2Q3CA

2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
298
Chain Sequence
b'MSIAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVDRIGVAMLQAAEQAGLIKPDTIILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGADGMSGAIAKAEELAKTDQRYFVPQQFENPANPAIHRVTTAEEVWRDTDGKVDIVVAGVGTGGTITGVAQVIKERKPSARFVAVEPAASPVLSGGQKGPHPIQGIGAGFVPPVLDQDLVDEIITVGNDALNVARRLAREEGLLVGISSGAATVAALQVARRPENAGKLIVVVLPDFGERYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase A
publication title Structural Insights into Catalysis and Inhibition of O-Acetylserine Sulfhydrylase from Mycobacterium tuberculosis: CRYSTAL STRUCTURES OF THE ENZYME {alpha}-AMINOACRYLATE INTERMEDIATE AND AN ENZYME-INHIBITOR COMPLEX.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 111
structure length 298
sequence length 300
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q3cA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q3cA02
3DKIA 1C8VB 2ZPUA 1O58A 1BEUB 4I1YA 2RH9B 1K7EB 1TDJA 4HPXB 5I7WA 2TSYB 4D99A 1TYZA 5DW0A 2TYSB 4COOA 4D9CA 5B36A 1RQXA 2TRSB 3R0ZA 1KFEB 5IXJA 5DW3A 5CVCA 5B3AA 3VBEA 5I7HA 1KFBB 2DH5A 2ISQA 4NEGA 4ZU6X 1CX9B 5DVZA 1A50B 1PWHA 2JC3A 1P5JA 4Y6GB 1A5BB 4H27A 5D86A 4JBNA 5HBGA 5I7AA 2Q3CA 2V03A 1Z7YA 3R0XA 4D8TA 1KFCB 4D8UA 1J0EA 4D9KA 3SS9X 2WSYB 4XUGB 1Y7LA 2Q3DA 3PR2B 1TZJA 1UIMA 1VE1A 2C2BA 2BHTA 1M54A 4HO1X 4LMAA 2CLLB 3IAUA 1E5XA 5CGQB 2Q3BA 3SPXA 2ZR8A 4HN4B 3DWGA 1D6SA 4D9NA 4D9EA 1WBJB 3VSCA 5DBHX 5KZMB 1K7XB 3PC4A 1K7FB 1FCJA 4ZQCB 3IQIX 3ZEIA 4D8WA 4D97A 1KFKB 2GN1A 1J0BA 1WKVA 5C3UA 3TBHA 1TZMA 1K3UB 1K8ZB 1V7CA 4LMBA 4D9GA 2O2JA 1TTQB 3BM5A 5I6DA 1KL7A 5J43A 3IQHX 3HMKA 2D1FA 5IWCA 1QOPB 2CLOB 1CW2B 4PCUA 1UINA 1UBSB 2EFYA 4LI3X 5B1IA 4AECA 2CLFB 2CLMB 1TTPB 1V8ZA 2PQMA 3X44A 2ZSJA 3V7NA 5I7OA 1BKSB 3PC3A 5KINB 2CLHB 5I7RA 1J0CA 1VE5A 3DWIA 4JBLA 2ECOA 3FGPA 4ZU1X 1A5SB 4L3VA 3X43A 1VB3A 4HT3B 2BHSA 5EY5B 4D9FA 1J0AA 2CLKB 2DH6A 3PC2A 3FCAA 2GN0A 1C9DB 4D9MA 4OFXA 2RHGB 4D92A 5D84A 5B55A 3VSAA 2GN2A 1K8XB 1V71A 4IL5A 5BW6B 1KFJB 3IQGX 4D96A 3VSDA 1JBQA 4WX2B 1J0DA 5D85A 1X1QA 4QYSA 2CLEB 4HPJB 4NU8X 1TJPB 5E0KB 1Z7WA 4OREX 5B53A 5JISA 3T4PA 3VC3A 5B1HA 3RR2A 2EGUA 4F4FA 4KKXB 1WTCA 1QOQB 3L6RA 4L0DA 1WDWB 2C2GA 2J9XB 1C29B 5D87A 5T6MA 5JJCA 2J9YB 3L6BA 1A5AB 2J9ZB 4D9IA 1FUYB 2O2EA 3L6CA 4AIRA 2CLIB 1TZKA 1PWEA 4L28A 5IW8A 1F2DA 5J5VA 3AEXA 2RKBA 4D9BA 2ECQA 3CEPB 1K8YB 4L27A 3AEYA 1OASA 3SS7X 5DBEX 1TZ2A
chains in the Genus database with same CATH superfamily
3DKIA 3AVUA 1D6JA 1PNRA 2GZ1A 2AN9A 2LP4Y 4RM2A 1Y6RA 1KTVA 3D7NA 1CVIA 2GZRA 3ESCA 4OMDA 4TWAA 3VGPA 1PS9A 1SIWA 5K0JA 1CDDA 3FNHA 1V2HE 3FB4A 4Q34A 2FPOA 4G5YA 2TS1A 2VPQA 3ANNA 1UOEA 4FJ2A 1ZU4A 4MWOA 4Q9NA 1ZUNB 1J1UA 4XYEA 1IFXA 2QTCA 3QTTA 3T94A 4E7OA 3C3AA 3FHOA 3N3BC 1FLDA 3TPZA 4MMXB 3ZC3A 1CJBA 3KXLA 4KR9A 3HJFA 3V1NA 2FEMA 1IL0A 3ELWA 3CHYA 5D86A 3VNQA 4DT1B 1PRYA 5EP3A 3ST7A 4CRWB 1R0ZA 2D7DA 1RMTA 4JJIA 1Z2PX 1EFUA 1XTVA 4BEVA 3NAGA 1CHNA 3KVNA 4MA4A 4NK5A 1QG4A 4Q9IA 2VK8A 3MXTA 4I50B 4NU6A 4Q3KA 3UEOA 1Z74A 1A72A 3A3KA 4M98A 3CBGA 13PKA 3ZWBA 4EPXA 1KP9A 4E5KA 2WG2A 3KDAA 1BCRA 3L8EA 3PPYA 4ZT4A 3TZ6A 1SQSA 3RV3A 2JFZA 3U4CA 4E5YA 3B6JA 2H3HA 4MKRA 4V2UA 3ZDXB 1HRDA 3P9IA 3N2GA 1IG3A 1ODJA 3SJBA 5ICCA 1P2DA 3GT4A 4MH0R 5DHQA 2RJNA 3HUUA 4U7PB 4AMVA 1O5TA 5T8KA 5GGXA 2CHEA 4BFSA 2QRVB 3EH1A 5FAKA 2PUAA 4JZKA 1G2QA 2LKDA 2O20A 3P2YA 4TZKA 2FRDC 4HV4A 1K2VN 2Q4BA 2FHSA 3M82A 3FFAA 4G36A 1W94A 4QGGA 4FHEA 1GFZA 2VYVA 4HADA 3JQEA 1EUZA 1I10A 3E1SA 4TKZA 4EYSA 3VPCA 3FIJA 4R9UC 4NCAA 2ZSUA 3QMVA 1E1KA 4K3UA 1UDRA 4TSFA 1DEHA 4GX0A 2NSLA 4BQQA 4B4VA 2APJA 4U2GA 4W1RA 3LC2O 3NGXA 5IPFA 2WD8A 2RGBA 3DHEA 1XLVA 3V4SA 1CE8A 2QUAA 3K1AA 3O83A 2R5FA 5BRNA 4AMYA 2LRHA 2VJPA 1NLYA 5IH7A 1XP8A 3AVYA 1EK1A 2FPSA 5CDUA 2RGWA 2VL7A 1GZ3A 5HF9A 3TR6A 4DA7A 5LB4A 2OBMA 3HO8A 1L5YA 1VLMA 3O03A 4I4TF 4NPCA 3KJNA 1FSFA 2HK6A 2B8WA 2QAIA 3MZ0A 4G84A 4ARZB 3IBCA 4XGRA 5CX4A 1Q21A 1ADJA 1KJZA 1NSTA 2I33A 3X0DA 4AG3A 5HIAA 1AQNA 2QU8A 3PFIA 4JP8A 4MI9A 4WOJA 3RVNA 5JO0A 1RRVA 2ACWA 1MG0A 5SZIA 3QVVA 3MJDA 1G1AA 1QXSA 2FW6A 3PJDA 2X5OA 4BVGA 1D5CA 2A78A 1AHNA 2VHWA 2GKGA 2REXB 4X7RA 2O8NA 4QOSA 2Y1GA 1ISGA 4TT3D 4AQYB 1T8SA 3PR1A 1ZGJA 4C22A 3LUFA 3FPKA 2XRYA 1NVVR 2DY0A 4JASB 3JWPA 3MJEA 3SIWA 2A9VA 1R8YA 3OZWA 2HV9A 5K6AC 3AONB 3ZXSA 1RRFA 2OVBA 4MV0A 3BE5A 2HF8A 1N36B 2O9JA 2FR8C 5AVJA 1I32A 4EOGA 2AZXA 2OZLB 1E4EB 2H4WA 1WWKA 1LVHA 4MMZB 4CDMA 3TQTA 1D4AA 3JD4A 4TM7A 3KQNA 2XA9A 4QL3A 4E2XA 3L84A 3C3MA 3NIFB 1XVLA 2XB9A 3ZH9B 3UMCA 2IPAB 2WJGA 3ZWPA 4E3WA 1QH9A 4PTYA 5PGMA 1MX1A 3VR5D 2YHBA 3VDXA 2JDID 2HF9A 3I2YX 4RZ2A 1MRZA 3HFJA 1YVEI 1YB4A 2HA3A 3JQ8A 1G8SA 2V5UA 3RS2A 4MMYB 2AG1A 5EJMA 3SNHA 2W22A 2CXXA 2IHJA 3ZVKA 1Z2OX 1Z7YA 4L74A 2ZJ5A 4RD3A 1NTOA 4O08A 2NW6A 4UM8B 3JSXA 5DHSA 4W7IA 4AT1A 4J2OA 2PX4A 1NUAA 1KAOA 1PNOA 2L18A 2Q27A 2DSTA 1QLHA 1AOXA 3C97A 1RZRA 3DE6X 1AQUA 2XRMA 3OZ7A 1PVVA 2VHVA 1IEQA 3AESA 3DTVA 2N46A 4LMAA 3R8FA 4C2UA 3UT5B 3V4ZA 3K1ZA 1ZHOA 1NXSA 3A4VA 1YS4A 3EB9A 4HWGA 1V7QA 3K31A 5DIFA 1PT9A 2VZEA 1NW6A 1JNYA 2O2IA 2ATIA 1LPNA 1YV9A 1JXOA 1N75A 5J2UF 3H5AA 4GPTA 5TMDA 3EUWA 4FOPA 4LPSA 1X1BA 3NEYA 2J0UB 4AWBA 1Q0RA 2EFCB 5D01A 1MAVA 1EFPA 1YB5A 4Q3CA 3V7FA 1D03A 2CMGA 4MRVA 4B0OA 2WFAA 3TTVA 1A97A 1W49A 5IVIA 3MN1A 5AXBA 1KSJA 2C8VA 3D5TA 4UATA 3SLGA 5DEOA 2HWKA 1N8SA 3K8ZA 2I4RA 1KIFA 1XLTC 2D0OB 2WJ4A 3E7PA 3AUKA 5FNVB 4A0RA 3OFSA 1PWXA 4YUZA 4KQWA 2P2SA 4LOLA 1UBTS 3AVQA 1E58A 3Q87B 2FU5C 1PHPA 4EB8A 1M7BA 3X43A 3H16A 4CV1A 2FOLA 3DVRX 3D4PA 3KEQA 2VJQA 1X1EA 5ELMA 3A6PC 4QPCA 1CY2A 3N7UA 3L4JA 2HDOA 2O52A 4C2TA 4WKPA 4J9VA 1QKJA 1IH8A 1X7GA 1P1JA 4BQNA 2ZULA 1J2UA 1MKYA 2CKMA 3KL2A 4KWHA 1H5NA 3FKJA 1IY9A 2DLDA 1A4RA 1DV2A 4OK3A 3IQGX 4ZC8A 3RWMB 4COKA 4QU0A 1VL1A 3ROMA 1Z73A 3FNFA 3EVNA 3N59A 2OCYC 4UD2A 1NV9A 4HB2A 1H2HA 1ZXXA 3BSWA 4NU8X 2EP5A 4DLKA 1SVKA 5FR2A 3R7NA 3C70A 3V4FA 3OA2A 3BBLA 2ODAA 3N3AC 4LA4A 3GDGA 4DDHA 5AESA 5HRAA 2OV4A 1HO3A 3L6BA 4J29A 3L8GA 1GARA 1NAHA 1SPBS 4HFNA 3UHOA 3HXOA 1A7KA 1GA6A 4RXUA 4K0RA 4F3CA 1DQPA 2B25A 2JIPA 2ZJ3A 3GARA 3L1VA 2NZYA 2JL1A 3DEZA 3IAXA 2Q7OE 4AWXA 1ZD1A 4BNUA 1OMOA 4CM6A 4EHIA 3L4BC 1E3WB 4NDNE 1YNSA 4GD3Q 1PCXA 2C00A 2NV6A 5AW7A 5CVJA 1P7YA 4WXEA 1LBQA 2PUWA 3VHXA 1O0SA 1HMYA 5KSYA 1IONA 2HMWA 2RGDA 5THKA 4MUFA 1GZSA 4L7QA 2YR0A 2H63A 4UE6A 2FK8A 4U7HA 4BMDA 4QXMA 1G16A 1Z0ZA 1A9PA 1GPWB 3GCDA 2XGGA 1RIFA 1I3KA 3M2TA 4PO8A 5E6UB 4KPUB 1TXGA 3DOJA 4M0MA 3D8SA 1RZ3A 3AMVA 3P2EA 3X1MA 2OWDA 3TKYA 1U9IC 2YN4A 2B1GA 2IZ0A 3UWDA 3IR6A 3Q12A 4E6PA 2R6JA 2BTQB 4NQRA 3VI4B 4HUJA 2VNAA 5BN3A 5KX5A 2PV7A 1X3LA 3BCHA 3TJZA 2A5YB 4R2LA 2EFDB 4PG6A 4EQ6B 2Q62A 1GGEA 3BZWA 3VH3A 1W96A 4LE1A 2Q6LA 3ILVA 5CNJA 4EB3A 4YRJA 9GPBA 4BJ3A 5IASA 2DPGA 4CQLB 1BXGB 2JB9A 3DEHA 3IQZA 2CHGA 4Q19A 5JAOA 4Z9XA 3JQFC 4BRUA 4C14A 2FFQA 3JWGA 4G37A 4OV6B 2BTOA 5DHAA 4C1NA 1RHMA 2OP0A 1GFSA 2BLLA 2YRWA 4HWKA 5D51S 2GEJA 2OB1A 1N0IA 1ICEA 3R7AA 4UAVA 1EA5A 5LKRA 1V26A 2EKDA 3A0RB 3R4CA 2HLDA 1ZUD1 2VPYA 2YRXA 4G1UC 1SBNE 3MTAA 2WT9A 3G1WA 4D42A 3AVVA 4ZTUB 4HQFA 1OBHA 3OETA 5D3ZA 1OQAA 4JR2A 4N9WA 1JKJB 4HS9A 3RRMA 2GYYA 3NIWA 4WCFB 3RABA 4PWYA 4CKCA 1GQQA 2HU2A 4MGYR 1TKAA 3EXG1 5ES4B 3N53A 4KGVA 4BO7A 2PXXA 5ELXA 1R16A 5ALZA 2D2FA 2C9ZA 1SVOA 2GLTA 2QW1A 4CDNA 4N1AA 3H5LA 3E18A 3FX2A 3ERCA 1ZKMA 1Q92A 2EYQA 4EB0A 3K70B 2AN5A 1J8QA 3VVLA 5CW2A 4RQUA 3ROXA 4C0QC 2V7UA 4J1SA 3ODPA 4P35A 1BN6A 4JQZA 3SSAA 3NAZA 1M34A 1UBFA 2PKWA 3RYIA 1US8A 1GZ7A 3GJRA 4R31A 5DU2A 3MELA 5JY1A 4QYSA 4BPBA 5FI1B 1RKXA 3P9XA 1XD2A 5AI9A 1XMPA 3I72A 4HAWA 4Q02A 2VQEB 1SPXA 3HN6A 1QC5A 1Z39A 2A57A 1XJCA 2W2VA 3KXDA 2P1ZA 3Q15C 5DIZA 4ZGBA 1EBBA 4OD0A 1D2EA 4JGGA 5T4BA 4YAOA 1TTHA 1WS6A 1TO1E 4IEIA 3WWOA 2P6RA 4QT4A 2WU0A 1SJ9A 3V1TC 1P9LA 4DLAA 4GOKA 3W79A 1W36C 3HLKA 3QVXA 3HZHA 3MK31 4XPZA 4WN9B 2AUTA 3OF5A 4PHHA 5KNDH 5I4IA 3VNSA 3O4IA 1J9GA 3WB2A 1H94A 3DE2X 4HZUA 1K97A 4OL0A 1WVGA 4XVHA 4ESOA 1BRTA 3F5QA 3MS7A 2C5BA 3RQIA 2XW6A 4TV9A 1J06A 4YDHB 3OM9A 4I4CA 2VNJA 2C7PA 1BIFA 2E48A 3CIOA 3VJMA 5C4GB 1IM8A 2X2OA 2YBEA 4H6XA 5G0TA 1H2WA 4RPCA 3THSA 4JVSB 3SHWA 3RVDA 2PWZA 2XXAB 3D4OA 2EIHA 1PWHA 3UGKA 3WHPA 1KXJA 4QJBA 4B3FX 3RS7A 3JWIA 4TKMA 1L1QA 1CRPA 5AJTA 2Q4TA 1KY2A 2QZ9A 4G56A 4GKKB 3PUIA 3BICA 2EJBA 2RHMA 3LT5A 1F2TB 3IP5A 3L8CA 5AP9A 3GUHA 1GU7A 4UCWA 4D6XA 5E38A 1H42A 4FYYA 1ESDA 3IXMA 3VR4A 3D8UA 3F96A 1G2IA 1X19A 5E6SA 1E2JA 2J3QA 4A8JB 3ZHQA 4AM8A 2VPTA 3ZDQA 3EVEA 4GKBA 5HCIA 3VVCA 3K70C 1CQJB 3TMYA 1UXHA 2PEZA 3OUUA 4G63A 2F6RA 2GPNA 3E7DA 4KQXA 2QMEA 4K9PA 1K0UA 3VU8A 4CLRA 5C8YF 1Q6ZA 5J4YA 4XEHA 1JG3A 4PSKA 1P7WA 4U9IS 4WERA 2X7JA 2Z95A 4NV0A 1C4WA 1LRJA 1H4QA 4A1FA 1NW4A 3NZEA 1KI2A 1RVDA 3NALA 4M7OA 3ADDA 1FSPA 3IQHX 3NIDB 3VO9A 5E4FA 1QOPB 2NO4A 4P81A 1L3CA 2IDJA 3PNQA 1UZNA 1E3TA 1S4MA 2R6HA 2X3FA 3NOQA 3NPMA 1YU9A 1Y5MA 1U28C 1ZCJA 5GINE 5DHUA 1I4OA 1SUAA 1VCOA 2R6DA 2ZRQA 5E3IA 2JLXA 1PZFA 4U9UA 2JGRA 3CPEA 3UM9A 2C83A 3PICA 4YO8A 3CRNA 4IIBA 2CSUA 4F1JA 2ZRPA 4LQLA 4H7EA 3QM1A 3D3EA 2HDHA 4EJ2A 2P4SA 1SC6A 1FX1A 4QTUB 4R1OA 3X1YA 5JATA 3O92A 4UCFA 2VZ9A 3L4SO 1EBFA 4YRIA 1KAMA 5BWLA 1GU1A 5JDCC 1C4KA 1VJGA 3VSAA 4Q4AA 4WLEA 1JAYA 4O4HB 1QK3A 4U6QA 1XV5A 2REOA 1NJSA 4H17A 1WF6A 4QPNA 5C5DA 3O9ZA 1RQPA 2HRDA 1J0DA 1GCUA 3GEIA 2W2KA 1GQSA 4KVGA 1R6BX 5HIJA 4L57A 3KALA 1YQWA 5E0KB 1EGVB 3K9LA 2ZYHA 5E9WA 4YY3B 1ZQ9A 3ESRA 1P72A 1NQXA 1T2AA 1TMGE 1Y8RA 3OFND 4MR7A 1VSTA 2ZUCA 4A73A 2ETVA 3P19A 4RVOA 4RNCA 1K8QA 2ZRJA 4PRYA 3M70A 2NLOA 4BMNA 1Z16A 3E2IA 3M34A 3DLCA 4MUBA 4ZO4A 4IDCA 4LHWA 5LL6P 3CSDA 2WQ7A 4TVKA 4PN3A 4F04A 1W8IA 2RK4A 1CJSA 2VRNA 1YRQA 5FBQB 2CVHA 2IUFA 1M5TA 1ZA2A 1JG1A 1ODIA 2WZDA 4ZRMA 4N7BA 1MTOA 2WWRA 4YFVA 4ZO6A 1N5OX 2HPZA 1T4CB 3IESA 4GZ3A 4M7PA 4PLCA 4R54A 1L7BA 1A4XA 1TOAA 3DDWA 1R4NA 4TMFA 5GIPE 2DZDA 2FVXA 3TW4A 1J8YF 4UFPA 4REQB 2CDRA 1WG8A 1O9HA 2MJLA 1PQ4A 2AJDA 3W8RA 3WVNA 1CJTC 2QTTA 3BL6A 2OO3A 5FBVB 3C3WA 3PWZA 4IIYA 3KPWA 2R6ZA 4BO6A 3HG7A 3HADA 4NJMA 1DMRA 1P9NA 2PKCA 2WPNA 5FF9A 3RRZA 3HCAA 5FULA 1E6LA 5IZCA 3CMCO 3E9NA 3RWOA 1JT9A 5AUOB 4OBBA 4C7OA 3FGNA 3MJTA 2Q5CA 4FNGA 4EY5A 4BKOA 3IP9A 1MD9A 1OAKA 3WK9A 4QATA 4UVEA 1FNDA 4PEVA 4JK3A 2OCAA 1A9XB 2GF0A 3BSFA 1CFJA 4C06A 3PPXA 5JJKA 1EE1A 1II8B 1Q0QA 2C2BA 4S35A 4D4GA 5AFSA 2BHTA 4BVEA 3VVMA 4JEMA 5FUYA 2BCJQ 4HNAB 3KQLA 4NOKA 2VP2A 2WOOA 2OP1A 4I1VA 4XR4A 4R1NA 3S40A 4MCAA 1YOBA 3VU1A 4DREA 4DG9A 2VDOB 3TM5A 1UBJS 3KE8A 4AS1A 1BU5A 2K5UA 2JPDA 1A8SA 3QIAA 4NYMR 1OX5A 1YQGA 2FMUA 5K0FA 4MZXA 4NBSA 4K9OA 2ZKLA 1O2DA 2BEVA 1MMFB 5MDHA 1M3SA 2EG5A 5BUCA 2BPOA 1OH7A 2CSXA 2X8JB 4LDAA 4CF4A 3O82A 3AEUB 3OZGA 4ZI2A 1YU6A 1TQ2A 2XUQA 3A4YA 1TIKA 4HLCA 3TFOA 2ZZNA 4ZOCA 4PXYA 3ZXIA 2GETA 3I76A 3KTAA 1FJHA 4D1YA 2ZWVA 2CLFB 3LOUA 1WXWA 1GIAA 3AI3A 1A2OA 1J8FA 5FAXA 2WYWA 4Q3OA 2F2TA 4BX3A 1HRKA 1MQ8B 1Y80A 4ZJYA 5IJ9A 4KDEA 4DBLE 3TGPA 1D0VA 4L3VA 1K75A 1RYBA 5LB2A 4MROA 2RGEA 1LNSA 4YRSA 5E7JA 4P3XA 3VH2A 1UMBA 3BB4A 1FFWA 2FEKA 2O6LA 1FFXA 3ZHRA 4HEA1 4J9UE 5L7TA 1EEHA 3SKVA 2JBWA 1RXIA 2QPTA 1J97A 2C4VA 4GKVA 4KUGA 3FVWA 2Q2NA 3PK0A 4RADA 4ZQEA 4CM4A 1AT1A 3AVXA 5T3UA 2P8JA 3P9KA 1UWLA 4GP6A 5FBRB 1WHTA 2ZRBA 4RJLA 3SF0A 2IBMA 2ID7A 2NOAA 4MO2A 1JDNA 2WQZA 5BYAA 4KJXA 1NXVA 4BMPB 3TB4A 1L7RA 2FEXA 3NOXA 5CT6A 4B32A 2BDTA 3COJA 2FR1A 3P9RA 4QC2A 1KS2A 1V6SA 2PRJA 3CF0A 3QLVC 4M8KA 4OJKA 4CKYA 4UUNA 1KVSA 1SURA 3JXEA 1VCIA 1JQ3A 3L02A 3U4IA 5IBRA 5K3EA 2RHWA 4K40A 4Y2XA 5DBIA 4YT4A 4B8WA 1R9GA 1TVCA 2F3RA 1XHFA 2OO5C 2QVXX 4HNSA 1M1XB 3EMBA 3P94A 1DKOA 1NW7A 1PTJA 1V4BA 3H84A 4HDSB 4LF5B 1N8NA 3LCJA 1F8FA 2QRMA 2AXNA 1Y37A 3PXCX 1HYQA 4MW5A 4L02A 5JH7B 4Z1OA 4ARIA 1VKJA 2WK1A 2TSYB 2ONZA 1BEEA 4RKQA 5F2KA 3R7SA 1XZIA 4XARA 3A9VA 2DR2A 5KQSA 3HJRA 3U3XA 2NTYC 4YA6A 4E32A 4EYGA 4INOA 2FMXA 5IJ0A 3TUZC 4KFUA 1N5MA 1T24A 2FJUA 3WWDA 2HA0A 1HM5A 2Z1DA 5E9QA 4KZKA 3BA1A 4RLSA 4WKNA 4DMHA 1J1IA 5MN4A 2XMZA 2DFKB 3I6ZA 3QTLA 4YJGA 2O2GA 5EMLA 3ADBA 1GAWA 1SU6A 2G07A 3CRZA 4CMEA 1WP4A 2OORA 5HYVA 5JZVA 1KKUA 1TM7E 3MCTA 5IBPA 5BPHA 1A76A 2ORED 1KAGA 1PJBA 5HKAA 3ESXA 1WLSA 1MB9A 1ZBDA 4JUIA 2IKSA 2YH2A 4PRZA 2I4LA 4ZZ2A 3MFYA 2VDRB 5JG7A 4EHDA 1W4ZA 1OZ0A 2EKBA 1I3CA 4KO1S 3ELUA 5K8CA 1T5TA 1KZYC 2QOEA 3G2LA 2BONA 4JOCA 2IXFA 5JJ5A 2P5SA 5I9NA 1PD1A 2XTMA 1ZESA 2RONA 5HJ5A 2CCGA 4X1IB 2R1UA 1NRIA 4Y67A 4Q9JA 2REQA 2F00A 4YEDA 1U2QA 1H9CA 4X7MA 1G6OA 4XWYA 1IZYA 3SF8B 1NI4A 5A2QA 2JARA 3C2QA 2DBZA 5B3JA 3EDCA 4PCUA 4V0OA 2A0FA 3AZQA 4W8HA 3GVHA 4L0QA 2YOHA 5JIBA 4QUGA 4DLWA 5TPZD 5DB4A 3HB1A 4BNYA 1EH5A 3DPIA 2W2LA 3GD5A 4J1TC 1SOAA 2QR5A 3UK7A 1VG8A 1KZHA 1YONA 3AKYA 2HSWA 2J7PD 3CMMA 4OFWA 5LCXA 1U0NA 1IN7A 1TYBE 4RE6A 1J22A 5DP1A 3NHMA 5FTWA 5IMBA 4B09A 1XQ9A 1DG1G 4IJVA 2GBFA 3LZ6A 3ADPA 3OX4A 4A6DA 3FFXA 1OZHA 4EA8A 1G7TA 5G1NA 2X8BA 1KFJB 4NFHA 1TU0A 2B5WA 3Q5EA 4G9BA 2X0RA 1N3BA 4L8WB 3RYFA 2QSJA 2F67A 1MEJA 1OLXB 5D8DA 4CV0A 5IS2A 3I2JA 1ZRHA 3W2HA 4AG5A 3EOZA 2YYAA 5A5VA 5G3ZA 3W3AD 1O6ZA 2A1TR 3ZW8A 1PYOA 3MINB 5EHNA 2BBSA 2X1VA 3T52A 4DHEA 1GNLA 2WWFA 1I51A 2CNKA 2CLIB 3PEFA 4O4JA 5D7BA 3VR3D 3WMRA 3MC1A 4TTSA 3I5MA 4EHBA 2J48A 2YXEA 4JB0A 1T9DA 3WK8A 3SQDA 2PBFA 3PDHA 4MGHA 3RVBA 4CR6A 4RVFA 1QUFA 5EIHA 2JHGA 2F62A 3D6UA 4N65A 3O0TA 2BKEA 4GZ5A 4B4KA 4I66A 3D2BA 4ETMA 1WDTA 2AEFA 5I9SA 5EXEA 1BEUB 4OJMX 4RYDA 4DR7B 5IN4A 2BEUB 3PEWA 1ONNA 1DQZA 4OQYA 2XKKA 1AK9A 3BQNB 1FMCA 3RG2A 2I80A 1S7CA 2KWIA 2ERXA 4XWTA 1Y9DA 1ZNWA 1H9BA 3BXOA 3H1GA 5EAIA 2TMKA 4K1LA 4Q3DA 2P67A 2H9AA 4RIIA 1V16A 4D56A 4ZA2A 3L7BA 2NT3A 2GJAA 2ZVJA 5BUSA 3EUEA 1XTIA 1P5JA 3AHCA 1HC7A 3FMVA 3TLZA 2FTKE 2PM8A 4MVJH 4Q7LA 1A0OA 1MW8X 2AX4A 2CJYA 1SUIA 1RAAA 3EZGA 3PRKE 2P9QA 1FOEB 3PDIA 4DCCA 2BGNA 1JEYB 4QO8A 3MM4A 2R6AA 1NYTA 3BIOA 3CE6A 1EUYA 4MRPA 2L17A 2PS3A 2COEA 2Q3DA 3GRUA 4LTDA 3KZCA 4J0FA 5AHOA 2WJWA 3SHTA 2AFHB 2O7VA 3Q3GE 4UCXA 4PGMA 3WQRA 1LK5A 4HUQB 1RXEA 1M2WA 3C3PA 1Z6GA 3FNQA 1XD9A 2IYUA 2J59A 4I6EA 1CUZA 5DGTA 1GN8A 1PUJA 1SCUB 4NHOA 4BOYA 4BASA 1JEEA 3SD7A 1APBA 1DSSG 4JLKA 1T8YA 1FFHA 3WFIA 3OOHA 1E2LA 3MJFA 4H2DA 4YO7A 1XZDA 4OHWA 3S6JA 2FFRA 5B3KA 3KYDB 2JLYA 4UHEA 1VP3A 3OJEA 4NULA 4Y9RA 3FNGA 1TIPA 3CH6A 1XCOA 1I5OA 1QP4A 3NGMA 3WLMA 4AW9A 5IAKA 5B6PA 3HEAA 2AOVA 2R7KA 4JQYA 4KV9A 2BEWA 3ICWA 4BGUA 2GO1A 1A9YA 3HPRA 4FFMA 2Q9AA 2YUTA 3DEYX 4O0LA 5K8LA 1UBLS 1UZAA 4XE5A 3R5SA 4ZYVA 1QG2A 2FZCA 2AN1A 3GLHA 2GI4A 1DAKA 4V2IA 2YBDA 1GL9B 3W06A 4WWHA 4HT3B 3IELA 2W2MA 3COPA 4NU0A 2O4UX 5C1OA 3PT9A 3T8YA 1VJRA 5ALWA 1I0LA 3MRVA 5FL7D 2ZIAA 2XODA 1N9KA 3ANYB 3LCUA 3T61A 5KQLA 3DO5A 5KVQA 1VMEA 2PX5A 2R6CA 1JDJA 1KVTA 2CNWD 3HJTA 5MFZA 2JHCA 2V9PA 3ETCA 3LQ2A 4XJXA 5HHTA 5D3QA 3II6X 4ER3A 5HQ3B 1D1TA 4UTZA 5F9HA 3JYQA 4B44A 3IP6A 4ALLA 2QSZA 4IV0A 3U81A 1QQ7A 1SQ5A 1PNVA 2XMQA 4NKRA 4CG3A 3M1IA 1P2TA 1ILWA 4FKMA 4LGMA 5LA6B 1PR4A 3WFJA 2I6TA 4WL0A 2NQTA 4V0LA 1EJ6A 2C2KA 5F52A 1YCGA 5JBNA 3N5CA 2R00C 2VSQA 4MVJM 1PJSA 4RY8A 1NONA 4OM8A 2ORIA 1QO0D 2VKQA 2UV8A 3D7LA 3O75A 3PD1A 4QAJA 4LYHA 5BQXA 5KHLB 1FRZA 2O3SA 5AKLA 1B0AA 5J4LA 5I4KA 2J33A 2EBHX 3LOQA 4RJJA 4EG7A 2C57A 1WOMA 2JLBA 1RHJA 2OR3A 4AKEA 4TL6A 4BLTA 5D00A 3JRXA 1XOIA 4MHTA 2JK1A 2NU7B 2REBA 3HCRA 3L0IB 1VHDA 1RADA 1TVMA 3CZPA 3LK7A 4K2HA 4KQGA 2G71A 5H8WA 3UXEA 3A04A 3CISA 1KU0A 2XA2A 4J0EA 4EBBA 1H85A 2I0FA 3KHUA 1N1MA 4YCBA 1NOJA 2ISQA 4UPDA 1W6UA 1J9ZA 4J3JA 3E9MA 1T5HX 4ND7A 5M2QA 2I4IA 2P3SA 3H5VA 2XMDA 1UP4A 2GPSA 1Z0JA 2Y8EA 3NASA 4QUBA 5CBPB 4P98A 2OBFA 1D0IA 5G0VA 2O06A 4M9SA 2DTXA 3OO0A 4XQCA 4A0FA 3ZGOA 1XMXA 1RWNA 1QIMA 3F6RA 4D0SA 4H77A 2B83A 2BP7B 3WL4A 2IOHA 2DGDA 3ANTA 1KMCA 4A2QA 3HEMA 4JVNA 4ZAVA 3Q6IA 1ZSYA 1FMJA 2JA2A 4K8RB 2AYZA 2I6QA 1E3MA 4TVSA 4R71A 2C92A 1NXXA 1D9ZA 5CU7A 1EFHA 5CA0B 4G0OA 1RI1A 5K6RA 5ITZA 4HX2A 3UMYA 5I5EA 2OO7A 2OZKA 1L8OA 3ENWA 2V58A 4EK9A 1PS8A 2AX3A 3RF7A 1I5EA 3WLTA 2GPYA 4NABA 3IOCA 3PFKA 1KEEA 3SZUA 3B1KA 2DPMA 2A9KA 1FYXA 3KUDA 4J7CA 5HFAA 2XNDA 4KQ9A 4YCDA 1P31A 5JBIA 3GVXA 2HAEA 1E8NA 2L19A 3BMNB 5IARA 4E70A 4J2HA 1LJUA 3LBAA 3CH5A 3P71T 2AOTB 2WVAA 3DMTC 2ZAOA 4HJXA 4PE5B 5F21A 4E4TA 4EUHA 1DBRA 5JQGB 1TQ8A 3WWZA 5IG2A 2AOUB 2DQ4A 3QKSA 3A32A 1JDBC 4ZYXA 4JZYA 4WY8A 3EK2A 4MJLA 4WECA 3CJRA 5JI3E 3IKVA 2HIAA 1GTJ1 4FC7A 4HQKA 3GLFB 1FMLA 1L9XA 1CR6A 1GUYA 4FFVA 1ZGGA 2WP8J 1LLUA 3HB7A 1CS4C 5ERYA 1B00A 3I9KA 3EGWA 5KNDA 1F6DA 1H9AA 3GT3A 1Q5PA 3F8WA 1NM5A 2HHCA 2YDXA 4TMYA 2ZI3A 1IEWA 3ZNQA 2YYZA 2VT2A 4G1EB 2JAXA 4HJRA 1XZCA 2PT6A 4O4IF 2R1VA 2X5NA 5HM6A 2ZBDA 4NCBA 1RCFA 3V1KA 3BD9A 2R86A 4TXHA 1B6TA 1MEEA 1Y33E 3HJBA 1TLLA 3TRKA 5UKDA 2DWUA 3UXYA 3V8EA 1ZCAA 4UUPA 4QIHA 4QYXA 5E3HA 4Z7JA 3DVLA 1WHSB 2FJ0A 1JYEA 1TADA 2RGUA 2W2XA 4KSYA 1E3EA 2A84A 3SHQA 1CIVA 3OTHA 1QFXA 4FLMA 4TMWA 2WKPA 4ZODA 2E37A 3FWNA 3LCRA 5DH9A 4AURA 3GLTA 1A96A 4JGBA 5EINA 1Q1QA 3NATA 3LHSA 4YBZA 4DANA 2HMYB 4EZBA 3D3KA 4F45A 1E6MA 3A6DA 3WJAA 5KC9A 1ZY2A 4TXMA 3VQTA 1QM5A 4RFSB 2CFRA 1SKYE 5AUQA 4I4NA 3RKRA 3AFIA 3KO8A 3MTJA 1J99A 2GJ8A 3PT5A 4H3KB 5D5PA 5G0SA 3WJ2A 1QX4A 4RCVA 3CPHA 1DBQA 4LRYA 3NT5A 3TN7A 5HK9A 3PP8A 1G3IA 3DZDA 3H11A 1B8VA 4PQYA 1M5UA 3BTOA 5K7SA 1AQLA 4ND8A 5FFMA 2RAUA 1D9XA 1O87A 1T13A 3H3XA 4LCBA 3MFQA 2ODBA 1P5FA 5ALPA 5CFPA 1DCFA 5L4NA 5FOWA 2X9LA 4J75A 4DV2B 2DPLA 4E5PA 4RH1A 4DIMA 1UJCA 2W9XA 3PTAA 3BEDA 3WL7A 2WYUA 5SYNA 3UCXA 4DCTA 3THRA 3E4DA 2XQKA 4FFLA 4RLHA 3GEHA 1JALA 1RD4A 2E5FA 4DVGA 7REQA 4YJHB 4RHTA 1KMQA 4XOIA 1HA3A 3MGKA 1SCIA 2AG5A 4CKWB 2UUAB 4PPGA 3TUJC 5IM4A 2ZW9A 1UBCA 4H0CA 5EE1A 4JJKA 4EI8A 1WVIA 1B8NA 1JDPA 3ESYA 1FLNA 3GRKA 4I08A 3DOOA 4OMCA 1KQOA 2Q1XA 4PYNA 1PR3A 1PW7A 1CR2A 4XR9A 3HQ4O 4H16A 1M54A 4TWJA 2GA8A 2V65A 3H1PA 3KYIB 3D7SA 3U3ZA 4QGBA 2JKZA 1HQCA 4ND1A 4CKBA 2V9CA 4XX0B 2BBWA 4INJA 3G9QA 2ATVA 4LJSA 1UP6A 4R0NA 3TKAA 2JGDA 5ABPA 3DV0B 1ZVVA 4DPKA 3DQZA 5DRYA 1KMMA 5EP1A 1T3TA 2ID9A 2ZS8A 4S0XA 2GPAA 1L4FA 2CVZA 4O2AA 2IQIA 2ZI9A 2D1FA 4KOAA 4REOA 2VNHA 2QL7A 3IVGA 2V9ZA 1Y3IA 3OE7A 4XPIA 4KYVA 2YNMC 3FYUC 5B2FA 2F9MA 3MYRA 2B0JA 4K9RA 4WA8A 4GLLA 2F59A 4AROA 4DJEC 5I7OA 3SC2B 3WRVA 2X5KO 5KYXA 4CTJA 3PNSA 4F1WA 1QJCA 2CLHB 1NUHA 2NM0A 4JBLA 2QM7A 1IQPA 2FHPA 4ZYUA 3F6SA 4IDNA 4JLPA 4LYEA 3P0HA 2XWPA 1SELA 3NJRA 3K5WA 4X1YA 1RTKA 3OQ6A 3UYKA 3QK7A 1H6CA 1NW5A 2HNKA 3S7TA 1S8FA 2A86A 2Z04A 4EKDA 5JNRA 2FMIA 1WY5A 2I7DA 2IITA 3KJQA 3N8GA 5JVDA 3Q8LA 5D84A 3SVLA 1EJ2A 1ZMRA 2ZVPX 1VYTA 2P6OA 3HU2A 1PG0A 2HCFA 2HSDA 1M2JA 2XZTA 3DKPA 3STXA 4RMHA 4IQ8A 5HUQA 2ZBPA 4CCSA 2YWRA 3EIEA 1OTXA 4MULA 3WYEA 4MR9B 4DDWA 2AUNA 3G9TA 4QUAA 3LT1A 2EZTA 1W1IA 4KO4S 4MWTA 4RV5A 1Z37A 4JWTA 4YRZA 3DP7A 4F46A 3TTXA 4FFRA 4UUBA 2J9XB 2PX8A 3AFOA 5K4AA 3T41A 1VPLA 1TKBA 2QX4A 2G77B 4OHUA 4O8CA 1B0PA 1QFMA 3J81k 3OEED 4MJ3A 3EPRA 2IV2X 3PQEA 2O8FB 4C43A 4QUHA 3M6XA 4RF3A 5AVVA 3DEJA 1QRUA 3V8RA 3G9XA 4NBKA 3FPLA 4YRDA 3HUDA 1IB6A 1BW9A 2MSLA 3OICA 3D3QA 1MIHA 1G3QA 2CYAA 2DULA 3NMUF 5KEIA 5J58A 5HG0A 3T7RA 1Y63A 5DHPA 2CHQA 5C5EA 5AKGA 2BF4A 3GNSA 5BN5B 3PNKA 4EECA 3DE5X 4K9DA 1YMVA 2F7SA 4KAAA 2H52A 3FIUA 2R87A 1FYFA 1G8MA 1KFEB 1WMBA 2Y6VA 5ALLA 5CITA 4GOLD 3NHLA 5C35A 1JSCA 3MRSA 3HRHA 3CLRD 1HL7A 1E79D 1HT2E 1QZXA 4UBMA 4ABYA 2O57A 3H2JA 4X93A 3K73O 5DM1A 2HMVA 4DM4A 4ZCTA 5JZBA 1R8SA 4HRAA 1IZ8A 4GC9A 4C4PA 4BX8A 1IU9A 4OQMA 1DC7A 3MMXA 1YE5A 2WIDA 5FWAA 5BR4A 1NJ6A 1CUIA 3GEBA 1MVNA 3HSKA 4INZA 1JB1A 4US0R 4WDRA 4ZZ3A 3RYCA 1C8LA 3EXIA 5LYJF 1C8KA 1OX4B 1XROA 1XYVA 4TVBA 4NYIR 4I2NA 4RD2A 4BY9E 4A1OA 1HE3A 2GSWA 4QHSA 5KNBD 1GDTA 3UOGA 1RPZA 1PEYA 2RGAA 1AN9A 2XRFA 3AUSA 3NTQA 1J7KA 2PGLA 2C84A 2WPDD 5LQCA 2XDYA 1XZFA 3GRPA 2WJPA 1OXKB 1KFKB 4KXUA 1SZJG 3LO8A 3SQNA 2PUBA 3ADOA 1E9AA 1VLQA 1X74A 4OB6A 4GPEA 1D0SA 1NUPA 3LHDA 2DKOA 3ABOB 4FFSA 1ECBA 4IIGA 4PV7A 4V03A 2PRZA 4MEJA 1QMGA 1C7QA 1SR8A 4WNIA 1SA0A 2ZYRA 2HHAA 3RVLA 3ZHVA 1OAAA 1N9GA 1SEPA 5SY6A 3ZX4A 4EI9A 4MUEA 4XGNA 1E59A 2FXIA 2P78A 3USES 1T9GS 3T5BA 3D3WB 1I6LA 1XKXA 1ACLA 1YI8A 3K0AA 4YCNA 4DM3A 2CHFA 1Z26A 3DFFA 5LU9A 2QSYA 5HCNA 3IGFA 3DWIA 4NHEA 4ZAXA 4YMTA 4D0GA 3WAKA 3CVVA 2C31A 1ZGBA 2ZT8A 3WWCA 3OFJA 4D45A 3QZUA 4GGMX 3BKXA 4ZHQA 4FYIA 1YOVA 2ADMA 4PPNA 2PANA 2IEZA 3F9RA 4ZZ1A 1QHNA 1Z35A 4DSZA 2DT5A 2CK3A 1Z33A 3V34A 1SU8A 1K88A 2IX9A 1U1EA 1A71A 4DQVA 4F2DA 1YL7A 5F12A 1UJ2A 4U1RA 3CNQS 4RXMA 1Z7EA 2GN8A 5EIBD 2V59A 2VHUA 1OFHA 1QTNA 3G0OA 3P9NA 3DB2A 5FADA 3BMQB 5H3CA 1OBCA 1YC2A 4AXBA 1Z5UA 1GTG1 1E2IA 1IDOA 4F4FA 5KWJA 2CVOA 2G76A 3DXXA 2IEYA 3G89A 4R84A 1H69A 4NRDA 4R2MA 3DO8A 4TN5A 4HDOB 2G04A 3VKHA 1FSZA 4BCBA 3SMQA 1JU4A 4IHKA 1IMOA 3UG7A 1EWKA 1U7WA 4WT7A 1Z63A 5CM8B 3SZOA 5I9IA 1R64A 2OXFA 1ISRA 2ZRHA 1MGOA 4FMDB 1Z12A 1U2RA 1H6BA 1XZPA 1G4HA 1ZM7A 1ISFA 1NOKA 2H3EA 3A26A 3GJ6A 3OMWA 3PHIA 2IV3A 3FLBA 4GPD1 5KKCA 5B2ZA 5TJHA 2ZSFA 3RD5A 3PGXA 3W6OA 3VPFA 2ZJ8A 1A95A 5F7JA 3ZWDA 4JJ4A 1IBCA 5FB3A 2B8JA 5GJCA 5ULLA 4Z2YA 2X5JO 4L9WA 4LGYA 1NV8A 1KYXA 4UREA 1P1HA 4DUZB 3MWLA 4E33A 1L6RA 1SHJA 4IDFA 1JT2A 1VDMA 4HP8A 5JSUA 5CIQA 1C4XA 3ZH2A 4Q3NA 3GHHA 3W1VA 3WIEA 5I7HA 3B53X 1EINA 2QLFA 3PQ7A 4X8MA 7MDHA 3V3TA 3LUCA 3DZBA 2PS1A 5IJZA 4MHOA 4RVGA 4EF6A 5FJJA 1MHPA 2H4XA 1AIPA 3OJ0A 4M9XA 3DCJA 2CB0A 3CUYA 2B4AA 3RBXA 4HAZA 4JP3A 3X3HA 1IHXA 1PJQA 2R4TA 2VAXA 3W5BA 3V4VB 1CZNA 4CR8A 4KXNA 1N5JA 3I05A 3WYDA 5JMOA 5CCBA 2J85A 2IOYA 3ZBUA 4PO1A 2R96A 4UDNA 3RKUA 1ABFA 5BT8A 1E2BA 1N7JA 4QSMA 3TQSA 4YXFA 1GPKA 1VLLA 1WDMA 3RLIA 4G1MB 4CKEA 5M04A 4UEQA 3C43A 2XQVA 1UOPA 4M7WA 2DJ5A 2C94A 3FSGD 1NDQA 1BCRB 2IYWA 4KVZA 3V1UA 1D09A 1Q95A 3N2GB 1SCDA 3WMGA 2D2VA 1KBOA 2NTNA 3QVOA 2Q8PA 4GX2A 4EG0A 4DMLA 5EYPB 2J32A 1GG9A 3VH1A 5SICE 4PTLA 5EE0A 1HQKA 3QWHA 4MCHA 5DLDA 1YKGA 3PLNA 4NP6A 2EZUA 2Q28A 3I9NA 5DNWA 1VBMA 5BQ3A 4H1UA 5FOQA 3HY3A 1GQYA 3QKTA 1PR0A 1UPBA 3GHYA 3K0HA 3GLGA 4FBMA 2ZRKA 2P0YA 3DZIA 1W4AA 2ACVA 2ZWMA 3GT7A 1YS2X 1YVUA 2CLMB 2WUVA 3H2ZA 3KJIA 5IBQA 3VX3A 3AHGA 3CC8A 3ETJA 1VL5A 2NN3C 3JY6A 4PGHA 3G2NA 4RD0A 3NDBB 1EFTA 2WZBA 3GGJA 3C85A 2VFAA 3ACDA 2W6JD 3MF4A 4HGPA 2WE7A 1Y3AA 1GZUA 4O4LB 1GG8A 2VUSA 4BQFA 5ALNA 3BHJA 3WRYC 3EUFA 4DJAA 1ICIA 3EEBA 4CM8B 5DDIP 5EXSA 3FRIA 3UAGA 1XRNA 2QIPA 4ALNA 4EGCB 1Q0ZA 2KX7A 4II3A 1YO6A 3EQ2A 2CXNA 1G8JA 1FQKA 2NZ8A 1KORA 3M6LA 5AKEA 5DULA 2GNAA 2PR2A 4YRQA 5CT8A 1IXYA 1P9OA 2V7QD 2GILA 2GOYA 4ZVRA 4HVLA 1RFGE 1R7RA 3OIVA 4GOOD 4IZIA 2ZSBA 4ZEOA 3VSBA 2OSVA 1U8FO 2XOEA 1L3IA 4RJTA 4MVJA 3F5MA 5TQ0A 5IAAA 2ZB7A 5IFKA 1GPDG 2V7XA 2B2NA 2W6PA 2AMJA 2FWNA 4NY1A 1JZSA 1FEZA 3VMMA 5JSZB 1EESA 3KWJA 3QBDA 1T25A 4RL4A 5ILGA 2DG2A 3W6NA 4YASA 4DDTA 2FQ1A 2HJSA 4TS3A 2DR0A 2BVNA 4G9EA 2EEPA 1JR3A 2XYGA 3N86A 2OXTA 2W0SA 1UIMA 3DKKA 1BXKA 1DQRA 1ESCA 4ZVTA 5JADA 3R9WA 3NEPX 3IPYA 3PFBA 4BEJA 4KN8A 4Y6OA 4Q4CA 4CXMA 2BRUA 1UC8A 2RAVA 3K7EA 4Q9LA 2AF3C 1LQTA 3B2QA 3PVCA 3R3SA 1Y1PA 4RJIA 2BSAA 3V1LA 2VVTA 5T3YA 5I4BA 3JVIA 4QGAA 1P62B 3R20A 4LDQA 3X1XA 1BJTA 4PX5A 1THMA 2QJOA 3ONVA 2IYZA 4PWZA 2IBTA 1M2GA 4FSXA 2Z5FA 3ZYCA 4WASA 1MT3A 4OYLA 2YJ6A 3EVTA 4XD7D 4GR9A 5HQTA 4G4SO 3K0KA 5T8KC 2FKAA 3FMOB 4V3BA 4BLVA 5HXAA 2A5FA 3GZNB 2ZGVA 4HDQB 3KQTA 1AJEA 3QLEA 3FDFA 2Z6VA 2DKNA 3CCBA 3TRDA 6AT1A 4AZ0B 2ZRGA 3BD6A 4RIHA 2D4HA 4G3XA 1NNUA 3EIHA 4JT2A 5C5IA 8OHMA 2DFDA 2D1YA 3QUBA 4OH1A 3TSZA 1WCIB 2X6TA 2FA9A 4DNXA 3TXAA 4ZZIA 2KLBA 2R8XA 1P1IA 2GXUA 3H1EA 2QRKA 3AESB 3DTVB 3M5WA 1MH1A 2C4HA 1CD5A 2IHVA 4MWBA 1C4OA 2W2NA 3L7YA 4HB0A 4WINA 5A5GA 1L4LA 2ICAA 4YP9A 1YRWA 3DYVA 3VHLB 2A58A 2ALJA 1ULSA 4JB8A 4DYHA 1XDUA 4GBED 2DQSA 4MPTA 3B1WA 4EB6A 2Q6TA 4UZSA 4AJ9A 1JSRA 3HXTA 3GLKA 4DVJA 4CM3A 1AQ6A 2XMRA 4OF4A 4P4TA 4RV9A 9LDBA 1R10A 2OCBA 1P39A 1WU7A 1EFPB 1Y1RA 2DUNA 1CLEA 1CJMA 2QLMA 4IEEA 1Z82A 4MAMA 3UJBA 4P33A 2QGNA 2RGNA 3LT4A 1C1YA 2PQMA 2FPIB 2M9MA 1XPUA 2G82A 2OK7A 2W90A 3W8EA 1WXEA 2C1ZA 1BO6A 1GKUB 3L9WA 4G85A 3VR6D 5KX5F 1RJFA 1T1JA 3DD1A 2RGGA 3IAHA 4XTCS 1Z28A 1IVNA 1GV0A 3PE3A 4HD8A 4V0NA 3GELA 1KDVA 4HFJA 3LG2A 1Y82A 3HKCA 3OP1A 2QRJA 3HO6A 3K20A 3JQQA 5KYTA 5LSAA 1DWOA 3ENQA 3P5BA 3IR5A 2P9ZA 1RABA 2WI8A 1N2XA 3L77A 4KO2S 4MVCA 4ZFNA 4CGZA 2D8MA 4MQEA 4Y2JA 4MVWA 1LC0A 1I2CA 5JAQA 1DU4A 3WP1B 2OHVA 2XVMA 3WLFA 4FMCF 3CLTC 4L73A 4I9UA 3RB8A 4CMAA 1Z06A 4LOKA 1SFRA 2ZB2A 4IJ6A 6REQA 5M7EA 1PR5A 2C61A 2JW5A 1A5AB 1U7ZA 1MJHA 1E3SA 2X15A 4XFJA 1IUNA 3S2EA 3UV3A 2PMDA 4L4SA 4BFZA 1A1SA 4YJFA 3M83A 3I1FA 4TROA 4RY0A 1XDWA 4UUAA 3LYHA 5LXTF 3FUCA 1R15A 1KVUA 2RSLA 2CV1A 2A0WA 1AGRA 3LGSA 2O7SA 1XF1A 2D1RA 1T1EA 2QTVA 4EJ6A 4OHYA 3TG2A 4PZDA 3MBIA 2VBGA 5AICA 1G21E 4TLEA 4EGAA 5A9SB 1QGZA 3Q9LA 4EP1A 3N0XA 3SYLA 3ORQA 1EP3B 3DUFA 3A27A 1N6OA 3R5XA 4C7JA 2I9KA 3RS8A 1OBOA 1WSAA 3B60A 3VHXB 3JQPA 5TS2A 1RVV1 3JASB 1RAGA 3NHFA 2WD7A 2GVZC 3D8TA 1S2MA 4HAOA 4K0KB 4JEIA 1KRXA 5F98A 3CH4B 4GWLA 4EJSA 5EEGA 5LLDA 1A9QA 4YP7A 3UXMA 4G23A 2WMYA 3PCXA 3VR2D 1KQPA 2Q5IA 2G9NA 3PXUA 4Z4HA 4FXOA 4V1CB 3PLAE 3O3CA 3ZWVA 1U3FA 1H1LA 1PLKA 4QQNA 4KQEA 2AMLA 1OI2A 1RBZA 4I55A 2LCIA 5KX5B 2B92A 4TT3A 3SBXA 3P97A 3VKGA 2CUZA 3R6TA 2CNOA 4FE7A 4P7KA 4A0QA 4DADA 4E51A 3OKFA 4C3UA 3BCSA 1M6VB 4QRDA 1X7YB 4KHZA 4V02A 4PBSA 1IHUA 5GVRA 3THWA 4U2FA 1LB1B 1F0YA 3J81A 1DC6A 1AXGA 1VHLA 2X86A 1V47A 2YCLA 1TFUA 5KYNA 4Y2QA 5GPBA 3R7BA 2WJYA 3HN7A 1B6RA 1TGYA 4XA8A 2P3LA 3HM9A 3ICQB 1HE5A 2PZLA 1N1GA 1PNTA 4QT0A 5CH5A 2BFNA 4R3UC 4PG8A 2CFIA 4DR4B 4HLQB 2RHTA 4MW9A 3V8BA 2AW3A 4TV9F 4P5EA 4B9AA 1YQTA 4MW6A 3OIYA 1AU9A 1LRLA 2QTLA 2OCGA 3FNRA 1ZIDA 3MWEA 3UK1A 2EKPA 1TUGA 3ASZA 3H2IA 3VR5A 4UDYX 4JITA 2FF5A 5H83A 4WY2A 4DSTA 1IY2A 4JX9A 3UBMA 3I32A 3W3AH 4ZQBA 3FI0A 3B9RA 4WDQA 3VPXA 4CKCB 1Z3IX 2WNIA 2QGFA 1C30A 4MV1A 3LCVB 3C4VA 1CHDA 3IIIA 4R2WA 4RVCA 5U1PA 4P0TA 4Z0PA 5DYWA 1U3GA 3ABSB 4ND2A 4QJ4A 4QE3A 2R11A 2H5EA 2VBCA 3HVUA 2NV0A 3S2SA 2VTEA 1UMDA 5YASA 3T1HB 4PIPA 1W47A 2Z8YM 3IIJA 2ZJ4A 4DCVA 2EGHA 4QX6A 4D43A 3M4ZA 4L3WA 2NU8A 3B3JA 1ULBA 1V1RA 2CGEA 5FKJA 3IAM1 4DLLA 2R8YA 1DV1A 1VYUA 1ZJ5A 3SQXA 1OE0A 2GKOA 2WBLC 4UAGA 1M34B 1W8DA 4YECA 5IEJA 1E69A 3RYIB 1KI7A 3H5OA 1YTUA 1YZKA 1YE8A 3E9ZA 2IWHA 2H0RA 4R7ZA 5FPTA 1TO6A 3JSAA 4MYTA 1XD2B 3I1IA 1FL9A 2O5CA 1R37A 3O8NA 2G70A 2XQIA 1QC5B 2Q0SA 3D02A 4IIXA 4RFVA 5T67A 4LOIA 2P5TB 1H22A 1UKVY 4D3SA 5L8VA 3UAXA 2FWRA 2P9CA 3BFXA 1ZS9A 3TQIA 4ENRA 2H08A 2GAJA 4DCGA 4PHGA 2EATA 3HMQA 3U6BA 3EHDA 4V0MA 5FTNA 3V2GA 1I7PA 5DNAA 1ZRSA 2JIQA 4D0NA 1MT0A 5L6MB 4RTJA 1ZQ1A 5EWLA 1X70A 1ZH8A 4B3SB 4F85A 2R68A 1GGHA 2CJFA 2OV2A 3DWEX 1LTKA 4M8NE 1QP8A 4HZUB 1GAEO 4QXOA 4TKVA 1FTWA 2VK1A 2XDQA 4LG1A 4URWR 1Q1NA 1JWAB 1XDBA 1G20A 1F0PA 1XQ1A 3GEPA 4HXFB 4RD1A 3ZTWA 3RC9A 1KK3A 3R0ZA 1NN3A 4DXHA 4BMYA 4MS1A 5AW4A 3SAJA 3Q7IA 5JO9A 2V45A 4MKXA 3UENA 4ZAWA 3MAJA 3T3HA 2JAUA 4EH1A 3W2GA 1N8KA 1TE2A 5AI6A 1LKZA 3DXZA 3F9CA 3WNVA 5B58T 5DGDA 2J3JA 3TL3A 3KYCA 3PV0A 3BZBA 5JMWA 1I0IA 4GYKA 3H2SA 4MITA 1XRQA 3TTUA 1EXWA 4LNAA 3DXYA 1JRLA 2FSGA 2IEGA 4XX1A 4DNFA 5U4QA 1JJVA 1V5FA 4N0DA 4ZT5A 5IZCC 4YV1A 5JZSA 3B2NA 5KOIA 2AK3A 2NO1A 4C08A 4E0BA 1ZW6A 3NBQA 2QD4A 1N4AA 4HN2A 2WHPA 1QBKC 3SQLA 2ORYA 3W4JA 3MWKA 2XUKA 1H4TA 2O0MA 1HXHA 2X0IA 4DWOA 1RR6A 2WF8A 1UM9B 2WAAA 5LZ5A 3R6WA 1OYWA 3AVWA 2C0CA 3QPCA 1JDZA 2VDWA 3AG5A 4JA2A 3LLMA 1IWBB 3I2KA 3EASA 5F64A 3OX2A 2G9UA 2JCVA 1RRKA 4UJ5A 4XWGA 4ZT6A 1ZGCA 4WK6A 4WZAA 1BOFA 2JHAA 3C1TA 2X0EA 2I78A 5J43A 4KE6A 4AJ4A 3OH8A 3AI1A 3FYCA 3R7WB 4YCCA 4YRNA 3S2ZA 3K3PA 5ICSA 1JVNA 3PQDA 2CE7A 3E9DA 4O29A 5B1IA 4WLUA 2DF8A 1SY7A 3HCOA 3OWHA 5CXSA 4E09A 1YWGO 5A0VA 2QN7A 2BL4A 2C5FA 5EGNA 2V97A 1XU4A 3H6GA 2O1EA 1C9JA 1UQUA 4I2VA 4YAFA 5AJZA 3SKXA 3IDFA 1ZOOA 2GTIA 5DHFA 1WUTA 5NULA 1JIXA 1QYRA 2GASA 4C21A 1JQ5A 4PYMA 2FXVA 3VKWA 1JU3A 1V8PA 2Q3MA 3JYOA 2VP4A 1MAHA 1GG2A 3D43A 1KJQA 2XLCA 3HEBA 1I0ZA 4OVKA 2AMFA 4JFRA 5K8JB 1W9HA 4A0GA 4RQAA 4Q4AB 2H7YA 3VM6A 4DRXB 5IAEA 1OAOA 1FE8A 2Y4OA 4BQPA 3MT9A 4H1VA 3JR3A 4IIVA 4P84A 4AB1A 4ENUA 1FDVA 1IHDA 3CZ5A 4OUKX 1R8JA 5IAOA 5CLFA 3THYA 2R9VA 3P0JA 4TXNA 4B79A 5F7ZA 2I22A 2LE0A 1JFLA 2IV7A 4OJTA 2SCUB 4YGYA 1W44A 3BB1A 1UWKA 1DXQA 5JXJA 2J9YB 3RU2A 3WQQA 4TUYA 1E9FA 4LOJA 4YNBA 1YJAA 1YR3A 3K16A 5H9VA 1U4NA 1VHWA 1BXRA 3TX6A 3HL0A 1EWQA 3ZDAA 1Y8AA 4L78A 2CN1A 3LBNA 5GQSA 4MVYA 3RFTA 1DBWA 4DC0A 2HQRA 4P4GA 1O8CA 3SDBA 3NONA 1THZA 1YR9A 4B33A 3BXHA 2DP4E 2PRSA 3AEYA 3KFLA 4FN5A 4IPTA 3UJPA 4O1MA 3RSSA 4NMHA 2VH2A 2VK2A 1V6CA 3SZLA 3VC7A 821PA 3E8MA 2EF1A 1XTPA 5IAGA 3WLRA 4HY3A 5EZ6B 4KQIA 5FTLA 3RFCA 5CB4A 5DW0A 1E6KA 4Q21A 1FC0A 3RC2A 1Z5OA 4B85A 1D04A 5C51B 2D00A 2IUUA 4HUTA 1JVBA 2D6FA 4HSGA 3SBDA 3GDFA 2W2QA 3NP7A 1ONPA 1XJWA 3RCBA 4RORA 4RULA 1YFLA 4F5YA 1OYYA 2YIJA 4JBHA 2ZLBA 5JWHA 3ZDEA 1D2RA 2EW1A 3NI2A 2YC4C 4HGYA 2JKVA 2YZMA 4CT5A 3IAM6 3W4KA 3I9JA 5G1PA 4BEWA 1DAHA 2Y1KA 4ZVNA 1JFFA 5DT2A 3LI2A 2NSHA 4L2IA 2ZCUA 3LTNC 1GG5A 2POCA 3NHBA 4C7OB 4LHSA 5HSGA 1IJKA 1N9ZA 2ZYUX 4JDPA 2EGGA 1GZ4A 4KBGA 2FK7A 5ES3A 1MO5A 1P2SA 2OBYA 3HH8A 3LC7O 4KQJA 4RSHA 2ZJZA 2QPOA 1QGUA 2JATA 4MCIA 1ULHA 1GPMA 4M86A 1R5OA 4PQGA 4Z9YA 3SYTA 5TGTA 1BCSB 2Q6VA 3TK1A 2WZCA 2BUAA 4ALKA 5B7QA 5EG5A 1PLLA 5EE9A 4AJNA 1W5FA 4NDZA 1B15A 1ZUWA 1CS0B 2BMVA 1QGAA 3MT8A 4PYIA 5BQOA 3FDZA 1F8XA 1E2PA 2QI9F 1WD7A 4LVOA 4RD6A 3DHVA 4NJOA 1ECCA 5FJIA 3VTKA 5KAMA 4DQKA 5JZOA 2YC2C 1NL3A 2CE2X 4OSPA 5I6DA 3GN1A 3H5IA 2QVCA 1L8AA 4R2HA 1TAUA 4Z1MD 2EVWX 4FILA 3WGQA 5DYIA 4JSYA 1Z0IA 1UF9A 2DHEA 3BXXA 3EW7A 4HNGA 4E46A 1HTWA 2PO7A 3OLVA 4XASA 721PA 5KMGB 4HWSA 4LAFA 2C7GA 1PK9A 1UP7A 3DD5A 3EGXB 3R5TA 4Q05A 3KTAB 4G5HA 2R4UA 3RSFA 3RTCA 3X44A 5B3LA 4US1R 1KWKA 4KEAA 3NNNA 1CT9A 3IDZA 3ZLBA 5D3MA 3L1UA 4FDUA 4QZVA 3HPQA 3NHJA 1HZJA 2H0AA 3DLAA 4X54A 3UH0A 5JCPA 1JHDA 2FPGA 1EFVA 4KQ1A 5HF6A 2UYGA 1UK9A 3A8TA 1UMBB 1ZL0A 3Q2OA 4HF7A 2WT4A 6NULA 1SG9A 3O4HA 4RHFA 1FFXB 1U2GC 2XCQA 1GEEA 1OBVA 1R8QA 5LKAA 3P9QA 3B6IA 3PNLA 4YRBA 3GLSA 4CM4B 5I3ZA 4R05A 4F93B 1HETA 5K45A 1OIWA 2HA4A 3BH0A 4YMSA 4I5IA 1X14A 2UVDA 4FCVA 3W5VA 3GLIA 4LHZA 1P60A 1WXHA 2HGZA 2ZUBA 4UPVA 4DYDA 5GONB 3FFTA 3AR7A 3D3NA 1SOUA 3KB6A 4FKBA 1LH0A 4R8LA 2EOAA 3NM5A 5A9RA 5HUJA 3E84A 1MQAA 4X44A 3OU2A 3WLLA 3PUZA 2FW9A 1U2TA 3FWPA 3TW8A 2UZIR 1YVDA 1FFSA 3B78A 2KW5A 2XIJA 5K3AA 2QY9A 1NQWA 4MGEA 3JX9A 4C1BA 3FCCA 1P6UA 2H0QA 4BNHA 4B34A 1GYRA 1Q6YA 3NTOA 4MQBA 3UB2A 3UMBA 4C0WA 1Z5ZA 3LT0A 4IDOA 4CNQA 2B20A 1YFJA 1VGQA 3GCXA 4XWAA 4AO6A 1LK7A 4COOA 3K9FC 1RQXA 2AVNA 3ADCA 2ZYTX 1JW9B 3C3KA 1BMQA 1CUEA 1W87A 3FUUA 1RS0A 1PFWA 1RPJA 2A3NA 1T2CA 2ERCA 3GNQA 1KY4A 1IQRA 3P2IA 3PI6A 4I1UA 3ZE6A 3RVRA 2Q3HA 2ZI7A 4RTQA 3U1BA 5TQ2A 1JQEA 1DJQA 2DWCA 2E18A 4L6AA 3KXPA 5JCZA 1LWOA 1KDPA 1W85A 2QN1A 3ZU5A 2P65A 4YJGB 4BFWA 4BIIA 1UAYA 1TQ4A 4BFUA 3T5TA 4ZYYA 3OFNA 1L2TA 2IEBA 1HLPA 3ZDYB 2OC9A 3DMDA 2QNRA 5KYWA 4U00A 1STOA 4L9RA 5H80A 2IF0A 4C6SA 1SBCA 2IZ6A 1N2CA 3KSMA 3PUVA 4O4JF 5GM2A 3UMRA 1UK8A 1A98A 1QKKA 2PKRA 5ALIA 4OQLA 1YHZA 3BJEA 1C50A 1H65A 2FQXA 3E35A 3LX6A 3AJ8A 4PC1A 1QTRA 2KM1A 3AF6A 1J0BA 1J09A 1Y0BA 1RJDA 2OCXA 2HFKA 2REQB 2Q5QA 3TCNA 1V41E 2PZJA 2QUJA 4EHFA 1W93A 2XXBA 3U7QB 1WJGA 2EFGA 2CFSA 1V43A 5FA5A 3DTNA 3HZOA 3T9CA 2GPJA 3N7TA 1DDIA 1ZNYA 3EXFA 2IXEA 4KFRA 5EXXA 1JTVA 1R9MA 2ZCVA 2O59A 4TSRA 4MWDA 1ZIOA 4JYCA 4MIEA 4K7JA 3QU2A 3JWEA 4C0XA 2FVYA 2J6CA 3PRYA 4MV3A 3C3EA 2BT4A 1UR5A 3SEQA 2F90A 1ZD8A 2XVAA 3T5CA 5TDHA 3OM1A 3C1UA 4HWPA 1KMIY 4NAHA 3UMFA 4QBTA 2AS0A 4D4HA 2GN0A 2MSKA 1C9EA 1N1DA 1Z8HA 2HRCA 1BZYA 5A0TA 1ONSA 1Q7RA 1G0OA 1RQNA 1K8XB 2PT7A 4R1LA 3OTOB 1GPAA 3O3NB 1WCWA 2Q4OA 4WW0A 3PDUA 4JC8A 3NOVA 5TJ9A 3VSDA 4QG3A 3QOWA 1PTJC 5EI5A 4BP1A 1MIOB 4D8XA 1R2QA 1ZEMA 4CUJA 4DMRA 1EK5A 1G4UR 2W0MA 3RYFB 2QI9C 3NVAA 2Y67A 1QO7A 1M1YA 1LF5A 1VIMA 1UM8A 3NNDA 4GOJA 3D59A 3GLRA 3IIKA 1UFKA 4UBKA 1NE2A 1K6XA 2QYTA 4EAQA 3SCZA 2EX1A 5TMPA 1E61A 1FW8A 4QOIA 1G41A 1QS0A 3GCGA 3RIHA 3B85A 5JUWA 1B14A 4YFYA 2E5WA 4DDUA 4MB0A 4PQEA 5IW8A 1VIDA 3GROA 5BNZA 3JZFA 2PLWA 1S2NA 4HH3C 2DHDA 3MJSA 4O4JB 4LV8B 9ATCA 2BM8A 3MS4A 4WFJA 1ZH6A 4CTKA 4JI0B 3BMCA 2HUNA 3T5MA 3DO6A 4DFDA 2OORC 4DTCA 3SX4A 1EUCA 3FNEA 1RE0A 2X0DA 1A9RA 4MYHA 2M1XA 1R6VA 1HGXA 3A7EA 1DFIA 3X2FA 4A15A 4Q1EA 4ZQGA 3D8NA 3GJ8A 1QF7A 1GLVA 2B3TA 3TPCA 2LCFA 2QEQA 4YAUA 4QBFA 1ARZA 5AVOA 5KNBH 2IH4A 3EA5A 5CX1B 1PR9A 4QTZA 5K3FB 4GS5A 1W52X 3JQBA 1PEAA 5H3LA 2JGIA 4XZ3A 3ZDZB 4RTRA 3A6GA 4WOPA 2ZBRA 5DO9A 3RT9A 5ICGA 3BGVA 4L0CA 3TL2A 3DLTA 1DRKA 3I9LA 5AOAA 3FZQA 1X7XB 3GJ0A 4HFRA 4JBNA 4JXJA 1XMJA 1ZN2A 1RWBA 1QDLB 1QGOA 1Q16A 3SVTA 4XGIA 2AC7A 1I30A 2J1LA 3QF7A 1Z47A 3G88A 4GXTA 4Z5XA 3A58B 5LD2B 3C7CB 3DAGA 2O1XA 1OXBB 4ZXPA 3TNYA 4C0BA 1B42A 1XLUA 3HWWA 4EO9A 4UU1A 6ABPA 3OLCX 5ITSA 4N6NA 4RFLA 3VZCA 2XGJA 5JAHA 2QT9A 1BOOA 4PBRA 4FP9A 1VL0A 2CNNA 3EGEA 3H4TA 3FVTA 5JD6A 3QFHA 3QMWA 1TCUA 3H9CA 1P7VA 3Q10A 3CF2A 4X5OA 2XMSA 4ZOLA 3IP3A 3KTOA 3H13A 1DQYA 2WFLA 1AX9A 1AKYA 2AJBA 3HLTA 1SUFA 3G2OA 3MCUA 5JDIA 1B23P 4IVQA 4JBYA 3IDSA 4ZVSA 4BU0A 5IVKA 5BSEA 1H2XA 4R7TA 3TLGB 4BVJA 1KBQA 1KI6A 2YV3A 3HMKA 4N76A 3ON5A 4RBNA 3EDOA 1H0SA 1RM5A 2C4KA 3JALB 5AKJA 3P1JA 1ZM3A 4BVLA 4PN7A 2G7MC 3R6LA 3B20A 1PL0A 3AYZB 2ZQZA 1SNYA 1KGDA 1W35A 2BEWB 1F4LA 5AQEA 4EVQA 1IM2A 3C7AA 3LY9A 3U7HB 5FOSA 3WLEA 1K63A 4L8VA 3G85A 1BJRE 2Z8YA 4Q9DA 2HDNB 1RZRD 1M6HA 3OOYA 5PNTA 5JNVA 1UEIA 1X77A 3PC2A 1LY1A 3AGQA 1ZMTA 1KZ4A 3K1YA 1F38A 3NTXA 3EULA 1XZGA 4V38A 2AI3A 5FYQA 5BSUA 2YJGA 3P8ZA 4LBYA 3Q8KA 5AJVB 4LVUA 3I45A 1O6GA 1A5TA 1ZN9A 3AG6A 4WZ6A 3LM8A 5AKKA 3T12A 1VIYA 2Y0EA 3IAS6 4D3ZA 4ZCIA 2AFIE 2J0QA 1ZUNA 1TCBA 1M1UA 2P9JA 2FSPA 3W90A 5AW2A 5C4IA 4CI0B 1QOQB 2FJPA 3LAWA 5BNTA 2ANCA 4HH0A 1NVUQ 4L07A 1R50A 4DT1A 4R0MA 2BFMA 1UDCA 2Q5FA 1UQRA 1GGKA 3FUWA 3KK0A 3MCZA 2WWVD 2YTZA 3OC6A 4Y1RB 3W34A 3ZKWA 1CF2O 2B4QA 4XIGS 1Y9ZA 1F3OA 5JTTA 2ZETA 3MWYW 4Q48A 4X3PA 4A8PA 1GRQA 4IJ5A 3VR1A 9ABPA 3AERA 1D2HA 16PKA 1LBHA 5HIIA 4B6QA 2FWJA 5DBEX 4AUEA 5DNUA 5H16A 1SQFA 4BQOA 1AQYA 3W5SA 1BGWA 3F5SA 3E1GA 2AF4C 3WGZA 1LI5A 2V5VA 3H5WA 5AW5A 2VHYA 4ZPJA 3EEFA 2ZUVA 2WW8A 2RK3A 1ORHA 3TOCA 1YRBA 4N0MA 3SBOA 4BO2A 3KT6A 1XL1A 4YROA 4IVRA 5IBCA 3GIWA 121PA 4GWKA 4H4DA 5DOZA 3WSWA 2D1QA 3ZJYA 2B5OA 2PUVA 2QRVA 3C8MA 3ENNA 4JLWA 4CM5A 4P22A 3DDOA 4D44A 4CHTA 3KSBC 2CT8A 3MSXA 2JLWA 4F60A 5CEJA 4R3NA 3JVVA 4QXAA 1ZKDA 2BISA 2AD1A 4N49A 5CTAA 3G8DA 3TZKA 4YQYA 4LYAA 5ALEA 1NJ5A 3FZEA 4LOAA 4GIBA 1BAPA 4BZPA 3BN3A 1TM5E 1D2GA 4F5EA 1EP1B 2Q5HA 4D3XA 4HLUA 2UUOA 3UFXB 1MNQA 2YS7A 1SKMA 3KLOA 1I3NA 3CX7A 3QX7A 2PWAA 3PL5A 4ZI7F 3UCEA 1JSLA 4IH9A 2OV1A 1POXA 2F3SA 2WNHA 4ZEXA 3RHZA 4FHCA 4M46A 3M0EA 4Q47A 4TOIA 4ZDWA 4KRGA 3UHJA 2DKFA 3U0VA 5LP1A 4EPVA 1ZD2P 2B4KA 4D3FA 1ZZEA 1AMUA 2G6BA 2I4OA 4RC9A 1ID1A 5JD5A 3ZCTA 3CLSD 4JXXA 1R3DA 1A88A 1V7CA 3CX4A 5KREA 4ESHA 1TUBA 1YE3A 4ZAZA 3BM5A 3NYQA 1QV9A 3SI7A 4BX2A 1BX3A 4J4HA 1HDIA 2C8KA 2ODWA 1TNDA 4Z99A 3OPVA 4UXHA 4CCWA 4BQIA 5I9LA 5IDWA 3D1VA 4H60A 4EHJA 4UEJA 3FNBA 5IUNC 3WE7A 4KWTA 1RAEA 3PE4A 1BRMA 3TIXB 4X6UA 5DI9A 3LKZA 3TLJA 2Y93A 5AHKA 3QJYA 3WJ7A 5TSDA 5IM4F 1F12A 3AU9A 3CZ9A 4X66B 5I7SA 1ONOA 3EEQA 2IYVA 1RLTA 2UZ0A 1W581 2W71A 3QEAZ 4XVUA 2MSDB 3OFVA 1R0XA 2HA5A 4HATA 3TRHA 3B7PA 2RHGB 3QQ5A 2OZLA 2X4IA 1E4EA 1GPBA 2ZJ6A 3VPDA 3LP5A 1QHXA 3F2VA 3KT0A 4HRYA 3L0PA 2K6GA 1LBIA 1E96A 1Q74A 4GX1A 1VLVA 1I7DA 1ENZA 2VXYA 2WE8A 1OXXK 3MGAA 2XJ4A 4BFTA 3GBSA 3FE2A 1EX6A 4M9RA 3CUWA 3MD0A 4ISCA 4WLFA 3REQA 3WJ1A 2ZT7A 2QRZA 4II2A 3SGLA 3V8MA 1E1RD 1QONA 4RWZA 4G9GA 5CFLA 2HFJA 2JFPA 3LFUA 4B3TB 3R9XB 1E20A 4DY6A 1RXUA 1OWOA 1V9CA 2QQGA 4O2AF 3AW9A 1MB4A 1PJ4A 1XYGA 4JR1A 1FZTA 3BH7A 3X1JA 4WBNA 4BLPA 1C3JA 3D8RA 3G2IA 3FTNA 5HFJA 3A6HA 5C1IA 3H7IA 1EP2B 5TRTA 3SJCA 4B3BA 5HUHA 2RKBA 5BR1A 5I51A 3K6SA 4HYTA 2PGXA 2DHQA 1X38A 2WA1A 3SICE 2FWIA 1XMQB 3SS7X 1T91A 3TLMA 3BERA 4C0AC 3ECSA 3H1TA 4II7A 3H11B 2FN3A 4AS2A 1T5DX 3UT5A 2ZRAA 3R3HA 5DTJA 3ZKAA 3UGJA 4ND8B 1JHYA 4W5TA 4NBUA 3LUGA 1O94C 2WHXA 3PVSA 4WK2B 4V0RA 2PWPA 5FL7A 3ZGVA 1MU0A 4AU1A 2G88A 5JVDF 2GVDC 4OLAA 1NVVQ 4S1NA 5SY4A 2RI6A 5KO2A 2RE8A 1POWA 2XUJA 3K9QO 2H7XA 4X61A 2QZPA 3CVJA 2CNWA 3LZCA 3MIZA 4GVPA 1ZWLA 4R8KA 4TKUA 1VIAA 4BWYA 2NXWA 1P2GA 3G59A 1Q0SA 1PZHA 1W0JA 1BS2A 2J0UA 2UZ3A 3S99A 4V1CI 1FF9A 3BL8A 4NX2A 5HP4A 2FQQA 4OHKA 3U80A 2W37A 4ARUA 5GY7A 7REQB 2ANBA 3IUPA 1VKZA 2IJGX 3UJHA 2PUFA 4M6WB 2VCHA 4RENA 1W5EA 2A5DA 2X0FA 3V4RA 1V25A 1LW6E 4FB5A 1UADA 2LD4A 4PFJA 4ZO8A 4Z0TA 1QP0A 4RS3A 4BAZA 3UMGA 3VJRA 5FNVA 3OZUA 3RJ9A 5IYZB 2VC2B 1BTOA 4AJEA 1QAQA 5DT9A 3H19A 2H65A 1QO0A 1QHSA 3KKKA 1RLUA 2QRHA 3L06A 1SC3A 3R0VA 4NBTA 5C5CA 1NKSA 1JHRA 4I8DA 1A2QA 4QOFA 3SX2A 4ZQCB 4REMA 3A70A 4HWOA 4PIMA 1ENOA 3R24A 4YMLA 1NQTA 3WIVA 1NM5C 3Q6NA 3L1JA 3TBHA 2JGDB 3GK3A 3JATB 4FBLA 2B69A 1FVOA 2XMBA 3B1VA 5CTJA 4C30A 5ISMA 2UZ1A 5JYDA 2GK6A 2XT6A 4ZVUA 3STYA 3ZX5A 5AHXA 2YWHA 3WKEA 3H9JA 4BN0A 1CK4A 1X2BA 2AXPA 3AY0A 3L7IA 1WXXA 5AUPB 4G6ZA 2VWQA 2GK3A 1YQEA 4LI3X 1A1VA 1WM1A 5FH9A 1BVUA 2E2WA 2GZDA 2RJ3A 4XPIB 5A6SA 5ITWA 4YPVA 1R00A 1GPLA 2X4GA 3LTEA 1U0GA 1B7GO 2HM7A 3L8ZA 3O8QB 2QZSA 4I19A 4ZRNA 1XRSB 5EQTA 3IKTA 5KYXB 3D9QX 3GBPA 2V6MA 3W8NA 3PHCA 1YZFA 3EG9A 1YDEA 2RCYA 3M7IA 4FXPA 4ZZ0A 1IBKB 1GFWA 4FR0A 5HR5A 1OC4A 3MWGA 2Z5LA 1DAFA 1EDBA 3P0RA 5E0OA 1LBEA 3OSUA 3LBHA 4FHFA 5JVDB 1S96A 1T8UA 5CB0A 4NYJR 1PFVA 5E2BA 1ILEA 2SKCA 3N2IA 5HOQA 3WYFA 4NMLA 3ZQ4A 4OQ4A 5EKXA 1DXOA 2HN9A 4NJEB 2Q5OA 3GN2A 3PFHA 1ULZA 1RM0A 3EXEB 3A1NA 4KPUA 3L2OB 4W9NA 3UA4A 1U1FA 1WRBA 3LVBA 3T7EA 3RADC 3AF2A 3T1QA 1Q84A 3BTSA 1HR0B 4AF6A 5TIIA 2HBRA 2PX2A 4L4YA 2Q21A 2BTQA 4FE4A 5DXFA 4B9EA 4B17A 2IDMA 2FPXA 4QSHA 2EBFX 4DJTA 4OI1A 1QZTA 4M83A 2GF9A 3P0IA 3T38A 3WNZA 4FZJA 4LISA 4I5GA 2HEIA 2P2DA 4ILEA 3SSNA 4CQJA 1N33B 1T5SA 4YREA 3FCXA 3LNTA 4K6HA 4DLVA 5BOSA 3RBZA 3MERA 1XN1A 3BWXA 1TF5A 3DZ8A 1NULA 4CQLA 1BW9B 4AXXA 5F4ZA 1HKHA 2VRCD 3I0ZA 1YFKA 4U4AA 1EQ2A 1SHLA 3IALA 1QCZA 2ZSEA 4HCJA 3BOSA 4NSNA 4Y98A 5BSWA 2MWMA 4IR7A 2ZDGA 4TWBA 4U6SA 5BRJA 5A06A 4LBZA 3PX7A 4GE0A 4ZK6A 2IPMA 1MENA 3M9WA 1Y1SA 4I9FA 5CH3A 5B6IA 2ZBFA 1G4AE 3HYLA 3QVSA 2DHRA 1CUGA 4LJYA 2Q99A 5EIXA 1CG6A 3VTAA 3RIXA 3IEVA 2FMKA 3EXHB 4CM1A 6YASA 3RQSA 4HHEA 3KOZA 2G17A 2Y68A 1L5FA 5I4CA 1V6AA 3HN2A 3K6KA 5EA2A 4ZKEA 4E2WA 2PJUA 4NAVA 4HX5A 3OX3A 1JKJA 4OX9B 5EVJA 1IXRC 4JODA 2HR1A 2H4ZA 4WCFA 2O6HA 2C5HA 2Z8XA 3CUKA 3JYPA 2RB5A 1WPQA 1YIAA 3HB0A 5CAEB 1E62A 421PA 3CVUA 1FX0B 3TXYA 1WMSA 3F49S 3IE0A 1N2OA 3HCEA 4QRIA 3EOBI 5FUBA 5MHTA 1PQWA 1JDTA 1KJNA 3AZPA 3OZTA 4E1BA 3EXIB 2B1IA 2WB2A 1B43A 3R1IA 1UQTA 2IGBA 1Z88A 2GR9A 2ZSKA 3EQZA 2I76A 3KZKA 4KTVE 3DAHA 3V2UA 4U39A 4BNIA 1NKTA 4QARA 3O7WA 1FVFA 1QWOA 2XMPA 3LECA 1BEZA 2YZ2A 3SIRA 2WICA 3KLNA 3TRIA 4DSOA 4AKIA 2OG1A 3GAZA 4BL5A 2PMCA 3N75A 5EFZA 5K09A 2PMFA 2VJOA 1NLZA 4KODA 4DV1B 1SXGA 4BLQA 2RBKA 3IAFA 3RKSA 3WG9A 1SXPA 1X1DA 1SA0B 1G2PA 3BFKA 2WAOA 3D8HA 3PD0A 4PONA 4BO0A 4C5CA 3F74A 4PLGA 3RS0A 1N9GB 3DMNA 3TR0A 3IP1A 2FRVA 1YGPA 2IY8A 3DZFA 3IJEB 5KCMA 3VJKA 1PLJA 4Z7OB 3HBJA 3W2IA 5JNSA 2RAFA 3K0AB 5EE5B 5BYKA 5C46F 2C2YA 1Z07A 2P2ZA 2X77A 3IOEA 2BHSA 3DE0X 3HY4A 4MKIA 5M34A 1O97C 4MKGA 2WIBA 4UVHA 3ER9A 4ZHQB 3B6KA 1ADGA 2QMZA 2I6GA 2Z8ZA 1T2DA 1NT2A 1YL6A 5CR9A 3I3OA 4R9NA 1IN4A 1P2BA 1HNWB 2PUDA 3I8SA 3HB4X 3M4NA 4E1AA 3EBOA 1WZEA 3P2KA 2OD2A 4FM9A 4KI7A 5FI5A 5A7FA 1M7GA 3E8SA 3PF8A 2IWRA 2VDNB 1SVWA 3ZY2A 1CUJA 4PPQA 3VHRA 4IKEA 3HYSA 3F73A 1Z5GA 4PX3A 4UNPA 1U0SY 2JKYA 1W0KD 3G17A 2YQ5A 4OOFA 2HSJA 3MVEA 3MLAA 1X7WB 2YIMA 5B30A 3PKZA 1YFZA 2IYNA 3N87A 3FTCA 3TYXA 4JQOA 3SNKA 4UEWA 1M76A 4NVRA 3R74A 2BTEA 4ZV9A 3GH3A 2ZJ1A 1EHYA 1RMYA 3QUAA 1XJ0A 4KGDA 3K0FB 3VDRA 1F2TA 2CKDA 1CFZA 1I4DD 2AA3A 4H3SA 2GWHA 2JHPA 4BP8A 4Q3EA 3PWKA 2QE6A 5CDGA 1MZPA 3QFFA 5FBHA 3NQ41 3PNOA 3RROA 3RUIA 3UH1A 3BH6A 4A8JA 4LGVA 4XEUA 1NNI1 3ZV7A 4DLTA 2PBLA 3X1DA 4M99A 1CB0A 4A16A 4M53A 4D5EA 5FDFA 1IDN1 4DQUA 1P1KA 3AIKA 2N42A 2CEKA 2NTEA 4X0EA 3ZLJA 3GMDA 2I3AA 4JLJA 4M36A 3IBFA 5EN4A 1P0CA 1WXDA 2ATEA 2NSDA 2X6QA 5AW6A 4CMJA 3I6MA 1RKQA 2XEDA 5K0TA 4JI3B 3VAAA 1NF3A 3HXMA 5IABA 3EQ8A 1JPNA 3OECA 4GMKA 2P79A 1F2VA 3VKFA 3R2JA 3VO2A 1PQUA 3WR5A 2FPPB 4MVJF 4MKZA 5JCXA 1GFIA 1FBTA 1GL6A 3OEEA 3PWTA 3DAFA 4JLOA 1U1IA 1DEOA 1RW4A 1XCPA 3HCDA 1E60A 3ZDBA 3KZ1E 4K9SA 4Y6QA 3EARA 4RK5A 1TYAE 4CKEB 3AV3A 2HLHA 1KY3A 3OIGA 3RTGA 1KDTA 5KZMB 2VNKA 4UBIA 3FY4A 5BY2A 2R8ZA 4O6VA 3VYSB 3QPDA 2W11A 1V9LA 4KE8A 4O4HA 3J7TA 1ZHHA 1KEUA 1TM1E 3N8KA 4KH1A 1ZVJA 3WSVA 4ER5A 2PD3A 2FEAA 3K5HA 5KOHB 4B0PA 4JYAB 1J20A 3N28A 3CN7A 5AXAA 5KTKA 1EP9A 1YUNA 3W6UA 4FQ5A 4RPIA 1S01A 4YAGA 1HNXB 2E89A 1Z6PA 1P3DA 5CDHA 4WGFA 3KOWA 5KOJB 1Q0UA 4KTTE 1E1LA 3TLYA 4TXJA 4UNIA 3EXG2 4NMXB 4JMLA 1QWSA 3P4UA 1VFPA 1H66A 1TD9A 3UOAB 3OLYA 1WD5A 3GLGB 4G5OA 1W4RA 4MS4B 1QDEA 4GSLA 4JI8B 4G8BA 3SE0A 3H1FA 1ACMA 1MDBA 4F91B 3BVPA 4J1NA 3CUUA 1A5SB 4N01A 2O8EB 2FAXA 5KCZA 3P26A 1VP9A 3A6ZA 2J6HA 1UDAA 2Q1TA 3L9XA 4AX8A 4IMRA 3KTFA 3HCBA 1QIKA 2GRUA 4EX6A 2XADA 4Y9TA 2GN2A