1DAKA

Dethiobiotin synthetase from escherichia coli, complex reaction intermediate adp and mixed anhydride
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
224
structure length
224
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Snapshot of a phosphorylated substrate intermediate by kinetic crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 75
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dakA00
5K8LA 4E09A 2Z43A 4I1SA 4NP6A 2XITA 1KSFX 1RC8A 1SZPA 2OXRA 3SZRA 1E9BA 1OHHD 4ZDJA 3FHCB 5EXTA 2GEUA 4BWYA 2W6JD 3DKPA 4FMCF 1GITA 4LBVA 2D7CA 4LRWA 4PC2A 5E3HA 4TL8A 2A5GA 2CHQA 4F4CA 2DFKB 1Q44A 1G3QA 2GCOB 4KHZA 1BOFA 1ODFA 4YDHB 3OEHD 2OSBA 2CNWD 3LQRA 1OT3A 4OHYA 3J81k 3R9IA 5H70A 2LCFA 3OE7A 3TR5A 2R65A 1Z0KA 3GLGE 1XD2A 2BVNA 1II9A 3LY5A 1RFLA 1KI2A 4U5XA 1TTTA 1YR6A 3K0AB 1GKYA 4BFTA 4A15A 2RGAA 2BBOA 3CB4A 3O47A 5KUTA 4YMTA 1IJEA 3WYFA 1N5KA 4FWIB 5B57C 4KYUA 5KSZA 2N1BA 5DLQC 4LHWA 4V0MA 3BH0A 4D0NA 1KHTA 3SOPA 2P5SA 4BZPA 3BIFA 2CCJA 2QT0A 1LV7A 2ZJZA 1AK2A 3TSOA 1J70A 3B8HA 2OO7A 2GESA 1JBKA 4DLXA 4F93B 3RS7A 3B1VA 4PHTA 2VBCA 2BCGY 2IUTA 3DEFA 5EUMA 1ZUHA 4DLRA 2ZRMA 1Z6YA 2QAGB 2W2VA 4C0BA 1FQKA 2ZANA 1E9AA 2XSZD 1H8ED 3CNLA 3PQCA 1JAIA 5JWOA 1SVIA 1EFHA 3U4QA 5J40A 2WPDD 1JECA 1BS1A 3FKSD 1K5DA 3QG5A 4BFVA 1VYUA 1EWRA 2OFOA 1N6LA 2WKPA 2XOKA 2WMOB 4MGIR 4MKGA 2C8VA 1IN7A 3HPQA 3NHAA 2IYVA 4BFSA 3BFVA 1M74A 3L0OA 5L3SA 2ODNA 3BFXA 4JSTA 5BQ5A 1DELA 3T5DA 5H8WA 1GZSA 1OPXA 4Q66C 5FTNA 5CK5A 3I61A 4B33A 1J2JA 1D2MA 3ZVNA 4LGMA 2CE2X 1LF5A 4MKHA 1M34E 4LJ5A 4FI3C 1A4RA 4V0KA 4C2TA 3TUIC 3VNUA 4V0ME 3DMDA 4UNPA 4PQYA 3BERA 2NO6A 2Z5FA 1VIYA 4CT4B 4FCWA 1NY5A 5B58C 3A37A 2IS6A 4EPXA 3KB1A 2RAPA 1N5JA 1UAAA 1EGAA 3L82B 1W36C 3EASA 4EFLA 5FBLB 1K5GA 5GJWC 4B74A 3T1VA 1M7BA 3GJXC 2V55B 3AF2A 5L3RA 3T61A 1KSJA 1C4OA 4I99A 1O3YA 4HAYA 4IHQA 1G7TA 2G1JA 2QSYA 3AUXA 3FKQA 1FNMA 2YINC 3PUXA 1IY0A 4DRZA 1R2QA 5EJEA 4LI0A 3NEJA 4M1TA 2OCAA 3SNHA 4Q1DA 2JLQA 1OH5A 5EZ5A 1US8B 2BCJQ 1JEDA 3PFIA 1GTVA 4HUQA 3B1YA 4MA4A 1KAGA 2GJSA 3BORA 3K09C 3LLUA 4O25A 3UIEA 3U7EB 5JSZA 2ZRGA 5HR5A 1SKYB 1MRNA 1IN8A 5TV2A 5KNCA 4EFMA 2JJ2D 4TMZA 5GJCA 3B60A 1GDDA 1TMKA 2J59A 3CF6R 4NCIA 1P9WA 5LB2A 4UXIA 2QTFA 1RYHA 5EP1A 1DG3A 1OFUX 1XEXA 3BOSA 3U3RA 3U61B 1ZIPA 3KKQA 3G0HA 3QSYA 3ICQB 2VH5R 2W58A 4HAZA 1E2LA 4LHXA 3ADCA 2CCGA 5FH9A 3K70D 2A3RA 1Y63A 2GJ9A 4JLJA 2NG1A 2WWWA 1JXMA 3TVTA 1TEXA 3LFUA 4CEHA 2D74A 2ZRBA 2KWIA 4JLDA 2R44A 4BEBA 5JWRA 4HLCA 3WXMA 1XTJA 1KNXA 1TQ4A 4D25A 5FL7A 4PSKA 4AIIA 4P4SB 2C2HA 3NKVA 4C9BA 1DEKA 2JLWA 2JJ1A 4R7ZA 2RGDA 3ZVLA 5D3MB 1E1QA 1EG7A 1S9HA 4A8JC 5C4MA 3R7WA 1II8B 4Z8XA 4LJAA 4B6EA 2HLDA 1LTQA 2ZRKA 3CX6A 1KI7A 1NP6A 3LV8A 4UNQA 3WBJA 3CIOA 2GA8A 1U0LA 2KB0A 4A36A 2ZRLA 1XDBA 3EZ6A 1OFIA 1QVRA 2O8FB 1XEWY 4DC9A 1R0WA 1ZUNB 2BEKA 3EA0A 1E79A 4NKRA 1MOZA 1J7KA 3BFKA 2OE2A 1A5TA 4NONA 4BLRA 1X1RA 4RFSB 4ARZA 3VNVA 3N70A 3KQNA 3QUSA 1Z3IX 4G5OA 2EU8A 3W5IA 3MSXA 4MUAA 4D82A 1NVVR 1TUEA 2JAQA 4OHWA 4B71A 5IF9A 2XNDA 2GDJA 1JI0A 2WVJA 3ZZUA 4DLZA 3X1YA 3TRFA 1U81A 3LNCA 2O52A 2YJTD 4RCZA 5FR1A 2NZJA 2IK8A 4QXAA 4OL0A 2QL6A 1S96A 2BIFA 2IYYA 2VHTA 3IO3A 4DEYA 1PV4A 4QGFA 3RS3A 1DAFA 3KQLA 1NN1A 3JVVA 4LC0A 4KJZA 2JLXA 4X8MA 2HDNB 3GJ3A 1J8MF 2I1VB 2CHGA 4N3NA 4BRWA 4DDUA 2IYQA 4GMDA 1IHUA 1NJFA 1QBKC 2WOOA 3IGFA 5E7JA 3MWYW 4D4KA 5AUPB 3BH6A 4XTRA 5CJPA 3NDBB 1S0UA 1FX0A 2B7BA 1F48A 1RJ9A 4KFUA 3HYTA 1KDPA 5C46F 5FPYA 4URWR 1TADA 1M2OB 4XJXA 1P2UA 5F9FA 4C0QC 5EQTA 3A1TA 4CEIB 3WMEA 1U2RA 4XWAA 4LWZA 5AK0A 1G3RA 5EUQB 4AI6A 3N2EA 4C0KA 2QGZA 4TMVA 4JLNA 3FMPB 1TF7A 3OFND 1KK2A 4TQ9A 2H17A 2MSCB 2P65A 3ADKA 1VCMA 3RWMB 4D2IA 3ASYA 1JPJA 4A1FA 2GBLC 2JJ1D 3BK7A 1IAQA 3WRYC 3OIVA 621PA 3AVUA 3BBPA 3GJ0A 3PIRA 1XPUA 1LB1B 3K8YA 2SHKA 2HLDD 2IYZA 3CNNA 1T3LA 3EIHA 2HF8A 3LW7A 3BWDD 5EE1A 2JIZA 3R9XA 1NL3A 1P2VA 5DI9A 2O8BA 2RB4A 1JALA 2J41A 1UM8A 2XXAB 2BEJA 1LF0A 5SZIA 3QXXA 3KJGA 4OK3A 2WAXA 1MKYA 3NH9A 3O8RA 3IHLA 4HATA 1KMQA 2IT1A 4XTCS 1P3JA 1MH1A 1IONA 2J0UA 1A7JA 1E9FA 2RGNA 3K9HA 4KFSA 4K46A 1Q57A 1VHLA 1Z63A 2KI5A 1YZTA 5KHOC 3P20A 1CRPA 3QKRB 2QAJA 4J0QA 4NCNA 2FPLA 4FN5A 1RIFA 3QXCA 4DB2A 4YMVA 1V5WA 2ZRIA 1VKJA 2ODEA 3SHFA 3KUDA 1KSGA 3UK6A 4Q01A 2C9OA 1EFCA 2B6HA 4KLNA 3TK1A 4QGHA 5FPSA 1OXVA 3ND9A 4F4IA 5KDDA 2HUPA 4POAA 2GXSA 3ND8A 2XNDD 2WWXA 3VU9A 2J5XA 1GAJA 2R6AA 4B2LA 2E9SA 4BLPA 2QAGC 2ZJYA 1T5LA 4TLBA 2B8TA 2WSMA 3KZ1E 4TLAA 3HP1A 2OLKA 2IWHA 5IK2D 4B3XA 2WWHA 5LD2C 3LX8A 3BB1A 4ON9A 1R0ZA 2WICA 2IEZA 4JLMA 2ZSDA 4DEXA 1TQ6A 3DOFA 2EYQA 1PJRA 4M53A 3A1VA 3FFBA 3EPKA 4KO8A 3EZ9A 1IOZA 2MSEB 2WIBA 3MWJA 4F4JA 2GAOA 2OBLA 1Q3HA 3ZDQA 3T34A 2WWIA 2NZ8A 1UKYA 4PQRA 5HKKA 3FB4A 2ZE8A 3N2IA 4NHOA 4Q1AA 1N0UA 4TMKA 3W6NA 2IS1A 2G1KA 1YR8A 3EIEA 4WAUA 1F2TA 3K9GA 4G01B 1U90A 3VR6A 4KODA 1DARA 1VG9B 4IRUB 4BFUA 4Z1MD 2RMKA 1KO5A 3C4JA 2WJHA 3ZZ0A 1IJFA 1MABB 3VKGA 2IYUA 2GK7A 5KDLA 1KOFA 4BZXA 1HUQA 2A9KA 5EXSA 2GXAA 1Q1BA 2WJJA 2FSFA 2XTNA 121PA 3BC1A 2X8AA 3GLGB 4LV5B 1XBTA 2GJKA 4JL8A 3VHXA 5JRZA 5FFMA 3V9PA 3NDPA 2VP6A 3ZVMA 2YWEA 4G3XA 3R8CA 2FGJA 1XPOA 3S1AB 1DAMA 4JL6A 1BH2A 2JIZD 5BYJA 1KKMA 4CZ2A 2XAUA 4HLUA 3OAAD 1E2KA 3IEUA 1BYUA 2BMDA 2ZRNA 1BKDR 4AKIA 3QVVA 4YMUA 5DI3A 4OHVA 1CJTC 4V02A 1UBEA 5ELXA 1W0JA 3Q7PA 3Q3JB 2ZSAA 4MGZR 3TUJC 5G3ZA 3GJ8A 4WZBE 2FV8A 4PC1A 1UBFA 3MCAA 1WE2A 1NG9A 4NYIR 2QSZA 2CBZA 4BLQA 1E2EA 4XIGS 1KK3A 3K0CA 1P2TA 2FU5C 2QY9A 2UKDA 4RKEA 4C0LA 2ZEJA 3KJIA 3U6BA 3CRMA 1KK1A 3CRRA 3P1JA 1W0KA 1KGDA 3TH5A 3SBEA 5AUNB 1JJ7A 2KJQA 3QPUA 2ZJ5A 1M7GA 2AL7A 3RS0A 1S9DA 1XXHA 4B3FX 3PXGA 5FOWA 2OG2A 3U3MA 4C0AC 3T15A 3CWQA 3K0FA 5KTYA 1XMVA 4URUR 4LJ7A 4KLZA 3TW8B 4JLVA 5FTLA 2VSOA 1TEVA 3X1DA 4BLOA 2YOGA 4NCHA 1KI4A 1DBSA 3HU3A 4AYTA 3M4YA 1F3OA 4V0LA 4XSHA 4DWJA 4B34A 4C0SA 1XTSA 3P27A 3U7HB 1W36B 2GXUA 4WXRA 4NYJR 1Q12A 2DR3A 2V1UA 3IO5A 4LBYA 1UDWA 1D6JA 4UNRA 2J7PA 1KO7A 2Z6VA 2IEYA 4EPWA 2P5TB 1G5RA 4WIAA 1YRAA 2WTUA 5FPTA 1W47A 4IFBA 1VECA 1EFRD 2FX3A 2FOLA 3RDPA 2WMNB 1ZM4A 2GNOA 5GJVC 3RANA 4XWOA 1VPLA 2GF9A 3THXA 2WKRA 2GJ8A 2P6UA 2JLSA 1VG1A 3NXSA 3GLIA 4WW0A 2GETA 1N6NA 4JJZA 2ORVA 4HYYA 4CF7A 3RSLA 4I81A 4BPBA 1G18A 2Z4RA 1G9XA 2WWFA 3VR5A 5GVRA 3KJEA 1WCV1 2ODBA 4AD8A 1NN3A 1XXHE 2DWQA 2IYLD 3T35A 2G9NA 1WBDA 3CF2A 2MMCA 1UKVY 2XZOA 4IKEA 2PT7A 3GFTA 1A2BA 1JB1A 1C9KA 2P2LA 3LXXA 4TMXA 4GBMA 5HPYB 4TYWA 1KJWA 2BDTA 3WP0A 1Z0AA 1J8YF 5L3SB 3CH4B 2IYXA 4JBXA 2PJZA 2O8EA 1Z83A 2O0KA 1VIAA 1ZCBA 2EYUA 1MO6A 1N6PA 1W4BA 3FE2A 3U44A 4HLDA 4OYHA 2OLJA 3GLHA 3NBZC 4R9UC 1Z28A 1LFDB 2XJ9A 3OIWA 3PUVA 3K9LA 2AN9A 2NOAA 3AF3A 3LW8A 1GOTA 3IQXA 4PZYA 2VRWA 2G6BA 1KIMA 4HZUB 3UG7A 2W6JA 1UADA 4B48A 4ERNA 2FZ4A 1GKIA 3O8BA 4DT1A 3WHLA 3MMPA 2AD5A 1WMSA 5FOSA 1SULA 1CJUC 4ZKDA 2JLYA 3C41J 3OHMA 1U9IC 1SVLA 3GLIE 2QBYB 2QMEA 2V7QD 1YRBA 1ZC3A 3OEHA 2CNWA 4A8JB 4RY2A 4DLVA 5EP3A 1XTRA 2W6ID 3HU1A 4TYNA 1UEIA 3U3OA 4PC6A 1TQ2A 2ZS9A 1ZM7A 3I73A 4DUGD 3AQ4A 3CZQA 2XNSA 3PUZA 1T8UA 2ZAMA 3UPUA 3NC1C 1KO1A 3PJRA 4FMDB 4Q4AB 1N0VC 2EWWA 2NMVA 2IF0A 3OESA 1HQYE 4G5GA 2F6RA 3B85A 4CYMA 2FH5B 1YJ5A 3IUYA 3TBKA 1I4TD 4HUQB 1OXUA 2QQ0A 4MRPA 3AKEA 4I1UA 1DAGA 1W48A 4IVRA 4NTZA 4B44A 3ZD6A 1XD8A 3PV0A 3AP3A 1Z2AA 4JYCA 4PZZA 3VR1A 2BOVA 2P0EA 5JJIA 1LY1A 3AVYA 3GLHE 2Q9CA 2ZVQX 4AYXA 3PEVA 1Z22A 2F55A 5FPHA 3VTKA 1XEFA 3I92A 2XEXA 4X8HA 5HZHA 1I4LD 4KYIB 1ZMXA 2Z0MA 2VTKA 3VQTA 5G41A 2EFDB 2WJVA 2XSZA 1H8EA 4LY6A 4M9XA 5K8TA 2W2XA 4O3MA 1PLKA 2WZQA 3FKSA 4DDTA 3MGCA 3NHBA 4JVLA 4LJ6A 2UZIR 2FN4A 2FEMA 4UNSA 1IXZA 1F6BA 1WXQA 1G21E 1G3IA 2GK6A 1KDTA 4KU4A 4ZCLA 5JZVA 4CEHB 2F43A 2BC9A 2F1JA 4TQUS 1F2UA 2ERXA 5FBRB 3THYA 3P4YA 4Q18A 4EQ6A 2IUUA 3IIKA 1NI3A 3FVQA 1P5ZB 2G0NA 4GSYA 3W8NA 4LK2A 3D31A 3F8TA 3AKCA 2C99A 3KB2A 4PXAA 4DZZA 4JS0A 4MUBA 4QM7A 2DWPA 4K8OA 3HR8A 4M9QA 4M21A 1EFTA 4LV6A 1ZNYA 1Z29A 3K9NA 1JQJC 5FUYA 1KKLA 1U98A 3E70C 3TW4A 4PR0A 521PA 4LUCA 1SXJD 2ASEA 4DJTA 1DO0A 3AVVA 4PX9A 1WRBA 5JHGB 3KFXA 4N0EA 3NBXX 2QP3A 1XU4A 2HCJB 4OJKA 4ITRC 4A6PA 4ACBA 3WY9A 4LBWA 4BFZA 4ZCIA 2I3BA 3PITA 4QBHA 5LPNA 4TZ6A 4RJLA 1SHKA 3SBDA 3VFDA 4QJ4A 4DVGA 4ARZB 3VKHA 1FP6A 1Q21A 3GFPA 4DXAA 1R6BX 2VP5A 1KI6B 1G41A 1GG2A 4OHXA 4XH9B 3ONWA 5AUQA 5TY0A 2IBMA 2Q3MA 4TYQA 2EW1A 2FZLA 1MT0A 1OIWA 2X2FA 1QZXA 1BIFA 4NCJA 1DPFA 3SN6A 1SHZA 2V1XA 3DOEA 2V4ZA 5TDHA 4B3CA 2BMJA 4AURA 1HT2E 1G291 3L0SA 1SVMA 5EXPA 4V0OA 2C78A 4JLAA 2RHDA 3SFZA 1NLZA 2JJ2A 1OYWA 3EA5A 2Z4SA 3T5GA 4LCBA 2QA5A 1ZBDA 2WSSD 3CPEA 4KVGA 2PX0A 4LHYA 1RJ9B 1QHXA 2AK2A 3N5CA 2ORIA 2YYZA 5LD2B 4OK5A 3VR2A 4BFYA 4U02A 2VF7A 1L8QA 4AKGA 4XVUA 1E2JA 3AP2A 1T5IA 1P72A 2FJUA 2N42A 3BS4A 4Q9IA 4PAOA 5DIFA 4RD4A 4LC1A 1AQYA 2FA9A 3EAQA 4PAMA 4A9AA 5KNDA 1ESMA 4HB2A 4TTPA 2JATA 1CRQA 821PA 4P0TA 1E9CA 2WWGA 1K8RA 1MR3F 4MQBA 4B73A 5JCZA 5LB4A 3EWSA 1E2HA 4M9ZA 1MRSA 4LYJA 4QBGB 3QF4A 4Q7LA 2ZI6A 3G82C 1NVXQ 2DPXA 2MMGA 4L16A 2OCBA 1N6OA 4M1SA 4QHTA 5EE0A 4YMWA 4U7DA 4M1OA 5F3WB 1N5IA 4L5BA 3C16C 1Z8FA 4Z51A 1IM2A 2G88A 4KBGA 2ZJOA 5JS8A 1CJMA 3TJZA 1ETUA 1EK0A 1Z0DA 2REBA 1KI9A 3WMFA 4EJSA 3OEEA 1ZU4A 5CIQA 5FOVA 2ZETA 1YZQA 1E9SA 3WHKA 4CEJA 1D9ZA 3AEZA 4A92A 3QXJA 3Q5EA 4B76A 2BMEA 2I4IA 1D8TA 4GDFA 3Q85A 3IKJA 3RS4A 2A30A 2O8CB 4IVPA 1YU9A 2RGXA 2OCPA 1ZC4A 4JVSB 4E5UA 4NZYA 3I5XA 3E5HA 4DCSA 2QTHA 3Q7QA 1E9EA 2F3RA 1KJYA 3DKVA 3K0EA 1R5OA 2J0QA 2OILA 4M1KA 3TKLA 1IN4A 4GP7A 1WQ1R 4V03A 5JBQA 2GXQA 4L8GA 4Q5IA 5FBQB 3D3QA 1XFAA 4O2LA 2NPIA 3O8DA 5KU1A 1O87A 2QT1A 1AKEA 2HV8A 2CLCX 4YQFA 4MYHA 3T1OA 3RYTC 4UKDA 2F3TA 1M8PA 2ZIAA 4MRRA 2NPFA 2BMFA 4N0DA 2OCYC 1OF1A 4C7OA 1J90A 1NJGA 4CGZA 2AK3A 2LWIA 4HUTA 1KY2A 1W36D 2OUKA 2GZHA 1FTNA 2OZEA 1R10A 5CM9C 3THWB 4OI0A 2Q0HA 4M9SA 3EPJA 1NIJA 1A1VA 4E22A 2ZSFA 1HV8A 4HDOB 2HYIC 5C4GB 4KAXA 4TLEA 3WNDA 1IN5A 1PVOA 2VA8A 1NMZA 3FHTA 4UXJA 1GIAA 3HJNA 5JJKA 1ELOA 1ANKA 2CJWA 1P9NA 2CVHA 4WVFA 2AWNA 3BJIC 4WZ6A 3KL4A 1M7HA 1OFTA 1S1CA 1KMHA 3OFNA 4GRAA 2ZQ5A 5GADl 2REXB 2HF9A 4PHFA 1W44A 2JLZA 4DCNA 2VL7A 4CDGA 5BW8A 2ZYWX 1II0A 4IVQA 2QEQA 1IBRA 4ZI2A 1UKEA 2QE7D 4Q21A 3SQWA 1WB9A 1W49A 3GQBA 3IBYA 1MV5A 4P4TA 3FFAA 5UKDA 3WNBA 3H4MA 4GNKA 2JDID 4RZUA 3AV0B 5BXQC 3E1SA 2G0TA 4NL4H 4F38A 4M2LA 2WJYA 3AF0A 3D6TB 3AM1A 2AFIE 3FMOB 3OEED 4B47A 5B64A 4TMWA 5DH9A 2GCNA 5G40A 3IQWA 4H1VA 1HA3A 3KTAB 4Z8YA 5K8UA 1KYIA 4RD6A 4AYWA 3QG1A 3ZQJA 3A4MA 4LYFA 4NPHA 4QNRA 4Q4HA 4D81A 3R9WA 4C0HA 4F92B 2X77A 2H1LA 3QXHA 1E2IA 5CYPA 2AWOA 3A4NA 1FQJA 1OW3B 2REOA 3SJZA 1NLFA 3C15C 4Q9KA 3SEAA 3C5HA 3ZZTA 5IRCD 4DHEA 1JR3D 2KBEA 1IXSB 4TWZA 3L0IB 2FNAA 1SGWA 3CR7A 2OBNA 3PCRB 4W5HA 2C9YA 4O2RA 5AJYA 4B2IA 3A1UA 3ZS8A 4NBSA 4JJKA 3MLEA 4P3YA 5HTKA 1G4UR 2ONJA 5FBVB 2GCOA 2GBLA 2NTYC 5IK2A 1X6VA 2CCKA 2WBLC 2X1VA 1U0HC 2NO9A 2ZE6A 2FGKA 4FD2A 4RSGA 2Q3FA 4PAQA 1TAGA 4TYPA 3DZDA 1ZNZA 2GTPA 2RGEA 1W4RA 4JKYA 4D80A 2PZEA 3EWAA 3P4XA 1E2FA 1W5SA 2Q3HA 4D0GA 1TF5A 2RGCA 1AIPA 1N6HA 5KOYA 4G5SA 2ONKA 2F1RA 3ASZA 1T3SA 1XCPA 3SJAA 1KNQA 3PUWA 1JQLB 2CK3A 3EIQA 1NKTA 3U2QA 5CYOA 1G7SA 4P4UA 2FG5A 3U6KA 2Q9AA 2PMKA 4ASUD 2PLRA 3GJ6A 2J46A 2PZGA 1RRGA 4TL9A 2G83A 4RVCA 1IY1A 4CIDA 3OF5A 4D4MA 1X8KA 3X1ZA 2JLVA 4Z1MA 2E1RA 221PA 4LJYA 3R8FA 2IYWA 4WA7A 5AJXA 1R8SA 1U0JA 3VR4A 4X8LA 4EPYA 1ZNXA 3FPAA 2ZRCA 3CPJB 5JEDA 1N6RA 1VDZA 3AGPA 1E2MA 3DVLA 2R8RA 4EUNA 1E96A 1WBBA 4GOKA 1ZM2A 1Z5ZA 2B21A 4B3BA 4HB3A 1RVDA 2HXSA 4DSUA 4D6PA 2WJGA 3QVUA 3UANA 1EX6A 3X1WA 2AX4A 2Q9BA 5CLLA 2ZE7A 3OAAA 1KI8A 4A0RA 2QUZA 1TQDA 1BMFA 1HE8B 4QFMA 2BBWA 3DDCA 4BECA 1FOEB 1G8GA 4ILEA 4C4PA 3SQXA 4B2PA 3HWSA 1SQ5A 3IILA 2FSIA 4TLDA 3X2SA 2BV3A 3PVSA 2YNMA 2CL0X 2QPAA 3GLFB 3UWKA 2CXXA 5DHFA 4DLWA 4Q7KA 3U44B 5FI1B 1RZ3A 1Q3TA 4Z54A 1WF3A 3B13B 2CVFA 4ESHA 4QG7A 4M0LA 3W9YA 2VEDA 4C30A 5FTKA 3RAPR 2OESA 5JEEA 3V00A 3RC3A 2MSDB 2D62A 1G8HA 2OAQ1 1YZKA 3FWYA 4DCTA 3BRWD 2GVZC 4UJ5A 4NH0A 3RRNA 2P6RA 4IDPA 4NDZA 3MAAC 1G6HA 4LPKA 2QM8A 3LH5A 2FFAA 3W3ZB 1LS6A 3LXRA 5SZKB 4DCVA 1Q20A 2HXYA 2F7SA 1Q0UA 1HY3A 5GJBA 4URYR 1Q1QA 2JCSA 2W0SA 2YV5A 4PO1A 2AXPA 2GHIA 3NC0C 5E7MA 2XTZA 2GKSA 4R2HA 4EIWA 3LVRE 1US8A 3RVBA 1T4GA 4XSGA 1D2EA 2IF2A 3A36A 5FUVA 1G16A 4MH0R 1XB2A 1N5LA 2B8WA 3LBIA 3VX4A 2O8DB 1D5CA 2ZAOA 4I1VA 1NNEA 1NY6A 1X3SA 2CK3D 2ZRPA 1OIVA 2YOHA 1KZ7B 2ORWA 5JRJA 4OHZA 3CONA 1EFRA 1ZUIA 3B1WA 3CRVA 3W8RA 1HURA 1CXZA 2AR7A 2PEYA 4OQLA 1VTKA 2H57A 4TSFD 5JHHB 5L3QB 3O8CA 1AS2A 3B2EA 5E4FA 1S2MA 5HCIA 4EAQA 2OFXA 2PT5A 5EE3A 4L15A 4IOKA 4BASA 2C03A 3A58B 4Q9LA 2A5JA 3IHWA 1FP7A 2JLRA 1FUKA 3QOFA 1RKBA 3ECCA 4GOXA 1TX4B 1W2GA 2O5VA 4MRNA 3U3JA 1OSNA 5HZKA 4Q00A 3W6PA 2RGBA 5TVKA 3ZGXA 3AVOA 2GVDC 4Q1BA 1T6NA 3UWOA 4ZO4A 1BMFD 3RNLA 3L2OB 4MKIA 2CL6X 1AS3A 3U7GA 2EQBA 4MYUA 4N1AA 4P4SA 5CLQA 3RABA 1AA9A 4OQFA 4PQFA 2BJVA 4GL2A 2VF8A 1R4AA 5JLJA 2XGJA 4ESVA 2JEOA 5AJWA 4NYMQ 2OBMA 4HDQB 5EXXA 4RZ3A 1LS1A 4PHGA 1QHHA 4CW7A 3B5JA 2QN6A 2D2FA 5DHAA 4AWXA 4XVRA 2QZ4A 1YZUA 3CM0A 1PLJA 3EZFA 4A0GA 3LAWA 1N6KA 1N2CE 3Q72A 4LYAA 1SKYE 2CLDX 1XEWX 3NTUA 3ADDA 2F1HA 2EFGA 1ZM9A 2O8FA 3AP1A 1S3SA 5CITA 1E1RD 2IWRA 4JLKA 5FPKA 2YOFA 3RLFA 3U3KA 3NH6A 3RS2A 5EE5B 2V7QA 3GP8A 3TSZA 3WBKA 4URXR 1CR4A 2W6IA 2ZUCA 3ZVRA 1XD2B 1U8YA 3A4LA 4DUGA 2A2ZA 2D7DA 2AFHE 1KK0A 2ERYA 1LVGA 3KQHA 2D4HA 1N3BA 2YC4C 4EPRA 4EPVA 4Q4JA 3G5UA 2J87A 1F60A 2QG6A 3W5JA 4AK9A 4TYYA 2FPMA 4AKHA 3RWOA 4QKQA 3KDSE 3FHOA 1I2DA 3AVXA 1I2MA 2PBRA 4ZIRA 4Q9JA 4QC2A 4UJ3A 4ZPXA 3CX8A 1KI1A 5EP2A 1WDTA 2ANBA 1S4QA 1X1SA 1T9HA 2IC5A 3EX7C 3AVPA 4DKXA 2GF0A 2FFQA 3RS5A 3GMTA 5KYKA 4M8NE 1D2NA 2DFNA 4OKSA 2DCUA 2OHFA 2A5DA 4GT1A 2H16A 4JBWA 1ZP6A 2G3YA 4HAUA 1CJKC 4TTRA 1W1WA 2ZR9A 1UDXA 1M1YE 2LKCA 2ZRFA 1QHIA 1R8QA 3CW2A 5TARA 5AJVB 2R6GA 1NLYA 3LO5A 2O0JA 4JMPA 4OI1A 3LWNA 3I5YA 3C14C 2QP4A 4M1WA 2B92A 2FFHA 3K0CC 4CEIA 1KAOA 3GEEA 4V0NA 5LDDC 3GJ7A 4QL3A 2BHRA 3CO5A 1NN0A 1W4AA 4A0FA 2CEAA 1DTSA 2J0SA 4LSGA 4F7WA 4F91B 5IHPA 4US1R 1Q22A 3KKNA 4HDCA 4RZ2A 1XJ0A 2FFBA 3EC2A 4YXWD 1Z0FA 5TXGA 1G3MA 4MYCA 2IHYA 3IIMA 3CUEF 4FCTA 3QF4B 4PC3A 4C3ZA 5KO2A 1IXRC 4Q7MB 1G6OA 1CULC 3B7GA 3AF4A 3ZLJA 1NMYA 2OM2A 2UVQA 3ICEA 5CJ2A 3NEYA 3HPRA 4KSCA 3WP1B 1GILA 3LD9A 2ZPTX 3DM9B 1COWA 3MFYA 2XXAA 1P62B 4KITB 5BN5A 1OB5A 5JCPA 2X19A 1SXJA 1SKQA 3FGNA 1H8HD 4HI0E 2YC2C 3AVWA 5A5GA 3JZAA 1OKKD 1ZD1A 5KDOA 4KBFA 3TNFA 4HAVA 1N6IA 2IW3A 5F2EA 1F5NA 2FF7A 4JSYA 1ESNA 4AG5A 3MD0A 1L4YA 3CLVA 3QKRA 3FYHA 1JAHA 3KXIA 4XD7A 2EWVA 3CBQA 1N0WA 1SVSA 1TL7C 2Y8EA 1OV4A 2JGNA 2OT3B 2QMOA 3K53A 2JLUA 3U5ZB 1W2HA 3B1XA 1R0XA 1X8LA 2ANCA 4FMDF 4LOAA 3ZJYA 2F9MA 3CR8A 1AZTA 4Q1FA 2W0MA 2QQEA 1ZVQA 4MDEA 3AKYA 3LA6A 1W4CA 1OE0A 1B23P 1TU3A 1XMIA 5JSZB 3UKDA 4JIMA 1PLLA 3KUCA 2BBSA 3QPWA 4RD2A 4Q7JB 3GD7A 1FTSA 5CDFA 3IBGA 4KVAA 4AY2A 4C7OB 3F5FA 3W34A 2ZXUA 1VCNA 1NG1A 4HSEA 4W7SA 1ZM3A 2WSSA 1XEXB 4IDOA 2CMKA 4LDJA 1SXJE 4JBYA 1S3GA 4FXPA 4JT4A 3QKSA 1MO4A 1UFQA 4ZI3A 1HQCA 3RC8A 3TR0A 3AUYA 4LV8B 3LDAA 1GNQA 1HT1E 4PO8A 4QHYA 3GEHA 4M4SA 1KSHA 2CJWB 2DFTA 1MABA 2VPPA 1AZSC 1EFUA 5DYIA 2ZI9A 5IT5A 2QP9X 1Z6AA 2CL7X 2H5EA 5DYGA 2VO1A 2WIAA 5J4VA 1UBCA 5FUXA 3QXSA 4ZCMA 3T1TA 2VSFA 3AB3A 2JA1A 3R7WB 4DLTA 2FWRA 2DYKA 4NYJQ 2ZTSA 1COWD 1XCGB 1NSFA 4TT3D 1LW7A 4IW3B 2J7KA 2ATVA 4W5WA 5A0FA 3BB4A 1ZD8A 1NVUQ 3GJ5A 3FDIA 5H1YA 5CDFE 4HAWA 4A82A 1Y3AA 2GEDA 1E6CA 2L0XA 3OZXA 4Q4HB 2ZSBA 3WYGA 4DSOA 2R2AA 2PZFA 2C04A 4PSVA 5JS7A 4XD7D 3VX3A 1DAIA 1E0SA 2ZI3A 3WMGA 2X2EA 2OV2A 3QEJA 5D3QA 4HLQB 2BKUA 1AJEA 4YC7A 3HR7A 3F3YA 2VSXA 2P3SA 5GVSA 3I3SR 4MRSA 3KKOA 5DN6D 3QJYA 1WP9A 4FMCB 4FWTA 3QI2A 3ZH9B 1YR9A 2QRNA 3AKDA 2HCBA 5CB8A 3T1QA 1HEIA 4BFXA 4BLSA 1FL9A 3UG6A 2V9PA 3SYKA 1AKYA 4R71A 3PUYA 4MGKR 1NBMD 1XD9A 3FMFA 5KPJA 1N25A 3KXKA 3THOA 4QRHA 4CT5A 2DB3A 1Q1ZA 2AKYA 2IHBA 1DG1G 2NIPA 1P75A 2IYSA 3TMKA 3B6EA 3BXZA 2PJRA 4PO9A 2OAP1 1FX0B 2VHJA 3LQQA 2NO0A 2Q21A 3MJHA 1OLOA 1QHSA 2NO7A 2VIIA 1XRJA 2ZREA 2AD1A 3NG1A 4O0MA 4RKFA 2ZITA 4KXFB 2F1IA 4QNMA 4Q19A 1S8FA 1Z06A 5TMPA 4K81B 2ZROA 5JECA 1GL7A 1OXXK 4OQXA 1NF3A 2F9LA 4NU0A 4QOSA 5DSZA 4LZZA 5FR2A 4H1UA 1ZNWA 4MKFA 4KFTA 1T8TA 2VYFA 2JJ8A 3PENA 1P61B 2IS2A 4IOMA 1RRPA 3E2IA 2UZ3A 3K09A 4URVR 3FOZA 5F98A 2AKAB 1JR6A 2QE7A 4G0NA 5EZ6B 1YR7A 3SR0A 1GRNA 3ZIAD 3DO6A 4BLTA 4DCUA 1E2QA 3C5CA 421PA 1QHYA 4RZXA 3AF1A 3B9PA 3T12A 1U99A 2JDIA 2DFLA 2J9RA 1DE0A 3M1IA 1OXTA 2ECKA 2O8BB 2DBYA 2J1LA 4PPNA 3OIYA 5AUOB 3BAFA 3QF7A 1E9RA 4GI7A 1G5TA 3L8YA 3F0TA 3CRW1 4LX0A 2YWHA 3TIFA 4IFEA 1E4VA 4GPTA 3SC3A 3V4RA 2PCJA 2J0UB 4WZAE 2GWHA 2OFWA 4NCKA 4GFDA 4IOLA 4ZDWA 2ZU6A 1KJZA 5JFGA 1GL6A 1G7RA 1P7CA 3I8XA 5BWMA 3A1SA 2WWYA 2QTVB 1VG8A 1ZD9A 2J45A 3U7FB 1XNJA 4HZUA 1E2NA 3SS8A 1JR3A 4H9GA 2D3WA 4GMXA 1T91A 4ABYA 5JJLA 3VU9B 1R7RA 4GP6A 4WBSA 4JYBA 1NRJB 2C96A 1E2DA 2VLIA 4Q1EA 4IJMA 5F9HA 4KV9A 4G5RA 2ZS7A 4EFNA 1DOAA 2QNRA 4URZR 2ZJ2A 3HYRA 3QBTA 5K8IA 2ATXA 2QBYA 1RRFA 1ZW6A 4XVQA 4A8JA 4A2WA 4HB0A 5FBWB 3OE7D 5L3VA 4A2QA 3K70C 4D26A 2Z83A 3ZYCA 3I62A 1G4AE 2FPKA 2QI9C 4ZDKA 3A8TA 2A78A 4QGAA 1ZJ6A 3Q8XB 3D8BA 5BYKA 1GNRA 4Q4AA 1Z6XA 3FMIA 2LKDA 2ZR7A 4IDNA 2O0HA 5M04A 4OQNA 1GRRA 1OH7A 3LLMA 3EPHA 3EC1A 4EKDA 4DDWA 1A82A 5C1BA 5E95A 3M0EA 1EWQA 1E2GA 2C98A 1EXMA 3C8UA 5KPDA 1GL9B 2NGRA 1F2TB 4TTQA 3BGWA 2XB4A 1CP2A 3SE0A 3D7MA 1QG2A 3CRQA 4ASUA 1XP8A 3DZ8A 2BKEA 1GWNA 3UMRA 2IXGA 3CWZA 2ZVPX 4EJSC 1CR0A 1FPMA 2W2TA 3BD9A 3QENA 1GM5A 2GEVA 2ZR0A 3UMSA 2GZAA 1J99A 2PH1A 1JR3E 2VP4A 2XZPA 1QG4A 1VCIA 3IDQA 4FW9A 1RYFA 1JNYA 2PCLA 3TVDA 721PA 1ZINA 2PMDA 1GSIA 3QNUA 2GAAA 3SFVA 3W6OA 3AVTA 4RCYA 4CRWB 2XOKD 3SYLA 1XWIA 2AXNA 4NMMA 5A4JA 2QPTA 4W9MC 1DO2A 4FMBB 3QE0A 5P21A 1C1YA 3OIUA 3B78A 3H84A 4NE2A 1R5BA 2P67A 4BZQA 5J4KA 2TMKA 3H86A 5DI3B 3L0PA 5B30A 1UEJA 1GVNB 4RD1A 3KQKA 1YQTA 4BE7B 4DSTA 4A0HA 1CIPA 4MGYR 2AHOA 5FOUA 2ZRAA 3RRZA 2HEIA 2PLFA 2BM0A 4YMSA 4LJ8A 1QHHB 3DL0A 3ZD7A 3SDZA 2E87A 4HAXA 4DLSA 4EDHA 3GFOA 2ZM5A 3RSOA 4JL5A 2IXFA 1RE0A 4D0LB 4C2UA 4RFVA 3L8ZA 4DSNA 4YONB 2DWOA 2V6JA 5TB5A 2ZUBA 1V43A 3K0SA 4MITA 2PL3A 1XXHB 4IDQA 2IUSA 2VHCA 1VG0B 3C7KA 4AC9A 1MO3A 3UMFA 4KFRA 1Z0JA 1G19A 1ZYUA 3EPLA 3SHWA 4B3GA 3VAAA 2RGGA 3K0FB 2H92A 2FSHA 4Q03A 3LX5A 5CM8B 1NMXA 4P32A 3NIBA 1ZIOA 3K0AA 4DIEA 2YKGA 1OJLA 5SZJA 1KI6A 2D2EA 1QHNA 1NKSA 1UJ2A 5IDVA 3EG5A 4ZDIA 3IPXA 4Q4JB 5AJZA 3QY0A 2C9CA 1PUJA 2GZDA 4Q1CA 2C95A 4BEJA 3IEVA 2QMUA 3HDTA 1KO4A 1DAEA 4ZIRB 3WNCA 2XX3A 1JJVA 4QJ3A 3QKUA 2G77B 2ZJAA 1FFHA 4Y0VA 2ZYVX 2H18A 3NVAA 3I8SA 4L9SA 5H68A 3VR3A 1XZPA 1EX7A 3B9QA 2VP2A 1TUIA 1G3UA 4P31A 1RRCA 2WKQA 2YWFA 4E07A 3P32A 1W5TA 3THXB 3GCGA 4NYMR 1DS6A 1RPZA 5J4HA 4TSFA 4AKEA 4PANA 3TLXA 2QAGA 3GLIB 4MDFA 2FEOA 2RCNA 4G1UC 3EXAA 3LBNA 3CKLA 2CLSA 4BQSA 1GKUB 4S35A 3DM5A 2QU8A 3REFA 8OHMA 4KSBA 4DB4A 2ZU0C 5FI0B 2HJVA 1S1MA 1E9DA 1Z47A 4Y0AA 4PHHA 1AGPA 2ZYUX 3CH5A 1P60A 3WRXC 2XTMA 3T06B 3TUZC 1IY2A 2OXCA 4JLOA 3W3AA 3KKPA 4FCVA 3W90A 3A1WA 4M22A 4RD0A 5FL7D 4PC7A 2O8EB 2BJWA 3DHWC 4IXNA 2RH5A 2NO1A 1E1QD 4ACAA 1Z6GA 1E0AA 4QJ5A 5B2ZA 1G8FA 5FL3A 1AQUA 3GLHB 1Z08A 1SVOA 1GUAA 2P6NA 4TL6A 2R62A 4DLYA 5EE9A 1TNDA 2QORA 1JEEA 2CE7A 2EFHB 1YVDA 1DVRA 4B6FA 1TPZA 2IYTA 3SJCA 1SXJB 2VHUA 4A6XA 1G64A 2R6FA 5KSPA 4DT1B 2KE5A 1AGRA 4S2EA 5G3YA 3PEUA 4TLCA 4YDSA 1E1RA 1IQPA 1SVKA 4P33A 1E79D 2YWGA 5J4LA 3CX7A 2ZS8A 4II7A 2C5LA 5ANRB 4HZIA 3SI7A 2YVUA 2YZ2A 2CDNA 1E2PA 2O8CA 2WOJA 1IN6A 2WV9A 4TMTA 1U94A 4OQMA 1CEEA 5BN4A 4OI4A 1XF9A 3I72A 3PG5A 1YHNA 2DY1A 2WHXA 4LJ9A 3TSWA 4XWKA 1CTQA 3REGA 3GEIA 4L4UA 4B3DA 2YHSA 3UXMA 5JI2E 1YE8A 1QDEA 1YKSA 1XPRA 4Q4LA 2OEPA 4FINA 1X86B 3PR1A 5DISB 3JVUA 1YZLA 3BH7A 5CIWA 1XJQA 2EFCB 1UF9A 2QROA 1VCOA 3AH8A 1M6NA 2R6CA 3GPLA 2XZLA 5FTJA 3SJBA 2QM7A 3TQCA 3EZ7A 1G17A 4IXMA 2PX3A 1GP2A 5HE9A 3MG9A 4YLGA 4US0R 1Z0IA 2A5FA 4DIDA 3THWA 1DAKA 2RGNC 5LBIA 6Q21A 2HT6A 3VHLB 3WYAA 2HT1A 1NVVQ 4PPFA 4B75A 3QBVA 3H0KA 4LBZA 1VYVA 3QKSB 2ZJ8A 2GJAA 4ZKEA 4TN1A 2KBFA 5J4YA 1E0KA 1T3HA 3EARA 3TE6A 1KZGB 2NQ2C 4JVMA 5DO9A 1TF2A 4IEEA 5AWFC 2W83A 2J0VA 2F43B 2WJIA 2IYRA 1F2UB 3THYB 3ZS9A 4EQ6B 2ZJBA 2RHMA 4YXWA 1KO8A 1KTVA 4OBEA 1CJVC 1E69A 3B1ZA 2H7VA 1L7VC 4ZV4A 3MWKA 1NSTA 2D06A 5D3MA 3CNOA 1XTIA 3MRSA 1II8A 4OI2A 1Q1EA 1I4DD 1QHGA 1XTQA 1FMJA 4D4LA 3SU8A 3ADBA 2QRZA 1OYYA 3M6AA 2ZRDA 1W7AA 2H8KA 2V8OA 3KFVA 2C77A 1XCMA 4X8OA 4BUJA 1FMLA 4I1OA 1H8HA 3KTAA 3I32A 4JLPA 4U00A 2GILA 3L43A 4IEIA 1OKKA 1KDOA 4B35A 1P4SA 4HEJA 4R98A 1T0JB 3IIJA 3KKMA 4DDVA 4A2PA 1XMSA 3K1JA 3R20A 1E98A 1YZGA 4RFSA 4A4DA 4XOIA 4IDHA 4AG6A 3U60B 1RW4A 4JT2A 1XZQA 3LRPA 1NN5A 4JLBA 4QBIA 4L9WA 4PPQA 1SVWA 1R0YA 1VYTA 4JKIA 1CR1A 1X8JA 3HU2A 4Q9HA 3JZMA 5FOXA 2IS4A 4QHSA 2QGNA 1WA5A 2ZRJA 4PSAA 4EPTA 2ZE5A 3Q5DA 3PEYA 2IX3A 1CF4A 3SYNA 1BYIA 4Q47A 2A5YB 1UKZA 3ZQ6A 5C2JB 4BGDA 3QIAA 1E32A 1CR2A 3AVQA 2N46A 5HCNA 1LNZA 1OIXA 2ODWA 3VKWA 1H65A 4HLUC 2IXEA 5JMTA 1OH6A 2JASA 3NBFA 4PTLA 1NVWQ 2ZI5A 1QVAA 1UBGA 1GNPA 4B32A 5J5CA 1YZNA 2EVWX 3AGQA 3DPUA 1DADA 4WXPA 3V4FA 2GRJA 2FMXA 5HKKD 2XB2A 4B43A 4LHVA 3KJHA 1U9IA 5KSOA 1L4UA 2DHRA 5L8VA 1JPNA 3H2YA 3Q9LA 1P9RA 4GZLA 3MWLA 1DAHA 4KI0A 4G5QA 3K70B 3KQUA 2VHQA 5BN3A 1KI3A 3I4LA 3KX2A 4QGGA 1KDRA 2HJGA 1UPTA 4OK6A 4QM6A 5JI3E 1FW6A 1HYQA 3MJRA 1GFIA 3TAUA 5G53C 1HE1C 1P6XA 1ZAKA 2BWJA 5KNBA 2J3EA 1AS0A 1CKEA 1Z07A 2QMHA 3NWJA 1HH4A 1L2TA 4JZKA 3I1FA 3NBYC 2W00A 2BM1A 1FZQA 1GRQA 3RRYA 4PFSA 1W46A 2V3CC 4WOPA 1Z6TA 5AR1A 1G8YA 3TQFA 1D9XA 5FTMA 4TT3A 4W5JA 3X1XA 3A6PC 3QPVA 1Z2CA 4I4LA 1FNNA 3B82A 5DGXA 4EJSB 3RRMA 1QF9A 2I1QA 4LHZA 3FTQA 4BFWA 4FIDA 5KSYA 1W0JD 3GLFA 4LPSA 4CEJB 1ZRHA 1AN0A 1ONBA 4LYHA 4UQOA 5DE3A 2ZUDA 3PEWA 4CVNA 2BBTA 1U8AA 2ZI4A 3QQ5A 4IOJA 1QRAA 2WM9B 3ETLA 2VQSA 4Q48A 3TAHA 1W0KD 3DMNA 1TU4A 3H1TA 1OHHA 1OXSC 1PUIA 4UXHA 2FDCA 4TZ0A 1OB2A 2V54A 2A7QA 2R6DA 3CZPA 3KXLA 3QEOA 5DN6A 3UATA 4TQAA 1E0JA 2ZYTX 3EW9A 3LBHA 4LJ4A 2QPOA 2EFEB 3VMFA 5JWHA 1G20E 3LVQE 3IPYA 2VP9A 2WAYA 5CB6A 1CU1A 1KY3A 3CPHA 3RHFA 1G7CA 2IA5A 1G8PA 1NBMA 4DLUA 4TL7A 1G1MA 2PEZA 2ZI7A 2GCPA 1A2KC 4M1YA 2XJ4A 5CK4A 4M1MA 1T0HB 4JVNA 2IL1A 1ZU5A 4NYIQ 2RKOA 5C18A 1HTWA 1K6MA 4GOJA 4C0JA 4GZMA 2ZSEA 5J47A 4US2R 1FUUA 2O8DA 1AM4D 1NIPA 2J7PD 2KSQA 2ZRHA 1E99A 4E03A 1G5PA 2HYDA 4D4JA 4KCGA 5E7IA 1JXOA 3BB3A 3GLFE 1E4YA 1EESA 2FE4A 3GJ4A 4MRVA 4Q02A 3QKTA 2VP0A 1BO6A 1XJCA 2CHVA 1MO5A 1B0UA 5SZHB 3MUFA 4OJQA 1SXJC 2QENA 5L3QA 1PZNA 1E3MA 4PPGA 1VMAA 1XX6A 2V6IA 4MYTA 3TGPA 1CLUA 4BRUA 1KMHB 3U4QB 5HE8A 5FUWA 3GLGA 1CS4C 1CBUA 1U8ZA 1XMJA 2WPDA 2FSGA 5DNYB 2R9VA 1ZCAA 5EP4A 1P73A 3BE4A 3CF0A 4RD3A 3S1AA 1OH8A 3ZIAA 3P26A 1P2SA 1XTKA 4R2IA 4HB4A 1R5NA 4DBLC 1NBME 2Q6TA 3EZ2A 4PZLA 4QBFA 4UNNA 2K5UA 5FOTA 1VHTA 1OFHA 1E94E 2B7CA
chains in the Genus database with same CATH superfamily
1L0BA 3M9XA 4PZ0A 3A1CA 4UE2A 3PL1A 2DR0A 4NP6A 2PZ8A 4GKJB 1DQSA 5EJ7A 1E66A 3O8QA 3SZRA 3WLQA 1E9BA 3CUVA 4UHEA 2IX9A 1KYXA 4P54A 4HT3B 2JI7A 2JI9A 3DKPA 4FMCF 4NZNA 3WLLA 2OUIA 1KWKA 2JH3A 3AXSA 1Z33A 1I51A 3SM9A 1C8KA 1DJQA 5E3HA 5HS4A 4PLVA 2P4UA 4D6YA 3WKCA 2CHQA 4F4CA 1JG1A 3P9CA 3VV2A 2IQ5A 4IYJA 4CR7A 3ZY2A 2Y92A 1GU7A 2I55A 4R1OA 2FEXA 3FUTA 4D43A 2ID7A 1NQOA 2XF8A 2CNWD 4XGQA 3DHEA 4OHYA 2FWIA 3J81k 3R24A 3H9UA 4WKBA 3F98A 3OE7A 2GN0A 5H70A 1UXKA 1Z0KA 5H82A 1N0IA 3P52A 4AMVA 1W5AA 5GV7A 4MV1A 3KR9A 7ABPA 5LJIA 2GD0A 2GOYA 1JP7A 1ZXBA 3K0AB 1GKYA 1Y8AA 1LJLA 3I53A 3ZCPA 5ITVA 3G02A 2EIXA 1R18A 1DU4A 1EP1B 1T8WA 1H3FA 2X5XA 4OU5A 2NUTB 2QUKA 4JODA 5BVGA 4G5FA 3UKOA 2WFLB 2BR5A 2I6QA 5EI5A 2JFFA 4E08A 5A06A 5B57C 3E82A 3BXHA 4U2CA 5DLQC 4MVJA 3WTBA 2MINA 5DGIA 4XQEA 1KHTA 3PXAA 2P5SA 1KPIA 2CCJA 5CCXA 3UYKA 1ONNA 3BMNB 3B8HA 5C1OA 5KVQA 1MA3A 1KC3A 3UMYA 4X9XA 1D4OA 5LOVA 3QVGB 5AW1A 4BKOA 4URFA 4O4LB 3SX4A 4MCHA 2BCGY 2IUTA 2HDOA 5ALMA 4L8FA 1NAIA 5D2CA 1BJTA 1Z6YA 5JVDA 2O19A 3UWMA 1PDOA 3BL8A 1R0BA 2IH4A 2W2VA 2Q1UA 1FQKA 2Q0SA 2XSZD 3CNLA 2HLNA 2W11A 4R2KA 3V33A 5CG2A 2VHVA 1QP8A 2A5LA 1Y3CE 4HDSA 2QJFA 1RAGA 5J40A 3T9CA 2C3UA 3VPSA 3QG5A 1U8CB 2XMZA 2HZ7A 3QI7A 1EK6A 3L7OA 2CV0A 1ONPA 2XOKA 5D51S 3JATA 5FO1A 1T13A 3DOHA 3AR6A 1IN7A 3HPQA 3T4EA 3LL4A 4MUKA 4BFSA 3BFVA 1SC4A 2V5VA 1KJ8A 3PWSA 3PEFA 1EDEA 2CUZA 3BFXA 3IR5A 3TRKA 4HEA1 3AETB 1EMDA 4YIHA 2O59A 3TSCA 1MEJA 5CK5A 2R8BA 1D2MA 2C2XA 4YUYA 5U9CA 1BEZA 4LGMA 4YN3A 3CUWA 4LJ5A 1A4RA 1UMBA 4IGAA 4V0KA 3HKCA 3TUIC 2D13A 3FZEA 4EI9A 1K0FA 1YR2A 2GUGA 4IQFA 3ZE0B 2ILVA 3DMDA 1UBMS 1WW2A 2B1QA 2XIQA 3EXFB 3BERA 2Z5FA 3OX3A 3TL3A 1PQYA 4B7CA 1RVV1 3DEHA 1JHAA 3ZR4B 4JFAA 4I55B 4AMGA 3Q88A 1U3CA 3AW8A 1EGAA 4I0WB 4PLYA 4YASA 4EFLA 3GGJA 1KZHA 3QWFA 1RHKA 5FLKA 2O7SA 3KT8A 4WLOA 5GJWC 5LA6F 3T1VA 1M7BA 2V55B 3PKIA 3T61A 1HRKA 3HZZA 3IXMA 3EZLA 3AY7A 3AR5A 4O4IA 4CQMD 3HUUA 5EEHA 1O3YA 2GYVA 1MB2A 4HAYA 3KNZA 5AKKA 5JSUA 1QTQA 2G1JA 4TS4A 4PTZA 1FNMA 2J6HA 1IUNA 3PFKA 5TMDA 3TLJA 4OY3A 1JW9B 2HDHA 2JGEA 4EO7A 5DVZA 4JFRA 1KEPA 1S01A 5L7YA 4M1TA 4D46A 4FNMA 1D09A 1AE1A 1NC1A 4Q1DA 1X7ZA 3S68A 4BJ1A 4Z6KA 3IOCA 3ZY3A 3VPGA 1US8B 3DDUA 1V0JA 2GDZA 4NWIA 1KAGA 4O25A 1EUDA 3K09C 2NXNA 3LGSA 2VDWA 3ECSA 4JU9A 3A7DA 2ECQA 1MRNA 1ZK1A 3QLJA 4DAEA 2DHEA 5HWSA 1I3CA 1ZJZA 3SLGA 4UZFA 3UT5B 1Q0RA 2GEFA 3T4XA 3W6UA 5KNCA 2JJ2D 4L4RA 2JK1A 5K3FA 4XYEA 3L84A 1VRWA 5GJCA 3RSSA 2XOEA 1YZHA 3H75A 5BQOA 5CFLA 4GM0A 5E38A 5AXAA 2C4KA 1GTL1 2QTFA 3A6EA 5EP1A 1OFUX 3BOSA 4DBZA 2P9EA 1QJ4A 4EYKA 1RRMA 2FW0A 1CIVA 5CVVA 1G2IA 3S40A 1E2LA 1QH0A 3GJYA 4FYIA 1Z6ZA 3GCZA 1RAAA 1U3DA 4N4AA 4ZRMA 5F52A 2RD2A 2CCGA 2AFHB 1N2OA 1X2BA 3LZCA 3LKZA 3PE3A 4QTUB 3R7NA 3FPSA 5GZ1A 4G1VA 5IN5A 3IPLA 4U8GA 2A67A 4QVGA 3OZAA 1T2VA 2VT2A 4QPZA 4BMNA 2YWRA 4J9UE 1IIBA 2OTCA 3TOCA 2X9VA 4X7BA 4BEBA 5JJBA 4YK7A 1XTJA 2ZK7A 1TQ4A 2I76A 2PVPA 3GARA 4PSKA 1U7DA 5DLYA 3AF6A 2AVNA 4ZVPA 4C9BA 4ZMRA 1HDCA 5BW4A 2JLWA 1QZZA 1SEVA 2K4MA 2JJ1A 5LQCA 2RGDA 3ZVLA 3MAJA 5D3MB 1S9HA 3OJOA 4A8JC 1II8B 1WVIA 2O3TA 3WLIA 3OWOA 4JK3A 4K6GA 4LJAA 2R8XA 1PR6A 2WVAA 4PZDA 4YACA 4IS3A 2JB9A 1A2OA 1NP6A 3FMGA 1FSFA 1A9XB 3E84A 2DPLA 2GA8A 3CIOA 1WETA 2B4AA 1N7JA 2VJKA 1KZ4A 3ABOB 4XFJA 3WS7A 3OT1A 1RWMA 4DJDC 1XDBA 3UN1A 4O2BA 1A4XA 1DT3A 3I76A 3QVTA 3SMVA 4PLWA 3VVMA 4MQEA 2WFMA 3HDYA 2BEKA 1E79A 1DCTA 3PNBA 4ZWNA 2EJUA 4LEIA 1MOZA 3BKWA 4NBNA 2QZ9A 2QW0X 3T0IA 1X1RA 3ZWVA 5KHLB 1UFOA 5H16A 1UM9A 2XUFA 3E7WA 4G5OA 4R3UC 4X1IB 4CLRA 3WV5A 4MUAA 3KU4A 3ZDYB 1JXQA 4GRDA 2JAQA 2SCUB 2XNDA 4AX4A 3T1YB 5HS6A 3EUWA 3C7CB 1EFKA 4DLZA 2GZSA 4MNTA 4RCZA 1EVKA 5FR1A 2QTAA 4GEGA 2V4MA 2NZJA 2IK8A 3DC7A 4DCGA 1J0EA 5JO9A 4HGPA 4MB6A 5AVRA 4HG2A 3PR2B 3QTLA 1OD6A 1V1RB 2BIFA 5E6UB 3QMVA 1U3FA 4ZTBA 1X3LA 2BUBA 1H4VB 4HNGA 4D74A 1SWWA 5CB4A 1NHWA 2X0RA 4FE3A 4EB3A 5IWAB 4O02B 3VDXA 1D03A 4CIAA 4X8MA 2HDNB 3GJ3A 4BBAA 1Y8ZA 4BRWA 3PYMA 4GMDA 1IHUA 3KETA 3LQ4A 1X9HA 1PWYE 3MWYW 2IEAA 3DBHA 1PQPA 4JQOA 5CJPA 4ENTA 3IJRA 4Z3KA 1FX0A 1I5RA 4EUHA 1ZWLA 1G5IA 2NSJA 1Q7CA 3E8MA 3HYTA 1AX9A 1B76A 4KFUA 4N5NA 2C7OA 2QY6A 3L5OA 4RWEA 3OCVA 1DBWA 3L6RA 2Q99A 5G0SA 4NJEB 1G4HA 1OFVA 2DT8A 4GOLD 1P2UA 4XJXA 2C4UA 4HWOA 3COVA 1C1XB 3A1TA 5FJJA 4CGYA 1AMOA 3WLHA 4CEIB 1U2RA 1GU1A 1HL7A 1G0OA 4ZT6A 5EUQB 4QJBA 4UUAA 7AT1A 1WDMA 4AI6A 1TVEA 4PLCA 3EISA 2CFOA 4TMVA 1TK9A 3FMPB 5CT8A 1KK2A 3WV4A 1OLSA 3EZYA 4WCVA 1VCMA 3OFKA 3RWMB 3RU7A 3RFTA 2IV3A 1GN8A 1JR4A 3OIVA 1Q1GA 4CL8A 1L3CA 2D4AA 2QR5A 1LB1B 1MNAA 3K8YA 3DQPA 4X41A 1DZ3A 2VPIA 4F5EA 4TMFA 1I2CA 3I09A 5ALKA 1FRQA 3BWDD 2JIZA 2EBHX 1P2VA 5DI9A 2O8BA 2IQIA 3ENZA 1UM8A 5IH3A 4GICA 3QXXA 1SVNA 4Y30A 3KJGA 1MKYA 2D5LA 1XLUA 5AK5A 3EBPA 2VAPA 2RGUA 3IA7A 2IT1A 3C3DA 5THXA 1NUTA 1CD5A 4O2AB 4D8UA 5BT9A 5IKEA 1P3JA 4MGHA 2J0UA 1EVLA 2RGNA 3HCBA 1JHZA 2HMTA 1VHLA 4K46A 1F17A 4KIWA 1P1CA 3UFXB 1FE8A 1YZTA 4L57A 4MPTA 1HNXB 2Y1WA 4K88A 2H1RA 4NCNA 3VC7A 3LK6A 4L4XA 3QNMA 4FN5A 2DH6A 3A70A 5IBRA 4YMVA 3DV0A 3Q0TA 1A5BB 2ODEA 3SHFA 3KUDA 4BB9A 4DXDA 3ROKA 4FHCA 3DC2A 4A23A 1ECBA 4F6RA 1E92A 4F4IA 1HLFA 3CMMA 1OXVA 3ND9A 4N40A 4QQKA 2HUPA 2QZPA 4U8HA 5J9FA 2O2EA 4ES6A 3OCJA 1XA0A 3WNVA 2JBHA 1PFWA 3GXBA 2R6AA 5HJEA 2WF9A 4ZA2A 4BLPA 2ZJYA 1T5LA 3IBSA 1SQGA 5H80A 5DX8A 2WSMA 3EIWA 5H3HA 3BGDA 4ZMSA 5IK2D 1OOEA 5KB3A 4ECAA 4HN2A 2AE2A 2AC7A 4EY5A 2C58A 4FJ0A 5K3EA 3ZJ5A 1CZOA 1E1NA 1IEQA 1VSUA 2BGMA 2IEZA 2ZSDA 2V7EA 3DOFA 1W8DA 2G04A 3L49A 4NBVA 3UENA 4YAWA 2C2BA 4B3SB 4JXXA 4YRLA 4C7KA 1PJRA 3FFBA 4IXWA 3F49S 1EDOA 5A2GA 1LI4A 2WIBA 2FJ0A 2CFIA 3PJGA 2I34A 4FT2A 4RLQA 5G4KB 1P77A 5EUBA 5GONA 2XD4A 2P0YA 3ZDQA 1Y1TA 3U16A 1FP1D 1V95A 4WZBA 3DZCA 4PHCA 4LFBB 4UUBA 2FK8A 4NHOA 1HXHA 4Q1AA 1N0UA 4TMKA 2WFAA 2YNMC 5LCXA 5IM4A 4D8XA 3NMUF 3KLBA 1EP3B 2GAIA 3IE2A 3SZLA 5EGNA 1YR8A 1KDZA 2HMAA 4RXMA 1WY7A 1E3WA 3GPBA 3DW3X 3F4KA 3QLUC 2ZDHA 5FA5A 3IELA 1XZ8A 3NIGB 2YL2A 4LIPD 2WIKA 4GHWA 5DTEA 5HMMA 1X1TA 2APJA 1BN7A 3JYQA 1DARA 3FUWA 3PDUA 3TLYA 5CW1A 1WP4A 5KDLA 2QUHA 1ESEA 2XTJA 2ENWA 3UWDA 4FFPA 5EXSA 1H6DA 1RNLA 4G4SO 2HREA 4YT4A 3WK8A 3BC1A 2AS0A 2X8AA 3N28A 2P8JA 3GEDA 2PKRA 2RHTA 1W88B 4HDKB 3VHXA 4F7DA 4OX9Y 1JYEA 5DRTA 2O50A 3I58A 3R8CA 1BC5A 3S1AB 1DAMA 3UAVA 3DFIA 3T1NA 3HTXA 1NJ6A 2L42A 3BILA 3UMGA 4CZ2A 1JDTA 4YCDA 3URMA 1GDHA 3OAAD 3NP7A 4GE3A 4H35A 2AYYA 5LBUA 5CB0A 4EOGA 4E1AA 2ZRNA 4JUDX 4OQ4A 1BKDR 4CIBA 1EGVB 3QVVA 1Z5WA 1PL0A 3QITA 4L8WB 4EG5A 3RC2A 5BV0A 4V02A 2QYTA 1BFDA 3PC2A 2IELA 5ELXA 1MPTA 4EFDA 2ZSAA 5G3ZA 5FWAA 2OCXA 3NM4A 3NQ41 1UBFA 2W2LA 4H0FA 1N2GA 2AR0A 3V4VB 4NYIR 3T7CA 2CBZA 1KK3A 2ZSHA 1P2TA 3ABSB 3FZNA 3K0CA 4DIFA 5JXIA 1MJGA 2ZEJA 3OZWA 4GKAA 2XMCA 4JI0B 3CRMA 3CRRA 2E6KA 2IH2A 4J03A 1BXGB 5IN4A 1GUDA 3IDAA 4NIMA 3SBEA 4I14A 2ZJ5A 3SBOA 3VBEA 3FWZA 5JDIA 5I7HA 1ZWKA 1EU1A 2DY0A 4PM4A 2HIAA 4A0QA 5LZ7A 2GKOA 1WUIS 4J1TC 4QYTA 1UK8A 4MI9A 1L4EA 5DOVA 2W2PA 2J9ZB 3FVRA 4X60A 3ZW9A 4C0XA 3T15A 3U3ZA 1K75A 3C3JA 4FI3F 1ZK4A 4K1LA 3K0FA 3UUWA 4MUXA 4NZZA 1O03A 1C1HA 1HNZB 1FF9A 3TW8B 4JLVA 4C4AA 2VSOA 9LDBA 4NCHA 4H3HB 1JHUA 1YZFA 4KN5A 2B25A 1DBSA 2WHPA 4DSZA 1H2ZA 2UYOA 4FW8A 4XDYA 4AYTA 1F3OA 2NXCA 4XSHA 4WZAB 2CFCA 2G9UA 2BGKA 2JBAB 2VDRB 4U4AA 1QKIA 1LSSA 1F7VA 3LGXA 1W36B 2V1UA 5E6SB 1J0CA 2GPBA 1JEYA 3DYIA 1D6JA 1UDWA 1V7PC 3JQQA 4CUJA 3H1PA 1UDRA 1G5RA 1P6QA 1MT3A 1QRRA 3OM9A 3NT5A 5ALZA 2P6OA 2QD1A 1R50A 1SFRA 3NHRA 3DBRA 2NACA 2UUPA 3LZ6A 1RRKA 3FBTA 1UQUA 2FOLA 1LVHA 1NBEA 3Q2IA 5FCDA 2ZSUA 2GF9A 3BZWA 3THXA 1YK1A 1TYDE 2PMCA 1EBUA 2EBUA 1FDTA 2JLSA 1RCTE 4FPXA 3GLIA 4WW0A 2GETA 1N6NA 3FFXA 3GRCA 1F3LA 2RI1A 2WKSA 4DV6B 2OENG 2BM8A 1XAIA 3TRHA 4CM1A 2ODBA 1RWKA 3FDZA 3MILA 3T5AA 2NZYA 5TMBA 4KXUA 1TEZA 1TM2A 3ZWNA 1LI5A 5K3CA 3GNLA 3GFTA 4TMXA 1JB1A 5BN5A 2YVKA 3LY8A 1M73E 4Q39A 1N78A 1YDMA 1YVEI 1MP0A 2X8WA 2XQVA 1SQ0A 1EUCB 2VDVE 3EMKA 5IVHA 1KJWA 3F6EX 3WP0A 1SCIA 2WTEA 3K5IA 3VKUA 3BWXA 4PS1A 4UHCA 1JIQA 1NZJA 2CVZA 4JP3A 3L7IA 2O8EA 1LBSA 4TXMA 4MB0A 3TIXB 2QG4A 1KQPA 1VIAA 2EYUA 4C20A 3NUGA 1SC6A 2VQ6A 3V1UA 1FVOA 1EZZA 4PG4A 4INPA 4HLDA 2HMWA 4YV2A 4P4GA 1PK7A 1Z28A 3CHYA 3K9LA 4ZXFA 4Z2AA 1QP0A 1N2ZA 1YTLA 3LW8A 3VI3B 3EOAI 4QUBA 3NDIA 4PINA 1GOTA 3S27A 1L5YA 1SBIA 1SOAA 4D99A 3MA0A 4WESB 4MV3A 1C30B 1VLLA 1BS9A 1NXXA 1ZZGA 4QODA 3WHLA 3GZNB 3V8MA 2E4UA 3KPUA 2AD5A 3MMPA 5FOSA 1NVAA 1TC1A 1SULA 2R8PA 4OH1A 2D0PB 4B3JA 3B20A 1GGNA 2OGWA 3OHMA 4AQYB 3UJHA 1IJBA 4IZ6A 4X20B 1ZC3A 1R00A 3G1WA 2IDZA 3A6JA 1Q1AA 1TTHA 4HGQA 4RY2A 2W6ID 3DOUA 4AUNA 3E9ZA 1CY6A 4R54A 1X7GA 3NIWA 4PC6A 3ZQ4A 1TQ2A 3FYUB 1ZM7A 2QTWB 3I73A 1B8UA 1SH7A 3AQ4A 1EA5A 5DHSA 4CM6A 1PSZA 3CZQA 1CRWG 1X74A 1T8UA 2ZAMA 3OU7A 2FMTA 1KO1A 3JQ8B 4H4EA 2QR3A 4EITA 2IF0A 3JPYA 3WICA 5E2IA 4U7PB 2AQIA 3O26A 3TTTA 5K0NA 2MYUA 3B85A 4CYMA 3I9V6 1YJ5A 3KC2A 3LECA 4GLOA 3TBKA 4HUQB 2DQ4A 1W73A 1GQ2A 1AA6A 3N2GB 1ZFNA 1QO9A 2HRQA 3H2IA 1DAGA 4QXOA 4V1CB 4IGFA 4RTLA 3TTSA 5KEIA 3DEJA 4ZFNA 5K6AA 3LCRA 4PZZA 2R6JA 4HRXA 2JIBA 2HWWA 2P0EA 3RC1A 1LY1A 3T9EA 2DCMA 3GLHE 1XZMA 1XMXA 2JIOA 1S2IA 2H0AA 2Q5CA 4WOJA 5AM0A 4ZVQA 2Q2VA 3R0IA 5FPHA 2BHSA 1RAFA 4EHKA 1HZJA 1FRVA 1N2BA 1VLZA 1M1NB 2HU8A 2XEXA 5HZHA 1TKAA 5CFNA 3WB1A 2EJCA 4M9XA 2AOUA 4BMXA 2I3DA 3VDNB 3M34A 1XZJA 1Y8QA 1PLKA 4FEEA 4ALLA 4RA9A 3C5WP 4JI1B 3FKSA 3MGCA 4AY5A 4LJ6A 1XVTA 5FLEX 4LCEA 4YGXB 4QBKA 5JNLA 1IXZA 1F6BA 3UF0A 3ZHCA 1G21E 4PYQA 2WVHA 3D3WB 3FD8A 3OZEA 4R6XA 1OWNA 1UAGA 1ML3A 1M0SA 4ZCLA 3W2TA 4C4RA 4NR0A 4EELA 4U6SA 1H05A 2WAAA 3G85A 5JC8A 3THYA 2E5LB 2CHFA 1DTWB 4UDNA 3BQNB 2D1TA 4A16A 2OD7A 5LC1A 1NI3A 2A6PA 1PDWA 3F96A 4GSYA 3UC9A 2IH5A 4L6AA 4CCWA 4JBHA 2W6CX 1K8ZB 2C99A 4DZZA 5I7EA 4JS0A 3DKRA 2GD1O 4G4GA 3C98A 4M9QA 4RM2A 1EFTA 3LOUA 1UBOS 4AWBA 5IKPA 2ONYA 1ZNYA 1QOZA 1U28A 4LV6A 3OQOA 3I52A 3R7DA 5BYBA 4B81A 1CFJA 3DO5A 5CMLA 3ADOA 3NU1A 4WX2B 5B3KA 2HA0A 3WQQA 1ST3A 3TXAA 2A9OA 4NU8X 1MB3A 4YCMA 1VZ2A 3IPCA 4N3GA 3E7XA 4FHZA 3AVVA 1WRBA 4J75A 4EQZA 4DA4A 3EVZA 4N0EA 3VGJA 2WNSA 2QP3A 4ND2A 3ROEA 1ADJA 3I2HA 4Q3DA 4A6PA 3E9DA 4FR0A 1GU0A 2Q8QA 3T8YA 4ACBA 2FAXA 5GMOA 4ZCIA 2DLNA 4KNYA 3PSAA 4BBPA 4WCDA 4RJLA 1PJQA 1S2NA 3UGJA 2HIHA 2R8OA 2XUPA 3WQSB 1JJBA 4BO3A 4JHXA 1SIOA 3DZFA 3QU7A 4ARZB 5LLSA 1FP6A 5AKLA 4R3NA 1Q21A 3GFPA 2JGMA 3KEGA 3QVWA 4LCJA 3V8QA 3PI7A 1J25A 4XH9B 1XPJA 1T3TA 5TY0A 3PPVA 1Y5IA 3O0TA 4GOOD 4DGSA 1U7OA 2X2FA 1SPBS 3E5RA 2WW8A 3UICA 1MIHA 1LLQA 3DOEA 1A96A 1WCIB 2BMJA 4AURA 1O95C 1TJ5A 3C43A 2YJGA 4XFKA 5HMLA 1L5MA 4AF7A 1SVMA 2VNJA 1QNFA 1GV0A 3LC1O 1U0BB 4I9UA 5CNKA 4JROA 4O8ZA 3PPYA 4DA0A 2FP4A 1V8OA 1NVMB 3LXUX 4LCBA 2QA5A 4JUAA 1T4MA 1BN6A 4XIFA 1OX4B 2VPXA 5G0UA 3A2MA 1BMTA 4PONA 3L04A 1RP1A 1CZLA 1KMMA 1A97A 4OMFG 1QHXA 1F8GA 3C3MA 5JXHA 2CXOA 3UHOA 4W9NA 5AVKA 1JTEA 1BCRA 1Z4LA 5DN9A 3QLEA 2VTBA 4BFYA 2GD2A 1B41A 2VF7A 4KACA 3H1BA 3AP2A 1NOJA 2FJUA 2YW2A 1W5BA 4GX2A 4PAMA 3T95A 2XUZA 1CRZA 2JATA 1HRDA 3IIEA 4L5AA 1PJ2A 2WWGA 4D6XA 4MZDA 4MQBA 1PQ4A 2G8LA 4PLGA 1MQSA 2A7XA 3K8QA 3ZWQA 4F86A 2PGIA 1BOOA 3MT8A 2JD0A 1ZGJA 3C4QA 3HDGA 2FLWA 4DZTA 2EL7A 2AIRA 2DPXA 2MMGA 1NVEA 3D4IA 3O4RA 4M1SA 1RJEA 2DSNA 4QHTA 1B8NA 3KOYA 5F3WB 4KN6A 1VMDA 1NFRA 3W78A 2VPZA 2GI4A 3K0KA 1IM2A 4Z51A 4XAQA 3I2KA 1ETUA 1EK0A 3Q9NA 3R3WA 1EHIA 4MA0A 2O54A 3RUCA 3E81A 1D2RA 1LNSA 4QTTB 4G65A 3SHQA 1C7QA 2H63A 2H52A 5FOVA 5DF1A 2WV7A 4MUMA 4O1HA 3PCTA 5ITZB 4GL4A 3CVUA 3H8VA 3P9RA 1IZ7A 3L0YA 5EIBC 1P1RA 4A92A 4YRQA 4NJMB 1RBQA 2NW6A 3GL9A 3W5HA 2O8FA 1YKGA 1Z56C 3IKJA 4IIJA 3RS4A 4ETWA 1IB6A 1XZNA 1P19A 2O8CB 4IVPA 3OEWA 2GGSA 1TIBA 1L4KA 2RGXA 3IA2A 5G4LA 3UFXA 1NPYA 3SLRA 2R1UA 2ISSD 3JAWB 3MIZA 3RQSA 3IKLA 3SG0A 2NSHA 1IBLB 1WZNA 1YBVA 3ABZA 3Q7QA 2F3RA 5LVAA 1EXDA 4EHNA 4YPVA 2EF0A 1R5OA 2I65A 3K7EA 2OILA 1E58A 4CKWB 1IN4A 1H2BA 2FW8A 4DAOA 3ANNA 3AUFA 3AEUB 3I6IA 4FFWA 2FFRA 4I50A 4M8LA 3VVCA 3O8DA 3NPAA 3MPUA 1O87A 1XNQB 5JISA 1AKEA 5EHZA 4TPKA 4AJLA 5MGNA 2ODAA 2P2CA 4RSMA 1OJ7A 3V4SA 4DR2B 3DV2A 3QFCA 4KW7A 4GP9A 1U0TA 4Y1GA 4YUVA 2D1FA 1M8PA 4DLKA 3GAAA 5F9MA 4IMJB 4GPAA 4QTZA 2NPFA 4N0DA 3RSQA 1DWOA 3GCWA 4ZU3A 2LWIA 5REQB 1HG0A 1KOGA 4YREA 5EIHA 1PZXA 3ER9A 1KZ6A 1BWPA 1ITZA 2BTQB 3X2FA 4EB8A 5AK4A 1PK8A 5BN1A 2JL1A 3THWB 4OI0A 4G89A 4M46A 3NRJA 1KEVA 1QCZA 2HWXA 5J2UB 1CK4A 2PA3A 2HLPA 3AOGA 2ZSFA 1HV8A 2CYAA 1TKRA 1TTPB 3L4BA 1TXGA 1C3LA 4RF5A 4KGVA 2H2IA 4TLEA 1AURA 2AA3A 3U4CA 1THGA 3A25A 5EG5A 4UXJA 2YCBA 4OLAA 1GIAA 3HJNA 5DNAA 2C5GA 2B3DA 2CVHA 5SYMA 2AWNA 3OPYI 3BJIC 1HLGA 1HI9A 1MD9A 3KL4A 2OSVA 1KMHA 3MMXA 3OFNA 2OB1A 2HMVA 2DM6A 3ER6A 2VL7A 4QOIA 2EDCA 3C7AA 3L8CA 4CDGA 5BW8A 1V8DA 1USIA 2VAWA 3DAHA 4YDRA 1UKEA 4Q21A 3V9AA 2XCUA 1L5RA 3WE7A 3GQBA 1V3VA 2VHEA 1MV5A 2E5WA 3STUA 3F9RA 3OMWA 3UJAA 3OFJA 4GNKA 3MPOA 2I2DA 1NOKA 2A9RA 2DETA 2G0TA 4F38A 1U2DA 4CODB 1QV7A 1EFPB 3D6TB 4BRSA 1MW8X 3Q8KA 1HNNA 3CH7A 3OEED 2AJCA 1SXIA 4TMWA 3MBOA 1CYDA 3IQWA 2A0XA 2GBPA 4Z8YA 3VYTB 4JN6B 1DL5A 2A59A 3AIOA 3AFGA 1EE1A 3FOFC 3G2KA 3LHIA 4LYFA 3AU8A 2CFTA 4TX1A 5FOXA 3WGKA 1QQ7A 2ZCVA 4Y2PA 3R9WA 2M32A 3SOZA 3L1HA 2PFSA 1ORTA 1RS0A 1E2IA 1P8AA 5CYPA 4BO6A 3A4NA 3RS8A 1FQJA 1BDBA 4EHIA 2DF8A 4G5YA 1W85A 1WO8A 4LZNA 3WLTA 3C5HA 1QDLB 1BFUA 2JAXA 3O38A 4TWZA 3V1MA 5EMLA 2JAHA 1N2SA 3GHYA 4IWNA 5DBGA 4EA6A 3PGMA 1W6UA 1K27A 4O2RA 4IQ0A 4AWAA 2OXEA 3A1UA 3ESBA 5K03A 4AROA 3DDNA 2CD9A 3ZDCA 4CCSA 1GKLA 1G4UR 1WHSB 2EJWA 3KQSA 4OO3A 5TT0A 3WG9A 5FBVB 2Z2XA 2NV2B 2B2NA 3BD8A 1H42A 4YV0A 1ZCFA 2F00A 2XXBA 3PZRA 1U0HC 2NO9A 3ORSA 3ZU6A 4TYPA 1TAGA 4MR9B 3EGCA 3DZDA 2FKNA 5I7UA 5AKGA 4H16A 2RGEA 1W4RA 4FB5A 2Q1TA 5JYBA 2P5YA 1TCBA 2PZEA 2R8EA 4BN4A 1E2FA 2PRJA 4D80A 5IG2A 1C2YA 3E9RA 4Q4DA 5JZMA 5HGXA 3GYBA 3I0NA 1B4DA 3EBOA 3O82A 4FR5A 4IUDS 4CMHA 1QIFA 3VISA 4G5SA 2WFLA 1ST2A 1GCGA 10MHA 2QTRA 2QN8A 1D2AA 1XCPA 1K7FB 2HA2A 4LE2A 4NLLA 1CY8A 3UJ9A 4C1BA 1NXQA 4KN8A 4KPUB 1R8JA 1F2VA 1M2EA 3BMNA 1NKTA 2ZP1A 3EAGA 1A95A 1YXMA 1G7SA 3PQDA 1BDJA 4K1XA 3U6KA 2Q9AA 2PMKA 3DTVB 5AVOA 4ASUD 2PZGA 1SQSA 1CF2O 4TL9A 3KEFA 3OF5A 1IIRA 4Z1MA 3DVAB 2JCYA 4KAFA 4RPGA 4PNEA 4HX2A 3H5OA 4CG1A 3UMMA 5ISMA 3PT9A 4UU7A 4GE0A 3R8FA 4WA7A 5AJXA 1IWBB 1PBNA 1GZUA 1ACJA 1U0JA 2XCQA 1ZNXA 3EOZA 1OC2A 2H1SA 3FPAA 3CPJB 3G7UA 3IMEA 2PHZA 1VDZA 2HY7A 2A4MA 2ZYGA 5EIAA 4EUNA 3DL2A 1WBBA 3TTVA 4GOKA 4XEUA 1ZM2A 1FZTA 4PZ9A 1YDWA 1ZITA 1QIHA 4HB3A 4B31A 4FP9A 4K5QA 4CM9D 4LVOA 5ER6A 2O06A 4M87A 2AX4A 2H9AA 2FG7C 5CLLA 4YX9A 1RKXA 3YASA 3FYTA 4BUCA 2QJTA 4PSDA 4E2YA 1KI8A 1VKNA 2ET6A 5BWOA 1SXPA 1T43A 2QUZA 1TQDA 1R5JA 3IODA 1UBJS 3BHNA 3K96A 4QFMA 3SSOA 5BMVA 5JD4A 4DMCA 5JAIA 1G8GA 1OV6A 5A6SB 5KQSA 3RIGA 2Q4TA 3AETA 3HWSA 1JFLA 1F1JA 2MYTA 1HG1A 4FIZA 2BV3A 3GLFB 4P4LA 2QPAA 4XLLA 3SP1A 1E1CB 3QPAA 1CVRA 4DLWA 4D9KA 3L1JA 4Q7KA 3HABA 3U44B 1YQDA 4Z54A 2DPYA 4ARUA 1Z4NA 2CVFA 1IXKA 1H93A 3HBMA 4X24A 2VEDA 3NHYA 1O08A 4C30A 5IFLA 3UWSA 5LKAA 2I80A 1ID8A 1QG0A 2MSDB 2A1IA 5T67A 1I1NA 1L7XA 1GGEA 1U7XA 4KRYA 1Z7WA 4YRPA 1YZKA 3AC0A 3VH3A 4O08A 4EFKA 4NMWA 4OGGA 3R7LA 1J5XA 3RM3A 2WHQA 1Q6YA 5BSHA 1BS2A 5DYTA 4CV1A 2W98A 3GH3A 4WEOA 3ZK7A 2FMIA 3GRAA 4GNRA 5LA6A 4DQLA 1EB8A 1CIJA 1P45A 3D81A 4LK3A 1ZISA 5DM4A 3U17A 3R6TA 1JZTA 1Q20A 1V1MB 3FH0A 2J5BA 1Q0UA 3LCMA 1Q92A 3B48A 3MTGA 1HY3A 4MULA 5GJBA 2YV5A 2AXPA 2GHIA 5EZYF 3NC0C 2FN8A 2IJGX 1RWWA 2I6GA 4EIWA 2OHVA 3HYSA 5IDXA 3MRVA 1JEJA 1US8A 2P62A 4IQ8A 4NNOA 1D2EA 5E2AA 5FUVA 4HH3C 5LZ5A 3VX4A 4ENWA 1N5LA 3LBIA 4ITVA 4KPYA 1P74A 2AG0A 3TXYA 1XRPA 3BEDA 3AJEA 3ML1A 2G9QA 3HZRA 1N2CA 2C4WA 1CHDA 1NY6A 4CJXA 2CLOB 3TMAA 1OIVA 3NDRA 4N41A 3I0ZA 1UCFA 3MTQA 2ORWA 3HZHA 3UT5A 4HWTA 1V8BA 3SM3A 2X6RA 5T41A 3OPMA 2WZBA 2O8NA 3TZHA 2FWAA 3O5AA 4OQLA 3ZDXB 2A84A 3TAXA 2IYAA 3EB9A 4U7FA 3OLZA 2HNAA 3NETA 4JU8A 2EL9A 2PFGA 3PHCA 4RY8A 5E4FA 5EIWA 2HNKA 3S2ZA 3HM2A 3U5TA 3LQKA 4S24A 4BASA 1BE0A 2C03A 1V45E 2Q2NA 3LF1A 5IZ4A 2QN3A 4OBBA 1IH8A 1I36A 5JUWA 3ECCA 2AFHA 2O5VA 3EHDA 2EJVA 3WMRA 1IK4A 1WBJB 1NDUA 4Q00A 1ADFA 3CGGA 3DULA 5TVKA 3ZGXA 3WIUA 3H99A 5BSEA 2GFQA 2GVDC 3MGAA 3BE5A 1I2BA 1NRXA 3ZQKA 1QRTA 1SR8A 2H4YA 4DYVA 3S2SA 1AS3A 1NXVA 3LT4A 3MELA 3TDKA 3ZK8A 2EQ5A 4M36A 5E1MA 4E31A 2XCRB 4X84A 3TMYA 3KOOA 2YNMD 4R8KA 5FA6A 3EDRA 4G8BA 3I2JA 1ZJWA 1XUOA 1GPYA 3MS2A 1V9SA 4Q82A 5AJWA 4CLOB 1Z18A 2EFYA 1EDDA 5C0OE 2R97A 2QN6A 5DHAA 4UD6A 3SX0A 3IE1A 4IGEA 4QYSA 3PS9A 3C3XA 3CM0A 1KQNA 1A9XA 1LDMA 1DIGA 1RACA 1N5DA 2CLDX 2BKLA 3NTUA 1SQ6A 4F5DA 3A3KA 1VB3A 5L7WA 1Y4UA 3UAZA 3UK1A 1U02A 3ADDA 3PHBE 2F1HA 1DJLA 2OR3A 1IQUA 2V6MA 4ZVUA 4ARCA 5EMJA 2IWRA 4R1LA 2IUYA 3GP3A 1ZI6A 4EB6B 1P4HA 4X5OA 2YOFA 5G1OA 3NH6A 2FG6C 1MC8A 3EUEA 4R05A 4ZT5A 5BO5A 5EE5B 1H3NA 1VPTA 5CVUA 2V7QA 4RQAA 1F38A 4OQZA 5G0TA 3RAJA 3VZSA 5A4FS 5BMVF 3GP8A 1CR4A 3OSUA 5ALJA 3ZVRA 1XD2B 5BMVB 2OZLA 4X1IA 3N0RA 2A2ZA 5FTWA 5K0LA 1O94A 1J2UA 1LVGA 1XDZA 4EHAA 2SCUA 4EPRA 4ER3A 1SUBA 3G5UA 1F60A 3RBVA 3RVKA 2R6HA 2DP4E 4H7DA 4L78A 3W5JA 1MLDA 2ODQA 4OYLA 4TYYA 2G67A 2OMKA 2WSBA 4YALA 5AMXA 4QKQA 5KVVA 1JDJA 1C3OA 2PBRA 3FSJX 4ZIRA 4UJ3A 1K9SA 4ZPXA 3CX8A 5D5PA 1WDTA 5EP2A 5E6UA 1E60A 1QGAA 1T9HA 3CVJA 3TEJA 4IUYA 3AVPA 2AZMA 3ROZA 2GF0A 2WHYA 4BMSA 5HF6A 2FFQA 4DKXA 2O5CA 2FQYA 2VF4X 4F3TA 4M8NE 3EOBI 3IUEA 1VE7A 3HO8A 3M4XA 1NMEA 1QBGA 4DA7A 1RE1A 3E53A 4RPHA 3CEHA 5AW4A 1EDZA 3GRZA 4OU4A 1ZIDA 2A5DA 2OV3A 3LX4A 5JS6A 2H16A 4Q3EA 3ZE6A 1GPUA 4Q3AA 2ZKIA 4G0XA 5JROA 4HAUA 4KOAA 1X1DA 4MTLA 4Z4GA 2HOQA 2LKCA 3U4QB 2PUHA 3PF9A 1OB5A 2F1OA 2HK8A 2NQ8A 3QE4A 4NJEA 3I5YA 5BQFA 3C14C 1P8JA 1O9BA 2EARA 1UDBA 1C1XA 2I4MA 3K0CC 4JOBA 4V0NA 4CEIA 2AUTA 2V7BA 3F6CA 3W8DA 3QHQA 1BHSA 3CO5A 1NN0A 4QL3A 4A0FA 3ZHSA 2CEAA 1DTSA 4G8CA 3ZHRA 4EVQA 2J0SA 1E62A 4F91B 1QB7A 2XT6A