2DR3A

Crystal structure of reca superfamily atpase ph0284 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
239
structure length
232
Chain Sequence
RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKGIIVYPDKVLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0273 protein PH0284
publication title Crystal Structure of RecA superfamily ATPase PH0284 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 74
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dr3A00
3IO3A 3HPQA 1FMJA 2VF7A 5AR1A 2FGJA 1E9FA 4QHSA 5FOWA 2JEOA 2REXB 2ORVA 4CIDA 4PHTA 1XMIA 2QSZA 2VP5A 3BH7A 3QXHA 4P4SB 1P2UA 2O8BB 4PSKA 1ZC3A 3IIJA 4GMXA 4DLXA 3QXJA 2WAXA 3GMTA 3CWZA 4JL5A 1Q57A 1ZUNB 2OSBA 1ZVQA 4LK2A 4EPYA 4MRSA 1Z0FA 1I4LD 2HLDA 3THXA 2Q6TA 2FEOA 1FUKA 1GWNA 1KK0A 1DEKA 3IPYA 2P6RA 3UIEA 4CRWB 2DB3A 3BWDD 1IONA 2FWRA 5HZKA 1Z6TA 3AKDA 4BASA 2X8AA 1P3JA 1Z28A 1Z6XA 2A78A 1MRSA 2AFHE 2IYVA 4MYUA 5KDLA 2ZUBA 4KFTA 3GLGB 1N6HA 1G7CA 3EX7C 5L3RA 4LJ8A 4D25A 4A1FA 3TW4A 2F1JA 4Q1CA 4IW3B 5CB6A 5L3QB 3QBTA 2GA8A 2NZJA 1F2UB 5CIQA 1OXVA 4A9AA 2F9LA 3LLUA 2EYUA 4LYHA 1GM5A 2WWFA 5LB4A 1SGWA 1JQLB 3SFZA 2YWHA 1WDTA 1UPTA 3H1TA 1U8ZA 2PEZA 1T3SA 2AXPA 2JAQA 5JJLA 5AJVB 2WICA 1TQ2A 4CT4B 2ZRBA 4DDUA 5DE3A 5JSZA 1YR9A 3ZVRA 2QP4A 2JLSA 5JI3E 3HYTA 2VP6A 4C7OA 3RS3A 3UATA 4PPFA 3GLIE 5SZIA 1T3LA 2ATXA 4HAYA 4P3YA 1HA3A 3KQKA 2WJYA 1P9NA 1ZNWA 3DZDA 2D3WA 2ZJ8A 3C4JA 1SVOA 2IS4A 4JVMA 1LTQA 1W0JA 2JLUA 2IYTA 3MG9A 2FSIA 3IIMA 4TL8A 3A1SA 4N1AA 2P6NA 1XP8A 4D81A 1NLYA 5TARA 1G291 1G3IA 3LW7A 4BFXA 3IIKA 4GOJA 5EE0A 5FPTA 3ZYCA 1TL7C 2BBOA 2GVDC 2J0VA 2X1VA 4N3NA 5LD2C 4KODA 1R5NA 2KBEA 2V1UA 3KUCA 3QKSB 1XF9A 1JBKA 1YQTA 3K0FB 5CLLA 3PUYA 2E9SA 1CR0A 3W90A 5DI9A 3BFXA 5EXPA 5FPHA 3THWB 1C4OA 1R4AA 3SFVA 2IUTA 2ZI7A 4KHZA 2F3TA 3QG5A 1T9HA 4KCGA 3GLFB 2G3YA 1TF7A 4YMVA 4PZLA 3PEYA 5GJCA 5JRJA 4D4KA 2AWNA 4PANA 2QBYB 2VP2A 1U2RA 2VL7A 3MGCA 1YVDA 2CE2X 2G83A 3AUXA 4KBFA 4LHXA 1UF9A 2Q9BA 3MLEA 3TRFA 5AUPB 4URYR 5CDFE 4KU4A 3UPUA 1RRPA 2GXUA 3WMEA 3DM5A 1H65A 1RYFA 4GPTA 3ZZTA 2W2VA 4EFNA 2NO9A 1YE8A 1SZPA 3ZZ0A 4ACAA 1U8AA 2WKRA 5FBWB 8OHMA 1UEJA 3JVUA 2VYFA 4PC3A 1AS3A 1FPMA 5EE3A 3CRVA 1OPXA 3KJIA 3THYA 1MR3F 1W36D 4DSTA 2PZEA 2J1LA 2J0UA 3W6NA 4GI7A 5B30A 3T5GA 5HZHA 3CH4B 1G64A 3HU1A 1DOAA 4KLNA 4OK6A 2GRJA 4HAVA 4OHWA 2J59A 5CLQA 2YOHA 2ODNA 2RGXA 2IYSA 3AP3A 3CZPA 4QXAA 4D4MA 4URVR 2NTYC 4DJTA 4H9GA 5IT5A 2PJRA 4NYMR 1CXZA 1TQ6A 3HDTA 4ZDKA 4NCHA 2Q0HA 5A5GA 1A2KC 2D4HA 3O8CA 1HTWA 1Z06A 1DO2A 1P2SA 3PV0A 2QI9C 3FMOB 2ERXA 2PL3A 4Q1EA 1Z0JA 1W48A 2F7SA 3X1WA 1MRNA 3IEVA 2FZ4A 5AK0A 4RFVA 4CEIB 4AKIA 2UZIR 3WMFA 4U00A 4GRAA 4URWR 2JLRA 2JLYA 2FG5A 4URXR 1YKSA 3U7HB 1GRRA 1XEXB 1QVAA 3QUSA 3BD9A 4I99A 4ZKDA 1LVGA 4AYWA 1G3QA 1NVXQ 4NE2A 4V0OA 1IN5A 1WP9A 2JATA 3TLXA 3T1VA 4V0KA 1R7RA 3L0PA 2XSZA 3C5HA 1KSHA 2OLJA 1OIWA 5DNYB 1ZM4A 2IX3A 4IDNA 1G41A 4BRUA 1XEFA 1Q3TA 4POAA 4UQOA 3QY0A 4KYIB 4NL4H 4Z8YA 4DKXA 1E1QA 4BLSA 4Z1MD 2I4IA 4FCTA 5EP2A 4MGIR 3Q9LA 1XTKA 3SEAA 1F48A 1ZNXA 2PX0A 3ND9A 5FPKA 1U98A 3P4XA 3ZJYA 4YMTA 4DCTA 5C1BA 1JI0A 3IHLA 4Q4LA 4TLCA 3BAFA 1G8YA 1X8LA 2VHCA 1Q20A 1D2MA 3B1ZA 2A5FA 4DLWA 2NG1A 1Z2AA 3GQBA 3LNCA 4MA4A 1OFIA 4MRVA 2KJQA 2IS2A 4FD2A 1KSFX 2BIFA 3MWJA 2YC4C 1VG8A 1SXJD 1E2HA 2ANBA 3EZ6A 5EE1A 5IDVA 2ZJ5A 1W0KD 2PLFA 3CX6A 3LWNA 3N2IA 3MFYA 4Q4AB 1D5CA 3R8CA 1N2CE 4LCBA 3WMGA 1N6OA 2EWWA 2IBMA 1JAIA 1WMSA 1LS6A 4HZUB 2GWHA 3V4FA 5DN6D 4KXFB 4ARZB 3ZQJA 2YC2C 1HT1E 1NBME 2XTMA 3X1YA 1AK2A 3L0SA 2BMEA 2F9MA 2WV9A 5C4MA 2V4ZA 4NCNA 3I72A 2RGDA 2GAOA 2WJJA 2IK8A 3PENA 1GG2A 3OEHD 4KITB 2WJGA 2YOFA 3FMFA 1G21E 3NTUA 3NBXX 3MD0A 1E69A 3E70C 4IEEA 3I92A 4JT4A 3RS7A 3N5CA 4Z54A 3VR4A 2WWHA 4G1UC 1KI2A 2GDJA 4IDPA 2WTUA 2VF8A 4DSOA 4DUGA 1E2NA 3SBDA 1XJ0A 3AKCA 4UNRA 2R62A 2J7PD 2OAP1 2G88A 5AWFC 1II0A 3IKJA 1GOTA 2C9OA 5SZJA 2ZYUX 3SC3A 5F2EA 2EFCB 1EFCA 1OFTA 1XRJA 3FPAA 3U44A 1X8JA 2H8KA 4TQUS 4QBHA 4LV5B 1TEVA 4LBZA 2QL6A 1VHLA 3DMDA 3AVUA 4OKSA 3BERA 2UKDA 2W0SA 2EW1A 1NVUQ 3SZRA 2ZYVX 1M8PA 4TMXA 4I4LA 3THXB 2WPDA 2YOGA 3A6PC 4Q21A 3FMIA 3CIOA 3O8BA 3RC8A 2J7PA 1FW6A 4PHHA 1XJQA 2C2HA 5JWRA 2BBWA 2O8EB 1COWD 4AKGA 3B85A 3GLHE 5JHHB 5F9HA 1YR6A 1W44A 2C9YA 3TQFA 2CNWD 4GBMA 5JEEA 3RHFA 3Q7PA 4JYCA 2PEYA 4O0MA 1J99A 1Z83A 1TU4A 2NGRA 3B82A 3R9WA 1BMFD 4OQXA 3SQXA 4RD6A 4BFWA 2B8TA 1G3UA 1P61B 5TDHA 4TL7A 3TVDA 4IDHA 1KJZA 3DOEA 1R6BX 4I1VA 5FBQB 3VHLB 3I61A 1FZQA 2ZSDA 2XOKD 3O8DA 4DDVA 1S3SA 2C77A 2DYKA 2Q3HA 4LBYA 2P5SA 2RCNA 3WXMA 1MO4A 5LPNA 5JSZB 1HV8A 2GZDA 4BLQA 3I3SR 3WHLA 2BEKA 5CK4A 4XVUA 3QXSA 4C7OB 4A82A 3BE4A 2XGJA 1KAGA 4QFMA 5E3HA 2IUSA 3WP0A 4TZ0A 2BVNA 4CVNA 1KKLA 1MV5A 4TQ9A 4X8LA 3FTQA 2ZVQX 2XNDD 4AG6A 1E4VA 4JLVA 2XZLA 4B73A 5FOXA 4NYJQ 4R9UC 4B71A 3FWYA 2SHKA 4MDEA 2BM1A 2ZUCA 4V0MA 4Z8XA 2JLZA 1E2LA 1TF5A 2EFHB 1S1CA 2OFOA 4JJKA 2FPLA 2A7QA 4TTPA 4EJSC 5TMPA 2AWOA 1NP6A 3KB1A 4C0HA 3NDPA 2PZFA 3Q72A 3U60B 1X1SA 2D06A 2IF2A 3AVYA 4QGAA 2BJWA 3PEVA 5BW8A 1XPRA 2Z4RA 1KO4A 1VYTA 2V7QA 4A6PA 1EWRA 3GJ5A 4A0HA 1TEXA 4ASUA 2UVQA 4AKHA 2FX3A 4AI6A 3GJ6A 1XD9A 1H8HA 2NZ8A 4CF7A 4JZKA 2YZ2A 2ZITA 2O0JA 3DL0A 4L5BA 3LQQA 2MSEB 2XB2A 1EG7A 3NBFA 2GEUA 3BJIC 3CUEF 4LZZA 4GFDA 1GITA 2PMDA 4B43A 1LW7A 2IA5A 1DARA 4P0TA 4M8NE 5GJVC 1HEIA 2GZHA 5AJZA 1MT0A 3RNLA 4TMKA 2G0NA 1KI7A 4L4UA 1E0AA 1OIXA 1T0JB 1YHNA 4P32A 1NVVQ 2ZROA 4BZPA 2C03A 4Q4HA 5KDOA 5CYPA 5JMTA 3THYB 2FN4A 2OFWA 1T5IA 1I2MA 2XXAA 2J0UB 2QGZA 4PHGA 3EPHA 4L16A 4MQBA 3NVAA 1A1VA 2ZRIA 2Z0MA 3EXAA 2QAGC 4CGZA 2VA8A 3FOZA 2CVFA 2V3CC 1W4AA 3OHMA 1U9IA 2OM2A 3Q3JB 3ND8A 2FSGA 2OLKA 1YZNA 4G0NA 3LVQE 4EKDA 2QE7A 2G6BA 1A2BA 3K0AA 3DVLA 3KQNA 4L8GA 1E0JA 4FCWA 4TSFA 3VR2A 1T5LA 5L8VA 3TR0A 4XH9B 4C2TA 2IS1A 3EPKA 2VHJA 4C0SA 2AFIE 1YRAA 2A2ZA 821PA 4BEJA 5G53C 3T1TA 1KAOA 1N6RA 4OK5A 1W36B 1ANKA 5B57C 3PITA 3B6EA 5E95A 2IL1A 3CRQA 4JL8A 2W58A 1W2GA 1KK2A 2QMUA 4Q9IA 5TV2A 1XXHE 2V54A 4PAOA 4B75A 1GILA 4Q9KA 4G01B 1NMXA 1ZAKA 4G5RA 1D6JA 2YVUA 2ZI3A 4C4PA 1YZQA 3KKOA 1XDBA 2MMCA 4MYHA 1XTSA 3L8ZA 4PQRA 1UJ2A 2IYWA 3Q7QA 3HR8A 4MYCA 1QF9A 1E0SA 4R2HA 4W9MC 4IVPA 4YMUA 2QPAA 1EFTA 1RYHA 3J81k 4NYJR 4FWIB 2OXCA 4WVFA 1GTVA 1E4YA 1MO3A 2CL7X 3ZH9B 1KI3A 1LFDB 3U3RA 2CHQA 1E94E 4FMDB 3TVTA 4OQNA 1NKTA 3SJBA 4IFEA 5JHGB 1IJFA 4LY6A 3G5UA 3P20A 2GILA 4WIAA 2Z6VA 1I4DD 4OJQA 3TK1A 4B3DA 4GMDA 3IBYA 2VRWA 2NIPA 2ZS8A 3BRWD 2V6JA 3KDSE 4LSGA 4AY2A 1G8GA 2BWJA 1E99A 2QUZA 1JR3D 4V0NA 2NO1A 1G5TA 1G7RA 1XCGB 3T5DA 3DZ8A 2KWIA 2C04A 3C8UA 2ZSFA 3C16C 3SU8A 4EFLA 3QE0A 1RE0A 3KQLA 1ZM9A 3FDIA 1K5GA 4DCVA 1XMJA 2W00A 5JI2E 2ZRLA 521PA 1A4RA 1ZRHA 2GXAA 1Q21A 4RD4A 4FINA 2ZYTX 1MKYA 1IN8A 1E1RA 3IHWA 3UWOA 1SKYE 3BXZA 4B2IA 3EZ7A 1FTNA 1D8TA 3Q5DA 1RVDA 1XCPA 4B34A 1M7HA 2ZR7A 2D2FA 1DVRA 1NG9A 3A8TA 1OXTA 3MCAA 3SI7A 1OFUX 1UAAA 2K5UA 3OFNA 1NVVR 3PR1A 5EQTA 4YXWD 3QKRA 4MITA 1W46A 3U7FB 1UKVY 4XWOA 1UKZA 4OI2A 3GJ0A 4HDQB 1XU4A 4F92B 1TU3A 3RVBA 3KL4A 1JEEA 4B35A 1NRJB 2CK3D 4PFSA 4BQSA 4OQMA 4DC9A 3GJXC 3UXMA 5EUQB 1W36C 3U44B 2QORA 4M1OA 3I8XA 1XFAA 3K70D 5FTJA 1CJTC 3N70A 4TLAA 4OI4A 2F55A 1PLKA 4BECA 3MWLA 2EFDB 3NEJA 4Q01A 1TADA 4ZCLA 3SYLA 3W9YA 1HQYE 1WRBA 1AQUA 2ZPTX 2B6HA 4PHFA 2OT3B 4KAXA 1VCOA 4RCZA 5JS8A 1P60A 4Q00A 3VAAA 2BCJQ 1E2MA 3NC0C 2ZE6A 2DFTA 4ZPXA 3U61B 1NI3A 1SVMA 2GK6A 3PIRA 2GBLC 4YXWA 1GUAA 2XZOA 1BYIA 1OH7A 2ZVPX 3MWYW 5FFMA 1GIAA 1IN7A 3RDPA 2YHSA 3BH6A 4G3XA 4GT1A 2LKDA 1CEEA 3VNVA 2VHUA 3LY5A 1KI6A 1PZNA 1XD2A 2CK3A 1YRBA 2HV8A 3VX3A 2HLDD 4WZBE 2ZRGA 3CF2A 4LGMA 5G41A 1OYWA 4U5XA 3HYRA 3EC1A 2R9VA 2AHOA 3WBKA 1JNYA 3QBVA 1KO8A 4AG5A 5KNBA 1KJYA 1MH1A 5CJ2A 3TIFA 3K09C 1W4BA 2DWPA 3ZZUA 4DLUA 4DWJA 3IBGA 1UBEA 4JLJA 3KJEA 1AS2A 2WOOA 3R7WA 5TVKA 1IN6A 1E2FA 2BC9A 4EPWA 3L0OA 4WZAE 3LW8A 4M1WA 3U6BA 1R2QA 1SVWA 4PSAA 4NBSA 4MH0R 4BFTA 1IHUA 2VHTA 4JLKA 1KJWA 5J4KA 2ZS7A 5EXXA 4AD8A 4NYMQ 1K8RA 1X6VA 3T34A 2BKEA 1L8QA 4R98A 2QA5A 1OXXK 5HE8A 1HY3A 1ELOA 5L3SA 1KMQA 3IPXA 5BN4A 4NYIQ 1JECA 2KE5A 3EIHA 4OL0A 3TJZA 4RD1A 2X2EA 5JFGA 1DAEA 3VU9A 4WOPA 3K9NA 3EC2A 3ZVMA 5G3ZA 2ZRCA 2HJVA 4Q18A 1J2JA 1DG1G 1SXJC 5FBVB 5EP1A 3GEHA 2FE4A 3VTKA 1W0JD 1JPJA 4LBVA 3ADCA 1IXZA 2GESA 2BBSA 1PV4A 2WWXA 1CKEA 3IDQA 4US1R 4TLBA 2ZETA 1AQYA 3LA6A 1Z22A 1Q1QA 1G17A 1MO5A 4TL9A 3KKPA 1N5LA 4DLZA 1Z07A 5FBRB 5D3QA 1Q0UA 1M1YE 3NG1A 1LS1A 5AJWA 4A8JA 3LO5A 3Q8XB 3QPUA 3QVVA 2JLWA 1ZCBA 4TTQA 3W34A 3RC3A 5GVSA 3DM9B 1OHHA 1O3YA 2FGKA 3X1ZA 3EA0A 2XTZA 1XPUA 5TB5A 1BYUA 1KO7A 1NIJA 4Q7MB 4F4IA 3C14C 4YDSA 4IOJA 2ZAOA 1U8YA 3EARA 4ILEA 4B3FX 3VX4A 4Q4HB 4A4DA 3NH9A 1AS0A 3W6PA 4PQFA 5F98A 2REOA 4NCKA 2QP9X 2XX3A 3NWJA 4ZV4A 2XXAB 4KBGA 4IJMA 4K81B 4TYPA 4DT1A 1SHZA 2PX3A 1H8EA 4UNQA 2D74A 4PAMA 2GF0A 3EZ2A 1FQJA 4D0LB 5CB8A 4DB2A 2NQ2C 2R6FA 2J9RA 1VCIA 4NONA 3REGA 1S8FA 3K0AB 3DOFA 5J4YA 3A4LA 2Q3FA 2RGNC 1FP7A 2R65A 2FOLA 2ZRAA 4HAZA 4OK3A 1ZC4A 2QQ0A 4HLUC 5JECA 4BGDA 1D2EA 1R10A 3EZ9A 2WIAA 2BMFA 3W3ZB 3HPRA 3OIVA 1HQCA 2LCFA 3UMSA 1BKDR 1XEWX 1IBRA 3LDAA 4FMDF 4DIEA 3D31A 1CULC 1U0LA 2GEDA 2D62A 3B2EA 3CBQA 3NC1C 3AM1A 3GFOA 1VCNA 1CU1A 3CPEA 1CS4C 1G7SA 3AGPA 2H1LA 1E79A 2MSCB 2NPIA 4IOMA 3TQCA 4JLBA 3TAHA 2JJ1A 3MJRA 2JLQA 1NJFA 4LJ6A 1DTSA 4RKFA 2WSSA 5KOYA 3ICEA 2XSZD 2DR3A 3M6AA 4TMTA 2ORWA 4M1YA 4D82A 4TYQA 1XMSA 1X86B 3M4YA 3REFA 2EU8A 4PO9A 4RD2A 5CM8B 2CXXA 4QNMA 4MKIA 2OV2A 1SULA 1E1QD 4NYIR 1Z2CA 2OESA 1XZPA 4OHXA 3GLIA 1NMZA 4HEJA 2O8EA 4V0LA 4M9XA 4OQFA 4FN5A 1US8A 2DWQA 5FUXA 4F91B 5KDDA 3FHOA 2P67A 3DPUA 3P26A 3OEED 2WMNB 4PPGA 1SXJE 1DE0A 3HP1A 5DGXA 5DLQC 5E7JA 5KSOA 1G6HA 1QBKC 3QKUA 4LX0A 4O2LA 4GOKA 5M04A 3P32A 3WBJA 3CONA 5JBQA 1BOFA 2OCPA 5GVRA 3TR5A 3K9GA 4AWXA 2O8CA 4L9SA 3AP2A 2GXQA 3OIUA 5HE9A 4CDGA 3AVTA 2B7BA 4HI0E 1NKSA 4B33A 2DBYA 1W2HA 2W6IA 4DDWA 5FOSA 5L3VA 3Q5EA 4FMCB 1F5NA 5BWMA 2ZE8A 3SS8A 4OHVA 3QKTA 2OCBA 1N5JA 2VQSA 2YWGA 2JLXA 4AIIA 4MUAA 4A0GA 3PUZA 1W5TA 3OEEA 1OH8A 1FNNA 4RZUA 2E87A 5IRCD 1PUIA 1QHIA 2AD1A 4NPHA 4DCUA 2CL0X 1VPLA 4B3CA 2ASEA 1FX0B 1QHYA 1XB2A 1ZCAA 3CR8A 3QG1A 3QKRB 3ASYA 3BK7A 3D7MA 5CDFA 1N6NA 2WHXA 2F1HA 4XD7D 2XB4A 1EWQA 1XD8A 3DO6A 3Q85A 4D2IA 4F7WA 3CO5A 3EPJA 1FMLA 1A7JA 1UM8A 2C99A 3UG7A 1DPFA 3CX7A 2OE2A 3NDBB 4DUGD 1RJ9A 2CHGA 3PQCA 1RRGA 1ZJ6A 1R8QA 1E2GA 2F43A 2ZR9A 5EZ5A 3BBPA 3U2QA 3SBEA 2QSYA 3L82B 1CJUC 1OLOA 5A4JA 1G8HA 1J70A 1VDZA 5DSZA 3O47A 2R6GA 5DISB 2NMVA 4MUBA 4UJ5A 4BEBA 1CLUA 1ZD9A 3RRYA 1G18A 1C9KA 1EFUA 2CLSA 3A37A 3K53A 3CH5A 4XD7A 1FQKA 1OB5A 4YMSA 4HATA 4NTZA 2R44A 1KI6B 4C30A 1LB1B 4NCIA 4QJ3A 1XD2B 2B8WA 1LF0A 5FBLB 2QRNA 3TSOA 4BFVA 2IYLD 4C0LA 2WPDD 4S35A 2QAJA 4NKRA 2A3RA 5E7IA 3QVUA 3K70B 1GKIA 2PH1A 4G5GA 2QROA 1D9ZA 2AKAB 2R6AA 4HAWA 5DHFA 2GKSA 2QPTA 3AVWA 3GLGE 4Q48A 4G5SA 1F3OA 5FUWA 3ADKA 2ZM5A 2KBFA 1CTQA 4B32A 1CJVC 2J0QA 4QNRA 3CF6R 3GEIA 3R7WB 3ICQB 4XOIA 2ZJOA 3PXGA 4AK9A 1HE8B 3AKYA 4RCYA 1YR7A 3QNUA 5JCPA 1E3MA 1E2KA 2YKGA 2D7DA 3BH0A 1AIPA 2HF9A 1XPOA 4LOAA 1GKYA 1DAFA 3KTAA 4P31A 4Q5IA 3CZQA 4QBGB 1E2QA 1OT3A 1P6XA 4I1OA 5KSPA 5BYJA 4IVRA 2JCSA 1JEDA 1CR4A 3ZD7A 5J47A 2ORIA 1IXSB 4AURA 4RD0A 5L3SB 1P7CA 5CM9C 2FNAA 3K9HA 3MWKA 4LWZA 1KZGB 2WWGA 3GEEA 2G77B 2GCOA 1M7GA 4KLZA 4Q9JA 3VU9B 3AF1A 2YYZA 1M34E 1KSGA 1ESMA 1XEWY 1G3RA 4R71A 2QN6A 2W83A 1CF4A 2HDNB 4FMBB 3MMPA 4WBSA 3MUFA 1S3GA 1NSTA 5TXGA 3SJZA 3VKWA 4AKEA 3THOA 1CP2A 1O87A 4C0BA 5FTMA 2J5XA 4BLTA 1Z0DA 1D9XA 1BO6A 4QBIA 2ZSAA 2Y8EA 1CR2A 4QHTA 3JZMA 2XZPA 4QHYA 2WWWA 3SE0A 4GOXA 4HZIA 1B23P 1E2PA 2DPXA 2V7QD 4E22A 4LJAA 4ASUD 1KO5A 2H17A 3BOSA 3GFPA 4MRPA 4A8JB 1H8HD 1Z0IA 2H5EA 1DO0A 1R5OA 3TAUA 1ZIOA 1C1YA 1NBMA 4XVQA 5EE5B 2HJGA 1JJVA 4RSGA 3MSXA 3DHWC 3QQ5A 2VP0A 1G5RA 1SVIA 3GLFE 4DVGA 721PA 4HDOB 4KSBA 4I81A 3VHXA 3SOPA 3RS0A 5GJWC 4MDFA 2WBLC 1YU9A 1Q1ZA 4LC1A 1F60A 2RGCA 2VBCA 3IQWA 1RRCA 2P65A 4TZ6A 4JVNA 1NNEA 4BE7B 1YZGA 3K70C 3WNBA 2I3BA 1AJEA 4KI0A 5FL7A 3MAAC 5EUMA 4W5JA 1S4QA 2Z4SA 1PJRA 2ZQ5A 4KO8A 4U02A 4M21A 4DT1B 1OF1A 4TLEA 4HLCA 2IYUA 3OIYA 4JKYA 4M1SA 1SVLA 2WOJA 2PLRA 5HCNA 5IK2D 1G4UR 1M2OB 2WJVA 1E2JA 5A0FA 3LV8A 4HB0A 2O0HA 3ZQ6A 4PPQA 4NP6A 3VFDA 5FH9A 2AL7A 3OZXA 1VIYA 3H86A 2AXNA 1KTVA 2E1RA 2IHBA 2RGEA 1CR1A 1J90A 3E5HA 2C9CA 3B78A 3L43A 5DYGA 2C5LA 2ZE5A 3K0SA 1KMHA 2PBRA 5C18A 4Q7JB 1M7BA 1NF3A 2QE7D 2J3EA 3B5JA 3TW8B 3UMRA 5BN3A 3HJNA 4GL2A 4TT3A 4TSFD 5G3YA 3X1XA 3IUYA 2XAUA 3SR0A 3GLHA 5JZVA 3W3AA 4CEHA 1II9A 3FHTA 4E5UA 4O3MA 2ZTSA 4PO8A 3UANA 4PZYA 4ZCMA 2IYXA 4PC7A 5BXQC 4BUJA 2RGAA 5H68A 5IK2A 3TBKA 1P73A 3QXCA 3F8TA 4FW9A 2GK7A 1E9BA 4DLVA 1VECA 2Q3MA 4XSHA 3GCGA 3LRPA 4XJXA 2QTHA 3TSZA 2VIIA 1OIVA 1W4RA 1TUEA 2Z43A 5ANRB 1NN5A 4EPVA 1KIMA 3M1IA 1XTRA 4B3BA 4LPSA 2W2XA 3CWQA 2B7CA 3VKGA 2PMKA 3ZS8A 4IXMA 4IVQA 1U99A 3PUVA 4GNKA 4HUQA 4JVSB 2IW3A 3RABA 2A30A 4UXHA 1J7KA 3GLIB 3CKLA 3QEJA 2OZEA 1QZXA 1US8B 1UKEA 1ZINA 1WE2A 4DSNA 2P6UA 3QI2A 1R8SA 1V43A 4E09A 3I62A 2IC5A 2D2EA 4JMPA 2ZAMA 4D6PA 2O8DA 4WA7A 1NIPA 2RHDA 3K0CA 4ZI2A 2QMOA 3RSLA 1AKYA 3GJ8A 1JR3E 2W6JA 2X77A 5J40A 4UKDA 3I32A 4RVCA 1SVSA 4CT5A 1NY5A 3HU3A 2O8CB 1Q3HA 4GDFA 4BLPA 4PPNA 3GJ3A 3GFTA 5KNDA 2ZRDA 2CL6X 2PT7A 4PX9A 2J41A 4BFYA 4EFMA 4O2RA 4BZXA 3RLFA 2OBNA 4JT2A 2GCPA 4Y0AA 1W47A 3VQTA 4II7A 4TYYA 1QHGA 1ZYUA 2CBZA 3A4MA 4J0QA 3U7GA 3BS4A 1NN1A 1YZKA 2ZR0A 4TYNA 1DADA 4DRZA 2GJAA 4Q9HA 4EQ6A 2DFLA 2RAPA 4QJ4A 2HXSA 3QSYA 4BZQA 1E9AA 2IXEA 3L8YA 1TPZA 3RAPR 2AR7A 5D3MA 3O8RA 1RW4A 1OV4A 4DBLC 2N1BA 2IF0A 1E1RD 1ZU5A 1OB2A 1P62B 2RHMA 2IYYA 3I4LA 1T3HA 2WVJA 2BCGY 3CR7A 1N5IA 2PCLA 2XNSA 4MRNA 4NDZA 5EP4A 3V00A 1G20E 1UDWA 1KDOA 1ONBA 3AUYA 1HYQA 1B0UA 1G19A 2B21A 2JIZA 2RMKA 3OFND 4BFSA 5K8LA 1TX4B 2FPMA 1UFQA 2VHQA 4G5OA 1W5SA 3B1XA 4P4TA 1GNPA 1Q1BA 3ZVLA 1TNDA 2BMJA 3FVQA 1RJ9B 1FNMA 1WBBA 3AF2A 2ODEA 2CEAA 1VG9B 5TY0A 3A4NA 2P2LA 3I8SA 1JJ7A 1OW3B 2F43B 1N6LA 4QKQA 3KJGA 3KFVA 1S0UA 1FFHA 3OAAA 5B58C 3I73A 1UBCA 3UWKA 4JLAA 1L4YA 3C41J 4A92A 3ZGXA 2F3RA 3WP1B 2ECKA 3U5ZB 4A2PA 5CJPA 1MABA 3SYNA 1OJLA 3EG5A 1VTKA 2CLDX 4Q7KA 4ZIRA 1L7VC 2A5JA 1TF2A 4DB4A 4IOKA 1F6BA 1L4UA 2ANCA 1G6OA 2X19A 3CNOA 3DMNA 3GJ7A 2JJ2A 4QM7A 3WRYC 1E9DA 3H84A 2FFQA 2OAQ1 4RZ2A 3TUJC 4FCVA 1KI4A 1E2IA 1GNQA 2IXFA 4D4LA 3NEYA 3U3JA 1Q1EA 2HEIA 1EXMA 2CVHA 2A9KA 3W8NA 2YWFA 2ZANA 3LBNA 4GSYA 2A5YB 2R8RA 3EASA 4XWAA 4IRUB 2BMDA 2CCJA 4UNSA 1UKYA 2XJ4A 3AEZA 5FPYA 2OXRA 1GRNA 1XXHA 2IYRA 2ZRNA 3EIEA 1D2NA 3KKNA 5CIWA 2GTPA 3RWOA 3M0EA 2KB0A 3EAQA 1GRQA 3D3QA 2VP4A 2GVZC 3KTAB 1F2TA 2QRZA 3F0TA 2QP3A 4N0DA 3T1QA 1IOZA 1E32A 1G3MA 3SQWA 4V02A 1J8MF 3QENA 5AJYA 3FKSD 4TLDA 3NKVA 5FTKA 4RKEA 2NOAA 1P75A 1G16A 1EX6A 5FOUA 1CJKC 1PLJA 3I5YA 1HE1C 5F3WB 4NHOA 3K0EA 1U90A 2GCOB 3D8BA 1LNZA 3LBIA 3B13B 1KNQA 5JWOA 1EFHA 1IXRC 1E2DA 3WHKA 4I1SA 2YINC 3QF4A 4WZ6A 3IQXA 2ATVA 4B3XA 1M74A 4PC2A 1QVRA 4BWYA 4EJSA 2I1VB 1Q12A 1XJCA 2EFEB 3KKQA 5F9FA 4BLOA 1ZP6A 2Q9CA 2QNRA 4D80A 1QG2A 5LD2B 1IY1A 4Y0VA 2G1KA 4ESVA 4TMZA 3E1SA 2NO0A 1KDTA 3FKSA 4JVLA 1UDXA 2YWEA 4HSEA 4L15A 4US2R 1TTTA 2VLIA 2OBMA 5JJIA 2J87A 4OBEA 1Z63A 2IYQA 4ON9A 1Z6YA 1GP2A 3QF7A 1T8UA 3A1UA 4DLSA 1IJEA 3T35A 1K6MA 4JYBA 3P1JA 3I1FA 5DHAA 5JWHA 3AB3A 3BB1A 1ZM7A 4EPTA 4M53A 3WRXC 4M1KA 5JLJA 2O52A 2B92A 1N5KA 1VYVA 4JBYA 2BV3A 3I5XA 2WKPA 3GJ4A 4B74A 4QM6A 1P72A 4IEIA 4B44A 4F38A 1AZSC 2ZI9A 3IO5A 1TQ4A 2RKOA 3KXLA 5SZHB 4CYMA 5B64A 1OHHD 2GCNA 621PA 2DHRA 3BB4A 1IN4A 3NBYC 4L9WA 1QHHA 1FOEB 421PA 4D0GA 4GP6A 1ZU4A 4IKEA 2CLCX 2GETA 1RZ3A 2YJTD 2ZRKA 3PUWA 3AKEA 4A2WA 3K9LA 4KSCA 5FUYA 2GHIA 5KYKA 2VEDA 1YR8A 4U7DA 2FU5C 2V8OA 3AVVA 1VIAA 4C2UA 4EDHA 2QM7A 4P33A 3LX5A 1ZIPA 4M9ZA 4QRHA 4KFUA 4TL6A 1SHKA 3AGQA 2OUKA 2QAGA 4Q9LA 1H8ED 5AUOB 3VR6A 3FFBA 3U6KA 2BHRA 4LJ7A 2FPKA 2OG2A 2JGNA 4PO1A 4RFSA 3IILA 5HKKD 4HB4A 4DEXA 1KMHB 4TMWA 3C7KA 5KPJA 5DI3A 1XWIA 3TGPA 2V1XA 3CRRA 2H57A 4KVAA 1OH5A 1KY3A 2OEPA 2ODBA 4C0KA 5C4GB 1GNRA 2A5GA 5LB2A 3TUZC 2P3SA 4LJ5A 1AA9A 2QG6A 2QPOA 3GLHB 3ZIAD 5DH9A 4CEHB 1EESA 2JLVA 1AN0A 3BC1A 1R0WA 4B48A 1WCV1 3AVPA 2EVWX 4PC6A 3T06B 4TWZA 5HR5A 4MGKR 2N42A 3BORA 1DAIA 4G5QA 5FR2A 1UADA 1MO6A 3H0KA 2P0EA 1KDRA 5DO9A 5HCIA 3LD9A 4Z51A 4QGGA 1G8FA 3JZAA 3KKMA 4JL6A 5HKKA 5E7MA 2NO7A 1S9DA 3AQ4A 1EX7A 3A1VA 3AF3A 1E79D 1II8A 4DLTA 4HUQB 1Z6GA 1Z6AA 2JJ1D 2MSDB 3EW9A 2MMGA 1KKMA 1BIFA 1NN0A 2WSSD 3TSWA 2VP9A 3V4RA 1LF5A 1TMKA 2VTKA 3ZIAA 1ZD8A 2V55B 4IHQA 4RZ3A 3WY9A 1KY2A 1ZUIA 3LQRA 3NBZC 5JEDA 2FFAA 1OKKD 4JJZA 2J0SA 1GZSA 1QHNA 4OYHA 1RIFA 2O8DB 3KXIA 1EK0A 3CRW1 2ZSBA 5AUQA 2G9NA 3ZDQA 2FSHA 3BFVA 3KXKA 2C98A 2ZJZA 1GL7A 1E0KA 2EQBA 3LAWA 3P27A 3PG5A 4LHWA 2FV8A 5CK5A 4LYAA 1A5TA 4ZO4A 2TMKA 3UKDA 4H1UA 1W1WA 2IEZA 1OFHA 3EZFA 4Q19A 2PJZA 2ZS9A 6Q21A 1CRQA 1KI8A 2LWIA 4MRRA 3VKHA 4URZR 4IOLA 5KPDA 2FF7A 4M1TA 1G4AE 1KOFA 1G9XA 3PUXA 3H2YA 2QTVB 4C0QC 2W6ID 2HYIC 2ZIAA 2H92A 4M9SA 4Q02A 4EQ6B 1OKKA 5EXTA 4QC2A 2YNMA 3FE2A 1OXUA 5FI0B 4MKFA 1DAMA 3KQUA 3TH5A 3NXSA 3PVSA 5D3MB 1GSIA 2F1IA 2ZRFA 1JPNA 2ZRMA 2CDNA 5CITA 2KSQA 1IAQA 3DKVA 1GVNB 1VYUA 1W4CA 5EJEA 2ZU0C 1VMAA 4XVRA 3S1AA 1OE0A 5HPYB 3CPJB 2RB4A 1S96A 1Z3IX 221PA 2GEVA 4E07A 2CMKA 5FTNA 4F4JA 5ELXA 2CCGA 4PTLA 5EP3A 2Z83A 3SN6A 1PVOA 3BFKA 3CB4A 4DZZA 2WMOB 3CNLA 3CW2A 5KSZA 5KNCA 4HDCA 2VO1A 5GJBA 2PT5A 3LX8A 2GJSA 3B1VA 1KSJA 3LXRA 4PC1A 1RPZA 1ODFA 1Z47A 4XTCS 4DSUA 2ZRJA 2F6RA 2FA9A 2QQEA 3A36A 3AP1A 4KYUA 3B60A 2BDTA 4FIDA 4QGHA 4XSGA 4A15A 5KHOC 2ODWA 3R8FA 2NO6A 2ZJ2A 4DXAA 4M0LA 3AF4A 4K8OA 4Q7LA 1MABB 1E98A 4JBXA 4XTRA 3HWSA 2GZAA 1I2DA 1U9IC 2WIBA 3N2EA 4ZIRB 3B9PA 5KUTA 4GZMA 1N25A 2QM8A 4ACBA 2KI5A 2EWVA 2GBLA 2OFXA 5EZ6B 2WJHA 2D7CA 2ONKA 4UXIA 4LHVA 4EIWA 2HXYA 1N6IA 2HCJB 2IXGA 1JXOA 3SNHA 5IHPA 3ECCA 3SHWA 2WWIA 3GPLA 5J4HA 4MYTA 1KDPA 1V5WA 1HH4A 1UBGA 4JS0A 4TTRA 5LBIA 3TUIC 1RFLA 3K0CC 3TE6A 1XBTA 2VH5R 4H1VA 4URUR 1DELA 4EPRA 1P9WA 1E9RA 2HYDA 1ZD1A 4DCNA 1U0HC 1XXHB 2VPPA 4YONB 4B2PA 1JALA 5HTKA 4FXPA 1AZTA 4YLGA 4ABYA 1KNXA 2FH5B 3K09A 1MOZA 3CF0A 4RJLA 4DHEA 1J8YF 1FL9A 4PAQA 1P5ZB 3WYGA 4M4SA 1F2TB 1ZMXA 1FP6A 1VHTA 5J4VA 2I1QA 4LBWA 3AF0A 2A5DA 4Z1MA 4Q66C 4MGZR 3RYTC 4DLRA 2DY1A 2ZJYA 2AKYA 2JJ8A 4JLOA 4CEJA 2IT1A 2G1JA 4ZDIA 2JA1A 3U4QA 3BGWA 1OXSC 4PSVA 1R0YA 2J7KA 4O25A 2DFKB 3T12A 1P9RA 1XTQA 1W49A 2DWOA 3QF4B 2J46A 1OYYA 2HF8A 3KUDA 2W2TA 3WYFA 4E03A 4LJYA 1GL9B 4IFBA 4V0ME 2IS6A 1E9EA 4GP7A 3LXXA 4HYYA 1SXJA 1NLFA 2BBTA 5J5CA 4JLDA 4EJSB 1W0KA 2ZI6A 1IM2A 2ZU6A 1I4TD 5FTLA 5DYIA 1KK1A 5K8IA 3BIFA 3JVVA 1KHTA 1EGAA 1AKEA 2V9PA 1R0XA 1AGRA 4S2EA 4ESHA 4HLQB 2N46A 4RZXA 4B76A 2Q9AA 2IYZA 3A1TA 2ZEJA 1NMYA 2XEXA 1SKQA 1TQDA 4DCSA 5DN6A 1GKUB 2ZREA 3R20A 5H8WA 1XTJA 2O8FA 1IQPA 1G7TA 1P4SA 1LY1A 2H18A 1M6NA 2FSFA 4P4UA 2QY9A 2GF9A 4QOSA 4YQFA 4TN1A 3U3OA 1SKYB 1BH2A 4LYJA 4DDTA 5KO2A 2CCKA 3ZD6A 5K8UA 3T15A 1XNJA 2CJWA 3V9PA 2QTFA 2HT1A 2AX4A 4QGFA 3TNFA 1CIPA 1ZUHA 4LYFA 2QU8A 5K8TA 3AVQA 1JB1A 1NBMD 3PCRB 3RSOA 4MGYR 4OHYA 3WNDA 1NL3A 3OEHA 4M22A 4HAUA 3QXXA 2QMHA 3RWMB 4EPXA 2IHYA 1QHHB 3OE7D 4A0FA 3MRSA 2ZI5A 1KZ7B 3KQHA 4UXJA 3FKQA 3FGNA 2C95A 4W5HA 3ADDA 4NZYA 5UKDA 2OBLA 4A6XA 2IWHA 4JIMA 4Q1FA 4Q4JA 4LI0A 1KYIA 1Y3AA 4LPKA 4QG7A 3KX2A 1DBSA 3IEUA 3RS5A 1N6KA 2REBA 2EFGA 2RH5A 2FMXA 3KJHA 1KI9A 1E6CA 2O0KA 4M1MA 4EUNA 2OHFA 3B9QA 5FOTA 3NHAA 5FL7D 2ZYWX 1WA5A 4A2QA 2YV5A 1DG3A 1N3BA 1N0VC 2QAGB 1WXQA 3W5JA 1QHSA 4IXNA 2WZQA 3RRNA 2ZI4A 4CW7A 4RFSB 5J4LA 4JLPA 4Q03A 1FTSA 5BN5A 4P4SA 4US0R 3OE7A 5DI3B 2O8BA 2LKCA 4B6EA 1FUUA 2FJUA 4B6FA 2DCUA 4EAQA 2W0MA 3QJYA 1EFRD 1COWA 2RGNA 5P21A 3K1JA 3HU2A 1G1MA 2WKQA 5IF9A 4BLRA 1JQJC 4HLUA 1BS1A 2CNWA 3EPLA 1VG0B 5KTYA 1X8KA 1A82A 2ZJBA 5CYOA 1XCMA 1RC8A 2VSXA 1KI1A 4TT3D 3OF5A 3RS4A 1CBUA 1BMFA 1T8TA 2AN9A 4FI3C 4LHZA 3VNUA 3SJCA 3KB2A 3FHCB 1YZTA 1OH6A 3GLGA 2C96A 1UBFA 4YMWA 4HUTA 4M9QA 1CRPA 3E2IA 4W7SA 2FZLA 2XOKA 4W5WA 2P5TB 5KSYA 5FOVA 1E9SA 2HUPA 3GD7A 5L3QA 1UEIA 1F2UA 2PCJA 1II8B 2BM0A 2ZE7A 3DDCA 4F93B 4FWTA 5BQ5A 1T91A 3ZLJA 4ZDWA 1S9HA 2WSMA 2QT1A 1EFRA 2BEJA 2CE7A 4WXRA 2VSFA 2HT6A 1VG1A 1XX6A 2ZRHA 1E9CA 3DKPA 5LDDC 1AGPA 1QG4A 1U81A 3AVXA 4BFZA 2R2AA 4X8MA 3QPWA 1WBDA 1ZNZA 5GADl 1QHXA 2XNDA 3U7EB 3FFAA 1AM4D 5E4FA 1S1MA 1QDEA 4Q1AA 1G5PA 4IDQA 1NN3A 3VR1A 3W6OA 4PXAA 3BB3A 1IY0A 4LV8B 1HURA 3RANA 4LV6A 4K46A 4QBFA 2GJ9A 1GAJA 1JAHA 2AK3A 2FFBA 3EWSA 2QENA 4B47A 4BPBA 1E96A 5G40A 2W6JD 4LDJA 2FDCA 3LBHA 2WJIA 1VCMA 2BKUA 3WNCA 1U0JA 2JDID 4PZZA 5JJKA 3TMKA 3GP8A 4BRWA 1XMVA 2G0TA 3G82C 2QZ4A 4IDOA 4R7ZA 4LJ4A 4X8OA 2ZXUA 5C46F 3ASZA 1Q22A 3R9XA 2V6IA 1ZM3A 3NIBA 3K8YA 1T0HB 3CLVA 2F1RA 4KV9A 3ZVNA 2ERYA 5FR1A 4C9BA 3QKSA 4JLMA 1E2EA 3A1WA 3QIAA 4FMCF 3K0FA 3ZS9A 4UNNA 4ZCIA 3EA5A 1IY2A 1S2MA 2FFHA 4A8JC 5B2ZA 1Z29A 4LJ9A 3EIQA 4TMVA 3R9IA 3THWA 2IUUA 1ZM2A 2GJ8A 3HR7A 4HB2A 4JSYA 3S1AB 5AUNB 3GLFA 1L2TA 5SZKB 1DS6A 4C0AC 2JDIA 1YJ5A 3T61A 2QBYA 1Y63A 2AK2A 3KFXA 2RGBA 1W7AA 4NU0A 1ETUA 4HAXA 2WAYA 2JIZD 1NVWQ 3RRZA 3KZ1E 4PR0A 4QL3A 2NPFA 1P2TA 1GL6A 2X2FA 3PJRA 1NJGA 3MJHA 1HT2E 1ESNA 3B1YA 4KFRA 5BYKA 5H70A 2BJVA 2HCBA 2GJKA 4OHZA 4KFSA 4WAUA 4WW0A 1NLZA 3CX8A 2AD5A 3SHFA 2OO7A 5KU1A 3FMPB 3B1WA 5DIFA 3OAAD 3X1DA 1U94A 2ONJA 3SJAA 2ZJAA 2GNOA 4ITRC 1GDDA 3D6TB 1T6NA 3FB4A 1QRAA 3U3KA 3WYAA 3NH6A 3B7GA 3LFUA 4XIGS 4A36A 2XJ9A 3CPHA 4UNPA 4OQLA 1HUQA 3VMFA 3ADBA 4A0RA 4JKIA 3C5CA 2WWYA 121PA 3CNNA 3CRMA 2JJ2D 1YZUA 1SVKA 3AVOA 2QEQA 3A58B 4RY2A 3UK6A 2DFNA 4R2IA 4YDHB 3TKLA 2VSOA 3LVRE 4M2LA 2PZGA 3FYHA 3LLMA 4Q47A 4DLYA 4CEIA 2OCAA 4D4JA 2R6CA 4X8HA 4ZDJA 4NMMA 1ZBDA 2L0XA 1XEXA 5AJXA 4ZKEA 1R5BA 3UMFA 1G8PA 2GXSA 4AYXA 2J45A 2WM9B 5FI1B 4I1UA 5C2JB 4B3GA 4Q1DA 4CZ2A 4HLDA 1Q44A 3L0IB 4MKHA 4OJKA 4GZLA 3W8RA 2C8VA 1X1RA 3F5FA 1SQ5A 1VKJA 4CEJB 4Q1BA 3OESA 2EYQA 3U4QB 1LV7A 2H16A 4ZI3A 4C0JA 1N0WA 2ZSEA 1PLLA 3VR3A 1XZQA 3ETLA 4B2LA 4ERNA 4JSTA 2OCYC 4LRWA 5JS7A 2GAAA 2QGNA 1CJMA 2IWRA 3B8HA 1WQ1R 1OSNA 2H7VA 4LHYA 4TYWA 1SXJB 2ZUDA 1JR3A 2FEMA 3F3YA 5FL3A 1FX0A 4LUCA 3OIWA 1Z0AA 5EXSA 4D26A 1P2VA 5H1YA 4JBWA 2BOVA 3LH5A 4WXPA 1NY6A 1TAGA 3IGFA 4MKGA 4PQYA 1N0UA 3DEFA 2QMEA 4OI1A 2QT0A 2RGGA 4LC0A 3RRMA 1RKBA 3SYKA 1K5DA 4Q4AA 2R6DA 2Q21A 4KJZA 3SDZA 4JLNA 1Z8FA 4NCJA 2O8FB 2CHVA 2IEYA 3X2SA 1X3SA 5JCZA 4TQAA 1KGDA 2JASA 4C3ZA 1NG1A 3U3MA 1N6PA 4YC7A 1R0ZA 4HZUA 4KVGA 2CJWB 5FPSA 5JRZA 1PUJA 4HB3A 2ZRPA 2UZ3A 4ARZA 1T4GA 4D0NA 3PEWA 3C15C 1Z08A 1XTIA 1WB9A 4QJ5A 3P4YA 3G0HA 3EWAA 3RS2A 1YZLA 3H4MA 4BFUA 1KO1A 1DAGA 3QEOA 5FUVA 3CM0A 1DAHA 4NH0A 1JR6A 2OILA 3QPVA 1TUIA 3ONWA 4OI0A 1WF3A 4AC9A 2C78A 4DIDA 1ZW6A 4Q4JB 1RRFA 3AH8A 3L2OB 4UJ3A 2O5VA 2XTNA 3AV0B 3NHBA 3UG6A 4V03A 1Z5ZA 2XITA 1Z0KA 2Z5FA 4N0EA 4XWKA 1KK3A 3W5IA 4DEYA 1GFIA 5EE9A 4F4CA 3QOFA 3T1OA 4RD3A 1JXMA 3PFIA 3VR5A 3PEUA 4AYTA 1ZNYA 1DAKA 1NSFA
chains in the Genus database with same CATH superfamily
1NDUA 2PSFA 3UFXB 2I62A 1E9FA 4QHSA 3T3EA 2JEOA 5CXUA 4CIDA 1EXDA 1GD1O 2GN2A 2QSZA 2VP5A 5CG1A 1JU9A 5BN5B 3BH7A 1QO0D 4L3VA 2FG6C 1JMKC 4RY0A 1P2UA 4KPYA 4N6NA 1L5HA 5CG2A 1RZRA 2O8BB 3D2BA 3ITKA 3K1TA 2WD9A 4G89A 4GMXA 3Q8LA 1VJTA 3QXJA 1O8CA 1NJ1A 2BGTA 2X0JA 4EPYA 2OSBA 2NUTA 1L7MA 4HTFB 4JMLA 4ENUA 4BNMA 4FC7A 1I4LD 3NDIA 4KDFA 3PCTA 1SPBS 3I1JA 3W6UA 4EOGA 4J91A 3X44A 2F67A 1FUKA 1KK0A 3EGIA 3CC8A 3N8HA 3IPYA 4I55F 4M83A 2P6RA 1V3VA 2DB3A 3E8MA 4MQLA 1Z6TA 5JMOA 3L0ZA 1Z28A 3ZWNA 1Z6XA 3QX8A 4JA0A 3P9ZA 1NT4A 2ZUBA 1X1EA 4DNXA 3PA6A 1G7CA 4BNIA 3EXFA 1D1QA 2IBSA 5GZ6A 4CCWA 1UFKA 5E4JA 3TW4A 2H2FA 3OQPA 1TU0A 2A0KA 4CM8B 3M34A 3H5AA 4NBLA 5KS2A 4W8GA 2EXXA 3F3SA 2GA8A 3U1BA 1F2UB 1QO0A 2YWJA 1OXVA 5CIQA 3F1KA 1U7ZA 2BLNA 3LECA 2D2VA 3LP8A 4XD2A 1VM6A 2F9LA 5EKTA 2GFQA 3WQRA 4A9AA 3K30A 3SFZA 1KYXA 1NUQA 3AT1A 2YWHA 2AUMA 3G7UA 4L8LA 1WDTA 1AHNA 1NRWA 2HKIA 1ISJA 3E4DA 3K2BA 2PEZA 1QFXA 1TMOA 2YV1A 4BO2A 1ZLYA 3NWPA 4MVJH 4Q3BA 5F2NA 1TQ2A 2ZRBA 4BX0A 5LJLA 2C5EA 2B4YA 1YR9A 3INGA 3MMSA 3V80A 5A4KA 3OM9A 3LXMA 4GSKA 3KS9A 5K3DA 4GPBA 5AW5A 4MAFA 2CZGA 2Q5JA 2QNIA 2WJ6A 3EJ6A 3H1GA 3OZIA 4KE8A 4MS3B 4JLNA 2ZIXB 3GLIE 4Q0MA 1X7GA 2NYVA 1T3LA 2PO5A 1BWRA 1ZCFA 3NT5A 4GLFA 3T9BA 1ECGA 4HAYA 4P54A 4TWBA 4PS0A 1SD5A 2WJYA 2XUFA 4Q4DA 4PNZA 4DPKA 2P40A 4FYXA 3MM4A 3TGWA 4RV5A 3CZAA 1U0TA 3PX3A 3RO7A 2SKEA 4RU1A 2GKOA 1TM1E 1SA0A 3KSAC 1E4OA 2BFDA 2FX2A 1KAMA 2GYWA 2AQHA 3LOUA 1G3IA 2CFCA 1WVMA 3LW7A 2BDEA 3FUWA 4BFXA 5CXQA 3D0OA 4GOJA 5DZSA 1TL7C 2BBOA 2GVDC 5EGSA 3CY6A 2ZVDA 3PIDA 1JT2A 3WGHA 3CV3A 4V39A 3FF4A 3QKSB 2LDBA 4CIWA 1YVUA 1YQTA 3K0FB 2P30A 2E9SA 5E1OA 3TS1A 3IVCA 3WSVA 4LXYA 1KAHA 5A0TA 2BFOA 5FPHA 3LCJA 3VPDA 2Q3JA 3OUZA 5I9MA 2XUKA 2JPDA 2IIQA 2IUTA 2IEDA 3VPBA 1UJ4A 4YJGB 1MDBA 4KHZA 5TNXA 1C3LA 4NENA 3SYTA 2X13A 3WLHA 4KCGA 1MXHA 2R85A 4HFNA 4YMVA 4PZLA 3VVMA 4FB5A 1IM5A 2O7VA 1QFMA 3ZDCA 4D4KA 3CX3A 1OAOC 3TSCA 4YLYA 2CE2X 3WZLA 3HLYA 3TRFA 1UF9A 4EG6A 1Q0RA 2Z04A 1Y37A 2EBUA 1V4VA 2WE8A 4HK4A 3RBAA 5JCXA 4FHZA 5KOJA 2C2WA 2ES4A 4LWOA 2GXUA 3JTMA 3KBBA 4ETIA 5JZMA 1H65A 3ZZTA 1P4RA 4EFNA 5TJHA 3P9YA 3KZVA 1PJSA 1SZPA 3FPKA 4ACAA 3A70A 1U8AA 1UXKA 1LBSA 2PAFA 3KU4A 3B3AA 2O2DA 1QKKA 1UEJA 3IBFA 4X92A 1AS3A 1FPMA 4QPDA 5EE3A 3TNLA 3HJTA 2R751 2DERA 3DL4A 2YICA 4F06A 2E4WA 2J1LA 4X5OA 4EA7A 1L7PA 1EHCA 2PUTA 3EYAA 2DWCA 2PUGA 2NZVG 1WKBA 2VVTA 3W6NA 4XGKA 1MBZA 1IE3A 4AF7A 2B5WA 3KVRA 5IDQA 3KOZA 3OZEA 1N9GB 4OEHA 3WB2A 3VTAA 3TQHA 4BMOB 2MSLA 2WT9A 3C7DB 2JS7A 1U31A 2GN1A 2Z9CA 3CZPA 3HXQA 2HB6A 4FN4A 1AUOA 1Q74A 4FHGA 4NYMR 4P4GA 5CNIA 3RAGA 2Q0HA 2PUVA 3VZSA 4EW3A 5JPDA 3LI2A 3T7EA 4Z7NB 2GASA 1GTG1 1SIUA 1VL0A 1RLTA 2MDTA 4RPJA 1E5TA 3NTLA 1DO2A 1R74A 3S7ZA 4EF6A 1B6RA 2QI9C 3PXCX 4DM3A 1Q0TA 3IEVA 4BQOA 2WKSA 5AM2A 3CN7A 5U9CA 2EZUA 2EDAA 2J6HA 2UZIR 3KIPA 3WR5A 1POWA 3PVCA 1GPWB 2FG5A 5K3BA 4FYJA 1V9LA 5A9TA 1YKSA 2F1OA 1GRRA 4I99A 1A98A 5F51A 3DBRA 1LVGA 5JVDA 4IEFB 4V0OA 3O0DA 3NCTA 2JATA 3EB9A 4HQFA 3TLXA 3W3AH 1JHUA 4DG8A 3AHFA 4NWIA 4WCDA 3BGDA 3DXYA 1C3JA 2P4SA 4UHDA 4IDAA 3UAXA 1TJ4A 3H1EA 5E3IA 2YWBA 3P9PA 4PVDA 3L8FA 1THTA 2CYCA 4I4CA 4IDNA 4DMCA 3TM4A 4POAA 4C6HA 4DXDA 2A59A 4TUYF 2GCEA 1EGVB 1QZUA 2I4IA 2IGTA 1ADGA 2OWEA 4HP8A 5EP2A 1EUDA 5I7AA 3K6SB 1K86A 2GLTA 2PSJA 3SEAA 3W8EA 1J4AA 2PPLA 3A1NA 2PX0A 4EMTA 1SZJG 5HOEA 4X3CA 3TD6A 2V65A 3TL3A 2JJQA 1U2DA 5LP6F 1ZJ4A 4YJKA 3CEHA 2VXCA 4NMHA 4DNFA 2CXQA 3FCUB 3RIEA 1QE5A 3BAFA 3HACA 2AOWA 1X8LA 1Q20A 3AHIA 1SC3A 5L45A 4DLWA 5FA6A 3A27A 4H60A 2WTAA 2PGLA 1OROA 5IYZB 4I9UA 2KJQA 4DMLA 1QKJA 4WOBA 4D99A 3COYA 3SVZA 4AJOA 4PCVA 5BWNA 3MWJA 1UWLA 2IEBA 1SXJD 4LNHA 5IDVA 4KPUA 3H97A 1EDEA 3ZLVA 4E08A 2E5WA 2WEKA 3BJZA 4XR9A 1QZZA 2HWYA 2RHBA 5KEIA 1YQQA 2V0CA 3H42B 3MFYA 3JWIA 3QW2A 1EFPA 2YMQA 4R4JA 2XDWA 3UK0A 3WV5A 4Q4AB 2QAIA 4UE6A 3G0CA 4X84A 5EIBC 1ZMTA 1E1NA 3O4JA 4ZI7A 5A71A 3QOYA 2IBMA 3TOVA 2I7VA 4PQEA 2ZJ0A 1LS6A 1WW8A 4CKEB 3E48A 3LLCA 4BMPB 4HZUB 3MWGA 1SUEA 4V0SA 4ZN6A 3V4FA 5DN6D 4KXFB 2DJIA 2QD2A 2NO5A 4ARZB 2XTMA 3P0IA 5ALZA 3X1YA 1CRZA 2IU4A 2FY8A 4KKXB 4B3RB 4M7PA 4RLQA 4MHSA 4CL2A 3I72A 2GAOA 3EWIA 4DG5A 5CA1F 3D3KA 4E5KA 1VL5A 5CAEA 2REQA 3UJ8A 4MVYA 1C1DB 3DKIA 3TB4A 1K7YA 2C4UA 1J2EA 3PENA 4JR0A 3WL5A 3GG2A 4DCCA 1GG2A 1WCIA 2QX8A 4KITB 3NTUA 4DBLC 2CF6A 3E70C 4TX1A 1NF9A 5CNJA 4Z54A 1B00A 1XOIA 4ZK6A 1Y9EA 1V1RA 5ENVA 4ATNA 1KI2A 3SG0A 3M6IA 2VF8A 3DZKA 4YPFA 1Y9JA 3IMGA 4UNRA 1ZG3A 3F6PA 2G88A 3GO4A 4XM0A 1Z33A 1PAUA 2C9OA 2NWQA 4Y2HA 1A88A 2IUYA 5TVGA 4MI1A 4LF9B 1EFCA 2BSAA 5HUJA 3SF8B 3SYMA 3HJAA 2EGHA 1U9CA 4YJ3F 5GTDA 2QTRA 1A9ZA 3VDXA 3VDMA 1JHPA 1TEVA 1NDHA 3UWSA 1WXGA 2IHZA 2Z3VA 1W6UA 3AFOA 3FZEA 3PHHA 4OKSA 3SPXA 3AVUA 2UKDA 4FX2A 3GRFA 4C5BA 3NRBA 2EW1A 3GVPA 4EB3A 3HXTA 2B1IA 3PXXA 4RV9A 1MVLA 3O4HA 4ZK2A 1N1DA 3RFFA 2IOFA 4CU5A 8ABPA 3VJMA 3NAZA 1O96B 3EGVA 4LE0A 4L1KA 4R8RA 5THQA 5B5SA 4ZODA 5B7PA 3BL5A 4Q3DA 1SBTA 3EGDB 2QL7A 3ENQA 1FW6A 1FSSA 1QH0A 2PVSA 1SUAA 3WAGA 1AO3A 1UUFA 3IKMB 4PRLA 5AKJA 2C9YA 2QRVB 4QOHA 3TQFA 4GBMA 4HADA 3RHFA 1I01A 1NVBA 1NDQA 1R8XA 3QUAA 2QT9A 3HEAA 1J99A 1M5TA 2EIXA 1XDSA 2NGRA 3N2GA 3HU5A 4FGUA 4HQNA 4OQXA 2FPUA 5EJFA 3R9WA 4BFWA 3MHTA 1SCJA 2P9EA 1G3UA 1S2OA 4ND3A 2FW6A 3ZXXA 2X4LA 3DOEA 3QMMA 1R6BX 3G02A 4NPAA 3VHLB 1HKHA 3Q3VA 3I61A 1FS5A 3I6ZA 3P9NA 2Q9UA 1I5RA 1JGTA 1S3SA 2C77A 2I8AA 2VH1A 3ICPA 2VS1A 2P5SA 2RCNA 3INTA 1R5JA 4PSDA 1P81A 3IDOA 2H1VA 5F76A 2ASVA 5H02A 3NHZA 5T8KC 1EK1A 5TC4A 4AXXA 5CK4A 3HYCA 3JWHA 3KAQA 3QXSA 1YQUA 4XUEA 5E8RA 4IHKA 2P8SA 3EC7A 4FYVA 1ZUD1 5DU2A 5E3HA 3MINA 1K3UB 2QW0X 5LFAA 2A8YA 1KKLA 1MV5A 5DMHA 4TQ9A 4CQMD 1WLYA 4O4IB 4MPJA 2XNDD 2WYIA 3DAOA 2OCLA 3ZLUA 1I7DA 5EIWA 4CUJA 2RJ3A 4NYJQ 5FOXA 1E0DA 4NS4A 3RK1A 1KFBB 3IIEA 5DTEA 1ZMOA 3FWYA 2EF1A 4AN0A 3ZU4A 4V0MA 4CHTA 3A2LA 3B8EA 4EUSA 1E2LA 3IXQA 4F6LA 1I7LA 4EJSC 2VJCA 1BOOA 4C0HA 3NDPA 3U60B 3HI4A 1Q95A 2QVYX 1AUPA 2IF2A 3C6XA 3KEMA 1QG6A 3OCXA 4MV6A 4NBKA 1J8QA 3LJKA 3PEVA 4EW6A 5IT0A 1XPRA 1XNRB 4Y2YA 2RAVA 1KO4A 2R0QC 4DS3A 5K8CA 1DXOA 2WA1A 2RJNA 2WIDA 4J0FA 1I7SB 1M2KA 2H11A 1Z4MA 1ZGHA 2PKXA 3QHPA 2JJMA 1DOZA 2NZ8A 3ELUA 1QR2A 3F8WA 1Q0PA 2GZRA 4JZKA 2E5FA 2ZITA 3A7DA 4KP7A 5ALTA 4R7TA 1Q14A 3DOOA 4JBNA 1R8YA 2ZZMA 4C43A 1EG7A 3EHDA 1AKRA 3I37X 1H9BA 5DGHA 5HZMA 3BJIC 4K6MA 3SM3A 5BR4A 2GN4A 4HYEA 4YRDA 1WB4A 1GITA 1VGRA 3JQAD 4F21A 4F56A 4P0TA 3KPUA 3TECE 3EQ2A 3DFZA 2XKBA 4M8NE 4FHEA 3JX9A 3QVSA 4WH0A 4KQ1A 1DTEA 1HEIA 2C8KA 2H4WA 3HUDA 4LK3A 1CUIA 2PS3A 3CEPB 5K51A 3RNLA 1JEYB 2P90A 2ZSKA 1KI7A 4N0MA 4OA5A 1FYEA 3URMA 4L4UA 4LZPA 1E0AA 4ARIA 3ROFA 3PNPA 1JFFA 4PE5B 1GEEA 2UZ1B 2CB0A 3ICOA 2HJHA 2A33A 4LOHA 2JHCA 1M75A 4BZPA 1QF7A 5EXEA 4BO7A 4ND2A 3QQPA 1U28C 4Q4HA 3GFGA 4QU9A 5KDOA 3DO5A 4HGOA 1U7WA 2G5PA 2JHPA 1SHUX 3KOUA 1K7EB 2YR0A 4KI7A 1ZX1A 4XIYA 5DEIA 2YH2A 3OFKA 1J5EB 2OOSA 2J0UB 2QGZA 4R54A 4YVFA 4RSMA 2EX0A 3UCFA 3ADPA 2BUBA 1A1VA 4J1TC 1Y7TA 1HZJA 4EX6A 4OAPA 5BSWA 2RHOA 2GBPA 5HJ5A 3FA2A 1F9EA 3K0KA 3UA3A 3J7TA 4BVFA 1MJ5A 4GSLA 4K8RB 4LYYA 5HOQA 1TVMA 4WUVA 3ND8A 3PPYA 4K2HA 4P1ZA 2XUOA 4ZT5A 1G8AA 3LVQE 3JASB 4HGNA 1LK5A 1VBNA 1S2DA 2G6BA 3DVLA 2DULA 4LGVA 1C14A 2FZKA 3JAKA 3I52A 3FI0A 5ICEA 5KNLA 3HKEB 1K97A 3O6VA 3OOHA 4XEHA 1CJBA 2VHJA 4C0SA 2Q4BA 5F1OA 3ZE8A 3O95A 5A4MS 4EYGA 1YRAA 3V1NA 2QZPA 2RC5A 2A2ZA 3JU3A 1A4UA 2YUIA 1XQYA 3H65A 3N6XA 3V2UA 5KVSA 5E95A 4MLZA 3MVEA 4DV7B 2Z98A 3FOEC 1V37A 2WLSA 4D9HA 1IEQA 1SCDA 2W58A 5TV2A 3WS7A 4UMFA 5EUBA 1XXHE 4OSEA 1X7WB 3CVUA 1E1DA 3R2JA 2ZWAA 5CEFA 1R1DA 3O03A 3R0VA 3W8FA 1E3WB 4MVJG 4Z7JA 2CUTA 4JGBA 1O6BA 2ETVA 4IXDA 1YZQA 4FNGA 4I5FA 4Y7CA 3T4EA 1XDBA 1ZD2P 2IZ0A 2MMCA 1XQWA 5F1YA 2COUA 4G6ZA 2XF2A 4PQRA 4N7RA 4JI6B 3PS9A 5B4TA 4HNRA 4CKCA 1MX5A 1HLDA 2PLWA 4MQ6A 5I4IA 4MW0A 2BGMA 2VUHB 4QXQA 4R2HA 5BSKA 3L7CA 1VI6A 4IVPA 1KEPA 3SZ3A 1JKFA 1MJHA 1XELA 1MTZA 4KQ6A 2OXCA 4R84A 3EMKA 5CXSA 1GTVA 2CL7X 3LXUX 1LFDB 2X7XA 4TVBA 3TVTA 1CY6A 3VR3D 3LKZA 2AJTA 4OQNA 4BBZA 3GQBB 3N7UA 1JDJA 3MW8A 2J5RA 4I5DA 4IFEA 4KNWA 4LY6A 4FR5A 4PZAA 3QX3A 1OTHA 2VBFA 4UHKA 1BS9A 1C4WA 5K3AA 3TK1A 5TS3A 4B3DA 4GMDA 3IBYA 2V74B 3NJ4A 3VNAA 2ZS8A 1XVLA 1JHYA 2BWJA 4RAOA 1E99A 2QUZA 2CLHB 3SC2B 1XCGB 2Z2XA 3VDRA 3T5DA 3TOZA 5A9SA 5TSDA 5LQUA 4YAGA 3D54D 4BKRA 2XODA 4FCCA 4BNGA 3C8UA 3SVTA 2ZUFA 7ADHA 3GNSA 5BR8B 3QE0A 1CQWA 3BICA 5ES3A 1RE0A 2H2GA 3TRHA 3FIUA 2YWCA 4M8SA 1K5GA 4X3PA 4BNKA 5JNWA 3NAMA 3V4LA 5LOVA 4B3SB 1MIOA 1WQ3A 2YNMC 4KRGA 3PZBA 3TLKA 3WKCA 1ODIA 1Q21A 4GU5A 3L6UA 3LUGA 2ZYTX 4FINA 1MKYA 4RD4A 4KPEC 2A6PA 1Y3DE 4YASA 2WFLB 2XE7A 5JT1A 3OP1A 4ENWA 3G6WA 1E1RA 3BE6A 4NS1A 3KAJA 3BXZA 4D8UA 3NVMB 3IBTA 1J39A 1C0IA 1ZHOA 3Q5DA 1CUUA 1IDN1 1XCPA 3ASUA 4Z9XA 1RBMA 2ZR7A 3ER6A 4CQNA 1B6GA 3AEXA 3DPIA 4EIWA 3NRCA 2ZBFA 5KOHB 3I58A 4A5OA 1YVEI 3OFNA 3ISVA 3PR1A 4YXWD 3NMUF 3TTXA 1BTOA 2G63A 1UKVY 2DOKA 4XWOA 4OI2A 3WLOA 5K20A 3F6BX 4ECAA 1ZK1A 4EB6A 1Z8HA 4HDQB 3WNZA 3H2BA 3UUGA 4ZHQB 2Q2NA 1TU3A 5TQJA 2OZPA 4EBFA 1NUHA 2CK3D 3P7MA 3EVCA 4PFSA 2O07A 2EJTA 4RIHA 5J2UB 4D3YA 1G2QA 1HC7A 2YZMA 3FLEA 3GJXC 4FT4A 4U9HS 2XE4A 4MVJI 2P4HX 4MKZA 4M1OA 4J3FA 5GIPE 4B84A 2EGGA 5J23A 4JY7A 1PLKA 3NEJA 5ECGC 4Q01A 2FLVA 5AT1A 3W5AA 4EHKA 5KNCH 2AYYA 4EA9A 4TV9F 1E6MA 1WRBA 2JGFA 5I7FA 4GOOD 3DKRA 5KNBD 2ZPTX 4PHFA 5EJ9A 2C7VA 1HT3A 2OT3B 4OH7A 4RCZA 4NBTA 1P60A 2JAOA 3VAAA 3OI7A 1P4HA 2Q7OE 3ZY2A 3NC0C 3Q11A 1YMVA 2W8ZA 1SVMA 2GK6A 4QODA 3E3MA 4LKOA 4YXWA 5LQKA 1YA6A 4XW2A 2ZVPX 3MWYW 3DE2X 5FFMA 1GIAA 5CFRA 2YHSA 3BH6A 4DJDC 3VR6D 2LKDA 3IBSA 3MYRA 3R7NA 1Y8QA 2BZ1A 2VHUA 5KQSA 4I2VA 2C3UA 2CK3A 1YRBA 1K8QA 1A9TA 2H2AA 2WD7B 5AW0A 2C9BA 3EXEA 4NSNA 5KCZA 1QV6A 2NZUG 2HO4A 5HA5A 3PPWA 2EZ9A 4ENRA 1QYDA 3H11A 1CDDA 3DLAA 3WBKA 2O0LA 1JNYA 5LU9A 4DV6B 3AK4A 4BO3A 3VH1A 3IE2A 5KNBA 5I01A 4J76A 3H6HA 4CTKA 3STUA 4NXNB 1W4BA 1KH3A 2DWPA 3JWPA 3NHUA 4IJ5A 4DLUA 5ER6A 3TOCA 3R7AA 3IBGA 2YYSA 5T67A 2ZZKA 2JRCA 3MTJA 4JLJA 3WICA 1LSSA 3R7WA 5TVKA 2VT7A 1IN6A 3KJFA 3ZV6A 4PYOA 3KUKA 5CLHA 1SVWA 3BA6A 4JUBA 3GJRA 2JBAA 4QOEA 1IHUA 3O3NB 4KFCA 3FX2A 2FMUA 3GW8A 3DLCA 3VGPA 1EP1B 4DA8A 2Q1XA 2P5YA 1K8RA 1X6VA 4QAQA 2VPWA 3VJKA 1MPTA 4UHEA 1T2EA 1RT9A 5HE8A 1VE7A 1ELOA 4DCOA 5H83A 5F77A 2XDQB 3TAXA 4CTJA 2JKYA 2KE5A 3EIHA 2G0AA 3TJZA 1QS0A 2ZTVA 3VU9A 5M7EA 4WOPA 3MSCA 3UJ7A 2Y1GA 4B3TB 1WZCA 1ESCA 1FYDA 2HJVA 2ZRCA 3R6WA 1J2JA 2ZTUA 2X23A 4LF5B 3T0GA 5CBKA 4C7JA 3FBGA 1SFRA 3GEHA 4FFRA 2QMQA 4MW2A 3JWGA 1JB9A 1JPJA 1U5CA 5C31A 4Z7QB 2GESA 2FEKA 3B3GA 3LO8A 1WXWA 3BREA 3MNFA 4PY2A 4B6RA 4F12A 2CXRA 1RPAA 3MTIA 5K2OA 3IDQA 3PDIA 1SELA 1NX6A 2VHWA 4TLBA 2ZDGA 1JDPA 1AQYA 3NTXA 1ORRA 4KQCA 2GZMA 5DWVA 2OFFA 4KOEC 5EN4A 3HFRA 4QUGA 2H2DA 1A9YA 3SJBA 1G17A 2PH3A 3KKPA 4Z0PA 1N5LA 1Z07A 3BMNB 4KMOA 5D3QA 1Q0UA 2RGYA 3STXA 5K01A 1LS1A 3N2YA 3NV9A 4GM0A 4NOLA 2YN4A 3OF3A 3IHKA 3Q8XB 1E4EB 3QPUA 1SVUA 2ZJ1A 3O4RA 4FFWA 2QQ5A 5LQMA 1AE1A 3JPYA 3CLTD 1Z26A 1SZCA 1ZCBA 1CUBA 3DD5A 3EF1A 3I1IA 4TTQA 3W34A 3N8NA 4AROA 1OHHA 3Q9SA 1G5QA 4LRUA 1U1EA 4F5DA 5IDWA 1ZWLA 1PGOA 4OP3A 2VTDA 1FXWA 1USIA 1SCBA 1Y4SA 4L75A 5TB5A 3VJRA 1KO7A 3JYNA 3OKPA 3R44A 4J2HA 4DR1B 4IOJA 1U8YA 4X7BA 1T9GS 4HXGA 1L1RA 1RLMA 4FHDA 4RIGA 5CPBA 3EARA 1I4OA 1V1MB 2EFJA 4O33A 2LCQA 1Z7WA 4PQFA 5U1PA 3GZNA 1AKNA 1PL6A 2REOA 1VMIA 2Z2KA 3DMPA 3WGLA 2DT5A 4CCSA 4IAOA 3IV7A 3T3NA 4FKZA 4KBGA 2ZG6A 1T6ZA 1BXRA 2WY2D 4CDNA 4K81B 5BPHA 5MN6A 1SHZA 5HQ3B 2W11A 4IUBS 1H8EA 3VNRA 3HY3A 1DKMA 3DGEC 1A8HA 2XBUA 4FHFA 4YBRA 1ZONA 2XB9A 1M2OA 4DB2A 5CA0F 3HG7A 2P77A 4M0MA 1NE2A 4HNSA 4NEGA 4U7WA 3WLMA 4ALNA 1VCIA 4W9RA 3REGA 3K0AB 1CK4A 4A03A 3ZZNA 1J42A 4BN0A 5JAUA 3L8DA 1EIWA 5JNLA 2Y1WA 3MQ2A 5ALPA 1KBZA 1PU2A 3HZHA 3OZSA 1EFVA 2VKQA 3KT3A 4AKTA 5GV7A 1O4WA 1YB7A 4HAZA 4OK3A 2QQ0A 1VSBA 4HLUC 4X94A 3QU9A 4CM1A 4I50A 3HBJA 3D4PA 3TZ6A 2VI5A 2BMFA 3QEMA 2OTCA 3L93A 3V7FA 3PQFA 2G5CA 4F4DA 4V2IA 1R0KA 3IP5A 5HG0A 3WJ7A 4A10A 2ZZNA 1H22A 1OY1A 4JQCA 2GM9A 1S89A 3BYZA 1XEWX 3IAFA 4LQCA 2BW0A 2OWDA 1ZW1A 2P8JA 3NC1C 4P81A 4UHHA 2XF8A 4ARCA 4P0PB 2JCYA 1VE9A 3U4HA 5CEJA 4W1RA 1IK4A 2DHCA 2G8NA 2QZJA 3TKAA 5GGYA 1E79A 5K0EA 4ZGGA 4GLJA 4JLBA 2JJYA 4LHEA 4R7GA 2V7PA 3ZWAA 2II6A 3LGSA 1NJ8A 2CYBA 4LJ6A 3C39A 3T5MA 4RKFA 1JIXA 5G4KA 4CN9A 6PFKA 3I6MA 5CVUA 2HIGA 1MVOA 1I10A 3O8OB 2H65A 2VR1A 4TMTA 4M1YA 3FPHA 4F86A 4GVLA 1XMSA 1XVVA 3UWPA 2P2DA 2ZAYA 2EU8A 4PO9A 4RD2A 5CM8B 1Y8CA 1GSHA 2CXXA 2ZWIA 2D4AA 2AQKA 4AAYA 1PTJC 2OV2A 1SULA 1E1QD 1YGPA 4NYIR 4J7AA 3EPPA 2Q2VA 3CJTA 4WL0A 5J2TB 3LYAA 5CCBA 4OQFA 5A5DA 1WOMA 2OO5A 1JFVA 1T9GR 4F6RA 4Y2UA 3B48A 1YKGA 3EOBI 1OBVA 3OM0A 1LX6A 1VJ5A 2C58A 1FDRA 5KAMA 5KDDA 1EUQA 2YHUA 1Z2EA 4PPGA 3B52X 1VGQA 2HPAA 4UCWA 3FMVA 1CB0A 5E7JA 1QBKC 4PG5A 4L50A 3LUDA 5LBUA 4CBVA 2CWWA 3CONA 1BOFA 3KHTA 3UT5A 4OFWA 3H05A 4Q24A 4GXNA 5GVRA 4PSCA 3TR5A 3K9GA 1CFZA 1I8TA 5AICA 4AWXA 5C1PA 2O8CA 3JSXA 3KNZA 2EP8A 1NR5A 1VXRA 2GXQA 1LPAB 4LE2A 4MARA 2B7BA 5HE9A 3V1YA 3H3JA 4HI0E 4JLUA 3AVTA 3NYIA 2W6IA 4D9GA 1AHPA 4OSOA 4NJOA 1ONSA 4ZQHA 4ER6A 3U81A 1W19A 3LUHA 3K8QA 3BIOA 2HN9A 4MSUA 3OQHA 1ZGAA 2JIRA 1PJQA 1N5JA 2X42A 2ZSUA 3G7SA 4HBGA 4JR2A 2YWGA 5I5GA 4MQFB 1VL2A 3GR6A 3OVMA 2DUWA 1KERA 3JARB 2XMCA 3T4XA 3ZWXA 1J8DA 2VSNA 4AIIA 4OBWA 4A0GA 3TL6A 5IFLA 3BSSA 4JZYA 4TVSA 3FLAA 1W34A 1ZJ5A 2H4ZA 2EGUA 2BF4A 4ZYZA 3HKCB 5LLTA 2IZZA 1VMEA 4DCUA 2CL0X 1RM4A 1VPLA 3CISA 4B3CA 2B2CA 2YS7A 4P84A 4E2YA 1XB2A 1ZCAA 3U7JA 3CR8A 3E9MA 3QG1A 1HMPA 1ZD5A 4H7JA 2A9RA 3ASYA 3BK7A 4XGNA 4DANA 1LPBB 3UJHA 1Z73A 1N6NA 3D6HA 4XD7D 3RC1A 4UHFA 1S3IA 1EWQA 4BMZA 3CTMA 3Q85A 1GTRA 1DLIA 1V95A 2RSLA 4OQYA 3HDGA 1Z5VA 4H1TA 5A6VA 3ANXA 1QQBA 7MHTA 1QCZA 2OE2A 3Q12A 4JUAA 4QPZA 4U6SA 2PGDA 3OLWA 4L0QA 3R1IA 2ID7A 4TS3A 2Q41A 1AB5A 1E2GA 3L4BC 3OA0A 2ZR9A 5EZ5A 1VGVA 3V32A 3BBPA 3PYMA 3SBEA 3V8RA 4BTEA 4DMFA 2FQQA 1CJUC 1BCSA 5B1HA 1KEEB 1NZDA 2VUIB 1L4EA 4OGGA 3HNOA 4YJ2B 4MVJD 5DISB 3EY4A 1GQOA 3WRXA 1Y9DA 3DBHB 5ALLA 1KDZA 3IJRA 2FG7C 4Q3LA 4G86A 4D97A 3HDQA 1CLUA 1ESDA 1RPJA 1OA0A 1RQLA 1YE5A 1G18A 3K53A 3A37A 1JJAA 3CH5A 4XD7A 3HO8A 4ZVUA 4YMSA 2W90A 1KE1A 4NTZA 4RK6A 3OTOB 2R44A 4C30A 1LB1B 1N5RA 3DWIA 1M2FA 2LIVA 5FBLB 4U3JA 2QRNA 4XR4A 2IYLD 1KZ1A 4PNPA 4YWHA 4M89A 2A3RA 2NX2A 5E7IA 1SCKA 2XD4A 3QVUA 4N6OA 2P9GA 2PH1A 2MOKA 2QU7A 3HHPA 3LRTA 3OTIA 4KQWA 4MJ7A 5LQAA 5LQDA 2J9FB 2ZQYA 4XI9A 2I2XB 2R6AA 4HAWA 5DV9A 2FMTA 2QLTA 4JU9A 3NLLA 4UHBA 1QH8A 4UVDA 4UBNA 4GNRA 2ZSHA 4BDSA 1N8TA 3NTRA 2QTZA 4G5SA 4MR7A 3HXOA 3KU1A 4MVJA 3V8VA 1REQA 2XD9A 3C7TA 3DLBA 1HNNA 1LSJA 2OCGA 4ETWA 2ZJOA 3PXGA 3AYXB 3QNUA 4DR2B 1T9ZA 3H83A 3IP7A 1KMCA 2CWDA 2YKGA 3G2HA 5CUQA 2HF9A 5EPEA 2YXLA 3OJ0A 1XPOA 2A14A 1JNXX 1ZXBA 3AINA 3SKXA 4AZSA 1TMYA 1ZD4A 4QQKA 4KIUA 5HIJA 1X80B 3W2TA 5JFOA 3CZQA 1PZMA 4IMJB 4LHSA 2VTBA 4I1OA 2P9FA 2BGNA 3K1AA 5BYJA 3K71B 2CT8A 4ZO7A 4P6VF 2DR2A 3W7AA 5J47A 4DMKA 2QUIA 5L3SB 4YV1A 2Q3DA 3EF0A 4FJ2A 4D7AA 3K9HA 1PS9A 1U2GC 3GWGA 3O8QA 2GCOA 3V8EA 4OYLA 3P0HA 4FIZA 4RTJA 3DE5X 5EKSA 1KQOA 4XLZA 5C1DA 4PYJA 5K9ZA 4JJ8A 4N5LA 2GARA 3TLBA 1L8AA 4J43A 2DHDA 1KZ6A 3VHRA 1ODTC 1EP3B 2H52A 1JFTA 3N5KA 4A3SA 2JFWA 1R88A 4N41A 1CF4A 2JZCA 1FFGA 3CUTA 1F7UA 1SK9A 3MUFA 5TXGA 3RYIB 4X85A 4E51A 5GOZA 1LWNA 3D81A 1K66A 3DDWA 3ND7A 2V3WA 1WX1A 2ZSIA 4HEA6 4IL5A 4DC0A 1M1UA 5EQFA 1QQTA 4ZICA 4C0AC 4BLTA 1D9XA 1K7XB 1Y1PA 2X9VA 5EWLA 4OLBA 1Q50A 1N2CA 1DBWA 1GNLA 1L6RA 3CH6A 1I2ZA 4M3NA 4QHYA 3MUOA 5PNTA 2WTXA 1E2PA 5MN5A 1B23P 4DR6B 3KEGA 4GG1A 4LJAA 4ASUD 4E22A 4DLKA 1NXQA 3RTCA 4PG7A 1R9MA 3QVOA 1PR9A 4MRPA 4C5CA 4B79A 3BMCB 4EAAA 4J0HA 1H8HD 3DW1X 4H77A 4RF4A 3BK2A 1R5OA 3TAUA 4FP9A 1C1YA 4XVQA 5CB4A 5DK6A 4X6LA 1WHTB 4RSGA 2OC9A 3MSXA 4TXJA 5GMOA 2VP0A 3VH4A 1XJWA 5ELMA 1Q11A 1Q0SA 5DGIA 3IR6A 4DVGA 4HDOB 5FPPA 3FTPA 4EGFA 3IVXA 1VCHA 4Y9DA 3V4PB 3VHXA 2QTMA 3AIOA 4WSOA 5AI4A 3UXYA 5JRDS 5IM4F 2WBLC 2P9BA 1PL8A 1PQPA 4KZKA 3TE7A 4LC1A 3BT7A 3IQWA 3AUJB 4R8MA 4IQGA 2DLCX 3NIGB 4RDXA 2ZYAA 1WR8A 1K4MA 4U6QA 5FNVF 1RRCA 2QN8A 1KXJA 2QW1A 1YZGA 2IEIA 4CIVA 3NASA 3TOXA 1ZZEA 2G67A 1NMSA 1B93A 2Y4NA 2GTIA 5CT5A 5EUMA 4ALKA 4FYYA 5AW7A 2Z4SA 4GZ3A 2ZOSA 3C3XA 4FKMA 4U02A 4UEOA 3IDSA 4O4HB 4BKMA 3W3AD 4Z5XA 2IYUA 5KX5B 6ADHA 3UC5A 1SVLA 2WOJA 3CLUC 3ZGZA 2W6QA 2WJVA 4KWTA 4INZA 1P1HA 1IZ0A 2WG0A 3SFTA 1BC5A 3TCNA 4AKSA 4PYQA 1QMGA 1VP3A 2HX1A 1GVHA 2BN4A 2I4TA 2AXNA 1I14A 3KPWA 3VPCA 1X1CA 3ITDA 5FRDA 5C8XA 1W25A 1QRRA 3H6GA 5DYGA 1XCOA 1E61A 1FSGA 2XPCA 4HDKA 4Q9DA 4EG4A 5C18A 2QXTA 3HKBA 3A6KA 4LQLA 5DM2A 2AG0A 4EY3A 4V24A 5HZGA 5BN3A 1ZSVA 2R96A 4FGWA 1FW8A 4MEJA 2XT9A 4QDTA 5DTRA 2FWJA 3IUYA 1YBFA 3RYCB 2AFHB 2DY0A 4WX2B 1C8KA 3SR0A 4YP0A 1FSFA 3W3AA 1W9MA 2ZTSA 4PO8A 1VLJA 3UANA 2IYXA 2C2ZA 1HDGO 4PC7A 2RGAA 4A7PA 3STWA 4UVHA 4LOIA 3U1VA 2CLIB 1BCRB 1DJLA 2VLBA 3EXG1 1YDFA 2DLNA 1VBKA 3N0RA 4MO2A 3PSAA 1CY0A 2YQ5A 4LRYA 4OB6A 3SR4A 3TSZA 3ZDBA 3LRPA 4G4SP 3RUDA 2M6KA 2MR6A 1SCNE 4X1KB 5HUHA 3L49A 1OIVA 3JV7A 3ZKWB 4EO7A 5K0BA 1TUEA 4EELA 4YT4A 1SD2A 4RDIA 1E18A 3TYXA 4EPVA 2DG2A 3M1IA 3UT6A 3TW6A 4FFNA 4W5QA 1VSVA 1XTRA 1Z7EA 4B3BA 2D8MA 2W2XA 4L76A 3EAFA 1QLJA 3BMOB 1FP2A 1O57A 1R64A 1XAGA 1ZICA 4HUQA 2V5UA 4IVQA 4IXMA 1V8PA 4KQJA 4OYYA 3TZEA 2L42A 1DTWB 4LIPD 2IW3A 2V7EA 1MH9A 3CTPA 3WBBA 4KWCA 3VR6H 1K8ZB 1PL0A 4F85A 1KAQA 5AQEA 4TKVB 3BAZA 4WN3A 4Y1RA 5JXJA 3RUPA 1TO6A 1US8B 1ZINA 2HHLA 1WE2A 2NVOA 3G9QA 2C92A 3JQDA 4AJHA 4E09A 2O5CA 3MERA 4PLPA 4EB8A 3I62A 2RG7A 1H23A 2ID4A 3ODPA 4OG2A 4WA7A 5TQ2B 3WIVA 1DWQA 1AK1A 2RHDA 2QMOA 3ZW9A 1JR3E 2DSNA 3NATA 1OI4A 3KQYA 2AW3A 3KJZA 5J40A 2IYAA 4FQ8A 2PYIA 1BE1A 4KXMA 4L7QA 5FLEX 3ZHCA 4JFRA 4YRTA 2O2ZA 3QWIA 4IDBA 5AOAA 4B80A 1QAQA 2JBHA 4QFBA 1EG2A 1Q3HA 4DBZA 3A6HA 3GJ3A