2Q3CA

2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
300
structure length
298
Chain Sequence
MSIAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVDRIGVAMLQAAEQAGLIKPDTIILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGADGMSGAIAKAEELAKTDQRYFVPQQFENPANPAIHRVTTAEEVWRDTDGKVDIVVAGVGTGGTITGVAQVIKERKPSARFVAVEPAASPVLSGGQKGPHPIQGIGAGFVPPVLDQDLVDEIITVGNDALNVARRLAREEGLLVGISSGAATVAALQVARRPENAGKLIVVVLPDFGERYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Catalysis and Inhibition of O-Acetylserine Sulfhydrylase from Mycobacterium tuberculosis: CRYSTAL STRUCTURES OF THE ENZYME {alpha}-AMINOACRYLATE INTERMEDIATE AND AN ENZYME-INHIBITOR COMPLEX.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Cysteine synthase A
total genus 111
structure length 298
sequence length 300
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q3cA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q3cA02
4LMAA 1TZKA 5B1IA 4I1YA 3SS9X 1BKSB 1A50B 4D9MA 2V03A 1D6SA 5KINB 4D9GA 2ZPUA 2GN2A 2CLFB 2WSYB 4AIRA 1TZ2A 2RHGB 5DW3A 5D87A 4HO1X 1RQXA 1WDWB 2CLMB 4OFXA 4COOA 2DH5A 5B3AA 1VE5A 5J43A 4QYSA 1KFKB 2GN0A 1O58A 2EGUA 3R0ZA 1KFBB 5C3UA 4L28A 3VC3A 5D84A 5EY5B 1QOQB 4D8WA 2O2JA 2C2GA 1WBJB 1BEUB 2CLKB 5B36A 1K7XB 4LI3X 2JC3A 4HT3B 5B53A 4F4FA 1J0DA 1FCJA 3PR2B 3V7NA 5CVCA 4AECA 2Q3DA 1C29B 5B55A 1CX9B 4D8UA 4D97A 1TZJA 1K8XB 2CLHB 4D8TA 1V71A 1PWEA 4D9EA 3L6CA 2C2BA 3IQGX 4L3VA 3AEYA 4D9KA 1P5JA 1TTPB 1A5AB 1KL7A 1E5XA 2CLLB 4NU8X 4ZU1X 3FGPA 4IL5A 1Z7WA 2CLIB 5IWCA 1F2DA 5I7RA 1A5BB 3L6BA 2GN1A 1KFCB 1V8ZA 3T4PA 5T6MA 2DH6A 4HPXB 3BM5A 1J0AA 1CW2B 1V7CA 1Z7YA 2ZSJA 2ZR8A 3PC4A 4L0DA 3VSCA 5KZMB 2Q3CA 1JBQA 3IQIX 1QOPB 4WX2B 1K3UB 1KFJB 1K7FB 4OREX 3SS7X 1UINA 3VSDA 5I7OA 4KKXB 2TRSB 4ZQCB 1TJPB 5E0KB 3DWIA 5I7AA 4NEGA 1A5SB 3CEPB 5I7WA 2BHTA 5DBEX 1X1QA 5I7HA 5I6DA 3TBHA 1TZMA 3VSAA 2TSYB 2RH9B 2Q3BA 4HPJB 1Y7LA 3AEXA 3RR2A 5IXJA 5BW6B 2CLEB 2EFYA 5JISA 5DBHX 4JBNA 4D92A 3ZEIA 3IAUA 5HBGA 2D1FA 3FCAA 4HN4B 4D9BA 5IW8A 4D99A 1TTQB 4D96A 4D9IA 5DVZA 1J0CA 2J9YB 5D85A 4ZU6X 1C9DB 1K8YB 4D9NA 4D9FA 2O2EA 2ISQA 1TDJA 2J9ZB 1UBSB 3IQHX 4JBLA 3PC2A 2TYSB 4XUGB 5J5VA 1OASA 4LMBA 2J9XB 3DWGA 3PC3A 1KFEB 1FUYB 3X43A 5B1HA 4D9CA 2RKBA 5CGQB 1WTCA 3HMKA 1K8ZB 3L6RA 1M54A 1TYZA 2PQMA 3X44A 1C8VB 5D86A 5DW0A 2ECQA 1J0BA 1K7EB 4PCUA 3SPXA 1VE1A 1VB3A 3R0XA 1WKVA 1J0EA 2BHSA 3DKIA 2CLOB 4L27A 5JJCA 1UIMA 1PWHA 2ECOA 4Y6GB 3VBEA 4H27A
chains in the Genus database with same CATH superfamily
1F2UA 1TA9A 3GJXC 1XLVA 3GLHA 1XN1A 4BNLA 1W5FA 2K7FA 1HRKA 1THMA 4NOJA 1WL8A 4BBAA 1TE2A 1YUNA 3Q7QA 2GN2A 4LY3A 4CM8B 2WYOA 3KEOA 1XUOA 2W6NA 1YOVB 3NTVA 1NT2A 1ZIDA 2I8CA 2O2YA 5DW3A 3ETGA 4C29A 4HV4A 2M6RA 2BGWA 4O8CA 2GM5A 2KLBA 5J2TA 3VR3D 4GLFA 2VQDA 2GJ4A 3MMSA 2JBHA 1N6HA 2JFBA 1XTJA 3VC3A 1MIOA 4FDMA 2F62A 4HNQA 2GDZA 4KN8A 2FSUA 1CJSA 3TTVA 4AZTA 1X1TA 2CFTA 1NP7A 4LHYA 5KMGB 4C4SA 1UKZA 1O2DA 2B4KA 1AHIA 4UU0A 4BN0A 1VRWA 1YRLA 4I8XA 1AGPA 1Z47A 4X90A 3NCHA 2XAUA 1R37A 1OFUA 1OJLA 4NHOA 1DIGA 3VX3A 5KPJA 2Y1KA 4PYNA 1ZCAA 5HBRA 1QONA 1E8MA 2PZBA 3WKEA 3DVRX 1XQWA 3GT7A 4I8DA 3WLQA 4QOGA 3LBYA 3S6JA 4AF7A 4CG2A 4PLPA 5DI9A 1FZQA 4C4AA 5KC9A 1NQXA 3ETEA 2FEKA 4P83A 1X7ZA 2WD7B 4GMFA 3ACCA 3A06A 3GCWA 4X91A 5REQA 2B4RO 1Y9ZA 1IJBA 3I61A 5EFZA 2OV4A 5I9LA 3U6KA 2O7RA 2R5NA 3C8ZA 4LK2A 3BM5A 1E66A 1GGEA 2FB9A 2HK7A 4V02A 3U0VA 3O1HB 4TV8B 2ZG6A 4R1MA 5AVWA 1PRYA 1H23A 5K3OA 3NW9A 1Z82A 3SYNA 4QG7A 4PQRA 2IHTA 4OB6A 3GMSA 2YXLA 2C1XA 1R6VA 5L4SA 1CRQA 4RPGA 3NV7A 2QD4A 3EZGA 4CR8A 2JLZA 2ODAA 5EP1A 1I3NA 1ICIA 2HT6A 1DEOA 1DBPA 5DBEX 3WDKA 3AUXA 1VI5A 4HTFB 1RWPA 3IDSA 3QKWA 3BB4A 4EIWA 4EH1A 2I7CA 1AKNA 1NKSA 2PH3A 1TZMA 3WLKX 5LP1A 1RJ9A 1KH3A 2QJOA 3IIIA 3ZXIA 5C18A 3AUTA 1ULSA 5K0FA 6Q21A 4BQEA 2C2HA 4BQIA 5BW5A 3RRJA 4EEXA 4Z4FA 5FTNA 1X70A 3LUPA 1FFSA 1DV2A 1X7WA 4D99A 3N9IA 4OSEA 3WGKA 4D96A 4CEHB 2V1XA 2O1WA 4BJHB 3QBEA 2LZ0A 2KW5A 5E1OA 2XRZA 3IA7A 4R1LA 3ZOKA 2GOYA 1H6AA 1RC0A 1RRKA 5JNRA 2J85A 1A8HA 1DO2A 1N3BA 3I28A 3M82A 3Q3IA 3WP0A 3SMQA 1GPH1 3RRFA 2I2FA 2RAPA 5B1SA 5CH8A 3S81A 3V4RA 1ZRMA 3LPLA 3I62A 4G67A 1I6KA 1Q7BA 1YRBA 3NWPA 4MGIR 4K9RA 5DE3A 5LDGA 5G0UA 2YRXA 2C4VA 5CLIA 3S2EA 5KTPA 2QI9C 4NCIA 4Q1AA 4BVEA 4Y9DA 1WCV1 5K0BA 2WWXA 5ALSA 1G8PA 2H6EA 5AVQA 4K6GA 4PNEA 1XDDA 1YRQA 2VHTA 1TK2A 2XNDA 3CRZA 1CS4C 5IP5A 4FZJA 4RZHA 3UNXA 1V11A 2I87A 1SURA 4IHJF 4HYEA 2DHDA 3LX6A 4FDAA 1Q7GA 4LXGA 5FL3A 4YRRA 3ZNOA 2Y2VA 1QANA 3ET4A 3QVMA 1AE1A 2DPMA 2HA7A 3DEFA 4G81A 3RW9A 1HMYA 1YUBA 4Q18A 2GZ1A 1VYTA 1I0ZA 4MPPA 4IQ0A 1N8KA 1P2UA 1RQXA 3RSFA 1ORWA 1QCDA 2JIQA 4RF2A 3NIDB 4MWOA 4PAWA 4TWBA 1TCBA 4UXJA 3S27A 3FIUA 5F1YA 1GITA 3WRXC 5K4HA 5DXJA 4D4LA 5EJ7A 1CUGA 3C7AA 3L77A 1KY3A 3WKDA 3RVNA 4C05A 3Q8WA 3PIRA 1SXJC 1KARA 4C3OB 5A02A 3PTLA 4PCAA 1TEXA 2OXFA 1JLHA 1L7EA 3NUGA 2H4XA 3P0HA 2FZ5A 4W63A 3SZRA 4J6EA 2XVZA 4TKUA 4J1TC 1Z06A 3GEGA 4KTVE 3CS3A 4Z4EA 1EGVB 2Y27A 5TQ0A 1IHDA 1WY7A 2CLLB 2R96A 2XKBA 3JAWA 5JATA 4ASUA 1N25A 4KX5A 4YRBA 4OI1A 3UENA 4HNGA 3ADCA 3DNPA 1M7BA 4IZHA 5CIYA 2HLDD 4N47A 2CMHA 3SK0A 3Q98A 2WV7A 3E05A 3EUEA 4MP3A 2WJJA 4UW9A 1SUDA 1GUAA 5GZ3A 5KVVA 3RIYA 3S1SA 3LCVB 5EJGA 2WP0A 3JZAA 3EFEA 4IY1A 4KPUB 2NVUB 3RVOA 3RIEA 1KZ7B 2P3QA 3UWPA 1DXYA 3GRUA 1DX4A 1PR5A 1E61A 1GKLA 1YE5A 2KPOA 5I8ZA 3D4BA 3T4XA 4QZVA 4PHHA 4BUZA 3T7RA 3NWBA 3X3HA 3WB1A 1ESZA 2V9ZA 5CFPA 2XDYA 3BHJA 4A8TA 3EF3A 3MWLA 4DXHA 1ZISA 2PIAA 3ED5A 4FSHA 2YN4A 1QX3A 4MRAA 5A05A 1JFVA 1HE1C 3DD1A 3HZHA 1Q57A 3THWA 1UOEA 4CT4B 4OX9Y 2JEYA 2X0NA 3DMYA 3KKKA 2C3YA 2A3RA 3QIAA 3N2YA 4PF1A 4DEYA 3B5JA 2LUOA 3CWQA 3KOYA 1K2VN 3O8CA 3FGOA 4DDTA 3O95A 3QFTA 4ZIRB 3T3GA 2X14A 5E3IA 4RY0A 3QEMA 2RHBA 4RFVA 1EJ0A 1VHTA 1UQTA 1Z5VA 1KHTA 1B0PA 1KAEA 5FI5A 4BNGA 3AUAA 1II0A 1N6LA 5CEEA 1MHTA 2G72A 5B1HA 3ZTWA 4O2LA 1Y3FE 1OXUA 1Z0IA 4C0QC 2HREA 4G63A 5GVRA 4C7MA 1E1MA 1Z39A 3H6GA 2R86A 1TI7A 3IIMA 5DLPA 4MQBA 3WVNA 2M1ZA 2RSLA 1JQBA 1QX4A 3ESXA 2VSQA 1YI8A 5TT0A 3U2QA 5KNBH 3TRJA 3OY2A 3WOHA 3KXKA 4UHKA 1YZTA 3WLIA 2I6SA 1TVMA 5EUBA 3WIVA 4BBJA 4J3FA 4ARUA 4P5DA 2X4GA 3A9WA 4OYRA 4OJYA 2FA9A 4PWYA 5CA0A 2WWFA 1DUVG 2JHFA 4EMUA 1D4ZA 2N1BA 3ZNNA 2B6NA 2K7ZA 4B09A 3W2FA 4FFNA 2CUZA 4YJ3F 4GVXA 4X45A 2VYND 4B82A 1IK4A 1YKSA 5BSTA 2GCEA 3AG6A 2A9JA 2ZJZA 3GP5A 3W77A 4B8ZA 5I4KA 4QYSA 4BPBA 1NJSA 1PKXA 3T3NA 4LKOA 2YVAA 4UZEA 3OQPA 4WD3A 2IXDA 2V65A 1TKCA 2AJCA 1QMGA 2CUNA 3BWXA 3ET5A 4F38A 2FKAA 3KZXA 4WOBA 5B58C 1U90A 5K20A 4IZ6A 1VP9A 3T7JA 1U2GA 4XX0B 1UAYA 1E1YA 1K7SN 4XVQA 2MIIA 3DKPA 3NHLA 4ZC1A 3V9AA 4QM7A 4UEOA 1V9SA 2QD3A 3OFSA 5CW1A 3U9SA 1FMTA 5KYUB 1WX1A 4FPXA 4XYMA 2VSYA 1QP4A 3V97A 3EAQA 2JIDA 2P69A 3WGOA 3EDYA 3H9BA 1Z4OA 4P38A 5CYPA 4BTEA 1FX0A 2WVHA 1TL7C 4FYIA 2GLTA 4PLWA 3V7YA 4D8VA 1M1XB 2D62A 3RCBA 5LOVB 1G18A 4DLKA 2AG5A 2OD9A 4H3KB 1QDEA 3VJRA 5TQ2A 2MSNA 4RV9A 2AS0A 5GQSA 4FE7A 2IKQA 5TMPA 1RS0A 4QL3A 4ZVLA 4D9JA 1CUIA 1L1QA 3R6GA 4M8IA 3CLUC 2VQ3A 3D3EA 2VJAA 4EY3A 3HUDA 4BYMA 2WJVA 5EE3A 4BMVA 3PQFA 1GGVA 1YFLA 1CUXA 2AOVA 3NP9A 3NBXX 1XZFA 1NVUQ 5EZYA 2BZ0A 3PWZA 4DW8A 2R65A 3KM0A 4HGZA 3PUXA 2Q9BA 2GCOB 1L5WA 1L7MA 2FMXA 3SZGA 3G9QA 2QRKA 1QQBA 4NPAA 2HD4A 1A5TA 2Q2WA 3QXXA 4KIUA 1NVWQ 4NMMA 1XWIA 1G4HA 1RWVA 2AMYA 4DT1A 1N5KA 5FWXA 4CIVA 4QGSA 5INTA 3QVVA 1RAIA 2QY9A 2PUDA 2G70A 3A3NA 1K6MA 4NP6A 1D0SA 2JLCA 1J2UA 1XB2A 2PA3A 2KBEA 1JQEA 4QQRA 1R15A 2C8LA 3DVAA 5IAKA 4Z2AA 4JEHA 2O1EA 3KVNA 3RYFB 3STXA 1OX4A 2C97A 3ESQA 2IS2A 1KI6B 1CZRA 3CZQA 2GFIA 1NP3A 2OB1A 4RVDA 4PRZA 3SF0A 4CG1A 3K6SB 1CUDA 3HKEA 5AHOA 4CKXA 4DFDA 2VHVA 2DECA 3INNA 4JKOA 3DWGA 4LNHA 4BKOA 1CFZA 5BSRA 4WK2B 3ASZA 3DBOB 4H0FA 4AFNA 1H8EA 1N1EA 4W1PA 4KE6A 3T6KA 3N39C 1GNLA 3TVYA 4TMVA 3RSSA 3SVLA 5HNKA 2RC5A 1EG2A 1MJFA 1G5PA 1QIGA 4Q7MB 3W8NA 1T43A 3MBOA 1GY8A 4L7QA 3OD1A 4U39A 1MT3A 5JAIA 1SWVA 5ESXA 3R7WA 4OQPA 2QX7A 3Q8KA 1HDZA 2CEKA 2CWDA 2WAYA 4Q24A 1WTAA 3RODA 3RS2A 1YA6A 1IJKA 3I4CA 3O7MA 4WEOA 5BYJA 2P62A 4RMHA 1JNXX 4QQ8A 3SZLA 3INRA 3L7AA 1PFQA 1Y8QA 2M1XA 4ZQFA 4RDIA 4WBXC 2QSJA 1VC2A 4E33A 4ZPJA 5G0SA 4P4GA 5JYDA 3OFKA 2CLMB 5F64A 3PX7A 4L78A 4Q4HB 2YUIA 1HOTA 2EGUA 1R8YA 4TWZA 1TUBB 1S4MA 3E8SA 1KI8A 1TRHA 3BMOA 3O8OB 1HUQA 2QMQA 1OHHA 4KQMA 4R84A 4WTOA 3K6RA 4H6VA 5EIAA 3U7QB 4E5SA 1ZVVA 3K4HA 4LYAA 4DQLA 4AD8A 4WERA 5CB4B 4M88A 1WKCA 2ZBGA 4YV2A 1B8UA 1TO1E 2IYRA 1OWOA 2QBYB 1H65A 4LGMA 3CC8A 4N3BA 5H16A 4CBVA 1Q50A 4QYWA 4RPLA 3QKTA 1P6XA 4JJ7A 4ENVA 2HDNB 2K87A 5KHAA 3FCUB 3ZDYB 2H7VA 4F45A 3CJRA 3KUCA 4IDQA 2HRZA 2YV4A 3N0RA 1XTKA 5C53B 4M86A 4NBNA 4BX9A 1U5BB 1A9PA 3QTLA 5EJMA 5BW4A 4ARSA 4Q93A 3ZCRA 1NR1A 3ZIUA 2A2ZA 1LVGA 1XDBA 3BE4A 4GXTA 1SMKA 1ESEA 4GR5A 1ZC4A 5B1EA 1N1DA 2ZI3A 4GNKA 4M99A 5DKFA 4FIDA 4PCLA 4NBUA 2R4TA 5TRTA 1HLPA 1M10A 3B1FA 3IT1A 3GJTA 5FUMA 5IYZB 4P93A 4QOSA 1S1CA 3RU3A 3ORYA 3OIWA 4IYRA 4M3NA 4ARZB 1HR0B 4CDNA 4CN9A 4PG6A 4OQLA 3QYFA 1WZ2A 2VL7A 1CRLA 3L9WA 1JQDA 2RHDA 4FBGA 2NU9B 4MQFA 2OK8A 2WG0A 3GLRA 1ABEA 1ZGGA 1I0IA 4BVGA 2F4VB 3MTEA 4G1VA 2QQ0A 5IH3A 1VHLA 2YWXA 4M49A 1WMFA 5HQJA 1IUNA 1U02A 3H2KA 5FL7A 3TNDA 2OCKA 1PR2A 4FFDA 4IXTA 3AP3A 3TSCA 4I5IA 4F1WA 5IKXA 2AX4A 3OF2A 3K0AB 3RR2A 3WL3A 4XKJA 3L4JA 2XUPA 3QYAA 4N0DA 3CVJA 5K3AA 4MI9A 2F1RA 3ICPA 5IJXA 4N5HX 4JI7B 1YDEA 1SXJA 3WMGA 4D9IA 5ESRA 2E18A 4BEJA 2FJPA 2HRQA 2R7MA 1F8YA 2HMWA 4ZU6X 2X5JO 3UC9A 4JVLA 3WL8A 4ZK6A 3NHUA 5HK9A 1DJPA 3C3BA 1RNLA 4AI6A 2HJRA 4ZANA 5B30A 4O4HF 4M21A 2GK4A 5HIIA 4IPTA 1IBRA 2FPXA 4HDNB 3RJTA 2BY4A 3LUDA 4S2UA 4OQEA 1NATA 1E3WB 1IEWA 3WBKA 3BQ9A 1R0BA 5FXMA 1KI9A 2R00C 1VSTA 4IRUB 4BX2A 1P4JA 3B9PA 1QJ4A 4TKVA 4X3OA 3ZI0A 4G0QA 4JBHA 1VYHA 1GA1A 5ALHA 3SLRA 4D3XA 5HGXA 4CTKA 4CV3A 5FO1A 3HVUA 3OICA 3SDSA 3K96A 1RLOA 1F0NA 1XQYA 1ZINA 1CFJA 2MHCA 2ZSKA 2ZJAA 1OV6A 3CCCA 4PPFA 4MUIA 4IIGA 3UHAA 1ZESA 3TBFA 3VJLA 2GERA 4RKRA 3ZK7A 5HCUA 5A6SB 3WLMA 4ANFA 4D82A 1FZTA 3BDVA 1I36A 5J2UB 4AZVA 4RJLA 4EDFA 2YV1A 2BEVA 3QXSA 4EVQA 3FRHA 2HZBA 3WL6A 5ESWA 4ETMA 1UADA 4PAQA 5ALPA 2P65A 2V7WA 1E4VA 3F90A 3VC7A 4C0JA 1UBMS 1JJ7A 4UDOA 2JHGA 3C3CA 4BQFA 1M8GA 1G59A 1ZU5A 3WIBA 3OQIA 1USWA 4Q21A 3FH0A 3WJ7A 3GLHE 3AVYA 4QRDA 2O19A 2ZQZA 3ZHSA 2FOLA 4RYDA 4BJ1A 1HFEL 2ZIXB 3KOZA 5ED0A 4MA5A 1U99A 4B75A 1U3TA 4MVJG 2DKNA 3FFWA 5D51S 5E3JA 3JQAA 3AKDA 4F4DA 3FLEA 3ISVA 4EY7A 5ERXA 3OLWA 1N8SA 1PAUA 1Z2NX 4BX8A 1EWRA 1Z29A 2B7BA 2DUNA 4CM3A 2HW8A 3GW8A 4QEKA 1KAQA 4HDOB 4MYHA 1J2EA 3AFNA 4MAMA 2B30A 4CFYA 1NIJA 3OCCA 4XGRA 4JJ8A 3PR1A 2UXCB 3A1SA 3PJDA 4TSFA 2A5FA 1MO6A 1GFZA 2WABA 5C7YA 2D6FA 3HDJA 5EKSA 3UQZA 1ZUD1 1TZCA 2HDWA 4P82A 1TQ6A 2WMOB 1P5HA 2G4LA 4P4UA 2ZSEA 1NY5A 3U13A 5LMUB 4ZC8A 4QBFA 1P3DA 1SB8A 4JQSA 4RZXA 4UUOA 2H17A 2VCEA 3JQPA 3LDFA 2PGJA 2GM3A 3DOUA 4IR7A 4XUCA 2GF0A 2GXSA 5ALEA 1UWLA 3WJ2A 1SEVA 2IOFA 5J59A 1N6NA 1POXA 5ENZA 3MBKA 4K2AA 3ABOB 3QLTA 1ZCJA 2Q3CA 4FGWA 4TRRA 1XVUA 4URZR 2W0MA 2OHVA 3UW3A 5BQ3A 3TIFA 4PAOA 4DLXA 1Z22A 2C4WA 2PEYA 1RZVA 1YONA 3DFZA 3SSMA 2OHIA 3V7UA 3UPTA 1WDMA 1UJ5A 2R25B 3I3OA 1FP1D 4NAUA 3TGWA 3VYTB 3NTXA 4BBZA 8MHTA 2JCSA 2GF2A 2EDCA 2GCNA 3FIJA 2X0FA 1FJGB 2ZYSA 1H6DA 1YJXA 4MARA 2GK7A 4O1MA 1ZZGA 1C30B 4H08A 1DXHA 5FBRB 4D79A 4N9QA 3PXAA 1GV0A 1P39A 3UOAB 4XJSA 4YJHA 3ENQA 5SYNA 1JHRA 3TLEA 1OU4A 4FFLA 4ZHSA 2ZTHA 2R8OA 3NNNA 1U7HA 4DG8A 3KYDA 2C99A 3ENVA 2YVQA 3W6UA 3E61A 4YV0A 1FS6A 2R1TB 4MULA 1SVIA 1Z68A 2UVDA 2XMCA 2XIQA 2YOGA 4FCTA 4JEMA 3EWNA 3ROEA 3I2HA 4PO3X 5A4KA 1P74A 1KH1A 4DLPA 4DCVA 4CTNA 1ZRHA 2XNJA 4ONEA 2FDCA 5H80A 3E3AA 2IOHA 3N74A 3QLUC 1IVYA 4O02B 1HDOA 4AMVA 3DZDA 4F2GA 1NMXA 3ZWDA 1DWOA 2W2OA 2PUEA 1P45A 1QC5A 1U9CA 1J0BA 1XZKA 4QJ3A 3NGLA 5K8CA 4HLUC 1KF0A 2IYFA 1DC6A 4J91A 3ZQUA 4OLAA 4KR0A 2QVBA 3G0CA 3OD5A 5JSZA 4B6RA 1L9XA 3H11B 5FV4A 3GOHA 2JFUA 1TIKA 2HZ7A 4LWQA 3ZE7A 3F73A 3IUMA 3DW1X 3T06B 3GVHA 5LBUA 3AQ4A 1O4VA 5K01A 4BMSA 1UT8A 3QGMA 1VM6A 3R6WA 4IEIA 1AK9A 3SZMA 2OO5C 3O21A 2YWGA 3KQQA 3OWOA 4NBLA 1K27A 4KR3A 1O77A 3H5AA 3KTOA 3HN7A 3E35A 2D1YA 5DNWA 4FS8A 1SVLA 2NACA 3MC1A 4NE2A 3I9JA 1U0OC 5JPIA 3A6FA 3FTNA 4NY1A 4EW2A 5HQ3B 3INGA 2IF0A 3F1LA 2CHGA 1LV7A 4O4HA 1EFUA 2X77A 2Q5OA 4FMDF 2IX9A 4KW7A 4TL8A 2ONZA 5EZYF 1DRKA 3HBLA 3M33A 1RPZA 3OVMA 3THXA 3BSWA 2PYZA 4YDQA 2YWHA 3R6DA 3ZE9A 2ZLBA 1IULA 3K8QA 3MD0A 4C7OA 1FRVA 4CR7A 3BB3A 2RH5A 2ZUBA 4CDMA 4CNQA 4DPKA 1CZHA 1EFKA 3RUDA 4RA9B 1QIIA 3CV3A 5KQPA 3A3YA 2FJ0A 4QICA 3SF8B 3H4TA 3N8IA 1VG9B 3WNBA 2BUBA 5DHFA 3BIXA 4MB2A 1ATIA 1NRJB 4YAUA 2H1SA 1YFKA 2V0CA 1GL3A 1URPA 4H4CA 2DF8A 5ANRB 4IBOA 1YZQA 1Z5OA 1IAQA 3L6BA 5EMMA 5JYBA 5FEMA 2CHUA 3S2GA 1NRWA 4E14A 3L4KA 3A4VA 2NQ2C 4KE7A 4BFCA 1WU8A 4I36A 2BEUB 2PGOA 1QLHA 4IDCA 2V0GA 3S5JA 3OOWA 3EVBA 4WRRA 3NAZA 4FCWA 3MINA 2WIJA 2A92A 2EG9A 3PEFA 4I50B 2BHNA 2FQWA 3FWNA 4CIYA 4BJ5A 2ZWIA 5HF8A 4G5YA 5CBPA 2YTZA 5AW5A 3HWSA 1SCJA 4B4WA 1LPMA 3C14C 3HDVA 4MPTA 4EHIA 3QWAA 1PNRA 1G7CA 4ETWA 5ICCA 4L7VA 3F7NA 1I9GA 4IDEA 5ALXA 1JLLA 1RAEA 4JIGA 5EVJA 3LOPA 1NURA 1LVUA 2LPMA 4WFQA 3ZQ4A 4CMCA 5EJFA 4KREA 2QDKA 4JB3A 1G55A 1E3JA 1RPJA 1I51A 1TFRA 2VDVE 1NSYA 3RD5A 3GFBA 3T94A 4U9IS 4J4BA 2JZOA 3KJEA 5C4IA 2PSSA 3OH8A 4JL6A 2H07A 4DOMA 3W1WA 4KDFA 4PC1A 1KEPA 3IDOA 3LO8A 4XD7A 2BPOA 2QTGA 3ZV3A 1QH9A 3LC0A 2XQVA 4JJIA 4K1LA 3VZDA 1Z33A 2WJAA 3T41A 1XK6A 5C81A 3EGDB 2Z9BA 2P0EA 3I0MA 1GQ2A 4B4KA 1A77A 3AG5A 3B3FA 5E4JA 5IAGA 4DCMA 5EIFA 1FP6A 1SHTX 1GNSA 2VNJA 3I01M 4HOYA 4JUAA 4HDSA 4QPDA 5BMVA 3R8CA 4CQLA 4QQKA 1X6VA 3GN1A 3Q7SA 2GZDA 1GRQA 2B69A 4RY2A 4S0ZA 3RVSA 1MG0A 4JZYA 2XMPA 1UMBA 1KQNA 1NUUA 5BSGA 1QZUA 2G9QA 3ZWPA 2JF0A 1XFDA 3P9PA 3T5BA 2XEXA 4OD0A 3UO8B 3WA6A 2ATIA 4O1HA 4UQPA 4C0BA 1J9EA 3REQA 3BRWD 3SSAA 3TFQA 4WNAA 2TMKA 4YACA 1P9OA 2PJUA 3DR3A 3TQHA 2CHVA 1P9NA 2ES4A 4E3WA 5B7GA 5ITZB 2VPPA 3R74A 3TE7A 1O89A 1IWPB 3K0CC 1EP3B 4O4JF 2QLBA 4ON9A 1R27A 3HYRA 1KEEB 4G5HA 4C7XA 2ZVQX 4R98A 1XZQA 2FRDA 2P8SA 1ISJA 1RZUA 3LCCA 4DIMA 3BRQA 1ECJA 3H1TA 1BHO1 3C6XA 4C03A 2BEKA 1RQ2A 4BO6A 4IX9A 5IBCA 3IPAA 4M1ZA 4BS9A 3AFMA 4XQCA 3N6RA 1AX9A 2EFHB 4Y18A 4OLJA 3LFUA 3SP1A 4F93B 3OKCA 3MLEA 1OVGA 1WVMA 1M34E 4E15A 3N07A 1D2CA 4JWTA 1W9MA 3HU2A 2OOSA 3SQNA 5KC8A 3H8JA 1T2DA 1K6IA 1OW3B 5GJBA 2Q6VA 3GI1A 1UJ4A 1KQFA 2Q5LA 4HFRA 2PT9A 1V71A 4ZQHA 4L2IB 1JDBB 1AZTA 5AW1A 7ADHA 2NLOA 2D1SA 4W7SA 1KGSA 1DAMA 5IASA 5JWRA 2OMEA 5KJ6A 2AEJA 1E9BA 4NVRA 4M0MA 4D4IA 4DBVO 3DEAA 4B45A 4IVNA 4CFZA 2LXNA 3KNZA 4TTAA 1JAXA 1XKTA 3C15C 4U9HS 4Z99A 1QGZA 2IV3A 1VJTA 1LV8A 2WD9A 5DLEA 1LS6A 2QVXX 2R8BA 3EBLA 1CLEA 3OETA 4I1VA 4XLZA 4YUVA 6GPBA 1GLNA 3ZJ5A 1B2LA 4K9SA 4K5QA 1TW3A 2AVNA 2CB9A 1S6YA 4GM0A 4NBSA 4OSOA 2N1MA 2PKRA 2OVBA 3E8MA 3JD3A 1MXFA 4QTTB 5CVTA 1IN4A 3ZHCA 4C76A 2PJRA 3KLNA 2QR3A 1QH0A 3LNTA 3HCBA 5JC8A 3JASB 1IZ8A 1MOZA 3SIXA 4WE3A 1Y6GA 4ERXA 4P4LA 1LBHA 2GNOA 2L18A 2DBQA 4MP6A 3UAGA 5ERGB 3O8QB 5L3SB 4N18A 2XTAA 4YP5A 1Y7LA 4UTVA 2CK3D 4UCQA 1AS0A 1SXPA 1Z2PX 1PEYA 4IV8A 1JEYB 1Q5PA 1H1LB 3C5CA 3ZU6A 2B1GA 3AYZB 3MTBA 5CNIA 5BNTA 3PGVA 4COKA 4INPA 1I3MA 2CD7A 2O3SA 3AF2A 2RDMA 1W4CA 2AZTA 4FDTA 4M6WA 3VYWA 5FLXA 2CFOA 3IL2A 3RABA 1H9BA 3EDCA 4N5MA 4M1MA 1T9ZA 2BJVA 3KSRA 4U7FA 4IJMA 1GSAA 1YQWA 2F1IA 4GLJA 4PC2A 2E89A 3FRIA 3TMYA 3DP9A 1RXSA 5HX7A 2C61A 5EXTA 4O3FA 1OKKA 2C42A 1N3LA 3QUAA 3JZFA 2ZW9A 2JGLA 3DV9A 2RI0A 4PYQA 4U00A 3TDNA 3OTQA 2X15A 3WGYA 2VT3A 2ZIZA 3FXAA 3EGXA 3IP6A 4MV7A 3W04A 3VU1A 4BMNA 2C9ZA 4U5QA 2JI8A 3TNLA 1T5OA 3T7SA 3C8MA 3JYPA 1TQ8A 2J3IA 1KBZA 3KUXA 2Z95A 4S35A 1A8IA 3EPHA 1LPSA 2QGNA 4HDKA 1B14A 2A1IA 4MQEB 2VTDA 3ORSA 4COOA 1E58A 4TYYA 4WNYA 3Q87B 1T26A 3JQCA 3PYMA 1PYOA 4DUZB 4GPTA 1BH6A 3I1IA 1AUXA 3QPCA 4LJYA 4RQUA 1SCIA 4IHKA 4Y2RA 5LIPA 1WVGA 1OBHA 3PDHA 5M29A 4XQ0A 4CCYB 1QK4A 4DKXA 1NHWA 2HTFA 1UBCA 2GAIA 2HA3A 5CGZA 4XPZA 4QXMA 1J99A 1CS0B 2XOXA 3M6AA 4OGKA 4EUEA 1TGYA 1SKYB 2DFPA 4DSAA 5JNUA 3K5WA 2QLNA 3PNBA 5DNUA 4GSYA 1CUSA 3DB2A 3PC6A 2RJNA 3EEYA 2CLHB 1C3OA 1X7DA 2P3LA 2ZT8A 2NADA 1LDYA 1OAOC 1W2WB 3GEEA 4JYBA 3VR4H 4BZXA 4GMHA 2WVGA 3IAM6 1EA7A 1WNFA 2XRMA 3HVHA 3U09A 3GJ4A 4DR1B 3RVBA 4D3FA 5E1DA 4J2TA 3B3JA 4TRNA 4X9XA 1Y4AE 1HDIA 4WOKA 2O57A 3LVQE 3PPWA 3HJUA 2PZJA 3IRUA 3F2IA 3MS7A 1W4RA 4X8OA 3C16C 1R5BA 1WU7A 3OKFA 5BSWA 4Q4LA 1CPYA 4KPEC 3RVJA 4DAOA 1XZJA 2GPBA 3UVEA 5G40A 1UJNA 5ALGA 4JBGA 2W6IA 2P5TB 3HFGA 4UM9D 5BR7A 2VCHA 5JMWA 1JALA 2DUMA 4KBFA 3TLCA 4R2KA 1L1RA 1MQ9A 2DHCA 1KBOA 4WAUA 1TNDA 2WHEA 5FLKA 2F2TA 4DA7A 2DBYA 3CONA 1MCZA 4KH1A 2KSQA 4L4UA 1N2CA 1OYYA 1VOTA 1V8DA 1WUJS 2A5DA 3BRCA 1KYZA 4HH1A 3QFHA 4Q39A 1LKZA 1KTIA 1FFEA 3DXFA 3JATA 2AMJA 2QKYA 2A67A 3AY6A 3B1XA 4IRXA 3AGPA 1BKYA 4EEZA 2WSMA 2CXUA 3N8GA 2WQ7A 4ZT7A 5T64A 4B84A 2BMFA 2C2WA 2BJWA 5F1KA 3GZNA 1CY7A 2Z3VA 3D0RA 2FMIA 1CR6A 3WIDA 2ZI4A 5EIOA 3UHFA 4F2WA 1YR1A 4IDOA 3EIWA 3CF0A 5DPMA 2FWNA 2EKLA 5BW8A 5KJFA 3K32A 1KAGA 2C7PA 2E49A 2CHEA 4P7FA 3VNQA 1T3ZA 3AY7A 1MGPA 2P6OA 2C59A 4QYIB 3TLZA 1F8FA 3UG7A 4OHKA 1E2NA 4KXVA 3TSOA 3LTNC 3BDIA 3UYLA 3VVCA 1P44A 4IJWA 1PS0A 4TLCA 2V6JA 4G5XA 5T7BA 3LS2A 2VTBB 3MCZA 3NDBB 5FIUA 5ENVA 1OXSC 5LPNA 2KI5A 3G8BA 1A2BA 4EB6B 4EO9A 3W5BA 1WR8A 3WAJA 4F3TA 3ZV4A 2J3MA 2MSDB 2PFKA 4EHDA 1X38A 4L8GA 4F4IA 3H6KA 1QM5A 1X9HA 2WP8J 4JVSB 4PRKA 4ZVUA 3FBTA 4DLVA 2O5RA 2GYVA 5DDIP 3AEKA 3ICOA 1ZVQA 1CQIB 1ND6A 3E22B 3OY7A 1DB3A 1NUPA 2ZCUA 1L5YA 4PYOA 4ZV9A 1Y48E 2WD7A 3WLSA 3GX1A 4MR9B 3TW6A 3R0IA 5SYMA 3SXUB 5HF5A 4F8EA 2QRQA 3ZDZB 4X8MA 2YQ4A 4MUYA 3PR3A 3ZG6A 2FF5A 2FZCA 2NYAA 3PNKA 4M7WA 4RF3A 4ZODA 3TSWA 1KMMA 4NPCA 2WYHA 1O94A 3DUFB 3GVPA 1BWPA 1R3UA 3R3VA 5DM4A 4CLOB 2XZLA 1II8A 2FW0A 4JP1A 1GUDA 5DM1A 3SQLA 5JZSA 2MWMA 4IHJA 2B1QA 3EVNA 1CQJA 2F9LA 4HAYA 4QPJC 3FWPA 4BNDB 1V6AA 3ZD8A 4BU1A 3QVJA 1CY1A 3GJQA 3JWIA 3AZPA 3BS4A 1PGNA 4P1ZA 3U4QB 2GNPA 3VC2A 2I3AA 4LZOA 5CP8A 2EXXA 4PXYA 4Z1MD 3WSTA 1C0KA 4HAWA 2FVXA 2XUGA 2OENG 3C3YA 2QDXA 4UEJA 4XDHA 3TL2A 4YPOA 4U3JA 4C3VA 1HDGO 4NC9A 3USES 4HWPA 2P6RA 1QNFA 2YWDA 2NN3C 3ND7A 2BZGA 5HXAA 5IJZA 1J09A 1R4NB 5CAEA 5FA8A 1HFWA 4UE2A 1QGOA 1KYXA 4LYHA 4RVFA 3W5UA 1RRVA 2FX2A 3IIKA 4M54A 3D64A 1XCLA 4H6XA 2AEFA 2APJA 2C03A 1YGPA 4WBNF 3AFGA 3DCYA 4RPIA 3WISA 2Q5JA 1DSSG 1Y1KE 2DBZA 1L5VA 1RCUA 1VI6A 1NJ8A 2HBRA 3G85A 4HPXB 4WUTA 1T4GA 2ICAA 5LA6A 3TZBA 1A7AA 1PS9A 3ZDDA 4KJZA 1A71A 1Z4NA 4R2MA 3DO6A 1ZL2A 1F14A 4NH0A 1CEYA 3FUXA 3RAPR 3PDJA 5K3DA 3RJ9A 1NJ1A 2IEIA 1GL6A 3PUZA 5HGJA 5LC1A 1W9HA 2HJSA 1ZXLA 4RHFA 5BV1A 3KQUA 3IODA 3MMXA 3QX8A 3GRVA 4ZVTA 2HLDA 5GGXA 1N0HA 3QQ5A 4IG9A 4MSUA 3Q3HA 1LTKA 3AHEA 3PYXA 4WW0A 5LU9A 1KS2A 2DFNA 3JPYA 4P8RA 4EKEA 1V11B 3WXBA 4MUAA 3BIOA 3EOZA 3W05A 1F20A 3HG7A 4W99A 3W3AD 4R7ZA 4DPMA 3MWFA 1J39A 1EUZA 2JAQA 4ER5A 4JXKA 3FUVA 4PO8A 3WO0A 2OXRA 1GL7A 3AEXA 2CL7X 4ASUD 1F06A 2PO7A 3PUIA 1FK8A 1D2GA 3AF6A 4Y98A 3SHTA 3M4XA 3HCAA 3I9MA 5TV2A 1CSEE 2H4HA 2IIBA 2OZLA 3EVEA 1GKYA 1J7KA 3AJDA 3I9FA 2G4VA 3MTAA 3P2EA 5CYOA 2PZFA 2NUBA 4H1TA 2G7MC 4LMBA 4BGEA 3AX6A 3PUYA 2Q3EA 3V2IA 3TKAA 4UHDA 4XFDA 3A1WA 4J2OA 5JO9A 5CGQB 2ZQ5A 4N40A 4RD3A 221PA 4QXAA 4Q15A 3D54D 3G9UA 3W2IA 1GPLA 1PR9A 4X7MA 2GBGA 2D0PB 3N28A 1IE3A 4IIBA 5E38A 1R9GA 4J43A 4TKUB 1E89A 4OA8A 4Q0MA 3WNDA 1T36B 5IEJA 2A9QA 3JD4A 2JAXA 2XWQA 4LHZA 1I4OA 1RZ3A 3DKIA 5HJ5A 2QUJA 2B35A 5JU6A 1BCSA 2HUPA 3LV8A 1JQLB 4I0WB 4MYRA 2VVTA 4JC8A 4OHXA 4EI8A 4E51A 4QBHA 1EVZA 1GFWA 1F6BA 4G0YA 4Z0TA 1KNQA 1W29A 1PHRA 4RACA 5HFJA 2RGBA 2VAPA 4NENB 5L45A 3UK2A 3BWDD 4EQ6B 1XPJA 1NLMA 2HQSA 3HRIA 4I4CA 3DE3X 1XOIA 1KFKB 2ZPTX 3SYRA 1ULAA 4BL5A 5CB6A 3KLPX 1G19A 4Z3OA 3ZU5A 5LZ8A 1W5BA 3C3KA 4Y6LA 5SZJA 4BRZA 1A8UA 4KO2S 1Y5NA 5AUOB 2NV0A 3P9RA 1TXGA 3A3KA 4KWTA 1SKQA 4OLHA 1DL5A 1FOEB 1PZGA 1JTEA 1O94D 5CT8A 4IWYA 3I6ZA 4BZWA 1ZAKA 1PFYA 3QOFA 3PZBA 3QE4A 1CKEA 1LU9A 4MIEA 3E1KA 1DQRA 1JECA 1BEEA 4PU0A 3H65A 4O5AA 4X1IB 3PFCA 2V7XA 4UNNA 4CV2A 4D8TA 4CMEC 3N1UA 3KOMA 3PXDA 2BFBA 2CCKA 3JQ7B 4U0JA 1O6CA 4R0NA 4PLGA 3DV2A 5AXDA 2NO0A 3T1QA 1UFOA 2NVOA 5LYJB 3ICEA 3LYHA 4EAQA 4JS0A 3DFIA 2F55A 1MMFB 3CUKA 2FYTA 2AG8A 2FY8A 4B8YA 5BSFA 3BIJA 1I3KA 1KYTA 1NAIA 4RSRA 1GDHA 5TLSA 3UJBA 1QLWA 4WY8A 4YYZA 1DEHA 3D6MA 4TL6A 5DBGA 5KQMA 5C5DA 2O3TA 4ZOLA 1SHJA 4P22A 4J16C 4BJ3A 2ZR8A 2IYQA 4NBRA 2QTWB 1MTZA 4LJKA 4JFAA 2DBRA 4ALMA 1RE0A 2X23A 4IJ5A 1ULUA 5KNBD 1QOPB 3ICQB 4YMWA 2JJ1D 5I7OA 1IH8A 3WR5A 5HJ7A 3GBVA 1PUXA 2HSWA 3QENA 4NSNA 4RPCA 3EUFA 3GDGA 2V59A 3DZKA 4HDAA 4JK3A 3F9RA 4IUDS 4JUBA 4P5EA 3KAPA 3NHMA 3M6IA 1WG8A 2QTMA 2PAFA 3K6JA 5D5PA 2PM8A 1CJMA 3IEKA 2BF7A 1NYQA 2QNRA 2DQKA 1S96A 1ZK3A 4YCNA 4XWKA 1JI0A 1NSFA 2Z4SA 1BROA 1GARA 1NI4B 4Q7JB 4JBNA 2L69A 2Y1XA 2OCGA 2G04A 3T12A 4LDJA 1VRCA 4DJTA 3VKGA 3I72A 1KA9H 1ZWLA 4CZ2A 1R0LA 1ML3A 3DMPA 4NKRA 4RIEA 4X6UA 4X92A 1HE8B 3TZHA 4ZV7A 4MUEA 3D0OA 3MGBA 1WQ3A 3LCJA 3WE7A 1E2LA 4OQFA 4LCEA 4RKQA 1IIRA 2YFHA 4BLPA 2WICA 5HKLA 3G1TA 3TTYA 2DWUA 1QIDA 3AP1A 1OPRA 2R8RA 4KE9A 4B6GA 1J0XO 3MT7A 2H2IA 1CC1S 4YALA 3W1EA 4FP9A 3Q72A 1DBQA 5B2EA 3MGGA 1K7EB 5FA6A 5EJEA 3UA4A 2CXNA 3AESB 5C1PA 3KSZO 2I22A 3WGQA 3VAZA 4MW9A 1M2OA 3EGIA 4W5WA 5E6RB 4B79A 1JFSA 4IIVA 1ENPA 1TUIA 3BBLA 4HQRA 4RKEA 4YRQA 5DV9A 5E6SA 3T0GA 4OP2A 2Q45A 2BTQA 3S99A 1U9JA 3WMRA 2IEZA 3ZLBA 4Z4GA 1A4IA 1OIXA 2QZ4A 2EX1A 1BJKA 3FB4A 4TXLA 4RTLA 4RTMA 2F3RA 4Q9IA 1UBFA 3LMKA 4N8SA 5WRFA 1HDYA 1IB6A 5EZ6B 1QHGA 3RUEA 2C9CA 3K05A 3VO1A 1T5LA 2ZYRA 1E2KA 1FQKA 1UBKS 1A7JA 2CVHA 1QR2A 4L28A 1UXOA 2FWRA 3TZKA 1Z4JA 4PEVA 1BOFA 5IKPA 3ZBTA 4F9GA 4K0KB 2IFTA 2JIRA 3SIPA 2UVPB 4IMPA 3B1KA 1SC3A 4OJTA 5K6AC 2E3JA 1AQJA 1EUDA 5PNTA 4LHVA 3S4YA 3GJ3A 3FDJA 2V55B 5BN4B 4DT1B 5FWXB 3HO6A 4YJ2F 1BVRA 2JI6A 2UZ3A 1Q2XA 3KOXA 1KRHA 1ZDMA 2M6LA 2QM0A 3RS4A 3OU7A 2BFEA 1AO3A 2K2QB 5FH9A 2H18A 3CVXA 2UZ1B 2ZITA 2HMSA 3F96A 4TMKA 2QPTA 1IY2A 2ZRDA 4FX5A 1TCUA 1KORA 3GCZA 3K30A 4QULA 3QNWA 5A7HA 5FEUA 2RGNC 4A6DA 4GICA 3DVQX 2PN1A 2WJGA 3OAAD 5I7UA 1PP4A 3Q9SA 4MOWA 3WHKA 1RPNA 1XZDA 2JAWA 1UBHS 1I4DD 1P19A 3K6SA 5KIAA 4NBKA 1GEEA 1A97A 4KO4S 5AW0A 1K6JA 3DAGA 2LIPA 4OBEA 2ID8A 4IIFA 4PSKA 3UHOA 2P9JA 4M4SA 1C7EA 3O8LA 1P91A 2W2LA 3HQ4O 3PQ2A 4NG4A 3QI7A 3B82A 3PC7A 2EX0A 3BEDA 1XJCA 3WMWA 2BFCB 2Y66A 3O82A 1YMUA 4Q1VA 3ZZ1A 3VR2D 3H7AA 4LOHA 3HDYA 5JDCA 3EISA 1ZN2A 2XRFA 3IKTA 3R7WB 3RROA 2I9KA 2RHMA 2J0UA 3IO5A 4M1SA 1F2VA 1NMZA 2ID4A 3K70D 1XN4A 2WT4A 2FI1A 4G2NA 2ZB4A 4C4YA 4NG5A 1XZPA 2Q1WA 4K46A 4YRKA 4IDHA 3PHHA 1P7PA 2QMZA 3KZVA 2AJLI 1QDLB 4UFOA 3L0OA 4CKEB 1QPGA 1ADFA 3F74A 3TLGA 4LDAA 2QVZX 3REOA 1G2IA 2DAPA 3I1JA 2DLCX 4UHJA 4DWJA 4UTNA 3HP7A 5JNWA 3MRSA 4HZUB 2C54A 1ZMBA 2J9YB 3PQ3A 1NONA 4WLNA 3OX1A 2R44A 3VKVA 4I19A 4B71A 2EW8A 3FWZA 1Y3DE 5FL7D 4EPWA 3L8ZA 3PVCA 1T3TA 3COVA 3KYCB 1FVXA 2ZULA 1T1JA 4ND8B 1C3VA 5KU7A 1UMDA 5HRAA 3Q5EA 3ECCA 1PL0A 3BCHA 4ESOA 4EPVA 5J58A 2A59A 2RE8A 4GH5A 2FUKA 5EHIA 4G0VA 2C5FA 3Q6NA 2BTEA 3H5IA 2D0IA 2E5LB 4GF5A 2CV2A 2OBMA 2HXSA 3B1VA 4IOLA 2IQ5A 1ISMA 3T1HB 1RI2A 1OBVA 2VJCA 5E3HA 4N8EA 5IZ4A 1IZ0A 1RSZA 4RWZA 2P0YA 3EEFA 3HP1A 4WXEA 1K89A 3JU3A 5EINA 1RBMA 2XGSA 5AM3A 4C6RA 1SUWA 5KYTA 3C8DA 3L84A 4KRFA 1L2TA 3JD2A 4AY4A 4UVDA 4N6OA 3PD0A 4FBMA 4AIRA 4RH3A 5EIWA 1DQNA 5GZ1A 3OZCA 2ZRIA 5TARA 3ZY3A 4A9AA 1WKBA 3W9YA 4BCBA 3NAMA 3CH4B 4UXHA 3D0KA 3SQOA 3DEJA 1F17A 2QAGC 3MWJA 2CL0X 3V4FA 3WDMA 4NJMA 1ZICA 3LRPA 1SKBA 3IESA 1OC2A 3MJFA 1N6IA 4YREA 1HKHA 1NF8A 3CEMA 3IURA 3EGWA 3LD9A 1VYUA 1WULS 2YW9A 2ENUA 1TK3A 3G82C 4QHYA 4BGUA 4N0EA 4JHXA 1BE0A 2E6KA 1ZU4A 2PQ0A 2QRVA 2YHSA 4KRXA 4AY3A 3ITEA 1XALA 4WXMA 1Q1GA 4MKHA 5F52A 4LJSA 3JQ6A 1W88A 4F46A 2OQ2A 1C29B 3QPUA 1WOYA 1GNVA 3LLSA 3OPYI 4PSDA 3WLRA 5JHGB 3B12A 3IEXA 4LYJA 3T3OA 3DYIA 4HJXA 4DS3A 1EVKA 4DJAA 5B3LA 4M9CA 1JMYA 1WDLA 1LDNA 1NYLA 3GEPA 4L07A 1GG2A 4DV3B 5F73A 3V34A 1HETA 1QBGA 2YJZA 3NOVA 4OYLA 2BHRA 1Q0ZA 4UATA 1I2CA 2RHWA 1P4GA 2C4KA 3AERA 3QE2A 3U3XA 4BO7A 4YHHB 5KOJB 3JQAD 1RW4A 2JCYA 4RFSA 2ZYAA 3JZIA 1T0JB 4MI1A 1TYEB 1XTVA 2IELA 4XQ9A 4M9QA 4DXDA 2DPYA 1YB7A 3EC1A 4IS3A 5JRDS 5H7XA 3UTCA 2ZR9A 4HK4A 2ZI6A 3WY9A 2PKWA 3GFQA 4X44A 2EF1A 4BE4A 3QVGB 3IEMA 4JI2B 3KTFA 4FX2A 3AVWA 1JU9A 1J90A 3VISA 5AVZA 5AD1A 3ZVMA 3GMIA 2IPMA 4ENWA 1DQPA 2PK3A 2O14A 4TQGA 5F3DA 3MM4A 1A9ZA 1PJLA 1WXQA 1Y3CE 1M1ZA 3H6HA 2JH3A 4IGFA 4DABA 4E2YA 1G8SA 3UH0A 3NX4A 3KTAB 1I0LA 5A1JA 1CYEA 5KX5F 3B13B 2VWGA 3K0CA 3K9CA 3BSYA 1MX3A 3O03A 4AZWA 3I01A 5BUCA 2UU9B 3CLVA 3RHFA 3OX2A 4FW9A 2W2LD 3O4VA 3PRJA 1FFWA 5KCZA 3AXSA 2RGXA 3DBRB 4RD0A 1PDWA 5IKEA 5TPWB 3FHTA 1QG4A 2ZU0C 3O26A 1WBBA 2WFLA 1X8XA 2NUPB 3E7WA 3K1AB 2ID9A 2AHOA 3P0RA 4WBNA 2KX7A 3JTEA 5I5EA 2QQFA 1DOAA 1M6NA 1SVMA 2BP7A 3C45A 3RC9A 3T5AA 5L6LB 4JV5B 3EQ8A 1M6YA 3HA3A 1BTOA 2G40A 2H0AA 5TF4A 2JFXA 5JQGB 4I1OA 3J81k 1NE7A 1C2YA 4V38A 1OHHD 3M4YA 4MEAA 4UBKA 1TCCA 1DLIA 1W85B 4Y6PA 4J0CA 2F64A 2OORA 5CA1B 1P7ZA 4KV9A 2R8ZA 3IBGA 1JTFA 3ZE0B 4MRNA 5IM4A 2RHJA 1QAOA 2Q3HA 3P0JA 1BU5A 3NCTA 5JSUA 3A9RA 3OUTA 4NOKA 1YS4A 2H3EA 3ETCA 4P58A 4W5RA 1YZFA 1NMEA 5DB4A 3AL0C 4V24A 3DC2A 2OKGA 2IYVA 4KAXA 3SHVA 1KEUA 3IB6A 4PTZA 1K5HA 1B43A 4CKCB 2AFHE 2JATA 3QU5A 1X8KA 4YGXB 4ZP1A 4TROA 4CKWA 3U60B 1T8YA 3PFBA 1NP6A 3I04M 2P2ZA 1XZBA 2DTXA 2G82A 4L5IA 4M0FA 2WB2A 2BBOA 1C3LA 1VKHA 3NATA 3HZOA 1JHMA 3ZWWA 3K0FB 1JHAA 3IMFA 3R09A 2OSBA 4MPRA 1XVTA 4RUKA 4BOYA 4QWMA 5CFZA 3D0QA 1U8EA 4E6EA 4ZRMA 1JG2A 2ERCA 4ZTZB 2ZJ8A 1ZW1A 2HWXA 1Z5NA 2HM7A 2FEXA 2UUBB 5I7VA 1B26A 4F1JA 1J2RA 3O8BA 2WHRA 3P4UA 2UYCA 3A37A 3UCXA 2QX4A 2EP8A 2R751 1DAOA 3A4MA 4RTQA 3AOEC 4B34A 4F84A 2P2LA 1LK5A 1U8YA 5A4FS 3GPDG 2CJWA 3MXOA 4W1QA 5KS2A 1AUPA 4U7GA 2OUKA 3M6VA 3U4DA 2PT7A 3DTTA 5ECWA 2AH5A 3KQSA 1EZZA 2TMDA 3O94A 3G0HA 5FQOA 1F4VA 3C98A 3I0NA 5ARDA 1X87A 4ZI2A 4OAQA 2XSZA 5BSEA 5JS1A 3AKEA 2GHTA 2Q6KA 3QFRA 2G6BA 1LPOA 1SHZA 3HYCA 4F60A 4R40A 4P92A 1OLUB 2XYPA 4L6IA 1DC4A 1Y4SA 2GN1A 2WJWA 3GJ7A 3H0CA 3LX5A 1S3IA 1AHHA 3ORRA 4IXNA 1K7YA 3ZVRA 1DTWA 4RFLA 5J40A 5JAQA 4AZ0A 3H17A 4DMKA 3VPSA 3N5KA 4MB6A 5CVEA 3TGLA 5FI0B 3EPJA 4B3MB 4YJDA 3S2YA 1ZNQO 2WZDA 4MWEA 1G63A 1LX7A 2FR1A 2NZYA 3BOSA 3O3OB 4NE9A 2EHJA 2RHOA 3IUSA 3NZEA 3OG9A 2P4HX 1C9JA 4RV5A 4D0NA 1J5EB 3MHTA 1P75A 2OD7A 3BJIC 1WD7A 3EWIA 5GONA 1GIAA 3C6KA 4FR0A 1PEAA 4IUBS 5IDQA 5JTUA 3HL0A 1IY0A 2GTPA 1LX6A 4RHXA 4A1FA 4YROA 1KC1A 1SBTA 1UXKA 2RG1A 3F8TA 3KE9A 4HAIA 1QS0A 4TX1A 5T41A 4BO2A 5KTMA 4HL6A 1WHSA 2VCYA 2YWBA 3RYTC 1RRMA 1ODJA 3ZS9A 1BDHA 1U63A 4L1KA 1QO7A 1K4YA 2FSGA 4GRIA 3S44A 8ADHA 4FWTA 1I94B 1AG9A 5M7EA 1VBKA 1KDYA 5J3JA 3CZAA 3QVXA 4CMAA 2X6QA 1EI9A 1ZOIA 5EJ4A 2D3WA 2YRWA 2PX8A 1N2HA 2J4DA 2B21A 1JG1A 5EZSA 1GZDA 4R41A 3NKVA 4Y2UA 4FLEA 4C7JA 2B78A 3PNSA 3AR2A 2XWJI 2FMTA 1CIPA 1HZZA 1G7RA 2QT1A 1QYWA 4QXQA 5BWMA 3KSAC 3NPAA 1UBGA 1P3Y1 1T4CA 3EMKA 3LZ6A 1DI0A 4XGIA 1HQDA 1WHTA 3D6HA 3ZVNA 4P2BA 4EPXA 1OIVA 4KODA 1G3IA 5CW2A 5B12A 1IZYA 3OP1A 5HRCA 1J6UA 4TT8A 2I66A 1R12A 3A6DA 5DXFA 1YS7A 1Q91A 5CX4A 2PMCA 1N92A 3FYUA 3ONFA 1W5EA 3N2IA 5JJCA 3S28A 1QOZA 5KQLA 1E8NA 1SU6A 2O2IA 5LQSA 3U19A 4BRWA 5L7WA 3NS7A 3VU8A 4R9SA 2B1JA 4K2HA 4GX5A 5AT1A 1QQ5A 1Q0RA 1R0SA 3ETHA 3CPSA 4QDOA 5DH9A 5A06A 3W3AH 2OZVA 4F92B 3L6OO 1PJ3A 3DM5A 2FSIA 5F98A 5G53C 3JQRA 3UTDA 4QBGB 1UOOA 4LRXA 1WB5A 3E7XA 1ULTA 4IFEA 1BMTA 3BG5A 4PC6A 3OKAA 3LBFA 4EHHA 5GM1A 4UMVA 5IJ0B 2QV0A 1QZZA 1DVRA 3CR8A 5DM60 4GX2A 4UE6A 4KQHA 1MV5A 1Z26A 1CJBA 1XTTA 3GJ5A 3SEZA 2ZT7A 3F3SA 1YD7A 2PX0A 1B0ZA 1C8LA 3HVIA 2Q0HA 2Q3LA 4MWGA 1IWOA 3IKLA 1YBFA 1G5HA 5KYKA 4I4TB 3DTNA 4EYQA 2VZLA 4QARA 4P0PB 2QTBA 1I32A 3CF2A 1D0VA 4QLAA 3IDQA 3SHQA 1V4VA 4NXNB 5JJBA 4NFSA 2CBZA 1I7QB 4QFDA 1YIDA 2YRFA 2Y0DA 3U6BA 1KI4A 1PDOA 5JAUA 1C1HA 3NUZA 3T9FA 1G8HA 4POOA 4YX9A 1M3SA 1V45E 3SC2B 1SOAA 3VR6A 2P3SA 4MUBA 5TPZD 3L3BA 3Q7IA 1K0UA 2SECE 4M0UA 4XGNA 1FTGA 4R8VA 4MV9A 1EIWA 3EGDA 2O7VA 5EJ6A 1J8VA 2O8CB 3FLMA 3DC7A 3B6EA 1KDZA 2O8BA 2QJTA 1M7GA 1PUJA 2OZKA 1UDXA 4NJOA 5ALJA 4EFNA 4Q4CA 3IMCA 1IYZA 3COYA 3N2KA 4JQYA 2OV1A 3G49A 5JD4A 3R40A 4LX0A 3TCXB 2HK6A 1W4AA 4GP6A 2XX3A 5DGCA 1CR4A 4LXHA 5AK3A 5DX8A 4WN3A 1PLLA 2B20A 1O1YA 2E21A 4CXMA 3S70A 2W2XA 3P4XA 5LXTF 3EFOA 1SD1A 4OFZA 2IBSA 1FVHA 3UUEA 1HT3A 3MPOA 4EB8A 3UAXA 3BMNB 1JXQA 1Z5ZA 2VJQA 3CNQS 3HDHA 4FYHA 1I01A 1U3WA 4A0QA 1KJ8A 5EE9A 4M1QA 1ZK0A 1O54A 1A9SA 1U2TA 3ETLA 1PJBA 1WMSA 3FPBA 4Q9LA 2Q7OE 3VNAA 4RULA 1BXGB 5LSAA 4BAUA 1JEEA 4BVAA 4FONA 3UBTA 2VNIA 4LJRA 1VKNA 4OQQA 3Q40A 4TTTS 2PMEA 4PFSA 3DLHA 1DEAA 3OFVA 4LFAB 2HF2A 1ONPA 4CIWA 4Q3KA 5IABA 2DSTA 1LTHR 2WAAA 3V46A 2QJWA 3U7IA 3JXEA 2BDUA 2IIQA 1NOIA 3IRVA 3C7KA 5GINE 1J2JA 5KUTA 3WADA 3ZGVA 1ITZA 2E6UX 3CW8X 3GNSA 2H59A 3OTGA 1L7QA 4S24A 4CV0A 2Y4OA 5E4FA 3TIIA 3DMTA 3L6RA 2PUAA 2I1WA 3E27A 4PV7A 1HNWB 1T15A 2ZE5A 2IUTA 2A5GA 4YR9A 4PAGA 4L2IA 3HY6A 1QGUA 2A9FA 4FCVA 4HUQA 1QIFA 4GT1A 4K87A 3V80A 3GRPA 1JIKA 4J94A 2CLOB 2FZ4A 3KWFA 2GTIA 3PS9A 4F9TA 3ESYA 1P7CA 3FMPB 5CLLA 5L3QA 2W2MA 4Z54A 4DSUA 2QPAA 4PG5A 3ILYA 5CHYA 4OQXA 2WIDA 2SCUA 2WV9A 1TZBA 1UPXA 2BLLA 2HHCA 3N2NA 4MVJA 5K8JB 3WYDA 2D59A 2ZYHA 1OF1A 1E99A 2UDPA 5DTEA 2IXEA 3N2ZB 1GN8A 2NT3A 3OQHA 1VHQA 4OXNA 1V16A 2F67A 1NDHA 1XZ8A 3CXRA 3TD6A 2ZUCA 3M2PA 4B7AA 4KN5A 4MEJA 4OTZA 3T4EA 5A3QA 3ZU4A 1V1MB 4Q9NA 3PWKA 1OD6A 3M6FA 3IMGA 4YQYA 4DZZA 1NNEA 4DLRA 3H0EA 1NJGA 2Z58A 1X7YA 3RFVA 1SBQA 1O95A 2G80A 3UT0A 1A3CA 1XP8A 4L95C 4LVNA 4NYJR 3X1DA 2IEAA 2OB2A 5JNTA 4DIKA 5ALKA 1KZHA 4JBWA 1IHXA 2HPVA 2AOTA 1FJHA 2HA0A 4QU8A 1ZNYA 4BFSA 4XVCA 4M37A 4QA9A 5LQNA 3D3WB 3M3DA 5L9AA 3F6RA 5BURA 2HOQA 3H1GA 3LZDA 4QREA 5LP6B 2VZEA 1L5QA 3KZMA 2POQX 4RH0A 4IAOA 4S1TA 3TDKA 3KZ1E 4EL0A 1Q3KA 1SG6A 2O48X 1TF7A 1NJ2A 4HDMA 2ZBRA 4HQ0A 1VJ0A 4LXYA 2I6UA 5FADA 4OX9B 2VSXA 3T4PA 1XQ9A 1G21B 2QZPA 1WY5A 4JVOA 1EHIA 2NWQA 3DEZA 2NVBA 3B6IA 2PZMA 3C3EA 4DUYB 2H9AA 2IHZA 1EDOA 3W8DA 3WX0A 3RGWS 1L5NA 1R6UA 2OV2A 5TX7A 4UBMA 4GR4A 4OF4A 4NQRA 4WX2B 4ZO8A 2XUKA 2GFHA 4H60A 2RHHA 5C8YA 1TF5A 1J20A 1KR2A 3W6PA 4DBLE 1PT6A 1AN0A 4DMMA 3NDIA 4JLSA 4C87A 2QMYA 3CT6A 3BFVA 5IULC 2QA5A 3LDUA 4ED9A 3Q8LA 1KQ3A 3FYHA 4XARA 1VKZA 3FHCB 3CVUA 3CSUA 4PQFA 2R8EA 3WC4A 1EVLA 1TK9A 1JXAA 4KQKA 1PFWA 2Z5GA 3ZCSA 3VZRA 3G2QA 2R1ZA 3R41A 4IVPA 1XELA 2QZJA 4N82A 5IXYA 3KHUA 4GRAA 5JASA 1PL7A 4UTXA 4QHSA 5JR3A 4KQCA 3STWA 2MYUA 2OCPA 1USGA 3EXEB 5BNIA 1JE0A 3WYBA 2COEA 4RY9A 1ULZA 1RAAA 3C3PA 2XAAA 3OO0A 2EJTA 2CZQA 4BWGA 3EPLA 2XKKA 1ZD3A 3BK1A 1W8DA 3D3KA 4QTZA 4CCYA 2XT0A 3K2BA 4BV2A 2C4MA 2JCVA 3F67A 1CJTC 1DKPA 1JG6A 5J5VA 5BO5A 3VDMA 4YRAA 4WJLA 4JSYA 1Q19A 4MMXB 1KIAA 1XROA 5JSHA 3QPDA 3OEEA 5JZ9A 1D6NA 2PCJA 1ACLA 1CY4A 1G0OA 3ZWMA 2DWPA 1J2TA 3IILA 2GJSA 4ABYA 1LNQA 3OI7A 1BU8A 4YRNA 1M1YB 2FMUA 3BFXA 5FR2A 4J7AA 2VO1A 4OYHA 2WWHA 4N3CA 4WKOA 3RBZA 4QXOA 4WI1A 4JJZA 1E2QA 2I7VA 3QBTA 3T61A 2X7XA 3K70C 1YMQA 3DE2X 4JB8A 5DHQA 1GZVA 3DGFC 1FBTA 4EF6A 4EI9A 2XNKA 5JE8A 3ISTA 3UMCA 3DPSA 2DB3A 2C1EA 2W4QA 3SEFA 2GCGA 4XIGS 3FCEA 1F0PA 4LWOA 1JN0A 3VZSA 1LBQA 2HSZA 5J23A 3CE9A 4E2XA 3K4PA 1RWNA 2CDCA 4D9HA 5FFNA 3LECA 2IYXA 3F5SA 3HMQA 4MYSA 4BNTA 1KSGA 4OAPA 3ZQKA 1OFIA 4CNBA 4B3RB 1ST2A 2WM9B 3KT8A 2H06A 1T3GA 2L82A 4HZGA 5DASA 5A4JA 2CLKB 5K7SA 5ED4A 3ER9A 2HI0A 2WWIA 2FSSA 3DHVA 5GADl 1ZD5A 2D2XA 3RVLA 3WS7A 3WRYA 5T6BA 5K8TA 3AHIA 3OLQA 5B7PA 2QR2A 3O2QB 3M6WA 1EQAA 1V8BA 3THWB 1EUQA 1DIRA 1IN5A 1Q0SA 1WXWA 2JL1A 4EHJA 3U5ZB 3ZCUA 1LK0A 3E3MA 3HWWA 3QVTA 1YL6A 3WQHA 1JIJA 1L7XA 2W58A 1P6UA 1NZFA 5FR1A 1AQLA 1D7AA 1R66A 4Q47A 5T5QA 2WWVD 3VKHA 3L02A 1UJ2A 3RK0A 2WMYA 4HQKA 4Z1MA 2ODEA 1ETUA 1QHYA 1OXTA 1PK7A 4O2BF 1ADGA 3FVRA 2R8XA 2JIZD 2OAP1 5COQA 4NMLA 1FF9A 1PHPA 2JBAA 4KVGA 4XOUA 1NVMB 2P2NA 1KMHB 3KO8A 4Q3AA 2ODNA 1M1NB 1PQ4A 4M7OA 3CCFA 4LNUA 5EMJA 5GJVC 5TT1A 1DT3A 2BFDB 5KDDA 1VLHA 1C50A 1US8B 1R8QA 2VWQA 1SXJE 1XZLA 3DFMA 1PQWA 4L0DA 5AP9A 5FPTA 3SBOA 3D8HA 2HR1A 5TGTA 1GQRA 4HLUA 1ZZEA 3DL0A 1OI7A 2I71A 3EXFB 4RVSA 4WOPA 2X3FA 3QXCA 2PXAA 4GOXA 1UKYA 3IIEA 3JWJA 1SB9A 1L5HB 5A0FA 3LGXA 3TVTA 2D00A 2A78A 1J8YF 1KEZA 2R9VA 4YBZA 5LWHA 4MR9A 2FW8A 4PSAA 1JMKC 2GZHA 1LXCA 1MT0A 2CMFA 1AT1A 2N3ZA 3EW7A 4GPBA 4JCCA 4Q4AB 5CXSA 4EUHA 2JH9A 2ZJ3A 3IEPA 5K03A 3R0VA 3EQZA 1LJLA 3HP4A 5HK8A 4ZQEA 5EMNA 5TS2A 4LN1A 1XJ5A 1NUSA 4EUNA 1M72A 2O0LA 4Y9RA 1HDXA 4MW7A 1W34A 2WK1A 4GGPA 5A5GA 1UOPA 1MC4A 4ICIA 2P2GA 3BXOA 4ZREA 4BCDA 3PVSA 2I91A 2IS4A 2DCMA 2W5UA 1UF9A 2OHFA 2XXAB 4ZOBA 3WGZA 4RVNA 1YQQA 4EG8A 2EZ9A 2XQJA 3HCPA 4BCCA 2OLKA 1WSDA 2YOFA 4B3DA 3FCYA 1IN6A 4LSZA 4OHWA 1FYFA 5F2OA 4DV1B 3AVVA 3TLAA 2YCBA 3N0XA 1RXCA 3AV3A 3GB9A 3DQZA 4NATA 2F1KA 3AY0A 3II6X 4IMJB 4R81A 3LKVA 1BWQA 3PL5A 1W59A 3BQNB 5E6UB 4TQUS 2XVMA 3O83A 4AXBA 3A58B 1OGJA 4AJNA 1D2HA 1O6FA 2VHZA 3D4PA 4BTVA 4QSHA 2C5SA 2II6A 4HQOA 2ZUDA 2DQYA 3KKMA 1E6EA 4Y1FA 5CVVA 3VPGA 4BKQA 1PGJA 1Y98A 3RGGA 4FOOA 3QHAA 4DV4B 1QV7A 3Q85A 1OH7A 5LA6B 2C95A 3HKDB 3R5TA 4U2GA 1YZUA 3OCYA 3COWA 2P78A 2EZUA 2MJLA 1NMYA 2RCYA 1W4ZA 3GEHA 2VYCA 1RWKA 3LDHA 4JOCA 2QAIA 1JZQA 3WLTA 5H83A 4C4XA 3JVIA 4LOKA 1XRJA 3TX6A 4X97A 5JVDB 3U31A 2VJLA 1OFHA 2YX1A 5IBQA 2EYUA 2WAMA 2XMBA 2IBTA 4YT4A 4BX3A 5BXQC 3R9XB 3RIGA 1H8ED 3G2MA 4E94A 4GRDA 3NWEA 1WV1A 5HOQA 2QJFA 4TYQA 5B7QA 3TJRA 1VIYA 2XJ9A 4B31A 1JFTA 5DM2A 4BFVA 3EXHA 1QK3A 4BLVA 1IEQA 1TZJA 3HWX1 3GJRA 2J7KA 3LP6A 4I5EA 1DS6A 2OO7A 4R8LA 2X0DA 3LGSA 3FVQA 3I8XA 4DF3A 4JC0A 1K08A 2ZWMA 2CXHA 4HFNA 1SVOA 1TTPB 2EBHX 2GAJA 4BKUA 5JANA 5BUQA 3RC2A 3V7WA 3ADBA 2A0YA 1UEIA 4FHEA 1R2QA 2OQVA 1QU3A 4K0RA 3RYFA 4KO1S 2AN5A 2PR7A 2PUFA 1ENOA 3AF3A 3H2SA 3RADC 4IDAA 1BYUA 1JIUA 4HI0E 5AM2A 4RZIA 5JH7A 2FEMA 2JZNA 1Z0AA 1PV2A 2PZLA 3M70A 4HX2A 4NV0A 1U8TA 2GBCA 3OMLA 5TY0A 4HNUA 2ZBVA 3NP7A 4M7RA 3WG9A 1CW2B 3PDCA 2PGNA 3K1ZA 4QJIA 2FUG1 4G4SO 1W1UA 3I2IA 4FINA 3ROMA 2XVYA 5A9SA 2NSLA 4F3RA 1JBEA 1VHJA 4XB6B 1MHPA 4MQ5A 2GHQA 1CZNA 1RVDA 2WTBA 3BILA 4QOJA 5GOTA 1ZAYA 4OY3A 4WVLA 3GVIA 4WH0A 4PN7A 5CUQA 5JPCA 2IOFK 4KK4A 2Q3FA 4EARA 3ML1A 1CEEA 2FEPA 3U44A 4V1CA 1EFLA 3JWEA 3GZTB 3H19A 1FSZA 1YBHA 5E7JA 5JCOA 2R85A 3RSZA 4EATA 3EXIA 4JL5A 3GK3A 3VDRA 2V4MA 2I6QA 1THGA 3D6NB 3D8RA 3HY3A 5TGZA 1UC8A 1X1RA 3PLRA 3QMMA 3L7YA 2IS1A 3LTEA 2PLWA 2Q6OA 3FNRA 3W4IA 2RGRA 1XXLA 2HQRA 3LBIA 4K6CA 5HFAA 1EM8B 1U1IA 3MCTA 4V3CA 5JBIA 1DDIA 3JAKA 1A9YA 3MOSA 1KO4A 4N0PA 1EKXA 5JD3A 3WWCA 3UBMA 4CQMA 5T8KA 5C5CA 4Q05A 2NXNA 4IWNA 3KXDA 3TZLA 3BD6A 3D5QA 2QUZA 4ZI7B 3JQBA 3CUWA 1X86B 2ZJOA 3THYB 5BORA 4G1FA 2B6HA 2QVLA 5AESA 2PV7A 4U7WA 4LYYA 1XEFA 2GEBA 3TL6A 5EMKA 4MRRA 2EFCB 1JHPA 4NU6A 4YP1A 2QWXA 1B42A 3F5FA 3ZW7A 5CK4A 1B00A 2LTAA 4LMRA 4X94A 3SPXA 2IDZA 1MR3F 4LQCA 3S8EA 1MB4A 1XVVA 1RHRA 3UMVA 3T52A 5HTKA 2ATXA 3WZ2A 4R9UC 1VIVA 5B7NA 2J4CA 2WA2A 4XTRA 4U6SA 5JCOC 1G60A 3LC1O 4CLRA 2ZZNA 2FMHA 1Z6GA 1D8TA 4ZO7A 5A03A 4CM4B 1CUHA 1LB1B 4ZZIA 1ORTA 2WB4A 1QGAA 2Z9CA 3KPWA 5IKMA 5CURA 1P9LA 2XWPA 4R7TA 2BYTA 3FKSA 1BN6A 2YYZA 2ZRMA 3ELDA 3NALA 2HN9A 1DAEA 1E5DA 3RI3A 1QZXA 1WXIA 4JSTA 1W19A 3MHPA 1G16A 2WMDA 3UK0A 1LJUA 1TMGE 1V3VA 4TTSA 1ZD1A 2BI4A 2DRIA 3VMFA 4WOCA 4UAUA 1TB4A 3S2IA 1EE1A 4MQFB 5EJ8A 1PUIA 3AIKA 1SA0A 1SVUA 1D07A 4B3BA 1BS2A 1JT2A 3Q8XB 4AMZA 4EBFA 2B0JA 2IXGA 3EC2A 3V1MA 1ODTC 3FPEA 1FFDA 1K4KA 4KHZA 1Z75A 3W8RA 1T9AA 2IITA 1GLVA 5U1PA 1NW9B 3EQ6A 1QVRA 1BS9A 2J3KA 1B3BA 4PX3A 3W34A 5JMTA 2JVJA 4AK9A 2CZGA 3OZUA 1XQXA 1P7WA 1VCOA 2HRBA 3PIIA 1NPDA 2FP4B 4KXNA 4TYMA 3QX9A 1VPWA 5THXA 1WF6A 5BWLA 3GJZA 2AI1A 3SYLA 1JYEA 4EMSA 3VA7A 3KKOA 2EFEB 3QE0A 2B92A 4ZOCA 1KU0A 4BLSA 5HR5A 4MYUA 1XWWA 2YJ5A 2XRYA 4GECA 1ZQ1A 4JASB 4C88A 7REQA 2VBIA 4C7KA 4ZEVA 3CZ4A 2XTMA 4ISCA 1YASA 3IJPA 3L7CA 1J1UA 1P6QA 1EJ6A 2J9FA 1G7TA 1L6IA 3UJAA 4BE9A 3ANTA 3SYKA 1M6VA 2NX2A 4Q9HA 3TTUA 4KYIB 4NR0A 3R3WA 1G5FA 1GAWA 4R1PA 5EIBC 3H18A 3A2LA 1MO2A 3QXJA 4HF7A 1F7VA 4UBJA 1DQZA 3FTFA 2RAVA 3CRVA 3HGQA 1G8MA 1OTXA 2CJPA 2FN8A 3DT6A 4LJ4A 4NV1A 4A7PA 2NP6A 3HBFA 3PHGA 4OBXA 2EJCA 2SICE 1C8BA 4LXIA 1HYGA 3BXZA 2G9NA 1E2PA 1MH1A 2QF7A 4B3TB 1V5GA 1PIWA 1Z83A 3Q9LA 5FPHA 2Z43A 3HL4A 3KK0A 2GO7A 4GDFA 5DULA 4LZWA 1HLDA 3JRNA 1WF3A 2ZJ7A 3D6UA 4HFJA 1L7PA 3HXPA 4Y67A 1JIXA 5DVZA 2OVFA 4L4SA 3FPLA 4EM6A 1UBLS 5ICSA 3GBSA 3LF2A 3TW8B 4YV1A 5HPYB 1BW9B 4Z9BA 1YXMA 3UANA 1OI2A 3EVZA 2X19A 3IAM1 4J1NA 1QFJA 3H4MA 5TC4A 4NHEA 4UOZA 3FTPA 2JFPA 3BH6A 3D9QX 1JLRA 2ACVA 2I4TA 5D3ZA 5A5VA 3IT3A 3WDSA 2WHQA 1E6WA 3MAJA 3LQKA 5FNVA 2WJ6A 5I9IA 4LXUA 3OE1A 4Z8YA 4BNFA 4UM8B 2DUWA 1OWPA 2HQOA 3IHTA 2G5GX 1T6XA 2BFEB 2I1VB 3C1AA 3IT2A 4JYPA 4BFLA 1V9CA 4R5MA 5M5BA 3KQKA 2WE7A 2X0RA 5HYVA 1VIDA 3HDGA 1KY4A 2OAGA 3DM9B 1N4AA 3TH5A 5I3ZA 3H3XA 4M83A 1B0AA 1W48A 3DOHA 4OXKA 3PNQA 5MHTA 3ZD6A 2PD6A 2FVYA 1EK0A 1VL1A 4LY6A 6ABPA 1N8NA 3AONB 5FTKA 5ETJA 3LWBA 1F5NA 3A6ZA 3QKRB 1RJ9B 4S3MA 4C1NA 1POWA 4HEQA 2RBEA 4ARAA 2G1UA 3K09A 1KYQA 4YPFA 1L4YA 1D2RA 1FDSA 3GLQA 4K81B 3WB2A 4LMPA 4QELA 1IPEA 2NO9A 3BICA 5AVTA 5JWOA 1K7XB 2IPAB 2HCTA 4EUSA 1SBCA 1GGHA 3FMGA 1E4EB 2VDLB 3NKLA 3SJBA 1U2SA 3ETJA 1CUZA 3OTWA 1J24A 1A9XA 1TTHA 3JD0A 1C4OA 1G20A 1UJCA 1VRVA 1YI1A 4GX1A 4B7CA 1E79D 2F8SA 1R5NA 2M98A 3HYTA 4J7XA 3CMMA 3T35A 3AIMA 3EN0A 3IP9A 5EEGA 1OBOA 3ZE8A 4JENA 3SC6A 4J7UA 1ZXXA 4QQFA 3QP9A 2XB6A 5EE0A 1E6KA 4PY2A 3A9TA 3ABRB 3QVWA 4K05A 4BPRA 2VEDA 4LOLA 3KWJA 3E48A 1A9QA 2FW1A 2PD4A 2IYTA 4L22A 3A26A 4PONA 4U5XA 3OJOA 4EKNB 2AUMA 2AK2A 3R5KA 4TTQA 2QE7D 4E07A 5I7RA 3UWDA 2V6MA 3GGCA 3P9ZA 4NYIR 5GJWC 1ULBA 1YCDA 5FOXA 3KBOA 3V8MA 4CIBA 2HA2A 2QGFA 4JOBA 2IBMA 2NXCA 4MQLA 3TLMA 3BF7A 4OBWA 2BDEA 1JMVA 1JHXA 1ZEJA 2PBRA 2V7VA 4EW1A 1ILEA 4NAVA 2VT6A 3DKRA 3U7QA 5FBVB 1NNI1 3L79A 1R0YA 5KTRA 1Z17A 3IB3A 4TTRA 3GRZA 3EG5A 1EBFA 4L3OA 1PWYE 4G4GA 2IXBA 5I7AA 4ZDJA 4OGFA 1QCZA 2O8NA 3RBXA 5IU6A 3H86A 4KRYA 3PQ6A 3GYBA 3DQPA 1DWUA 3DPUA 2EVWX 3KUKA 3VI4B 3RC8A 4NICA 4XLLA 4EKGA 1WJGA 2XVXA 2QENA 1YF3A 4KI0A 3NTRA 4IIJB 1BQEA 4EG0A 1R9JA 4KK3A 2XMZA 5IUJC 3IYLW 2XT9A 1CG6A 2E4YA 2YHIA 4DLTA 3A2KA 1AGYA 1J5PA 3VHXA 4CFSA 2CKDA 1OFVA 4PZ9A 4CYMA 4IJVA 4HDQB 1UMCA 3GA0A 3MJEA 4G84A 3X1KA 2VJOA 1L4FA 1KVTA 4E70A 4IIEA 4I3GA 1YCFA 3I05A 4GGOA 4M46A 3FW1A 3PE3A 5JYCA 1EG7A 3BZBA 4N39A 4XFKA 2OZEA 3VRHA 3UJ3X 1I4TD 1MORA 5TVKA 3C3WA 3QNUA 3STHA 1WTCA 5ILQA 1QTQA 5DN6A 1K8ZB 3GMTA 3G5TA 3PFHA 3TSYA 3WK5A 3ITDA 3OIDA 4URVR 1EXVA 5BPFA 3WLPA 1RWBA 2DGDA 5EIHA 1Z8NA 1GADO 1RQRA 3O8NA 4L27A 1M0TA 1WXFA 2PV0A 1OE0A 3U0BA 5CRIA 4CE6A 4Y6GB 4RY8A 5B1IA 1DG3A 2Q0XA 2XQFA 4ZT5A 3UY4A 1IXKA 3AEUA 4RMGA 3DF9A 3IOMA 3M6MD 3TKLA 2QJRA 3N8KA 4KMMA 1IMOA 2I2WA 4YAOA 1L5SA 1YFZA 5DYYA 4IJUA 3NHZA 1C4KA 1XTBA 2DH5A 1M2JA 3BVPA 4FDVA 3Q15C 4HLNA 4RCZA 3TW4A 1GPBA 2CXRA 3EVTA 3KOUA 4LSWA 4G4SP 4C1BA 2A0WA 4EVRA 1CJVC 4MX8A 4YMHA 2CFCA 2H1HA 3KVRA 1XCJA 4DR2B 4RDCA 1SJ9A 3DOIA 2C84A 4C14A 3HJNA 4Y6OA 1E7MA 4JBIA 1U11A 3IERA 4JI4B 3TZQA 1GSHA 1H2XA 4QRIA 4YFVA 3ZHOA 1JDSA 3RNLA 1R8JA 2GM9A 3QIVA 4CMIA 2P7HA 4I5DA 3NKFA 4P7BA 4OP3A 4BNMA 4IDNA 1MJ5A 2NUAB 1BN7A 1JX6A 3PRKE 3RVDA 1N9GB 3PPIA 4D9KA 3BE8A 4YGYA 4J1QA 3FDZB 5CB4F 1ZSVA 2KB0A 2JD2A 1H2EA 2XY4A 4J0IA 1CRPA 3VVMA 4KXWA 2AHRA 3P5BA 4Z0PA 2ZETA 3NU1A 1DEXA 5EAIA 4HGYA 1SC6A 3H5OA 1BHSA 1DCFA 5I01A 1R8XA 3B5IA 1PI3A 4IOKA 3EHEA 4L4XA 1J1IA 3JYNA 3CKMA 4MWDA 4OM7A 3GA5A 5AI9A 3SOZA 3GROA 3HVKA 1FYXA 1YVDA 4XM1A 1MJGM 3EEIA 3UFBA 1DC3A 4NRDA 2BUAA 3LGAA 3MERA 1KK1A 1E2BA 2NPIA 5F23A 2NUTB 1EJBA 4UHCA 4C04A 4DMFA 3BULA 1JTVA 1UMBB 2VP3A 5KKAA 3RRBA 3NC4A 1GWNA 1N1GA 3M83A 3G0BA 1YB5A 2E55A 5F51A 5LN1A 2J8ZA 2UUOA 3IP3A 2X6RA 4EA7A 3UK1A 1L4GA 3KYIB 3TQIA 5JLJA 3IQZA 2GRAA 5IYZF 2WIAA 4HXGA 1UWCA 4C3UA 1YA4A 1X77A 4OOFA 4Q3BA 1RHQA 3KKPA 5DYNA 1E1CA 5BN1A 5LQAA 3FE2A 3EAFA 4LQDA 2PUBA 1QIMA 5FI3A 2QL5A 1H1TA 3EEBA 4GUAA 2C8JA 2AV6A 3G5UA 1PNTA 2C0QA 2I5PO 3SX4A 2X40A 5J5AA 1JSCA 4QJBA 2R8PA 3Q0EA 4BEBA 3EQ2A 2X8AA 3U56A 3SLGA 2O8EB 2I4LA 3K72B 4GKBA 3TQTA 2AFIA 4L8FA 4RO0A 4DIEA 2B83A 5JJIA 4PX9A 4MDFA 2NO7A 2XMGA 1FYWA 3KEFA 4LHSA 5CCDA 4D5GA 2WF7A 4QUAA 4B46A 5KWSA 1HQKA 5KTTA 1ZUHA 4BC0A 2XWBF 5FUYA 4U7TB 4UUBA 1ZD2P 3WQRA 1AA6A 2DFKB 4W5OA 4DR6B 4R3NA 1RXUA 1N75A 3OZEA 4GI7A 2DWQA 3T9CA 3B3AA 3QXHA 2V6BA 4WY2A 4L15A 3DAFA 1W36C 1RXEA 2E82A 3NBYC 3NM4A 4KUHA 5AM1A 4IMRA 1EZ4A 1I6MA 3FPAA 3Q8MA 3CE6A 4H7JA 3MQFA 3QVLA 1GAQA 1M34B 1UODA 3ORHA 1R6BX 3LT1A 3UV7A 2F59A 1J5XA 2PMKA 3B1JA 3HO1A 2AMVA 5BRAA 3LY8A 1Q15A 2ZUUA 1JR2A 1KVUA 1L5LA 3JQGA 4GLBA 1HZZC 4WXYB 3WJ1A 2VQSA 4BMPB 3FVWA 2NU7A 2HFKA 5CDHA 2HIHA 1UT6A 3P2KA 3R0ZA 1C4WA 5BOVA 3L06A 1HXHA 1LWNA 5BV0A 1FW6A 5KQGA 1DV1A 2VHYA 1QP0A 4KR9A 3K0HA 1OFTA 4Z2YA 1QRAA 2ZAOA 4ZV4A 3OM0A 2FZVA 1QYDA 3IAS1 3LQ4A 3PE6A 3LUGA 2WUFA 5KAPA 5TJ9A 1ODSA 1W1IA 3ORQA 3HXLA 4BKPA 4RLQA 2BZ1A 1GCUA 1NPTO 1P5JA 3OCWA 1XTPA 4MCIA 7AT1A 1M2EA 1SIWA 2X3YA 1NN0A 4M1WA 5CX1B 1B2RA 1E2DA 1OX6A 1KO8A 4MCJA 5C7OO 5KTYA 1C3XA 3CKYA 3RJMA 1OWLA 3I76A 3JARA 1H3EA 3L40A 2RJOA 3T5GA 4AJIA 1CNEA 4FB5A 3ANLA 1KFCB 5H3HA 4WINA 1UAGA 1VL8A 4L5CA 2GEKA 4BQQA 1WSAA 3UJHA 5AVYA 2V98A 1U0RA 1ZGAA 3GZJA 5K1ZA 4EVSA 3RYCB 1ZD4A 4KUGA