A 3EZFA 1LS6A 2GJKA 5BN4A 1MO6A 4S2EA 2ZYVX 1ZP6A 1HEIA 3QPWA 4LK2A 4BZPA 2X2EA 2WKRA 5HCNA 1D6JA 4JBYA 3K0EA 5FBRB 2ZM5A 2JDIA 3H2YA 2JEOA 4HATA 5BXQC 4LBZA 3IQXA 5EE5B 3W6PA 2OSBA 3I73A 4FMDB 3A58B 3ADBA 1L8QA 1N6RA 4GBMA 3RS7A 2GF0A 2R6AA 2WPDA 3QKUA 2ZI4A 3CPHA 4DBLC 1MR3F 4B71A 2WMOB 1CTQA 3MD0A 4LSGA 3O8DA 2FE4A 2NO6A 1ZM2A 3FE2A 5IK2D 1XPRA 1SZPA 1IAQA 3DM5A 4L4UA 3GD7A 2XTMA 3ZD7A 1M7HA 1GDDA 2WSSD 4QGHA 3U60B 1JECA 4QKQA 4UNNA 4AC9A 2AHOA 1G3IA 4AY2A 1PLKA 4UNPA 2ZREA 5FI1B 3SFVA 1OIXA 1SVOA 3P27A 4BFTA 2Z4SA 5DISB 1SVIA 1W1WA 2FMXA 3X2SA 2ERYA 2BM0A 4QBHA 3VR1A 5KPDA 3SHFA 5KHOC 3P26A 5FH9A 1XTSA 4CVNA 1CBUA 3OAAD 4TLAA 4N0EA 5K8TA 1ETUA 4N1AA 2A30A 5TDHA 2QY9A 2R6CA 1C4OA 2C2HA 2IK8A 4HB4A 5K8LA 1RW4A 1NBMD 2B8TA 2X77A 3OF5A 2A5FA 2DWQA 1ZM7A 4TLBA 2ZRIA 2NGRA 3WP0A 1O3YA 3FMOB 3W3ZB 1MKYA 4KV9A 2D74A 1GSIA 2GXUA 5CM9C 2NPFA 1NMXA 4CRWB 1QHSA 4ZCMA 3C8UA 3WRXC 1AN0A 1KMQA 4RKFA 1US8A 3THWA 1U8YA 1TPZA 4ABYA 3QG1A 3DHWC 1E94E 4B35A 1OHHA 4DLTA 4Z8YA 1Q1EA 2ZUCA 4B44A 3H0KA 3L0IB 5M04A 1MRSA 4MRRA 3EA5A 2IWRA 2AKAB 3BFKA 1KZGB 4YMVA 1DARA 1ZCAA 1G8GA 5E4FA 4TLEA 3BJIC 4BRWA 4MRVA 5H8WA 4AKHA 3RABA 1KI4A 4XVRA 1U94A 1G41A 3PEYA 1CR0A 2IYLD 1D8TA 1XEFA 4KFRA 1OIVA 1ZINA 2ZJAA 2D7CA 3AKCA 5DN6D 2OO7A 2GWHA 2IYSA 4BLRA 5JSZB 2QAGC 4OQFA 1IN8A 2AN9A 1BOFA 1E9AA 2JLXA 4KO8A 2AD5A 4HUQA 1U90A 5IRCD 2JLVA 1MV5A 3SYNA 1NVVQ 3K9HA 2FH5B 2GK7A 4M22A 4PR0A 1EFRA 2NMVA 1N6LA 3OIWA 2EQBA 4KBFA 4BFUA 2VHCA 2P67A 4OI0A 3I92A 1LNZA 1NBME 2E1RA 2QRZA 2W83A 4LJ9A 4JKIA 4C3ZA 1KSJA 2P0EA 2I3BA 4NP6A 5G40A 4R71A 2IHYA 2CCKA 2QI9C 3FFBA 2R6GA 3UXMA 3K8YA 3GJ0A 1NKTA 4L9SA 1KGDA 2ZPTX 4MGZR 4PZZA 1FP7A 2GAAA 4Q5IA 2QU8A 5BYJA 3U3OA 3W9YA 3DOFA 2FSIA 4XH9B 1AS3A 2QGZA 1S1CA 4UJ5A 2YJTD 4DCUA 3GLHB 1QDEA 1KMHB 2GILA 4HAXA 1UBGA 4NCIA 4NKRA 1P9WA 1KJYA 3K0FB 4CF7A 2ZR0A 3U61B 1CR4A 1AA9A 1X3SA 1F48A 4FIDA 5DYIA 1XMJA 5JI2E 2ZSDA 3A37A 1EK0A 4GFDA 3C7KA 1W47A 3OEHA 1G7RA 1S8FA 3GLFE 5JI3E 2WWXA 3BS4A 4CEJB 3AP3A 4XWOA 3A1TA 2JJ2D 4RFVA 2QORA 3K0AA 2NIPA 1NN1A 4MUAA 1MRNA 2ZS9A 3CNLA 4DHEA 1HY3A 2VO1A 2RGAA 4TWZA 1WXQA 3NEJA 1S96A 1VIAA 3CIOA 5DIFA 3AVOA 3ZD6A 4P4TA 4M8NE 4A8JC 1KSGA 1XD2B 4W5JA 3K0SA 1P72A 1TUIA 3R8CA 4JT4A 4PX9A 4IRUB 4C0JA 4D4MA 2Q3MA 1TEXA 1L7VC 2WKQA 4C7OA 5DHFA 4AYWA 1BH2A 3ICQB 1OFUX 3RDPA 3VX3A 4G0NA 3F3YA 5EJEA 4JIMA 5K8IA 2B8WA 2QTVB 1I4LD 1DBSA 2GJ9A 4LV6A 1ZUNB 4BGDA 1WDTA 1N6NA 4WAUA 3UPUA 2XNDD 5HPYB 3ZYCA 3BORA 2EYUA 2REBA 1NKSA 2WWFA 1E2LA 4JBXA 1N5IA 5D3QA 4TMTA 3VAAA 1KNXA 4NU0A 3AVVA 1DG3A 2GNOA 1ZAKA 1YZKA 3B78A 3KXKA 4BUJA 4DKXA 2NOAA 3C15C 3CPJB 4P4UA 4XSGA 3FGNA 5FBWB 3ZLJA 1JQLB 1N25A 1Z47A 4Z54A 2BBWA 3LX5A 3W6NA 8OHMA 5JS7A 2DFNA 4P31A 4PTLA 5KOYA 4G1UC 3IEUA 1EWRA 1JAIA 1ODFA 1MABB 3QF7A 4Q47A 4RD6A 1XDBA 3VU9B 4C0HA 3PCRB 2IUUA 4NYIQ 1C9KA 4I4LA 5HKKA 2PX3A 1VYUA 1OW3B 1QHHA 1IY1A 2IS6A 2HDNB 1J8YF 4TZ0A 1ONBA 2FFQA 5KTYA 4A0FA 2QPAA 1IY2A 3U4QB 3U2QA 4MYUA 3FMPB 1ZM9A 3AF3A 3B5JA 1OH8A 4OHVA 2YC4C 2ODNA 1E0JA 4RVCA 5KO2A 1FMJA 5JEDA 3QI2A 1XPOA 4D82A 5E3HA 1GL6A 4ITRC 2FOLA 4TQUS 4B33A 1J70A 4MA4A 3ZVRA 2H1LA 3ZQJA 4C7OB 5JJKA 2XZLA 2RGDA 1ZBDA 1G7SA 4FINA 4M9QA 3ECCA 2IA5A 2HCBA 3OZXA 1E2PA 1Q1QA 4M0LA 4LOAA 2J0UA 2ZVPX 5G41A 1MO3A 2Z43A 4V03A 4B73A 1KAOA 3DL0A 3L82B 1OV4A 3VR6A 3ASZA 2H57A 4TSFD 2C5LA 4BPBA 2G88A 3WYAA 3QJYA 4Q19A 1KO1A 1U8ZA 1E9BA 3U7EB 3K0FA 4AIIA 1D2EA 4BFYA 4TTQA 4X8OA 4W7SA 5EXTA 4EAQA 3REGA 3A4MA 4KLZA 4FMBB 4PHHA 5J4HA 4EUNA 1SKYB 1ZRHA 4NCJA 1P75A 3NHBA 5L3RA 2VP9A 4DEYA 3U5ZB 4WW0A 2JJ1D 4NCKA 3RWOA 1P2VA 4XTCS 3E70C 1W36B 2A78A 3RS5A 4BE7B 4BASA 1V5WA 1CKEA 1TNDA 1ZYUA 4EPVA 3KJGA 2WV9A 1OYWA 5C46F 1E6CA 2XTNA 1T8TA 3QKSB 3B60A 2VA8A 4KAXA 2MSDB 3ND9A 2PJRA 2VYFA 3LQRA 4NE2A 3NG1A 1Q0UA 1LW7A 2R65A 1P60A 4DT1B 3THXA 4B74A 5C2JB 2IYWA 5CLQA 1NVVR 4XWAA 1ZNZA 3GLIA 3NWJA 1TU3A 4QBIA 3M1IA 1N5KA 5FPYA 3VNUA 2ZJ2A 1J2JA 2IW3A 4LYAA 2GJ8A 4QJ3A 5J5CA 4OHWA 4D6PA 3TIFA 3NIBA 2QSYA 2CCJA 2JIZD 3HU3A 4YDSA 3QSYA 1XBTA 2OAQ1 2ERXA 2GAOA 1EFCA 1XEWY 3GMTA 3J81k 3GLFB 1EFTA 2XSZD 5FBVB 5D3MB 3T06B 2DPXA 1Z6YA 2CK3D 2G6BA 4A36A 2E87A 4JLKA 4IOLA 1GRRA 3P4XA 4NMMA 4OHZA 2IBMA 4I1UA 2WBLC 1TU4A 1E9FA 4G5OA 4IDPA 4B34A 3V9PA 2D06A 4Q02A 1UBFA 1ZC4A 3LVQE 1XCMA 2FZ4A 3ZZTA 4E03A 2A5DA 3BFVA 4WXRA 1HE8B 3EC1A 4TYYA 2F1RA 3FPAA 5HCIA 2V1XA 3LBNA 2FSHA 1YE8A 1HA3A 1Z6TA 2MMCA 4EQ6A 5C1BA 1FTNA 1T4GA 5FL7A 1OH6A 3DVLA 4GOKA 4OI4A 1S2MA 2D7DA 2ATVA 3BH6A 3PUWA 3G0HA 2F7SA 3W5IA 5JLJA 3KFVA 4IEIA 3OEEA 1XTIA 2WWIA 2JJ2A 4L9WA 1ZC3A 1O87A 2FF7A 2YZ2A 4TMKA 4GT1A 3ZS9A 4DSOA 4BWYA 2CLCX 4IEEA 5DHAA 5JJIA 1T5LA 5FPTA 3VR2A 2QM8A 1Z6AA 2Q3FA 2W0SA 4LHYA 4CEIA 1IONA 2J0SA 1KSFX 4BFSA 4TL9A 2WWYA 3QKRA 4A82A 4WIAA 1CLUA 1NLFA 2H16A 1LV7A 5ANRB 2AWOA 3EWAA 4ZCIA 1PUIA 1VG8A 4I1VA 1UF9A 3TVTA 4ZPXA 2GCNA 3OIVA 5EP1A 1HT1E 4K46A 2ECKA 4ON9A 4DJTA 2OCPA 5B58C 3EZ9A 2ZXUA 1WE2A 1G3QA 1UM8A 1G64A 4Q4LA 1XF9A 1Z29A 2ZQ5A 2ZYUX 3X1XA 4LI0A 2DWOA 2YC2C 2LCFA 3IILA 2BWJA 3QEJA 3AP1A 1YZNA 4MKFA 4NL4H 1E0AA 1W4CA 1YQTA 1E2EA 4PSKA 5J47A 2YVUA 4OI1A 4B3DA 4LJAA 2GBLC 2ZRMA 3RLFA 521PA 3CO5A 2GVZC 1ESMA 2EFEB 4B48A 4MYTA 4B3CA 1G21E 3CWZA 4AK9A 4NYIR 1XZQA 1GG2A 1JEEA 2P5SA 2YINC 5FTNA 4I1SA 2BEKA 2WIBA 3DM9B 5GJVC 3AGPA 5KSYA 2XNSA 1RE0A 3TW8B 1GVNB 3MJRA 1UADA 3QENA 2CNWD 1II8B 1YJ5A 1TTTA 2BV3A 3AKYA 2O8BA 4C4PA 4RKEA 2PEYA 2RGXA 1UFQA 3KKPA 1CJTC 1VCOA 2XB4A 3LAWA 5JFGA 3B1VA 2RAPA 1GRNA 1W0KD 5DO9A 1N6KA 3I61A 4OL0A 1Y3AA 2RHDA 1R5BA 5EE1A 2P6NA 3C14C 1JEDA 4IW3B 4NCNA 3QQ5A 1F2UA 2Z5FA 1DAMA 3ZQ6A 5EP4A 4QXAA 1GL7A 5KSZA 2FWRA 5JZVA 3QKTA 4V0LA 1M1YE 2HV8A 5J4YA 1G6OA 2BJVA 3KX2A 4LBYA 5CK4A 4RD0A 1U98A 4ESHA 4XD7D 2OHFA 5BN5A 2DCUA 4AG5A 2QN6A 2W2VA 2WJVA 2ZS7A 1ZUIA 3AVYA 5CIWA 2BBOA 4Q4HB 2WMNB 3A4NA 2HYIC 3PXGA 4BFXA 1G17A 3T12A 3QXJA 4I99A 2FPMA 1CR1A 1F60A 3CH5A 3BAFA 1DAIA 1HQCA 1NG1A 3QKSA 3GQBA 2ZRHA 3CNNA 5AWFC 2JLYA 2XXAA 2YWGA 4KCGA 1AZSC 4B43A 4AKGA 5SZJA 1HV8A 3SC3A 4M53A 5DI3B 3V00A 5C18A 1QZXA 2QTFA 2XXAB 2MSEB 2PL3A 1EESA 3B1XA 4LV8B 4CT4B 4B2LA 3P20A 3W5JA 2RMKA 3IKJA 3EZ7A 2P2LA 2HCJB 4BFWA 2O8DA 3DO6A 1E1QD 3R9IA 3TVDA 3VQTA 121PA 3SBDA 4Q21A 2CMKA 2H8KA 3EA0A 5LBIA 3UG7A 4IHQA 2BEJA 3QY0A 2CXXA 5CB6A 4X8LA 4V0MA 3EPHA 4IDOA 3RRNA 4ARZB 1WB9A 3K1JA 4JLBA 1IM2A 1PLJA 2D2FA 2QT0A 4JL8A 2Z6VA 1NLZA 4MYHA 3RYTC 2Q21A 2OFWA 1KJZA 2HJVA 1W5SA 1SVLA 2KSQA 4FCTA 3PEUA 3T35A 4Q18A 2OT3B 4TL6A 3CF6R 3K0CC 1VECA 3RANA 3DZ8A 1Q3HA 2PLFA 2I1QA 2V4ZA 5CITA 1R8QA 1A82A 3MGCA 3NEYA 2QP9X 3KB2A 2VLIA 2DYKA 2UZIR 2WWGA 4QGGA 1DADA 1AIPA 1FTSA 3T34A 4OYHA 1KTVA 4A2PA 2F1IA 3GLIB 3LVRE 4LC0A 5JS8A 5KDOA 3IHWA 4DCSA 1PV4A 4ZDWA 2WKPA 4MDEA 4D0GA 4X8HA 3THXB 2QPOA 4DLZA 2ANCA 2N1BA 3PR1A 1E3MA 3QPUA 4V0KA 3T1VA 3B1ZA 1FX0A 1KI6A 1WQ1R 2CK3A 4PC7A 4PSVA 3CRQA 1NNEA 4JLVA 2CJWA 2O0KA 2ORIA 3FHCB 1P61B 3FYHA 3R9WA 2OESA 3BXZA 2I1VB 5JWHA 4GOJA 1A7JA 3L0PA 4YMSA 3EXAA 4POAA 2HUPA 2AL7A 1ZD1A 5KDLA 3D3QA 1ZNXA 2GEVA 2OXRA 2VHQA 5AUNB 2PCJA 1U0JA 3ADCA 3I32A 1BYUA 4I81A 1P9NA 1JR3A 1OXSC 1SXJA 1K5DA 2A9KA 1AZTA 3KJEA 2CVFA 2YOGA 1E2MA 3L8YA 4WOPA 1TQ2A 1Z22A 2ZRKA 3HYTA 4JYBA 1JQJC 2PLRA 1LF0A 1U9IC 1W0KA 4C0QC 5FFMA 5SZIA 2RGBA 4YMWA 1F3OA 3QVUA 2PH1A 3BB3A 3KQKA 3KQUA 4K81B 1FQKA 1U81A 2KI5A 4GMDA 3EW9A 4LBWA 4IFEA 4FXPA 2L0XA 1VKJA 4K8OA 5AUPB 3EASA 1EFUA 3DMNA 2OCAA 1VCMA 5DNYB 4OBEA 1TQ6A 4W5HA 1QVAA 1BMFD 4PPQA 4GI7A 2O0JA 2ZRPA 4M1OA 3W8NA 3TGPA 1W0JD 2X2FA 4JMPA 3NTUA 2OZEA 4TZ6A 1GKUB 1XXHB 4RZ2A 5EUQB 1PJRA 1AS2A 3U3RA 2HT6A 2OFOA 4CEJA 2W6ID 3SU8A 1TF5A 2XTZA 4E22A 3H1TA 5GJCA 4MH0R 1XTRA 2ANBA 3HPQA 3THOA 4ASUD 4EIWA 1IHUA 4LJYA 3JZMA 1CIPA 4LY6A 5D3MA 1U0HC 3SI7A 2ZE7A 1I4TD 1R0XA 2C95A 2HLDD 4TL7A 4EJSB 3EZ6A 1KMHA 1NVUQ 3X1YA 4KFSA 2G0TA 3RSLA 4Q1CA 3GJ6A 4CDGA 1P5ZB 3W8RA 4DLSA 4PHGA 821PA 1GAJA 3BE4A 2DBYA 4M21A 3NH6A 1OJLA 5GJWC 4IDNA 4Q1BA 1HYQA 2JIZA 4R98A 1X8LA 4ZV4A 3ZZUA 721PA 2QZ4A 2I4IA 2WOJA 1F2TA 1TF7A 1N5LA 2C96A 2D2EA 2KWIA 2QAJA 3MSXA 1CRQA 1W48A 1ZU4A 5BW8A 4QGAA 5SZHB 4HUTA 1OE0A 2V1UA 4M9SA 1P3JA 2A5JA 2ZI3A 3HYRA 5JWRA 5LPNA 1S9DA 2J46A 2VSXA 3S1AB 3UATA 1A1VA 4OI2A 1FW6A 4P4SB 4KFUA 3KZ1E 2KB0A 1G18A 1NSTA 1HUQA 3MRSA 2O52A 3UMSA 2REOA 3SR0A 3FHOA 3D8BA 1CU1A 4TLCA 1HURA 2A5YB 3FMIA 1Z0FA 4PC1A 3UANA 5AJWA 3FVQA 4M2LA 1NVWQ 1T3LA 1SKQA 4TMWA 4B76A 5FOTA 2GJSA 4UKDA 3WYFA 2R62A 1D2NA 1NN5A 2ZTSA 1IN5A 2UKDA 4BLOA 2XEXA 2ODBA 3MWJA 3D7MA 4MDFA 4TYNA 2ZAOA 1E79D 5AUOB 3M4YA 1JAHA 4HAZA 1N2CE 3HWSA 3K09A 4XIGS 1WF3A 3ND8A 4ZO4A 4KSBA 3GEEA 4CYMA 4IFBA 1ZMXA 3CBQA 3B9QA 4XSHA 3A1VA 4URYR 1OIWA 1VPLA 4Q1AA 3B9PA 1E0KA 3SHWA 4Q4AA 1G291 1VTKA 2F9MA 2VP0A 3TSOA 2V9PA 3NBZC 2CEAA 1G16A 4Q1FA 3EIQA 3FWYA 4TYPA 5FTKA 4DSTA 3SE0A 1EFRD 3CW2A 4YQFA 4AKIA 3VKGA 4G5QA 1OYYA 2J41A 3AF2A 2OLKA 1QHNA 3OAAA 3QXXA 1P73A 2QT1A 4HAUA 4IXMA 5CYOA 2QMEA 3G5UA 2IX3A 1E98A 2Z4RA 1M8PA 5EZ5A 2GXSA 2V3CC 1XRJA 1E2JA 4NYJR 2ZS8A 3VHXA 2YOHA 5FOXA 1P7CA 3WMGA 3IIMA 5LB2A 2KBEA 4A4DA 2IXEA 4EJSA 1E1RA 4JVSB 4RCYA 2CHQA 2FZLA 5FOVA 2WHXA 5FUYA 5E95A 3HU2A 1I2DA 1XX6A 2JJ8A 2TMKA 2CLDX 4M1WA 1IXSB 2G77B 4ACAA 1ZIOA 4DXAA 1OFHA 3ONWA 5UKDA 3T1QA 3PITA 4LZZA 2ZYTX 4BFZA 4G5RA 1UKYA 4L15A 4PO1A 1GNRA 1G3UA 3AV0B 3CRRA 3QXSA 5CYPA 2N42A 3U44A 4URVR 3TJZA 5L3VA 1X8KA 1X6VA 1U99A 3ZH9B 2OBLA 3GFPA 1US8B 3WP1B 2O8FA 1SQ5A 1YZQA 4Q9JA 2IYVA 3AUXA 5HE9A 4URXR 2BCJQ 3QPVA 1W2GA 1XEXA 5TY0A 1R0YA 2WTUA 2QMOA 2IYYA 1XD2A 3MJHA 4OK3A 4TTPA 2JASA 1VHLA 3AB3A 4TMZA 3GJ5A 4URWR 4OKSA 5CM8B 5JJLA 4Q7LA 5FPHA 4NZYA 1E4YA 3WHKA 4B3GA 3W34A 4QG7A 3LDAA 1Z63A 1M34E 2HXSA 2LKCA 1WP9A 4YMTA 1EX6A 3TQCA 2ZJ5A 2VHTA 4HB2A 3IBGA 4V0OA 4DUGD 3BRWD 4A0HA 1FL9A 1E79A 3THYA 2QMHA 3TAUA 1LY1A 4A15A 2O8EB 3LXRA 4JJZA 2IYUA 3QEOA 3CNOA 5DN6A 2CL7X 2ZUBA 2EWVA 2XAUA 3QIAA 4KSCA 3REFA 3SJBA 1ELOA 1MH1A 2FFAA 1S3SA 1VDZA 2DHRA 4ILEA 4NCHA 3K9NA 1YZTA 3ZDQA 3R9XA 4QL3A 4TT3A 1KDPA 2WSSA 4TYWA 3MWLA 3MG9A 4PAQA 1KI1A 4P4SA 1F5NA 1Q22A 2ZRJA 1XPUA 2ZANA 3KFXA 3IO5A 4FCWA 5CLLA 1N6HA 1WCV1 3SYLA 4HLQB 2GF9A 1KO4A 4QFMA 2DFKB 1DO2A 3C5HA 4GOXA 4JLOA 5KSOA 4BRUA 1FX0B 1KI6B 1KY3A 3Q5DA 1XFAA 2BMEA 4B75A 2GCPA 2QUZA 2VIIA 3D6TB 4LPSA 5EE9A 2JA1A 3N5CA 2W58A 3CX6A 3LW8A 2ZJYA 4GNKA 2WOOA 3VKHA 4DUGA 2WJIA 1NJFA 1D9ZA 2OXCA 3AVQA 3QUSA 4BLTA 4DSNA 4YONB 4D25A 621PA 3OFNA 3FB4A 4HUQB 1I2MA 1P2UA 2B7CA 2F3TA 4U5XA 4C2UA 2ZYWX 2YYZA 5FBQB 2AR7A 2V7QA 3ZVMA 2NTYC 1Y63A 2B6HA 4PFSA 2G1KA 3SS8A 3RNLA 2QNRA 3AF4A 5TVKA 3T61A 3W6OA 3OHMA 5FL7D 5FUWA 2JGNA 3IDQA 1DAEA 5KUTA 2ZI5A 4GMXA 4M1SA 2JDID 2ZE5A 3U6BA 5FI0B 4IKEA 1N0UA 3P32A 4WA7A 5EUMA 3GEHA 1W5TA 3GLHE 3KUCA 3KJHA 4RZXA 4U7DA 1E9CA 2JLSA 2PJZA 4F93B 2CLSA 4HEJA 2J7PD 3R7WB 5B57C 4II7A 4US2R 1U0LA 4QHTA 2QM7A 1D9XA 3A6PC 4BZQA 2JLRA 1QBKC 3MMPA 3AGQA 3IO3A 4F4IA 2ZJZA 4D0NA 2OLJA 4YMUA 5B64A 1E2NA 5G3YA 2OBMA 2ZE8A 2HT1A 4B3BA 4D4JA 4EFNA 5LD2B 2NO7A 4WXPA 1XCPA 4JL6A 3RRYA 1KSHA 1Z0AA 3AQ4A 3IIJA 4E5UA 1KI7A 1QVRA 3O8BA 1SGWA 3CWQA 2ZI6A 4A8JA 4BLSA 2OAP1 1LF5A 3B2EA 1W49A 5F98A 2RGNA 1GNQA 3CKLA 4ERNA 3F8TA 5IDVA 3MUFA 2HXYA 4C30A 2D4HA 2OCBA 5JHGB 2YHSA 2R9VA 3BB4A 4IOJA 4RD2A 1ZIPA 3Q72A 1OKKD 2GRJA 2FEMA 2C9OA 3EPKA 3U6KA 1PVOA 4P32A 3IQWA 3GCGA 2W00A 3V4FA 1JNYA 2QEQA 1Z3IX 1WMSA 4A1FA 2QAGB 3CPEA 2GEUA 1Q57A 1WBDA 2J87A 3N70A 3LX8A 1JPNA 4QJ4A 1CR2A 1VIYA 3RVBA 2GESA 3A1WA 2FFBA 3LO5A 2FPLA 3CB4A 1J8MF 3TBKA 3AF0A 1JALA 1OPXA 1NY6A 2GZAA 4TMVA 2FJUA 4KHZA 4EPXA 4C0BA 4D80A 3SYKA 4LV5B 4EPRA 4D81A 1NMZA 5KU1A 1KO8A 4TTRA 5BN3A 3X1WA 4OJKA 4LC1A 3LLUA 4DRZA 1ZD9A 1P2TA 4KU4A 5F9FA 1E2DA 3GJ7A 4E09A 2MSCB 1RJ9A 1RVDA 2AWNA 2F55A 5B2ZA 1SKYE 5HTKA 1YR7A 2C9YA 3BK7A 1IJFA 2QSZA 2BM1A 3B6EA 3C5CA 4PC2A 1S1MA 2HLDA 4Q1EA 4V02A 3PJRA 1L2TA 1KDTA 1LS1A 4JLJA 4YXWA 3IHLA 2JLZA 2IYXA 4PC6A 3ZIAA 1BMFA 1KI9A 4AURA 3GJXC 4B3XA 4PPNA 3B85A 4C2TA 1YKSA 3CH4B 1GM5A 2FG5A 3WNBA 1VYTA 2OV2A 5H68A 3OFND 3WY9A 4XJXA 2QQEA 1JXOA 1KK1A 5C4MA 3BOSA 1ESNA 1W46A 1R2QA 3L43A 4TL8A 3X1DA 3RWMB 3TUZC 4JVNA 1QG4A 2W6JD 3LY5A 1X1SA 5J4LA 2QE7A 4A8JB 3LBHA 1PZNA 4JYCA 4TSFA 4HLDA 5BQ5A 5CJPA 2IUTA 4KYUA 3I1FA 4UXIA 2BCGY 1YHNA 3VR3A 1I4DD 1OXVA 1FFHA 3TUJC 4EFLA 2WWWA 1G19A 2NZJA 2WIAA 2HF9A 1OFTA 1NI3A 4Z8XA 1H65A 4U02A 2Q9BA 3QBTA 4TT3D 3K0AB 3KQLA 5EXPA 3DKVA 4JLDA 1QF9A 4C0LA 3THYB 2EFHB 3SEAA 1XCGB 2FX3A 4M1YA 4O2RA 2GA8A 2FGKA 1LVGA 2VQSA 1ZCBA 3CRW1 4NPHA 4Q9LA 3BBPA 4MGYR 2J9RA 2IYTA 2VF8A 1DS6A 3I8XA 2R6DA 3EZ2A 4CEHB 3GP8A 1Z8FA 4HDQB 3Q7QA 4YXWD 4DB4A 4PAMA 3M0EA 1OT3A 2E9SA 2BKEA 3T1OA 2VL7A 1UBCA 4LDJA 2OBNA 1II9A 3RRZA 2DFTA 5EE3A 3EIHA 4BFVA 1H8EA 2UZ3A 4LJ4A 2IF2A 3RC8A 4DDVA 4O2LA 1DG1G 1SXJD 4X8MA 1OB2A 1YR6A 2DR3A 3S1AA 1XD8A 5L3QA 1GOTA 1QRAA 4ZDKA 4DDTA 1R8SA 1TX4B 421PA 3O8RA 3PEVA 4P33A 4I1OA 4EFMA 3TLXA 2IXGA 2PT7A 5EXXA 2R2AA 1RKBA 4QHYA 2QBYA 3LRPA 1H8HA 4Q1DA 3SJAA 3UKDA 3DDCA 5A5GA 4KITB 1UKEA 4Z1MA 2C78A 4AG6A 3KXIA 4Q48A 3B1YA 4UXJA 2BJWA 5JRZA 3C41J 4FCVA 3WBJA 3ADDA 3CM0A 4IDHA 3RHFA 221PA 1JJVA 2G3YA 1D5CA 1KI2A 3O8CA 2DFLA 3R8FA 4B2IA 3TRFA 3JVVA 2O5VA 1XU4A 2WM9B 4PPGA 4QM7A 2Q0HA 1GFIA 4WZ6A 3T5DA 1G1MA 3GLGE 3EPLA 1G20E 4LJ5A 4E07A 2WWHA 2V7QD 1Q44A 5KNBA 3GLGA 3DEFA 4RD3A 5KSPA 2NO9A 5F3WB 2A3RA 1F6BA 5J40A 2OEPA 4MITA 4QBGB 1NIJA 4F7WA 5G3ZA 3AVUA 4JL5A 1G8HA 4Y0AA 1X8JA 2DY1A 1XTJA 1E2FA 4DVGA 4ZIRA 3LW7A 1SXJC 2EU8A 3HR7A 1SXJE 1VYVA 2JLWA 1CF4A 4XD7A 2JLUA 1CXZA 4LWZA 2BKUA 2Z0MA 5IF9A 1UKZA 3AUYA 1W7AA 2YKGA 4MKIA 5JECA 2ZJ8A 2IWHA 1OKKA 2XOKD 3LFUA 4WZBE 3RC3A 4GZLA 2ZR7A 3O47A 4BECA 2H92A 1NF3A 1ZW6A 2FSGA 1GUAA 1XZPA 5AJYA 3SJCA 3TK1A 1XTQA 4GRAA 2AD1A 3IEVA 4R2IA 1OHHD 4DZZA 4TN1A 1NN3A 3RAPR 1R6BX 1NY5A 1E69A 2QMUA 2FV8A 2XNDA 1QHHB 3IIKA 4HDCA 2ZU0C 3MWYW 5EZ6B 2VHJA 2QP4A 3NDBB 3EIEA 3QF4B 3PEWA 4CGZA 1XP8A 3IPXA 4DB2A 2VP4A 3QXHA 3AKEA 4P3YA 1KOFA 2ZI9A 2XB2A 4BLPA 3EAQA 3L2OB 3Q5EA 1IXZA 4LHWA 4D0LB 3VNVA 4AI6A 2BIFA 2CHGA 1B23P 4QC2A 4GDFA 1SULA 4TYQA 3A4LA 2HF8A 1G5TA 4IXNA 1XB2A 2EW1A 2QL6A 3A1UA 3WBKA 4UNRA 4PO8A 3UK6A 4ZDJA 4JT2A 2QBYB 4C9BA 5CK5A 2ZRAA 3F0TA 2RKOA 4HLCA 1AS0A 5IHPA 2JATA 3OIYA 1DVRA 2GVDC 4AYTA 3AVXA 1TQ4A 3CF0A 2CCGA 2GKSA 3PQCA 2EFGA 3HPRA 3I3SR 4DLUA 1KKMA 3DPUA 2RH5A 2CJWB 2IT1A 2OM2A 1YR8A 1G8YA 1GTVA 1CJUC 4LYHA 2ZSEA 4Z1MD 3IBYA 2F1HA 3IGFA 1BIFA 1RFLA 2IL1A 1R0WA 1JR3E 2V55B 4Z51A 3B13B 4B6EA 4JZKA 4R9UC 3LV8A 1Z0DA 2ZRFA 5JSZA 1KNQA 2VTKA 1W0JA 4DDWA 4WBSA 3NBYC 5FOWA 3ZIAD 1GRQA 2BBTA 2W0MA 4JVMA 2ZRBA 1M6NA 3HDTA 2ORVA 4W9MC 3Q3JB 5TXGA 6Q21A 2JCSA 2GJAA 3N2EA 3ICEA 1Z5ZA 5DE3A 2B92A 1RC8A 2EYQA 2FGJA 4OJQA 1KHTA 2CNWA 5B30A 1G9XA 3K53A 4FMDF 3I5XA 2W2XA 2Q6TA 2Y8EA 2FA9A 1MT0A 2ZRGA 3FKSA 1M74A 3SQXA 1Z2CA 3BFXA 4W5WA 4H1VA 2QAGA 2P5TB 2OILA 1Q1BA 1ZJ6A 1XMIA 2HYDA 3BWDD 4IVPA 5FL3A 1YZGA 4CEHA 3OIUA 4A2QA 1XD9A 1R5OA 4GL2A 1FQJA 5CDFE 3RS0A 1IN4A 4ZI2A 2C9CA 1NG9A 1M7BA 1W2HA 1PLLA 1E1QA 2RGCA 3TSZA 1E1RD 4LHZA 5LD2C 2Q9AA 1W36D 4Q7MB 4OK5A 3LD9A 4GZMA 4DLRA 5KNCA 1YRAA 2AK2A 3FDIA 2FFHA 1KK2A 3W3AA 1SVWA 2CE2X 2J3EA 1OB5A 2QE7D 1COWA 5CJ2A 3GJ3A 2RB4A 3NBXX 1IQPA 1W4RA 2REXB 1IN6A 4HAWA 4MRSA 3PG5A 3KKNA 4B3FX 1KK0A 1KYIA 3KXLA 1SXJB 3Q85A 2CBZA 3TAHA 3SNHA 1T8UA 1T5IA 2ZVQX 2YWEA 1N6OA 2EFCB 2AXPA 5IK2A 3VTKA 3TE6A 3X1ZA 2PT5A 1E9DA 4DLYA 3ZGXA 1AGPA 3AM1A 2GZDA 2BBSA 1E2GA 1XNJA 2F43A 5LDDC 2XGJA 3NH9A 4HYYA 4MRNA 4Q00A 1OFIA 2ASEA 1Z07A 2MMGA 3TH5A 1RRFA 3HR8A 3VFDA 4CW7A 2YWHA 1E99A 2XSZA 1EWQA 4G5GA 5HZKA 4EJSC 1Z08A 1QG2A 3F5FA 1FUKA 5BYKA 3LQQA 1ZU5A 2Q9CA 4HDOB 1H8HD 1XWIA 1U2RA 1OXUA 4D4LA 1T0JB 5G53C 4JLMA 2IYQA 2QROA 5KYKA 2BMDA 1NLYA 3TR0A 2OFXA 2XJ9A 1RYFA 5KNDA 1FPMA 3PIRA 4WVFA 4HB3A 3OE7D 1IY0A 1Z6GA 2D3WA 1FP6A 1P4SA 1QHIA 4FMCF 5E7MA 2ZETA 2IXFA 1U9IA 1E9EA 4IJMA 5FR2A 3MWKA 1Q3TA 1JI0A 5AUQA 4O3MA 4MGIR 1VG9B 3NDPA 5FPSA 5HE8A 3MLEA 3EPJA 4ACBA 4DCVA 3KKMA 1R5NA 2IC5A 4XVQA 1JBKA 2ZUDA 4NHOA 1KDRA 5ELXA 3BH7A 2RGEA 3TKLA 2PEZA 3UMFA 2W6JA 1YZUA 1Q1ZA 4JJKA 4ZKEA 4QNMA 2JLQA 3BIFA 4EPYA 1G3MA 3KTAB 2P6RA 1II0A 1EGAA 4GPTA 3PVSA 4KJZA 5AJZA 4G5SA 1K5GA 3HU1A 4GP6A 2AX4A 1YRBA 4XWKA 3CRMA 4A9AA 3TR5A 1NJGA 3OE7A 4MKHA 5EXSA 2ZI7A 1Z28A 4KFTA 2WZQA 3B8HA 2RCNA 3QVVA 3NC1C 5TMPA 2BVNA 3RS4A 1XJ0A 4XOIA 2V8OA 3AF1A 4B47A 5FTJA 3KTAA 4ZI3A 2P65A 1GP2A 3GFTA 4DIEA 4EPWA 2V6IA 4YC7A 3KDSE 1UJ2A 1G5RA 1SVMA 4CEIB 4Q4JB 3E1SA 1RZ3A 3TW4A 1XJCA 4PHTA 4LJ7A 4M1MA 5HKKD 2KJQA 4S35A 4DCNA 2B7BA 5DH9A 2XZOA 1PUJA 1CJMA 1AKEA 1QHGA 3PENA 1T91A 2IHBA 4Q4HA 1TADA 3VMFA 3NC0C 1R4AA 4Q4AB 1RIFA 3R20A 1N6IA 2AFHE 1GWNA 4JLPA 2WJJA 1GZSA 3FKQA 4OQNA 1NVXQ 2ZIAA 4RFSB 5BWMA 2ZU6A 1FMLA 3KB1A 3CLVA 3RSOA 2O0HA 5HZHA 2ZITA 1G7CA 3WMEA 1QHYA 4FW9A 2YV5A 5FUVA 1YZLA 3HP1A 5FUXA 2QG6A 3K70D 1IXRC 3KKOA 5P21A 4PC3A 1VCIA 2J45A 4DLVA 4RCZA 2DB3A 5C4GB 2A7QA 3UWOA 3R7WA 3SBEA 3GLGB 2ZSAA 2H18A 1X1RA 5CDFA 2P3SA 1P62B 5FR1A 4C0SA 1IJEA 3CX8A 3SQWA 1G7TA 3JZAA 2O8BB 3BH0A 1II8A 3CR8A 2XZPA 2PMDA 5F2EA 5CB8A 1E4VA 4G3XA 1E2IA 3WRYC 4FWTA 2OUKA 3DZDA 1N5JA 4M4SA 5DYGA 1E32A 2PCLA 5J4KA 2G83A 3PFIA 1AGRA 5DLQC 2ZRLA 3HJNA 3UMRA 4O25A 1DPFA 4ZDIA 1S9HA 1RYHA 2J0QA 3NKVA 1XMVA 4XTRA 3UWKA 2J1LA 1DTSA 2ZRDA 2GCOB 2CDNA 3GJ8A 3FTQA 1C1YA 3BD9A 1F2TB 2AKYA 2ZEJA 5E7IA 1A4RA 1SHKA 3VR4A 2F1JA 1WA5A 4V0ME 4PHFA 1GKIA 2IUSA 3BC1A 4ASUA 1CRPA 4CT5A 3UIEA 3C4JA 3U7GA 3K70C 1KDOA 1P9RA 4KVAA 2P6UA 4Q4JA 1A2BA 4HB0A 5DI9A 1ANKA 1QHXA 4BQSA 1WBBA 1FNNA 2OCYC 4MQBA 3QKRB 1GKYA 4MGKR 4DDUA 2O8CB 4DSUA 1S3GA 4PQFA 1K8RA 2OG2A 2PZFA 3ASYA 3L8ZA 4NONA 4P0TA 2RGNC 1OH5A 3P4YA 3ZZ0A 4GP7A 3N2IA 3EC2A 3U3JA 4LRWA 3WNDA 4H9GA 4LJ8A 1Z0IA 3ZVLA 4KYIB 4N0DA 1CJVC 2ORWA 3OEHD 4URZR 3SN6A 3QF4A 3T15A 2J0UB 1P2SA 2O8EA 4PANA 1EG7A 2KBFA 3C16C 3CF2A 5HR5A 3AVTA 2RGGA 2J7KA 1T9HA 2QTHA 2ZROA 3KKQA 1X86B 2V54A 3MAAC 4FN5A 4HLUC 2ZRNA 4U00A 3SJZA 3TMKA 1W36C 3KJIA 1UEIA 5KDDA 2J7PA 1BO6A 4AKEA 1D2MA 1TMKA 5F9HA 4HAVA 2IS2A 5GJBA 2X8AA 4F4JA 5J4VA 3VKWA 2LWIA 4OHXA 4OQLA 5A0FA 2FDCA 2O8FB 3GPLA 2C04A 1NRJB 5E7JA 1A5TA 2XOKA 1XTKA 1W4BA 2BMFA 2RHMA 2XX3A 3LBIA 3I8SA 1HT2E 4ZIRB 5L3SB 2SHKA 4US1R 2FSFA 4M1TA 3FHTA 1UKVY 1Z0KA 1K6MA 4FWIB 4JLNA 1ZM3A 5EP3A 5SZKB 2R44A 5FOSA 4JBWA 4B32A 1T6NA 4RSGA 4L5BA 2J5XA 1KJWA 4NBSA 3U44B 2QP3A 2VH5R 1NP6A 1CS4C 2IEYA 4HZUA 4M9XA 4O0MA 4UNSA 1TAGA 4IVQA 2HJGA 4Q03A 2C03A 1TQDA 3CZPA 3BERA 3VU9A 4IVRA 3TNFA 4QRHA 1RRPA 3B82A 4PZYA 3NXSA 2F43B 2GBLA 4CIDA 3Q7PA 1SVSA 2EFDB 3I4LA 5EQTA 4LYFA 3B1WA 4URUR 1NSFA 3FOZA 2CE7A 1GL9B 1M2OB 1JPJA 4DT1A 4US0R 1T3SA 2VF7A 4IOKA 5H1YA 4FD2A 2NG1A 4MKGA 4PXAA 3WHLA 4DLWA 2UVQA 1E0SA 2X19A 1EX7A 4PQRA 3QOFA 4RZ3A 4F38A 2JAQA 4KLNA 4A6XA 2C98A 3OEED 3SOPA 1XEWX 2W2TA 4UJ3A 1B0UA 4NYMQ 4LBVA 4EQ6B 2J59A 1L4YA 5DSZA 1SVKA 3UG6A 1NN0A 1NMYA 5H70A 3SDZA 5FPKA 4PO9A 4LCBA 1G8PA 4OQXA 4DIDA 2GTPA 2WICA 2JJ1A 3T1TA 2CVHA 4JVLA 1CP2A 4RY2A 1G4UR 1HQYE 4QJ5A 3ZJYA 3K9LA 1V43A 1H8ED 2C8VA 1KIMA 2VP6A 1GITA 4F92B 3LA6A 5AK0A 2Q3HA 4KVGA 1FUUA 2G0NA 2N46A 2WSMA 4QBFA 1AQUA 2Z83A 4RZUA 3RS2A 4A0GA 4M9ZA 3A8TA 4WZAE 4LPKA 5EP2A 4B2PA 5KPJA 1GNPA 1KO7A 3U7HB 5FBLB 2QRNA 3A36A 2GHIA 3P1JA 4R7ZA 1TUEA 1XMSA 4HAYA 3W90A 1IBRA 1R0ZA 1NBMA 2GZHA 2V6JA 4QHSA 3K70B 1AJEA 1WRBA 4NTZA 4A0RA 4OHYA 4RJLA 4A2WA 2GXAA 1J7KA 3A1SA 3WNCA 3E2IA 4PAOA 2G1JA 2VPPA 3VHLB 4QGFA 2QQ0A 1MOZA 4QOSA 1UAAA 2O8DB 1W4AA 4EDHA 5JWOA 4JKYA 2BHRA 4PZLA 2VRWA 5GVSA 4LHXA 1U8AA 3B7GA 4NYMR 4RD4A 3L0OA 3PUVA 2KE5A 3U4QA 1BYIA 4F4CA 2F9LA 1Z06A 1T3HA 3H84A 2PBRA 2OE2A 4LUCA 1FNMA 1G6HA 3L0SA 4L8GA 2NZ8A 4AYXA 1P6XA 5JBQA 1N6PA 3EG5A 1Z0JA 2QGNA 3I5YA 1RPZA 3GEIA 1VHTA 4EKDA 5JHHB 1YR9A 2A5GA 1LB1B 1R10A 4Y0VA 1JR6A 5AJXA 1FOEB 5JEEA 1YU9A 4BEBA 3DKPA 1UDXA 4PPFA 1AQYA 1LTQA 1TL7C 3TSWA 4EPTA 2GXQA 2IYZA 3V4RA 4L16A 2BDTA 4DC9A 2AXNA 2DWPA 3AP2A 5FOUA 4NYJQ 3EX7C 3LH5A 3K0CA 1DAHA 2GK6A 2VSOA 4HZUB 1ZM4A 3GFOA 1VG1A 3Q8XB 4FI3C 3H86A 3BB1A 2IF0A 2QENA 3TQFA 4Q9IA 2W6IA 2ZJOA 4IOMA 4MUBA 4ESVA 4D26A 2C99A 3PUYA 4BZXA 5TARA 1J90A 4PQYA 2VBCA 4NDZA 1G8FA 2A2ZA 2PZGA 5JCZA 3ETLA 1T0HB 2ATXA 2CHVA 2ZSFA 4JSTA 1FZQA 1SHZA 4A92A 5CIQA 1IOZA 1XXHA 2FPKA 1OXXK 1E2QA 5FTMA 5LB4A 4TQAA 4UNQA 4YDHB 3GJ4A 4HI0E 4ZKDA 2FN4A 2ONKA 3NVAA 2F6RA 1R7RA 1GIAA 3QNUA 1KO5A 4TQ9A 1MO4A 3KL4A 1BS1A 3CRVA 1HH4A 2ODWA 1VCNA 4KODA 2EVWX 5JCPA 1G4AE 3TUIC 3BGWA 4Q66C 4YLGA 5L3QB 1DO0A 1Z2AA 1OLOA 1A2KC 5FTLA 3LWNA 2IEZA 4IDQA 4Q7JB 4TLDA 3AVWA 1NIPA 1NL3A 2NPIA 1MABA 4OQMA 3AKDA 1E9SA 3M6AA 2X1VA 1DELA 4J0QA 1Q20A 2ZSBA 4Q9HA 3RS3A 1OH7A 1DEKA 4KBGA 2D62A 4Q9KA 2ZJBA 5GADl 3GLHA 5DGXA 2BMJA 3GLIE 1J99A 3IPYA 4AD8A 1DE0A 4D2IA 4OK6A 1G3RA 1GILA 3EARA 1EFHA 4FMCB 4CZ2A 3ZVNA 1EXMA 1F2UB 4HZIA 2YNMA 4DCTA 3K09C 3SZRA 4QM6A 3QE0A 2B21A 4QNRA 2G9NA 4C0KA 3QG5A 2QA5A 1RRCA 2IS4A 2GCOA 5IT5A 3ADKA 1G5PA 3QXCA 1XEXB 4F91B 5L3SA 4HSEA 4LJ6A 4M1KA 5A4JA 4DLXA 1AM4D 1RRGA 3U3MA 4C0AC 1ZD8A 1KY2A 1Q21A 1S0UA 2WVJA 1Q12A 1JXMA 2GDJA 2HEIA 1KAGA 3FFAA 3Q9LA 1BKDR 3CR7A 3AEZA 4HLUA 5AR1A 1UEJA 3KQHA 4BEJA 3VX4A 1KZ7B 1Z6XA 3U7FB 3I62A 2YOFA 3T5GA 4UQOA 1LFDB 1S4QA 1ZNYA 2XJ4A 3AVPA 1ZNWA 2BC9A 3EWSA 4G01B 5JMTA 4ARZA 1DAGA 2ZE6A 2WAXA 3MFYA 2CL6X 1JB1A 3JVUA 4TMXA 4B6FA 1AKYA 3U3KA 3DOEA 3NBFA 3PUXA 1UBEA 5TV2A 1XXHE 3PUZA 1KI8A 1E9RA 1VMAA 1CJKC 3WXMA 1CULC 2ODEA 1DAFA 2WJHA 3I72A 1DAKA 3OESA
chains in the Genus database with same CATH superfamily
1KI3A 3CONA 1BWRA 2GCIA 4Y2VA 2IS1A 1WPQA 3JD3A 4CTOA 3C4QA 3E15A 4F0JA 3IIIA 2O8CA 4ETIA 3M4ZA 4A26A 1E2HA 3DAYA 4FP9A 1JMKC 1JLHA 1OSNA 1PQPA 1WHTB 2VSFA 4I5DA 4RK1A 2H7VA 1S8NA 4H4EA 2YNMD 1M7GA 3HSYA 4HH0A 4AMGA 3GQBB 4HX2A 1XVAA 2ZBDA 2WE8A 5KTTA 5LDHA 1XTPA 1A8PA 1HTWA 2NO1A 4MRPA 5EUCA 4CF3A 2PYIA 2RIRA 4N3NA 1AK2A 2ZSIA 3BSFA 2QX8A 1L3IA 1VG0B 3HMKA 3KELA 3LBFA 3UJ7A 2WABA 3GUHA 4EO4A 5F7ZA 2ASVA 1K8ZB 1I9CA 1KQOA 2G36A 2NO0A 1ZVQA 1N7IA 3DKKA 2MTBA 1DNPA 3FMFA 4MVJD 1NX6A 5K0NA 1OXBB 5AVTA 2VK4A 5EE0A 5K8UA 1OWMA 1RYEA 1C4WA 3IUYA 1JA1A 2CJXA 4KXFB 4R1QA 4TVKA 4B46A 2B61A 3GZNA 1A95A 4P2GA 4DEXA 1B00A 2H29A 2ZRCA 4F6LA 3OTOB 4CETA 5LLTA 2WJYA 3IVGA 3KQNA 1VJ1A 3RR2A 5JRJA 3HVJA 2C2WA 1CCWA 2WJGA 1RQ7A 2VP5A 5D7BA 2FEOA 4D92A 2R8PA 4YI3A 1HE1C 2NQ2C 1U1EA 3NOVA 4MTLA 5IARA 1NHGA 2I7VA 1IPFA 3R7FA 3LLMA 5FA6A 1L5KA 2GETA 3GLKA 4EELA 3M9WA 2HMSA 3PHLA 3P0IA 4B80A 2AFIE 4MW6A 1XJQA 1WEHA 2MDTA 4Q9DA 1KKLA 2GN2A 1PZMA 2BI4A 2K5UA 5KBYA 4I2NA 4S1OA 5D51S 3WGIA 4Y9SA 2RJOA 1COWD 5F64A 1CEEA 1UMCB 4HRYA 4WJZA 1QOPB 1TUBB 3AJRA 2VP2A 4ECAA 3QVGB 1UCFA 4JLAA 3PGXA 4WX2B 3DMPA 1YVEI 2VZLA 4Y9DA 4ER3A 7MHTA 2QHXA 2BGGA 4MW1A 4H7KA 1VE7A 3C3PA 5JNSA 3DZGA 3R6GA 2GI4A 4KI0A 4MYCA 4RV9A 4AWXA 2JA2A 4MGEA 3Q10A 3ZCVA 1LS6A 5BN4A 1QRUA 2C7RA 2BN4A 3SFTA 3AHJA 1MO6A 1KS2A 2GBGA 2CXOA 3KV1A 3QPWA 3QU5A 1WD7A 1WXGA 4TRNA 4LK2A 4BZPA 2X2EA 1V4BA 2PGNA 3C8DA 5JE8A 2IHVA 3ENZA 1D6JA 3L1IA 1N2HA 4LJSA 3DLCA 5KINB 5EMKA 3S55A 5KWVA 5BXQC 1WOYA 3DTVD 2O1WA 4FE7A 4FMDB 1ZHOA 1MAAA 5IKMA 4C4XA 1WTCA 3ADBA 5T4FA 3HHPA 2CFIA 2JPDA 4ENQA 1V3UA 1PG2A 2N3ZA 2WMOB 3LCVB 1CTQA 5F33A 3W90A 1C5KA 2GZRA 1V2GA 2R7NA 3NFYA 3Q3VA 1PT9A 3RTBA 3O8DA 4C88A 1FFCA 2FE4A 2CFRA 3QSGA 5T4BA 5L7TA 3FE2A 5IUJC 4I2VA 1IAQA 3D0KA 3DPIA 2R6JA 3L77A 2XTMA 3C45A 5GQSA 4LSMA 2QB5A 5M7EA 1M7HA 1GDDA 2XGOA 3GZNB 1NUAA 4RPCA 4ADSG 1JECA 5AKLA 4AC9A 4AJKA 2AHOA 1MB0A 3GB9A 4NE7A 3BDIA 1KH2A 5BSEA 3KR9A 1TA0A 1SVOA 2ZYRA 4ZV7A 3U1VA 4BFTA 3N6VA 2FMXA 1FBNA 2ERYA 4D4GA 2VDMB 2VLBA 5ITSA 1K0UA 5HG0A 3P94A 1B7GO 4TLAA 5AKXA 5A6SA 5K8TA 3DQZA 3DT8A 2OV6A 3JYNA 2QY9A 3PUKA 2R6CA 2DTEA 1VKNA 2FSSA 1Z8DA 2IK8A 5JSKA 2HBYA 1D2GA 1UPCA 5BN4B 1NBMD 2X77A 1QYIA 2FMKA 3OF5A 4JJ6A 3EOZA 5ICSA 3IBCA 3MMSA 5B37A 1H42A 3UWDA 3QEAZ 3AV3A 4TLBA 2ZRIA 3CYFA 1OXMA 3H8VA 3RO7A 3U1TA 4AKSA 1PT8A 4X9XA 4AQYB 4NOMA 2Q4DA 3ZX5A 3ZU5A 4ZCMA 3TLZA 2OKCA 4KKVA 3P8ZA 3TMAA 3WRXC 4Q05A 2EIXA 1KMQA 1QLHA 1KGSA 2DCMA 3DT6A 4RKFA 5CLIA 3THWA 3RIMA 1Y9JA 4UQLA 4BP9A 1OHHA 4C78A 3TXAA 1EFVB 1IG3A 2ZUCA 2RH9B 2FR8A 3H0KA 3LJKA 5K4HA 2RB5A 1IFXA 3WE7A 1PGNA 1LQ2A 1XKTA 1KZGB 5CVCA 1CFJA 1ZCAA 5E4FA 1WR8A 6PFKA 3BJIC 5KJ1A 4AKHA 4IIGA 2P9YA 3DYIA 3KJQA 4I6GA 2EP8A 3L41A 4BJ3A 3PEYA 5AW5A 2IYLD 4YRBA 4Z86A 1OIVA 5AJUA 2RGWA 5DN6D 5BWOA 5KYUB 1HEYA 2GWHA 2VEOA 2H7YA 5CHYA 2JZCA 3FA2A 5E2BA 3O2JA 2QAGC 4OQFA 4YJGB 3S27A 4AN1A 1E9AA 1YK0A 3HSSA 4JDUA 2RBGA 5ENVA 3COJA 1U90A 5IVPA 5IRCD 2JLVA 2F48A 1XZAA 1WXHA 1I4EB 1XTVA 3KQPA 1BEEA 4DGQA 2PZKA 5AW7A 1PJ8A 2PR7A 4M22A 2OWEA 1SB9A 3PFHA 3WRVA 3OO0A 2GASA 4L8FA 3QE4A 2P67A 5C5CA 2QRZA 2W83A 1A9RA 2XZDA 2PXXA 4FYMA 1C3EA 4BO1A 4L85A 3AR8A 4U7FA 5HS4A 5CTJA 4ND1A 2I4NA 2I3BA 1PTJC 4NP6A 1Y7HA 1M2GA 4KWEA 5G40A 4AMVA 2M6RA 3KC2A 2PANA 3ROMA 3AK4A 5AK4A 3SFVA 4L9SA 4MGZR 5L4NA 3NJRA 2EDAA 1FP7A 3PR3A 3JD1A 4YP6A 3F8SA 3DOFA 1NMQA 3ZBPA 1U2TA 2QGZA 1F4LA 1S1CA 1CG6A 1Y1RA 3HCRA 3I52A 3L3BA 3GLHB 4IRMA 2O6HA 3IQDB 1VIMA 3EXFA 4AECA 4FOOA 1B3RA 4JQCA 2CZGA 4MQEA 3GXOA 4PRLA 1H2BA 1KJYA 4ZV9A 4N6GA 4CF7A 1HDOA 4IO1A 1R0BA 2COUA 4GWGA 1WDKA 1TA4A 4X65B 4ZI3A 5EWMA 1C7JA 3D0QA 4QDZA 1T6BY 3DV0A 2AGVA 4GFDA 4TWRA 2HU8A 1THMA 2NAFA 1AF7A 3PC4A 3BMCB 1U1FA 1W47A 3OEHA 4F86A 2CMFA 1G7RA 3LT0A 3GLFE 4MLPA 1N92A 5K99A 2WWXA 3N2GB 2QVCA 5TT0A 4UARA 5CVUA 1I9GA 3K0AA 3LRXA 1VJDA 4YMLA 2D6FA 3RTEA 3Q2IA 3WGOA 5HA5A 3C4VA 4ID3A 4DNXA 2ZS9A 3CNLA 2F4VB 2VO1A 4JJ4A 4GPD1 4JELA 5DTMA 1I5RA 1P18A 2D5IA 1FLVA 3FCSB 5HMMA 4CLOA 2DPLA 4JB3A 3NEJA 1S96A 3WB0A 5IHXA 2RJNA 3AVOA 4RA6A 4P4TA 4M8NE 4A8JC 1GT91 1J42A 4RO0A 2RBEA 4JT4A 4PWYA 2XGGA 4ZCPA 1UT6A 5FQOA 1YASA 4C7OA 2HSJA 2WKQA 1TLTA 5DHFA 1Z4IA 2NUAB 2FQXA 4KXVA 4CU5A 5CA1A 3PPYA 2DU8A 5DNEA 2X0KA 4MW2A 2XTAA 1OLUA 4W6QA 1I4LD 3RBZA 2GJ9A 3A4VA 2I99A 1B8VA 1XCJA 3UPUA 4ZGGA 1BMTA 1Q0RA 3RUEA 1LJUA 4BMYA 1DBWA 4FNGA 1TKCA 2BR4A 3P5SA 1C1HA 2QLTA 3I9OA 5E1MA 3ZYCA 1JP7A 1Q7GA 5JS2A 4ID9A 1AKNA 4JBXA 1UXHA 2M6SA 5JSHA 3VAAA 3NIFB 4FKMA 1EP9A 1XUOA 3F1KA 4O4IF 4FHEA 3PNBA 2Q3BA 3GGJA 4HC4A 4PNZA 5HM8A 3QV1A 2NOAA 3CPJB 4P4UA 1T6YA 1C1DB 1NXXA 3FGNA 4XSGA 5AKJA 4E5MA 1N25A 4KMOA 1NJSA 2AEFA 1WMAA 4B6JA 5KOYA 3W6NA 3LX5A 4K6FA 1BE8A 4Q6BA 2DFNA 8OHMA 3RKRA 5DRYA 3I64A 1GV1A 3QU2A 1T9GS 1HNZB 1MB4A 4Y2SA 4BTEA 3FOWA 1ODFA 5LU8A 2FMIA 4Q47A 3OZ7A 2OGUA 4C03A 2IUUA 4CNQA 3UV6A 4HWKA 3NNDA 3FGZA 3H5OA 2FEKA 1VPTA 3KWJA 3SHTA 3G8DA 3LX4A 3Q8KA 2PX3A 2R8XA 3R76A 1OW3B 1KEPA 3LL4A 2IS6A 3FWZA 1SC3A 1IZZA 3JWPA 1J8YF 4LF9B 1QGUA 3TQIA 4ZYUA 1HYEA 1CUHA 5GAJA 3ZK9A 5KTYA 1WCXA 3LLVA 1IY2A 5JAZA 1IWBB 3AWIA 2QTZA 1B76A 3COSA 1B43A 3FMPB 4MYUA 5BQOA 2Y9MB 1I5OA 1ORHA 2QTVA 4RVCA 2YC4C 2ODNA 3VUEA 5KO2A 1X1TA 3LOPA 2BISA 2PLWA 5E3HA 3H5WA 1L1RA 1GL6A 2OQ2A 1BRTA 2X5KO 3K7EA 2JHPA 1J49A 3PPXA 4GM0A 4QDTA 5ALKA 4B33A 1DRVA 4GWLA 3FTEA 1NNLA 1ODTC 1HDIA 4DVJA 2XZLA 3RJ9A 1G7SA 1N0HA 3FIJA 1JDBC 4M9QA 1Q1QA 2B3TA 3T4PA 4UOZA 3OZEA 2C4KA 4BGEA 5KYXB 4I50F 4B73A 1C30A 1KAOA 1WUTA 2HRCA 4H27A 5F3DA 3H9CA 3L82B 4JXJA 1RRKA 3C39A 4FGLA 4K9SA 2H57A 1WMDA 4MO2A 3VR6A 2FK8A 1ZGCA 2G88A 2HREA 3WYAA 4BN0A 4Z7QB 3WV4A 1A50B 2ZUVA 1OTXA 5MN5A 5JS1A 3K0FA 4FUQA 1D2EA 1UJ4A 4X8OA 2P35A 5EXTA 2Q45A 4JAVC 4EAQA 1V16B 4OM8A 3AB8A 2RHWA 1G8JA 1XQVA 5BO5A 1O0SA 4R3WA 2P1DA 1ZRHA 3B3FA 2QVXX 3QTTA 3TNYA 1ZGZA 1E6UA 4HN9A 4H2DA 5IH7A 4YT2A 1ZXLA 2C88A 4CQNA 5TVGA 3NHBA 4UHKA 4GLJA 3A6DA 3G6KA 1PT5A 5FO1A 4WW0A 3WLMA 4NCKA 1GDTA 1P2VA 2K4MA 3RS5A 4BE7B 1ICIA 4BASA 3KQYA 3OCZA 2I6GA 4MR8A 5KYUA 1QFSA 2WK1A 2V7PA 2KW5A 3IR5A 2XTNA 1T8TA 4P22A 4P36A 1WU7A 1IG0A 1G98A 2VJAA 3D6FA 4GI5A 2DX7A 1MGOA 1TVKB 3K9WA 4HFJA 4TXNA 2R65A 2NU9B 3QPBA 4DT1B 3CRZA 3THXA 1C3XA 5TSDA 1EWTA 3EY9A 4ER5A 1FSZA 4EKYA 3PQ8A 3K5IA 2XAAA 3IUSA 4L8YA 1W1IA 2W2KA 5DSTA 1T9CA 3MRVA 4PGGA 1UINA 5CFOA 4DILA 4LYAA 4JD5A 3ORFA 2M1ZA 3DV9A 5J5CA 5BNIA 4D6PA 4RE6A 2FR0A 1EVLA 2QSYA 3VGPA 3A3OA 3CW8X 4CI9A 2VFAA 4RVOA 3QSYA 1VQ1A 2GAOA 2G5PA 3GLFB 2J9FB 1BVUA 1EFTA 1QGAA 2ODAA 2FPGA 2XSZD 3AI2A 2VYND 3EQ2A 3KOXA 1OZHA 5FPTA 1N2GA 3BKXA 1J5PA 4HDNA 3ZZ1A 5D3MB 2OZLB 5CB4F 3T06B 2DPXA 5YASA 1X7ZA 1Z6YA 4QOEA 4Y2UA 4L28A 3K71B 1DEAA 4IOLA 2BFCB 3AG5A 2J6BA 1KDYA 4YIHA 3Q2OA 4H35A 1B0AA 2TRSB 2HV9A 3EY4A 3ORRA 4NMMA 4PZ9A 2WBLC 3KS9A 4UCWA 3TR6A 3AHGA 1E9FA 4G5OA 1TM3E 2DRIA 4BXOA 1P19A 3ROQA 3FD8A 5HXAA 4AQ7A 1RU3A 1UFRA 1C14A 2D06A 3MT7A 1P1BA 1O54A 1GARA 2W6PA 4EY7A 3MW8A 4O4JB 4MS3B 2R86A 4NNJA 2VDUE 4LY9A 2A5DA 3BFVA 4WXRA 1Z6PA 3EC1A 5CUQA 3S40A 4MA5A 4TYYA 2F1RA 1JE0A 3KYDA 1U7OA 5HCIA 3RVQA 4E5PA 1NP7A 1TVKA 1XKQA 2FX2A 1BS2A 1YE8A 4ZK2A 2FZEA 2FLVA 1XU9A 1XR3A 3JYOA 3L8FA 1FS6A 2P0YA 2WJAA 1BKYA 2AX3A 3ASUA 4HMQA 4KBYA 4EQ6A 3I30X 3G7UA 3LHIA 5LQNA 3UGTA 5FL7A 2FSUA 1XJWA 1SUPA 1YHYA 3LIIA 3QBEA 1VLJA 2QNIA 4GOKA 4RZIA 1S2MA 1TK9A 4YUAA 3BH6A 1VE3A 3KOWA 1E7YA 3PUWA 3TZCA 4JASB 2BFWA 4QYSA 3ZEAA 5B6PA 3L93A 4BNHA 2L42A 3OPQA 2ID9A 4J7UA 3VR4D 3ETCA 2VQ6A 2HPHA 4ZQEA 5FBKA 1TZMA 1JG6A 2WWIA 4OSOA 4UUOA 3VDMA 2JJ2A 4X92A 5GOTA 1ZD4A 3DJYA 4MB6A 5CNKA 4TMKA 2YZ2A 3E9DA 4E46A 5LXTA 2ZW9A 1Y5MA 2EW8A 4BWYA 1HMPA 1RC1A 1T5LA 1P9LA 3E6AA 1H0HA 3IBTA 1FUEA 2QM8A 3P0EA 4WQMA 5CNMA 5ALGA 2J0SA 3VHRA 1E3DA 4ZOBA 4IJVA 4R2XA 4TL9A 4LXIA 3CVOA 3ROTA 4RKRA 4E7PA 1SO8A 1Z2EA 3UPDA 4H3HB 4AZWA 4QO8A 3HG7A 4OQPA 3D2AA 3EWAA 1PUIA 4IZIA 4DZRA 3ND7A 4RDCA 1B2RA 1EXNA 1UF9A 2QT9A 1T34A 4RQBA 2WF9A 4XB1A 5EP1A 3TVTA 3ZXYA 3QLJA 4K46A 4A0SA 4YCJA 2PVPA 1FFWA 1KEZA 1JLRA 4K86A 3JY6A 1FFDA 4K2AA 2Q2VA 1TIKA 1O97D 3AFNA 1G64A 4Q4LA 3U4CA 5HGJA 1XF9A 1Y1LA 2ZBVA 3GFSA 3L7JA 3LP8A 4LI0A 5JNWA 3RVOA 1UP4A 5LC1A 4NL4H 4WVLA 5CT5A 3AI3A 3WSTA 4BAUA 4IDEA 3E5MA 2H9AA 3PCTA 3JYQA 5HGXA 5J47A 2C61A 4IIEA 1CIVA 1ZI9A 4C1NA 2ZM6B 3CO5A 4B8YA 4ME6A 2VUTA 4N5LA 2BFOA 6REQB 3ZD8A 1ULZA 1CF2O 4B48A 3PRHA 1Z39A 4BJHB 4AK9A 3O31A 4EARA 2P2ZA 4Q3KA 5ALMA 4CDMA 2YINC 2BEKA 3DM9B 1Z7EA 1BX1A 1RWOA 2OKGA 3MJRA 3V8PA 1QZTA 1C1XB 4MJXA 3PTAA 2CNWD 1RTKA 4I1PA 1YJ5A 2C5HA 2OZPA 1XQ1A 4Q3LA 2HCRA 4DYHA 2PEYA 3EFHA 2DFPA 1WCWA 2XB4A 1U2GA 3RFXA 3SP1A 4PNPA 2AH5A 4MWBA 4YECA 3CW9A 1W0KD 5DO9A 2QR3A 3SC2A 3RGWS 3BTSA 4GOMD 4RESA 1H6DA 2OR3A 4L5AA 1TEZA 3SZUA 1UJ6A 5EE1A 2P6NA 3C14C 3O9MA 4F71A 1PR0A 2FPGB 3M3HA 1F2UA 2Z5FA 1DAMA 2IYFA 2H7XA 2IHUA 4IBOA 4J03A 4QLOA 4QXAA 4TM8A 5EP4A 2HRDA 3BHIA 3QKTA 1CERA 4IFTA 4JA0A 3T41A 2PDAA 3MLAA 3NKFA 1DHTA 3C3JA 4HP8A 1NW8A 4OP2A 5TLSA 1G6OA 4OHFA 1CS0A 2A84A 3ZGZA 4RD0A 3O3MB 2OHFA 1ADJA 5BSKA 2ZVDA 2W2VA 4RMNA 2AFHA 3HRKA 5AVYA 2A0WA 3FYUA 1T5HX 3VYRB 1I3OA 4YCBA 2XMDA 2HYIC 1CQJB 3NRBA 1DKMA 1T36A 2C94A 3H8JA 4MV5A 3PXGA 2R1ZA 1OLUB 1UBUS 4I99A 5HQ3A 1CR1A 1FDSA 3BAFA 2GK4A 4RVHA 1DAIA 4V0SA 5DXAA 4OJNA 5F21A 1J0BA 3BMXA 2XXAA 1MAHA 2YWGA 1AZSC 3U49A 3V6MA 1R74A 4AUNA 3M2PA 2E82A 1OCEA 5DTQA 1JIKA 3SC3A 3C98A 4MQMA 2PL3A 4GZ3A 1TT5A 1ZXBA 4OOFA 5ALTA 2IELA 1XI2A 4ZVUA 1RSZA 2LCQA 2V3WA 2GM9A 4XEHA 3C85A 4G2TA 3OZBA 3W5JA 4B2LA 1H23A 1VL2A 2RMKA 2ZSUA 3EZ7A 2WTXA 4BFWA 2O8DA 3QMVA 3DO6A 1P4HA 5JVDA 4NJOA 1XRLA 3LF1A 3SBDA 1VZ3A 3GJRA 4PINA 1FVXA 2FPPB 3A70A 1UK9A 4XRRA 5H83A 3EGOA 1IZ0A 4IHQA 4JVOA 1Z18A 2YJ3A 4XUDA 3QTLA 4X8LA 3B3GA 3G79A 3EPHA 1H2YA 3KTFA 2YVLA 4IDOA 3K1JA 3RRNA 4LNUA 1IM2A 4JL8A 4PZCA 3HVUA 4LF7B 2OFWA 1L5RA 1I3CA 4YLEA 3DDUA 2EJVA 1YRHA 2AN4A 5ALNA 4FCTA 5BSFA 1YNSA 1XA4A 3AJ9A 2PL5A 3PTZA 4JP2A 1RMYA 2D2VA 4J0EA 2CKDA 2QZJA 1R9NA 2HU5A 1QTNA 1JG2A 4YXFA 1K3FA 1ZH0A 1Q3HA 4JQSA 2I1QA 1JZSA 2V4ZA 1XWFA 1BXRA 3FTNA 3KB2A 3NEYA 2DYKA 1F14A 2Y77A 2WWGA 4RVUA 2AE1A 3AR5A 4YCCA 1OGJA 2VHVA 2VAXA 3QPDA 5AKKA 5CM2Z 1A04A 3L7BA 4CDNA 4OYHA 3CTPA 3HACA 2F1IA 4A2PA 3CVWA 3JD0A 1DBPA 1QWSA 2R1UA 4LC0A 1WSDA 4H7EA 3ZDEA 3NO4A 2X5XA 1YV9A 2SKCA 2LGJA 4PV7A 4BB6A 1XDGA 2J09A 2WKPA 4ZDWA 4MPJA 4X8HA 3SC4A 4MDEA 4E31A 1XLTC 1X1CA 4ESOA 3A3KA 5ALZA 3T1VA 3H17A 2HSZA 1KI6A 2CK3A 4ZEWA 1WQ4A 3EXG2 4CLDA 5KC9A 3R3UA 2HDHA 3Q3HA 4OM7A 3I2GA 4XX1A 2WUEA 4MIYA 3CRQA 3F6CA 4NJMA 4PVDA 3ZHZA 4D02A 4FFSA 2CJWA 2ORIA 5A5EA 1DCKA 1Y7IA 3FYHA 4RAOA 1QRDA 3P4UA 1IUOA 1B8NA 4NI5A 1OX4B 2C59A 4LKOA 4R0MA 1UWKA 2X9NA 4PLTA 1RRMA 3UJCA 1GNVA 5J59A 4Z4GA 3Q1LA 4EL5A 1FP2A 1WXIA 1ESDA 3IUBA 3ZI4A 1G66A 3HFRA 1U2PA 2VHQA 3FHJA 5AUNB 1AV6A 1CUEA 3U37A 3I32A 5BVGA 1BYUA 2H0AA 4P38A 3DOUA 4PCAA 4YUWA 1YL7A 2VR1A 1SXJA 4PLVA 1YMQA 1K8YB 1LX6A 2Z1MA 3KJEA 2O3QA 2AB0A 1TCUA 2CVFA 2QRVA 4Y6OA 3RVLA 3HDQA 4UVHA 3FPFA 2POQX 4H0NA 3F2IA 5GOZA 2ISCA 1KXJA 5CA0B 3KVNA 2PLRA 4BVAA 4PNEA 1LF0A 1U9IC 3KLPX 4NIMA 2RGBA 2NLOA 2VXBA 5SZIA 2PH1A 5JTTA 3KQKA 1KQNA 2KI5A 1PEDA 3EW9A 2J3HA 1T1GA 4FXPA 1VKJA 3DHYA 3BA6A 3M4JA 4QA9A 5K3CA 4BNZA 5CA1B 4MPTA 2XNKA 4A2CA 3OIFA 1RZRD 2IYEA 4G0VA 1VCMA 3P2YA 1T5TA 3PNYA 3QJGA 4W5HA 5JARA 1JFTA 3OQ1A 4E0BA 4FFDA 2QMYA 2ZRPA 1KWGA 4PG8A 4G25A 3EGXB 3GY0A 5JXGA 3I5UA 3MCZA 3FVRA 5CH8A 2OZEA 4BKMA 4L75A 2PE5A 2B0CA 4TZ6A 4CMJA 1GKUB 4P80A 4CWAA 2FMTA 3UKJA 2VJCA 4RZ2A 1KU6A 3V1YA 1BCSB 1GL3A 3Q1KA 1EUZA 3N2GA 2W6ID 3D7NA 4G1BA 3SU8A 1BEUB 5F51A 2W2LD 1NM5C 2Q49A 5FKJA 1U02A 2ILVA 3GH3A 3H1TA 4HH4A 2P3LA 3ZBQA 4MH0R 2LE0A 2IEAA 3NIWA 3CUTA 3QFRA 3CGWA 3AFMA 3BREA 3THOA 1YB6A 4EIWA 3DAHA 1J33A 1IHUA 1N1EA 3HXPA 1A7AA 4ZOLF 1YIAA 5AQEA 3WG9A 3OCUA 5DCYA 1JQDA 2PPVA 1GPBA 3JZMA 4FKZA 1CIPA 1BDMA 4X93A 1U0HC 1M5TA 5KAMA 3SI7A 1BMDA 5FOQA 1F4VA 3PVCA 1R0XA 4YRKA 3FRHA 4TL7A 2XYGA 1FF9A 5G1OA 1NU6A 2VKQA 3EZ6A 4PX2A 3X1YA 3H9EO 2G0TA 4B82A 5K1ZA 4DLSA 1ZOSA 3C6QA 1JVBA 3HGQA 2WHPA 3QTBA 4RMHA 4YAWA 3NJ8A 4JP1A 4C4TA 1FP4B 5BQPA 5BXYA 1T29A 2I8AA 3C97A 2AI2A 3NH6A 3A14A 4M21A 4IDNA 9LDTA 4Q1BA 3FVTA 1NW9B 3JWEA 5BRNA 5E9QA 2HFJA 3CZ4A 4KGZA 5LKAA 1I1HA 4KITB 1T1IA 2ADMA 4PICA 3RYIA 2P62A 1DPGA 2Y9PB 3KL2A 4B3JA 2WOJA 1P17A 2ISQA 3LWBA 1R8YA 1TM2A 3IODA 3RASA 4OAQA 4LNAA 4MR9B 3P45A 3H2IA 3MSXA 1DEXA 3ISVA 1CRQA 3HYLA 1YQGA 3NIDB 4KE7A 1DRUA 1P3Y1 3DBLB 5DK6A 1OBOA 3CNEA 4D5GA 3WLHA 2A5JA 2ZI3A 1A3CA 2YFHA 4WESA 5FNVF 3WWOA 3FF4A 3GG2A 4N5DA 3VJLA 4ENVA 5I4BA 2M6LA 3FYDA 4QDXA 4XUCA 2BFMA 3ZHYA 4OI2A 3SZLA 1SUWA 1ABEA 3KZ1E 5AI4A 2KB0A 3U9LA 1NTRA 3UMSA 3HB1A 3SR0A 3FHOA 4WFQA 2P1ZA 3MINB 4PC1A 4DCGA 1TQ8A 4BX8A 1FVHA 1P44A 1ZK3A 4OIFA 2X0FA 1T3LA 3GPDG 4LNUB 5E6SB 4GF5A 4B76A 3U3XA 5FOTA 3VSDA 2A1TR 1H5NA 3NHUA 2GJSA 3ZZMA 2R62A 4ZAFA 1IN5A 1BDBA 3L0ZA 2J9ZB 2VRCA 2PGAA 3RUFA 2R6ZA 2WTBA 4TLMB 2GO7A 1P1RA 5L53A 2XVMA 4K40A 3IJ5A 1E6LA 1NPTO 3Q88A 4LE2A 4LHSA 3K09A 4DMFA 4DNPA 5JD6A 1N4DA 1S7GA 4FYKA 2FEAA 2YQ5A 4KSBA 2EBHX 4RIIA 4LFBB 2WY2D 2EBWA 2EL7A 4CYMA 4GYJA 2NSDA 1ZMXA 4ENUA 4OREX 4XSHA 3B9QA 3A1VA 1XNQB 1W30A 1K4MA 1P81A 1WP4A 5JYCA 2VPTA 3ZJTA 1FRZA 1VTKA 2F9MA 2VP0A 4D97A 4YPVA 2AN3A 1QDUA 4IIXA 1POWA 4TUYF 2JGRA 4AFNA 4W5QA 4F4DA 3N8HA 4RH1A 5FPPA 4GUDA 1Q0QA 5IWAB 4CT0A 3AF2A 1D03A 1VHJA 5KEIA 4HWPA 3OAAA 4WLFA 1P73A 4KR0A 2OV1A 3FYUB 1JS1X 5CYOA 5DGCA 1O6ZA 5LJLA 2VWGA 3C8MA 2HDWA 1M8PA 3DR3A 5M29A 3LVFO 2RC5A 4XQEA 4H17A 3VHXA 4YFVA 3ESDA 5FOXA 1MBZA 2OCDA 2KBEA 3BCSA 1JW9B 4A4DA 4EJSA 2R48A 4O8CA 1H93A 1NT2A 1QQTA 1I1QB 2F59A 4OA5A 2QMZA 4NNPA 4QYIB 1MQ8B 1ILWA 5CYFA 3OQ6A 4EHNA 4WK0B 2XLBA 5FLXA 2TMKA 1C7EA 1FUYB 2WEKA 2WNSA 3BXGA 2Y66A 4W7HA 4FUTA 4DXAA 5AW8A 3GWGA 5IT4A 1OFHA 4ZP1A 3O21A 4LZZA 1W87A 1HDGO 5JJLA 4Y9RA 4G5RA 1UKYA 3WL8A 1V41E 4NV1A 1SC1A 1Y6RA 5GTDA 5FBZA 2N42A 3T3OA 2MSKA 4URVR 3WLOA 1U99A 3NCTA 2HIHA 3I1JA 2G63A 2YTZA 1US8B 4KWCA 4XUGB 2DHQA 4YV7A 3FSJX 1SQ5A 1S6YA 1TD1A 4RDIA 1J09A 3AG6A 4GEGA 5LZ4A 1E6MA 3AUXA 2XWJI 3VO9A 1KJQA 1TPYA 2XWSA 1SUSA 2H9IA 4KI7A 5CEEA 3PD1A 2O7SA 2H1IA 3S2EA 4Z9BA 3EMKA 5AK6A 3BJMA 4LOIA 4DMCA 3PDUA 1ENPA 1SQFA 1YB5A 2WIKA 4KWIA 2IXDA 2XB8A 1SAYA 1XD2A 1KQPA 1VKHA 3WA7A 3E0QA 1J39A 2JASA 1EP3B 1VHLA 2H2AA 3A6FA 3N0RA 1N2IA 3COVA 1Q77A 4ZRNA 2X8WA 2VUSA 4Q7LA 4CKEA 1U3GA 1PFGA 3QJ5A 4W99A 4NZYA 4ZXFA 1P7ZA 3WHKA 2WSYB 3W34A 3LDAA 3RFTA 4CV2A 2LKCA 3FTCA 2HH9A 4YMTA 1FU7A 1EX6A 2HI0A 1E5DA 2ZJ5A 3AUSA 4ISBA 4WUTA 3IBGA 5DYNA 3BRWD 1UXGA 2RHBA 2OXFA 3CLSD 1T1SA 1Z16A 3MJCA 3N9IA 4UAVA 5CR9A 3CLUD 2TMYA 3ITNA 3NAQA 1X3LA 3LXRA 3TCNA 2OORA 1QAQA 2IYUA 3CNOA 2B1JA 5GM1A 4H1HA 4EABA 1HORA 3K2IA 4K3VA 4G4JA 4WBNF 1Z2DA 4LISA 2R7LA 4KSCA 3REFA 1JVSA 3SJBA 5EJ6A 1AMUA 2FFAA 1VDZA 3X1KA 4NCHA 3QFTA 3VZDA 1KZ9A 4BKRA 4KRXA 4WKPA 1KDPA 2WSSA 2BH2A 4R2LA 3D3WA 2QRJA 2XTJA 4P4SA 3OLCX 1BFDA 1R00A 2NT4A 4FJ0A 4JJGA 2ZANA 3ZKAA 2EX4A 1YDHA 3UENA 3IO5A 4FCWA 5CLLA 4PN3A 3KD2A 4OQEA 1N6HA 1NJ1A 3LYLA 4QFDA 2RAUA 4LYGA 2W93A 2ABWA 3R6LA 2GF9A 3P0RA 4HLQB 3JAWB 4LGVA 2DFKB 1U2EA 1A9YA 3GHHA 3PZRA 4GOXA 5KSOA 2Z1NA 1CSEE 2Q5FA 1C9DB 1MJ5A 1JFVA 1X7YB 1W75A 2ZJ7A 1H05A 4OJTA 3ZH2A 2VIIA 2QRUA 3AYZB 1FK8A 2X2PA 3CUWA 5EE9A 1C0LA 4G1VA 4IQ8A 2W6OA 3N5CA 3NWEA 4KK3A 1JDPA 3ZTYA 1FPQA 2FPUA 1LVUA 2I6XA 2OD7A 3BJRA 1YB4A 2ZRQA 4F8YA 1KEVA 2CUZA 1VXOA 2GZMA 2ZUFA 4CGYA 4OU4A 1D9ZA 2XNHA 4GGPA 3OFVA 4OO3A 4LTMA 3QUSA 4NMXB 4AF7A 4DPLA 4IAOA 3UMVA 3RVDA 5E6UB 4DSNA 5JC8A 3W6UA 4KQFA 2C92A 3CXUA 1I2MA 1ODLA 1P2UA 3OD1A 4U5XA 2YYZA 2P75A 3H04A 1T5DX 2OCLA 2V7QA 3BL5A 2ZZKA 2P9JA 3ZVMA 1LV8A 1RAFA 1T9AA 1Y63A 5A71A 5BNWA 2G1KA 3SS8A 4N7RA 4LQCA 3MIIA 1MORA 3AF4A 1CYDA 5IC5A 3KB8A 1EFLA 4YJFA 1EXDA 3KOMA 5FB3A 5A0VA 2P7IA 3USZA 4PYMA 3QK7A 2XQVA 2ZI5A 3SVLA 5FYQA 3K9BA 1GYPA 4H7FA 1C9EA 2R1TB 2FJPA 4MUMA 4BNXA 2VNAA 1W5TA 4YWJA 5JTUA 1N1DA 1NBEA 1E9CA 2PJZA 1XQ9A 3HYSA 3ONNA 1KEEB 1PJCA 3OLQA 3VU1A 3KDAA 3R7WB 1UPUA 1DMRA 1MIHA 3NM5A 5GZ1A 5IDXA 2XDWA 1SBCA 4WMLA 5EIHA 1D9XA 4FFWA 1JQAA 1N2JA 3FMGA 4IKOA 3DJFA 3WLKX 1QBKC 5DLDA 2FYTA 4M54A 3IO3A 1HRKA 1JVNA 1UPFA 2ZJZA 4KE9A 1ZW1A 2OLJA 4EUKA 3F71A 4N0QA 1IMOA 2LUOA 2VK2A 1E2NA 2G07A 2R2GA 3GDHA 4IGEA 5G3YA 5EHXA 2IBTA 3AL0C 3BVPA 4G4GA 2FCRA 1KMNA 5EWLA 1NXSA 2NO7A 2QW1A 5EKXA 5IVHA 4BKUA 3NNSA 1DXQA 1VRCA 3QYJA 3EEBA 3HFSA 1EE1A 1TMYA 1SGWA 2EKBA 3CWQA 1MC5A 3ORSA 3NHYA 4BLSA 4BCCA 3D2LA 1W49A 2PKCA 3D3WB 4NV0A 4K28A 4AP9A 1Q2XA 5EPOA 3PUHA 1P80A 4ERNA 1S01A 2AZTA 3F8TA 2BF7A 3LX6A 3QFCA 3WKAA 3ZJVA 5IDVA 3DH0A 3HJBA 3AHCA 2HXYA 4MVWA 1I7SB 3U3ZA 1WZIA 1IBSA 2VZ9A 5JHGB 4INPA 3TPZA 2L18A 4HAOA 5BN5B 4G6ZA 4Z7OB 3E4CA 3T0FA 1TFRA 5DHUA 2V9ZA 2E49A 2IUEA 4WDQA 4IQ0A 4WCFB 2JCYA 2B37A 2I9KA 1W9HA 4JC5A 4BU0A 2NQ8A 3RUPA 2P3QA 4I9FA 2W00A 3DAFA 3CUVA 3QWIA 4BMZA 4MKZA 1JNYA 5J5VA 1Z3IX 1WMSA 5CCDA 3R5KA 2EJWA 2IZ5A 1A7UA 1CUXA 2WQZA 4N54A 3ETGA 1FRFS 3ZE1B 1LLFA 4CL3A 2J87A 4V0RA 1P0IA 2CDAA 1KJ9A 1HMYA 3F3SA 4HDAA 1R0RE 1VIYA 1Z5UA 5EIAA 1VHDA 4R1TA 2FFBA 2YWDA 2Q2QA 3SR3A 1YS6A 1SWWA 1NYLA 1OZGA 2VCEA 3PXUA 2CMHA 4LNHA 3JQBC 1TO1E 2CYCA 2NTVA 3DFIA 4DMKA 4QPPA 1THTA 3LUAA 3MS2A 3VMMA 2G1PA 2HTEA 2V6BA 2FJUA 5EJ5A 4M0CA 1FLAA 5DIZA 5TIIA 3HXQA 1PDVA 2BH9A 3HK2A 3E3LA 3QFHA 5CG2A 5GIPE 4MUEA 4D81A 1NMZA 5KU1A 1KO8A 1Q50A 3T7TA 3Q41A 2PL9A 5BN3A 4OJKA 5ENDA 1QFMA 4AQDA 4E6PA 5BMVB 4M9UA 2XADA 3GAAA 4O4IB 4WI1A 4DRZA 3F5DA 4MAMA 3G7NA 1GAXA 1T8WA 4IWNA 2QD1A 1V7PC 1GADO 1QAOA 2GCEA 5FWDA 2VDJA 4AO7A 5G0TA 3UV7A 3L7AA 1GSOA 5HTKA 3UUWA 5DGDA 2JG3A 1NE2A 3GAMA 4UBLA 2V74B 4Q1EA 2ZYDA 1KDTA 2OV8A 3IHLA 3MJ4A 1W76A 1ZK0A 2JLZA 1CY1A 1C3OA 3V2IA 3R0VA 3ZIAA 5JNVA 1P7PA 2Y1EA 2JBWA 1MVOA 2KLBA 3RYCA 4K9KA 2IP1A 3CLKA 2ZBGA 3I28A 4FK8A 1E5LA 2PY6A 3EIXA 3OFND 4UM5A 4IS2