2DR3A

Crystal structure of reca superfamily atpase ph0284 from pyrococcus horikoshii ot3
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
239
structure length
232
Chain Sequence
b'RRVKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKGIIVYPDKVLKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0273 protein PH0284
publication title Crystal Structure of RecA superfamily ATPase PH0284 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 74
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06745 ATPase KaiC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2dr3A00
3AF4A 1XF9A 4ZI2A 4LY6A 3AV0B 2OFWA 4Z1MD 2QPTA 4HEJA 1G18A 1KNQA 2QL6A 3CRQA 4WW0A 3WNDA 2CLSA 3QOFA 4V0LA 5E3HA 5DSZA 1RIFA 3U3RA 2FFAA 5JMTA 4AURA 5GJWC 4W5HA 3ZZUA 5KPJA 4XH9B 5E95A 2GWHA 1P2SA 4DCUA 1GITA 2GXAA 1XJ0A 2QPOA 5DNYB 1CIPA 4MH0R 1UAAA 1P72A 1E69A 3THXA 1G7CA 3RANA 2J0SA 1UKZA 3H2YA 3FDIA 3RS0A 2J7PD 1SGWA 2A5YB 2P3SA 3MCAA 4JIMA 3DVLA 3NBFA 2QTVB 3CRRA 3TAHA 4BWYA 2J9RA 3DOEA 4LBVA 1OH7A 4EAQA 3W5IA 4OHYA 4M1SA 3NWJA 1FOEB 4PHTA 4Q7MB 1E1QA 5AR1A 3FKQA 4UKDA 2ONKA 3Q8XB 4DLWA 3TMKA 1FNNA 4AD8A 3K0CC 4Q66C 2IYYA 4DIEA 4HDQB 1HTWA 2DBYA 2L0XA 2F1RA 1KI6B 1S0UA 3X1WA 2FA9A 3H84A 2Q9CA 3ZIAD 1D2EA 3KTAB 2CL0X 4MYTA 1I2MA 1WDTA 4ZO4A 2XB4A 3WMFA 3F0TA 4BEJA 2OG2A 2HT6A 2O8CB 2JJ1A 4ZDKA 4PQYA 1HE8B 1W36C 4RD3A 4RFSA 2FSFA 3LV8A 2C95A 1YU9A 4D25A 4MUAA 1KMQA 4B74A 4DC9A 1QVRA 1Z06A 2ZR7A 1AS2A 1G5RA 3MFYA 4ZV4A 1C9KA 3ND9A 4MGKR 3TUIC 2G0NA 2Z83A 4EQ6A 1ZP6A 2BC9A 2A5FA 3KB2A 5KSZA 3JZAA 3VR4A 1S8FA 3BERA 3LXRA 421PA 4LBYA 1GWNA 1T8TA 2BBWA 1FNMA 2WPDA 3VKGA 5C2JB 1E2LA 1KSJA 4G5OA 4MGIR 2KJQA 5C4GB 3U61B 2C03A 1W0JA 2O8EB 1IJFA 1E96A 2FF7A 2F7SA 4XWAA 2XZLA 4JBXA 2QPAA 4P3YA 5AUOB 3I73A 5BW8A 4CDGA 4LUCA 4CT5A 4K46A 3L82B 4IHQA 4TMKA 2REBA 1D5CA 2G0TA 2BM1A 2GEVA 2VP6A 3Q5EA 4UQOA 4A2WA 1L4YA 2WWFA 3B1XA 2WIAA 4Z8XA 5TDHA 2CJWB 1DG1G 5EP2A 2BBSA 4QBFA 4YONB 3AKYA 4B32A 1YR9A 2ZJBA 4UNPA 2W6ID 1IN8A 2YC2C 3EZ9A 2VIIA 3NH6A 1KK3A 4OYHA 2AD1A 5EP4A 5CIWA 2P0EA 1FUUA 4HSEA 2JCSA 3V9PA 2JATA 4D82A 5P21A 1DO2A 2IEZA 1N6LA 3BC1A 1EGAA 3Q85A 4IOJA 4S2EA 3QKSA 4B3BA 3PG5A 1T3HA 3NKVA 4HZUA 3QVVA 1T8UA 1VPLA 1G4UR 2ZJZA 1JR3D 2ZAOA 2F1HA 4DSUA 1M6NA 1E2EA 5AK0A 3NIBA 4KFSA 4Q7LA 2FNAA 4TYPA 3T12A 3T1VA 4E07A 3AUXA 2FGJA 4DCVA 1A2KC 4XJXA 2G1KA 4IVRA 4TYWA 2IW3A 1AZSC 1DAIA 3VTKA 1JR6A 1KYIA 4WIAA 1ELOA 4URYR 4C9BA 1ZJ6A 4Q4AA 2Z5FA 1H8EA 1LFDB 4DSOA 1IY0A 3K0FB 1G6OA 3FE2A 4I1UA 3G82C 2P6NA 4JMPA 2B8TA 5CM9C 5FBWB 1VCMA 5DHFA 4DHEA 1IY1A 2GESA 5H70A 2OCYC 5EXTA 5IDVA 1E94E 2CLCX 4FD2A 2QE7D 4RZ2A 2WIBA 3HJNA 4QJ3A 5TY0A 3ZYCA 4KFUA 3NEYA 2X2EA 2CEAA 2ECKA 1Z07A 3KQLA 3HPQA 3WBJA 3ZGXA 1TF5A 2EYUA 3KB1A 2X19A 1WP9A 3LW7A 4HDCA 3R9XA 1KSHA 3C8UA 3PUVA 2OUKA 3P4XA 1DAHA 1B23P 2C8VA 3BFXA 1E79A 3WP0A 2WVJA 3MD0A 3EPKA 4NP6A 1LF0A 2J0UB 2CE7A 3IPYA 3IDQA 3QEJA 3BIFA 4LYAA 1E1RD 1YZGA 4A8JB 4URXR 2NZJA 4GI7A 3GLFA 1EG7A 2LKCA 1UEJA 4DSNA 4GOKA 2FN4A 2VP5A 4LCBA 4URUR 1G3QA 1E2KA 4FW9A 1F6BA 2WHXA 2PJRA 3K9NA 4QL3A 1VECA 2VYFA 2XOKA 2HT1A 2VO1A 1QHIA 2CVHA 1NBMA 4PAMA 3VU9A 2QT0A 1N6PA 5JI2E 3MSXA 2VP2A 4ITRC 2NPFA 1W49A 2G3YA 3CZQA 2DWPA 3RABA 1E9SA 4OI4A 3TQFA 1MABB 1FTNA 1ZAKA 1JQJC 2D7DA 1ZM3A 1EESA 2ZJ2A 3ASYA 3B5JA 5FOSA 4LYJA 4JYBA 2NMVA 1DAGA 3AKEA 3R7WA 5IK2D 1M1YE 3QXSA 3AKDA 2OXRA 1Z0AA 4UNNA 4CEJA 5CDFE 3GLIB 1A7JA 1XXHB 2ZRNA 4URVR 2CK3A 1AGPA 3VR3A 3WRYC 3GLGA 3GLHE 4NMMA 5F2EA 8OHMA 4RKEA 3K9LA 5ELXA 3SR0A 4M22A 1EFRA 1T9HA 1X6VA 3U3JA 2OESA 3U7GA 4BRUA 3SYNA 4LHWA 1ZC4A 4G5RA 4TSFA 5E4FA 4JT2A 2JLSA 4BGDA 1AM4D 3WHKA 4LJ4A 2IX3A 1U8AA 5HKKA 4FINA 4XSGA 3HP1A 2C96A 2W6JA 4C0QC 4Q4JA 2FU5C 2CDNA 1KKMA 1L7VC 1M74A 1Q1BA 4HB3A 4LI0A 5TARA 5K8TA 2ZEJA 2ZM5A 1W46A 1K5DA 3WYGA 5KDOA 1MV5A 4YDHB 1KDTA 2GVDC 1N5LA 1KI9A 1T3SA 2F3RA 3CKLA 3FMFA 3HDTA 3B1VA 4LHVA 3CF0A 4M9QA 4PHGA 4BEBA 1P62B 5DN6D 5K8LA 4II7A 2HYIC 2B21A 4BQSA 4EDHA 3ZLJA 3UPUA 2O8BA 1FL9A 4OHWA 1DS6A 4Y0AA 4CEIA 3W3AA 4DXAA 3C41J 4BZPA 1PUJA 4B2PA 4JSYA 3PFIA 3TLXA 4PO9A 3LNCA 3BFVA 3KXKA 3SJZA 1TTTA 3A6PC 3NTUA 5JLJA 4KLNA 2E9SA 2RGNA 1Z63A 4TL8A 1JAHA 2P65A 4QGHA 5KPDA 2XZPA 3MRSA 2YJTD 5L3RA 2ZQ5A 2HDNB 3UXMA 3SEAA 4LV5B 1XX6A 2RGBA 4AYWA 2OLKA 5JCPA 3U7FB 4ZIRB 1DOAA 2V3CC 4XVUA 4I1VA 1LW7A 1MO6A 1XXHE 1VKJA 4TLCA 5FUVA 3TSWA 3K1JA 3I72A 1XEWX 1N6KA 2ZI3A 5DGXA 3CZPA 2IYLD 1RW4A 4DDUA 4ARZB 2JLXA 4QM7A 1NN5A 4PC1A 5CJ2A 3NHBA 3CX6A 4NCNA 2JASA 2EFDB 5DI3A 1NIJA 1GKYA 1UBEA 3W90A 4Q1DA 4BFUA 3MUFA 1LF5A 3ZVMA 4DIDA 3THYA 4R9UC 1XPRA 4PAOA 4GRAA 2WICA 4P4SA 4K81B 4YQFA 2JIZD 3W5JA 2I3BA 1Z5ZA 2N42A 2H7VA 2A5GA 4US0R 5AUNB 1TQ4A 3QNUA 1E6CA 2QP3A 5FI1B 3I62A 2VQSA 4OHXA 3UKDA 4TYYA 1R8SA 1NJFA 1AIPA 1M34E 2CE2X 3QKRA 3K70C 2QM7A 1GTVA 1U0JA 3I3SR 4DT1B 1UDXA 1QDEA 2A78A 3FKSD 4XSHA 2UVQA 3GEEA 3Q7PA 1B0UA 1OXTA 3LH5A 1R8QA 1TUEA 2RGAA 4N0EA 2R6DA 5LBIA 2ZRFA 5DH9A 3GJ8A 1Z29A 2W00A 4QXAA 4L9SA 1D2NA 2VPPA 4L4UA 2C9YA 5JEDA 2N46A 1T0JB 3BE4A 1F2TA 1G8FA 1W44A 1AA9A 2HF8A 2IK8A 5A5GA 3CNLA 2ZU6A 3GLHA 5J4LA 4N1AA 3R9WA 2DFNA 2J5XA 2PCJA 2QNRA 3FWYA 3HU3A 1AJEA 4D6PA 3AVXA 4IJMA 3QXCA 4DCTA 1J8MF 1E4VA 4FI3C 5FUYA 3FOZA 2V54A 1DAFA 3ZS9A 1PZNA 3QPVA 1RFLA 5SZIA 4W7SA 1AGRA 4GP7A 4FWTA 4WBSA 1G5PA 1ZW6A 1EK0A 1M7HA 1YJ5A 4ESVA 2BOVA 2QAGC 2VTKA 4LJ5A 4A2QA 4IW3B 1MOZA 3L8YA 4QKQA 2YVUA 4W9MC 1FFHA 3KKMA 1J70A 3I92A 3MAAC 1OFUX 4B75A 1KK0A 2AKYA 2JJ2D 2FEOA 2R65A 3CONA 4RVCA 5FPYA 1NNEA 3GFTA 4DEXA 4O0MA 1HV8A 4QC2A 2JLVA 3SS8A 2YHSA 4OHZA 1KTVA 1G8YA 2EFHB 2R8RA 4OHVA 3THOA 3ZDQA 1XEWY 5FFMA 2XEXA 1XD2A 1CJMA 3C4JA 2FFQA 4EFNA 3EC1A 2XNSA 3BBPA 3FFAA 1SHKA 2ZJAA 4BFSA 1J90A 3FMOB 3OZXA 3HU1A 2ZVQX 1RRCA 4OJKA 2HLDD 1X3SA 2FEMA 1BYUA 2ZSEA 5FL7D 1H8HD 4FMDB 4RD6A 1YQTA 5LB4A 4AY2A 2JAQA 4TLEA 2QT1A 3MLEA 1F60A 3CNNA 2BMEA 3SJBA 5FBQB 3A4LA 1II9A 2WKRA 1D8TA 2F43B 3AUYA 4QOSA 1T4GA 1GIAA 4F4JA 3B78A 1YHNA 1G20E 1Z0JA 1ZD9A 2ORIA 2J87A 4BZXA 3KXIA 4XWKA 1UADA 4H1VA 4GOXA 2WAYA 4ZDWA 1NP6A 1KO1A 3WP1B 4OI1A 5FTLA 5EZ5A 4MRNA 4EJSC 4R7ZA 2CHGA 3U4QB 4BASA 1CEEA 2B92A 4DJTA 1GRNA 2J1LA 1E2QA 2FZ4A 3AKCA 3K53A 5JJKA 3SHFA 3TH5A 2CBZA 3TRFA 1NY6A 3MMPA 1OYYA 2IXGA 2V1UA 3K0EA 3E5HA 4MDEA 4IRUB 4AC9A 2ANBA 2ZS9A 5DO9A 4B47A 3NBXX 4GZMA 5C46F 1A5TA 4LJ9A 1XTRA 4IDPA 4A0FA 1S1MA 4G5SA 3OEHA 1Z0KA 2KI5A 4QNRA 1MRNA 2AWOA 1PLJA 1QZXA 4IEIA 4LYHA 4V0ME 4OL0A 4HATA 1BYIA 3KDSE 5FR2A 1JBKA 2F9MA 1E2FA 5CK5A 1S2MA 2GHIA 3U60B 1M2OB 2YNMA 4M1OA 3HPRA 4Z8YA 2WOJA 3P4YA 1ESNA 4A9AA 3EPJA 2BBOA 4NYMR 2GK6A 5FTKA 2VLIA 1N5KA 5E7JA 4M1WA 1S1CA 2QRNA 4B3CA 4PZYA 3A37A 5DYGA 2OBNA 1E2DA 1ZVQA 3QF7A 3QF4B 2ZUBA 4FCVA 3ND8A 1M7GA 1ZBDA 2Z4SA 1OXVA 2FFHA 2OLJA 3AF2A 1TQDA 2QEQA 3RVBA 1IXZA 1AKEA 1OKKD 1GZSA 1E2NA 3UWOA 5J40A 3AVWA 1E2PA 1HE1C 1GKUB 1SKYB 3CNOA 4QG7A 4EQ6B 2AWNA 5BN4A 4DZZA 1Z0IA 3KXLA 3B7GA 1GL9B 4UXHA 4EKDA 5IT5A 2H1LA 3IO3A 3VHLB 3GMTA 4B73A 1UKYA 2J46A 4WZBE 1US8A 3WHLA 5F9HA 1VDZA 4QRHA 1FQKA 3R8FA 3IQWA 4NYMQ 1Z0DA 2PMKA 1P9WA 1P61B 1M7BA 2PJZA 4TLAA 3B82A 1XEXB 3KQNA 1ZNWA 3B2EA 4PX9A 4YLGA 2Q9AA 5FPTA 4HUQB 1HA3A 2ZE6A 4JLMA 1XTJA 3IILA 4RZUA 1YRBA 2C9OA 4LGMA 2VP4A 3WMEA 5FPHA 3EG5A 1I2DA 5KSYA 1KDPA 1CRPA 2ZRIA 2FDCA 1LV7A 4C0LA 1Q12A 2QMUA 3P27A 3IO5A 1ZMXA 4JL5A 2AK3A 2Q21A 4B6EA 1W36D 2CCKA 4F38A 3K70B 4XVRA 1XMSA 2D2FA 3AVPA 2FX3A 2OBLA 1TNDA 5E7MA 2OCPA 2WOOA 3QY0A 2WTUA 3WNCA 2CLDX 2NZ8A 2KSQA 2BV3A 1II8B 1E2JA 1ZM9A 3H0KA 1KO7A 3D7MA 4WZAE 1KO8A 1JJ7A 2HXSA 4HLDA 1PV4A 1T5LA 3SFZA 1XJQA 1CP2A 1NL3A 1Z08A 1HT2E 1KKLA 2CNWD 1E0KA 5L8VA 1ZUHA 3GP8A 4KCGA 4D26A 1XFAA 1FP6A 3RWOA 2CXXA 2J7PA 1OE0A 2V4ZA 3BB4A 1KMHA 3ADBA 4Q4AB 1Z47A 4TWZA 1W2GA 3REGA 3SFVA 5L3QA 1L8QA 2RGGA 5FOTA 4JZKA 3DPUA 3EIHA 1XBTA 1F48A 2FSIA 1NMXA 2OILA 4D80A 3QJYA 2FMXA 1TU4A 4A82A 1U90A 4QM6A 3R20A 2ZIAA 1GILA 3IHWA 3D31A 4HUTA 4KYUA 3VX3A 4KO8A 1P73A 4G0NA 4PQFA 1R4AA 3AVTA 2GVZC 2IT1A 2QSZA 4QHSA 3ONWA 3ZIAA 3A58B 2ZTSA 1BMFA 3I8SA 2NO9A 1VHTA 4ASUA 4V0MA 4U02A 4BFXA 2QAGB 4ILEA 2O8FA 2W58A 4NCHA 1QHNA 1CTQA 1U9IA 1MH1A 1VYTA 2Y8EA 2E1RA 4NU0A 3FHCB 2PT7A 4Q1BA 3VKWA 1JNYA 4B48A 5JHGB 1AKYA 4Q9IA 1OIWA 2NGRA 3KJIA 1QHXA 4DB4A 2DY1A 4D81A 1WB9A 1CS4C 4BRWA 5D3MA 5G40A 2FH5B 3LFUA 4JLNA 4Q18A 1Q21A 4KLZA 3TNFA 3OIWA 4EUNA 5EE9A 3F8TA 1EFHA 5JS7A 1UJ2A 1FUKA 1XDBA 2ATXA 3WBKA 4ZDIA 3I8XA 1E0JA 2AL7A 2ONJA 5G41A 4JVLA 2YV5A 4A0HA 2BVNA 2QQEA 4BFZA 2VHCA 3HYTA 3WNBA 3AB3A 2IS6A 1FZQA 3NEJA 4AKEA 4KBGA 5B30A 3H4MA 2KB0A 4G3XA 4M0LA 2IYQA 3IPXA 3BH7A 3W8RA 1X8LA 3A8TA 3LX8A 1IJEA 1MR3F 5TB5A 2OV2A 3EIQA 1TL7C 2BMFA 2O8DA 2F6RA 4R2HA 1XMVA 5GJCA 1G21E 1YVDA 2RB4A 4PC6A 5EXXA 4MA4A 2ZI9A 2HJVA 4CEJB 4JVNA 2W6IA 4EPTA 2ZVPX 1S9HA 5D3QA 3SDZA 3ZQ6A 3PVSA 4I4LA 1ZM4A 2DCUA 2BBTA 1EX7A 3RRZA 4NHOA 3T1OA 4EJSB 4IOMA 2V7QD 4HAVA 1N6HA 1E9DA 4L9WA 4P31A 3MGCA 1ONBA 2PMDA 3FTQA 4XOIA 4U7DA 3WMGA 1JR3A 2RHMA 3EA0A 1I4DD 1AS0A 1NVVR 1XZPA 3IBYA 3GJ3A 3I32A 1RYFA 1IN6A 3ECCA 4Y0VA 5JFGA 4OQLA 1TAGA 3CRVA 2R6AA 3TSZA 5TVKA 2W0SA 1KAGA 4V0NA 5CJPA 2AXNA 3BK7A 3U44B 1Q57A 3OEED 3B1YA 4PANA 1GM5A 4CEHA 1G9XA 2GZHA 4OQNA 2B7BA 3MWYW 2IYZA 3LVRE 4Q4LA 4O3MA 2KE5A 3PEYA 1NLYA 4M1KA 4PXAA 3CPEA 1TX4B 2HCJB 1OH5A 1DAEA 1XWIA 4TN1A 2EWVA 3GJ0A 1NVWQ 5C4MA 4JJKA 1OSNA 2WWXA 1E4YA 2ZYWX 3IGFA 3QE0A 2GA8A 4Q1CA 2JLYA 2QE7A 5H8WA 1UDWA 3EARA 4KVGA 2H8KA 5LD2B 4LHYA 3U3OA 4URWR 721PA 3I4LA 1E3MA 3W6PA 2ZJYA 4LWZA 1GKIA 3VHXA 1XZQA 3T61A 1XB2A 1NI3A 2G77B 1NVVQ 2ZU0C 1OPXA 4MUBA 1VCNA 2WSSA 4JL8A 1QHHA 4Q02A 2PLRA 4R2IA 2A7QA 4TL7A 1Z6GA 2QENA 4NCIA 3UG7A 4MRVA 4YMUA 4GP6A 3VKHA 3SNHA 3SI7A 3LLUA 1NN0A 1QVAA 1UBFA 1SXJC 2NQ2C 4LV8B 1E1RA 1GVNB 2Q3HA 4YMSA 2F3TA 4DLRA 3UMRA 4WXPA 2DFKB 2XJ4A 2PZEA 3SJAA 4WZ6A 4EFMA 5KTYA 4DLTA 5ANRB 2ODWA 2OHFA 3E1SA 3VNVA 4C4PA 3R8CA 2OE2A 1QBKC 4F7WA 4DVGA 5DI3B 2GJKA 4OQFA 3RSOA 3Q5DA 3CR8A 4DLXA 2K5UA 2QBYB 2REOA 1I4LD 1A1VA 3OE7D 2PEZA 2RAPA 3DL0A 5JS8A 1G3IA 1KSFX 2IYUA 2TMKA 1E9BA 3IHLA 2ZAMA 3M6AA 4IDHA 3GFPA 3TW4A 3CX7A 3KKNA 4HZIA 2QA5A 3FPAA 3KUCA 1NLZA 2P5SA 1AS3A 3OIUA 2BCJQ 4FMBB 3FHTA 1SVIA 2KBFA 1TU3A 3CF6R 5E7IA 4QGGA 3RAPR 1XTSA 2GCPA 2ZJ5A 4A92A 5AJZA 3SBDA 2W83A 3RLFA 4A6PA 4PSKA 1MRSA 1N3BA 1T6NA 1CJTC 3EXAA 4JVSB 1U8ZA 3TKLA 3SU8A 3U7HB 4DDVA 4P33A 4CF7A 3Q9LA 3PJRA 3VR2A 2QMHA 4U5XA 4Z51A 1NKSA 2BM0A 2JJ8A 4IDOA 1G5TA 1L2TA 1GNRA 2C98A 1N0VC 1UPTA 3AH8A 3U6KA 2ATVA 5CB8A 3RS2A 1G8PA 1LY1A 2BEJA 3PENA 3ZZTA 4RJLA 3EX7C 5GVRA 3RRYA 2JLWA 4HAZA 3BXZA 1GRQA 4CRWB 2Q3FA 1RVDA 4NZYA 2A3RA 4PC7A 2DPXA 5CLQA 5FTNA 4A0GA 4QNMA 5DN6A 3V4FA 3AVYA 1YR6A 2AFIE 5AUQA 4OK6A 4US2R 1X1RA 4LPKA 3VQTA 1RC8A 2W2TA 3B60A 3K70D 4PFSA 4QGFA 2JGNA 3D3QA 1WBBA 4IEEA 3C7KA 4K8OA 2C99A 2FSGA 1G7SA 1U9IC 4NYIR 1T91A 1AQYA 1RKBA 2ZROA 4E03A 5JZVA 2C04A 2PEYA 1RE0A 3ZD7A 5H68A 1F2UB 3UMFA 2YOHA 2Q0HA 4C7OB 4XD7A 3B9QA 2IS2A 2MSDB 1HYQA 2OCAA 2VHQA 3K09A 4Q4HB 3EASA 4V02A 5BYJA 2WWGA 3IIJA 1CXZA 2WM9B 1NN1A 3CR7A 3DMNA 3VX4A 1YZTA 3X1XA 4URZR 5GVSA 5IHPA 4B3XA 3BJIC 1KY2A 2GBLA 4Q19A 1QHSA 2QP9X 3BH6A 5J47A 2VSOA 5FOUA 1KZ7B 4DKXA 2GDJA 2P6UA 1WBDA 2H16A 3WRXC 1ZNZA 3QI2A 1ZCAA 2VL7A 4RY2A 1SZPA 4JLAA 3LWNA 1H65A 2LWIA 1NG9A 1KI6A 4YDSA 4FXPA 4S35A 2EWWA 4I1SA 5A0FA 4MKHA 2EYQA 3KTAA 3EZ7A 3CW2A 4EIWA 1WA5A 4V0KA 4US1R 3F3YA 4NBSA 1Q44A 1KO4A 1GL6A 2XAUA 2O8CA 1OFIA 4V0OA 4PZZA 2HEIA 1G19A 5M04A 3RDPA 1DARA 4NKRA 3F5FA 4BLQA 3J81k 3BORA 4WVFA 1N6IA 4M8NE 2WWIA 821PA 1SQ5A 4I81A 3QUSA 2CCGA 1CBUA 4F4IA 3T06B 1XCGB 1DVRA 4FCWA 3RHFA 3K0AB 4TQAA 1P2TA 4TQUS 5KDDA 1R10A 4LOAA 4NE2A 4CW7A 1W36B 1J7KA 4ZKEA 2RHDA 4MKIA 3RRNA 3QKUA 4IVQA 4WA7A 2A5DA 3LRPA 3ZVRA 3ADDA 4ZCIA 1L4UA 2WJGA 3GLIE 2O8EA 1S96A 1GG2A 2AN9A 1CJVC 1W4CA 2GEDA 2WKPA 4GZLA 4RD0A 2D7CA 1EXMA 1JXMA 4E22A 3I1FA 4WXRA 2QMOA 3AGQA 3EW9A 3PUXA 5JHHB 3SQXA 3CM0A 3IEVA 2CJWA 2W2VA 3GEIA 5FPKA 1R0WA 1YR7A 1WXQA 4IXMA 1EFTA 1S3GA 4PAQA 5G53C 1JECA 3X1ZA 2IC5A 4H9GA 5FOVA 1DAKA 1JALA 2PH1A 3RS3A 3LVQE 4ABYA 2GCOA 1EWRA 2MMGA 2ZRDA 2G6BA 2ODNA 4D4LA 2OBMA 2GK7A 3NBZC 5H1YA 1ZIPA 3EZ2A 2GJ9A 3P26A 2PX3A 1LVGA 3IBGA 1EFCA 4EPXA 4KYIB 3JVVA 1N2CE 4Q47A 1VG9B 2XTMA 1S9DA 2OFXA 5F9FA 2RGDA 4M53A 1SXJB 1ZC3A 4HB4A 4JT4A 2VSFA 2WJVA 5AWFC 4BE7B 1I4TD 2BJWA 2XNDA 3EWAA 1V43A 4Q1FA 4M21A 1P6XA 3PXGA 2G83A 3DDCA 1PLLA 3K0FA 2AKAB 3I5XA 3NC1C 3CLVA 4PO8A 5FTMA 5EZ6B 2HV8A 4LHZA 2HLDA 5CDFA 3U6BA 2ZRKA 2BCGY 1QG2A 3G5UA 4KXFB 4RZXA 3KJHA 2FE4A 5FL7A 1H8HA 3THWB 2J0QA 3Q72A 3PUZA 1ESMA 3LLMA 4XTRA 2REXB 3EPLA 2QQ0A 1VYUA 1W4RA 2FFBA 4PHHA 4PPGA 1W1WA 4BLTA 3B85A 1X8KA 1E99A 1FP7A 2CL7X 3FFBA 1P2UA 5JSZB 1F3OA 3OFND 1BO6A 5TMPA 3GLFB 2JLUA 2EFGA 1JEDA 1JEEA 3LQRA 4G5GA 2J0UA 4HB0A 1TMKA 2EVWX 4LYFA 4A8JA 2FJUA 4KJZA 1TF7A 1UBCA 1G8HA 2OZEA 1DE0A 4RFVA 2FWRA 1IOZA 1DEKA 4FN5A 4XIGS 5KHOC 1FX0B 3GQBA 4LJ7A 2UZIR 2WJHA 2WAXA 4B34A 1OJLA 3ZH9B 2DWQA 2ZRHA 3UMSA 4OKSA 4M9XA 1G7RA 3W3ZB 4LRWA 3MWLA 2IXEA 5JI3E 3VR6A 3ADKA 3E70C 2RCNA 3OHMA 4GFDA 3CPHA 2IWRA 5EQTA 1NIPA 1P7CA 1SXJE 2AHOA 1A4RA 4KFTA 1JPNA 1J99A 2D74A 3EZFA 1MKYA 5LB2A 3GJXC 2ZANA 1MABA 5EE1A 4F93B 2XSZA 4C3ZA 4P32A 3NXSA 5B57C 5JJLA 2XXAA 3A36A 3A4NA 2B8WA 1RJ9B 5DIFA 5JWRA 2NO0A 1GNPA 4MITA 4IXNA 4IOLA 1W0KA 5F3WB 2V6IA 3UATA 1KJZA 1XXHA 2QGZA 4NL4H 3RYTC 3TBKA 1P2VA 3RWMB 2O8FB 2ZSAA 4A1FA 3CF2A 4IDQA 1KDOA 3ZS8A 1G1MA 1R0YA 4QGAA 2WWHA 3H1TA 1ZNYA 5KNCA 1PLKA 5L3SA 1ZNXA 2HUPA 4IVPA 4KVAA 2XTNA 1PJRA 4MGZR 5BQ5A 1TF2A 1OKKA 4YMWA 5C18A 1KI1A 3AGPA 4D0GA 4ESHA 2VRWA 1WCV1 1XEFA 2QRZA 3JZMA 2XITA 4BZQA 4DBLC 3GLFE 1W4BA 2IEYA 4Q5IA 4BFYA 2GBLC 2WMNB 3QXXA 1QG4A 2C2HA 1AQUA 4L15A 2CMKA 2R2AA 3THXB 2AXPA 2JLQA 1W5SA 3LXXA 3CWZA 5KSPA 1E9RA 1KNXA 1Y3AA 3GJ5A 2IUTA 1VYVA 4B3FX 1P3JA 4P4UA 2AD5A 2IYRA 4C0KA 2GXSA 5B64A 2YWGA 1AK2A 3WXMA 3K0CA 4RSGA 2R6FA 3CX8A 3H86A 3OAAD 5JEEA 4C30A 5LDDC 5UKDA 1KO5A 1KIMA 4GMDA 3SJCA 3D8BA 2FPLA 2O8DB 3LD9A 4GBMA 4GNKA 4TT3D 3MJHA 2PBRA 3QG1A 3X2SA 1MO5A 2OCBA 4PPFA 4JLJA 1NVXQ 2V8OA 3A4MA 3QVUA 5DLQC 3UK6A 1IXSB 2QG6A 1R2QA 2QP4A 1HQCA 2D62A 2YYZA 1AZTA 4JKYA 6Q21A 3K9HA 3A1VA 2GETA 4Q9JA 2DB3A 1Q1ZA 2XB2A 4ZIRA 4W5JA 2RGNC 4MYUA 2IYWA 3EIEA 3DMDA 5FUWA 2IHBA 4HYYA 1C4OA 3LDAA 2D06A 2ZETA 4RFSB 2JDID 5GJVC 4LX0A 4UNSA 5KUTA 3QSYA 3LBHA 1ODFA 2CNWA 2QY9A 2IL1A 4OK5A 4ARZA 1COWA 1SVWA 2AX4A 3NVAA 1OHHD 3PR1A 2DFTA 3TIFA 2EFCB 3P32A 1YRAA 2VHTA 1CJKC 3R9IA 1TADA 3T5GA 2GCNA 1VG0B 3DKPA 2BMDA 3RSLA 1P75A 2XX3A 4IKEA 1NMYA 1E9AA 3NG1A 4JLPA 5KSOA 4RD2A 2H17A 3KX2A 2ERXA 3PUYA 3MG9A 3KJGA 3A1WA 4HB2A 4TYNA 1EFUA 3PUWA 2FPMA 2RKOA 2GILA 2V55B 1P4SA 3DHWC 4R71A 3HR8A 4DT1A 5BN5A 4FCTA 1R5BA 2GF9A 4JLBA 1KAOA 2WV9A 5KDLA 5SZKB 3TW8B 1K8RA 4NCJA 3UIEA 2C5LA 1RYHA 4KAXA 4Z1MA 1NJGA 4DEYA 4AKGA 2B6HA 2ZRGA 3CIOA 3QKSB 3OEHD 1RZ3A 1W2HA 1KGDA 3B1WA 4HZUB 4O2RA 1IN5A 1LNZA 1YZLA 5CITA 1OV4A 4AI6A 4OJQA 3U2QA 5JBQA 1Q22A 1LS1A 4Q7JB 4A6XA 1CJUC 4M9ZA 4ON9A 4KBFA 1YKSA 2V1XA 2JLRA 4EFLA 4JLOA 1U0LA 1DO0A 3X1DA 1DAMA 221PA 3EAQA 1J2JA 4X8OA 4QJ4A 1VIYA 2QORA 1RPZA 4LSGA 2Q9BA 3QBTA 1Q0UA 3DO6A 3W34A 1G8GA 5TV2A 1R0ZA 1SKYE 1XU4A 3SN6A 4C0HA 4CYMA 3IIMA 4DLSA 1JB1A 4KI0A 2FOLA 2HF9A 4N0DA 1OXUA 1S3SA 1OH6A 3N70A 4YXWD 4G5QA 3TJZA 4B43A 4MRRA 1KI4A 2ERYA 2WSMA 2PX0A 2BMJA 2VP9A 4QHTA 1R6BX 2ZRAA 4EPYA 2Q6TA 1SXJD 2O0KA 3EC2A 4L16A 5KO2A 5CIQA 1UFQA 2ZUCA 2QTFA 2V7QA 3LX5A 4G01B 1XRJA 4OK3A 2P5TB 4NPHA 2OO7A 2ZPTX 3TGPA 1W47A 4D4MA 2GJSA 2QGNA 4XVQA 1VCOA 2QMEA 4DUGD 4FMCF 4C2UA 1Q1EA 5EUMA 4O25A 4AK9A 1XCMA 5CM8B 5JJIA 2EQBA 3REFA 4LZZA 4XWOA 3QPUA 4TMXA 3OEEA 1VTKA 4JLDA 1E2IA 3GPLA 4QBHA 3N2EA 1SVLA 1KK2A 1DG3A 3AF0A 4LPSA 4UNQA 2SHKA 3QKTA 1JAIA 1OFTA 2N1BA 4B6FA 1VG1A 2GF0A 5HCNA 2IYTA 4O2LA 2F43A 3DZ8A 5CLLA 5DE3A 2LKDA 3VU9B 1WQ1R 5LPNA 4B3GA 5SZHB 3SOPA 1KHTA 1AN0A 2GZAA 1ZYUA 4DLYA 4UNRA 1DELA 1RRFA 4Q1AA 3ZZ0A 3U4QA 3P1JA 4BLSA 4C2TA 3R7WB 4E09A 1Z3IX 4G1UC 3S1AA 1KJYA 2GJ8A 2YZ2A 2PCLA 1Z2CA 1Z22A 4MRSA 1E9EA 3EPHA 5BWMA 4GOJA 4C0BA 2GAAA 4MYCA 4Q01A 3GLGB 2DR3A 3T5DA 2ZXUA 3FHOA 2A5JA 2PLFA 3UG6A 4YMTA 2EW1A 5JECA 1C1YA 2HYDA 2YINC 2ODBA 3RS4A 5J4YA 2ZSFA 1NKTA 2F9LA 2PL3A 1SVSA 1UF9A 1UM8A 5HZHA 3VNUA 1GNQA 5DI9A 3W6OA 3U5ZB 1ZD1A 1N5IA 1OW3B 1Z0FA 3QQ5A 3L43A 4DDTA 2IXFA 1XD9A 4TLDA 4B2IA 3N2IA 4Q4JB 3JVUA 1LS6A 3OE7A 1KI7A 4AIIA 3QG5A 1XMIA 4OI2A 2RH5A 1QHYA 1BMFD 2UKDA 3K0SA 4KITB 4L5BA 1ZIOA 4ASUD 5FBVB 1F5NA 2FGKA 1OB2A 4Q21A 3RS5A 3C14C 1NG1A 2FZLA 2BJVA 3QF4A 1YZKA 5FBLB 3CWQA 2O8BB 1CKEA 3TR5A 4DCSA 5HPYB 3TSOA 4CEIB 1PVOA 1N6NA 3IIKA 3TUJC 1NBME 1II0A 2GJAA 4B2LA 5KU1A 2BHRA 2QZ4A 1Q3TA 3B1ZA 3VAAA 2MMCA 4EPVA 3CRW1 5JCZA 4FIDA 4HAYA 2AK2A 1YZNA 1R7RA 4TMVA 3SC3A 2VEDA 1OYWA 4LC0A 1CR1A 2NIPA 4DWJA 3QIAA 2GNOA 3SE0A 2OXCA 3D6TB 4I1OA 4M1MA 3M1IA 2ZRBA 4GL2A 1NN3A 1XEXA 1E1QD 1G3MA 1M8PA 2B7CA 3LQQA 1YZQA 1GAJA 2J3EA 1Z2AA 4HUQA 3TE6A 4B44A 1Q3HA 2YWFA 1U98A 3BD9A 2HCBA 5DHAA 3U3MA 4A0RA 4C0AC 1BOFA 4JLVA 3KJEA 3L8ZA 1D2MA 3MJRA 3RNLA 4XTCS 1OB5A 2ZE8A 3P20A 4A2PA 1JQLB 1Z8FA 4BFWA 1T5IA 3IKJA 2GTPA 3THYB 2VH5R 4GSYA 3OIVA 4P4SB 3VR1A 3KQKA 1MO3A 2GCOB 1DPFA 2CHVA 2IF0A 2JJ1D 2QUZA 2Z0MA 4LJ8A 4R98A 2WZQA 5JRJA 4LJ6A 3AEZA 3TVTA 1II8A 3EZ6A 4CIDA 4RD4A 1IY2A 4ACBA 1G17A 3QKRB 5IK2A 2ZITA 2ZRLA 3VFDA 4JBWA 3KKOA 1TEVA 4BLOA 2YKGA 4POAA 5L3VA 2OFOA 4J0QA 5BXQC 2G9NA 4JBYA 4DRZA 4BFTA 4RCYA 2X77A 3KZ1E 1UKVY 2KBEA 3TAUA 3O8CA 1YZUA 2ZE7A 3AP2A 4D2IA 5JRZA 4RKFA 3ZQJA 5B2ZA 4I99A 2QM8A 4MKGA 3KQUA 1R0XA 2UZ3A 2O5VA 5BN3A 3HR7A 1XTQA 4M2LA 2QAJA 2W0MA 3TVDA 2OM2A 5GADl 5FL3A 5HR5A 1F2TB 2WPDD 2A9KA 1D6JA 1OFHA 3E2IA 1W0JD 2AFHE 3L0IB 3GLHB 5EP1A 2IHYA 3GEHA 2NTYC 4FMDF 4DLUA 3W6NA 2OAQ1 2IF2A 5IF9A 1E9FA 4ZCMA 2H57A 3U3KA 2J45A 3AVVA 1W48A 1OXXK 3O8RA 4HAUA 2EU8A 3WY9A 1OT3A 2QAGA 1E2HA 2DFLA 1ZU5A 1U0HC 2WSSD 2WKQA 4HAWA 2IUSA 4A4DA 4E5UA 4QJ5A 3T1TA 1G7TA 5KNDA 1Z28A 2ZRJA 2ZYVX 3B9PA 5EE0A 4JLKA 4RD1A 3L2OB 4NCKA 5HE9A 1OLOA 4P0TA 4HLUA 4LBZA 1NSTA 4PSVA 4QBIA 5CYPA 1GOTA 3VR5A 3BRWD 2IYSA 1JI0A 4M9SA 2BIFA 1O3YA 1XTKA 4QHYA 2HJGA 4EPWA 1Q20A 2J7KA 2NG1A 4Q9LA 3RS7A 5HTKA 4F4CA 3I5YA 2ZJOA 3GD7A 1U94A 2NO6A 1BH2A 1FQJA 1GUAA 3PIRA 3BFKA 4TMZA 5KYKA 4DB2A 1H8ED 3PEWA 2C9CA 3BAFA 1XD2B 4NDZA 5C1BA 5KNBA 5FTJA 5HE8A 2RGCA 2IBMA 1T3LA 4LK2A 1ANKA 4OI0A 2ZYTX 4AG6A 2GEUA 2XXAB 1ETUA 1QF9A 2VF8A 2WBLC 2XTZA 3TR0A 3WYFA 521PA 2J0VA 3FMIA 1SVKA 4WAUA 5JWOA 2YC4C 1J8YF 3L0SA 4AKIA 4TTQA 3X1YA 2ZI6A 4ZDJA 3BWDD 2QI9C 4NYIQ 1ZM7A 3AF1A 2JIZA 2OEPA 4EJSA 4TL9A 5L3SB 2ZSDA 2Z4RA 3A1UA 4AKHA 4LBWA 4CT4B 3LBNA 1QHGA 3FVQA 2F1JA 1HQYE 1E32A 4AG5A 1E79D 3DM5A 4LJYA 1HURA 4FMCB 2ORVA 1CU1A 3O8BA 4W5WA 2X1VA 5EP3A 1W7AA 1OXSC 4Q03A 4PC3A 3CH5A 3FKSA 2Z6VA 1E98A 1KDRA 4TZ6A 4B76A 1P5ZB 2CVFA 4NYJR 1ZUIA 2J41A 4QBGB 4Z54A 3ADCA 2A30A 3U44A 2V6JA 2R6CA 4MRPA 2IYXA 4Q9KA 3AF3A 3BS4A 2JLZA 2XOKD 2C77A 2BWJA 4F92B 2WWWA 3T1QA 1HT1E 2A2ZA 1NBMD 1IHUA 4OBEA 4GPTA 4IDNA 4TYQA 4M1TA 1PUIA 1X86B 1XMJA 1KI2A 1GRRA 1RRPA 1O87A 1XP8A 1N6OA 2O0JA 2QTHA 3AP3A 1HH4A 3M4YA 2ZR9A 5G3ZA 3MWJA 4HI0E 3LY5A 4DDWA 4XD7D 4X8HA 4EPRA 3OFNA 5SZJA 4F91B 4GMXA 3CBQA 2IWHA 2CK3D 5FR1A 4Q48A 1SKQA 3KKPA 1NF3A 3AQ4A 3GJ7A 3KUDA 4LDJA 4NYJQ 3C5HA 4QFMA 4ZPXA 1NVUQ 4OQXA 1KSGA 1EFRD 1TPZA 5EXSA 2CHQA 3Q3JB 4PQRA 1WE2A 2Q3MA 2NOAA 4TSFD 1HY3A 4KV9A 3SBEA 2ZREA 1FMJA 4JS0A 4WOPA 2JJ2A 5HKKD 3QENA 2W6JD 2QBYA 1E9CA 1G4AE 2ZI5A 4Q1EA 2O52A 3T34A 3LA6A 1TQ6A 1MT0A 1US8B 1K6MA 4DLVA 2FSHA 3C5CA 3BGWA 3KL4A 5AJVB 2ANCA 3CO5A 3TK1A 1ZD8A 4M1YA 3KQHA 4KHZA 2Z43A 3KFXA 3N5CA 2AR7A 5AJWA 2VHUA 3ICQB 2RGEA 121PA 4MDFA 4UJ3A 2JA1A 4V03A 2P6RA 1NMZA 3GCGA 3KFVA 4MQBA 1ZUNB 4CVNA 1GDDA 2JEOA 2R44A 621PA 1KY3A 3A1SA 4MGYR 4BLRA 1UKEA 1N0UA 2IUUA 4PTLA 1UBGA 2IA5A 2ZI4A 1KJWA 3K9GA 1GFIA 2ZYUX 1SULA 2GRJA 2NO1A 1KZGB 3C15C 3LW8A 2BEKA 2DWOA 2OSBA 2MSEB 4TMTA 1EWQA 4L8GA 4KFRA 1ZCBA 2P67A 4MYHA 1CR4A 4PO1A 3PV0A 1OH8A 1IXRC 4IOKA 2IS1A 3AVQA 3OESA 3NHAA 1Z6YA 1RRGA 5AJXA 2H5EA 3NBYC 4LHXA 1TQ2A 4X8MA 2O0HA 1KMHB 4HDOB 4HLQB 2IS4A 3DOFA 5CYOA 3ETLA 5L3QB 4CGZA 3ZVLA 5EJEA 3OAAA 4Q00A 3T35A 2R6GA 4IFBA 3QEOA 5IRCD 1G16A 4JL6A 2ZR0A 1G41A 2GZDA 3G0HA 4JSTA 3FB4A 4TT3A 4BUJA 2RGXA 1IN4A 4A36A 4GDFA 1TUIA 1CLUA 1XCPA 1XD8A 4TTRA 1FMLA 1YE8A 2P2LA 1XJCA 1F2UA 4C7OA 4RZ3A 1GL7A 3W8NA 4HLUC 4LC1A 3RC3A 3DZDA 3UWKA 2F55A 5EUQB 4Q4HA 1IM2A 3RRMA 4A15A 1A82A 3GLIA 1P60A 1NLFA 4DCNA 4PSAA 1N25A 3GLGE 1U8YA 1IONA 3M0EA 1OIXA 2XNDD 2YOFA 3CRMA 4B71A 5FBRB 5FPSA 3FYHA 2BKEA 2JDIA 1DBSA 1V5WA 2IYVA 4LJAA 3K09C 2ZJ8A 1N6RA 1CR2A 1E2GA 2GXUA 3BH0A 3HWSA 4HAXA 5G3YA 2CL6X 1S4QA 3LO5A 1XPOA 1JJVA 4Q7KA 2HXYA 2KWIA 5CK4A 5D3MB 1KI3A 1X8JA 1U99A 1ZU4A 2H18A 1CF4A 1OHHA 4H1UA 4ACAA 2XZOA 3NH9A 1XTIA 3SQWA 2X8AA 1GP2A 1FPMA 2ZSBA 4BFVA 4ZI3A 2R62A 1OIVA 2WJJA 4OQMA 2F1IA 2PT5A 2CCJA 2ZI7A 4N3NA 4AWXA 2G88A 4JKIA 3L0PA 3V4RA 2YOGA 4Q9HA 1N5JA 4DLZA 3U7EB 2YWHA 4ERNA 2WWYA 2R9VA 3B6EA 1BIFA 1BKDR 1VHLA 2GKSA 5K8IA 2FG5A 2D3WA 2V9PA 2ZRMA 3AVOA 3VMFA 1E2MA 1IBRA 3QXHA 1U81A 3TQCA 4IFEA 1FW6A 5GJBA 1VCIA 1Z6TA 3T15A 3CUEF 3BOSA 1G64A 1IQPA 5FI0B 3S1AB 4JVMA 2WMOB 2VA8A 4RCZA 1HUQA 3DM9B 3SZRA 3K0AA 3EWSA 2XJ9A 4CZ2A 2ZE5A 5FOXA 2ODEA 2EFEB 2ZS7A 3GFOA 3PEUA 4BLPA 1T0HB 3O8DA 5J4HA 1CULC 2WJIA 2H92A 4BECA 4PZLA 4UXJA 1NSFA 1Z6AA 1Z6XA 5EE5B 5A4JA 3HU2A 5B58C 1LTQA 3WYAA 1GSIA 3B13B 3PCRB 4GT1A 1NY5A 3B8HA 5J5CA 3BB1A 3OF5A 5J4VA 3QXJA 2ZRPA 3A1TA 1G3RA 4PC2A 4D0LB 3O47A 2XSZD 4TL6A 3NDPA 2VHJA 2GAOA 2ZUDA 3AM1A 3ICEA 2MSCB 3IEUA 5LD2C 5BYKA 4TZ0A 2DYKA 3FMPB 3SYLA 4B33A 4CEHB 1X1SA 5JWHA 1W0KD 2WJYA 3QPWA 2ZRCA 1W5TA 4TQ9A 4PR0A 1SVMA 3CH4B 3LAWA 1WF3A 2I4IA 4M4SA 5AJYA 4PPQA 3TUZC 2E87A 4X8LA 1P9RA 3I61A 3ZJYA 2FV8A 4PPNA 1D9XA 3SHWA 2C78A 3SYKA 3NDBB 1Y63A 3DKVA 5AUPB 3L0OA 1IN7A 2VP0A 3AP1A 4YXWA 4YMVA 1KOFA 4ZCLA 3BB3A 5DISB 1XNJA 1YR8A 1DADA 1K5GA 3ASZA 3K8YA 2ZS8A 1E0AA 4BPBA 3CB4A 1G291 1G3UA 1SXJA 1G6HA 3LBIA 4LV6A 4DSTA 3FGNA 1QHHB 1CRQA 1P9NA 3GJ4A 2DHRA 2I1QA 2YWEA 3GJ6A 2QN6A 4YC7A 4DUGA 4TMWA 2NPIA 4JJZA 4TLBA 1UEIA 4NH0A 3HYRA 2LCFA 3C16C 5HZKA 3PQCA 2RMKA 2QSYA 4C0JA 1ZM2A 1VIAA 1E0SA 4KODA 1A2BA 2OAP1 4PHFA 4D4KA 1LB1B 1SHZA 3THWA 2XGJA 1XPUA 1SVOA 4C0SA 1JR3E 5K8UA 1KK1A 4MKFA 2VBCA 4ZKDA 3CPJB 3UANA 5JSZA 2BKUA 1IAQA 4D0NA 4KU4A 5F98A 2NO7A 2VF7A 2ASEA 1QRAA 3IUYA 2D4HA 2G1JA 2QU8A 5CB6A 5J4KA 2J59A 5EE3A 1Z83A 2PZGA 4U00A 4B3DA 2I1VB 3EA5A 4TTPA 5TXGA 2PZFA 2VSXA 1VG8A 1WRBA 3W9YA 1DTSA 3KKQA 2QROA 4FWIB 4P4TA 5DYIA 1VMAA 1D9ZA 4AYXA 1MO4A 3NC0C 3OIYA 3PITA 1COWD 1FX0A 1WMSA 4AYTA 2OT3B 3ZD6A 4UXIA 1CR0A 1FTSA 1KI8A 1ZINA 1ZRHA 4JYCA 1EX6A 4A8JC 1U2RA 3MWKA 3V00A 3DEFA 3PEVA 1Q1QA 5EXPA 1HEIA 1R5NA 2BDTA 4UJ5A 1NRJB 2W2XA 1R5OA 4HLCA 5KOYA 5HCIA 4KSBA 4D4JA 5FUXA 3QBVA 1OF1A 3Q7QA 4NTZA 3ZVNA 1N0WA 2GXQA 3RC8A 4B35A 1JXOA 1RJ9A 2ORWA 1BS1A 2X2FA 4KSCA 1W4AA 5FH9A 5FOWA 1JPJA 2D2EA 4NONA 3AVUA 3IQXA 1TEXA 2FPKA
chains in the Genus database with same CATH superfamily
3UH0A 1SZDA 3AF4A 1X7XA 1THZA 1XF9A 3TEFA 2OECA 3NM4A 4LY6A 4PEVA 4E46A 5AVTA 3ZDAA 1GRVA 3WK9A 2Y93A 1K6EA 4L72A 1G18A 2QL6A 3AB8A 3CRQA 4HQ6A 4WW0A 5JJCA 5L51A 2DERA 5ESXA 4Q9AA 1RIFA 1CK4A 2ZT8A 4FHFA 3P19A 5DSZA 1KOLA 3SGLA 3U3RA 4EKIA 5A5DA 5KPJA 3N6XA 4WBXC 2O3RA 4XH9B 3PXUA 5E95A 4XVCA 1FYEA 1P2SA 4QJIA 3BTSA 2ISCA 2KS6A 2ZT7A 1VMKA 1XJ0A 3GA7A 2WYUA 3PDIA 5DNYB 1A96A 4JBGA 4ALNA 4AJOA 1ZIDA 2YY5A 3ZWOA 4U2BA 1UAAA 4FFNA 5K3SA 1C3VA 4RGQA 4FJ1A 1UKZA 2XYRA 2CMHA 5B4VA 1PW7A 2AN4A 2XDYA 2A5YB 2BGLA 2O2JA 2P3SA 2PSSA 3AINA 4EG5A 1IWBB 4R3WA 1WHSA 1EYZA 2QVXX 4NK4A 4Q7MB 4PHTA 1I7QB 1E1QA 5KREA 3Q7TA 4P5EA 3DGFC 2FVYA 3BXPA 1GPAA 1L9XA 2D2VA 1ZHHA 3N74A 5GGYA 2GPJA 1M54A 4QAJA 4AD8A 5KOJA 2ZM6B 1RQPA 3ETHA 3BJMA 3UGTA 4R51A 3GEDA 3MJCA 4P80A 4NWIA 4DIEA 1KARA 1H6CA 1HTWA 1IHPA 3QY9A 1CERA 2DQSA 3RBZA 4OBWA 3T4UA 3HVHA 2FHSA 3KSDO 1D2EA 3MYRA 2FLWA 3K1AA 1QONA 3MMSA 4G1VA 1BKYA 1Z7BA 4PLZA 2YJZA 5HK8A 4ZYWA 1JHYA 1F3LA 2R97A 2XB4A 3MHPA 3A2LA 3VXKA 2OG2A 3IR5A 3BE5A 4G0WA 1QHFA 3OT1B 4Y18A 5E0OA 3LC2O 3A4VA 3RUEA 4QOFA 4Q05A 2CGEA 3KQWA 4RD3A 2O9JA 1KF0A 3LV8A 5F2OA 4M54A 3CG0A 3MT8A 3NYQA 4AXXA 1QGDA 2G9RA 3QITA 1L7BA 1K75A 1Q1GA 3OU2A 4KV7A 2G9UA 1GA4A 1RCUA 1SAYA 3Q10A 2JF0A 2OUIA 2G1AA 1MJGM 3DC7A 5KKCA 3BHNA 1CZRA 3FN4A 3G49A 1PR2A 3L6BA 1H69A 2Z83A 4XX0A 1ZP6A 1JP7A 1Y4UA 2RG1A 4RQUA 2IYOA 2A3NA 3IJEB 4U5QA 5FJIA 1RJFA 1DZIA 1X7DA 3BERA 5IAOA 1JIQA 2AFVA 3DAPA 1XQ1A 3PQEA 4MYDA 2K2WA 4PZ9A 5LMZA 4ENTA 3ZKWB 2IU4A 3S2EA 3COJA 2WPDA 3NV7A 2KJQA 2AZMA 3HACA 2C03A 1Y3BE 2WJ6A 2FF7A 4FYKA 3L7CA 4XWAA 4AJ2A 2VATA 4JBXA 1EFAA 3T0IA 1L8LA 2C59A 1QLHA 1ZGAA 1L1RA 4LUCA 4BGUA 2AQIA 3DBLA 4TMKA 1D5CA 2FUCA 2BM1A 2G0TA 1UR5A 2GEVA 4I5IA 4UQOA 3CLKA 2WWFA 1JI3A 3B1XA 2WIAA 3ROPA 6CHYA 1L5WA 4BIIA 4Z8XA 5TS2A 3FDXA 5TDHA 1MC5A 1DG1G 1L4KA 2APJA 2BBSA 2I4NA 2EX4A 3IP9A 4FYHA 2ZJBA 4RVHA 4JP8A 3OPMA 4RKQA 1OI3A 3TLGB 3ZIDA 4DA9A 2DR0A 3NH6A 5CGZA 1HDOA 5KOHA 5IKPA 4PLGA 2JCSA 2F62A 3CTPA 1SHUX 1SG9A 3LYHA 3OQ1A 3PQ2A 4KE8A 3V9PA 1DO2A 2AW3A 2IEZA 3Q85A 3BC1A 1EGAA 3LLCA 4IOJA 3KELA 4KQIA 4RVUA 2ATCA 1GG9A 4B83A 3NGLA 4UVHA 3D2LA 3CLRD 1MX9A 1VSQA 4CTJA 2DE0X 2C82A 2UDPA 1O6ZA 3W4KA 1H94A 2PMCA 4KQ9A 5CT9A 1NDQA 1M6NA 2UYHA 2I67A 1Z73A 3SP1A 1O94A 1PDOA 2EZ4A 3JYHA 3OC0A 4H7FA 4TYPA 5I9NA 2WT4A 3H2JA 1PL7A 1I7PA 1W0CA 1A2KC 2AG8A 2BL4A 2P2CA 2G1KA 1V3UA 3B2QA 4L73A 4IVRA 5AP9A 2Y0DA 1M0WA 5JISA 2NYRA 4COKA 1DAIA 2D54A 3MTGA 1ELOA 4C4SA 1FDUA 1QC5B 5BV0A 4CUJA 3H4IA 4PLWA 1WUTA 4DYHA 5K0SA 5I51A 3K0FB 1G6OA 2C8LA 1EWVA 2P6NA 5FWNA 4QOIA 4QQRA 2PH7A 3P52A 5H70A 1B76A 2GBFA 4FSDA 3DUFB 1LI5A 2H7XA 3GJRA 4FD2A 2QE7D 4RZ2A 3W05A 4HS9A 5TY0A 3ZYCA 1IBMB 3RFXA 2X2EA 3PT5A 2ECKA 4MW1A 1Z07A 3KQLA 2AVDA 2QS9A 2QRPA 3LQFA 4JGIA 2CYAA 1TF5A 2Q5EA 3EFHA 3KJNA 4G09A 4HDCA 4I1RA 1TKCA 4EH1A 1KSHA 1LNSA 1BHJA 4ER7A 3P4XA 1DAHA 2GPNA 3ROGA 3UGKA 1DOHA 1DWUA 1RHUA 5LYJA 4AU1A 4DJEC 4IJUA 5LU9A 1POXA 1Z39A 2PQ2A 4R54A 1RHQA 1E79A 3WP0A 2C88A 3EPKA 4NP6A 4QGSA 2GF2A 4GOLD 2WQZA 3QEJA 5E4JA 3BIFA 2GRAA 1Z34A 2N47A 2PVCA 4ZRNA 3CZAA 1MF7A 4A8JB 1HEUA 4P38A 5FLXA 2WYIA 4UHJA 5MGNA 2GBPA 2LKCA 1DHTA 3DE0X 1JPUA 4DSNA 3C7DB 3PE4A 4GOKA 3HVUA 4BOYA 2JARA 2FN4A 4H7DA 4PYMA 3UK2A 4O2AA 4B3IA 1Z5VA 5BWLA 4KIUA 1LUAA 2C3OA 4GS5A 2JGMA 2VRCD 4QL3A 1Z16A 4MUEA 3WOVA 3DMRA 1V47A 3WG9A 2VO1A 4X24A 3MTAA 3AC0A 5C8XA 3Q8LA 4S24A 3BL8A 2YJ6A 1NBMA 5A62A 1JIVA 3H75A 2A1UB 3LDUA 4QSHA 4EGQA 5ARDA 3T52A 1T1EA 4CQLB 5JYDA 1EVJA 1W49A 2G3YA 4XIIA 1YCHA 1XA0A 2DWPA 2L42A 3O94A 4FDAA 4L5JA 5IVPA 3B2NA 2VJOA 1YIOA 2INGX 1G5HA 2D7DA 1ZM3A 3LECA 4BFCA 1EESA 4F45A 3V8MA 4KR2A 1EDEA 1VPEA 4XR4A 3DZKA 4EGAA 5IK2D 4P0QB 3AKDA 1BEZA 2OXRA 1Z0AA 4UNNA 3Q98A 4K6MA 5CDFE 5KYUA 5JSHA 1JHOA 3HXTA 4FPXA 4H27A 2Q7OE 3R76A 4X20B 3GLHE 1J39A 3GUZA 3BULA 4RKEA 3S2YA 3AUFA 5HUHA 3AHIA 4UVEA 3ZNNA 4ARSA 4BMZA 3ZBQA 4M22A 4QASA 2AQHA 3OJXA 1VBMA 3KT0A 5ITZA 2HNBA 4G36A 4EB8A 1YCGA 1P2DA 3BK1A 1C9YA 1GPDG 2OCDA 1KC3A 1XTUA 2VF4X 4LHWA 2JLSA 4LVOA 3WHKA 4FYIA 3GT3A 4BGDA 1A9ZA 3C3KA 2XNJA 3MNFA 3PFBA 4LJ4A 4UUBA 4XEHA 3RG8A 1JTVA 2AC7A 1CUCA 4C0XA 4FINA 1U5AA 3VTFA 4YRAA 1Q11A 3NONA 4Z4IA 3C1UA 3LUDA 4OQZA 1YRLA 2FZEA 5B4UA 2J3JA 4KIFA 1JEYA 3WK4A 5G4KA 1JHQA 1KKMA 3FJOA 4HB3A 5AT1A 4LI0A 3WSWA 4XUCA 1K5DA 4Z0PA 2WU3A 1P1FA 1THTA 3MTEA 2IPXA 2IEGA 1KI9A 1T3SA 3HDTA 5TPZA 4M9QA 3EPPA 4ZZ1A 5K8LA 3WZLA 4II7A 2EW2A 3P2EA 1N2CB 3ZLJA 3C8HA 2Q2WA 4LOLA 3ZU6A 2O8BA 1TPYA 1DS6A 4Y0AA 3DBOB 4OA8A 3W3AA 1RXVA 3CJQA 3UYLA 3C41J 1HFEL 2PH3A 2BAGA 2Q9UA 3MTIA 3HBJA 4KOAA 4MCAA 1U2ZA 3TLXA 5K3DA 5DXAA 2FPPB 4POOA 4QOJA 4HDRB 4UDYX 2A58A 1LLDA 2ZGVA 1TTTA 3H5RA 3UO8B 4KZPA 3FPEA 1PNTA 2JFYA 2AR0A 2E9SA 2WABA 4G4SO 5BQPA 2CUNA 1X0VA 4CKWA 4TL8A 1B42A 4ROTA 3HKCB 1BFKA 4QGHA 1I2AA 3MRSA 1FMFA 2YJTD 5L3RA 3TOCA 4KNWA 2HDNB 4MVJF 4TTSA 3UXMA 2RGBA 1CYDA 2QD2A 3CNBA 1V5IA 1QFYA 1I1OA 3Q6MA 4V3BA 3SQNA 4ZIRB 5MHTA 2WYOA 1WMBA 3BDAA 4XVUA 3IDSA 1XXHE 4I1VA 3TSWA 2E89A 5FUVA 1XVIA 4E13A 5B55A 4X1IA 1ULUA 5DGXA 2F00A 5E4YA 2BGNA 4JHLA 3G85A 4G8CA 4CETA 2GD0A 1SUFA 2JLXA 3EH1A 1U5BA 2F9FA 4MHSA 5HYVA 2H2GA 1R9JA 5CJ2A 3A3OA 2OC4A 4KTTE 3TXAA 4CNQA 1N2HA 2A92A 3EPRA 1WLYA 3LFTA 3TLYA 3RU9A 3GBVA 3HBMA 1OGJA 3S2UA 3IMFA 1EZZA 3ZU4A 3ZVMA 4BECA 3IVGA 2I2BA 1Y89A 1AZWA 1T13A 3EZXA 4R9UC 4GRAA 4DRXB 3Q7SA 4OXKA 4P4SA 4QRIA 5FFFA 4G5YA 2EIHA 3FCUB 4J1TC 2HSJA 1KPGA 1Y7LA 4FEGA 4PIPA 1UXKA 1I33A 2PZJA 3O4IA 4FQ8A 4YGXB 5FI1B 4YWJA 2FWJA 3C6QA 3AJAA 4J0KA 4KDEA 1CR6A 2DGDA 4JEIA 5CLIA 4R6XA 5DPMA 3GLSA 3UC5A 3UKDA 1U8CB 2RB5A 4RX1A 3QWAA 2GZ1A 4ZI5A 3WGYA 4OKIA 5IVKA 1M66A 5DLEA 1QDEA 4XSHA 1P39A 1R4MA 2N9UA 4NPAA 2PKQP 2UVQA 3GEEA 3PD0A 3L7LA 1B0UA 2V7VA 1UWVA 3Q7PA 1OXTA 2VJPA 1CQPA 1TUEA 2RGAA 4OXQA 5EMHA 3HO1A 1IHYA 1V1JA 4YCNA 2EP7A 3CISA 1BCRB 2AOTA 3QFSA 1TE2A 1ZD4A 1D2NA 4XCVA 1MU0A 1BE6A 1Y3DE 1RZRA 4UCWA 2GCIA 1KZ1A 5JEDA 2XBMA 5CVVA 1W25A 4UD6A 3ZDYB 5IJAA 3BZWA 1TOAA 5JANA 2FSVC 4KWEA 2QTWB 1IRXA 2HF8A 4WXMA 1HDCA 4GMGA 2IK8A 5EMJA 3SJUA 1DWQA 2PUJA 5I9SA 1QFMA 4CIAA 2ZU6A 4U1RA 3F47A 2FCAA 4Z2AA 2AF4C 2C2WA 2HM7A 1VRCA 4H16A 5TQ0A 3IVRA 1Y9ZA 2YHIB 1AJEA 1CIJA 4IJMA 3QXCA 1ZW1A 4DA0A 1B73A 1JDPA 2QNBA 5DEIA 4KR6A 4XWWA 1J8MF 1IE3A 1W5BA 3BREA 4GLBA 2V54A 5LP6C 3QHQA 2B3TA 4YO7A 4Z2YA 3DMPA 5IJ0B 1PZNA 5DP2A 3QPVA 5K6AA 4IZ6A 4KQWA 5DW3A 4GP7A 1IDOA 4FWTA 1D6NA 3PK0A 4NNJA 1EVIA 4UDNA 1G5PA 3S1LA 1EK0A 4Q0MA 1YJ5A 4ZU6X 5FHRA 4CM4A 5FPPA 1ESZA 5LOVF 1XNHA 4LJ5A 3TTTA 2GD1O 4DSAA 5DNCA 4IW3B 1AH2A 1XDDA 2XYVA 3PJEA 3VDXA 4QKQA 2ON6A 2C2OA 3O8NA 4HBZA 3W3AH 1V96A 4WSOA 2H3EA 3MAAC 4IDBA 2J5QA 2OM6A 5TNXA 3VHRA 4HMOA 1AK9A 4K2HA 4W82A 3ZZ1A 2AKYA 1BOOA 4MCJA 1NNEA 2CLFB 1ISGA 2Z8ZA 3HUEA 4KKVA 1CRLA 1HV8A 2JLVA 1GQ2A 1DPGA 1L1QA 2YHSA 3FPJA 2D1YA 1NRXA 3MW8A 3TRIA 4RV5A 1YTLA 2AR9A 2BRUC 2MHCA 3NJRA 4KNVA 3RIXA 3THOA 1SU6A 4TTAA 1D4OA 2XGGA 5AD1A 1OVMA 3HKDB 1C3LA 3EH2A 3OE5A 1W5FA 4HL6A 4LMPA 1CJMA 2AYYA 2QG4A 1ZZEA 4EFNA 3EC1A 3BBPA 1SBQA 3IJ5A 5FNVB 4BFSA 1J90A 2NVUB 3HU1A 2ZVQX 3VYUB 5JPIA 3V8NA 4YCCA 1YBFA 5THKA 4I9GA 3UJ8A 4QG3A 5T7BA 3WFIA 4D8YA 1IBLB 3VDQA 1IXKA 1BYUA 2ZSEA 5FL7D 4FMDB 4JJGA 4RD6A 5DNUA 1PT7A 3BTVA 5BUZA 1UZNA 4EX6A 4TLEA 2FZWA 3CNNA 1Q14A 1O58A 3NHKA 1JRLA 3A4LA 2I3AA 2OWDA 3NHUA 2I6XA 5JSUA 1ZD9A 5TE9A 2PV0A 1AQIA 3PSHA 1XPJA 2QX6A 1LPOA 2YW9A 4H1VA 4G0ZA 5EJ6A 3H1PA 1F6WA 3GRAA 1YQWA 3KP1A 4OI1A 3FZGA 2YMPA 4FFMA 1KEZA 1UH5A 1K7XB 1NLMA 2QYTA 4R7ZA 3UMMA 1LJUA 3NBQA 4LDPA 4ZEOA 3JQRA 5CCXA 3AOEC 1LCIA 4LIPD 2J1LA 3K53A 2FZ4A 1LPNA 4CFZA 5JJKA 2Q2NA 4J0HA 4W4TA 2MSWA 3ZLBA 2I22A 5C1OA 5HM8A 2V1UA 3T5PA 3E5HA 4MQLA 4R1TA 1H3FA 3AF5A 4C3VA 3NBXX 4GZMA 4CN9A 5C46F 3ZVKA 1EZ1A 1DCFA 1E7SA 4A0FA 3C5EA 3VR6D 3BM5A 3BYZA 4K9KA 2R68A 3A9UA 1XOIA 4LYHA 3A11A 4V0ME 3ZHXA 4NCBA 3WL6A 2YN2A 3K8OE 3V7FA 5FR2A 4AMYA 3RFFA 4E4RA 1UDRA 5CK5A 1S2MA 2XA1A 2GHIA 1HQDA 3WLFA 2YIMA 1DEHA 2IPNA 2GK6A 1GU0A 5FTKA 3ZGNA 4RZQA 4D02A 2XTAA 4CMEA 1Z6PA 4MIYA 1KP3A 3CKMA 5E7JA 1QMGA 1N9ZA 2P7IA 2WI8A 4M1WA 1H2YA 1CVLA 2V3WA 3ZU3A 5E3JA 5KUTA 2P2NA 3WGIA 1J0EA 1E1CB 4PZYA 5DYGA 2Q99A 5JAOA 3KK0A 3KWMA 3QF7A 3QF4B 1W87A 2ZUBA 3LQKA 3MAJA 3ND8A 1RWVA 5E6SB 3VPBA 2Z4SA 2QR5A 4DV3B 1GVHA 3N28A 1O0SA 2ZZMA 2FFHA 4IZOA 1F0YA 2WD7A 1X1TA 5GGXA 1TQDA 3AF6A 1QP4A 2C57A 4W9NA 2QJFA 1J22A 1YOVB 2VHZA 3OZUA 3PXBA 3QEKA 2DG2A 4HDSA 3G8AA 4I2NA 2OP0A 2RHTA 1QQBA 3AR6A 2GK4A 1FFCA 3WDSA 2AJCA 1OKKD 3EGDA 3ZHBA 5F12A 5BMVA 1WTCA 2H1VA 3INYA 3ZXYA 2VDMB 1E2PA 5KCMA 1HE1C 1MDBA 4ZGGA 1Y4AE 2YTZA 1YGPA 3IQGX 2W2LA 4JUDX 4R3NA 3VMMA 3H3XA 1UANA 4E7PA 4EQ6B 4W99A 1GGEA 3CT6A 3NRJA 2X86A 5PNTA 3B7GA 1GL9B 4IIVA 4UXHA 4EKDA 2H1LA 1RI4A 2Q2QA 1O6FA 2RHBA 3KUXA 1VRWA 4P7FA 5IAGA 1PAUA 1YKFA 1BX0A 1US8A 2ADOA 4WZBE 4MP3A 4ZQBA 1VDZA 5AW3A 5F9HA 1FQKA 3EIXA 3PD1A 1Z0DA 1P9WA 1X13A 1RQNA 3DE4X 2HZ7A 2PPLA 2PJZA 2VR1A 4MIKA 5ALGA 1CB0A 1XEXB 3B82A 5JDCC 1LLCA 3NT4A 4GWKA 1HG0A 4MMZB 1JDSA 5KJ6A 1H4QA 4JLMA 4QZVA 1QCCA 5SICE 3CZ5A 1V8OA 3NOOA 3GGDA 3EVBA 4FNGA 4UMEA 4OLAA 2VP4A 4LWPA 1P9OA 4QUJA 2IQ5A 3EG5A 3DMYA 4IIJF 4I1IA 3NVDA 4ENRA 1TC1A 2ZRIA 5FLKA 3N07A 3OUTA 2VEOA 1VJTA 2QMUA 5D84A 2JAPA 1K7FB 2LP4Y 3E03A 4JL5A 3ZCTA 3W79A 1MO2A 2MR5A 2O1XA 1MQ8B 4IZIA 2O8NA 3P9SA 4L57A 4BZWA 2I29A 2FX3A 3EMKA 4ETNA 4Y2PA 5E7MA 4BKQA 1KVUA 5K03A 2WTUA 1MAWA 4KB5A 3WNCA 2CLDX 3C6XA 1E6WA 4HF7A 3OJFA 4W5QA 4NBNA 2BV3A 4QUEA 4ARAA 1ZM9A 3H0KA 4AFNA 1QG0A 4YRGA 1EEHA 3JQDA 2HXSA 3SFZA 2X40A 1Z08A 1T2VA 1MEOA 1XJQA 1HT2E 1KKLA 4ND8B 1E0KA 3TB4A 3U26A 4CLRB 4F1KA 5BNTA 2GUWA 2DP4E 2JI6A 4HO1X 4OIMA 3RCBA 3SS7X 1MB9A 4R83A 4J4BA 2V4ZA 4OYLA 4BN5A 5JS2A 2XGSA 1KMHA 3JQFA 2MINA 4YREA 2IU0A 4TWZA 1W2GA 5T4HA 1ILEA 4E12A 2JIPA 1L8QA 2GM5A 3HS3A 3KLBA 1OAKA 3TZBA 2M32A 5FOTA 3COZA 3RIHA 5E1OA 5H02A 4LISA 2D5AA 3E18A 5B3AA 1AUOA 2TYSB 4L50A 2FP4B 2XB9A 4NAUA 5ILQA 5KVQA 4S0ZA 4UU7A 5TR9A 1SHTX 5CEFA 3OIDA 3C85A 1Y5IA 3T94A 4YRTA 3EDRA 2ACWA 1Q6YA 1RRKA 1C8KA 1UMCB 3MCZA 4KEAA 4KYUA 3VX3A 3ESYA 5LP6B 4RELA 2DHQA 3BFPA 4G0NA 4PQFA 8LDHA 2GVZC 1SC1A 2QSZA 4X91A 3HCNA 4QHSA 4JYZA 3I8SA 3DD1A 1YBHA 4ASUA 3OLZA 4BFXA 3JWPA 4OEHA 3VM6A 3JSAA 1UM9B 3SS9X 4BGEA 5HQTA 2A0WA 1EP1B 4BX8A 1MH1A 2EKZA 1VYTA 4JP3A 2QN1A 4EF6A 3OPYI 1ODCA 4GP9A 2PT7A 4Q1BA 3VKWA 4DN6A 3H2ZA 1RXCA 3O90A 2CDCA 3RYIB 3LT1A 3MF4A 1SK9A 7ABPA 3FSGD 1WB9A 1JKIA 3QELA 4BRWA 4XM2A 1H5NA 5TQ2A 4Q18A 4MV9A 4O02B 3TNFA 2H85A 3E22A 4IXTA 4OIFA 1FLVA 1GJRA 5I7FA 3GWZA 5U1PA 4GKKB 1FUKA 2HA6A 2ATXA 1OOEA 4ZDIA 3I8XA 1E0JA 2AL7A 3PPVA 4KR3A 4JVLA 4A0HA 1NATA 2XOEA 2O23A 2JAUA 4F5YA 1G63A 1IATA 1TCAA 16PKA 3NEJA 3TGWA 4AKEA 4X7BA 3PA6A 4KBGA 1YRYE 1CHNA 2WW8A 2KB0A 4G3XA 1QIKA 4M0LA 4YVFA 1E5TA 4TROA 3IPXA 3BH7A 5CXSA 5CXXA 3A8TA 5LA6B 4BCDA 4G86A 1TK9A 2OV2A 3ZCXA 2VZEA 4D8UA 2Z1DA 4AJEA 5HP4A 2YJ3A 2F6RA 2G9ZA 1OLUB 2B35A 4PC6A 4OFXA 3ULKA 3HA2A 1TM5E 4JVNA 2W6IA 3RU3A 3S2GA 3I4FA 2SCUB 1S9HA 5EIBC 5KTSA 1I24A 3K71B 1ZM4A 1BH6A 2DCUA 3GRUA 4GZ6A 2EC5A 3RRZA 1P0QA 3MTQA 1AB6A 1T43A 1T1SA 4RXUA 3SEZA 2A5LA 2VTDA 3DTNA 4CMIA 3D0KA 1AC5A 2RI1A 4HAVA 4P31A 2XUAA 1QO9A 3MGCA 5KTYA 2MR6A 3BWBA 4NMXB 4LF6B 4CMKA 5F4BA 4ZAZA 1VKNA 3N5KA 3MGAA 1MA3A 4J1NA 1RYFA 1UMDA 1W9MA 5ES3A 2DT8A 3CRVA 3NR2A 4MPTA 4UTOA 3ZGYA 1QYDA 2JJMA 3KQPA 1KAGA 3KZNA 3SM3A 5CJPA 4DA6A 4JXKA 3GJSA 5FI3A 1Z0ZA 1MCZA 1Q57A 3B1YA 3ZHCA 1JEYB 2BONA 4L7QA 4OQNA 3TQHA 1GSAA 1V9SA 4M1KA 1UAYA 1E63A 1TX4B 1GGJA 1S2NA 4LA4A 1DAEA 4TN1A 5BN1A 4RA6B 4U39A 3TZQA 3GJ0A 4UHBA 5B6PA 4GF5A 2ILVA 4PN7A 2ZYWX 3Q8MA 1Q83A 1X7GA 4Q1CA 4GR5A 4ATNA 1CHDA 1I0ZA 2Z5LA 1VJ5A 2BMWA 3FNEA 2J9FA 3L05A 3GXOA 1ZBQA 2JFOA 2MYTA 3U3OA 5LD2B 4YT8A 2AEFA 3E7WA 4BMPB 1A4IA 2ZYHA 2ZJYA 3AR4A 4LWZA 4ZWNA 1GKIA 2OGUA 4BU0A 1KPHA 1V9CA 3NORA 4IJ6A 4I6EA 4Q6BA 4ZOQI 2B98A 4RQAA 1NI3A 2G77B 1U2PA 1JT9A 4MR7B 3U40A 2M6KA 4BVGA 1OPXA 2WSSA 1JKFA 1YK0A 3GDFA 1W6RA 2COUA 2IDKA 2M6RA 3E6AA 3ZXIA 2B20A 2WF5A 4XJSA 2ACEA 1SXJC 2NQ2C 3CE6A 3PP8A 4HADA 1JAXA 4LV8B 4YP0A 2B8EA 3C3XA 5BY2A 1PTJA 4G85A 1GGMA 3HCBA 2PL1A 3AESA 3JQCA 4GD3Q 4PVDA 4WZ6A 5CA0A 1VB5A 5TQVA 4DDMA 4EFMA 1AMNA 5ANRB 2OHFA 2VOJA 3FLMA 2P4HX 2Y1DA 4OPMA 5AKZA 1QH8A 5F1KA 1YBVA 4AP9A 4BX0A 2E18A 3D64A 5IEJA 2V74B 2OE2A 3NYRA 3GHYA 4F7WA 3E81A 3I9JA 3V2GA 1RYNA 1PHRA 1YQ9A 1V4BA 3VGJA 4ABTA 2X5KO 3OE7D 2PEZA 1FK8A 1UT8A 5K0JA 4ZN6A 3AUJB 3B6MA 1C0LA 5K5EA 1T9CA 1EFVA 2ZAMA 3M6AA 2W70A 1PWYE 3OQJA 2K6GA 4HGQA 4XJVA 4P7BA 3RSFA 3N7UA 2X6RA 3NTRA 5EI5A 1Q0QA 2WSYB 3A6DA 3H9CA 2BI7A 1NYRA 1R12A 1ULTA 3PGVA 4H35A 4JJAA 2BP7A 1TLTA 2KBFA 1TU3A 3RAPR 4ZAWA 5JXJA 1ZVKA 4FOTA 3USES 2FPIB 2GCPA 3KSMA 1ZAYA 4PAGA 4IO0A 2IHVA 1XCBA 3SVZA 3SBDA 1GLNA 4JP1A 3RLFA 3NAQA 1J2YA 5IXYA 5JOQA 3S40A 3JQBC 3KQTA 2Q3BA 2QN3A 4CM8B 2CDBA 1K68A 2I1WA 1U8ZA 3TKLA 3QPAA 2V5VA 1H2AS 1QM5A 4P33A 3AYXB 4CF7A 3KLMX 3Q9LA 4LXIA 3PJRA 1YWGO 2NU8A 1VQ1A 3D4LA 4EUFA 2D8AA 4MWGA 2JJ8A 2IXDA 1KFEB 1DAPA 1G5TA 2AMVA 2QZJA 1JU9A 3HMQA 3P94A 4UATA 1E6KA 1Z0UA 2C98A 1YULA 1G21A 1GZ3A 1E66A 1N0VC 1ST3A 2F8LA 2ATVA 2ZIUB 3LBYA 5CB8A 1G8PA 4R1PA 5LNK6 1LY1A 1PSWA 2BEJA 3I37X 5A4IS 3FBWA 3LXUX 5TGDA 3ZZTA 1L5HB 2RG7A 3ABZA 4AW9A 4KWCA 1X8XA 2HN9A 1JZSA 1FPQA 4OUDA 4TLLB 5EWMA 3RRYA 4YRZA 5HRUA 3BD7A 2LIVA 4JQYA 3R75A 3P9NA 3WIEA 2AOXA 2WG2A 3EEQA 4NZYA 2C54A 3OU7A 1CDEA 3JQ9A 4BX9A 3FVRA 4JBHA 4PC7A 2DPXA 4RBNA 3TLJA 5M29A 3AVYA 1DIRA 5AUQA 3W2FA 1IPEA 4GM1A 1NVBA 4OKNA 4R40A 4EJ0A 2V7WA 2QRUA 2I4LA 5DMHA 3A26A 4MPDA 1NZFA 1OGIA 4QGFA 4KR9A 2L19A 4MVJD 5EHIA 5EJ8A 3UJBA 1U3GA 1WBBA 4OOEA 1U7PA 1D07A 3TG2A 2IE0A 2IEDA 1G7SA 1HRDA 5ICCA 5C7LO 1H9AA 2C2YA 1EE1A 2CXTA 1CY6A 1RKBA 4ICIA 3EVNA 2IPOA 2C04A 1LQTA 4C4AA 5HR5A 5H68A 1F2UB 1FUYB 1LBIA 3S2SA 3T38A 3IUJA 4OXXA 4C7OB 2KYRA 4CL8A 1D3AA 3JRXA 5LNK1 5JQGF 4M46A 4Q4HB 2M2IA 1GQFA 1HRKA 3A9VA 2Q0SA 1E5VA 2RFLA 2BISA 3DLPX 4DCOA 2WM9B 1NN1A 1EDZA 3L6DA 3VX4A 3JD0A 2IOYA 1JKMA 4BQIA 4TV9B 5GVSA 3TWOA 4DM7A 3BJIC 3QEMB 1WMFA 2GBLA 3N8KA 3B3AA 4PZPA 4ZO6A 4JA0A 4NG5A 5A4AA 4JMLA 1RLMA 3H6KA 1WLSA 2GDJA 2JIOA 4F96A 5JR3A 4P3NA 1U1IA 3OCCA 5DM4A 1PBTA 1ZCAA 1JXQA 1KFCB 3U4DA 1ZRMA 4KLCA 3PIDA 3EIWA 1TUGA 4JLAA 4JNCA 2R1UA 5AM3A 3DZBA 3LWNA 5GONF 1NG9A 4GOND 1KI6A 1EXNA 2E4UA 4W1SA 4FXPA 1DB3A 2EWWA 3K2EA 3U9TA 3TRDA 3ZE0B 4ZJPA 4DV5B 3O31A 1CS0B 2R751 3KTAA 4V0KA 3L4KA 1A7AA 3G88A 4US1R 2BR3A 3V4LA 5MN6A 3KVNA 4PTYA 3OE4A 1DDIA 1WNFA 1FJXA 1GL6A 2VT3A 3NRBA 1OFIA 1IK6A 4V0OA 4XFJA 5I5GA 1UQRA 4HTFA 2FG6C 3SX2A 5M04A 2WK1A 3RDPA 1DARA 1XZNA 2CZGA 4ND2A 2W2KB 1EIZA 3D9QX 1FW8A 5B7QA 2Y1OA 4LZPA 1QANA 4M8NE 1TK2A 1S2GA 2XMBA 3SSAA 5C5DA 5KMGA 1SQ5A 2JI8A 4G9EA 2W90A 2XIJA 3PRYA 2H31A 1UPFA 2CCGA 1NNLA 1KEEA 1WTAA 1Z5OA 3T06B 2A9RA 1XCGB 1DVRA 4DV2B 4J3JA 3RHFA 2IP1A 4QUHA 1E3IA 5I4IA 4DNOA 4TQAA 2IUEA 1CEYA 1RJEA 1EM8A 3QTBA 5HKOA 2B69A 3T3EA 5LN1A 1VMEA 3IB6A 3QKUA 3PWSA 3BHIA 2YIDA 2YXPX 2OHHA 3RB8A 3LRPA 3ADDA 4X62B 4ZCIA 2ODTX 2Q7XA 1Q50A 2QN7A 2CKDA 2HSWA 1I1HA 5F5XA 2O8EA 4RQTA 2V0GA 3PF9A 1RKXA 3AY6A 2GEDA 1VE5A 1RI2A 4RD0A 3ABIA 2D7CA 4CKYA 3WO0A 1FXSA 4E22A 3WMRA 2FMTA 5ABPA 4ZYVA 4PVCA 1QIGA 3AL2A 1TW2A 1X38A 2ISQA 2QMOA 2J3QA 3AGQA 5ECGC 1VIDA 3W5DA 4IHAA 1Z56C 3UUGA 1A77A 2I6TA 1E3JA 1YR7A 3OLQA 5FBZA 4RYLA 4BN0A 1BE8A 1X1AA 2WTEA 4XGKA 3W77A 4H9GA 3V4VB 4YUYA 5FOVA 3GGOA 1TKRA 5KWVA 4A8HA 2NU7A 1LEHA 3JWEA 3MPUA 5CPFA 5AW9A 2BH2A 1DC7A 2UXCB 2Q6IA 2XDQB 3DZHA 2FP3A 4D4LA 5FEMA 1ZIPA 3EZ2A 2HH9A 3KJZA 2PX3A 1EFCA 4PG5A 3CH6A 1OTYA 1N2CE 2FAXA 4AMGA 3ANSA 4Q47A 1N3IA 3Q12A 1TM3E 3E7XA 3A1CA 4RY8A 1SC9A 1J97A 2RJNA 3K4HA 1NXXA 2RGDA 4LZWA 1SXJB 2ZG6A 4TKMA 5D1HA 3RQSA 3ZX5A 1ZC3A 4HB4A 4WWHA 1ONPA 4LOJA 1MV8A 1MORA 5CX1B 1RZUA 5JW6A 2W6QA 4BE7B 4Q3KA 2BHNA 1SXGA 3QTLA 1V43A 4Q15A 1A9RA 1VGVA 1WDMA 4UTVA 4M21A 3O8OA 3PWZA 5DHUA 2C9DA 3JQQA 3AY3A 3UPTA 3LT0A 3I5XA 1A04A 3FYSA 2IOFK 2LDXA 4PO8A 5ALXA 2HV8A 3OPYB 5FTMA 1K4KA 4WLOA 4M0PA 4YHBA 1CD5A 1U2TA 1U31A 2WJAA 4FYMA 5GY7A 5CDFA 4B4OA 1VL6A 2ATEA 3L1IA 2W4IA 3OOYA 1IWPB 4MW5A 5AM4A 4N12A 3THWB 4LGVA 2J0QA 4XLTA 3K5WA 4YAFA 1Q0SA 4INAA 2QR3A 2XMCA 1DJNA 2PKWA 3QIVA 2D1TA 2OBBA 2POQX 2REXB 3MWGA 2QQ0A 5D00A 5GMOA 5TT1A 1W4RA 2FFBA 3W6ZA 2TMGA 5E2IA 4BLTA 1E99A 4MR8A 4GHWA 1IM5A 2O6LA 2HJSA 2VNIA 1K4MA 3UCFA 1N2ZA 3HEMA 5EPUA 3GWGA 2E48A 1ZONA 2D2IA 1MJHA 2J0UA 3I2KA 1TMKA 4GC5A 1YTUA 2HBYA 1UBCA 1GUDA 1WXXA 1G8HA 1XL0A 3M34A 1DE0A 3LUFA 2DPHA 3NAZA 1UFOA 1DEKA 5CD1A 4FN5A 3DLHA 3CKKA 4IDEA 2NUPA 2QNIA 4QVGA 4UQPA 5KTKA 5B1IA 1TM2A 1TUBA 2DWQA 2V58A 4BO9A 5LR6A 3HV0A 4X61A 1FCJA 5I8ZA 1R8YA 2C97A 3MWLA 5E6RB 3WE7A 3QV2A 7YASA 3A06A 2NO5A 3ADKA 4MW2A 3NDBB 5LQUA 1EFPA 2CVPA 1DKQA 1GGKA 2Q27A 1CIVA 1P7CA 3DV2A 2F8TA 1A4RA 2ODQA 3MILA 1P0PA 1NE7A 4KFTA 2LRHA 4RVDA 1J99A 3KHKA 3KVOA 3NBMA 4EQZA 3DTYA 4MUMA 2EERA 3RRXA 2R96A 3EZFA 3F1KA 2GT1A 4GAEA 1LBTA 5EC8A 4C6TB 4TPKA 3FSJX 3BCRA 5C8YA 1L4NA 1I4EB 4G41A 2J3DA 1N4DA 2AHRA 4F3NA 2PR2A 2B8WA 2XCUA 2XZTA 1EDBA 5JWRA 4EP1A 2EGGA 1NI4B 4IOLA 4OQPA 1YQXA 4Z9FA 2G36A 4BNZA 1VBNA 5KAMA 4YA6A 4Z7QB 1KJZA 4WL0A 3K70D 1XXHA 2BKAA 1HLDA 3RYTC 3ASUA 3DAGA 3RWMB 3OU6A 4NRDA 4DJAA 4MAFA 5ALPA 1QGED 3CF2A 4IDQA 3AUSA 4MQMA 4CV3A 2PR7A 3NEPX 4EA9A 3V2IA 3GAFA 3PXAA 1ZNYA 2OCLA 3KTOA 1PLKA 3VOSA 2GDZA 5KEIA 5L3SA 1ZH0A 2QV7A 4IVPA 4KVAA 3VSEA 2XTNA 1SHLA 3WYBA 3EGXB 3FYUA 1T9KA 2GZSA 5C18A 3ZDBA 3ZJVA 2QRZA 2GOYA 2FQXA 1RDFA 2XITA 1QV7A 3DP9A 4BFYA 2IEYA 5T4EA 1XMPA 4KSYA 2C2HA 3F6RA 2OQ2A 3BF7A 1THGA 4JOQA 3EVFA 4KYTA 3LXXA 2JLQA 1SBIA 1ZMBA 5I3ZA 4O4IA 1E9RA 1Y3AA 2VQ3A 3NO4A 2P6OA 4GVLA 2IVZA 2Q4EA 2IUTA 4MQ6A 2OO5A 3HJHA 1ISPA 1P3JA 4EI9A 4EI2A 2CUKA 4YT2A 4Z4CA 4PZDA 2W4QA 5GZ3A 1SKMA 4PN3A 3LCUA 3KB6A 4O4LB 4IX9A 3Q0IA 1IHXA 4QAQA 4RUKA 3R7LA 5JEEA