2DR3A

Crystal structure of reca superfamily atpase ph0284 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
239
structure length
232
Chain Sequence
RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKGIIVYPDKVLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0273 protein PH0284
publication title Crystal Structure of RecA superfamily ATPase PH0284 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 74
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dr3A00
1N6LA 3R7WA 3MGCA 1GITA 2IT1A 3R9XA 3U5ZB 1ZP6A 1P61B 3CONA 3MFYA 4BLSA 1DG1G 4NCJA 4NYIR 3PENA 1YRAA 1VCMA 3K09A 1EGAA 4CVNA 1LB1B 1MO4A 2ANBA 4Q4AA 3H84A 4F4CA 3MAAC 3TKLA 4NKRA 3BS4A 3EAQA 1WB9A 2LKCA 3N2IA 4EJSC 5JRJA 2FFQA 4IFEA 4DLRA 2DBYA 5TMPA 1DAIA 1CULC 1KO1A 4LBWA 1DAMA 2ZI6A 3ZZUA 1Z6XA 2ZSFA 1YZTA 3MRSA 1NIJA 2RGEA 2DFTA 4PTLA 3EPHA 4OI2A 3L2OB 3AV0B 4KU4A 3PUZA 5JJIA 1JPNA 4R9UC 1YKSA 3IBYA 2YZ2A 1ZW6A 4UXHA 1YZLA 4Q1DA 3KXIA 3A6PC 5JJLA 3IO3A 2QY9A 3F0TA 4KBGA 2WWGA 4TL7A 2DWPA 3C8UA 3BH6A 5DNYB 2RAPA 4TLCA 4GZMA 3QNUA 4OK3A 5CK4A 4QG7A 5L3QA 2UZIR 1C4OA 3OIVA 4G1UC 2HXYA 3SR0A 2IYVA 1GOTA 1TUEA 2QTVB 2ZRJA 2G77B 1R8SA 3EZ2A 3L43A 4PXAA 3RYTC 4KHZA 2QROA 3EXAA 4OQXA 5H1YA 1E69A 4JSYA 3ASYA 1S96A 3DKVA 5JI3E 1CLUA 4M0LA 1E1RA 1HQCA 5DLQC 3RNLA 3EPKA 5J4HA 2Q0HA 3CNLA 2QQEA 3AGPA 3EZ6A 1U99A 3W90A 3ZS9A 4FW9A 2JLUA 3O8CA 1UKYA 3FMOB 1OV4A 4LJ5A 2BCJQ 2QPTA 4TYYA 4HUQB 1ZD8A 1IONA 2DR3A 1US8A 1NVVR 2F1RA 1FQKA 3B1ZA 4R71A 2FA9A 2OSBA 1E2JA 4BEBA 4NCIA 4F4JA 3I62A 4D2IA 4ACBA 2WJGA 3GLIE 4Q9HA 1PZNA 2CLDX 4HAWA 1E9RA 3NBXX 1NIPA 2W2VA 3QKSB 5HZHA 2C96A 3CZQA 1FP6A 1YZQA 5HR5A 1XFAA 1AS0A 2QG6A 4AURA 2ZE6A 1NBMD 4DB4A 1RJ9A 3TVDA 1XXHB 2FZ4A 3SJCA 4KLNA 1W4RA 3HWSA 1GILA 4EPXA 4TLDA 1OW3B 2QM7A 1RFLA 4KYUA 4UJ5A 1Z0IA 1NRJB 4L16A 2JLRA 2HEIA 3QVVA 2PH1A 4MKIA 3AVYA 2NG1A 1JNYA 2ZRLA 4Q7JB 3GMTA 3MJRA 2QT1A 3WYAA 3PFIA 3C15C 5ELXA 2ZUBA 3UANA 2MSCB 5BN5A 2RCNA 2XITA 4IOMA 3Q9LA 4CEIB 4R7ZA 4GOKA 2J0UA 1HUQA 4HEJA 3R9IA 4URWR 3TSOA 2NZJA 4G5GA 1EFUA 4YLGA 1IY0A 4TL6A 3HYRA 1OFHA 3TH5A 1AKYA 5KYKA 2IHBA 1RVDA 4AKGA 3EIHA 4IDNA 4B32A 5LD2C 1VYUA 1WMSA 1ZYUA 4A36A 2R6CA 2WJJA 1XXHE 4D26A 1ZNXA 4WXRA 2BIFA 3FMIA 1KMQA 2W0SA 4FXPA 4WZBE 3GLFE 4PPNA 3AEZA 1WP9A 1QHHA 3TK1A 2ZI3A 3CRRA 2VP9A 2ZSEA 2W2XA 1LS1A 3EW9A 4MUBA 4EDHA 1A2KC 2QORA 3F8TA 2EFEB 1OXVA 3O8RA 2HLDD 3B82A 4MKGA 3CF2A 1NLFA 2IW3A 1XTKA 4ILEA 2G83A 2JIZD 2WSSA 3K0CA 3NTUA 4M8NE 2C03A 3B1VA 1OSNA 4JLAA 1E94E 2FNAA 1ESNA 2HF8A 4M9XA 2XEXA 4PC3A 4Q1BA 3KKNA 4TTPA 5HCIA 1M8PA 3MWYW 5TY0A 2J0SA 3GCGA 3IQWA 3K0EA 4J0QA 1KY3A 4QL3A 5EZ5A 3T12A 3VR1A 4XD7D 2FJUA 1LW7A 2O8CA 1N6KA 5FPYA 1YZNA 2ZSDA 4BFWA 2ODBA 5JSZA 4U02A 2R44A 1Z83A 1SKQA 2BEKA 1G19A 3AP1A 1G8PA 2O0HA 3OESA 4MQBA 4YMWA 1NBME 1ZM7A 2YVUA 2J87A 5CM8B 1M7HA 4KJZA 4CGZA 2QTFA 2OCPA 3BK7A 2IK8A 3AVWA 2IUTA 3AKCA 1WE2A 5L3SA 2XSZD 2AWNA 1ZNYA 4Q5IA 1E6CA 2YV5A 4XTCS 2ZR7A 1UKVY 4L9WA 1UBEA 1A5TA 4YMTA 3MD0A 2IYRA 4LK2A 4HSEA 4O25A 1Z22A 1OH7A 1JXMA 421PA 4QGGA 1TMKA 4JLVA 5G40A 3KUCA 1II8A 1KJWA 2WZQA 4XWAA 1P60A 1JAHA 5CIWA 3NBZC 2D7DA 2IXGA 2WPDD 2HT1A 4PHGA 2YC4C 2BMDA 3NH6A 3VTKA 3QI2A 1Q22A 2W00A 1DAHA 4RZ3A 4IJMA 4DDVA 5E7MA 1IN5A 3VR2A 2EWWA 4OQFA 4ASUA 2OV2A 1KMHB 3QOFA 2QGZA 2CK3A 4MDFA 5FBLB 5LDDC 4KVGA 3DL0A 4C0KA 3RRNA 1XB2A 4JT2A 2XGJA 1OHHD 1CTQA 1JR3D 1LFDB 2OBMA 3TIFA 4OHWA 3KQUA 4B3GA 1G7CA 1RRCA 1M6NA 4W9MC 1W4CA 1S1MA 3K70D 1ZU4A 4LJ8A 1DTSA 1U8AA 2O0JA 2JEOA 4HLUC 1HT2E 3ZVRA 4BPBA 2ZJ8A 2ZJYA 2GWHA 1S0UA 4IEEA 4LX0A 3K70C 1UF9A 1GM5A 3GEEA 3X2SA 2ZJ2A 5FBRB 3BB1A 3H2YA 2WV9A 1XJQA 3A36A 4Q4JA 2V3CC 2J7PA 3T5GA 3SI7A 5DI9A 2FV8A 2PEYA 1ZJ6A 2OBNA 2KWIA 4ZDWA 4DUGD 2NZ8A 3KTAB 4EPYA 2FEOA 5LPNA 3KXLA 5AR1A 4DEYA 4FWIB 1E79D 1J2JA 4B35A 1DG3A 3BD9A 4M1YA 2ZE5A 4RD6A 4Z1MA 2YJTD 2A2ZA 2J7KA 2FPKA 3TR5A 2GF9A 1CJUC 1D2EA 4IVPA 5HPYB 1MRNA 3GP8A 2BEJA 1E9CA 3CM0A 3I5YA 1P3JA 2WWXA 1NY5A 1J8YF 3FDIA 4IFBA 5BYJA 1OXUA 3PXGA 4L15A 1YR8A 2AXNA 5HE8A 2VEDA 2DPXA 4PC1A 3DZ8A 2GJ8A 3HYTA 4JT4A 4ZDKA 5DHAA 1GZSA 3GPLA 3MSXA 1S4QA 1SULA 3CRQA 4N0EA 2AXPA 1W46A 2F1JA 2NPIA 2GJ9A 3RS5A 3TR0A 1N6HA 3VU9A 1OH6A 1MT0A 1E3MA 1MR3F 4GP7A 4ZPXA 3UIEA 1XP8A 3B6EA 1D8TA 2ODNA 3L0PA 4JLPA 3ND8A 1TF2A 2D62A 2DFKB 3X1XA 3DDCA 2O8BA 1W48A 4PSVA 1WCV1 2ZROA 1AS2A 3KDSE 5EXSA 1VCOA 2ZTSA 4GSYA 4DLXA 1F5NA 4M53A 5JCPA 2QPOA 3N5CA 1NMYA 1XD8A 3GJ4A 3VNVA 4HZUA 1F48A 4M2LA 4X8MA 3RRZA 3MUFA 1W36C 1X1SA 3QENA 4KLZA 2BJWA 4NCNA 1Q0UA 1JR3E 4Q1EA 1CIPA 3D8BA 5C4MA 2Z4RA 1SVWA 1XDBA 4OI4A 1EX6A 3QG5A 4LC0A 4NYIQ 1XEFA 1U8ZA 2NIPA 4NYMR 3EZFA 3A37A 5AK0A 2ERXA 4N3NA 3AM1A 1G8HA 4HYYA 3K0FA 3TBKA 4QJ4A 3GJ6A 1XJ0A 1N0UA 1N5LA 2RHDA 2GCOB 1OIWA 1MKYA 2CHGA 3I3SR 1TNDA 2Q3MA 5D3MA 2ZRIA 4BZPA 1IN6A 4R2HA 2FF7A 4C7OB 4HDCA 3FKSA 3U2QA 5J47A 1MO6A 2YWEA 1U2RA 2N1BA 5JEEA 1UEIA 2C77A 3ONWA 1SVMA 4V0KA 3T06B 1Z3IX 5KOYA 3K0AB 1GTVA 2DWQA 1W0JD 2QPAA 2ZVPX 1T3LA 2EW1A 5AJYA 1FOEB 3BJIC 1FFHA 3BB4A 2QL6A 2WMNB 2UVQA 3KXKA 4P31A 5KHOC 2BV3A 1KTVA 5CJ2A 3PEWA 2OXCA 2JDID 3C41J 1M34E 3GLGB 2GKSA 3O8BA 4DHEA 1FPMA 3WYGA 1KGDA 1EK0A 3QQ5A 5EP2A 1GNRA 1UBCA 4LGMA 3P26A 2EWVA 3THOA 2A5GA 4QGHA 5KSPA 2C9OA 2RGXA 3R20A 3ZGXA 1GAJA 1ETUA 2F3RA 1QBKC 3FPAA 2J9RA 3IBGA 1I2MA 1E2HA 1QDEA 2G1JA 1E9SA 4HDQB 4YC7A 1KOFA 1E2DA 4PFSA 5TB5A 2QBYA 2G0TA 1DO0A 5TARA 1SVOA 1S9DA 4ZKDA 2GXQA 4NP6A 1XBTA 1G5RA 1NVVQ 1G64A 3THXB 2VP4A 1UFQA 1P9NA 2VA8A 1QF9A 1A82A 1N5JA 4XSHA 4QBHA 1XPUA 1MO5A 5EXPA 2OCAA 4CF7A 4WA7A 3GLHA 1JR6A 3GD7A 4V0OA 2F7SA 1AA9A 1GRRA 4RSGA 1RW4A 1XZPA 4IDOA 4A92A 3EARA 2GTPA 4URUR 4CIDA 3FWYA 3QXCA 3GLGE 5TXGA 1VECA 2WWYA 3M4YA 3K09C 3TUIC 5JS7A 1DPFA 2ONJA 4AI6A 1DS6A 5FBWB 3TW8B 2HYDA 4A2QA 4EFNA 1P9RA 1T0HB 1FQJA 2QAGA 3CPHA 2IYSA 2N42A 1NF3A 5CIQA 4D0GA 1ZNZA 5DHFA 2CEAA 5CM9C 3NDPA 3LRPA 4TL8A 4B44A 1OT3A 1Z2CA 3RC3A 3A1SA 1HV8A 3VR3A 3CUEF 4QXAA 5JECA 2JATA 2C2HA 3A4MA 3E70C 4TYPA 1OXSC 4TQ9A 4CT5A 2R9VA 2CE2X 2OE2A 1G4UR 3I32A 1IXZA 4FMDB 4JLBA 3ZIAA 4DB2A 3LW7A 2BOVA 4PANA 4P4SB 2P5TB 4JBWA 3B78A 1F60A 4UXJA 121PA 2GK6A 3CX6A 4OQLA 1V43A 5FUYA 3KKMA 3SBEA 5FTLA 3C5HA 4DC9A 1OLOA 5C18A 2G1KA 1OYYA 1E2EA 4YMSA 4GDFA 4AC9A 4KYIB 2OESA 4P32A 1OE0A 3B1XA 2WBLC 1E1RD 4Q4AB 6Q21A 2EU8A 4B34A 3U6BA 2WIAA 1P62B 4D82A 2P65A 2EFGA 5KSZA 2F43A 5IT5A 4Q4HA 2JAQA 3CH4B 1NG1A 5IK2A 2V7QA 2CHQA 4XJXA 1NN0A 1KI6B 1VG0B 1TU4A 5KNBA 3IUYA 1GUAA 2R6GA 1G3MA 3K8YA 2FE4A 3NC0C 4Q00A 5AUQA 5FOSA 5FL3A 3SHWA 1UDWA 3PQCA 4FI3C 4H9GA 3T1VA 3T1OA 4Y0VA 2XXAA 4OHYA 2PLRA 3QKRB 3UWKA 1ZIPA 1P72A 4LZZA 1KIMA 1N6PA 4W5WA 5KUTA 3X1DA 3ZVNA 1Z0FA 5IF9A 2X2EA 2BMEA 3KB1A 2OFWA 3PG5A 1G5TA 3SFVA 1AZSC 3IO5A 4NMMA 4TQUS 3P20A 5L3QB 4JLOA 1NSFA 1Q3HA 3T15A 2VP5A 3AGQA 5G3ZA 3S1AA 3QE0A 4MGKR 1E2PA 2Z4SA 1G18A 1A1VA 1SXJB 3MG9A 2ZUDA 5DI3B 1XNJA 4BFYA 2OILA 4F91B 2QMOA 4DZZA 3LBIA 1OH8A 3IEVA 1AGRA 1US8B 1CR2A 1E2QA 2H92A 1BKDR 1ZM4A 2RHMA 3NHAA 3Q7PA 4JVSB 4LDJA 4LYAA 2YWFA 3J81k 2AFHE 2BM0A 4NZYA 3TRFA 4KV9A 5DH9A 5K8IA 1BIFA 2OFOA 3G82C 2MSDB 4LHVA 1GP2A 3TUZC 1J8MF 1N25A 2ZM5A 2QMUA 4PSKA 2REBA 2VRWA 1EFRA 2D2EA 4JL8A 5GVRA 1KSJA 1PLKA 1OYWA 1H65A 4GL2A 3LAWA 3FMPB 3AVUA 2Q6TA 3WRXC 3CNNA 1DAGA 2EFHB 1WF3A 1YQTA 1UBGA 2H16A 2NMVA 2JLYA 4JBXA 2CL0X 2WSSD 3U7GA 2GXSA 2MMCA 3MWKA 2CL6X 3EA5A 5FBVB 1Q1QA 4TT3A 4LUCA 2GEDA 2J0UB 3K0CC 1SKYB 5B58C 3OE7A 1AIPA 1S8FA 5EP1A 4M21A 4URXR 3L0SA 1D9XA 2QSYA 1FUUA 3NVAA 3DOEA 3VHXA 4D6PA 2QMHA 2ZRNA 2QMEA 3SYLA 4PHHA 3LV8A 5FTMA 4MH0R 4WVFA 4B6EA 3OIUA 2ZRAA 1VIYA 1C9KA 1Z6YA 2WWFA 5KO2A 2PCLA 3W6OA 5J4VA 3C4JA 4OHVA 2HCJB 2ZVQX 1QVRA 5FI0B 3EWSA 4BLRA 4QFMA 1KSGA 2WWHA 3ADKA 5AUOB 1G17A 5J40A 4FN5A 2V4ZA 4UNSA 3WBJA 1VKJA 1FZQA 1G16A 2O5VA 4DSUA 1EWRA 2FG5A 2KBEA 3TUJC 1PUJA 3KQLA 4D0NA 2XZLA 2ZRGA 3PIRA 3QEJA 4BLQA 1PVOA 2BBWA 3I72A 2R8RA 3OAAA 4A8JB 2AD1A 4KSBA 2F1HA 2PLFA 1P2UA 1M74A 3OZXA 5JMTA 3WYFA 4EPRA 4TMKA 4LV8B 5DO9A 2WM9B 2CCGA 4GT1A 1DBSA 1Z0AA 3NXSA 4ASUD 3VKGA 4LI0A 4BASA 1BMFA 1Q21A 1NVUQ 2CLCX 2CK3D 3LDAA 5CB8A 2O8CB 4QBIA 2IWHA 3QPVA 2BMJA 2FMXA 3GJ3A 2IS2A 1TF7A 1M7BA 1JAIA 1I4TD 1LNZA 2ZRPA 4EQ6A 4C0BA 2VHUA 2P3SA 1AKEA 2ODEA 2JLZA 4NTZA 2VBCA 1ELOA 2XNDA 2Q3HA 4UQOA 1P75A 1ODFA 4CEJA 2AR7A 5FI1B 1R5OA 3PCRB 4A0FA 1KO5A 2HDNB 2QAJA 4S35A 1HEIA 2ZITA 4C0HA 4ZCLA 5EXXA 1CU1A 1HQYE 4OKSA 5A4JA 2Z0MA 5FTJA 4AIIA 1Q1BA 4Q9JA 4D81A 2DFLA 3BORA 4NYMQ 3MMPA 1V5WA 4LBYA 5CJPA 5H68A 5DE3A 4BFTA 2IXFA 2J7PD 1TL7C 1GNPA 1G3UA 3GLIB 4PO1A 2WOOA 5GADl 2BM1A 5FOWA 1XTQA 3EPLA 2OLJA 5KTYA 2IYLD 2VHQA 1Q1EA 1ZC4A 4B2PA 2IS1A 1KI7A 1NP6A 3A58B 1KI4A 1E98A 2D74A 2CXXA 3KFXA 3WHKA 2JJ1A 4DVGA 5BN4A 2CDNA 4OYHA 2ZANA 4Z1MD 3EG5A 2D2FA 2BBSA 5UKDA 4A0GA 4M9QA 4B48A 4EJSB 2CVHA 4KSCA 4DXAA 2BC9A 4DWJA 2RB4A 4M9SA 4IDQA 5CLQA 4QJ3A 2ASEA 1RYFA 4X8LA 2QE7A 3NDBB 4PZYA 4B3XA 3TSWA 4HDOB 2ZRHA 1GSIA 1TPZA 4CZ2A 4TSFA 3W5IA 4TLBA 1L7VC 4C0QC 2O8DA 3MCAA 4I4LA 4IEIA 5G41A 4WZ6A 2EVWX 3KFVA 5EP3A 5CK5A 5H70A 3UMRA 3CZPA 2WMOB 3NBYC 3T1TA 1S9HA 4GMDA 2GXAA 4Q4JB 3SJAA 1E9AA 4GRAA 1B0UA 3ZLJA 5JFGA 3HJNA 4DLWA 3H1TA 4A6XA 3VKWA 1KDRA 3UWOA 3DHWC 4YMUA 3X1YA 3GLFB 3LW8A 2FPLA 3ASZA 4L5BA 1CJVC 2YHSA 2VIIA 3CWQA 4BRUA 1GRQA 1S2MA 3JVVA 4CT4B 2GA8A 3CX7A 3FMFA 1Z28A 2C9CA 4MKHA 2PBRA 4X8HA 3FHCB 2GZDA 3ZDQA 4BFUA 2J46A 1X3SA 2O0KA 4G01B 4TYNA 3LXRA 3W6NA 5KNDA 4TN1A 1BS1A 3CX8A 4Z8YA 1DELA 1RIFA 3AQ4A 1QHSA 3P27A 3AKEA 3EA0A 5B57C 4P33A 3U44A 2HV8A 4FD2A 4LV6A 2XOKA 1IJFA 2QENA 1P2VA 2TMKA 3FTQA 3FKSD 1E2KA 1D2MA 4PPGA 3LX8A 2ZE8A 3MWLA 2JJ2A 4KFSA 4V0MA 2QP9X 1U98A 4AYWA 1OFTA 3HR8A 1Z6GA 1FW6A 1GL7A 2GEUA 4DCSA 4RKEA 4BE7B 1KK0A 5FUVA 4JLDA 3H0KA 5FBQB 4V03A 2VYFA 2ZI5A 1WRBA 4NH0A 2CJWA 3HR7A 2XJ9A 2BKEA 4A1FA 1I4DD 3T1QA 4IVRA 1XEWX 2FEMA 4XWOA 3UPUA 1BYUA 1U0LA 1XRJA 3L0OA 3QJYA 1Z07A 2R65A 1LF0A 3KJEA 5HKKA 5LD2B 1NVWQ 1EX7A 2CCJA 1K5DA 4WXPA 4E22A 4M22A 4LHYA 5KU1A 4Q1CA 4TZ0A 3LLUA 1F6BA 4ABYA 4B3FX 1GG2A 1H8HA 4IOLA 3RC8A 3V9PA 4QNRA 2LKDA 2RGDA 2VF8A 2GCNA 1XEXB 2GZHA 2ZYWX 5BWMA 4CRWB 4BECA 4MYHA 4WW0A 2GEVA 3Q8XB 4LJ6A 1T8TA 2X8AA 4JLNA 4ARZA 3TAHA 4B47A 3B1WA 3NIBA 1IXSB 2YOFA 3QF4A 5ANRB 4V0LA 1U94A 2W6IA 4HLDA 4A2PA 4KO8A 4B43A 5K8LA 1Q1ZA 2WJIA 1GFIA 4YQFA 3U3KA 3W34A 4II7A 1J99A 1ZD1A 1S3GA 2I1VB 1UDXA 3SC3A 1D2NA 1NVXQ 3CRW1 221PA 3BE4A 3BH7A 3QVUA 4MGZR 5BXQC 4BGDA 5SZIA 4MRPA 4R2IA 1TF5A 3FFAA 1QHGA 3QPWA 4GMXA 1UKEA 3KQKA 5FTNA 5DIFA 4DIDA 1U0JA 3SDZA 3QXXA 4NDZA 3C7KA 1F2TA 2P0EA 4RCZA 2OAQ1 2VP2A 4TQAA 2QAGC 3NHBA 4HI0E 2FPMA 3FKQA 3WNDA 4DCNA 4MRVA 2QBYB 1JB1A 2NO1A 4Q19A 5EUMA 4NE2A 4A4DA 2QNRA 5F9HA 1KO4A 2ZS8A 3KKQA 3RAPR 4V0NA 3AF4A 2QT0A 2GAOA 2XZPA 4DLVA 4YONB 3U3OA 3ZIAD 4FMBB 2GVDC 2BDTA 2H7VA 3AF0A 5D3QA 2ATXA 2YINC 2ZRCA 1JQLB 3QF7A 5GJBA 4LY6A 4DT1A 4OI1A 5G53C 4IKEA 4OI0A 3JZAA 621PA 1E9DA 1E2IA 2ZU6A 2O8FB 1NY6A 3O47A 2ZYVX 2IF2A 4C0JA 5AJXA 1E1QA 2ZQ5A 4OHZA 1G3QA 4EIWA 2F55A 1G291 3G5UA 1KK2A 1IY2A 1KDPA 4MKFA 4RKFA 4I1UA 5J4YA 3KUDA 4LPSA 4DKXA 2EYQA 4AG6A 2GHIA 2QTHA 2V7QD 2WAXA 4LRWA 2Q9BA 1XEWY 5IK2D 2ZXUA 2QSZA 3THWB 1KNQA 5EXTA 1ESMA 2OBLA 3SZRA 1HA3A 3HU3A 5FTKA 3B8HA 2NTYC 3U3JA 2X19A 5EZ6B 2ZE7A 4HUQA 1KO8A 1T6NA 3LA6A 1IN4A 2YWHA 3UMSA 3LX5A 4G5RA 1A2BA 4PZZA 4AWXA 2NO9A 4OL0A 1PLLA 1NMXA 2I4IA 3IKJA 1K8RA 1S3SA 4WZAE 3ZH9B 4UNQA 1Z0KA 2RGBA 2X2FA 4G5OA 4L9SA 3Q85A 3RWMB 1J90A 1W5TA 2A5JA 3K70B 1CR0A 2D06A 3BAFA 2ORVA 1U0HC 3I8SA 3FHOA 1QHIA 1TUIA 3QSYA 1SVSA 4MITA 2L0XA 4JJKA 3W3ZB 2FU5C 5LBIA 1R8QA 1NL3A 4RFVA 4DDWA 5KNCA 3PR1A 3PUVA 4ZCIA 3U7EB 4B33A 3W9YA 1T91A 4TMZA 3IPXA 2ZR9A 1FNMA 2WAYA 3C14C 5JS8A 5K8TA 2DFNA 1ZM2A 1RYHA 1KDTA 4GI7A 2BJVA 4D4JA 2RH5A 4E03A 3QBTA 5JBQA 4IXNA 3NEYA 3REGA 4OK6A 4PQRA 2OXRA 1W36D 3MWJA 4LCBA 1ZBDA 4OBEA 1E96A 2OAP1 5K8UA 4CEIA 2IS4A 4H1UA 3AVVA 1WA5A 5H8WA 4URYR 2NQ2C 3B9PA 3SNHA 2UKDA 1XTJA 2E87A 3SQWA 2C9YA 5JWHA 2NO6A 2JGNA 1MABB 1JECA 4RFSB 2P5SA 1KAGA 3CPJB 4LHZA 2O52A 1EFRD 2XZOA 4Q03A 4YMVA 3IQXA 3AF3A 2RKOA 3ZYCA 3ZVMA 5J5CA 3U3RA 3U7FB 5HE9A 1XPRA 3QUSA 3BIFA 4LPKA 5KDLA 2DYKA 1XCPA 3ADBA 1UPTA 1ZUIA 1NN1A 1XF9A 4IVQA 1F2UA 3T61A 2IL1A 3DEFA 3K9GA 1HH4A 2LCFA 1N2CE 2GXUA 3VR5A 3SQXA 1G1MA 2ZS7A 3VX4A 4TT3D 1R4AA 4QBGB 2VQSA 4ZIRB 1W36B 3OE7D 4CYMA 2GVZC 3ZQ6A 3A1WA 1HYQA 5JEDA 4G0NA 5BYKA 1NMZA 1MOZA 1ZU5A 5FPKA 2ONKA 1Z29A 1ZIOA 3OHMA 2J0VA 5HZKA 3B13B 1U81A 4Q66C 3WY9A 1RZ3A 2FDCA 4HB4A 4KODA 4XVUA 2V1XA 5FL7A 1RE0A 5JLJA 2QU8A 2J3EA 3RABA 1VTKA 4GP6A 2PCJA 5CB6A 2J0QA 3FE2A 1E2MA 1OJLA 1TEVA 2JCSA 4C30A 4C4PA 1KKMA 1ZMXA 5FPSA 2AFIE 4DCUA 3ADCA 1CBUA 2R6FA 1G8YA 3HPQA 4XOIA 1L4UA 2GESA 4P3YA 1T3SA 3KQNA 4LBVA 4Q1FA 3T34A 1SVIA 3RHFA 3T5DA 2I1QA 4PPQA 1MH1A 4GOXA 2FX3A 1N6OA 1Z47A 3AVXA 4QNMA 2DY1A 3KL4A 1J70A 3OAAD 4MYCA 2B92A 2ZAOA 2P6RA 2PJRA 4MA4A 4JBYA 3B7GA 4MRRA 1UBFA 4ESVA 4JSTA 1QG2A 1W2HA 1EESA 4DCTA 4JL5A 3QIAA 1BMFD 2G3YA 4NL4H 3PUXA 3RS2A 1JQJC 2HT6A 2FGJA 3LVQE 4DRZA 1VG9B 3RRYA 2GF0A 4XTRA 2AKAB 3ZD7A 4JMPA 2VHJA 1A7JA 1CR4A 2XNDD 4LJ4A 4US1R 1XMVA 5CDFA 1MRSA 5KDDA 1OXXK 1JJ7A 2A5YB 3Q3JB 3THYB 4RD4A 1D6JA 3BBPA 3R8CA 1X86B 3GFOA 4ZKEA 1JBKA 1G7TA 3W8RA 3CF6R 1IHUA 5L3RA 3EIEA 3I1FA 3ECCA 1VMAA 4HAZA 4XVRA 5SZKB 1R5BA 3CNOA 1OIXA 1QHXA 3I8XA 2HJVA 4LHWA 2ZIAA 1AQYA 1H8EA 2B21A 2IX3A 1PJRA 1W44A 1YZGA 3IIKA 3ZZ0A 4DLYA 4DLTA 3KTAA 3R7WB 3RLFA 1G3IA 4D4KA 3U6KA 3W3AA 2JJ1D 5HCNA 1N3BA 2RGGA 4O0MA 4TYWA 2AWOA 4Q9IA 1DOAA 4NONA 1BYIA 4QHYA 2UZ3A 1Y63A 1G6HA 3CIOA 1X8LA 4JKIA 3ZZTA 4M1TA 3U61B 1EWQA 1DADA 1NLZA 1EG7A 5EUQB 2VP0A 2GAAA 2C99A 1KDOA 4IDHA 4O2RA 3AP3A 3CR8A 4MYUA 2QE7D 4QGAA 4CEJB 1G6OA 4JIMA 2ZRDA 2IYQA 1U9IA 3ND9A 1KZGB 1M7GA 4M1SA 4TSFD 3Q5DA 3FFBA 4L4UA 2P67A 4PO9A 1IN7A 2FWRA 4X8OA 4O3MA 3TQFA 1YU9A 1NN3A 4UNPA 1AJEA 1TX4B 3AB3A 3RANA 1E4VA 4D4LA 5J4KA 3BFKA 3QKUA 3IHWA 4KBFA 2GILA 4RD2A 3PUWA 1GNQA 4ON9A 3LQQA 4ZI3A 5EJEA 3FGNA 3H4MA 4JVLA 4Q7LA 4LYHA 4QC2A 1NI3A 1W1WA 4FMCF 2PMKA 1DAKA 2AK3A 3IIMA 3WRYC 2B7CA 2IUSA 2IYXA 5FFMA 2Q9AA 2JLXA 5EQTA 2H17A 5DYGA 1Z63A 1Q3TA 3VQTA 3VMFA 4UXIA 4Q21A 2PT5A 3WP0A 2ZJAA 4JL6A 1E99A 2GBLA 1K6MA 3OEHA 3RRMA 1Z0JA 4LYFA 3LXXA 4MRNA 1P73A 2QEQA 1DE0A 2Z83A 3CB4A 1XPOA 1GRNA 1GVNB 2AKYA 2NOAA 4RZXA 1GWNA 4KITB 3DOFA 4TMVA 4FCVA 3FYHA 2AL7A 1UKZA 2OCBA 4C9BA 2J41A 1SVLA 2O8DB 2CMKA 2XOKD 3U7HB 4PAOA 1CJKC 1JXOA 1W4BA 4PSAA 3ICEA 3ZQJA 1NLYA 2A78A 1YJ5A 821PA 2ZJBA 3I61A 4YXWA 5F98A 2GCOA 1OPXA 2QRNA 3KKOA 4ZV4A 4C7OA 1N0VC 2JJ2D 1TEXA 3OIWA 4JYBA 4PAMA 3SHFA 5JZVA 1WQ1R 521PA 3U4QA 3R8FA 1RJ9B 4A0RA 1U8YA 3RS0A 2WWIA 1MV5A 1QHYA 1GKIA 4M1OA 2ZRKA 5BQ5A 4C3ZA 4FINA 2D4HA 3DKPA 3K0AA 4QRHA 4XIGS 5E95A 2FGKA 3AVOA 3BB3A 3BERA 5BW8A 5JHGB 5AWFC 4MDEA 4L8GA 1WXQA 4A0HA 5EE3A 3SOPA 3CWZA 1E2GA 1G21E 4ACAA 1F3OA 3GLGA 2XAUA 4AKHA 3VR4A 4CEHA 1TTTA 3PEYA 2XNSA 5GVSA 3U44B 1XD9A 4IHQA 4XVQA 1VCIA 1SQ5A 1LS6A 5HKKD 1R0XA 2WKPA 4JLJA 3AKDA 4Q7KA 4YDHB 2PL3A 1N6NA 2BVNA 5TV2A 4GFDA 4RY2A 1H8HD 4LJAA 5CYOA 3I4LA 2ZI9A 4HAUA 3VAAA 3BRWD 5LB4A 3THXA 1XCGB 2YKGA 3U60B 2W83A 2ZRFA 3E2IA 4A82A 4LSGA 4PR0A 5TVKA 4D4MA 4UNRA 4C0AC 2GNOA 4DDUA 1IAQA 4DDTA 1QHHB 4YDSA 4U00A 2W6ID 3HU1A 1R6BX 5L3VA 3WP1B 4MYTA 2MSEB 3K9NA 1CF4A 1WDTA 2RMKA 3D31A 1UM8A 1AS3A 1ZM3A 4RJLA 1E9EA 4Q9KA 1Q57A 3C5CA 1YZKA 4KVAA 3DMDA 4PHFA 1J7KA 1GKYA 4KXFB 3HU2A 2REOA 4US0R 1N5KA 4PC6A 4LJ9A 2H1LA 4F7WA 2JLWA 4UKDA 2W6JA 2FSGA 2A7QA 4A2WA 3EZ9A 4WOPA 5JWOA 1KI8A 1G20E 4B74A 2SHKA 3PITA 2KI5A 4V02A 5CYPA 3X1ZA 5FR1A 2QUZA 1FMLA 5JSZB 1E0SA 2Q3FA 1KZ7B 4V0ME 3ZJYA 4ITRC 5DGXA 5A5GA 4NHOA 4FIDA 4M1KA 1G3RA 3PVSA 4Z54A 4US2R 2ZEJA 1E0KA 1YZUA 5KPDA 4I1SA 5L3SB 1LF5A 5DN6A 1W5SA 4LYJA 3GEIA 2BMFA 3QF4B 1E1QD 1KI3A 3DZDA 1PV4A 1W0KA 2VP6A 4W5JA 1KKLA 3UATA 1II8B 1TQ6A 2Z5FA 3SEAA 1UEJA 1YRBA 4AG5A 1T5LA 1YVDA 2W2TA 1FMJA 1HE8B 3DVLA 3LLMA 3A1UA 4FCTA 1KI6A 4DLSA 2BCGY 5IRCD 1F2TB 3CH5A 4E09A 4JJZA 1D9ZA 1COWA 2CVFA 5C4GB 4ESHA 4F38A 3K1JA 1QG4A 3C16C 3PEUA 2IF0A 1II0A 1KSHA 1E32A 3KX2A 4I1VA 1T8UA 4HZIA 3B5JA 4HAYA 4BLTA 1X8KA 1FX0A 5JWRA 4JVMA 3QKRA 3EIQA 1II9A 1ZAKA 4LC1A 2IBMA 1OKKA 2WJYA 4DIEA 2VL7A 4DJTA 3P4XA 3I5XA 1HY3A 2OLKA 4RZ2A 2XX3A 3D6TB 4HUTA 2VH5R 3AP2A 2FFAA 4DT1B 2V54A 3GJ0A 1X1RA 3SYKA 2OHFA 5JI2E 1CEEA 5FOUA 3TLXA 1SZPA 2A9KA 2JA1A 4NU0A 1O87A 4MRSA 4P4TA 4ZO4A 3WHLA 3CRMA 3QKTA 4RZUA 5KDOA 1SXJA 1KI1A 4JKYA 1G9XA 3TSZA 1AM4D 3ICQB 5DI3A 1UJ2A 1CJMA 1D5CA 2ZSBA 4BZXA 4PHTA 2ZRMA 2G6BA 5E7IA 1T0JB 4UJ3A 5E7JA 1Z08A 2NPFA 2ZETA 2FZLA 4TLAA 1R0ZA 2G88A 4BFXA 3P1JA 1WBBA 4LJYA 2C95A 2WWWA 5AJWA 3TW4A 4WIAA 4EPTA 3M1IA 3QY0A 5B2ZA 2PX0A 4BFVA 3AUYA 4C0LA 3IEUA 5IDVA 4HB0A 4BLOA 2O8EA 2YWGA 1XZQA 4F4IA 2IA5A 2GRJA 4Y0AA 4BFZA 1OB5A 1LVGA 2OEPA 3DPUA 4KI0A 2ZJ5A 3QXJA 2AHOA 3OEEA 4OHXA 4QJ5A 1ONBA 2QQ0A 2FFBA 4AYTA 2IUUA 4PZLA 2Q9CA 2V1UA 1N5IA 2AK2A 1W2GA 1Q12A 2WVJA 1RKBA 3VU9B 2C78A 5E4FA 1XD2A 4BLPA 1GDDA 2E1RA 3TMKA 2AX4A 2FSFA 3RSOA 1RPZA 1KJYA 5EE9A 3G0HA 1VPLA 2V8OA 4P4UA 2REXB 2QZ4A 4CDGA 3WMFA 4PAQA 2O8BB 3LQRA 3VKHA 2PX3A 4B2IA 5AJZA 1NJGA 5E3HA 1G5PA 1ZINA 1W4AA 3NH9A 4BRWA 2I3BA 2AD5A 1EFTA 1R0WA 4EKDA 3D7MA 3K53A 1VG1A 2MMGA 3CLVA 4HZUB 4NYJR 5C46F 3P4YA 5FL7D 1AK2A 1Z06A 5KSYA 2HYIC 2P2LA 4LV5B 1TAGA 1XWIA 3IHLA 4I99A 5JCZA 4AD8A 2NO7A 4JLKA 1HT1E 1YR9A 1ZD9A 2ZI7A 3EC2A 5AUPB 1CRQA 2CNWA 4JVNA 1W7AA 3CR7A 4ZCMA 2B8TA 2ATVA 4UNNA 4OJKA 1FTSA 3Q5EA 2VTKA 3OIYA 3AH8A 5F3WB 3IDQA 3K9LA 3K0FB 3AVPA 2K5UA 2KSQA 4A6PA 5F9FA 2WKQA 1UADA 1XMJA 5D3MB 3SU8A 2Y8EA 3ZS8A 1YR7A 1F2UB 2QM8A 1T9HA 1G7SA 3U3MA 2W58A 3ZVLA 1RC8A 4C2TA 2YOGA 1XJCA 2H8KA 5JRZA 4Q01A 4EFLA 4A8JA 2CLSA 1XCMA 4HLCA 4MGIR 4URVR 3CBQA 3LVRE 1E0JA 1K5GA 3WXMA 4G3XA 5L8VA 3ADDA 4B3BA 2D3WA 2WKRA 1XTSA 4H1VA 1ZM9A 1NKTA 1PUIA 1VHTA 4QM6A 3GJ5A 5EE0A 3OFNA 3B9QA 5EE1A 2RGNA 3E1SA 3RS4A 4E07A 4BQSA 4EAQA 4ZDIA 1CKEA 4IW3B 4FCWA 1YHNA 1R2QA 2V9PA 4TLEA 2CHVA 5CITA 4IRUB 1OB2A 4IDPA 4MUAA 3HP1A 3L82B 4U7DA 2ZPTX 3KJGA 4Q02A 2FSIA 5JHHB 4DSOA 2A30A 2BWJA 1RRFA 3QXSA 4NPHA 3A8TA 1SHKA 3KJHA 1XTIA 4B75A 1LTQA 3UK6A 3IILA 3WMGA 2KE5A 5SZHB 3V4RA 2YOHA 1NG9A 3REFA 1IQPA 2V6IA 2ERYA 3GLIA 3N2EA 3BXZA 1GIAA 1H8ED 3PJRA 2JLSA 4M1MA 2HF9A 3AF1A 3PUYA 3SJZA 3SYNA 2ZI4A 2F9MA 3GLHB 3A1TA 3IGFA 3QEOA 1FTNA 3IIJA 4KFRA 4TMWA 2KJQA 5JJKA 4K8OA 3UG6A 2EYUA 4DSNA 2PT7A 2XTNA 3EASA 4QHSA 2F9LA 4EJSA 2KB0A 1NNEA 1KNXA 3CRVA 2QAGB 1IBRA 1XX6A 2Z43A 2OT3B 3B1YA 2H57A 3A4LA 3B60A 3KZ1E 1ANKA 4MGYR 2C5LA 2Q21A 4Z51A 2DHRA 2CL7X 1TQDA 1G7RA 1U9IC 4TMTA 3LO5A 4NCKA 4RD3A 2OFXA 3GEHA 2ZREA 4Q1AA 4G5QA 1E2LA 1IJEA 2CBZA 2GJKA 3QKSA 4B2LA 1EFHA 2ZJZA 1ZRHA 3LNCA 1VYVA 4GZLA 3GLHE 1LV7A 2IYZA 1XTRA 4R98A 4EPWA 2OM2A 1XXHA 2NGRA 2VO1A 3O8DA 4TTQA 1Z6TA 4DEXA 3GLFA 5TDHA 2P6UA 1KAOA 1R0YA 2FSHA 3OEHD 2GDJA 3UXMA 3LD9A 1DO2A 2WOJA 5SZJA 1DVRA 5CDFE 2F43B 2G0NA 4Q4HB 1P2TA 2XTMA 4WAUA 5GJVC 1E4YA 3HPRA 1LY1A 1FNNA 2GBLC 2OZEA 2NO0A 3DO6A 1Z2AA 2OG2A 1AN0A 1RRGA 2JJ8A 1GL6A 2X77A 5HTKA 1OFIA 2VSXA 3TNFA 1ZNWA 2GETA 1KSFX 3TE6A 3GJXC 4B3CA 2VHTA 1NN5A 3WNBA 2JASA 4NCHA 2R6AA 3W6PA 2QRZA 2XXAB 1E9FA 1R7RA 2HCBA 4YXWD 5AJVB 1P6XA 2WJHA 1C1YA 2HXSA 3D3QA 1CR1A 1X8JA 1I4LD 2CCKA 3AUXA 2ORWA 2IYTA 4P0TA 1JPJA 1OH5A 1YR6A 2F3TA 1BOFA 3KB2A 5AUNB 4OQMA 1FUKA 2C04A 3TGPA 2IEYA 2EFDB 1G4AE 1NBMA 2H18A 2EFCB 4PQFA 4BWYA 3S1AB 3QG1A 3NG1A 3V00A 2RGAA 4DLUA 3SE0A 1KI9A 3W5JA 3UG7A 2PZFA 1DARA 2ZSAA 3R9WA 1KO7A 1T3HA 4A15A 4LHXA 2XB2A 3KKPA 8OHMA 3NWJA 1U90A 1JJVA 4RD0A 3A1VA 4TMXA 1S1CA 1VG8A 3F3YA 3AKYA 2GCPA 1JEEA 4AK9A 1JEDA 3EC1A 1GKUB 5LB2A 4DCVA 2AN9A 3GQBA 3WBKA 2H5EA 2B6HA 4D25A 1JI0A 3H86A 2IYYA 4KCGA 4CW7A 3LWNA 2J59A 3EX7C 2G9NA 3VFDA 4M1WA 3TVTA 2HJGA 2YYZA 3CKLA 1G41A 2DCUA 3CF0A 3MJHA 3QXHA 4I1OA 5FPHA 1EFCA 2IC5A 3NC1C 1AZTA 3TAUA 3VNUA 1KK3A 3U4QB 2ECKA 3LBNA 4HLQB 4LBZA 2FH5B 1R5NA 4M9ZA 2RGCA 3BWDD 1XEXA 1T4GA 4RD1A 2ZRBA 4GPTA 1IN8A 4Q48A 1KHTA 3RSLA 4IOJA 4TYQA 1OXTA 4Q4LA 2WTUA 3B2EA 2GK7A 2E9SA 4FWTA 2F6RA 5CLLA 2ZAMA 4PX9A 4QHTA 2ZUCA 3AVTA 3QBVA 4CEHB 2HLDA 1M2OB 3QPUA 2JIZA 2FFHA 2X1VA 4K81B 3FVQA 1TQ4A 2VSOA 3A4NA 5FPTA 2W6JD 2IHYA 1A4RA 1Q20A 2XJ4A 3KQHA 2YC2C 1E2NA 4KFTA 1KMHA 4GBMA 3SBDA 4XD7A 3HDTA 3E5HA 2QA5A 2XB4A 4ZDJA 1PLJA 3RS3A 2A5DA 3VX3A 1N6IA 1QZXA 2C98A 4B71A 4BUJA 3L0IB 3TQCA 3GJ8A 3T35A 4DSTA 3PEVA 4Q47A 5DN6D 2N46A 3EWAA 4S2EA 5KSOA 3K0SA 4FMCB 2ZU0C 1CS4C 2XSZA 1W0KD 4ERNA 2GJSA 4Q7MB 4G5SA 2O8FA 1X6VA 2F1IA 5B64A 2OUKA 4RCYA 1Z8FA 2CE7A 4K46A 1DEKA 3L8YA 1KI2A 3Q7QA 1ZVQA 3BFXA 3KJIA 1ZUNB 4M4SA 2VHCA 3PV0A 3THWA 3K9HA 4AYXA 5EP4A 5F2EA 1TADA 1ZCBA 1Y3AA 1AGPA 1OIVA 2WPDA 4EFMA 1OFUX 1E9BA 1ZCAA 1COWD 1E2FA 5M04A 1O3YA 3SN6A 1XMSA 2ZYUX 5EE5B 3VR6A 4JYCA 2QI9C 4I81A 4XH9B 2GZAA 3SS8A 2WJVA 5KPJA 2GJAA 5B30A 3LH5A 4EQ6B 2Z6VA 4EPVA 3X1WA 4B6FA 2OO7A 1OKKD 1SVKA 2KBFA 3UKDA 1OHHA 3JZMA 1L2TA 1JR3A 1GL9B 4B73A 4HLUA 4NYJQ 4PO8A 4KFUA 2P6NA 4QOSA 4AKIA 3IPYA 3BGWA 3GFTA 1NKSA 3LY5A 3SJBA 3V4FA 4IXMA 1NJFA 2ZYTX 5G3YA 5FH9A 3FHTA 4HATA 1WBDA 4WBSA 4Q9LA 5FUXA 3NKVA 1CP2A 1R10A 1QHNA 3NBFA 3RWOA 1BO6A 4XWKA 1SXJD 4AKEA 2R2AA 3W8NA 1P5ZB 2PJZA 3UMFA 1KY2A 1BH2A 4C0SA 2J45A 2QP3A 4HAXA 4XSGA 4POAA 1SXJC 2PMDA 2ODWA 4PC2A 4DUGA 2IYUA 2VSFA 2FOLA 4DBLC 5IHPA 2IS6A 4HAVA 2ORIA 2C8VA 2QGNA 4BFSA 1Z6AA 1CRPA 4NBSA 1HURA 1KJZA 3N70A 1E79A 1N6RA 3CO5A 2PEZA 2IWRA 1FX0B 5DISB 1IOZA 1SHZA 4LOAA 1NSTA 3BFVA 1MABA 2J5XA 3OEED 4RFSA 1HE1C 2WHXA 3WNCA 3Q72A 4HB2A 4OK5A 4EUNA 1Z5ZA 1TU3A 2IEZA 3OF5A 3DM9B 4E5UA 1UAAA 2QN6A 3DM5A 3LFUA 1B23P 4PC7A 4DLZA 3I73A 4LWZA 1L4YA 5FOTA 4D0LB 5P21A 2BKUA 1AQUA 4Q18A 2WICA 1IXRC 3MLEA 1JALA 1Q44A 1MO3A 2B8WA 4Z8XA 5FUWA 5C2JB 2VF7A 4O2LA 4FMDF 3F5FA 4N0DA 4W5HA 2HUPA 5FOXA 3M6AA 3M0EA 4D80A 2FN4A 1P7CA 1FP7A 4A9AA 1FL9A 2JLVA 2LWIA 1Z0DA 1EXMA 1P4SA 1QRAA 4GNKA 1SGWA 1W49A 4ZI2A 1KYIA 4ZIRA 3RDPA 1RRPA 1IM2A 2YNMA 3FOZA 3FB4A 5BN3A 721PA 5FOVA 1XU4A 1G8GA 4OQNA 1L8QA 1OF1A 1VDZA 3BC1A 4KAXA 3GJ7A 2ZS9A 3VHLB 2O8EB 5C1BA 1HTWA 2CNWD 4IOKA 2ZJOA 1W47A 4LJ7A 1T5IA 2J1LA 1CJTC 3BOSA 3ETLA 3TJZA 1IY1A 2B7BA 2R62A 2R6DA 3ZD6A 3AF2A 4JZKA 1N0WA 4TTRA 2WSMA 2PZEA 1XD2B 5GJWC 4PQYA 2ZR0A 1SXJE 4QBFA 2VLIA 2WIBA 5GJCA 2V6JA 4QM7A 3SFZA 5DYIA 4TWZA 3LBHA 2DWOA 4HB3A 1VHLA 3AVQA 4TZ6A 1QVAA 4U5XA 3RS7A 4F93B 3JVUA 3NEJA 3I92A 2BBOA 4B76A 1W0JA 4BZQA 4A8JC 1VYTA 3OFND 3EPJA 4QGFA 3CPEA 3RVBA 4AY2A 3WMEA 3CW2A 2CJWB 3L8ZA 3GFPA 4TL9A 2DB3A 1XMIA 4PPFA 2IYWA 2RGNC 2JDIA 4QKQA 1P2SA 4F92B 1I2DA 1E0AA 4RVCA 3THYA 5J4LA 1ZC3A 5DSZA 2BBTA 3EZ7A 1DAEA 2JLQA 4B3DA 1YE8A 1M1YE 3B85A 2PZGA 2EQBA 2ANCA 2V55B 4JS0A 4W7SA 2XTZA 1VIAA 2IXEA 4GOJA 4URZR 4N1AA 2BHRA 3DMNA 1VCNA 1TQ2A 3BH0A 2QP4A 3P32A 4BEJA 2OCYC 1KK1A 4JLMA 1ZUHA 4OJQA 5A0FA 2D7CA 2A5FA 2W0MA 1CXZA 1G8FA 2A3RA 1SKYE 4P4SA 1DAFA 1P9WA 4C2UA 2VPPA 4ARZB 5FR2A
chains in the Genus database with same CATH superfamily
4WLNA 1A8HA 3R7WA 3KQYA 3MGCA 4BP1A 4B3IA 5K0GA 1PSWA 2EKBA 1WETA 1P6QA 2DFVA 3ZWXA 1PI3A 4NYIR 3U48A 3PENA 2Y4NA 3AU9A 3OECA 1U2PA 1LB1B 1MO4A 5TLSA 4Q4AA 4TVBA 5C81A 2I6UA 4HNUA 1VSUA 5BN1A 4MQ6A 3TKLA 3M3PA 4EGSA 4DV5B 2F48A 3PI6A 4BO1A 4EW3A 1WB9A 4D5GA 1U4SA 2PMFA 1WXIA 4EJSC 2VXYA 1A76A 4P2GA 1KH1A 2C31A 4RANA 4N3GA 5IYZF 4F4UA 2Z4TA 3KS9A 1OTHA 3HJGA 3I2IA 4BB6A 4LBWA 4BZWA 3IIEA 3H2ZA 4G9EA 1X42A 2XTJA 2W70A 1EQUA 4P7JA 5EPOA 4BLUA 2RGEA 1J0EA 3D1JA 3LFHA 4AMBA 4A73A 1L5VA 2R00C 3GBVA 4X71A 4DUYB 4H1WA 4JOCA 1U7PA 4Z0PA 2O1SA 3B38A 4R9UC 2C5HA 1UK6A 3IBYA 4OJMX 2YZ2A 4IZHA 3UHPA 1YZLA 4P7BA 3KXIA 2C4TA 4Q1DA 5JJLA 4R8RA 1R50A 4MNTA 5M34A 3RIGA 2VPTA 3GDWA 4QD3A 4XWGA 5DNYB 2X0KA 5HTOA 2BGLA 1KP3A 1TCVA 1Y9EA 2V7BA 4KIWA 4U3JB 1JDTA 5H83A 2CSXA 5ADVA 1ZLYA 4NNOA 2FPPB 4OO3A 1JL3A 3VOAA 2P3OA 1ICIA 5L3QA 3OIVA 4QQFA 4OHKA 3K0SA 4YTEA 1FE8A 2QTVB 2G77B 4UOEA 4PXAA 1PJBA 4WDQA 1E69A 1HDZA 3DKVA 1EB8A 1Y1KE 2R5FA 2VAVA 2YRXA 4M0LA 4XCXA 1E1RA 3EPKA 1FVHA 5FFFA 5TX7A 5J4HA 4QJBA 1RWKA 2Q0HA 1PFVA 2UZ1B 1RJGA 1U99A 1HL3A 4YRKA 5ARCA 3E84A 4LJ5A 2BCJQ 4HUQB 4Q3EA 1Q1NA 3PFCA 2DR3A 1US8A 2EW8A 1PJTA 1PFWA 1FQKA 2F1RA 2GPWA 4G09A 4R71A 2OSBA 4WY2A 4X20A 5BWLA 4BX2A 4RVFA 4BEBA 1GA4A 3SHOA 2B9EA 3VM6A 3I62A 4WLOA 1BA3A 4ACBA 5T3UA 4LI3X 2ARKA 5IJ0B 4MXDA 1QAOA 4HAWA 4BV8A 4HQ0A 1UBMS 4S0XA 2W2VA 1H6CA 4P5EA 4UHBA 3I1IA 4FLFA 1QS0A 3SC4A 1A9OA 3KWFA 4PIPA 4HWSA 3TPZA 4AURA 5ITWA 1MOPA 2IH4A 1RJ9A 2BFWA 3PXUA 4HMOA 2X4GA 2XH8A 2X3FA 3GMSA 1W4RA 3UFXB 2V6MA 4IZ6A 4J0JA 1D6MA 3R40A 4X1OA 2HEIA 1NOIA 3I37X 3AVYA 5H82A 4GR9A 4IILA 1Q0HA 2RD2A 3B51X 1NX9A 3S2YA 5CLJA 3F8SA 3MJRA 5CU7A 3WYAA 3PGVA 5A5DA 2WG2A 3LG2A 3C15C 1U7OA 2B36A 3BG5A 2ZUBA 1ZOLA 4OP3A 4WA8A 1LDYA 2RCNA 1PBTA 3DS8A 3UANA 3FSJX 5J58A 4NK5A 5A03A 1UCFA 2BSXA 1UFRA 3D4LA 5A3RA 5TQ2A 2HA2A 1ATIA 4DTIA 1FU7A 4FFWA 4K6CA 1MJHA 4H1HA 3A31A 4RL6A 4ZK6A 1Z26A 5JXIA 1IC6A 1AKYA 4BVGA 3K71B 3Q3GE 4AKGA 1QPBA 4IDNA 4R1OA 4XE5A 5LD2C 3LL4A 2QLLA 3N7TA 3CZAA 2R6CA 2JZOA 1W35A 4WJKB 2FJPA 3ZJ5A 2QUHA 3R9KA 2DHQA 1J49A 4N5HX 3QVXA 2OTCA 3FMIA 4KYVA 2W0SA 4EB6B 3WRXA 4PPNA 1H85A 1Z4QA 1SUFA 2ESRA 1XHEA 2X8JB 5BSMA 3ZNPA 3WLAA 4M0CA 2ZI3A 2ZSEA 4EJMA 4Q1VA 4GI5A 1DWQA 2HA4A 3KBBA 5LQSA 4MUBA 5BV7A 1BRTA 1CUSA 1DC7A 4TUYA 5EJMA 2IY9A 5CH5A 5A02A 2IYFA 3NVMB 5AKLA 1KPIA 3BDAA 3CF2A 4ILEA 1M75A 2G83A 2WSSA 1KA9H 1N2EA 1RQGA 3NTUA 1QCYA 1DIOB 1DINA 1V7PC 3O84A 3TLMA 2C03A 1K63A 4OHOA 3WB0A 3B1VA 4YY3B 2H65A 2HBZA 3E9NA 4BBZA 1ZJWA 4NOJA 1ZVKA 3KKNA 1NWHA 4Q1BA 1L7BA 2RONA 5AXAA 3E18A 3KDAA 4BU1A 3HVRA 3UCEA 1F0YA 2YZGA 2P2ZA 4J0QA 5EZ5A 3VR1A 2P4HX 7MDHA 5KWEA 4MS3B 1Z2OX 1N4AA 4CFSA 3HEMA 2O8CA 1N6KA 4QUEA 2NSJA 3RC9A 3ZHXA 3EA4A 4YJ3B 5FULA 2XYRA 5FPYA 4CQMA 5L4SA 2ODBA 5JSZA 1JIIA 1ONSA 2NPOA 5LYJF 2R44A 1Z83A 1JU4A 2AFVA 3IX7A 2ABWA 3UXYA 2OL4A 1G19A 2CLHB 3F47A 2LD4A 3C3KA 2YJGA 4MQBA 1NBME 1ZM7A 3SKYA 4B8YA 2J87A 3FFTA 4QREA 4BN4A 3LUFA 3NW9A 4L02A 4AMVA 2IK8A 3AVWA 3AKCA 3U80A 4JLSA 3UK1A 4J3NA 2AWNA 4IR7A 4ND8A 2WUDA 1SUBA 4DV6B 1SXGA 1QRRA 3OWOA 3N87A 4OGFA 1UKVY 4OP1A 2FG7C 1RI3A 4XM1A 3VNQA 4CUKA 4LE1A 4B0PA 4QARA 2FK7A 4YMTA 4II2A 2D0OB 5AVRA 2VH2A 2YXEA 3N07A 1KWKA 1JXMA 4A10A 4Z86A 1U63A 1V8PA 4QODA 1DTWB 4KL8S 1PFQA 4ESOA 3KSUA 2WZQA 1J07A 1QKJA 1P60A 4XWAA 3BSSA 5CA0F 2HSDA 1Q0RA 5HCUA 4LF7B 1CETA 1EUCB 4AG3A 2IXGA 5KWJA 1G2IA 3RUFA 3N3AC 3IP8A 5EKUA 3QI2A 1Q22A 3EGEA 2C5SA 4NOMA 1TUBB 3BDVA 2I91A 1Y37A 4XOUA 3VR2A 5AVZA 1LK5A 3BJMA 3OQ6A 3WK6A 1RP7A 1UJ5A 2PYDA 5F21A 4QLAA 5REQA 2QGZA 3CX4A 3U17A 5JSYA 3H83A 3K2EA 5FBLB 1RMTA 5IASA 4FE4A 1SHJA 1OREA 3ZE1B 3TIFA 4ZVUA 5HFAA 5T67A 1RRCA 4UMDA 3MMNA 4PPYA 4RFSB 2ISSD 3LUAA 2PIDA 2W90A 1W2WB 2YMMA 4EKNB 1T5BA 4KGVA 1XLTC 1TQ8A 4ZI7B 2G71A 2JEOA 3PL5A 1HT2E 4HLUC 4TWJA 4BPBA 2J30A 1U7UA 1RQPA 2PD3A 2W11A 3MLBA 4LX0A 1IAVA 5EN4A 3K70C 3U1BA 2J9FB 4BRSA 2ZJ2A 4PLCA 1IG0A 3NRJA 4H7JA 3ZV4A 1B0ZA 1MQAA 1OAAA 4MWBA 4D8XA 4FHEA 3H2YA 3MS7A 4H4EA 3LK7A 3SIRA 3HGQA 4CLDA 3T5GA 1UBUS 2B2XA 3UXHA 4YR9A 1E4OA 5D5PA 5DI9A 4ZDWA 2NUTB 4QAJA 4DUGD 1G6KA 1RJWA 1Z88A 4EY7A 3PPXA 1VKRA 3MAGA 4R1NA 3UK0A 1FDSA 2FEOA 5LPNA 5FO1A 5AR1A 1YU6A 1LLFA 1C0EA 1PKXA 2HHJA 3P9QA 1YOVA 4FWIB 4ARAA 4B35A 5BORA 3LQFA 3BD9A 1WO8A 3FBGA 3JWEA 4D3SA 1KMMA 3NTVA 4Z1MA 3UAVA 4WCFC 2YJTD 2A2ZA 3W5HA 4JJGA 3ZQKA 1A9PA 3DLAA 3TR5A 1QM5A 5AW7A 2Z8XA 4QA9A 5DLDA 1EA5A 5JZOA 2YDYA 2BEJA 3ET5A 3OUUA 2MYPA 1P3JA 2WHEA 1X87A 3B9BA 3KU1A 3URMA 2IXTA 1NQOA 2WFLB 1GUBA 4J29A 4MIOA 5I7AA 5BYJA 2XT9A 1OXUA 4YRTA 1QBGA 3PXGA 3UK2A 1YR8A 5TC4A 3UMMA 2DPXA 4OP2A 3DZ8A 4EHNA 4JT4A 3TLZA 3STVA 1QFMA 1JT2A 3A70A 3VNBA 5DHAA 5KYUB 3MSXA 4EB0A 1HX7A 3CRQA 2NTNA 2AXPA 2B37A 3KQVA 5ULLA 4JC0A 4FCCA 3RS5A 3EXHC 3B3GA 1MT0A 2P1RA 5AXDA 3EGCA 3USES 1GL3A 2H7CA 1R27A 4H59A 4YGXB 4ZPXA 1K7EB 4MR8A 1EZ1A 2F4NA 3B6EA 3JYLA 2OC4A 2AVDA 3LL7A 1V1JA 1QV7A 1Y8AA 2WE7A 3NPMA 1GU0A 2D62A 1BS2A 2PZBA 3NEPX 1JAZA 3DDCA 3LLSA 3OUZA 4PSVA 1Z4OA 3B70A 3OZEA 1P91A 1WCV1 1AS2A 1B3RA 4P7FA 5FOQA 1AKMA 4GPBA 5KOHB 4GU5A 4WCFB 1JKJA 2C8JA 3EPRA 4K6MA 3LYAA 3BWVA 2GYYA 3KD2A 4GSYA 2C5GA 1F5NA 4M53A 4U7WA 4EMUA 5CT4A 5CA1B 1J39A 2VDWB 4BY9E 1U9ZA 5IVPA 2YUIA 1NNLA 4M2LA 3PNYA 1FXUA 3RUPA 1PHPA 4HD8A 2BJWA 2JIBA 1Q0UA 4KLZA 4NCNA 4NJMB 3MVEA 3W6UA 4P4LA 4UEWA 2X6TA 1NFFA 1XDBA 1QE0A 1DXYA 2CMHA 1AT1A 2OB1A 2Z4RA 3K2BA 3JTMA 2YASA 1RQLA 4U2DA 1M34B 3V2UA 5JXGA 4NYIQ 4G81A 1KWGA 3SHVA 1C0PA 4GMGA 3SX2A 4CKEA 2ONCA 3V1YA 2SKEA 3NV7A 4HNAB 2GFIA 3A37A 2ERXA 4N3NA 1KP9A 2YHBA 3O8OB 5C5CA 3DQPA 4JEIA 4YREA 2CNLA 2CHEA 4LDZA 3TBKA 1T5TA 5HG0A 4OA8A 2RHDA 2GCOB 1OIWA 3EFBA 3QRWA 1TNDA 1Z8DA 1AUOA 3W2IA 4R2HA 2FF7A 4HDCA 2FWAA 3BD7A 1M2VA 3S27A 1NGSA 3U2QA 3T9CA 4MUMA 4CV1A 3LWDA 5JD5A 4NI5A 2JF0A 4KIUA 1U2RA 1LA2A 3A6LA 3EY9A 4EG8A 2SCUB 1E5DA 2XB6A 4MZXA 1UEIA 2ZJ4A 1SVMA 4ETWA 1Z3IX 2A14A 4B0OA 3GJSA 2OM6A 2QPAA 4NCXA 3D59A 1Z8HA 1XALA 4UCWA 3L8MA 5AVSA 1VI6A 3JVIA 2YW9A 2WSLA 1NXXA 4H18A 2C4VA 3GLQA 4R9RA 2FKNA 2BV3A 3D3WA 1MC8A 1K3TA 1ODJA 3HCFA 3R4VA 4D56A 2OXCA 1MVLA 2ON6A 3P19A 5JNSA 4EWLA 2NP6A 2CSUA 3E05A 1UBCA 4LGMA 4GKJB 3QJGA 5LOVF 1GPMA 3WC4A 2EWVA 5JZ9A 1SCBA 1YOBA 3KOUA 3G13A 3B9RA 4HDSB 2RGXA 4YI3A 5A6SB 1U2ZA 5F64A 3ZGXA 4BUZA 4ZZ3A 2VTVA 2F3RA 3FPAA 5C8YA 3SJ7A 1NFQA 4ZZ2A 5ALYA 1QDEA 5F3DA 3PRHA 2EJUA 5BY2A 1KOFA 1E2DA 3AEXA 1C3OA 1AVTA 3I64A 3EXG2 5KI6A 4PNEA 5KCZA 3PHLA 1S9DA 2GXQA 1YNSA 4NP6A 1G5RA 4KPYA 2XCIA 3V7FA 1UFQA 2VA8A 4M9RA 3HSSA 1QF9A 4MW9A 4RA6A 1ZN7A 4Y1GA 4YNBA 4ZYXA 3ER8A 3F90A 2FN3A 4J91A 2V59A 4M6WA 4QDXA 2E82A 4U39A 2BEWA 4BJ6A 2FN8A 4E21A 4YUXA 2JGKA 5EXPA 2VDKB 1A2QA 3GLHA 3ZE0B 5AM2A 1GPNA 2VRBA 3NJ8A 2R6JA 4A92A 2QIOA 4EOGA 3CGGA 1T8YA 2XLCA 3ESQA 4TXHA 1BVUA 2BZSA 2WU4A 3E1GA 4CU5A 5TXGA 2D7JA 4WVLA 3TVYA 1VECA 3H42B 1DPFA 2AJBA 1Y98A 2J9GA 4WSOA 5HGJA 5DNEA 3WJ1A 4EG7A 1SIWA 1JLHA 1K0UA 1FQJA 2QAGA 2XDQB 3KSDO 4FFOA 5CURA 1O94C 3DZCA 3Q3IA 1NF3A 4QATA 5CIQA 2R8ZA 2DBQA 4IG9A 2HMTA 3LRPA 4JP2A 2GM4A 4RZQA 2CF5A 4B44A 3ZD8A 1ZBQA 1HV8A 3JPWA 2A1UB 4HX2A 4U7JA 2JATA 5GM2A 4N9WA 1V95A 4EP1A 3M33A 1CJCA 2A33A 3IHKA 2EQAA 3KTDA 1GKKA 1TM5E 4NPAA 4CT5A 2X9QA 3H9EO 4DB2A 5DHSA 2C4NA 3FR8A 1E5TA 2XQJA 4AKEA 2BOVA 4PANA 5DBHX 3EEOA 1YKFA 1QPZA 3B78A 1EVZA 4QUDA 4TOIA 5FUYA 2ZTUA 2YIJA 3CLTD 4KQFA 4RXMA 2HJSA 5FWXA 4DC9A 2V5AA 3OT4A 2VNKA 4ZAGA 3DLHA 2A1TR 1FVFA 1QQBA 3FHLA 3O1LA 3JQBC 5JV5A 5HA5A 4GDFA 3MA0A 2WUVA 4ITVA 2NAFA 4GSLA 1GCAA 1P1KA 1QR2A 2B5VA 3AR4A 1NMSA 2WBLC 3WL8A 6Q21A 2JCYA 3UJNA 1JIKA 2ZSHA 1LBIA 4IG4A 4K6KA 4UFOA 3U6BA 4RTNA 2YV1A 4Q37A 2P65A 2Y1KA 3WL4A 3SQOA 3X44A 1X1AA 3CH4B 3ESXA 3FGZA 2A94A 1H66A 2NUAB 3VO8A 2V7QA 1O96B 1YZYA 4JJ4A 2R96A 5IT4A 1G3MA 3G0BA 1DO8A 2ZSJA 3K8YA 3NTQA 1T1GA 5K0BA 1QAMA 3O4VA 4NENB 4PU0A 5C4IA 2AZMA 4MWEA 2QX4A 3RYHB 4EVSA 2FPXA 3BXPA 4E51A 3W7VA 2XXAA 5CXXA 4NMWA 3JW8A 4OHYA 4R83A 2PLRA 2VXCA 1GCIA 4HAIA 3L4BA 4LZZA 1KIMA 4B46A 3R24A 1N6PA 2VDNB 5FWYA 2UZ0A 3O73A 1LI4A 1Z0FA 2XAAA 3I0ZA 2DU8A 3WSVA 5AW6A 1NM5C 4QYXA 5LFAA 3PPVA 2MTBA 4ZCRA 4F0JA 3FD8A 2PMCA 2D1QA 2V45A 3FPGA 4TQUS 1VRVA 2Q5JA 3UJHA 3EXHA 4JLOA 4DILA 4BU0A 4U2KA 1E6KA 1ORDA 3IELA 2Z4SA 2YWBA 1G18A 3ETHA 1WS6A 1A1VA 3W1EA 2YRFA 2QZSA 1SXJB 1M6VB 3MG9A 4WUTA 3UAOA 1NYRA 3V8QA 2I7TA 4F04A 4ENPA 4LSMA 3O2SB 1R9JA 5KYYA 1KIFA 2DRIA 3CVOA 2RHRA 1VKZA 2WG1A 1C30B 3K72B 4DZZA 5IVHA 1IG3A 3WIUA 1INLA 2W98A 3H19A 1HMPA 4ALNA 4LSWA 3IEVA 2FSUA 1UIMA 4GE3A 4WWHA 4JI5B 3UJ3X 3IUEA 1UODA 3Q7PA 1PEAA 4WADA 2V98A 2Z5LA 3I4FA 1M33A 3N0RA 4I4CA 1UT8A 1PIWA 2W2LD 1ENZA 1YUNA 2YWFA 3BXXA 3OZUA 3L7CA 4YECA 1NI4A 2YBDA 2FN7A 3TRFA 4DBZA 2P9GA 2PUCA 4H35A 1Z36A 2ID9A 3HO8A 4RTQA 3G82C 4LHVA 5K0TA 1YF3A 3TUZC 1J8MF 1P80A 2BFEA 3H1GA 5G1PA 3DB1A 2VPWA 2ZM5A 3H2JA 1YQUA 4RSRA 2QMUA 1T0UA 2PGOA 3WGIA 2REBA 1RXVA 2VRWA 4EYSA 1EFRA 1UT6A 4QPNA 2FWBA 3DOOA 4RVUA 3ZE7A 4YP6A 1R37A 4WNIA 1GZUA 1KSJA 1NW8A 1LQTA 1QH8B 4K1LA 4PWZA 5M3BA 3SM3A 1H65A 3THRA 3TM5A 3DF9A 2EFHB 2Y76A 2ZJ6A 4CN8A 3HY3A 5DNWA 2C2KA 3ZE9A 4UUBA 4DDMA 3LT1A 1FLAA 1Z34A 3U7GA 3JQ8A 2GXSA 4AF7A 2XMBA 4BNVA 3HCAA 2CL6X 3M1YA 3ZH2A 3EA5A 1H9BA 4J49A 1YB6A 1RBZA 1V1MB 1RCUA 3G8AA 4RJJA 3A6GA 4CCYB 5IYZB 1S2DA 2FK8A 2FQ1A 4MPDA 3AT1A 1AIPA 1S8FA 4GD3Q 1FSZA 1ONNA 2PPVA 2FR0A 1FLVA 1XZCA 1GYRA 3AEKA 4OSEA 3Q2IA 3EQZA 5CJJA 3W0LB 3NVAA 2G28A 4V3CA 3H8JA 3NHKA 1L8OA 3EUAA 2QMHA 4D6PA 4DA6A 2H1SA 2QMEA 2V7PA 2VXOA 3A1NA 3JSXA 5K3OA 1TAUA 3T3MB 2VATA 4YK7A 1FYFA 1EP2B 4HR7A 4GLBA 4OGKA 3ESAA 4E14A 2H5IA 4F85A 3OIUA 4ZEMA 2P5YA 4RHTA 4NU8X 2WWFA 1Z6YA 4WHMA 5A3QA 3N9IA 5KO2A 4JYAB 3GVXA 4OHVA 5CNMA 2OYRA 2IOHA 5FI0B 1QVRA 4FDAA 4G0OA 2D0PB 5LWHA 2WWHA 1UMCA 3ADKA 5J40A 1L5KA 4FN5A 3F7MA 1VKJA 1GYPA 1JWAB 4A5SA 1Q0ZA 4CI0B 1Q14A 1BH6A 2P91A 1EWRA 3IAUA 3LS2A 3TUJC 5IAKA 4GXRA 1PUJA 4UHEA 3UC9A 3RAFC 3WGGA 3EH2A 1DDIA 2MWMA 3ZV7A 5CFRA 3AC0A 5B58T 1DP4A 1WXWA 3GIDA 4A8JB 1G38A 5FO0A 4OLFA 5CT5A 3OZXA 4QQ8A 2HREA 3V55A 4LV8B 1KETA 3A0UA 1KR2A 4RYDA 2OQ2A 3NXSA 3VKGA 2VZ8A 2VQFB 4L08A 4A5OA 5HKBA 1CZOA 3CNEA 5K03A 2ZKIA 1GU7A 4KE8A 1LVUA 2CLCX 2CK3D 4KUEA 2OZLB 4JI3B 1E61A 3GT7A 3GJ3A 3Q9UA 4B7ZA 1HLGA 4YV1A 1LNZA 3P4UA 4C0BA 2J8ZA 2VHUA 4HS9A 4JOBA 4RS4A 3HJRA 2P3SA 2ODEA 1DKMA 3FOWA 2RHLA 4NTZA 4L27A 2QLTA 2PZ8A 4AUMA 1B4DA 1Y80A 4QVKA 5JISA 3GUUA 3V8BA 4D8VA 1KJQA 3UQZA 5AI9A 5FI1B 4YMLA 3GX1A 1R5OA 2GEFA 3PPWA 1ENOA 1EX1A 3M3DA 2OOSA 4JB8A 5L6MB 3OBIA 2ZITA 4C0HA 1ZR4A 1PQWA 2N3ZA 5J63A 5A4JA 2BT4A 1X0XA 1XZKA 3FCOA 3RVPA 3AUFA 2OFPA 1Q1BA 2I7CA 4D81A 4ENSA 3DVSX 2JI9A 2O3JA 5H68A 3B2NA 1CB0A 1CJSA 1JU9A 1EFPA 4NS1A 3G49A 4W9NC 4YAGA 2IXFA 1BDBA 1DUVG 1GNPA 1TL7C 3NHUA 5JNWA 3JQPA 4E5DA 3GLIB 1R15A 3NC4A 4KR0A 1O9HA 3SSOA 3HXTA 4MYDA 3UH1A 1OTYA 5J3JA 5K4AA 1Q1EA 5LQDA 3CT6A 4IV8A 2F3UA 1UQUA 4NRDA 3UV7A 1N1GA 2D74A 1XQXA 4L57A 5ICGA 2CXXA 3FPJA 1GHTA 2AC2A 4OMUA 5C80A 3U9SA 4IQGA 1K5HA 1Z25A 4TKMA 1YCFA 3EG5A 3BREA 4TUYF 1GPYA 3IR5A 4M9QA 3RIHA 5CIYA 1W6UA 4QPDA 1EFVA 2AH5A 2QYOA 2HF2A 1DV2A 3GOQA 3HBLA 5KZMB 2JVJA 1X92A 4ER0A 1K0FA 4Z53A 3JVDA 4M9SA 2XMDA 4IDQA 5CLQA 4QJ3A 1ND6A 2PHZA 2ASEA 1AO3A 1RYFA 4HTFA 2BRUA 2C3UA 4I50F 4PZYA 1FPQA 4DMLA 4YA6A 2RHWA 4UASA 3EK2A 4CL2A 2O06A 4HGQA 3DNFA 1T8RA 2QIPA 1JG6A 3KYJB 3FPSA 4GM4A 4KE6A 3W5IA 4C4TA 1Y9ZA 4C21A 1L7VC 4OU5A 5LM3A 2R48A 3PFNA 3G2PA 2JHPA 3QU5A 3KFVA 1JKMA 4JX8A 1ID1A 2WMOB 3VPDA 1NBOA 1IM5A 1GPWB 1S9HA 1VBNA 5AHKA 3FRHA 3I9NA 2ZDGA 1LRJA 5G2OA 1EKXA 1U2DC 3PQDA 2J0EA 1B0UA 2NXNA 1TM7E 5JFGA 3TZCA 2RHHA 4R9SA 2ZYGA 2E55A 4JEHA 3I45A 5E8RA 5ALHA 3VKWA 1KDRA 3O82A 1UMBA 3OTWA 4M60A 3T4UA 3ELWA 3GP3A 3NM5A 4YMUA 1RWPA 1PEDA 4H7DA 2O19A 3H1PA 3MC1A 4KX5A 3GLFB 1VJ0A 3AEQB 1RLUA 3BX1A 1THMA 1H6DA 1K75A 1KFCB 4IH1A 4MCJA 4R8VA 2OXIA 3RUHA 3GB9A 4BRUA 2XVXA 2YZKA 1HKHA 1TKCA 4IM7A 2PBRA 4RK7A 3ANXA 4X8HA 2B6NA 4BVBA 3AOEC 4BFUA 1AGXA 3G1UA 2O0KA 4M8KA 2CUTA 1XWWA 2XUQA 3QWHA 1PT8A 3U3DA 4BMZA 5JCXA 5K99A 1XNQB 2MIIA 5LYJB 4TN1A 5BSWA 1IVYA 2OQVA 4ABTA 4ZGWA 4ICIA 1DELA 1RIFA 3P27A 4NBNA 3T54A 2H1OA 1O58A 3LT2A 1SH7A 1DPGA 2PL1A 2AUMA 1RCFA 3CX3A 3H65A 5JD4A 1VE9A 4P33A 2Q50A 2NZ2A 4FD2A 1PWHA 3PFWO 3TL3A 4DANA 2I9PA 3B48A 4GVXA 4QU0A 1FK8A 1O54A 2M2IA 2W2MA 3FPFA 4QEDA 3S68A 3MWDA 5CEFA 1GEGA 2TMKA 3DMRA 3FKSD 3QU7A 1D1PA 5HJ7A 4YAIA 2XGSA 2ZE8A 2BUCA 1KVQA 2GBCA 2JJ2A 4KFSA 5CA0B 7ADHA 2QRKA 4XGKA 5HHTA 4HPWA 3O6VA 1HKUA 1XHFA 1ZY2A 2QLNA 2IP2A 1OFTA 2JFNA 3TQTA 2BE7A 1FW6A 2GEUA 1MPXA 3PYMA 4DCSA 1NZDA 1LK0A 2CGEA 3LECA 3NUGA 5FUVA 4C2BA 2X76A 4JLDA 4E3ZA 3H0KA 1GSHA 4IIFA 1JSXA 4Q7EA 1XV5A 2ZGVA 3JWJA 5HILA 3TW6A 5M5BA 2FSPA 4NH0A 5GGXA 2PZLA 2ZJFA 3NFRA 3N2GA 1G5IA 3SKXA 3SZGA 2Q4BA 3Q6MA 1V11B 3BQMB 3HXQA 3ET4A 4IVRA 3GDHA 1WSWA 2ZAIA 3PJFA 1M66A 4JGGA 5FUBA 3ZKWB 3LT5A 4LZAA 3FM9A 4NZMA 2EKLA 3IBSA 1BYUA 1DL5A 3T7JA 1U0LA 3AL0C 1DGQA 1QIGA 3H16A 4BNWA 2YJNA 1J23A 3L0OA 2DQKA 3QJYA 4NESA 2C2GA 1RHQA 3CUUA 3SGLA 2VCEA 4ER7A 4D9GA 2QVXX 2QHXA 3KPYA 5CDSA 1KH2A 5AYVA 3NBKA 2MINA 3K35A 1SMKA 3ELDA 4HK4A 1B8PA 4B3FX 3H9BA 4IOLA 2PLNA 2LRHA 1K8QA 5A62A 3VI3B 4AROA 4LXQA 2GCNA 3QX8A 4G26A 4RE6A 1R0SA 4EELA 5BWMA 4CRWB 4FVTA 4MYHA 5AW2A 3Q8XB 4M89A 4IH4A 1JIJA 1NPDA 2HAEA 4FDUA 1T8TA 2X8AA 3CLKA 4LJ6A 3RKRA 3AM5A 3ETEA 4TKUB 5CPFA 3NIBA 4R2XA 2YOFA 3PWSA 2W6IA 3E22A 3PUJA 4A2PA 5K20A 3EEQA 1L7OA 1F7UA 1YJBA 1Q1ZA 4Y2PA 4B6SA 3DXYA 5LR6A 5FHQA 1ODCA 3NU1A 1S3GA 1UDXA 2R5WA 3NYIA 3BE4A 3BH7A 3QVUA 5B6PA 4GUAA 5BXQC 4BGDA 4MRPA 5ALPA 3GNQA 1GPJA 1J5EB 3FFAA 4IXDA 5CLFA 3PZBA 5I7EA 4Q0MA 3KQKA 5LJIA 4D3ZA 2PVSA 4DIDA 1U0JA 3GP5A 3QXXA 4CM8B 3F6CA 3ONFA 4J16C 3BMCB 4Z4GA 4TQAA 1EXVA 3FVVA 5HM8A 1R6DA 5C34B 1A72A 5GZ6A 4MRVA 2QBYB 1JB1A 4Q19A 2GM3A 1WEHA 2FMKA 2QNRA 4Q82A 1P5RA 2ZS8A 5CFNA 3RAPR 1KGSA 7ABPA 3AF4A 3ENNA 1C7QA 2XZPA 3A26A 3UUFA 3JZIA 4G8DA 3EOAI 1WBJB 3OLWA 4JA0A 2ATXA 3IQFA 1I24A 3QF7A 1JQLB 3VZSA 2ST1A 1C50A 4IKEA 5A7GA 2H4WA 3WWPA 4I4TA 1E9DA 2O8FB 1LW6E 1NY6A 3K0KA 4TV9B 1KYZA 1G1AA 3WKEA 1E1QA 3QNMA 1NQAO 1IIRA 4YO8A 5T7BA 1F4PA 1QZTA 1VE6A 2C59A 4OXXA 1G291 1AH2A 4IX9A 4RF4A 1XVAA 4QFBA 4MKFA 1TRKA 1S02A 4OJYA 4G8JA 3KUDA 5C8XA 1NP3A 4FM9A 4LRWA 5IK2D 2NM0A 2ZXUA 3THWB 5DGTA 2QRVA 5E1DA 1U0FA 3K92A 3PFHA 1KNQA 1ZGAA 5KCMA 4BL5A 1Y7LA 4QYIA 4BNKA 3QU2A 4WCDA 1RFGE 4Z2AA 3B8HA 3U3JA 5BNIA 5EZ6B 3HVIA 2ZE7A 5I9TA 4UOQA 3MTDA 2YWHA 3K1AB 3UMSA 3LX5A 4G5RA 3EN0A 1T1EA 1PO7A 4PZZA 4I8XA 2O59A 1U8FO 5FPPA 3VPXA 4H7HA 4YI5A 2V7WA 2PIAA 4CLXA 2VAMA 5H59A 2I3DA 4EB3A 4DQVA 1H2EA 4UNQA 4NABA 1Z0KA 5HIJA 2A0WA 2Q29A 2HQSA 1SB8A 3Q85A 5JCJD 4MHTA 1W5TA 4QO8A 3LPAA 2GKGA 4TXJA 3OPYI 2PDAA 1PG2A 2FRVA 5FIUA 4OA5A 3FHOA 1QHIA 1W75A 3GLKA 3SLRA 1KEUA 4MITA 3G0GA 4KMMA 2ZUUA 2L0XA 4ZC8A 5C8YF 5G4KA 1NL3A 1Y9AA 1DKQA 2FW9A 3NJRA 4YN3A 1THTA 3PUVA 4KNWA 3OMLA 4FHDA 3V6MA 1MOQA 4B33A 2WW8A 3OZGA 1I1QB 5H7XA 3W9YA 4BQOA 2A4KA 4QE3A 1FFGA 3E2PA 2ZR9A 3FPHA 3H2SA 4K6GA 4AT1A 1QIHA 4CJXA 1MXHA 1WUYA 2RH5A 3PJEA 1V6AA 5AKJA 3MXTA 5JBQA 1T3GA 4UE3S 3DONA 1X7DA 3REGA 5C37A 3GLUA 4PQRA 4R01A 5B3KA 3COVA 1L0BA 2GYVA 1NC3A 3BZBA 4YAEA 4DV4B 1YWGO 5LOVB 1LDGA 4PF1A 2RBEA 2C58A 3NZEA 3P0JA 3OC0A 3TWOA 3CVJA 5K8UA 4IIDA 1FVXA 1WA5A 1P0IA 4CCWA 4URYR 4L2IA 2OQIA 1B8UA 3HLYA 1PQ4A 3MWEA 3KOYA 1TAHA 2GA9A 4ZREA 1FFXA 2UKDA 3VH3A 5DTRA 5CUQA 5A3SA 3IUPA 2AFRA 2C9YA 2RIPA 2IVFA 4BVAA 2JGNA 3ANNA 1MABB 3L07A 3MCWA 3RV3A 4BFLA 3ABZA 4UDOA 3CPJB 5CTJA 3UOWA 2ID7A 2FP4A 3B6MA 2RKOA 3QVGA 3VKVA 5JAMA 2QM0A 1EX9A 2V97A 2BFCA 5J5CA 2II6A 2P9QA 1LZKA 3WLPA 1J8DA 1RMQA 2YHAA 1JYFA 3EOBI 3NOQA 3EIUA 4WQMA 3U7FB 4LPKA 1PR6A 4PGFA 1ZUIA 3OPYA 2N0SA 2XXJA 1BQ4A 1IVNA 3A06A 4X6YA 4BNJA 1PEYA 5GV7A 4NAHA 1Z9BA 3ZQ4A 3SQXA 4EUHA 3AMVA 2BM9A 2V4UA 1RHMA 3Q12A 2UV8A 2NYVA 5D1HA 1VIMA 1PJQA 1P0PA 1R4AA 3B7WA 2FHPA 2YVAA 1OI7A 3GCXA 4BMPB 5A0FA 1A71A 2RC5A 1AHIA 2AN1A 3CW9A 1W36B 1JJFA 5JEDA 4G0NA 5HWSA 3P71T 1HDIA 1ZU5A 4MB6A 2WMYA 1ZIOA 4JDPA 1DQSA 4ND1A 3KZNA 1RZ3A 5FL7A 2Z5VA 4WXMA 5JLJA 2QU8A 2WQ6A 1XMOB 2X6RA 3OKCA 1ZD5A 2VJDA 2PCJA 4GP6A 5CB6A 3BT7A 4C30A 2PH5A 1A9RA 4M0FA 2GFQA 3WWZA 3ADCA 2VYND 3K30A 4ZZ1A 2YWRA 4TRMA 1MEOA 2LDBA 5LZ5A 3ROZA 1EP3B 1L4UA 1UAGA 4PBSA 1VGRA 1WXFA 4P3YA 3ECSA 1T3SA 4XOIA 4B5LA 2WYIA 3FYTA 3JS5A 3NX4A 3RVNA 1F0NA 2I1QA 3ELUA 1ECBA 4GOXA 2ZYDA 1JDSA 2FX3A 2B5OA 3MAJA 4GMFA 2DY1A 3S5JA 4YPOA 1WSDA 1C1DB 2UAGA 2FFJA 4KQ9A 4RE5A 4MYCA 4ZT7A 2B92A 5ILQA 3REQA 5IU6A 2PJRA 3QFSA 4CETA 4MA4A 4JBYA 4KPUA 3UTCA 2IXAA 3FCXA 5JOQA 4ESVA 1W2HA 4H6VA 2O8DA 1EESA 4FHGA 1MIOA 4TKLA 4FKMA 2G3YA 3L3BA 3A6FA 4NL4H 3STTA 2ZIUB 4JUAA 2J4FA 1T2AA 3WIDA 1JQJC 1DUSA 2O23A 3DVRX 3F9CA 5JIBA 2E4ZA 5EMHA 1OZFA 1I36A 3CYFA 5IJ9B 2QDXA 2IUYA 2YWJA 3ONVA 3QY9A 4BNXA 1N3LA 1CR4A 1GTJ1 1Z74A 1JFFA 3O92A 4LJ4A 4LEIA 1VQ1A 2H59A 2BELA 1Z6PA 3IAS1 1J7JA 1JQ3A 4RM3A 3VNAA 3V6LA 4AECA 3EDMA 3MWGA 3KD3A 4ZVPA 1EGVB 3SVZA 3THYB 1D6JA 3CSDA 5K0SA 3IIIA 1OFGA 3ZGLA 4UFPA 1JEJA 4QUHA 4I55A 1RHUA 3GFOA 4ZKEA 5D8DA 4QQKA 5AW8A 3N86A 3RO7A 5K45A 1KTIA 3CF6R 4FFLA 3NS7A 3SS7X 5CYGA 3I1FA 4NQRA 1X1BA 3ECCA 1VMAA 1FSGA 3CH7A 1MW9X 3PPIA 1QHXA 3I8XA 2HJVA 4KVZA 3TD9A 3L8DA 4MS4B 3B6ZA 1Y8RB 2XKBA 2ZIAA 1GZ7A 1R00A 4MK4A 4TYMA 3ZY4A 4BLVA 2JFGA 3FNRA 1G8JA 2B3DA 1U04A 4RIEA 5DT2A 4DLYA 3R7WB 5JVDB 5IXJA 1N3BA 2B1QA 1R9MA 1AC5A 3LHIA 3VMMA 2C0PA 2AWOA 1WV0A 3T0FA 1IL0A 4Q9IA 1E20A 1BYIA 2NUBA 4FEYA 5TT1A 2FPGA 2REQA 1G6HA 1RYEA 4RMHA 4QT4A 3MGKA 5KQGA 1A69A 3BTOA 3QFRA 5EUQB 3ZBUA 3KZMA 4L5IA 4IDHA 4KXMA 4KXYA 3AP3A 4O2RA 5EIBD 3ME5A 1WXEA 1BN7A 1Z2EA 5F78A 1SKBA 5K05A 4QGAA 4JIMA 2JGRA 2PKEA 3PTLA 1UJ4A 3C0KA 4KQ1A 1Z62A 3ND9A 2A3NA 1PR2A 4TSFD 3WGMA 3CLUD 3FFBA 4D9JA 3UHJA 4Z9FA 3FOFC 1ZK3A 4KIGA 3NIFB 5EY5B 4GLOA 1ORRA 2HDOA 3M9XA 3OO1A 5CT8A