2DR3A

Crystal structure of reca superfamily atpase ph0284 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
239
structure length
232
Chain Sequence
RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKGIIVYPDKVLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RecA superfamily ATPase PH0284 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords UPF0273 protein PH0284
total genus 74
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dr3A00
2GETA 1GL7A 1JXMA 1N5LA 3PUYA 5LBIA 3W8NA 4BASA 1DARA 4DSNA 4RZXA 5JSZA 3OEEA 4D82A 1OH5A 4G3XA 3RRZA 1SGWA 4AKIA 3QBVA 2CLDX 2YC2C 1GWNA 1SVIA 3U3MA 3RS5A 2KBFA 5CLLA 1RC8A 1ZW6A 2J41A 4MKHA 1XD2A 1P61B 1MOZA 2F3RA 3X1YA 4P3YA 4DIEA 1AQUA 3UG6A 2ZEJA 1KSJA 2EU8A 3U3JA 2GXAA 2QRZA 1S8FA 5CB8A 1WP9A 2CXXA 2V54A 2WOOA 3ZVRA 3IDQA 4DWJA 2WTUA 2WWFA 3QUSA 3C41J 1EGAA 2Z0MA 3UK6A 1J99A 1ZNYA 3WNBA 1Q1EA 3F0TA 2ZS8A 3TSZA 4DLYA 4OI2A 4M8NE 5FR2A 3MD0A 5DE3A 4JVNA 4LI0A 1QDEA 3AVPA 1O87A 3B5JA 5JZVA 3PEWA 5AJWA 4G5OA 4HB0A 1P3JA 3SI7A 1NKTA 4OHVA 4Q4JB 2IYTA 4TMXA 2GRJA 4XVUA 1DTSA 1U9IC 5CM8B 2IX3A 4PAMA 1XMIA 3A58B 1GDDA 4LHWA 5EUQB 5KPDA 1QHSA 3MJHA 5EE1A 2FZ4A 2XSZD 4TSFA 2JLYA 4TQAA 1QBKC 4CYMA 3AVTA 4RD3A 3Q72A 2HF8A 2WMOB 2ONJA 4IJMA 4EPVA 5KNBA 4C2TA 3TR0A 2QE7D 1R0ZA 3QXSA 3AUYA 2GCOB 4OKSA 3E70C 4U7DA 2H5EA 3R9IA 3R9XA 4TZ0A 1G8PA 3GFTA 4US1R 1ZNXA 3I61A 2GDJA 3E5HA 4PC7A 3EWSA 2V7QD 4UXJA 2ZR0A 1FQKA 2W0SA 1WBBA 1GILA 1G7CA 5DYIA 4LBVA 3OIUA 1YR7A 3DKVA 3LXRA 2ZRDA 3CR8A 1FP6A 3CM0A 1CS4C 1U98A 2OE2A 3EIHA 3EW9A 4B3DA 4IVRA 3R9WA 3DDCA 2CMKA 2IC5A 1U8YA 2GZAA 4AIIA 1XRJA 2J0UA 4DLRA 2ZRGA 5A0FA 3SZRA 2IS4A 3U7FB 1ZM4A 3I3SR 1ZJ6A 5TMPA 2IYZA 3QIAA 4YONB 1N6IA 3PG5A 2BCJQ 2ZYUX 1P2UA 3CRW1 1YZKA 2WKQA 1IXSB 1OT3A 4IRUB 4EQ6A 5IHPA 2BV3A 4EPRA 3IIKA 1TL7C 1UBCA 1YZUA 3Q5EA 4CEJB 1XMJA 2OEPA 3JVUA 3KJHA 4JLKA 1R8QA 2PEYA 2XB2A 3K0EA 3UWKA 1G8GA 2BDTA 2ATXA 4URZR 5FOTA 3Q3JB 3IO3A 1IAQA 2OBMA 4J0QA 1U8ZA 4AI6A 3QOFA 3RS3A 3JVVA 4TYNA 4ZIRB 2JATA 1XPUA 3WYAA 1XCPA 1MO4A 5DN6A 1Z2CA 5DYGA 3EC2A 4QGHA 4BFUA 1E2JA 1FP7A 5F98A 3K8YA 4XD7D 4OHYA 1WF3A 1E9EA 1GOTA 1JQJC 2ZREA 2GAOA 4Q7MB 1LY1A 1U9IA 4URXR 3ADCA 2DBYA 4KHZA 1QHNA 4Q5IA 2ZIAA 4V0NA 2C77A 4LV6A 2ZJBA 4AURA 1ZC3A 2CDNA 2WPDA 5HR5A 3MAAC 2G3YA 1UDWA 4HYYA 3CF0A 3RRMA 4BZPA 3I5YA 3MCAA 2R6GA 4TYYA 2IW3A 4AC9A 1XEFA 2F1HA 4DBLC 2FFHA 3GD7A 1SKQA 2CHGA 2H8KA 4Z1MA 2MMCA 5BN5A 1AZSC 1TU4A 1C4OA 5SZHB 4MRSA 2KB0A 521PA 1AJEA 2BMEA 4A0FA 4UNRA 1WA5A 1AS0A 4I1VA 3TQFA 3F5FA 1TAGA 1JALA 1VG0B 1BMFD 1H65A 1Q1BA 5DH9A 2UZIR 1XEWY 2QM7A 4DCTA 5FPKA 3GFPA 2GZHA 3PEVA 1NSFA 4U5XA 1UDXA 2YOFA 3L8ZA 1FOEB 3RSLA 3CONA 2MSCB 3BFVA 3RS2A 1VPLA 1G21E 4BGDA 4NCNA 3EPKA 3CRQA 1ZVQA 1AKEA 2UZ3A 2JLZA 3B78A 1ZMXA 3K53A 3CRRA 3K9LA 5HE8A 1RPZA 5KYKA 1KKMA 2QU8A 4JBXA 2VP2A 3ZQJA 4OL0A 2ODBA 1NVUQ 3OESA 1RRFA 1FUUA 1F2UB 3ZVNA 5JEEA 1SVSA 4C0BA 4GL2A 4Q9HA 3TAUA 2XNDD 3BORA 1S96A 4M22A 2QA5A 2DFTA 1TPZA 4M1MA 2FZLA 3KUCA 1DG1G 2VO1A 3BC1A 4B76A 4DLUA 2QSYA 4QC2A 4TT3A 2A7QA 3A4LA 4GOKA 4KO8A 1OV4A 4TTRA 4URUR 2FPMA 4ZO4A 4A9AA 5L3QB 4HB2A 1GRNA 1X8JA 4B32A 3I8SA 4KFUA 3SYNA 4A82A 3BWDD 1CJUC 3GJ4A 3UATA 4QKQA 4OBEA 2HJGA 4HZUB 5F3WB 3N2IA 3REFA 4K81B 1ZP6A 4NL4H 2NQ2C 1MO3A 3AF1A 1U81A 4B2PA 1YHNA 3JZMA 4HB4A 4C9BA 2A9KA 5D3MA 4BEJA 3AKYA 1FL9A 1GNQA 1CTQA 1OH6A 5C18A 1T6NA 4YDHB 4NKRA 2G88A 1HQCA 4OHZA 5J40A 1E2PA 1QHXA 4A0RA 3FHTA 5DLQC 2ZQ5A 3D3QA 1UF9A 4D26A 3KFXA 4URVR 4GOXA 1KI4A 2QTFA 1OFTA 1GUAA 1UPTA 4Q4HB 4L9SA 3FB4A 4QHYA 2PJZA 1Q3HA 5DHAA 4IVQA 4BRWA 4QBIA 3KQHA 1E99A 4PHHA 3SJAA 2QBYB 3OIYA 1Z3IX 3CR7A 4OYHA 5JI3E 2ANBA 3CIOA 2YV5A 2WWHA 3TR5A 5AR1A 2NZ8A 2DB3A 2BHRA 3DPUA 4QJ4A 3KTAB 4NTZA 2QENA 3MWLA 5JCZA 3BH6A 1I2DA 4PC3A 2IS1A 4B71A 3I92A 2NPFA 3TJZA 2GXUA 1VMAA 3QY0A 1YZTA 2JJ2A 3GJ6A 5CM9C 4ZV4A 4EPTA 1KY3A 4G01B 2OHFA 4EUNA 3TVTA 2OG2A 1SXJC 2ZSAA 5KSOA 4P33A 5TY0A 3K9NA 3GLFA 2RGAA 3THOA 3QKSB 5M04A 2ZUDA 3AV0B 1NP6A 4LJYA 4AKHA 4L16A 4NHOA 1E6CA 3QF4B 4Q4AA 3AEZA 3P1JA 3B1WA 3FVQA 4MUBA 4B6FA 4HDQB 4Z51A 1FTSA 2IXEA 2ZE6A 3BH0A 4C3ZA 1NI3A 3I73A 1ZU5A 1MH1A 1SXJA 3UXMA 1R6BX 1SULA 3QVUA 2ZSBA 4JBWA 2QE7A 3NC1C 1FTNA 1Z8FA 2OXCA 1T0HB 2GF9A 4GP6A 3B6EA 1E9FA 2ZJOA 4LOAA 2ERYA 4P0TA 1KZ7B 1CLUA 3IEVA 3HU1A 1DEKA 2VHTA 3K70C 221PA 2YZ2A 2AWNA 5FFMA 1OH8A 3KDSE 2IYUA 5CYOA 4DCVA 4NYMQ 2V3CC 4DT1A 3VU9A 4HAUA 4ZDWA 3IIMA 4PO9A 2CJWA 1R4AA 4PSKA 3VU9B 3EX7C 4DT1B 2J1LA 3BGWA 1G7RA 1QHHB 3V00A 2QAGA 3BFXA 3K1JA 4HSEA 1Y63A 2QP9X 5JCPA 1YR9A 4FCVA 3AVYA 3U44A 4NP6A 3FWYA 3LW7A 4OI4A 2P6NA 4XTCS 2NO9A 1KGDA 3VFDA 3P27A 4G5GA 2R6CA 4L5BA 3QI2A 1J2JA 2GBLA 3E2IA 3W6OA 2RGNC 4XTRA 4XVQA 4TWZA 1E96A 1G4UR 3QNUA 5IRCD 1OXSC 2GCNA 2Q9CA 3FYHA 2IWRA 3L0PA 2V9PA 2F9MA 4L9WA 1TF7A 3AQ4A 5C1BA 3SHWA 3CF2A 2ATVA 3KQLA 5SZJA 1CR0A 4KXFB 4OJQA 2MSEB 5FL7A 4C30A 3O47A 1N5JA 1ZD1A 4XOIA 2XAUA 3A1UA 3DO6A 4M9QA 3QF4A 2VP9A 4MKGA 1U90A 3C14C 4Q4AB 2OSBA 4JVSB 2JDIA 1XXHA 3C8UA 3E1SA 1ZAKA 2KE5A 4V02A 3RSOA 4Z8XA 8OHMA 2OAP1 1CR1A 3AGPA 2H1LA 4QBFA 5KU1A 2R6DA 4KSBA 3MMPA 5CJ2A 4PHGA 1Z0JA 5DI9A 3H4MA 2QORA 4YMSA 1DAEA 2ODWA 1P2SA 1IJFA 3R20A 4P32A 3K0SA 2Z83A 1BYIA 3TSWA 2KI5A 3TNFA 5C46F 5J47A 2XTZA 4IXNA 3LO5A 3AVOA 1JJ7A 2BBSA 4I81A 5DO9A 1SVLA 2J87A 4M1TA 3KB1A 3MJRA 3BBPA 1GNRA 1KSHA 3K0FB 3THXA 2ZETA 3QEJA 4LHXA 5FOSA 1EFUA 2EVWX 1S3GA 3I8XA 4W7SA 3A1WA 4QNMA 1WB9A 3LWNA 1DVRA 1P2TA 1T3LA 1ESMA 1S0UA 1BH2A 3I4LA 4PQFA 1T5LA 3N5CA 1KAOA 1P9NA 2H18A 3W3ZB 1DAMA 3W8RA 3THYA 1G3UA 3U3OA 4Q1DA 2OLJA 2E87A 2WWWA 3SFVA 4CZ2A 3BFKA 5D3MB 3GQBA 2WKRA 4RFVA 1TU3A 4AK9A 1FMJA 3IIJA 3TK1A 1C1YA 2DHRA 2IYWA 3G0HA 2GA8A 5FBQB 5HE9A 2O8DB 1X6VA 4ZDIA 2J7PD 4JKIA 1N2CE 2P67A 1IOZA 4R2HA 5J4HA 2O8DA 1WDTA 1S4QA 4DIDA 4FMCB 3WBKA 4Q7KA 2VHQA 4LHVA 3K9GA 2ZJAA 3GJXC 3A8TA 3MGCA 3Q8XB 4OQXA 4YDSA 3UANA 5KHOC 3EA0A 4HAYA 4XD7A 5B30A 2ZJ8A 4KJZA 5LDDC 1LF5A 1N5KA 1KTVA 4JJKA 2QL6A 1WBDA 4LBWA 2FFBA 4DLTA 4UNNA 1N0WA 1ONBA 3CWZA 4C4PA 1M7GA 5J4VA 2HV8A 5HKKA 1YE8A 3K0CA 2HXYA 5GADl 2FFAA 3EIQA 3G82C 2SHKA 4M2LA 4DSTA 3NHBA 2A5YB 1ZUIA 1GITA 5FI1B 1FFHA 4C0QC 2BMFA 4G5RA 3A4NA 2AD1A 4TL9A 1PUIA 2HXSA 1KK2A 4ZPXA 3PITA 1YU9A 3TUJC 3RVBA 2NMVA 1LNZA 1BMFA 2CLSA 4JJZA 1X1RA 3CLVA 4XJXA 2XXAB 3U6BA 4MYTA 3UKDA 4B3CA 2WAXA 3L8YA 2PX3A 2IUTA 4GBMA 3WNCA 4HAVA 1RZ3A 1TUEA 3BE4A 5FI0B 1B0UA 2OUKA 3N70A 2VP0A 1H8HA 2NO1A 3MLEA 2BKEA 1ESNA 2GK7A 1SVKA 1E2LA 4H1VA 1UADA 2QUZA 2J0SA 1NN5A 1NVVR 1SKYB 1XD2B 5CYPA 1U2RA 4PX9A 5KSYA 3CRMA 1E32A 1H8ED 4UJ3A 3T15A 4ARZA 1YR8A 4Q1FA 2JDID 4M1YA 4IDPA 4CVNA 1UBEA 4QOSA 4PPFA 1D6JA 2PEZA 4TSFD 1UKZA 5HCNA 5EZ6B 4TMKA 1G64A 4C0SA 1Z6GA 1AQYA 2EWWA 1TUIA 1SVMA 2G83A 2F1IA 3RDPA 4RD1A 3QXCA 4JBYA 3ASZA 1OJLA 5CIWA 2C03A 3OFNA 4WAUA 2DFNA 5GJVC 3SR0A 2C8VA 4I4LA 3U44B 1DAHA 4LC1A 4NCIA 3X1XA 4JLOA 3KXIA 3U3RA 2IYLD 2ZRFA 4BEBA 2J0QA 2WSSD 1UFQA 4MUAA 1A82A 4CEIA 3K09A 4OQLA 4N0EA 2ZRCA 3FMFA 1GKUB 1P72A 1L4YA 2AHOA 2C95A 3B2EA 1IN7A 4MH0R 4XH9B 1JR3A 3D31A 3L82B 2B92A 4BFSA 1Z6TA 2ZJ2A 4OI1A 3QF7A 4KAXA 4F7WA 1II8A 4ON9A 3SC3A 1FNMA 2JLVA 4FWIB 1G8YA 1KY2A 2V6IA 4TTQA 5C4GB 1CRQA 1KZGB 3BERA 5CITA 3IPXA 2RB4A 2UVQA 4A15A 4DLSA 1PLKA 2Q21A 4BLTA 1P75A 1Q0UA 5JECA 2KBEA 1MO6A 2Q3MA 2XZPA 3U4QB 1FNNA 3VHLB 1R8SA 3T1QA 4QM7A 3IHLA 2J0UB 5KOYA 1E94E 1NF3A 3AVQA 4O2LA 4JMPA 5EP4A 3T35A 4ERNA 3NDBB 3AVXA 4GT1A 1ZIPA 3HYRA 5CLQA 1H8EA 4JSYA 4ABYA 1OB2A 5FUYA 3V4FA 1E1RD 5JWHA 3QKSA 2ZRLA 1RVDA 3T5DA 4GSYA 1NY6A 2YC4C 3IQXA 1G7TA 5EXTA 4TMVA 2N1BA 3GLIB 4OK6A 1Q1QA 2PZFA 4GNKA 4D0LB 1M7HA 1P62B 2QAJA 2WWIA 3D7MA 2VIIA 4WA7A 2IUUA 2ZXUA 3U7GA 1GP2A 4DCSA 3AH8A 1CP2A 1W4RA 4JSTA 1VG8A 2CK3D 3LRPA 5TARA 2FG5A 1MABA 1GVNB 1HV8A 1OSNA 2BMJA 4JVLA 1KOFA 1T0JB 1ZU4A 4Z8YA 3KXKA 5AUNB 1Q21A 4Z54A 2BJVA 1GFIA 4L15A 1W0JA 3CW2A 5B58C 1X86B 5L3SA 4A92A 2TMKA 3CX7A 3JZAA 2IS6A 1KI7A 4LYFA 3ZVMA 2LKCA 3BB1A 4PO8A 5GVSA 3GLFE 2W58A 1D2EA 3W5IA 5KUTA 2E9SA 3SE0A 3X1WA 4JLNA 1QG2A 3N2EA 1Z07A 2AX4A 2B8WA 3AKCA 4D81A 1ANKA 1UJ2A 2C2HA 1OXXK 2P65A 2IYYA 4G0NA 1TF2A 1GL9B 3B1XA 4DDWA 5F9FA 1QHGA 2QQEA 4NZYA 5E3HA 4YQFA 4KVGA 1FUKA 2VHUA 4TN1A 4AYTA 2O8EB 3RYTC 2D7DA 3NEYA 5EXXA 4A36A 2GK6A 3IHWA 4AKEA 4ACAA 3PENA 4C0AC 3I62A 3FTQA 1OXUA 2ZR7A 1HH4A 4FCWA 1GKIA 2X1VA 1E9DA 2RHMA 4DDTA 4YMTA 1JR6A 3IO5A 4JLPA 3CNLA 1Z06A 2AFHE 2JLUA 3SBDA 5BN4A 5CB6A 5L3VA 2Z6VA 2GF0A 5G40A 1VTKA 4QGAA 2FPLA 3S1AB 3L43A 1SXJE 2NO7A 4DDUA 1RYHA 2QPOA 1F2UA 1W46A 2CEAA 2H16A 1KMQA 1T91A 4YC7A 3CO5A 2PLFA 1DS6A 1Q57A 2FE4A 4BLRA 4W9MC 2ZJYA 2C98A 4ZI2A 3NBYC 4FN5A 5BQ5A 3T1OA 2OBLA 4NMMA 1RRPA 4R71A 2I1QA 2ZPTX 3QG1A 4D0GA 2F3TA 2P3SA 3HPRA 5JI2E 3DOFA 2AD5A 4BFXA 2YJTD 4X8MA 1GNPA 1CJKC 1SVWA 1KI6B 4QXAA 2ZE5A 1CF4A 2ZM5A 2OESA 3IBGA 4D4LA 1G291 2R8RA 1F3OA 4PQRA 4IFEA 4GI7A 2V7QA 4X8OA 3OHMA 2QMOA 1UM8A 1Z08A 2A5DA 4ASUA 2VHCA 1ZUNB 4OQNA 3KFVA 4PSVA 3WHLA 3DZDA 1S1CA 1OF1A 2NZJA 4PPQA 5KSZA 2J7PA 5JJLA 3LX8A 2XJ9A 3CWQA 1AN0A 2WMNB 3KQUA 2IWHA 3EG5A 2JGNA 3BIFA 3NDPA 5EP3A 1Z0AA 2NO6A 1VCMA 1R7RA 1XJ0A 3LXXA 4LV8B 4G5SA 2REXB 2VQSA 1E4YA 1F2TA 5AJYA 5EQTA 4AWXA 5FBWB 3B1ZA 3AF0A 1Z0IA 2XOKD 4UKDA 1PV4A 1F48A 1RKBA 5E7MA 1QHIA 1RYFA 2WWXA 3RWOA 3CX8A 721PA 1FW6A 1LS1A 2D62A 1AGPA 4ZCMA 1T4GA 3SJZA 2FU5C 4RVCA 3TLXA 2W2VA 4YMWA 4A2WA 1QRAA 1P9RA 3SYLA 1T8TA 3DVLA 4XWOA 4ZKDA 4F92B 2ZRJA 3GJ7A 6Q21A 1GG2A 4GPTA 3BK7A 1JEEA 1F6BA 3B85A 2JEOA 3ND8A 3FOZA 5GJCA 1XP8A 2DFLA 1JQLB 2RGBA 2F55A 1NSTA 2HF9A 3CUEF 4Q4HA 3F3YA 3H86A 4DZZA 4NCKA 5EE0A 2YNMA 1E2DA 4BZXA 1IN5A 2FGKA 4RZUA 1KK0A 4A8JA 1E2MA 5F9HA 3S1AA 1Z6AA 4RD6A 4Y0AA 2OCYC 1TEVA 3QJYA 1ZD9A 3TBKA 4AKGA 1OIWA 2UKDA 4MGZR 1NG1A 4MRRA 1HQYE 3BRWD 1Z5ZA 1XD8A 2YVUA 4QRHA 3EZ2A 1EG7A 1TQ2A 2IT1A 2PCJA 4M53A 5KDOA 5DI3A 4RKFA 3OEED 2CE2X 3LAWA 4W5HA 4C0HA 3CRVA 2VSOA 4ZCLA 4PZZA 1VG1A 4RFSA 1ETUA 5FBLB 1YZNA 1GKYA 1N25A 3VKHA 4M4SA 2V1UA 4Q03A 4V0LA 3HP1A 3RHFA 4O3MA 5DNYB 1W4AA 3LVRE 2GTPA 5CJPA 4B44A 5IK2D 1KNXA 3OEHA 4TMTA 1LFDB 3ZDQA 2W0MA 3VMFA 4W5WA 4OJKA 5FPTA 1KYIA 1R5OA 3W6PA 3KX2A 1X3SA 4E5UA 4V0MA 2ZYTX 4AY2A 1XXHE 3KQKA 1HT2E 3I5XA 5EXPA 2QPAA 2GVZC 1G7SA 2IA5A 1YRBA 1WMSA 1G8HA 2AFIE 2QP3A 1GSIA 3SOPA 2ZROA 2G77B 1COWD 1NL3A 5SZIA 2Q0HA 1XJCA 4HEJA 1KIMA 5EE3A 4JKYA 1HYQA 5SZKB 3FHOA 1JR3D 1NLZA 4Z1MD 4FW9A 2RMKA 5KTYA 1MABB 4M1OA 4QHTA 1JBKA 2JLQA 5AUOB 4KFRA 1N0VC 1VYVA 2Q6TA 4FCTA 2Q9BA 1G5PA 3B13B 2FOLA 1E2GA 4LCBA 4AG5A 2BEJA 2QGZA 5BXQC 2FNAA 2OCBA 1P6XA 3KJGA 3UWOA 2QG6A 4PC2A 2EW1A 3W5JA 3GLIA 3VQTA 3D8BA 3C4JA 4CW7A 2HEIA 2ORIA 1GL6A 2F43A 4HAXA 2JJ8A 2W2TA 4TLAA 3K9HA 1G4AE 1F2TB 2IUSA 3DHWC 4NCJA 3T1VA 4B75A 1E1QA 3SNHA 2D4HA 1CEEA 1W36B 2A5GA 1IQPA 3R8FA 1XTIA 4O2RA 3PUXA 2K5UA 5HZKA 2ZSDA 3R7WA 4OK3A 1G18A 2Y8EA 5TXGA 3Q7QA 3EPHA 2DCUA 2JA1A 3TUZC 2LWIA 1S1MA 2XSZA 3OIVA 1JI0A 5HTKA 3PJRA 3A1SA 2IF2A 5EE9A 4B33A 2IYVA 5A5GA 4QJ5A 5D3QA 3QEOA 3A4MA 4D4JA 1KHTA 3QSYA 2VSFA 4Q1BA 1NMZA 1GAJA 1E9BA 3TKLA 1QVRA 4JLMA 2CL7X 2X19A 2WHXA 2ZI6A 3KXLA 3AM1A 1D9XA 2J9RA 4HAWA 3MWKA 4CF7A 1W1WA 3SBEA 1XFAA 4BRUA 3TSOA 1G17A 2HLDD 1Z0DA 2FJUA 2GVDC 3LFUA 2CCKA 2EFEB 2QT0A 4GP7A 4DCUA 1Q22A 1RE0A 2Z43A 3K0AB 2QGNA 2EWVA 4UNPA 1XZPA 3Q7PA 1TEXA 3V9PA 5CIQA 4V0OA 1W44A 3BB4A 5L8VA 4CEIB 4CGZA 2QN6A 5KNCA 3QE0A 4M9ZA 3IEUA 2R6FA 5FBVB 3NVAA 4NPHA 2ZVPX 2GKSA 1NN1A 4LSGA 1J7KA 2DY1A 2EYUA 4R2IA 5E7JA 5G53C 2BEKA 4IHQA 1FX0B 1SZPA 2FPKA 2FSIA 3C7KA 3CZQA 3EZ6A 5E4FA 5E95A 3WP0A 5FTKA 2IYXA 4HLUA 1K6MA 4ZDKA 2EFDB 4OK5A 2JJ2D 4FD2A 3RANA 4IOJA 5GJBA 1G6OA 4Q7LA 5J4KA 1LV7A 4GFDA 1IN6A 1VCOA 1I2MA 2A2ZA 4JL8A 2WWYA 4WXPA 1NBMA 2MSDB 5FOUA 4NCHA 4II7A 4KYUA 3T12A 3DMNA 2AL7A 4WZBE 4FI3C 5KO2A 3OAAA 1HTWA 2XTNA 2VF8A 4Q9IA 1Q20A 4NE2A 3O8DA 4RJLA 1YVDA 5HPYB 2OM2A 1RRGA 3ZIAA 2WJVA 2CCJA 3VR2A 3OEHD 4M1KA 4DSUA 4DC9A 4Y0VA 4B34A 2B8TA 5ELXA 2DFKB 4XWKA 3C5CA 1EESA 2OO7A 1JJVA 3HPQA 3MUFA 5IDVA 3P20A 2GCOA 3FMOB 4JL6A 2Q9AA 2H57A 2R44A 4MKIA 1HY3A 5JRJA 1E79D 2GESA 1S9HA 1XD9A 4A8JC 2KWIA 3A1VA 2YOHA 3SN6A 2HLDA 5JLJA 3MFYA 1ELOA 1E98A 3TAHA 3X1ZA 5HCIA 1KO1A 4BFTA 2FDCA 4IFBA 1E9SA 5FL7D 3RABA 3EIEA 4MGIR 2J3EA 4JLDA 1OLOA 2FSHA 1FPMA 4PZLA 2JLRA 4RZ3A 1DO2A 5IT5A 4RSGA 3AKDA 5CK4A 2QSZA 4MYHA 3NH9A 1L8QA 2WZQA 2IS2A 1NN3A 2VP4A 2F9LA 2ZUBA 1KI3A 3AP3A 3L2OB 4QBHA 2W6IA 3ZH9B 4A6XA 1YZLA 4H1UA 4FINA 4AYWA 3U7HB 2AN9A 5JEDA 2FMXA 1M34E 3KQNA 1IJEA 4HATA 1VG9B 4WW0A 3DMDA 4EDHA 3WRYC 1BOFA 1HA3A 1KI2A 3NBZC 5FPYA 4BLPA 2J7KA 3ZZ0A 1K8RA 2F1RA 3ZYCA 1FZQA 2WSSA 1C9KA 3O8CA 4DSOA 5JJIA 4BECA 4NBSA 1I4TD 1G3MA 4LYJA 4E22A 2GHIA 3SEAA 1MR3F 3AF3A 4A1FA 2VF7A 1JPJA 2QEQA 3OIWA 4NONA 1T5IA 2IYSA 2R2AA 3CPHA 4P4TA 1ZIOA 2AR7A 1JAHA 1KSFX 3DL0A 2FN4A 3QXXA 4Q9JA 5KPJA 1M7BA 2OV2A 3FKSD 1HEIA 1MO5A 4EJSA 1T3SA 4TYWA 1II0A 2P6RA 5DIFA 2D2FA 3QVVA 4DLWA 3OF5A 5CDFA 4NYJR 1KKLA 4DEXA 4BFWA 1MRSA 2B6HA 4LPKA 3TH5A 2C9CA 3ZJYA 3VAAA 3CB4A 1CRPA 1P73A 1XMVA 4JT4A 3GLGB 5AUQA 1OXTA 3PFIA 4D0NA 2F6RA 3EZ7A 2W6JA 1OB5A 3PVSA 2OAQ1 2Q3HA 2ECKA 2J5XA 4IDNA 1KDTA 2EFGA 1QVAA 1CKEA 3EPLA 1TQ6A 4O25A 2N46A 3T61A 2ZI9A 1X8LA 1NJFA 4RD4A 1IONA 1OIXA 5G3YA 5J5CA 4B3GA 2F7SA 5L3RA 4YXWD 4FMDF 2YKGA 3LD9A 3LNCA 2IYRA 1BKDR 1G3QA 3NIBA 4HLQB 1GRRA 4LPSA 1NRJB 4V0KA 1GZSA 5FPHA 3PUVA 4DUGD 4AD8A 1IBRA 4KVAA 2CHVA 1COWA 4YMVA 2PZEA 5EUMA 2QMEA 1AGRA 2ZYVX 3PIRA 3UMFA 2VP5A 2OFXA 1ZINA 3W6NA 3ICQB 2A78A 1E69A 1DBSA 1S9DA 4F38A 1YZGA 4K8OA 2C9YA 1Z2AA 2KSQA 1CJMA 1UKYA 1XMSA 3THWB 4R98A 1SXJD 1D5CA 1KI9A 2WAYA 2PMKA 3FKSA 2GILA 1A5TA 3T34A 1W5SA 3C16C 2GEUA 3ZGXA 2IEYA 4P31A 1DE0A 5H8WA 3FKQA 1VCIA 2GEDA 2RGEA 3QKRB 1KI6A 1TNDA 1KDRA 2VEDA 4LJ6A 4KSCA 3TMKA 2HT1A 2OXRA 3IILA 3H1TA 4IXMA 1N6PA 2WKPA 4Q7JB 1P60A 1W7AA 3ETLA 1QZXA 4Q66C 4KBGA 1W47A 1JPNA 3KKMA 4HUQB 2C96A 3RAPR 2QAGC 3J81k 2P6UA 2DWQA 821PA 2DR3A 5LPNA 1E2KA 4CT4B 2VHJA 4RD2A 3IQWA 2QT1A 5EP2A 3GFOA 1AS3A 2W6JD 5BW8A 2JJ1D 3K0CC 2NPIA 4GMDA 2JAQA 4D4KA 5GVRA 1JNYA 1N6HA 1ZRHA 1NKSA 1NY5A 4ESVA 3CBQA 1XWIA 2PMDA 2Q3FA 4TL6A 2OT3B 3VKWA 4I99A 3NHAA 3WHKA 4QGGA 4DUGA 2I3BA 4CDGA 1KK1A 1R5BA 1NLFA 4ZKEA 4BZQA 5JHGB 5FTNA 4UNSA 3RS0A 4DLXA 1US8A 3OFND 4Q48A 1OKKA 5C4MA 2QROA 2PT7A 2N42A 1NVXQ 1EFRD 4FMCF 2ZE7A 3T5GA 4EPWA 4RFSB 1OYYA 1B23P 1K5DA 4V0ME 4IVPA 4UJ5A 1P7CA 1AS2A 2ODEA 4ESHA 1XU4A 3LBNA 3H2YA 3OZXA 3CPEA 1LB1B 4PC1A 2NIPA 2OCPA 1BIFA 3TGPA 4FMBB 3U7EB 4KITB 1HURA 1G41A 1XB2A 5TB5A 3DEFA 4F4CA 2GEVA 1EFCA 3DZ8A 4F4JA 2QBYA 2QM8A 1KO7A 1XBTA 1XEXA 3K0FA 3WYFA 3K70D 4A2PA 1EK0A 3THXB 4LBZA 3KUDA 1GM5A 2HYIC 1CJTC 2VRWA 3TUIC 1G8FA 1OIVA 2E1RA 4NYIR 4PSAA 4QBGB 5DGXA 1R0WA 5JS8A 2AKYA 3W90A 4A0GA 3AP2A 3U5ZB 3GLIE 1K5GA 4PXAA 1NIPA 5EZ5A 2P2LA 1LVGA 3M1IA 4KFTA 5BYJA 1E0JA 3UG7A 4FMDB 1AZTA 1MKYA 4MGKR 4C2UA 4QFMA 3B8HA 4LV5B 2QQ0A 1A1VA 2YYZA 4Q00A 1T8UA 2ZI7A 3QENA 1XX6A 1VYTA 2QMHA 4IW3B 1Z28A 2IBMA 4DJTA 1G20E 4CRWB 1P4SA 2FEMA 2OFWA 4O0MA 1GRQA 1Q1ZA 5JBQA 1IY0A 2CBZA 3ZS9A 4AYXA 3B82A 3SS8A 4C7OA 4HZUA 1EFTA 2BCGY 2A5JA 4LHYA 1ZCAA 4JLAA 1OFHA 3U3KA 3LW8A 1DAGA 2P0EA 1U0LA 4TLCA 1CULC 1J8MF 4HDCA 4LJAA 2IXGA 3P4XA 5L3QA 2O5VA 5C2JB 2O0KA 1HUQA 1US8B 3AF2A 2JLSA 1IN8A 5J4YA 1D8TA 2ZTSA 3WNDA 3L0IB 2BJWA 3KB2A 1CR2A 2WJHA 2AWOA 2X77A 3GLHB 1NG9A 3HJNA 3LV8A 2JIZD 4MKFA 2FGJA 2PLRA 1E0KA 4GZMA 1KSGA 1D2MA 1JR3E 3CH5A 4QG7A 5FTJA 4I1UA 2QRNA 3NBXX 4RD0A 3ADKA 1W0KA 1M1YE 2GJ8A 2EYQA 1XPRA 2VBCA 3SQWA 2J45A 2FEOA 2F1JA 3R8CA 1OH7A 4LK2A 4B2LA 1KI1A 3PEYA 2ZRMA 3IBYA 3MSXA 1Z22A 2IF0A 2PZGA 4CT5A 2CJWB 2IXFA 4P4UA 3SU8A 1L7VC 1DPFA 3KKQA 3B9QA 2ZU0C 4M21A 3K70B 4PHTA 1G1MA 5FR1A 5AJXA 1E1RA 1RRCA 5KDDA 4WVFA 1WRBA 1UKVY 5H68A 3MWYW 3B1YA 1G9XA 4LDJA 3IPYA 5UKDA 4BUJA 5FUXA 3CX6A 4Q47A 4B3BA 4RZ2A 3O8RA 2JASA 2DWPA 2WWGA 4U02A 4E03A 1FQJA 2VP6A 1N6KA 3GLHA 5F2EA 4Q4LA 2YOGA 1NBME 1V43A 1IY1A 4B48A 2ZI3A 3RNLA 3P4YA 1Q3TA 4LBYA 4TQUS 3TW8B 2WOJA 2GJ9A 4LGMA 4URYR 1R5NA 5LD2C 4WOPA 1OKKD 2G0NA 2WV9A 2GAAA 1E2IA 1J90A 1OHHD 4CIDA 1CR4A 4A4DA 4ARZB 5BN3A 2YINC 1BO6A 1QG4A 4MITA 4PAOA 4X8HA 2FH5B 2P5SA 2H17A 4PZYA 1U94A 1IXRC 2G1JA 3B7GA 3HYTA 5AJVB 5EE5B 1S2MA 1E2FA 1L4UA 1ZM7A 3QXHA 1A2KC 1N6RA 2V4ZA 1G19A 4IEIA 1ZNZA 3VR6A 1LF0A 1G3IA 4PFSA 2ZRPA 2CHQA 3EZ9A 2YHSA 3VR3A 4PR0A 2OLKA 1GIAA 3NEJA 5JS7A 3GP8A 2ZANA 5DSZA 1OXVA 4BFVA 3TQCA 5GJWC 4G1UC 1NMXA 4JVMA 4YMUA 3ADBA 1W2HA 5L3SB 4HLDA 2ZSFA 4F93B 1PLJA 3GJ3A 5HKKD 2GXSA 1Z6YA 4DVGA 1OE0A 5B2ZA 2EFCB 3Q9LA 3EZFA 2YWGA 3HDTA 1G16A 5KSPA 2AK2A 1XCMA 1NVWQ 1ZYUA 2O0JA 4PPNA 5P21A 4BQSA 2GJKA 2WIBA 3M6AA 2C99A 3DM5A 2XB4A 2VH5R 3P32A 3UPUA 1XTQA 3BOSA 4XIGS 1U99A 5DN6D 1R0YA 4EAQA 1EX6A 4BLQA 3RC8A 3GLGE 2QI9C 4OHXA 4LJ7A 4QL3A 1E2NA 3AKEA 1DELA 4EQ6B 2RKOA 4KU4A 3FFAA 2O8FA 4FIDA 2C78A 1VKJA 1W49A 4DLVA 4I1SA 1OFIA 2C9OA 4IOMA 3MG9A 3GJ8A 1A2BA 4JLVA 1PVOA 2ODNA 4XVRA 2HJVA 2ZI5A 3ZLJA 3EPJA 4RCYA 1W36C 4PC6A 2BOVA 2RGNA 3FMPB 3LVQE 1T9HA 3VTKA 2WJGA 1Z83A 4LUCA 2WSMA 2OZEA 3A1TA 1X8KA 3VR1A 4B73A 4C0JA 4IKEA 2GJAA 2ZS7A 1LTQA 4KYIB 2W00A 3U4QA 1VHLA 1N6LA 2WIAA 2ZR9A 4QGFA 3WMFA 4DRZA 4F91B 1AK2A 3KKOA 1OW3B 2HUPA 1LS6A 3CZPA 4C0LA 1AIPA 1M6NA 5FOVA 1ZC4A 1II9A 2Z4RA 4M0LA 2VTKA 4S2EA 2CL6X 4TMWA 1E9AA 2RHDA 3HR7A 4ASUD 1Z0FA 1II8B 1W0KD 2CK3A 2V1XA 4HDOB 3REGA 4HUTA 2C5LA 3QPUA 2HT6A 3EA5A 4ACBA 3DOEA 3LLUA 1RW4A 4HZIA 4E07A 1E3MA 4IDQA 2VA8A 4N1AA 2RGDA 2CNWD 4DB2A 4HUQA 4UXIA 4Q18A 1WXQA 5EXSA 1I4DD 1U0JA 2ZITA 1R0XA 4GMXA 2IHYA 2WJIA 1M74A 3EC1A 1KJWA 2XOKA 4MGYR 3ONWA 5ANRB 4A2QA 1UBGA 4WZ6A 5BWMA 1N3BA 3A36A 3OE7A 3UIEA 4YLGA 1V5WA 1ZM3A 4IDHA 5TVKA 3EAQA 3ZD6A 4BPBA 1E79A 2L0XA 5J4LA 4JIMA 3GJ5A 5H1YA 4DXAA 3LQQA 4ZCIA 1EFHA 1KO5A 1Q12A 3QPVA 2O52A 5FUWA 2GJSA 5G3ZA 3ND9A 2I4IA 2H7VA 1TF5A 4N0DA 4Q1EA 2CCGA 1ZD8A 421PA 2DWOA 3GEHA 1CJVC 1Z63A 1E4VA 1IHUA 1G5TA 1UKEA 3ECCA 3DKPA 1VECA 1UEIA 5FPSA 1KDOA 1KO8A 2B7BA 2ZS9A 2A5FA 3P26A 4BE7B 2ORWA 3EARA 2R65A 1IY2A 4NU0A 1YQTA 1NVVQ 1HE1C 3LQRA 1JXOA 2QTHA 4MRNA 5K8LA 4UQOA 2W6ID 2XJ4A 4KODA 5LB4A 1VHTA 2Z5FA 3PV0A 4ZI3A 4LYAA 1E0AA 5DISB 4B6EA 4B3XA 4EPYA 3EXAA 1A7JA 2HCJB 4NYJQ 2ASEA 4GRAA 1E9CA 4MYCA 5AWFC 2ZSEA 2ZRBA 3QBTA 3ZD7A 1NJGA 2XXAA 1YR6A 4LJ4A 4E09A 2A30A 2QP4A 3WBJA 3M4YA 2V8OA 3AF4A 4ZIRA 4GDFA 5FH9A 3X1DA 3KJEA 1PZNA 4LJ5A 2QAGB 3KKNA 1SHZA 3VR4A 3BJIC 1J8YF 2BKUA 2PX0A 1AM4D 3NXSA 1Q44A 1S3SA 2ZJ5A 3LBHA 4LX0A 4Q21A 2QY9A 2QNRA 3HR8A 1TQ4A 3K0AA 4W5JA 1RJ9A 2AXNA 1ZM9A 2B21A 4WZAE 1ZNWA 3MWJA 4CEJA 4BLSA 1Z6XA 2V6JA 3OE7D 4TMZA 2CLCX 4ILEA 3T06B 4PAQA 1XTKA 4CEHA 4EJSB 3V4RA 3WYGA 5JMTA 4R9UC 3VX4A 3FFBA 3KKPA 5EP1A 2G6BA 3CKLA 5CK5A 2WM9B 4DDVA 3LA6A 1X1SA 2J59A 3QKUA 2NG1A 3DM9B 1SXJB 2X2FA 3BH7A 3GCGA 1R10A 2VL7A 5LB2A 4D25A 2ONKA 1DO0A 2OCAA 4EIWA 2W83A 2RH5A 1AKYA 1KAGA 2NTYC 1JB1A 4B35A 1AA9A 1N6OA 3LDAA 5DHFA 2D7CA 3LBIA 4BFZA 5B64A 3AUXA 3IKJA 3QQ5A 4C7OB 3PUWA 2MMGA 1KNQA 4JYBA 4IOKA 2WJJA 1PLLA 2KJQA 3HWSA 1SKYE 2ZYWX 4G5QA 1E2QA 2F43B 1PUJA 2IYQA 2C04A 3RWMB 2ORVA 4TQ9A 2VYFA 2ZRIA 3U6KA 3G5UA 2XZLA 2O8FB 1EWQA 3THYB 1IM2A 1TTTA 1F5NA 1IXZA 5G41A 2XITA 1N5IA 3U60B 2CVHA 4TLEA 3ADDA 1CXZA 2O8BB 2BBOA 2ZVQX 2WJYA 621PA 2FSFA 4RY2A 2BBTA 3BAFA 4POAA 3A37A 2BM1A 5KNDA 2LCFA 3LLMA 1VYUA 2ZI4A 4IEEA 1IN4A 1Y3AA 5K8IA 2IK8A 2NOAA 1W2GA 1XEXB 2BIFA 1W4BA 4QHSA 4Q4JA 1P5ZB 3OAAD 2PT5A 4HI0E 4EPXA 2QMUA 3LY5A 3TIFA 3HU3A 1CIPA 3PEUA 4L8GA 3SYKA 4OQMA 2FFQA 4OQFA 4JLBA 2FA9A 4ZDJA 2P5TB 4LY6A 4LWZA 1CBUA 3CNNA 1EX7A 4A0HA 4LJ8A 1ZCBA 3NBFA 3ZZTA 3TRFA 2ZRNA 4EFLA 1KJZA 4KBFA 1E0SA 1OFUX 2D74A 4JYCA 1DAKA 3LH5A 1NBMD 2NGRA 1XXHB 1E2HA 4EKDA 4HLUC 4TLDA 2JLWA 1FMLA 2HDNB 4EJSC 3ZQ6A 2JJ1A 4U00A 2CE7A 3O8BA 4PO1A 3Q5DA 1VCNA 1YRAA 1U0HC 4Q9LA 5DI3B 2XNDA 1G3RA 4Q1CA 3KJIA 1G6HA 4JS0A 2Z4SA 2AXPA 4IOLA 1TMKA 2O0HA 3FMIA 4FWTA 4A6PA 2PBRA 1FX0A 1QHYA 1XF9A 5TV2A 4JT2A 5JHHB 4D6PA 2YWFA 121PA 5A4JA 1XNJA 3IUYA 2HYDA 1SQ5A 2BMDA 3PCRB 1SHKA 1Z47A 1I4LD 2GCPA 4QM6A 1OHHA 4PQYA 4LYHA 3BXZA 1MT0A 1QHHA 1N0UA 2D2EA 1KMHB 4Q19A 4HLCA 5EJEA 4Q01A 1WQ1R 3CF6R 3RRNA 1MRNA 1VIAA 2XEXA 4HB3A 2LKDA 4DHEA 1KO4A 2AKAB 3TVDA 3GLHE 4B2IA 5IK2A 2ZJZA 5JWRA 1ZUHA 2VPPA 4FXPA 4NYMR 2AK3A 3AGQA 3PXGA 3PUZA 3UMRA 1T3HA 1HT1E 4H9GA 2IEZA 4KCGA 3RC3A 3K09C 2BC9A 3CNOA 3I1FA 4LZZA 1W5TA 3W9YA 4TL7A 2X8AA 5E7IA 5FBRB 5JFGA 3GJ0A 2FV8A 5FUVA 4C0KA 2GNOA 1KJYA 5LD2B 3MRSA 3WRXC 2R9VA 1JECA 3QG5A 5K8TA 3THWA 1YJ5A 1A4RA 3U2QA 2O8CA 1XZQA 1DG3A 2OILA 2REOA 3R7WB 1GTVA 3QXJA 4KLZA 3U61B 4MRVA 2ZRAA 2ZU6A 2CNWA 3SFZA 2OBNA 2RCNA 3AVVA 1NNEA 2O8CB 1YKSA 4Q02A 3HU2A 1UAAA 5JRZA 2EFHB 1W48A 2XTMA 2RAPA 4QNRA 1QF9A 2WICA 1XTRA 4P4SA 1EWRA 2GWHA 3GLFB 3W34A 2PH1A 5FOXA 2ZE8A 3FE2A 3SJBA 3CPJB 3FDIA 2ERXA 4TZ6A 1Z0KA 5K8UA 2IL1A 2XGJA 3RS7A 3CH4B 3AB3A 5IF9A 3KTAA 4F4IA 1KDPA 4B74A 2NO0A 4DCNA 3I72A 4D4MA 1RIFA 4MRPA 3L0SA 3VKGA 4R7ZA 4QJ3A 1KK3A 2B7CA 3FPAA 4US0R 4EFMA 1KMHA 4NYIQ 3WMGA 1W0JD 3GLGA 5AK0A 4B43A 3T1TA 4XSGA 3UMSA 2JLXA 3AVUA 1P9WA 1JEDA 2J46A 1VIYA 1PJRA 2ANCA 3Q85A 3WY9A 1WCV1 1NN0A 3A6PC 1TADA 1NLYA 1KI8A 2VLIA 4TL8A 4DEYA 4NDZA 5H70A 1XCGB 3RS4A 3L0OA 1XPOA 2JIZA 4WIAA 3B1VA 4Q1AA 4RCZA 3WP1B 4OI0A 2WPDD 3WMEA 1OYWA 3GEEA 5FL3A 3RRYA 4WXRA 4LJ9A 2D06A 1DOAA 1TX4B 2O8EA 4US2R 1UEJA 2ZAOA 3GMTA 2BBWA 1D9ZA 2ZRHA 2J0VA 2FX3A 1U8AA 2W2XA 3BD9A 1P2VA 3PQCA 4HAZA 1M2OB 4N3NA 4MDEA 2V55B 3ZS8A 3RLFA 1DAFA 2D3WA 1D2NA 3VR5A 4B3FX 1Z29A 3FGNA 2GZDA 2GXQA 2QPTA 1XTJA 4PHFA 3B60A 5B57C 1VDZA 4D2IA 2QZ4A 1WE2A 4MQBA 3B9PA 5FTMA 2YWEA 1H8HD 4OHWA 3VX3A 3SQXA 4A8JB 4LHZA 1UBFA 3EWAA 4NH0A 2XX3A 3QKTA 4RKEA 4TYPA 1XJQA 2YWHA 1XTSA 2ZRKA 1M8PA 5AJZA 2BM0A 3IGFA 4KLNA 2CVFA 4D80A 3C15C 1L2TA 3NWJA 4L4UA 2QTVB 1OPXA 1W36D 3ZIAD 2O8BA 2I1VB 3NC0C 4MYUA 4GZLA 1BYUA 1E9RA 4TLBA 3WXMA 4DB4A 1JAIA 3EASA 1F60A 4BLOA 2REBA 4LRWA 4PTLA 5FTLA 3QKRA 3H0KA 2PJRA 1G5RA 2X2EA 2OFOA 4KV9A 3C5HA 3SHFA 4JZKA 3NG1A 1O3YA 1R2QA 4K46A 4P4SB 2A3RA 2EQBA 2WBLC 3H84A 2FWRA 2WVJA 4M1WA 3AP1A 4JL5A 4TT3D 5JWOA 1BS1A 5BYKA 1EXMA 3SDZA 2RGCA 3I32A 3NH6A 2RGGA 3ZVLA 4PPGA 1EFRA 2G9NA 2PCLA 4DKXA 4WBSA 1LW7A 1SVOA 2BWJA 4BWYA 3QPWA 2IHBA 2XZOA 1HE8B 2H92A 2R62A 3FHCB 4KFSA 4KI0A 1NIJA 2DYKA 4JLJA 3BB3A 2XNSA 4TYQA 3GPLA 2BVNA 1MV5A 1W4CA 4M1SA 5JSZB 2R6AA 2G1KA 3LX5A 1XDBA 2VSXA 3X2SA 2FF7A 3NKVA 3NTUA 2CL0X 1TQDA 2JCSA 4CEHB 3ICEA 3TE6A 4MDFA 4TTPA 4Q9KA 2RGXA 4X8LA 5TDHA 4ITRC 4DLZA 4M9SA 4UNQA 2DPXA 3GEIA 5CDFE 1ZBDA 2FSGA 1DADA 3KZ1E 4I1OA 4UXHA 5KDLA 1RJ9B 1RFLA 2GBLC 1ODFA 4GOJA 4LC0A 5AUPB 4MA4A 3W3AA 3F8TA 5HZHA 1N6NA 3M0EA 4EFNA 3VHXA 5FOWA 2ZUCA 1NMYA 4URWR 4AG6A 5JJKA 3SJCA 2ZAMA 3VNUA 4XSHA 4B47A 4S35A 4IDOA 2G0TA 1J70A 1CU1A 4XWAA 4PANA 1E2EA 3KL4A 1XEWX 2PL3A 3TW4A 3D6TB 1YZQA 3AVWA 3VNVA 4M9XA 1ZM2A 4V03A 1DAIA 4BFYA 4YXWA 2HCBA 3PR1A 3BS4A 3ZZUA 1E1QD 3ASYA
chains in the Genus database with same CATH superfamily
1ODTC 1HDYA 3JQ8B 1UEXC 1W29A 2O07A 3DR3A 4QLOA 1DARA 4RH1A 1SBCA 4DSNA 3TZ6A 3OEEA 3NEPX 1OX5A 1YXMA 4H3HB 4JLUA 5JADA 1A9XA 1VL1A 3L3BA 1GPJA 1P17A 1N2IA 2YC2C 1ZEMA 3OJOA 4KH0A 4ZZ3A 4GVLA 3L7KA 5IBRA 1VA5A 2GCGA 4DIEA 1EFKA 1J25A 5LQSA 2ZEJA 1KSJA 2CMGA 3C3EA 3MCWA 3PQDA 4MQUA 1XDSA 3A9CA 1MC8A 3A9TA 4RKYA 3X43A 4BVFA 1UC4B 5CB8A 1WP9A 5ICGA 1GUBA 5AJUA 3ZVRA 1FYWA 2GZSA 2WWFA 3QUSA 3R4VA 3C41J 4MWGA 5GM1A 3QX3A 4M88A 5ALEA 1EK1A 1Z7BA 1HG0A 1CP3A 4H31A 1JLKA 4I3GA 4V3CA 4BVBA 5K0TA 2W2NA 1HRKA 1WUTA 2O3QA 1B0AA 4KP7A 4M7RA 2VXOA 5JZVA 2P6OA 3D1JA 3KSMA 1HG1A 1DI0A 1KH3A 4BKQA 2P9JA 4JENA 1L5GB 4FBLA 3WA6A 3SI7A 1NKTA 4J03A 5HVNA 1WCXA 3H0CA 4IDCA 3U39A 5KMGA 3P2YA 1I9CA 1NXQA 2IDJA 5ALNA 1XMIA 4MS4A 5LZ4A 4JY7A 4NX2A 1YJXA 5JCOA 1BXGB 3COJA 4G0UA 2EERA 3U4IA 5EE1A 2ZBDA 1HSOA 4RVFA 4TQAA 1QBKC 4BIMA 3GP5A 4QOFA 1AOXA 2VDRB 5KNBA 2FRDC 2PU7A 2QTMA 4UAUA 2FWPA 1P6UA 1P2FA 1OBOA 1TK9A 1R0ZA 2QV0A 1WPRA 2XE4A 1K3FA 3QXSA 2GCOB 3ZX5A 2V0GA 2H5EA 2VUIB 3R9XA 3O1LA 4JB8A 4PZ9A 4Y7CA 5BOSA 3PC2A 2QD1A 1WD7A 1R5JA 3E5HA 5KQPA 2ZR0A 1MBZA 4LZOA 1WBBA 1GILA 3X44A 4TROA 3DKVA 2VJBA 3LXRA 4B3HA 4H6VA 1VL6A 4WLNA 1XTZA 5DHSA 1VB3A 1J8FA 1FP6A 2RJOA 4FYVA 5JDCC 3DTYA 1H1LA 3FZGA 4PGFA 3BREA 5DCWA 3VKFA 3U3XA 3EIHA 3PP8A 1ST3A 3RASA 3EW9A 1IPEA 1NJSA 1SCJA 3E03A 1DC7A 1L5QA 2CMKA 3I01M 5JDIC 1JIXA 1U8YA 5K0ZA 1XRJA 3DF7A 1U0BB 5FWYB 2ZLBA 1Y8QA 4JBGA 2DAPA 3U7FB 5THQA 2CVZA 2R66A 4A8PA 3U0BA 1ZJ6A 2HWXA 4TV8B 2VQFB 2IYZA 2PXAA 4R7TA 3PG5A 1JILA 3ZHBA 2BCJQ 5C7YA 3AF6A 3M4ZA 4L22A 4Q4CA 1EE1A 4JR2A 4IQGA 4D43A 3KVVA 1D2RA 1K08A 1BMDA 4P4NA 3T9FA 1OT3A 4IRUB 3CRZA 4YJFB 3ZUGA 1W5FA 2P68A 2BELA 2W90A 1QUFA 2WJWA 4CKBA 4EP1A 3S2FA 4ANFA 3PGJA 4D9BA 4Q24A 3R7BA 3SR3A 5I51A 3TCKA 3NJ8A 3DZKA 3AESA 3NHJA 1G8GA 3IERA 2FLKA 1X14A 3OO0A 4P34A 5AKGA 4N12A 5FLYA 2XWPA 3RBVA 2HLPA 1V47A 4C3OB 1IY9A 1O5IA 1ORHA 4EARA 4M7WA 1LNSA 4I55A 2EKPA 5CVCA 4Y6OA 3QOFA 4XQCA 3RS3A 4CI9A 1WUYA 2Q1SA 2JATA 5DN6A 1Z2CA 2V4MA 3EC2A 3G0BA 4N8SA 4PLTA 3EMVA 1E2JA 1FP7A 5FBHA 1FXWA 3V7NA 1W96A 3B8EA 3AR5A 4RORA 2WNSA 3V4OA 4UUOA 3BCUA 1WF3A 1E9EA 2N75A 3GVXA 2E6KA 2GAOA 4Q7MB 1LY1A 2ZB3A 3PDJA 2A33A 5DM2A 1QWOA 2V5UA 4J4TA 5DGIA 2PSFA 3NKFA 1TYEB 4KPEC 4V0NA 2XIJA 4X62B 4X66B 2ZJBA 5AVYA 4EKEA 5DM0A 3RT7A 1X7XA 1D7OA 1XK7A 2G3YA 1UDWA 1DOHA 3CF0A 3E3NA 3HI4A 4OH1A 2R6GA 1HGXA 4TYYA 2F8LA 4WFJA 2G6TA 1GARA 1VI6A 2W7TA 1FUYB 1XEFA 1Z7YA 3LTEA 3MBIA 4NSNA 4QYTA 3VJKA 1HXHA 2VS1A 4UE3S 2CHGA 4ZOLF 3GF4A 2MMCA 5BN5A 1AZSC 5SZHB 1C4OA 4M54A 1GG5A 2KB0A 1X1EA 3M6IA 4UNRA 1QRSA 1J00A 3ESBA 3I9LA 1EVEA 2Z9DA 3EXEB 3NWPA 2LXNA 1JALA 2VVTA 2Y1WA 1VG0B 3PYXA 3TQFA 4R0MA 1H65A 5FNVA 3ICCA 3JAWA 3ONFA 1PYDA 1ZKDA 3MS7A 4DCTA 3SOZA 1NSFA 1TIKA 3OU2A 1P3Y1 4AF6A 1E1LA 2VAMA 1SBTA 3DPSA 3PQ6A 4FNOA 1DXQA 2A0XA 4GBJA 3RS2A 3LQKA 3N2GA 2AVNA 4JGGA 4CQLB 3GARA 5I7HA 4NCNA 4C06A 3N8KA 3EPKA 2PG3A 4IJ5A 3PF8A 1DIBA 4FX2A 4L08A 1AKEA 1IE3A 2PRIA 4N4AA 3URKA 1ZMXA 4OB7A 4UCQA 5A6VA 5AT1A 1MCZA 2QUKA 3CRRA 5EWLB 1LDGA 5HE8A 1EUZA 4JBNA 1NURA 4KPUB 6REQA 5LMZA 4RGBA 4Z53A 5B3KA 1RPZA 5K9ZA 3FDZA 1QGYA 3H75A 1WCIA 3D3WB 1UBRS 3DXXA 4G0QA 4YRJA 4X64B 1NVUQ 1CY1A 1RRFA 3RG2A 3HXKA 4M0PA 1CR6A 4IH9A 1KS2A 3WR5A 4TZTA 3KUKA 3ZW8A 5JEEA 3LK6A 4G1CA 1MQAA 3WLKX 3HEBA 5AM1A 2WWTA 3P0JA 1PVVA 4M22A 2VYNA 2C8LA 4GEKA 1PFQA 2IU3A 4XR9A 3G2HA 2FZLA 3KUCA 4FUQA 1NU6A 3AZPA 3HXPA 1JAXA 5C8YA 4NMLA 3A0UA 2A7QA 3G2NA 3II6X 1VPTA 4GOKA 3EYWA 1QV7A 2IQIA 4I5IA 3B6KA 4B32A 2P9TA 3Q0TA 2KLHA 4IL5A 3I8SA 5BQFA 3D6AA 1CJUC 5T57A 4YJ3A 2BTEA 4HZUB 1KJJA 3REFA 3U4MA 1HX7A 1ZP6A 2NQ2C 1MO3A 3MRTA 4AUMA 3EJWA 3H97A 4B2PA 2COKA 3H5LA 4U3JB 1B00A 1EX9A 1RCTE 1FLAA 2PL9A 5LWHA 3IP8A 4XIFA 2EL9A 1U28C 4OHMA 5D3MA 2AG6A 3CURA 4HNGA 1P4AA 4DRXA 4RSRA 1GNQA 1H4SA 4MZXA 3E0XA 1DTWB 4CMCA 4YDHB 2VDVE 4UU8A 2Y1OA 4UULA 2F00A 2QVCA 4ARSA 4TLLB 3RYCA 4CJXA 1DZIA 4D9GA 4OHZA 2PMWB 3VA7A 4A0RA 2BZ1A 3D3QA 1XSEA 4D26A 3E2PA 1QQTA 1ZICA 2HRDA 2QTFA 1W1UA 1IUOA 1GUAA 3A1EA 1H94A 1RQNA 4ONEA 4QHYA 1Q3HA 4C89A 4REQB 4QBIA 2G0AA 1MX5A 3SJAA 3VMMA 3OIYA 2QBYB 2Q2NA 4KUEA 1CUHA 3AHEA 4PQGA 4YP6A 4OYHA 1BD3A 2ANBA 1QO7A 1QZ3A 1EJ2A 1BW9B 1RLOA 1ZXXA 2VXCA 3EXFB 3H83A 1KOGA 2DB3A 2BHRA 3DPUA 3O9MA 4GYWA 1IVYA 3HHEA 4YAOA 4V38A 4QT0A 4ZVPA 5TPWB 4N0PA 1GCIA 3OQIB 1W5AA 3FVRA 4KI7A 1IBKB 1HEUA 3SVTA 3G9QA 1IDOA 3GA5A 1A72A 1VMAA 2PWPA 3WLSA 4BZZA 4M0DA 5ALPA 5IC5A 3TEFA 3WC4A 1XRNA 2OHFA 3WIDA 4ZN6A 2QU7A 1QZZA 4P33A 4WBNF 4KQMA 2R1VA 4QA9A 1NI4A 1KAQA 2RGAA 3THOA 1UJMA 3ABQB 4AY3A 4N40A 5I9BA 4H77A 1VE3A 4LJYA 1Y1QA 5I4BA 2R1UA 4YJ3B 2BM9A 1E6CA 1IMOA 2XDWA 3REOA 3FVQA 2RCYA 1EQ2A 2HMTA 2OECA 3MRXA 1JLMA 1H2AS 3K6RA 4PRKA 1DX4A 3MT9A 4Z51A 1ECPA 4YUAA 1CIJA 2BFOA 1EFLA 3BH0A 3L1IA 1TT5B 1B15A 3KWMA 2F3SA 3P2OA 1GQYA 3D54D 1E7MA 3I73A 3RTBA 1SXJA 2EX1A 1VE5A 1Z5OA 1R6BX 2FDRA 4ND1A 2ZSBA 5ALUA 3ZEAA 1A7KA 4XJTA 1C50A 4IBOA 3NC1C 5DVZA 3G79A 3CNBA 2FG7C 3HCCA 2GF9A 3N76A 4GP6A 2AGVA 5AVVA 4LOAA 2ERYA 1MMFB 2GZ2A 3V8VA 4LRSB 1R4MB 4PF1A 3K70C 1OCEA 3G9XA 1U2GA 2XDYA 3VSEA 1SUWA 3T6KA 1RXWA 3SC2B 1J0DA 5CYOA 2J6CA 2YS7A 1TJ5A 2NUBA 4NYMQ 3SF0A 5JJCA 3PC7A 4JUDX 4R2MA 2MR6A 4MIYA 1FFCA 3IIMA 1T2FA 5LR6A 2CJWA 1MJGM 2E18A 2O50A 5E1BA 3F4LA 3LP8A 3OPYI 2FEWB 2JS7A 3KPJA 3H4VA 1WJGA 4PSKA 3HB9A 2W42A 4YAJA 3EX7C 5DFAA 1P2GA 1G7RA 1YC2A 4RPKA 3DA8A 3DUFA 2QAGA 2VNAA 3RI3A 3M5PA 3V00A 1L1EA 1Y63A 3N2GB 2BFBA 2QP9X 1SO8A 5K8VA 3UMMA 3AVYA 2NSLA 2ZSKA 3FWYA 4OI4A 3K8OE 2JZOA 2P6NA 2JAHA 4IVNA 4V2IA 1EHCA 2XQJA 3P27A 4EG0A 4L5BA 1DJLA 4CCAA 5K4GA 4D5GA 4FC7A 1E20A 4XVQA 2QLLA 1GUYA 3WLOA 4MRMB 2R751 4HEA1 3VTAA 5KJ6A 1OXSC 2GCNA 4Z4HA 3L0PA 2F9MA 4OMFG 4QOEA 3DLCA 1QRTA 1GZ4A 3FFXA 2ATVA 3L5KA 1Z2EA 4IINA 2PVSA 4KDEA 3T1HB 4KXFB 4REMA 3PWKA 1EZ1A 2XAUA 3A1UA 3DO6A 4M9QA 4MKGA 2VP9A 2JKZA 1U90A 3C14C 4Q4AB 3S44A 3ZXUB 2JDIA 1XXHA 4KQGA 3C8UA 4IGFA 1U28A 1I01A 1KQ3A 1TM4E 1ZD2P 2ILVA 3R0JA 3QYPA 4Z8XA 3SHOA 3SX4A 5FD8A 2HHJA 2H1LA 2XF8A 4R1MA 4MLPA 1KR5A 5KU1A 3U17A 3NQ41 4HEA6 5JSYA 4DZRA 5CJ2A 5E9WA 1K8XB 4LMAA 3BGIA 1Z0JA 1P5JA 3Q10A 3NBMA 4IGAA 4CL3A 1DAEA 2GRAA 1JDTA 1NR7A 2BFAA 2YN0A 3NRBA 4OYLA 4GI2A 1WU7A 4P32A 4P7FA 4LJSA 4BN0A 2JGEA 4O4IA 4GG1A 2QWXA 4ZVQA 4HXGA 3NGMA 4P5DA 4B6JA 5CFLA 4LSWA 1XCOA 2XTZA 1N33B 2BGMA 3AVOA 4GM0A 1WDLA 2UYCA 4DR4B 4OGFA 5KTKA 1USIA 4PYKA 4CIVA 4M1TA 3KU1A 1YQUA 1GNRA 1GFSA 1JMYA 1VBMA 1J06A 2HMSA 3K0FB 1Q7TA 4H18A 1EFUA 2EVWX 2FSPA 1M75A 2R1TB 2YN4A 3KT3A 4LS3A 3OHSX 1TVMA 3ESDA 4Z0HO 2OYCA 3UOWA 5PGMA 4RPHA 3LWNA 4BMNA 4WLOA 1XCBA 2PRKA 1OQAA 1P2TA 1V48A 2PV7A 3AK4A 4WLVA 3IE1A 1XC7A 3TNYA 1BH2A 1FRFS 4RETA 1TM1E 4GO1A 4TM7A 3IXQA 3LUCA 5TJHA 2H18A 3THYA 2TMYA 3Q8MA 3J7TA 1G3UA 4UQPA 1DJOA 1I30A 1R88A 2JKVA 4NECA 3G6KA 4P8RA 3D4BA 4Q1DA 1W30A 4UVGA 4DJDC 4EB6B 1O8BA 2OL4A 3GQBA 2E48A 2BAGA 1FYEA 1UQTA 2QN7A 1EXWA 2BFCA 1B8VA 2KPOA 1MH9A 4M0CA 3TK1A 3VJRA 1UDCA 2GA8A 5HG0A 4ALLA 2UZ4A 5FBQB 1UK8A 5IBQA 2NPOA 4RA6B 2Z3ZA 5GV8A 2V3VA 2O8DB 1ZR4A 1X6VA 3CIFA 1JL3A 4JKIA 2WG1A 3B89A 1P1IA 4CU5A 4DQUA 1N2GA 2XYHA 4BNDB 1AKUA 1WDTA 2HK7A 2YHUA 4EI8A 2H7YA 3QBDA 3DDWA 2QY6A 3WBKA 2VHQA 1ODIA 3MGCA 4YDSA 3GJRA 4CF3A 5KHOC 3EA0A 4XD7A 1C5KA 1J33A 1CZNA 4BMCA 3OSUA 1ZVMA 4JJ8A 1GPUA 1L4MA 1C9NA 2GT1A 4JJKA 5C1IA 2G5PA 3HEAA 4D44A 5JTUA 4G0VA 2FFBA 3L8FA 2GHTA 5DGHA 3JYLA 4UNNA 3KS9A 3P9ZA 4TKVA 5J4VA 1VLLA 4RHYA 3VGPA 1CZHA 1XDWA 1PEYA 1SOWA 2HXYA 5GADl 1T9KA 3AWDA 4DSTA 3K20A 5A5DA 1B3RA 1ZK1A 1DRJA 2CXTA 3E53A 4BU1A 1KA9H 1XXLA 1ZUIA 4FDVA 3JD2A 3D6VA 4C0QC 2BMFA 1BHJA 1BNCA 1C29B 4FHZA 5EWMA 1VKHA 1HKHA 3PITA 4NV0A 4MNTA 2R48A 3TUJC 3JQGA 1EZZA 2NMVA 1U7OA 2O5RA 2X1MA 4RVNA 4PFQA 4DIMA 2BFEA 4DG5A 3CLVA 2ZUUA 5CA1F 2OCLA 5DM60 4XJXA 1RD4A 5L45A 2VRBA 4F56A 4C01A 3K72B 5IASA 2AFVA 4WNIA 1PYGA 1ZJWA 2JJYA 1XEAA 3B12A 1YR1A 2PX3A 2HQSA 3I6BA 2VYVA 3L8YA 1RZ3A 4HAVA 5EUBA 5IANA 3CCCA 5FI0B 3I76A 1NAIA 3FCSB 2HOQA 1K4YA 3FGPA 3GGPA 1DQYA 2GSWA 4O29A 2VP0A 3A9WA 1H8HA 3MLEA 3C3MA 1P1JA 4BMPB 3KTDA 1PD0A 1E2LA 3GVHA 3O4GA 2J0SA 4HGZA 4CTJA 2A86A 2OHGA 4KN6A 4G89A 4EX6A 4ARZA 2C92A 4UJ3A 4RPCA 2H52A 3M4NA 4BWGA 4DA4A 1C3XA 4M1YA 4ZTBA 4IDPA 4CLXA 1XQWA 2CUTA 2P6MA 4MUIA 4PPFA 2JGAA 4UATA 3D0OA 1ISMA 2CJPA 3UJCA 1PG2A 2R97A 2VUUA 2I3AA 1MEJA 1TD9A 1Z6GA 2OWEA 5K8JB 2OZLB 1TZJA 4QFDA 3R5TA 1DCFA 5I48A 5HHTA 3U4DA 3P9XA 2IV7A 3PPVA 1CUFA 1AXEA 3ECAA 4NE9A 3RDPA 2GX6A 4N5DA 4RD1A 4KR3A 4YAIA 1CB0A 4ZYLA 2FW0A 2C03A 3DKIA 3U4HA 4UE2A 3SR0A 1OFUA 2C8VA 1FQOA 4I4LA 1BX3A 3T7AA 1B7GO 3X1XA 3U44B 3H5NA 1NR5A 3KXIA 5HF9A 2IYLD 4GQBA 1LTKA 1L8XA 3BSYA 3VR6H 4UTOA 3R0ZA 1P72A 2VJAA 1CZRA 1K2WA 1Y8ZA 3FPGA 4MH0R 2C95A 2IDZA 4OL9A 3ONDA 1HLPA 3FOCA 4TV9A 4BO9A 5EMMA 3D31A 3KKLA 2ICAA 4OFXA 5LZ5A 2ZJ2A 1H6DA 4I5EA 1ZA2A 4KMSA 4MQ4A 4Y18A 3H42B 3HUFA 3HDHA 1J0EA 3QF7A 4KAXA 3V1YA 5EHNA 1MRZA 1ABEA 1N2SA 1RWMA 3SC3A 1MVLA 4I14A 1EK5A 1G8YA 4XCXA 3BCRA 4B7ZA 2GPYA 5C4GB 3RSCA 3UTCA 1CRQA 1KZGB 2PQ6A 2V8BA 4B84A 2OK8A 3MERA 4D92A 1BJKA 4UOQA 1QH9A 2AEMA 2RB4A 2UVQA 3R2JA 5DGCA 4DLSA 3J80A 1TU0A 3P19A 5I7OA 3FLMA 3Q3VA 1XNQB 3JPWA 3DHYA 1N78A 3N75A 4AUEA 1XMOB 4WXHA 1MO6A 1R8SA 3T1QA 4EHIA 2JI9A 1UFKA 3B36A 3E5RA 3IHLA 3JD0A 4B1FA 4GGOA 5C31A 2W2PA 4MJ3A 1IPHA 3RNOA 3GPDG 4JMPA 2H1CA 3WDLA 5HK9A 4JUCA 1X77A 4DVJA 3AVXA 3PDCA 3KEFA 4GT1A 2JI7A 1ZIPA 3HYRA 2FPXA 3TLMA 5CLQA 5JISA 4GX5A 3TOCA 1EXVA 3LM8A 2Q5JA 4HDRA 4GICA 3STYA 5A4MS 3A1NA 2QX9A 2LIPA 3FMVA 1RVDA 2FHSA 3LLVA 2F48A 4MICA 4PLVA 4WZBA 5FYQA 1C80A 4M3NA 5LSAA 4R2KA 5JJ5A 5K45A 3A27A 4I6EA 5B12A 1ULBA 2E0IA 1Q1QA 7MHTA 2VF2A 4BCCA 4I66A 1UDBA 4PYRA 3IOBA 2IUUA 2XR1A 1GP2A 4D57A 4U7PB 1W4RA 4UEKA 1EP1B 2OORC 4JDUA 3Q6IA 1NFQA 1KOFA 1DLIA 1GCAA 1X3LA 2AF3C 3D5EA 4YP1A 1YBMA 4ZVTA 1V6SA 1NX9A 2GSDA 4PGHA 4QREA 3BD6A 2X6RA 1QJ4A 4IY1A 4EHDA 5BQPA 1GGFA 1VFPA 1L9XA 3RGGA 1MA0A 1X1QA 3PRJA 2VBIA 4PGMA 4CMHA 5C5CA 2Z08A 1LSJA 3WGQA 1AKNA 3OPQA 1ULSA 5H4HA 5B37A 4A92A 5L3SA 1CUWA 1QHFA 4RJKA 5B7PA 2IS6A 2FR1A 1PZEA 2YH2A 1KI7A 2XHEA 2XQIA 1MOSA 3GVPA 3BMNA 3HJBA 3KLOA 2VHZA 4HQFA 3M6WA 2LKCA 4O4IB 4LDQA 5HF5A 1JVBA 3RVLA 1XVAA 1ZCFA 3OZSA 4PO8A 5H02A 3RYCB 3O1HB 3GLFE 1PE0A 3WK7A 5KUTA 1TPYA 4F5ZA 5CM2Z 1CDZA 1MJGA 4MV1A 3LPAA 2BR5A 3LC7O 1MQ9A 4DIKA 1HDOA 1I1OA 2B8WA 5LVAA 1EVYA 1UJ2A 1B1AA 1OXXK 1UZNA 4XB2A 3IQEA 4A16A 1GFWA 3VU1A 1TF2A 3B1XA 1V1RB 3UGKA 1JSCA 4D99A 1SU8A 5ALZA 4NZYA 5JVDB 4CCYB 1A4XA 4KVGA 4MHTA 2Z2KA 2DWUA 3B3FA 3GRVA 4AYTA 3RYTC 2ADFA 1LQ2A 5LQKA 4A36A 1A95A 4DAOA 1E2BA 4Q9DA 4P82A 4ACAA 4UASA 4FFLA 2YVAA 2DETA 1VE6A 4HWGA 5TMBA 3L1UA 2BUCA 4DDTA 4LHEA 4YMTA 4W5TA 1YF3A 2HY7A 2WWVD 1DCMA 3R24A 2XXJA 2BFWA 3CNLA 1Z06A 1UK7A 3G0OA 5FI3A 5BN4A 2Z6VA 2ASVA 1VTKA 3HKCA 3BAZA 3IE2A 3PTZA 4QGAA 5KAMA 4JJAA 3S2GA 3L43A 4N41A 4BPRA 2HRQA 5DULA 4DDUA 1RYHA 2QPOA 2Z9BA 3ZLBA 3ZV4A 4PG5A 3TRHA 1Z25A 1CT9A 3IR6A 4S1TA 1IYZA 4X97A 4YC7A 2PLFA 1DS6A 4PZ0A 4KPUA 1BE6A 3NBYC 3SF8B 3T1OA 3V4PB 4YRGA 2NZ2A 2BE9A 4R68A 1TUBB 4J1TC 2BFDB 1VZ3A 3E3LA 2OHIA 3QG1A 4XM0A 4YRTA 1JTFA 3UB4A 3ROPA 3DQZA 1BMTA 2IFTA 2Q45A 3HI6A 4RS4A 5JI2E 2PMCA 3GHHA 1LK0A 2PM8A 5ESRA 1HC7A 1G21B 5B36A 4BFXA 4URVR 3TTWA 3TG8A 1ZI9A 4KNWA 2C0PA 3DMPA 3HCEA 4CGYA 3JQAA 4EJFA 2XT9A 2ZE5A 5CAEB 4Y0NA 4A5SA 2OESA 4DC0A 1GSOA 2R8RA 4PQRA 5D01A 1G66A 2QL9A 3GPIA 3I2GA 2BDEA 2BT4A 2BD0A 3N3AC 4DQ0A 2IY7A 3LHSA 1UM8A 4H0FA 4OMDA 2A5DA 4P4GA 3DBHB 5F1OA 4E6EA 4J1QA 2VHCA 2G4LA 4OQNA 1EFDN 4LX8A 1V1MB 4PSVA 3T0IA 4AAYA 4CNQA 1C2YA 1S1CA 1SN7A 1OF1A 3EIXA 4HNAB 2K6GA 2NZJA 1CQJB 4GBGA 4RTKA 1AN0A 2FUEA 1SCKA 1GJRA 2WMNB 1TIPA 2JGNA 4F3CA 1MNAA 1KAEA 1N5DA 4L4XA 1N2XA 2NO6A 1XJ0A 2H2AA 3L84A 4LV8B 2XUHA 4ENQA 2FZWA 4EL5A 4NCAA 1P7VA 1SOMA 4WJZA 4MV0A 3I09A 3WRYA 1HNNA 3WB1A 3A1DA 4HNSA 2G9VA 3SICE 1Q2UA 3C6MA 5TF0A 1PV4A 3V34A 1F48A 1YJAA 2VHWA 4Q34A 4PNEA 2QZPA 2SNIE 3RWOA 3CX8A 3S7ZA 4DBVO 5CB4A 721PA 2P69A 2YUTA 3OZVA 2OB2A 5L3ZA 4AX4A 4MLDA 4CM8A 1B3BA 1DQPA 1QTRA 4DNQA 4UFPA 3OC0A 1RHUA 2FU5C 3TLXA 2DR2A 1QRAA 4LOJA 1BE0A 1A98A 1HZJA 2JIOA 5KWVA 4XD2A 2ZRJA 6Q21A 5KCZA 1FJGB 2QTVA 3H4TA 4GPTA 4RW0A 2GPJA 1TUBA 1ZITA 1JEEA 1F6BA 1PI3A 2JEOA 5TT1A 5DM4A 2GKOA 1AKWA 5GJCA 1ECBA 5B3JA 3BEOA 1JG2A 1U9CA 3CN7A 4GMFA 3WSTA 4YEDA 4ENTA 1LPOA 5PNTA 1U02A 3PVZA 2WKSA 3BHIA 3HBLA 3PPYA 2ZIUB 4XQEA 3Q9NA 2I62A 2YNMA 2O59A 1IN5A 1XDZA 4G0MA 2P6PA 1I6WA 1FRVA 1UPCA 3H9JA 4A8JA 4ZVMA 1UZAA 1ZIDA 4Y6RA 2E2WA 1Q7GA 4JA2A 4RD6A 3ZXSA 4CCSA 5AVZA 1UMDB 3QJYA 1OIWA 5BN4B 1NTOA 2UKDA 4MGZR 1E9VA 3NWOA 5K3SA 4QT4A 5E4TA 4MRRA 1NP3A 5KYYA 2K7ZA 1NJ2A 2TYSB 2YVUA 3ZK8A 3VPXA 2IT1A 4G0PA 1FDRA 3NHYA 4J75A 4M53A 1D6MA 3B7PA 3HB1A 4RMGA 4K88A 4FDUA 3LAWA 4MMYB 4Z86A 4I1IA 1RACA 2OXIA 1XZHA 3PSHA 1JG7A 1MO2A 3OPYA 4RFSA 1ETUA 5FBLB 2RKBA 4M4SA 3C8MA 3FCCA 4R1OA 3HP1A 2C5SA 1H2EA 3RHFA 5DNYB 2J9FB 2GTPA 1PSZA 2ST1A 3OEHA 4X7RA 2C2BA 1WX1A 2IZZA 1FTQA 5IAGA 2PKYX 1G5FA 2ZTMA 1E3DA 5REQA 1QP4A 3KX2A 3MN1A 1X3SA 4NENB 4CM7A 1PYOA 3HKDB 4IPTA 1KQNA 3FJYA 2JI8A 5IVKA 1BMQA 1MOQA 4JEHA 3DDZX 3GBPA 4FOPA 1O95C 5EXPA 3I5XA 1G7SA 1WIWA 1L7PA 2IA5A 1YRBA 2ZYHA 1WMSA 1R6VA 3NAZA 4FSDA 2AFIE 3AHHA 1AF7A 1G9TA 1GSIA 1MHTA 4HH4A 1K63A 2NUTB 4J0JA 4D7AA 4R9SA 1C8VB 4Q6BA 3IAAA 1XZCA 1NL3A 3DBLB 3OX1A 3GUUA 3SK0A 4TS1A 4L2IA 1C0IA 2IP2A 1Z9BA 2IHJA 2A1TR 3UMVA 4V39A 1YMQA 1EJ0A 5SZKB 1TDJA 2O2XA 1JR3D 4AUKA 3FSEA 2WT8A 2PMEA 5C3MA 4QSMA 4MKRA 5AUOB 1TA9A 1WETA 1GNVA 3DO8A 3VPSA 4CG2A 3PFFA 4G0OA 3FSGD 3MJVA 4HSGA 1E2GA 1TOAA 2I6GA 2QGZA 3M89A 2FNAA 2G25A 2W22A 4JITA 1VP9A 1N0HA 1M2JA 2QG6A 2R85A 3PXCX 4NATA 4OXIA 3UUGA 4QO8A 3QVSA 4H17A 1AUXA 1UK9A 6AT1A 3EUFA 1FP4B 3PNOA 2IIPA 2XNKA 3T1VA 2IUSA 1F2TB 3SMVA 3H1AA 2XVAA 3LYLA 3LS2A 4JUIA 1FP2A 1E1QA 1YQQA 2GM5A 3SNKA 3N1UA 3ZY2A 1RKQA 2QRGA 3MPOA 1XTIA 1P4RA 2HNBA 3O83A 3KT6A 3PUXA 2K5UA 5HZKA 4U7FA 3QFFA 2ID8A 1TCAA 3R7WA 1UL1X 1H0SA 3LF2A 4JQYA 2Y8EA 2AZXA 4Q3LA 2A9VA 1V1MA 2LWIA 5I4CA 1JI0A 4HVAA 1UXGA 5EJ7A 3LC2O 1RM5A 3LVBA 1ZRMA 3K30A 4FT2A 4IDFA 4IIHA 3CSDA 3EF1A 3GEGA 4ZJPA 5A5GA 1W4ZA 2FMUA 1SXIA 2QMQA 1ECCA 1EJ6A 1EGQA 1KYVA 2J9XB 4QASA 3RHTA 1NMZA 3TKLA 3I2IA 5IZ4A 1KQFA 4JLMA 5JIBA 1NYLA 1JB9A 3ABIA 3AFHA 2FEPA 2ZI6A 2ZTLA 4RHFA 3OQMA 3TQTA 4GU5A 3AM1A 2J9RA 4HAWA 3SBEA 1W8DA 3QMPA 5F76A 1REQB 2FPUA 3TSOA 1C7QA 2HLDD 1XKQA 4K0RA 1EM8B 4L28A 3EEQA 1C0EA 2HJSA 4GOOD 2IEGA 2QT0A 4DCUA 1YKFA 4AY6A 1RE0A 1T2AA 4IRXA 2OZVA 4UMVA 4AJ4A 1BQ4A 5AW4A 4GP9A 3OWHA 4ZRDA 1U8CB 3EXHB 1XZPA 3ZWXA 4DQVA 2Z6AA 4G1MB 5G0UA 1XDDA 1W44A 2FW8A 5I5GA 4B82A 1KVUA 3PHLA 1HYBA 2W9XA 3QLUC 3RTCA 2Y68A 4G26A 4XIYA 2QYHA 5FBZA 3FRJA 1J7KA 2DY1A 1QK3A 2JGDA 1X70A 2BEKA 4NWIA 1XMQB 2FZEA 4UBOA 4B7AA 3PQ3A 4IHQA 4GWLA 1FX0B 2FPKA 4ZV9A 2X9LA 3L0ZA 3C7KA 1YOBA 3EZ6A 5CX4A 4IJWA 1Q0HA 5CBKA 1V5FA 4HLUA 4OGLA 4ZDKA 1OREA 5F64A 3E1KA 4AQYB 3FHJA 1KR2A 5BSKA 4MIEA 3SLGA 2GLUA 1G6OA 1PZFA 1J56A 4KTVE 4GFDA 5SYAA 4B4WA 1XELA 1QO0D 1QGDA 4K9KA 4E2XA 3M1YA 6YASA 3OA0A 5FKJA 4B0OA 2C9ZA 5HUHA 4NCHA 2QW0X 4KYUA 2NN3C 3DMNA 3NP9A 3NORA 1K5PA 4FI3C 4U0JA 5E9QA 3CJRA 1CUYA 1HTWA 3OAAA 4MS3B 2P91A 1E63A 2P3LA 1Q20A 2HMWA 5ALVA 4GMGA 2HRRA 2OM2A 3TNLA 5IN5A 2GARA 1NMEA 2A1UA 4OSEA 2DBRA 4OD0A 3TX2A 1WSDA 5CJJA 1QR2A 1XAHA 1TLFA 1QHEA 2C1ZA 3VU0A 1KL7A 3HLKA 1UWCA 3WGHA 2CNBA 3FM9A 3HPQA 3P9RA 5F35A 5AW1A 5ARDA 1J0BA 2GCOA 2Q9AA 2H57A 2R44A 4MKIA 1HY3A 1E79D 4J91A 1XD9A 2DQZA 4FONA 4A8JC 4ZVKA 2G7ZA 3LT4A 3FTFA 4FR5A 5KVCA 2JGKA 3TS1A 5JLJA 3X1ZA 3KAQA 2D7JA 3DJFA 1KO1A 1RDFA 3TN7A 1OI4A 3AI3A 1OX4A 2G4VA 1X7DA 1DX9A 1ZGJA 4H7JA 2BMAA 4MGIR 4JLDA 4E21A 4BV8A 1OLOA 4RZ3A 1DO2A 2V7BA 2Q2VA 2QSZA 1YMVA 2WJ4A 3NH9A 1YNSA 3HJHA 1D1SA 1UBSB 2F9LA 2INGX 2WM3A 1N0IA 1O2DA 2GQ0A 2YTZA 3AP3A 1E8NA 2H00A 4HGQA 1XI2A 4MV7A 4QDOA 5C80A 2HHHB 1DEHA 1T9GS 2DP4E 5AOCA 1VXOA 1YZLA 4FR0A 3V8NA 1T1EA 2FUKA 5CB4F 4V1CA 3CMCO 1GPNA 3NYWA 3CXRA 3SDBA 1FSSA 5JEDA 4XFJA 4TWJA 1W2WB 4J94A 1IJEA 3VOTA 4WW0A 4J0DA 1X92A 4EDHA 2ZB4A 4QEKA 3PEEA 1ZH8A 1KI2A 4BLPA 1SOVA 2J7KA 2QLMA 3RVQA 4ZVOA 4F9EA 3KLNA 4H7EA 1XVIA 1T2UA 1FZQA 1C9KA 3COYA 4OM7A 3VPGA 4DSOA 4QX6A 3NR2A 1AKQA 2PYDA 1NASA 2B4YA 1IEWA 3B2QA 5EZYA 4A27A 2EZ4A 1ZSYA 1YRLA 4PLCA 4AJLA 2ZKLA 4J7UA 5HQTA 4YCSA 1JPJA 2QEQA 3OIWA 1E6WA 4P4TA 2IYSA 1VXRA 3OBIA 4A2PA 2UU9B 4HQNA 2AR7A 1GTJ1 3JQ8A 4DMGA 1KSFX 4ZWNA 3DL0A 2PVPA 2ZUFA 1RABA 4F3NA 1HEIA 4GXRA 3T41A 1T3SA 4EJSA 3QU4A 3R0IA 4ZHQA 1BD4A 1N7HA 2O7NA 2BHTA 2EHJA 5DIFA 4WDRA 2E4ZA 4Q3BA 1BC5A 1XYVA 2FCAA 1L5WA 4YJKA 4P58A 4C0WA 4DEXA 4AJKA 5MN6A 5D84A 1MRSA 4PGGA 4DBZA 2YXDA 4H7PA 2X58A 3RYFA 4ARAA 1IM8A 4P0PB 1PVDA 4WXYB 4LF9B 1SZJG 2B8EA 1L8OA 4LQCA 2C9CA 5BSUA 5C5EA 4HGYA 3VAAA 2OKGA 1CRPA 4JT4A 5BV2P 1H85A 1PV1A 2Q4EA 1PS9A 4D0NA 5DNDA 1CY7A 5D1NA 2NT3A 3BCHA 4EA6A 1JDPA 3P2EA 2OM6A 4Y2TA 1Q92A 2OORA 3G02A 4IDNA 3AFNA 3OQHA 2XPCA 1JLLB 3EPLA 4O25A 3TNJA 3AWIA 4W8HA 4PZAA 3GLQA 3T61A 4DM7A 1X8LA 2AF4C 2WD7B 3WLMA 4UHJA 1IONA 1J24A 2I4LA 4MVJP 1PN3A 1W35A 4IF6A 3P71T 5JASA 3MGGA 3LD9A 3QYJA 4G1VA 1OI2A 3MBOA 3NIBA 1E1YA 4LPSA 1GRRA 2COUA 3RC2A 1GZSA 1NXVA 3H9QA 1PEDA 2A5LA 4ZC8A 1FFSA 4DZZA 1H9BA 2C2WA 3MZ0A 3IFSA 3PUVA 5AYVA 4BNMA 1Z13A 4DUGD 3L05A 1MU0A 1VRCA 3CG0A 4YRFA 2XEDA 1MC1A 3OZWA 1UXIA 1WHSA 4ZEMA 3EZGA 3F71A 2C00A 3CEHA 1PFWA 1L7OA 1CRLA 5A3SA 3W6NA 3ICQB 3WK8A 3DTTA 4KZPA 1S4MA 4S1NA 1H2YA 2PV0A 2O54A 1C14A 2P9CA 5HM6A 3LHFA 2FW6A 4M1EA 4K8OA 2C9YA 1O9HA 1L4HA 3THWB 1BH6A 2C3OA 4R98A 3OJ0A 3H1BA 4FX5A 1XLTC 2PMKA 3PGKA 5F1YA 1H4QA 1K6EA 2B4TO 2IHUA 1QQ7A 2ZUTA 1E1MA 2X0IA 3I64A 3SHQA 4WA8A 4OAQA 4F8EA 1RZUA 2PD4A 3JD1A 3RQIA 2RGEA 3QKRB 1TNDA 1YQGA 4FYXA 3V4ZA 4K8RB 3GAZA 1R8YA 3IILA 1E5LA 4IXMA 2HZ7A 1WCWA 2QD3A 2VUTA 4AW9A 4DJ5X 4QDKA 1W7AA 1BSVA 1CDEA 3O82A 4KBGA 1W47