1DAKA

Dethiobiotin synthetase from escherichia coli, complex reaction intermediate adp and mixed anhydride
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshot of a phosphorylated substrate intermediate by kinetic crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
total genus 75
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dakA00
2P2LA 3PQCA 5EUMA 2WWHA 3PEYA 1I4LD 2O0HA 4QHSA 1CR2A 2YC2C 1CR1A 1D6JA 5EXSA 2BHRA 3K8YA 3CW2A 4P4TA 2RGBA 4B47A 2C95A 1DOAA 1P2SA 4S2EA 5F3WB 2WWIA 3FMOB 1G19A 2WWWA 2B7BA 4BZXA 4RJLA 2GBLA 4LPSA 4A15A 4NYMR 3KTAA 2WKQA 2FN4A 2FU5C 4Q9LA 5JECA 5L3VA 4FI3C 4IOKA 4A36A 2WMNB 3KQKA 2UZ3A 1XCGB 2BMFA 5FOTA 4G3XA 2WJYA 4N0DA 4PSVA 2A5GA 4O2RA 4L4UA 2PX0A 1NN0A 5DLQC 1SVSA 5LB4A 2YWFA 5JWHA 2VA8A 4R9UC 4B6EA 1KO8A 3EAQA 3HWSA 1NJGA 2ZRMA 2ZJ8A 1XMJA 4MKFA 3TUIC 4MYCA 1G16A 3M6AA 3MJHA 2NO6A 4ESVA 2IX3A 4KBFA 1FNMA 1W0KD 2V4ZA 2QMEA 2B8TA 1QVAA 1E4VA 1U81A 2KI5A 3K09C 3EARA 3VR1A 1CR0A 2RGNC 2Y8EA 4W9MC 1ZUNB 2XITA 1MOZA 1U90A 2H57A 2HLDA 2PZFA 1TX4B 2D62A 2EFEB 2QU8A 3MJRA 3PEWA 1XMVA 3MRSA 4PHGA 1SXJE 5C4MA 2NQ2C 4LYHA 1MABB 3MAAC 4H9GA 4XD7A 3FE2A 3GLIE 4DSTA 1Z6GA 5JS7A 5CM8B 1Q3TA 4M9ZA 2GEUA 1UAAA 4AYTA 3HDTA 2O52A 1A5TA 1US8B 4JLOA 2J0UA 2QP3A 4A9AA 3GFPA 1NY5A 1IXZA 1GRNA 3BB4A 2XXAA 4II7A 2MSDB 2WV9A 5DNYB 1G3QA 4V0NA 3B13B 4CIDA 2NMVA 4OQNA 2HXSA 4PO1A 3BOSA 3Q8XB 4BFTA 1CJKC 3I5XA 1CTQA 3IKJA 1D2MA 3Q85A 2ONJA 2G77B 3VFDA 1XMSA 3DHWC 1EFTA 4UQOA 1Z07A 1SQ5A 2F9MA 4D2IA 2SHKA 4I81A 4ITRC 2CHGA 2AWOA 2WIAA 4JVNA 3O8DA 1XFAA 4A2PA 2ZUCA 1AKEA 2F3TA 3IHLA 5J4VA 1XTJA 3U4QA 4N1AA 4IFBA 2ZREA 4M4SA 2OCPA 3IIMA 2CNWD 3GLHE 4JMPA 2AHOA 5KYKA 3ADBA 2ZJOA 2J5XA 1D5CA 4Q4AB 2C5LA 2WSSA 1KAGA 4A2WA 4ZI3A 4DDTA 1KAOA 2A78A 3B1ZA 4GMDA 2E9SA 3O47A 2IXFA 4URYR 4US1R 1US8A 3HR8A 2XSZD 2QM8A 1QG2A 2GXQA 1S9HA 3C14C 5KHOC 5GJCA 4PPGA 1T3SA 1B0UA 221PA 1RRCA 2PZEA 4JL8A 3FTQA 2D7DA 3VQTA 4LI0A 3SHFA 1VHLA 3TQCA 3WYFA 3ZQJA 4C0SA 3SQXA 3AEZA 4AY2A 2VL7A 3ZVRA 3AKYA 4XIGS 3UPUA 1NBMD 5KDDA 2GEVA 1J7KA 1XZQA 5FUXA 3BXZA 4P4UA 1TF5A 1CBUA 1Z0DA 4BFXA 1BYIA 2PCJA 2D2EA 1RJ9B 1DEKA 1W44A 2QI9C 3OEED 1E9EA 1H8HD 3LVQE 4NH0A 2W6JA 4U00A 3VMFA 3NKVA 2BMEA 1S3GA 1LY1A 2ZR0A 4B3GA 2OE2A 4M2LA 3GJXC 5F2EA 4B73A 1U8AA 1XJQA 1JI0A 3LBHA 2XB4A 3WXMA 1QVRA 2CCGA 2JJ1A 1GNRA 4URWR 1IY0A 5IK2A 1F3OA 1XXHE 3D31A 1XTRA 4HDOB 4BLOA 4TQ9A 2A30A 2HLDD 3SS8A 3J81k 2CNWA 2Q6TA 4MITA 4JLBA 2XXAB 5HCIA 1DO0A 1XD2B 3EWAA 5CK5A 4DBLC 4DB4A 3UMSA 4C0LA 4HAYA 1OYWA 3H84A 2R6FA 2ZYWX 1AZSC 4TLEA 2R9VA 3KFVA 3FMIA 2XX3A 4LV6A 3SC3A 3TRFA 3HYTA 2JLZA 4NYJQ 1MO4A 4Q4HA 2JLWA 1VPLA 1R6BX 1YZGA 3BS4A 4OHZA 4BASA 3F8TA 1Z6TA 1DPFA 2GDJA 1W1WA 3B1VA 2YYZA 4TTRA 1IY2A 1RJ9A 3AKCA 4TL8A 3NBFA 1FQKA 4IDNA 4D4MA 2VP6A 1W5SA 5KSZA 1JB1A 2ZRIA 3B82A 3D3QA 1OJLA 1E9CA 3U3MA 4A4DA 4Q7MB 2YZ2A 2FNAA 3LX5A 5DE3A 2GCOA 1M34E 4IJMA 3I61A 5A4JA 2IYQA 1II8A 5G40A 4OI0A 2CVHA 2JLXA 4JJKA 4QKQA 4Z1MD 2BJWA 4XWOA 4DXAA 2P67A 3JVUA 5EZ5A 4LY6A 1R2QA 1GL7A 2KSQA 4AKHA 3GLFB 1NVVR 4V0LA 4HAUA 1YZUA 3VX3A 2AKAB 3A36A 1F6BA 1X6VA 3DDCA 1YQTA 4POAA 4QRHA 1FOEB 4O3MA 4GL2A 1FZQA 1QHIA 4EIWA 5BW8A 3SYLA 1WRBA 5C46F 4B2IA 3MGCA 4P3YA 1OHHA 1XTSA 4HB2A 1E79D 1EK0A 1I2DA 2ZRDA 4GI7A 3DM9B 4DIEA 1COWA 4HUTA 4A92A 1XWIA 4LHYA 1J90A 1GL6A 2V9PA 2CL6X 2CLSA 4JBWA 1FX0B 1KNXA 4A0HA 1L7VC 2QROA 4LJ8A 3UXMA 1D8TA 3ADKA 5CLLA 3SJBA 4JT4A 1KY2A 1HE1C 1N6KA 1YU9A 1II8B 5G53C 2PJRA 5HKKA 4GDFA 3KB1A 1RRPA 5C1BA 3SZRA 4DLTA 4DSOA 1ZMXA 4BLRA 1E2GA 3Q9LA 1DAFA 4Q18A 1YE8A 2EFGA 3W9YA 2A7QA 3PG5A 4PZLA 1IN6A 3U3KA 3EIEA 5FTMA 1XU4A 3QXCA 3TVDA 3AF0A 3X2SA 2WOOA 4HAZA 1NSFA 4YXWD 1Z28A 4JLDA 2ZI5A 1XTQA 4XWAA 3K0CC 4YDHB 4XVRA 3Q7PA 4R98A 5HCNA 2IS6A 4JBXA 1DVRA 3TJZA 3LDAA 2F55A 3G82C 1T0JB 2EYQA 1SZPA 1IN4A 4NP6A 2JJ1D 1I2MA 5F9HA 1IXSB 1FX0A 2ONKA 5HE8A 2V55B 2KWIA 1M6NA 4JVMA 1JAIA 4U7DA 1NG1A 4HYYA 1IN7A 1ESNA 3IPXA 4WXPA 4LBYA 1JR3A 3T1OA 2HJVA 1EWRA 1IJFA 1GILA 2IWHA 4AYXA 1XP8A 5L8VA 3EASA 2ZSBA 5KPDA 2WKRA 1GIAA 2ZIAA 5KDLA 4EAQA 1KK1A 3CRMA 3H2YA 5FOUA 4P4SA 4XSHA 3GEIA 1WQ1R 2VEDA 2R44A 3MWJA 5FL3A 2YNMA 4Q9IA 2JLVA 1DE0A 3AKEA 1N25A 1KIMA 4B34A 2AX4A 2AD1A 2XJ9A 3GFOA 4ZV4A 4KYIB 2WWYA 1OH6A 3ZZ0A 3GLGB 3A58B 3I32A 1OB5A 3PJRA 1G20E 1X8LA 2YWHA 3GQBA 4W7SA 3FB4A 5JEDA 2YOGA 4LWZA 3AVTA 1ZU4A 1N3BA 4Q1EA 3EWSA 1ANKA 3NBYC 3E5HA 1D9ZA 5AJWA 5EUQB 4A8JC 1F60A 1KSHA 1GAJA 3THXB 1KK0A 3KZ1E 4LJAA 4LJ6A 5P21A 1XPRA 4KHZA 2F43A 3NHBA 4PHHA 2AK2A 3VR3A 4DLWA 2G1KA 1YR7A 2QSZA 4OL0A 2Z0MA 2ZE6A 3QNUA 3SQWA 3VKGA 4TZ0A 3N2IA 2GRJA 3CF2A 2J7PA 4V03A 1ZNZA 1NVVQ 5GJWC 1ZP6A 5C4GB 3B7GA 2PEYA 1YKSA 1FQJA 2RAPA 4FWIB 1BO6A 3I8XA 3T06B 1XTKA 1YZNA 2JASA 2O8EB 3MD0A 2A3RA 1G8YA 2ZE7A 4V0OA 2QPTA 2XAUA 3CPJB 4F4CA 4G5OA 1IOZA 3TR0A 3WBKA 4E5UA 3LH5A 2QZ4A 3RHFA 1DAGA 3FMPB 1GKIA 5GJVC 2JEOA 4DUGD 2Q9AA 4L8GA 1P9WA 2G0TA 2NOAA 2YVUA 1WBDA 2LCFA 1NL3A 4BGDA 3ADDA 2ZS8A 4M53A 4QBGB 5B64A 2DFLA 4ASUA 5FUVA 1XPOA 3K0SA 1Z2AA 4ESHA 3GMTA 2WAXA 4M9XA 1RIFA 4WA7A 5UKDA 3ZGXA 3P4YA 821PA 3RS2A 3CNOA 2QPAA 4O2LA 2AL7A 4TWZA 2GK6A 4Z8YA 3FHOA 2V1UA 1GFIA 3D6TB 3WHKA 3EPKA 2QENA 3SR0A 1T3HA 2V6JA 3EZFA 2ZS7A 3P1JA 4FWTA 2R2AA 2AFHE 1N6IA 2IUTA 1NP6A 1W36D 3AF1A 1LNZA 4D26A 1KI6B 5EP3A 4ERNA 5JS8A 5LD2B 2X2FA 1V43A 3P26A 4QGHA 5TDHA 1CR4A 3CR8A 5JSZA 4UNSA 1ZCAA 3WY9A 1JXOA 4ACAA 1FMJA 2J41A 4C4PA 1OKKA 2A5DA 3MCAA 4MGZR 2QBYA 4A0FA 5BN5A 3AVQA 3R7WA 1CEEA 5BN3A 1E2JA 3QKSA 2ZRAA 2A2ZA 1TQ6A 1OFTA 1ZNWA 4GP7A 1G7SA 3SI7A 4DKXA 1QZXA 1T8TA 2IHYA 3BH7A 4FD2A 2G88A 1HV8A 2WWXA 1G9XA 4B3DA 1JR3D 1XD9A 4K46A 3CPHA 3L8YA 1OFIA 3RS4A 2ZXUA 3KUDA 1XDBA 1KK2A 1ZM4A 2PMKA 4GZLA 1WA5A 4A6PA 4YMTA 3M0EA 4LYFA 1NKTA 4MRSA 3I3SR 3TQFA 4EPYA 2PZGA 2KBEA 3SFZA 3VU9B 4PFSA 4DEYA 1SKYE 3RS3A 3K09A 3ZH9B 3BB1A 1AJEA 3GLGE 4QM6A 4H1VA 4JLNA 4Z54A 3L0PA 1YHNA 4G1UC 3CR7A 1HT2E 4URVR 3RRMA 4Q03A 4QBHA 4BFSA 3L2OB 4IVRA 2FSIA 4LBWA 4WW0A 4ARZB 4B6FA 2O8BB 3VR5A 2YC4C 4A0RA 2F1IA 1P72A 2QN6A 1VCNA 1GG2A 1TF2A 2VSXA 3A1UA 2MMCA 4TSFA 4KBGA 1Q12A 2QTFA 1KMHB 2P3SA 1SVLA 3CX8A 3AVUA 2WAYA 4ZIRA 3VTKA 1II9A 2PBRA 2VTKA 2NPIA 1A2KC 1UBFA 2QP9X 3CRQA 2PJZA 3H4MA 1W0JA 1QHHA 1DG3A 3H86A 3BC1A 2ZI9A 3EZ6A 3GEHA 4FMDB 2BDTA 1YJ5A 4RD0A 2RB4A 2IS1A 4ZCMA 2UZIR 4DT1B 4Q7LA 3TUZC 4B43A 1GNPA 4AG6A 4JSYA 3DL0A 3C16C 4DDUA 2HF8A 1BMFA 2GF0A 2CVFA 2W00A 2XEXA 4UNRA 5JJLA 2J1LA 2OCYC 1SVOA 2J46A 2GHIA 1OE0A 5TMPA 2NZ8A 1CKEA 4O25A 2AK3A 5EE3A 3DZDA 1G17A 3W90A 4DC9A 5KNCA 3K70B 3L43A 2ZVPX 3P27A 2J0SA 4PSAA 4UXHA 4Q1DA 1KY3A 4ARZA 4PO8A 3VNUA 2NO0A 4JSTA 3MMPA 3MG9A 3RABA 3OHMA 1M7GA 3KJHA 1SXJD 1DBSA 2ZUBA 4I1SA 1W4RA 4M1YA 3RYTC 3JZMA 4F92B 2W6ID 3KXKA 3B9PA 1ZCBA 5J40A 1IJEA 3CRW1 4C2UA 3EXAA 4B2LA 1XZPA 2QM7A 1E9AA 1U99A 2ECKA 2ODNA 2WSSD 2VP5A 4G5QA 5FL7A 2IYTA 3CX6A 3FPAA 3Q7QA 4TLDA 3RRNA 4BE7B 2ZETA 1UEJA 1S4QA 1TU4A 2VF7A 3Q5EA 1WBBA 2FPLA 2X2EA 4E22A 5JSZB 1BS1A 1Z6AA 2WPDD 3CH5A 4GNKA 1G6HA 2GCPA 4NCIA 4R7ZA 3PITA 5CJ2A 4RCYA 4N3NA 3RRZA 4IOLA 3B6EA 1SXJB 5SZIA 1OW3B 1UKZA 1C1YA 4ZO4A 2WVJA 3QKTA 1X86B 1UDXA 4JVSB 2VHCA 4Q9KA 2ZRHA 3NVAA 3CB4A 2O8EA 3AV0B 2N42A 4PHFA 4QHYA 4DHEA 4LGMA 1Y3AA 2HCJB 4Q1BA 3BBPA 4EPTA 1YRBA 1AQUA 4C2TA 3BAFA 3IILA 3QKUA 2ZRFA 5FBWB 1XJ0A 3WMFA 4AURA 4MKIA 4DSUA 1EESA 4G5GA 2NO1A 2PCLA 1IM2A 4FN5A 1QHHB 2GCOB 4LJYA 2AN9A 2XZOA 3U5ZB 2PX3A 2Q3MA 4US2R 5JZVA 4OQXA 4NZYA 4PAMA 4CYMA 2BCGY 1JAHA 1UKYA 3SBEA 2BBSA 3P4XA 5FOSA 3OE7D 5H8WA 4LC0A 1TEVA 4RD1A 2ZAOA 1AGRA 2CXXA 3B1WA 3B78A 2QL6A 4IEEA 3VHLB 2ZRPA 2CCKA 4P32A 4Q21A 1KSGA 1E1RD 3E70C 3UMFA 4B3BA 1HQCA 4D6PA 1AS2A 3CLVA 1E96A 3PUZA 1VIYA 1ETUA 1EGAA 2JAQA 1KZGB 2C78A 2EYUA 2WPDA 2YV5A 3BERA 1FTSA 4BZPA 3OF5A 1SHKA 4KVAA 3ZLJA 2Q9CA 1X3SA 4NL4H 1R5OA 1KDOA 5EZ6B 3ZIAA 1BIFA 3CWZA 1JQJC 2ZITA 1HYQA 2FEMA 3B1XA 4DB2A 1FUKA 1SKQA 5E7JA 5IF9A 2DPXA 1G8HA 4URUR 4HB0A 2NO9A 3OEHA 1QDEA 3UIEA 1G8GA 3FOZA 1P9NA 3VR4A 2GKSA 4FXPA 3RWOA 3ZZTA 1E2QA 5JLJA 3QXSA 1E0KA 5CYOA 3A4LA 1OXVA 4HLUC 4MGKR 3KQHA 1G5RA 1G3MA 3TH5A 4NMMA 3NC0C 2P5SA 3VR2A 1OKKD 2VSOA 3RS0A 3VHXA 3U3RA 1S3SA 2QE7A 2ZAMA 1SVMA 1Z2CA 3GEEA 4TQAA 3TMKA 1E2IA 2NG1A 3AF3A 2D2FA 4LJ5A 5JI3E 2JLSA 1TQ4A 3AVOA 4XD7D 1T9HA 4FMCF 1ZVQA 1W47A 2LKDA 1HTWA 4KFUA 1Q1ZA 8OHMA 1HUQA 2WSMA 4LHZA 4D0GA 1O87A 3ZZUA 2ZJYA 1E1QD 2FZLA 1U8ZA 5E3HA 2GNOA 2ZJ5A 1SVKA 2N1BA 4DLVA 4KSBA 4OQFA 4TL9A 3K0CA 1GM5A 3T61A 4LV8B 5DYIA 2VPPA 3AVXA 3IEVA 1XRJA 1G4AE 1U9IC 5FOWA 3WMEA 1U98A 1E2HA 4GP6A 2C04A 4DCSA 3LW8A 4Q4HB 2YWEA 2V54A 3FFAA 5IT5A 4XJXA 4HDCA 4OHYA 1AA9A 2OO7A 3TIFA 1TU3A 4GPTA 3IQWA 3NTUA 5KU1A 5CDFE 4FINA 2ZANA 4B75A 1G3IA 3WHLA 4BFVA 1ZJ6A 2FH5B 1YZQA 4HB4A 2VH5R 4DEXA 2VP2A 1P2TA 1KSFX 2IYLD 5IK2D 2F43B 2OFOA 2EFHB 2FZ4A 4KFTA 3QXXA 4LHVA 2IXEA 2HDNB 4JLVA 3OIVA 1NVWQ 1TAGA 1VCIA 1P61B 2BM0A 1T5IA 3DPUA 1SVIA 3P20A 3IBYA 1GWNA 5H70A 3WYGA 1Z6YA 2KE5A 5EXTA 3IUYA 3T34A 2BBOA 3W3AA 3GJ3A 1NJFA 4Q02A 4D0NA 1WE2A 2Q3HA 4OHWA 2FDCA 5AR1A 3HU3A 4WBSA 4TT3D 2QSYA 3QOFA 4NHOA 4Q66C 4M1KA 1CS4C 5BQ5A 5AK0A 1KJYA 3ND9A 1IY1A 3A37A 1QHGA 4RKEA 1Z0FA 2B92A 1XCPA 3MWYW 4AG5A 1WDTA 3E1SA 3QKSB 4NBSA 5JWOA 3IGFA 2R6AA 1UFQA 1ZIPA 3F5FA 4MUBA 3GLFA 4DLRA 1QHNA 2OZEA 4IDQA 3AB3A 4JKYA 4KAXA 4C3ZA 2CJWA 2CHVA 2QE7D 4AD8A 2IYSA 4QGFA 3W5JA 2F3RA 2ODWA 3ZD6A 5JJKA 3KJIA 5IDVA 5KUTA 3ZS8A 2O0JA 3WNDA 4YQFA 2ASEA 3PCRB 3PXGA 5B2ZA 3K9HA 1HURA 4C7OB 4E03A 3DOEA 5FPSA 1ZD1A 5AWFC 2H17A 1ZM9A 2GJSA 2I1QA 4OJKA 4BQSA 3ZVLA 4B44A 4PXAA 1IQPA 2NIPA 1G5TA 2QA5A 1R5BA 3BIFA 1G41A 3REFA 4V0MA 1NIPA 3L0IB 2C77A 5B58C 1K6MA 1N2CE 4NCJA 4Q9JA 2OLJA 2FX3A 2OHFA 2DHRA 2OBMA 2IK8A 3NBZC 1VG1A 2B6HA 1VECA 4ZPXA 1ZC3A 3ZYCA 4B74A 3I4LA 3UG6A 3R9IA 3WP0A 2RGNA 1TADA 4BWYA 1JR6A 3QSYA 2P6UA 3QJYA 1GNQA 3GLGA 2ZRGA 3TR5A 2OESA 4AK9A 2QG6A 3EA5A 2IYUA 3IHWA 2FMXA 5B57C 4LHXA 1H8EA 4MDEA 3KKNA 5FH9A 4AKIA 4BPBA 1RFLA 3K0FB 5KO2A 2F6RA 2FGKA 1JJVA 4P4SB 2KBFA 1Z29A 5TY0A 4TMXA 3LLUA 5DN6A 1GDDA 1NRJB 4G5RA 3NDPA 1XNJA 4QG7A 3SDZA 2PH1A 3P32A 1OIVA 1MR3F 2WM9B 2GZDA 4AKGA 4BEBA 4DT1A 4C7OA 2X1VA 4DDVA 1COWD 1Q44A 3KX2A 2JLYA 4LV5B 1E79A 4GFDA 2V3CC 2ZSEA 1UADA 3K0AA 1W0KA 4P0TA 3IBGA 3LBIA 3TLXA 2Q0HA 3ONWA 1BH2A 4GRAA 5EE9A 3REGA 2ZI6A 4KI0A 5LPNA 1E0SA 1FPMA 1XX6A 3W6PA 1E2DA 1L2TA 5DIFA 2A5FA 1R0YA 4YMVA 4R2HA 2GJ9A 1V5WA 5CDFA 1N6NA 1ESMA 2OSBA 3GLHA 2OG2A 4NTZA 2R6GA 3CRRA 3OEEA 1NLFA 3T5DA 1A2BA 4G01B 3QENA 4GSYA 3FHCB 4OK3A 2ZJAA 3UG7A 2YWGA 3BFXA 2REBA 1CRQA 3NG1A 1E2NA 4EQ6B 2WMOB 1KO7A 2WJIA 2ZS9A 1CULC 3EZ7A 1OYYA 1PJRA 4D80A 4O0MA 4A8JB 3I62A 1M7BA 3CNLA 2J7KA 4HAWA 1W36B 4AWXA 3NDBB 1LV7A 2H16A 5JCPA 2EU8A 2ANCA 3T1TA 3C5HA 1UF9A 3RDPA 3QF7A 3LNCA 4C30A 1L8QA 1Z6XA 3DO6A 4DLXA 4TYYA 1GP2A 4B3XA 2HUPA 3I8SA 3QG1A 3QEJA 1ODFA 3DMNA 1WF3A 3A4MA 2OBNA 2WKPA 1T8UA 2Z4SA 3AF4A 3C7KA 3ETLA 4OKSA 2CJWB 5GADl 2GXSA 3THYA 1P4SA 1L4YA 2ZRBA 3EW9A 4PPNA 5CB8A 1R4AA 1LVGA 2H8KA 4DCVA 1RC8A 1D9XA 1K5GA 4JJZA 2QBYB 1G7TA 1WMSA 3NH9A 5AJYA 3GCGA 2PT7A 1CJUC 4K8OA 2OAP1 1PLLA 1S0UA 1UBGA 4EKDA 1Z47A 1GRRA 3B60A 4KODA 5AUNB 1Q0UA 1W49A 3K0AB 1W2GA 3OAAA 3PFIA 5FI1B 3BH6A 1R10A 1E0AA 4PAQA 2IXGA 2O0KA 2RHDA 3B2EA 1CU1A 2NPFA 4LYAA 4A6XA 3ZVMA 3IDQA 5CLQA 1PUJA 1D2NA 2V7QD 3AQ4A 4KU4A 4ZKEA 3V4FA 2ZSAA 4N0EA 3MWKA 1BMFD 1VCOA 4KFRA 3IQXA 2RMKA 1W48A 2ERXA 3NXSA 4IRUB 1Z3IX 4RKFA 5KNDA 5J4LA 4BUJA 3W5IA 1CIPA 1EFCA 3K0FA 1EFHA 1OIXA 2G9NA 1VYUA 4UXJA 2YKGA 3FGNA 4M1SA 4WAUA 5HPYB 2UKDA 4R71A 4TMZA 1E9RA 2V1XA 3DKVA 5IHPA 4WIAA 4RD6A 1GITA 1OH5A 2ATXA 1Z0KA 2LWIA 3NC1C 1OLOA 2XTNA 1OXUA 4EQ6A 3RAPR 2WJVA 3LD9A 4CGZA 1NMXA 2J59A 2KB0A 3QUSA 4UNPA 4G5SA 1KMQA 1Z0IA 1EXMA 3SHWA 5LD2C 2QMHA 2WOJA 4LJ4A 1JBKA 1N5JA 2E87A 3B8HA 2G0NA 3UMRA 1E2PA 1ZYUA 3KKPA 2IC5A 4QBFA 2DWPA 4NDZA 1AN0A 3X1XA 3FKSD 3RSLA 4C0HA 5DI9A 3A1TA 3AH8A 4ZCIA 2XOKA 1ZW6A 2GILA 3BJIC 2O8CB 2IBMA 1K5DA 3O8BA 5K8IA 1KJWA 5CB6A 1E1QA 2QTHA 5BN4A 4NYMQ 2BBTA 1KTVA 1Q57A 3RWMB 3DM5A 4KV9A 3UWKA 3TKLA 2FWRA 2HT6A 2JGNA 3CX7A 1DELA 4Z51A 2Z43A 4HSEA 1NKSA 3N5CA 4ZIRB 3OIWA 1KK3A 1LS1A 1KHTA 3D8BA 3U60B 1IN8A 3Q3JB 3TBKA 5D3QA 3BRWD 4MGIR 4YMSA 1C4OA 1OXSC 5J47A 3SE0A 2OFXA 1KNQA 1Z0AA 5EE1A 3QQ5A 1UDWA 1XJCA 2EWVA 3HR7A 2QUZA 1ZRHA 4FW9A 1BOFA 1ZU5A 2IYRA 1JNYA 1E0JA 2EWWA 2QMOA 3CH4B 4TLCA 2RGCA 2RGEA 4QM7A 2FSGA 5G41A 2VHTA 2TMKA 3DVLA 4OI4A 5GVSA 2O8BA 4OYHA 4NYIR 3R9WA 3QI2A 2HT1A 4DRZA 4ON9A 5HTKA 1UBEA 3QXHA 2F7SA 1ZINA 5E95A 1UEIA 1OB2A 4M1OA 5EJEA 1Q22A 2QEQA 3HU2A 1P6XA 2BOVA 4BRWA 4DCNA 4AI6A 1RRGA 5B30A 4FIDA 5J5CA 2OV2A 4GMXA 4UJ5A 1QBKC 121PA 1P62B 1AK2A 1ZD8A 4IOJA 3EZ9A 1Q21A 3ZIAD 3HPRA 4H1UA 3MUFA 4MRRA 1T3LA 3ASZA 1O3YA 1YVDA 3TW4A 2AFIE 2I1VB 3HP1A 1JEEA 1F48A 2BWJA 3LRPA 4M9QA 3X1DA 3LFUA 3CO5A 3JZAA 5FTLA 4C0BA 3IIKA 3BWDD 2ATVA 1TTTA 3C8UA 4QXAA 2GXUA 1MO6A 1XF9A 4J0QA 3T5GA 4WZBE 4FMCB 3PEVA 1JXMA 1DADA 2W2VA 4OQLA 2WHXA 2FJUA 2R6DA 4HI0E 1Z06A 3I72A 3TGPA 1XXHB 2XNSA 4F4JA 2ZYUX 3U7GA 2GJKA 3UATA 1W4BA 1XCMA 3QIAA 4EJSA 3CUEF 2QNRA 1II0A 3R9XA 2B7CA 1GZSA 1HE8B 3QE0A 2OAQ1 2R65A 2DWQA 4DCUA 5DGXA 5AUOB 2GF9A 3A1VA 3LXXA 3B85A 3OZXA 4V0ME 3ADCA 1PVOA 1W0JD 1KDRA 1NI3A 1GKYA 4I4LA 1G7RA 3W3ZB 2A5YB 3G0HA 1NN1A 3T1VA 2QAJA 4QNRA 1NN5A 5BYJA 2IW3A 4ILEA 1U0JA 1GSIA 1VCMA 2D7CA 1M8PA 3PUXA 4JZKA 1U9IA 4EUNA 5LDDC 1OV4A 1R8SA 3PENA 4CW7A 3QF4A 4EFNA 1M7HA 5EP2A 1QHXA 3W6OA 3C41J 2Q21A 3A4NA 3BFVA 1CJMA 4RVCA 1CJVC 3F3YA 4M9SA 2OILA 3TSOA 3RANA 1MO3A 4W5WA 3RC8A 2FV8A 4Q01A 4RFSB 1ZD9A 3A1WA 3ZS9A 2EVWX 1E9FA 2A5JA 2YINC 4MKGA 1FFHA 1VIAA 2YJTD 3LQQA 4M1WA 4EPWA 4CT5A 1AGPA 4JYBA 4EJSB 2FSHA 4TMVA 2OEPA 4GOJA 1VG8A 1YZLA 2ORVA 1KO4A 2XNDA 4FMDF 3K9NA 1RYHA 2FPMA 5CYPA 3CNNA 2RHMA 2GTPA 3KFXA 4KSCA 4EPXA 5E7MA 4RFSA 5KSPA 1MRSA 1JPJA 2QT0A 3AP1A 1NMZA 1W36C 3QPWA 2P6RA 4LJ9A 2P65A 6Q21A 4K81B 2GAAA 3KB2A 2ORIA 2RH5A 2OT3B 3RNLA 2GVDC 3I92A 2D06A 1G6OA 4RFVA 1G3UA 3KJEA 3GFTA 5FTKA 4A1FA 1W5TA 1NNEA 2JLQA 2N46A 2ZI3A 2QGNA 3CF6R 3PEUA 4OHXA 4RZXA 1NF3A 3KL4A 5FTNA 4UNQA 4C9BA 2JJ2D 3WRXC 1NBMA 1N6LA 1ONBA 1ZNXA 1F2UA 4Q19A 1ZNYA 5L3SB 2WWGA 4HLDA 3LXRA 1JJ7A 2NTYC 3NHAA 3KXIA 2CL7X 4M1TA 4WZAE 5SZKB 4JBYA 4MRNA 3KJGA 2C98A 4PC7A 2Q9BA 5AJXA 4B71A 3W6NA 2EW1A 3PUWA 4NE2A 4BEJA 3U44B 3NH6A 2WIBA 2X77A 4HLQB 5A0FA 2JJ8A 3X1ZA 3QEOA 1JR3E 1H8ED 4V02A 3W8NA 2BMDA 2H18A 4JLPA 2O8DA 4OHVA 1H65A 4L9SA 5FTJA 4ASUD 4JLKA 4JIMA 4RD2A 5FUWA 5HE9A 1AZTA 1TMKA 3KUCA 2IUUA 1G21E 2ZR9A 1AIPA 1E9BA 2C99A 3GLHB 3R7WB 2JJ2A 2MMGA 1U0LA 4NKRA 1FW6A 2RGDA 4QJ4A 3WNCA 1W2HA 3TAUA 3CKLA 1J8MF 4HZUB 1P9RA 1E98A 1E1RA 1MRNA 4I1UA 2OM2A 4YDSA 2IWRA 4D4KA 4DSNA 4LC1A 2L0XA 3B9QA 3TUJC 1TPZA 4MYHA 5KSOA 4D4JA 1NSTA 4EDHA 5KNBA 2XZLA 5TB5A 2FF7A 2IYVA 3K9GA 1J8YF 1AM4D 1E2LA 3RVBA 3M1IA 3TAHA 4QNMA 2VF8A 4ZDIA 4UNNA 2ZJZA 3VKWA 2IYWA 2BBWA 2JDIA 4JLMA 5FR1A 5E4FA 1VYTA 4X8MA 2VHJA 1N6RA 4HUQA 2REXB 2HJGA 1KKLA 3AP3A 2W6JD 1R0XA 5CK4A 4JL5A 2X19A 4PC3A 1N6OA 1WXQA 1XBTA 3SYNA 4A2QA 1HQYE 1T4GA 3CRVA 3CF0A 2XB2A 1R5NA 5SZHB 1OFHA 4CRWB 4MKHA 5JMTA 3LO5A 2IA5A 1OPXA 4BLQA 5FOVA 1Q1EA 4HAVA 5KTYA 1CXZA 1NVUQ 3EX7C 2X8AA 4BRUA 1N5KA 4NYJR 2CL0X 2GETA 2OXRA 2W58A 4HUQB 4Q4JA 3X1YA 3KTAB 1VDZA 4B3FX 3ZVNA 1A4RA 2XSZA 4TN1A 4D0LB 4DLSA 1CRPA 2I4IA 3OIUA 1NY6A 2C2HA 4DLZA 2ZRCA 1DS6A 3PIRA 2QORA 5G3YA 4GOKA 3UKDA 1QG4A 1S8FA 2O8DB 5ELXA 2VO1A 2P6NA 4PAOA 1I4TD 3VX4A 1KGDA 2VLIA 4LBVA 5JRJA 4KXFB 1TEXA 2W0MA 1IAQA 3SYKA 1H8HA 1OXTA 2NZJA 3BE4A 2YOFA 1TQ2A 1X8JA 3EIHA 4DWJA 4XWKA 1J70A 4MRPA 2F1HA 1Z22A 5F98A 4M1MA 3O8RA 3LVRE 2IEZA 2WJGA 4ZI2A 4TYPA 1MV5A 4IW3B 5TVKA 5A5GA 1MH1A 4PC6A 4F38A 4CEJB 1TUIA 1N0VC 2V7QA 2H5EA 4JVLA 1SULA 3RC3A 1R0ZA 5EP1A 3U44A 4PTLA 3C15C 1DARA 2FFHA 1Z08A 4P31A 5K8LA 2Z6VA 5FR2A 4URZR 5FPYA 3WMGA 4MRVA 2ERYA 2ZU6A 4CDGA 3ASYA 4D4LA 1NBME 4UJ3A 2XZPA 3EG5A 2XTZA 4QJ3A 2ZVQX 4M8NE 1X1SA 5HZHA 5D3MA 2J87A 3BD9A 4WXRA 2OXCA 3QPUA 1L4UA 1TL7C 1NLYA 1UBCA 2W0SA 4NPHA 2AR7A 4KYUA 1KI1A 2ZRJA 2WZQA 2ZE5A 1WP9A 3SJAA 3R20A 2DBYA 3BB3A 2ZM5A 1HA3A 2QAGC 4XTRA 4LX0A 2ZEJA 3L8ZA 2IS2A 1HT1E 1KO5A 1NIJA 1T5LA 4HLCA 4LRWA 1ZUHA 5AUQA 4QC2A 5D3MB 4Q4JB 3SN6A 5FUYA 3AGPA 2FEOA 4DIDA 2MSEB 4CEHB 4LDJA 4DVGA 5L3QB 2DWOA 2DR3A 4HATA 5FPKA 4B35A 1FMLA 2WBLC 1U8YA 2BC9A 4Q4AA 3CZPA 1N5LA 4TMWA 4RCZA 3U6BA 3IO5A 2PT5A 2IYXA 5AJZA 5FOXA 4D82A 2G6BA 4Z1MA 2FE4A 2UVQA 2V6IA 3SJCA 1M74A 1P75A 3THWA 1ZBDA 1ZIOA 2BVNA 4ZDJA 3CIOA 4NCKA 2H92A 1SHZA 3CBQA 3VNVA 1E2KA 3FMFA 2ZE8A 2ZSDA 1HH4A 1LS6A 3RRYA 1PV4A 3U61B 1DAHA 3SOPA 2B21A 4F91B 1SXJC 1LW7A 4ZDKA 4KVGA 2BEJA 4LZZA 2J0UB 1S1CA 1ZUIA 3LWNA 5CITA 2VHUA 1KDTA 1HEIA 3OAAD 4MUAA 4FCTA 4OK5A 2YHSA 3RS5A 4C0JA 2ZR7A 3AGQA 2CDNA 2BV3A 3RLFA 3SU8A 3FKSA 2Z5FA 4LPKA 1VHTA 3VU9A 3K0EA 3MWLA 1VKJA 3NEJA 2BJVA 3QY0A 2FFQA 4LJ7A 5HR5A 5KPJA 1R0WA 3BK7A 2ZUDA 1DAMA 1G4UR 1W4AA 2YOHA 4OJQA 3U6KA 4Q00A 4BFWA 1CLUA 3EPJA 1FNNA 4PHTA 5HZKA 2ZRLA 2R6CA 5DI3B 4OK6A 2E1RA 3T15A 2ZQ5A 1MABA 4A0GA 5DN6D 2GK7A 1SKYB 3W34A 4YC7A 2ODEA 4Q47A 2W6IA 1E2MA 2EFCB 1A7JA 4HDQB 1KI8A 2OLKA 1XB2A 2ZI4A 4KLZA 3GPLA 1TUEA 3HU1A 1FUUA 1Y63A 1F5NA 2FA9A 4YLGA 4RY2A 1KYIA 2WJJA 4CZ2A 4D81A 3K70D 4MYTA 3THXA 1NLZA 1ZM3A 3M4YA 2O8CA 1E9DA 1X1RA 4ABYA 4ACBA 3H0KA 4RD4A 4QHTA 1G8PA 2V8OA 4LSGA 3FVQA 2RGXA 3CWQA 4NONA 4TLBA 2IL1A 1QF9A 4M21A 4DCTA 4DLYA 1EWQA 2ZJ2A 4W5JA 4I99A 1MT0A 2EFDB 3LW7A 1N6PA 4IDPA 4DDWA 1E9SA 1KSJA 3LAWA 3QF4B 4XVQA 2BCJQ 3FFBA 2D3WA 3GJ5A 3THYB 1BYUA 4PC2A 1RRFA 3KKOA 3N2EA 4EFLA 4QGGA 2G3YA 3O8CA 2OUKA 4CT4B 2JLUA 1RKBA 2GA8A 2RKOA 4LUCA 3IO3A 2DFTA 1F2TB 4MYUA 4EPRA 4TMTA 1KO1A 1KI2A 2WWFA 4IVQA 4BECA 3GLFE 2ZYVX 4YMWA 621PA 3THWB 2AXNA 2GBLC 3LX8A 1EFRD 1DAIA 1UJ2A 2PLRA 3AVPA 2CLDX 4US0R 1BKDR 2JIZA 1LB1B 1I4DD 1P5ZB 1YR6A 4M0LA 1KDPA 4HEJA 3QKRA 4R2IA 3ECCA 2BEKA 1KI7A 2QY9A 3LV8A 1RYFA 4I1VA 3LBNA 3DMDA 5CJPA 5KOYA 4RZ2A 3QVVA 2IS4A 2NGRA 4TL6A 3CONA 2I3BA 4IKEA 1EX6A 2D74A 3GJ4A 5DHAA 2QPOA 2W2XA 3C4JA 4BLTA 3GJ0A 2DY1A 2F1JA 5SZJA 3DEFA 2ZJBA 1VYVA 3WP1B 1E69A 2EQBA 1S9DA 1OHHD 5KSYA 3ICQB 1P60A 2FFAA 4C0AC 5DI3A 2VP4A 1TF7A 5K8TA 1AS3A 1KI6A 2H7VA 3B1YA 3QG5A 1UKEA 4LYJA 4LOAA 3EC2A 4KO8A 1D2EA 4B32A 4Y0VA 4PX9A 2AXPA 2C9OA 4B33A 2IF2A 4NU0A 3L0SA 2GXAA 4KJZA 4PQFA 1F2UB 1RE0A 4A82A 5L3SA 1ZM7A 5FBRB 3NEYA 1P73A 1KI9A 2VQSA 2W2TA 4LCBA 1MO5A 2GZHA 1XEFA 4IEIA 4NYIQ 3THOA 3PVSA 1S1MA 5DO9A 4CEIB 2GWHA 3F0TA 2O8FA 3RS7A 5EQTA 2RGGA 2B8WA 1G7CA 1GL9B 2G83A 3A1SA 4JLJA 4GOXA 5E7IA 1N5IA 3KDSE 3QKRB 2AKYA 2HV8A 3ZQ6A 3KKMA 3RSOA 2HYDA 1FP6A 2R62A 5C2JB 1ELOA 3FKQA 1XEWY 5BWMA 2P0EA 3MLEA 4JLAA 1Z5ZA 4V0KA 3H1TA 4QBIA 2PMDA 3Q72A 4FCWA 5EE5B 4CEIA 2CE2X 1RZ3A 3SJZA 3PV0A 3WBJA 2BMJA 4DZZA 1KI3A 3VAAA 4AKEA 4HAXA 4IXNA 1E99A 4W5HA 2HCBA 4MDFA 2KJQA 5G3ZA 4PANA 1E94E 2JCSA 4CEHA 4LK2A 1EX7A 1FTNA 3FDIA 3OESA 4TLAA 2W83A 1U2RA 3JVVA 4YONB 5KDOA 1IN5A 3C5CA 1E2EA 2G1JA 2GJAA 3KQLA 2C96A 1GKUB 4RZ3A 3TE6A 2ZRNA 1LF5A 4HB3A 4QFMA 5BXQC 2ORWA 3EC1A 1W7AA 2CE7A 5DH9A 1GUAA 2R8RA 3EPLA 3U3OA 1IXRC 3X1WA 2OFWA 3DOFA 4E09A 3LA6A 1QHYA 2Z4RA 4PPQA 4Q1FA 3LY5A 1G1MA 2Z83A 1P2VA 4TQUS 1QRAA 2XGJA 1Z63A 1A1VA 1SVWA 521PA 1EFUA 2NO7A 1JECA 4IOMA 4U5XA 1E3MA 1LFDB 1E4YA 5TXGA 3D7MA 2CK3D 4Q48A 2GVZC 1TQDA 4TYNA 2FFBA 4U02A 3SNHA 1F2TA 1VG0B 5EE0A 1Q1QA 3E2IA 3L82B 5AJVB 5J4YA 3QPVA 2VSFA 1XD2A 3OFNA 1N0UA 4C0QC 2IEYA 1HY3A 1U94A 1K8RA 1RVDA 4TTPA 1QHSA 1YZTA 3AVWA 1CF4A 2O8FB 2ODBA 3PUVA 3AUXA 4YMUA 3G5UA 3W8RA 4F7WA 4ZDWA 3U7HB 4DLUA 4MH0R 3FYHA 4JL6A 2JIZD 3IIJA 4QOSA 3U2QA 4PR0A 4XVUA 1E2FA 3R8FA 2C9YA 4QGAA 1G3RA 3K9LA 3K53A 4BZQA 4LHWA 1KI4A 1X8KA 3DZ8A 1J99A 4IDOA 4L9WA 2DFNA 2ZSFA 4L5BA 3QXJA 721PA 1XXHA 2QRNA 1XD8A 2ZYTX 4AIIA 4F4IA 3GJ7A 2RGAA 1FL9A 4Z8XA 1NVXQ 3EIQA 3TNFA 4OBEA 2JA1A 3U4QB 3A8TA 3LLMA 5J4HA 2IF0A 4QJ5A 4D25A 3UWOA 1OXXK 1YRAA 1CP2A 3LQRA 3K70C 3EA0A 2JATA 5FL7D 2O5VA 3AVYA 2FSFA 3EZ2A 5LBIA 4F93B 1G18A 3OE7A 4OI2A 2ZROA 5FPTA 2J0VA 3UANA 4BFUA 2IYYA 4JYCA 1Q20A 4MQBA 5JFGA 5IRCD 2VP9A 5EXPA 4QL3A 4E07A 5FPHA 2GAOA 2VYFA 4UKDA 1PLJA 1ZC4A 1UM8A 2F9LA 3PR1A 4X8HA 5FFMA 1DTSA 1W4CA 3ZDQA 4OQMA 4BFZA 2JDID 1KOFA 4FMBB 4IHQA 2AWNA 3T35A 3B5JA 5JWRA 4LBZA 2CLCX 3SEAA 3WRYC 3WYAA 1YZKA 2QT1A 4PO9A 4ZKDA 1WB9A 5JRZA 3AF2A 4CVNA 3ZJYA 2HEIA 2VHQA 5CM9C 421PA 1XPUA 4B3CA 1GOTA 5AUPB 2QP4A 3U3JA 5JEEA 1T0HB 1E6CA 1Z0JA 1P2UA 2IT1A 3KXLA 4PQYA 3TK1A 4CEJA 4X8LA 1DAEA 5K8UA 5M04A 4WZ6A 1AKYA 2XTMA 1WCV1 1RPZA 1VG9B 1S2MA 3HYRA 4IVPA 4MA4A 3HJNA 3OEHD 4KFSA 5FBVB 2QRZA 4L15A 5JI2E 1OF1A 4Q5IA 5BYKA 2MSCB 4KCGA 5FBQB 2VBCA 3UK6A 4PZYA 4C0KA 1OH7A 2C03A 5FI0B 5L3QA 3CPEA 4ZCLA 2GCNA 2BIFA 4S35A 4NCHA 3TW8B 1EFRA 1T6NA 2ANBA 1XEXB 2ZPTX 3IPYA 3QVUA 1ZM2A 4FCVA 4HZIA 5EP4A 1JALA 1YR9A 4X8OA 3AUYA 1UKVY 4DUGA 3QBTA 2C9CA 5CIWA 3N70A 4IDHA 3TSWA 2CK3A 3CZQA 3NWJA 5EXXA 1PZNA 4I1OA 5J4KA 4WOPA 2QTVB 4JKIA 2Q3FA 1R8QA 3SBDA 4JS0A 2JLRA 4RD3A 3T12A 1PUIA 2ZI7A 1OH8A 3AVVA 1YR8A 1KMHA 1IHUA 1M1YE 4GBMA 1IONA 4AYWA 3FHTA 2GESA 4YXWA 5L3RA 1Q1BA 2VIIA 4Y0AA 1MKYA 3I1FA 3VR6A 1P7CA 1N0WA 2OBLA 2VRWA 1GTVA 4MGYR 2IUSA 4PQRA 2ZTSA 5JCZA 1NN3A 3BGWA 4RSGA 4TTQA 5C18A 3AP2A 3HPQA 4TMKA 2LKCA 1G5PA 2HF9A 3MFYA 1T91A 2J3EA 4XTCS 3TSZA 1OSNA 1SGWA 3V00A 5CIQA 3CM0A 2PEZA 5H1YA 3K1JA 2PL3A 3I5YA 1B23P 5JHHB 2GZAA 2QAGA 3NIBA 3S1AB 2WTUA 1KJZA 1RW4A 2F1RA 4OI1A 4CF7A 4WVFA 1DG1G 4PSKA 4KITB 3GJ8A 2DCUA 4HLUA 4HZUA 4Q1CA 1NG9A 3AM1A 3T1QA 3U7EB 4RZUA 4G0NA 4PPFA 2IHBA 2XOKD 3OIYA 4GZMA 2HYIC 5JHGB 1VMAA 2DB3A 4EPVA 1AQYA 5TARA 1VTKA 1DAKA 4B2PA 1E32A 4BFYA 3ZD7A 4PC1A 4TT3A 4XSGA 3KQUA 2ZU0C 3BORA 5ANRB 4UXIA 1GRQA 4Q7JB 1OT3A 1C9KA 2WICA 3NBXX 4B48A 1JPNA 3BFKA 5FBLB 1Q3HA 4BLPA 2ZRKA 5GJBA 2BKEA 4Q9HA 5DISB 4TL7A 3GLIB 4IXMA 2FGJA 1G64A 2FOLA 2QQ0A 1DO2A 5JBQA 3QBVA 3EPHA 1XEXA 3GJ6A 3I73A 4XOIA 5DYGA 4URXR 1JEDA 3GP8A 4TYWA 5DSZA 2PLFA 4TYQA 2CEAA 5GVRA 3FWYA 4Q1AA 4NCNA 2K5UA 2J9RA 2J7PD 4A8JA 2BM1A 3AKDA 4JT2A 4AC9A 1OIWA 1KKMA 2FG5A 1SXJA 4B76A 1FP7A 1S96A 1R7RA 2BKUA 1UPTA 2AD5A 4BLSA 2C8VA 5TV2A 1N6HA 2VP0A 1Z83A 3IEUA 3R8CA 3L0OA 3KQNA 4TZ6A 2QGZA 2QQEA 1EG7A 3KKQA 1P3JA 3V4RA 5F9FA 1TNDA 2WJHA 2XNDD 4Q4LA 4GT1A 1NMYA 3U7FB 2XJ4A 4P33A 4IFEA 2J45A 3DKPA 1LTQA 1M2OB 2OCAA 3BH0A 2H1LA 2DYKA 1CJTC 4L16A 4M22A 2CCJA 3ICEA 5JJIA 3GD7A 3A6PC 1U0HC 1XEWX 3Q5DA 5LB2A 4EFMA 1LF0A 3GLIA 5HKKD 1ZAKA 2CMKA 4Q7KA 2P5TB 3TVTA 2QAGB 1AS0A 1G291 1XTIA 3S1AA 3PUYA 5DHFA 2RCNA 1G8FA 4EJSC 1JQLB 1KZ7B 2D4HA 3WNBA 3MSXA 2REOA 2IYZA 2QMUA 3V9PA 2OCBA 1Z8FA 2GJ8A 2CHQA 4PZZA 4TSFD 1J2JA 2FPKA 4XH9B 1GVNB 1IBRA 5H68A 2HXYA 2DFKB 2A9KA 4KLNA 1OFUX 1PLKA 1XMIA 2GEDA 4DJTA 2CBZA 3VKHA 2J0QA 3ND8A 1W46A 3OFND 3SFVA 1A82A
chains in the Genus database with same CATH superfamily
3WK4A 1RYMA 3UHFA 2P2LA 5LLSA 3MOSA 4QHSA 3KT0A 2CC2A 4LSZA 5F64A 1CR1A 3CTPA 3T7RA 1Y3BE 2BY4A 2CY0A 2F17A 2GJ4A 4FZVA 2OXEA 5D5QA 4P4TA 1M8GA 3HM2A 3QKIA 2HBRA 3BJRA 3H9UA 4R2MA 1YSCA 4B47A 4ETNA 1DOAA 1J5XA 3FCCA 1P2SA 2MR5A 4OHCA 2WYUA 4S2EA 3MTQA 2WWIA 1OWPA 3Q6IA 1BVRA 1WW3A 2B7BA 2BHNA 2H1WA 1KVUA 1QIGA 2NNWB 2RI6A 3CO0S 2ZUTA 2H85A 1DRJA 2Z09A 3AZOA 5HM8A 1CD5A 3B48A 5AXCA 2AG6A 2WUGA 1QYDA 4Q9LA 4D9JA 4F2PA 1Z56C 4R1LA 4IOKA 1E5QA 3AHDA 5EZYA 4IYRA 2Y66A 4OVKA 3NNNA 4H18A 4ANFA 3WYEA 5HYVA 1BGXT 1XT6A 5M29A 3E15A 2V3VA 3SIXA 5LB4A 2PX0A 4CV0A 3UPTA 1YHYA 2QVYX 4IIJF 3HB0A 1L4GA 2VA8A 2O6LA 2VK8A 3I42A 1T10A 1PJSA 4FYHA 4HAOA 4JJ8A 4XPIA 5JDCC 1MJHA 1TJ5A 1ZI6A 3K1AA 2ZB4A 4MLCA 2E3JA 3RV3A 1G20B 1GUDA 2LBPA 3A26A 1G8SA 1KO8A 1LJLA 2B4YA 4Q3LA 1NZFA 3VSBA 2G08A 2OPHA 2Z56A 5AW1A 5LQKA 1DX9A 2O8VA 5LQUA 1TGYA 1UOOA 4G9BA 3TUIC 1G16A 3M6AA 3JVEA 3QE4A 3EFBA 2RE8A 3GLTA 4INAA 5ENDA 1FNMA 1IDN1 2AZXA 1BXZA 3CLKA 1FLNA 1AY0A 2B8TA 3ZWNA 3L7LA 4Z0NA 1V1RA 5E4JA 4BAZA 1NXSA 2XKAA 3EARA 4RIIA 1G9SA 4RESA 1CR0A 5T6MA 3VR1A 4W9MC 1N2CA 4E5SA 1C0EA 2FW0A 3JS5A 4EG3A 1ES9A 2XITA 4J43A 5A05A 5JQGF 6ABPA 4U0JA 4CQLA 5E9AA 1U63A 4HZGA 1JEQA 3V33A 4CCSA 2QU8A 5KVVA 3CHYA 3QYJA 4JMLA 5F21A 1N1EA 1T3ZA 3S2ZA 4R2KA 3OQIB 2XNHA 1C29B 4FBMA 3MRSA 2YS7A 5A9TA 3CLHA 1C0KA 3WB2A 3E3AA 1O5OA 4MLPA 1J00A 3MAAC 4H9GA 4XD7A 4KXQA 4EYSA 1LCIA 5C8DA 5J23A 4TKUA 5FPQA 2ID7A 2ZTUA 3OIFA 5JPCA 1T2CA 3IUEA 3NU1A 3MM4A 3T5BA 2PUCA 1OX5A 2O52A 1I9CA 1TZKA 1FDUA 2J0UA 5E9QA 2QP3A 5FF9A 2IV2X 1K9VF 1L5OA 3ENZA 4IL5A 1GRNA 4K1XA 3PUKA 4F5ZA 4YV2A 2Q1UA 1U4SA 1V8DA 2MSDB 5DNYB 3BIXA 4CIDA 2NMVA 1MEJA 2I62A 3O75A 4B4WA 3LP5A 4R41A 2G1UA 1YVRA 4BMDA 2LPMA 3E5MA 1XZBA 1YBMA 3BOSA 3CPSA 1C81A 3ELUA 1M1UA 4A73A 3GPIA 2EDAA 4WBXC 4O1IA 3IKJA 3NBUA 3VZPA 1XRRA 2GZ1A 3KQVA 3OTHA 3PD1A 2PL9A 1GQYA 4UQOA 1W581 4R2WA 1K68A 3PJDA 4D2IA 3VH1A 2HB6A 3FTNA 3DCNA 2CHGA 2NAPA 1J0XO 1IPHA 1W76A 2WIAA 1A0OA 1DEHA 3E8XA 1YVPA 3ABOB 1AKEA 2E1PA 4GW3A 2IGBA 4TX1A 1XTJA 3TL6A 5K0BA 4M4SA 2ZREA 1JIIA 2OCPA 2R6R1 3EBOA 4G9GA 1KAQA 2CNWD 3IIMA 4JMPA 4W6QA 5ERXA 5KYKA 1MC5A 1IDOA 1DQNA 1KAGA 2XUGA 4WOCA 3A10A 3MSCA 1JEOA 4QGSA 1U7XA 1IRXA 1TYAE 3KYCA 4QWMA 4YH1A 3WISA 3UJHA 3GW8A 4J1SA 4DABA 3UY4A 3ZV7A 4AZTA 5KHOC 6CHYA 4PPGA 3N0XA 2D2XA 5HFAA 1T3SA 3W5BA 3UM9A 2NXNA 4EARA 1UXHA 2VAWA 5JAUA 2BFNA 3E7PA 1YE5A 2GVNA 4Q24A 4QA9A 2QW8A 4P7BA 1DIGA 5HBGA 4FDLA 2Y67A 2E85A 3SIWA 3SHFA 3TQCA 3WYFA 4C0SA 1QGOA 3AEZA 1JKFA 4XIGS 1GDTA 5GONF 5KDDA 1GCIA 2GEVA 3QXGA 5B1HA 3C2QA 3TOZA 1P7ZA 4S1WA 4UMVA 4OLJA 4WLEA 4Z49A 4JT8A 1RJ9B 2GASA 3HE3A 5DCUA 5LKRA 4CIXA 3KYBA 1E9EA 3O3NB 5AKZA 4ER7A 4NH0A 1O97D 4WCFA 2W6JA 4HNRA 3AINA 4N12A 3E35A 3VMFA 3NKVA 4CM6A 1VBNA 3QX3A 1S3GA 5IAAA 1C9DB 1LY1A 1T8PA 1K98A 4M2LA 4DYVA 1MB9A 1A9ZA 1QRDA 1TVCA 2GSWA 3IE2A 3IPAA 1IBLB 4B73A 3Q3GE 2XF2A 1U8AA 2PS1A 2R1TB 1ZONA 3WXMA 3PJFA 2CCGA 3IAUA 2AH5A 1UODA 2IE8A 5KQSA 1IY0A 5IK2A 3FOEC 1F3OA 2B4TO 5H82A 1XXHE 4E1AA 1EP2B 3R5SA 4TQ9A 1PP4A 2RHLA 2VS1A 3AUSA 1RDFA 2Q6TA 2R1VB 4MITA 3UGKA 4EB6A 2XXAB 2DGDA 5H59A 3TTSA 2C5FA 4DBLC 4DB4A 1IUKA 5T8KC 3LGAA 4B6RA 4C0LA 4NBLA 3RFXA 1D2CA 1OYWA 3BMNB 3H84A 3U17A 2WILA 2ZYWX 4PIPA 5BQXA 1AZSC 1DHTA 1H5NA 2FPPA 5LNK1 5ADVA 3FMIA 1XHFA 2FP3A 4LV6A 4OMCA 3V8EA 4BUZA 1LX7A 1RPAA 3O4FA 3HYTA 3SC3A 3COYA 4K0RA 2JLWA 1X9IA 4Q4HA 4HV4A 2NT4A 1R6BX 2FQ1A 2FPWA 3ZY5A 1QYXA 4C7XA 3KAKA 1W1WA 2W42A 1NOJA 3ITEA 5LXTF 3BEDA 4TTRA 5G0UA 2PH3A 4NVRA 4LXUA 1ARZA 4EF6A 2PYIA 5KSZA 2TMYA 4CN8A 3AHGA 4RF3A 3U3MA 2XQIA 5CXXA 2XHZA 3OLXA 5J2UF 3BTOA 1SXQA 3CG0A 4DGSA 3JVDA 4WBNB 4WESB 1SIWA 3LX5A 1L4KA 1U3VA 3I61A 4H3KB 1PFUA 2IYQA 5A4JA 5G40A 2IXTA 2DR2A 4OI0A 5AVTA 4AF6A 4JJKA 2AJ8A 2ISSD 4LDNA 1KERA 2JFBA 5B3JC 3AYXB 3QVXA 1YRLA 2ZJ6A 2P67A 1VPVA 4UBJA 3KEQA 1ICEA 1OAKA 1SCIA 3DPIA 4YRGA 5K05A 4LFBB 3RU2A 1S3IA 1ZH6A 3K0KA 2OOKA 5I5EA 4M6WA 1A2QA 4V0LA 1PQ4A 3VZBA 1QTQA 2I33A 3VX3A 5JBNA 4P3KA 3AUJB 4H4EA 3T3GA 1XTVA 4O3MA 4NBKA 5C1DA 2Z6QA 3ID6C 4FHCA 2W8ZA 2QVXX 4BBJA 4EIWA 4YNBA 1JYSA 2PUWA 2FPGA 2YMLA 4B2IA 3QE9Y 2HK6A 3NO4A 3NAQA 4A27A 3DM9B 4DIEA 1Z45A 3MEQA 3HO1A 4K0KB 3FFTA 4RLSA 5JMWA 1GCOA 4LHYA 3IUBA 1J90A 4N6NA 2J5RA 1HGXA 4OFWA 4OP1A 3WLLA 5EJ6A 1TMGE 2CLSA 3MBOA 4GUDA 4IUCS 4AULA 4MI1A 4UZEA 1EK2A 3L9WA 4ZCRA 3ON5A 5IAKA 1UC9A 3G8CA 1JLLA 4LJ8A 1SPXA 5IAGA 1D8TA 3ADKA 2EBUA 3LHSA 5CLLA 2D13A 3P97A 4HG2A 3AOEA 4NU8X 4BIMA 4GYKA 1GU7A 3LY8A 1EVZA 2PT6A 3BQ9A 4J7UA 1DKMA 4DF3A 1PQYA 5KYXB 1GQSA 1II8B 1QGUB 2JFZA 2ZBQA 5DBEX 3QBDA 2NZYA 4GDFA 3KB1A 1Z2EA 2ZBFA 4MPTA 4NJMA 4H7KA 1L0BA 1P5HA 1GGJA 3JWEA 3MJTA 1X1TA 3HM9A 3V42A 2C9BA 4MUEA 3Q9LA 4Q18A 5DBFA 3BN3A 2ZIVB 3PG5A 4PZLA 2J85A 4WZBB 3KQPA 2R5WA 5FTMA 1H93A 4QU0A 4IJWA 1R4NA 1WQ4A 2CMGA 3CJRA 1CZHA 3ENNA 3PBKA 1BN7A 1N7JA 1HNZB 1WHTB 3U1TA 1BEZA 1YB2A 4FR5A 3T1YB 1XTQA 1DIBA 1LQ2A 2WQ6A 3FLMA 1KZ9A 4YO8A 3VI3B 4BHTA 3MTEA 4ZN6A 6PFKA 2IS6A 2HSJA 1IB0A 1Z25A 2FZVA 4UHJA 2PGXA 5LU8A 3HCPA 1NE7A 3LDAA 5EKUA 5K6RA 1CY8A 4XARA 1O58A 1SZPA 3LX6A 3UQYS 1VJRA 4J7XA 1IXSB 4WKCA 5F9HA 1S4MA 1JAIA 1NG1A 2JLCA 4PG5A 1NAIA 3F4KA 1JR3A 4K26A 1EWRA 5BT8A 3Q11A 2IWHA 2OKGA 5BVHB 1B2RA 2WKRA 1GIAA 2ZIAA 4DDHA 4EAQA 1DDOA 1SZDA 3IXQA 3QVGA 3INYA 3DW1X 5C9ZA 2H0QA 3GEIA 4YAOA 4P38A 4NDAA 3H5AA 1BW9B 5FL3A 2B61A 3BQMB 4EB3A 5THQA 1NVTA 2JLVA 4K9SA 1QRRA 3EH2A 1WUTA 1LDYA 4HXEB 3UHPA 2AX4A 3EGOA 4ER0A 2XJ9A 3DVSX 4KYIB 1FUIA 2WWYA 3ZZ0A 3WNZA 3H87A 2FB9A 4R6XA 3OTWA 2GM3A 1IN1A 2YWHA 1HE5A 2W37A 1U7HA 2PT9A 3ETHA 1KQNA 4BP1A 2B20A 4EHFA 4ZGBA 5JEDA 1XZFA 5EJ4A 3UA3A 1JZQA 5B7PA 2EJCA 3JQAA 3DAHA 3HVJA 2QVCA 3A3NA 3T41A 3FA2A 2QXYA 3EWSA 5CGZA 4YT8A 1DU4A 4YRTA 3FM9A 1IXYA 4O4JA 3RIHA 3DLTA 4YRZA 3P2IA 5IVIA 3MILA 3F47A 2GD6A 4A8JC 4X7BA 1KSHA 1GAJA 3EZNA 3THXB 3LGSA 1GHTA 2Z95A 3K4HA 1U28C 3ZCRA 1WETA 5IM4A 2A9PA 2YN0A 5HM6A 2P4SA 4NK4A 1ND6A 1RYYA 3GZJA 4FB5A 2HSZA 2G1KA 2QSZA 3WWYA 3QLUA 4MTCA 4EO7A 3W5VA 4ZVKA 2RB5A 4L0QA 1G0NA 3N2IA 2X2PA 3H2ZA 1LW6E 1W5FA 1DZ3A 1CQWA 1XZDA 5FNZA 1AHNA 2VJQA 1ZP6A 4M55A 5C4GB 3UN1A 3ZU6A 2G9RA 2V7VA 3VTAA 3WAGA 1F06A 2ET6A 4KIGA 3I8XA 4KBYA 2VNHA 2Y1CA 2IW1A 1VLVA 1K7XB 2E82A 2IH5A 1JJAA 3PKIA 4O3FA 1OAOC 4ILEA 4JU9A 5GOTA 1TAUA 2AB0A 4WK0B 3LOPA 2XAUA 1OLXB 2FPXA 4ODIA 1SQ0A 3TMYA 4E5UA 4EUKA 5AW8A 1MVOA 4HGYA 2QZ4A 3HVUA 3DBVO 4LE1A 3U40A 1GKIA 1RMTA 1L1FA 3ED1A 4X54A 2VPZA 2G0AA 4UBKA 2HDHA 4CCYB 1X7HA 5JSYA 5TGDA 3GMDA 3WGLA 4BGDA 2J8ZA 1BQ4A 3CGGA 3D0KA 1JYFA 3GEMA 2GHTA 3QVGB 2UYOA 2BCEA 3RCBA 4CQNA 1NLUA 4IHJB 1XPOA 1D2GA 3CN7A 4ESHA 4OREX 4WA7A 3RIGA 5LA6A 2QVBA 4B5KA 1B0ZA 1V2GA 3PRYA 4TWZA 2GK6A 1HWYA 3KTDA 5J43A 3JQFC 3FHOA 1ECBA 3IDAA 2FFRA 3M7IA 4LTNA 5JNSA 1CJCA 1EQAA 5I9MA 2LUOA 2RI0A 1FFSA 1ZK2A 2BKXA 1PFWA 3M82A 1DX4A 2V6JA 4DSUA 2QR2A 3ORFA 3EW7A 1W36D 4BGEA 1LNZA 3IODA 1KI6B 1U0FA 1RWOA 1U2EA 2X2FA 5CH8A 3P26A 4IDDA 3A2LA 4QGHA 3GRVA 4OA8A 1ISRA 1X2BA 2QLJA 2YHUA 3WY9A 4G5YA 1JBEA 1L9KA 3ORQA 3JQEA 2R7NA 3FOBA 3NI2A 2A5DA 4GKAA 1PR3A 4MGZR 4ROTA 5BN5A 2QM0A 1CEEA 2NM0A 3EXIB 2P91A 2A2ZA 1J39A 3PHGA 3UKJA 1G7SA 1ML3A 1QZXA 4Y2QA 1TE2A 1DSSG 2VYVD 4J3NA 4DM7A 3VRHA 4QD3A 1YBAA 2NSJA 1L7MA 2Y1WA 1NFFA 2G88A 4BNTA 1CDOA 5LMUB 2H63A 1QO0A 4O2BB 2CYBA 5AJTA 5DBGA 6NULA 4B3DA 5JDCA 3EOZA 3TBHA 3CPHA 1P45A 5CUQA 1DTWB 5FEUA 1E8NA 4N5DA 4N3BA 1E6LA 1YJBA 1K7FB 1QP8A 2PMKA 2YIVX 1DXYA 1HOTA 1NKTA 3V4LA 3SZGA 5FWXB 4EPYA 4MYRA 2IHNA 3JYNA 4GD3Q 3PFBA 2UYGA 3AESB 2PZGA 4UM9D 2KBEA 3E8SA 5HFNA 3T38A 4F71A 1SKYE 2BR5A 1OYVA 3OX1A 1JSXA 2GN2A 4AJHA 3NAMA 4Q3KA 4Q34A 4DOMA 3BB1A 1C0LA 2JGEA 4ZJPA 3GLGE 4QM6A 2C3UA 2V74B 3GC6A 2X8JA 3KYDB 4WNAB 2BEVA 3TLAA 1HTBA 5EWJA 2UZ0A 3H13A 1MO2A 5SV2A 5I7UA 4RF4A 2OV1A 4QSHA 2ZWVA 5JE8A 1Q3KA 3HCRA 3M5PA 4Q03A 2XHEA 4ARZB 2WZDA 4LBWA 4IV8A 4J76A 4IH9A 3DE0X 4ZOAA 1PJBA 3RJMA 1QUEA 4B6FA 2VRCD 1P72A 3SIPA 4DQVA 1VCNA 4KFCA 4KWEA 2YYAA 1TF2A 3BGVA 4KX3A 2EZ4A 5DM1A 4BB0A 3HJRA 2HLPA 2PGNA 2VSXA 3A1UA 3ZJUA 1ORIA 2OR3A 3EGIA 3NBMA 4KBGA 3ELWA 3RFVA 3TQSA 1ILEA 3V4VB 3CX8A 4EG6A 5NLLA 1BMDA 5ESDA 3VTKA 1ORHA 2YDXA 2IVZA 1RM5A 3V4SA 1W0JA 5DNAA 3H86A 1D03A 2Q6LA 4GMHA 4FMDB 4Q39A 2VNJA 2WU3A 3IULA 1CUUA 3V8MA 1V1RB 2XCQA 4QOIA 3TOVA 1FXSA 2Q5QA 1GNPA 2YV4A 3PXBA 4WDRA 4AG6A 4B43A 4BDSA 3UYKA 1BXRA 1V5EA 4I3GA 2HF8A 1BMFA 3ABRB 4TVBA 4XYBA 2ZYSA 4MRMB 3BGSA 4DKJA 3TTTA 1GLGA 4ECEA 1J8DA 1N57A 1NBEA 2J1LA 3DXZA 5JJLA 1JJIA 3QVTA 3NHFA 4I55A 4AZ3B 2NZ8A 3BFPA 4WFQA 3RIYA 2ZIEA 5EE3A 2AK3A 2ZIUB 3IRUA 1ND5A 5NULA 5KNCA 2ENWA 1D2HA 1DNPA 4UXHA 4EHJA 2X0IA 4Q1DA 1A9XB 4PO8A 4S04A 3ZLUA 4PLCA 4JSTA 3S7ZA 5ICGA 2QI9F 3KYIB 3MG9A 2C8JA 3RABA 4GM0A 4MNTA 1X7XB 4U8HA 2W6CX 4I1SA 1L5NA 2WIDA 1YMVA 4WKPA 5DYTA 2QQGA 5LSAA 2Q3DA 3JZMA 1Z88A 3SXPA 5ERYA 4KC0A 2FRDA 5TGTA 1ZCBA 5J40A 1IJEA 2BUBA 3CLRD 3JQBA 3H2BA 2QTCA 4J75A 2TSYB 1QVZA 4GL4A 2OO5C 1U99A 2ODNA 1SEPA 4IFIA 5FL7A 3WMXA 3ROPA 2D00A 3F9CA 3T7IA 4WN9A 1F7UA 2ZETA 1S4QA 2NXJA 1TU4A 2VF7A 2FPLA 1T0IA 4IGFA 1L6RA 4Y67A 5KYUA 2QXTA 5JC8A 4TRRA 1IE3A 2WPDD 1HT3A 4O2BF 3WWDA 3TE7A 2CFRA 1ONNA 4R7ZA 3FZYA 5CJ2A 1V1JA 4N3NA 2CNNA 5CTAA 3TOCA 2X1MA 4ZVSA 1SXJB 3AW8A 3MUOA 5BQPA 5T5QA 3TFWA 4Q37A 2NVOA 3ONFA 4ZO4A 1U1EA 1W8DA 1WP4A 2H59A 2O2JA 4FKZA 3COVA 5A0TA 4TVOA 1BAPA 2ZRHA 3GA0A 5JJ5A 3NVAA 5CLHA 1O5TA 1PT7A 3CB4A 3EY4A 4HQ6A 3AV0B 2DT8A 2DHDA 4R40A 3UK2A 1Y3AA 4EPTA 1ZR4A 3BAFA 2ETVA 4G84A 3FDFA 4D8VA 3DNMA 2D5BA 4RGYA 2LD4A 1XJ0A 4MV7A 5FBWB 4AURA 4ZEOA 1JH9A 1B73A 4PX3A 3H19A 2BFDA 3GN2A 5A9RA 1CW2B 1Z4MA 1AGYA 1NPTO 3V2HA 1IM2A 3C24A 2GCOB 4NEHB 2PVCA 3O4IA 4GWLA 5AOVA 1IXKA 3OZWA 4US2R 3H9EO 1H2XA 8GPBA 1J33A 4WK4B 1OCEA 2BCGY 3ENVA 2CUTA 3S2UA 3WO0A 1F7VA 4JAVC 4BP8A 3AT1A 4JI4B 3EODA 3K2QA 3M1YA 5FOSA 3SBEA 4ZYTA 3KZOA 5I7HA 4Y2HA 1COZA 2P4UA 3KHSA 1G5IA 2JK0A 4RD1A 3B1WA 1AGRA 2CXXA 2ID4A 2E4YA 2QL6A 3B78A 4HEQA 4HQFA 2ZRPA 4IEEA 2CCKA 2G63A 3LQ4A 4P32A 4OATA 2WNSA 4PYKA 4XUDA 3E70C 8LDHA 1XLTA 3DBLA 4B3BA 5IVPA 3JD4A 3UT5B 4D6PA 4I36A 4MI6A 2AR9A 4XR4A 1E96A 3T6KA 5EJGA 1NVBA 1S7GA 2FPGB 3RVPA 2J3JA 3TZLA 4RGBA 4WLNA 1VIYA 1PBNA 3KVNA 1OVMA 5DHRA 2EYUA 2GBCA 2JAQA 3KAJA 3WA6A 5L95A 3BERA 2Q5EA 2GZ2A 4EWLA 4FFRA 1M5RA 4C5BA 4AJOA 5EHGA 5CIYA 1KMIY 2ATCA 3CZ4A 2WRZA 3KE8A 1DHRA 1K8QA 4JX8A 4LG1A 5F2NA 3M3HA 1KDOA 2B30A 5EZ6B 3L07A 4R5MA 4YP5A 5EGSA 4DMHA 3PUIA 4PU0A 4CKCB 1T8YA 2WKWA 4MICA 3ZE2B 2EIHA 3T1NA 1CP3A 1IPFA 3QYPA 4HNSA 1Z4LA 1CIVA 1E2BA 3RYHB 2DPXA 1AQNA 4G1FA 5T41A 4URUR 4B3JA 4HB0A 3F2IA 2VQFB 1NWCA 1A7UA 4MVJM 4ALJA 2O2ZA 2E7ZA 1QDEA 3GARA 5ELMA 1WXIA 3FOZA 2VDLB 3A3KA 2OOSA 3G1UA 4QTZA 3QU4A 1L5MA 2GKSA 4O29A 1CZOA 2Q99A 4ARAA 5ITZB 2FLKA 5H7XA 1WSDA 4R8RA 1E2QA 3T3EA 3SKVA 4P0PB 4M37A 5HQ3A 1EFDN 5E3JA 1V71A 4A0QA 2XT9A 4KUEA 1GU0A 4YRAA 5KQMA 4HLUC 5FEMA 3WJ7A 3KQHA 1G5RA 2ZIXA 1G3MA 2C4TA 1S2OA 3Q40A 3IAM6 4DGQA 3NC0C 7ABPA 4MI3A 2P5SA 3VR2A 5IJ0B 2QN7A 3RS0A 4BCDA 1Y3DE 5HIIA 1PHPA 2P9JA 3VJRA 1ADYA 3U3RA 3E22B 1NVFA 3P2OA 4HDRB 4BO9A 2GFQA 5LWHA 1XRLA 2VWHA 3PHHA 1HE2A 2NG1A 3TMKA 5C5EA 4EH1A 4EGSA 2QPLA 4A2CA 2J09A 3VKVA 3AVOA 2IYAA 2ZAYA 3A4VA 3GH1A 5U9CA 3JQ8B 4FNMA 1H3NA 1ZVQA 1EE1A 1DFIA 1MFPA 2R25B 1X1QA 3WJAA 3JTEA 2LKDA 2PTHA 3ZHBA 2GARA 4IHAA 1HUQA 1QYWA 4LHZA 3NX4A 4EY4A 3BXGA 4J49A 4IUYA 4OD0A 1DUVG 1HYHA 2Q1TA 3ZZUA 3QM1A 1QR2A 3K6JA 3CEAA 4DV5B 2BF4A 1ZOLA 1VJCA 1JDVA 3A0RB 4WUVA 2WG2A 2N1BA 2WMYA 3CUUA 4JYMA 4LNAA 4PVCA 1C7IA 2P2YA 4OQFA 3S6JA 4H6XA 3N59A 4DLVA 3K0CA 9LDTA 1GM5A 2F4NA 1PK8A 4P3PA 3A7DA 1BDJA 3KKEA 3TIIA 1W35A 1XL1A 3EULA 1M2JA 1RWXA 1Y89A 2VDWB 2VPPA 1JAZA 5ADHA 5FOWA 1FRNA 2JANA 2QDKA 4GP6A 1MGPA 3GH3A 4Q4HB 2WT9A 4LCEA 1D4ZA 4UHHA 4OHYA 1JHPA 1ZESA 3ONVA 4HDCA 3NOVA 5EMNA 1TU3A 2YUIA 4G4IA 5A4DA 4C4TA 1LD3A 2C3MA 2PZKA 2VJMA 1RHJA 4M46A 2QL9A 4GXTA 1G3IA 2VT7A 4RSRA 4I9GA 1GG9A 4JN6B 2VJYA 4LDPA 3ICOA 3WHLA 4BFVA 1U0TA 4GSLA 1DLJA 4PONA 4OHBA 4BXOB 2FH5B 3WYNA 4HB4A 4R84A 1CY2A 1S2LA 4DEXA 1KSFX 3RKRA 5IU6A 1B8PA 2OFOA 1P8JA 2WHYA 2FZ4A 2O5RA 2PIAA 2YQ4A 3CINA 3DQZA 4KFTA 5FQOA 4BZZA 2ENUA 2PLNA 3BRCA 5F5NA 1SQFA 3U0BA 2O2EA 4JLVA 4MW4A 5GP1A 5H4GA 3PLAE 3SHTA 3B52X 3QFTA 1A5BB 3MTAA 4UUOA 4LY0A 4PZPA 2J5QA 2CUNA 3DZGA 4LSWA 1P61B 4ALLA 2CXOA 3GJYA 3S8MA 4I4TB 3O8LA 2BM0A 3FIJA 3BULA 4QQRA 2QX4A 3P20A 3QQPA 4OBWA 2QYHA 1GWNA 5EUCA 1Z6YA 1H1LB 2KE5A 1WPGA 3CH7A 4CR7A 3W3AA 2YY6A 3GJ3A 4Q02A 3OSUA 4CCWA 3CLSC 2P2CA 4JC8A 3H99A 4CQLB 2Z8YM 3HVRA 3KM0A 3NUZA 4WBSA 4YV7A 1HFKA 1AQ6A 1FF9A 3QOFA 3B6IA 4CFSA 4Q66C 4M1KA 4YJ2F 2X6RA 1CS4C 1Y1QA 1WXWA 1D6SA 3GFFA 5AK0A 4QG3A 3OE4A 5AOBA 4IM7A 3RUDA 4GLBA 4M1QA 2AZDA 1FNBA 2V6BA 4R1QA 5HUJA 4PCUA 4OMDA 3O84A 4FM9A 1QHGA 4WD3A 1XAHA 2OM6A 2JVIA 3MWYW 3JALA 2KM1A 3N7UA 2JGJA 4QULA 1IULA 1UPCA 2RIRA 2H52A 2ODAA 2R5FA 3N05A 4UARA 1UFQA 2HRCA 3KDAA 5KI6A 3N3BC 1EXVA 1DMSA 3GP3A 4Y6PA 4KLRA 4MW0A 3PDIA 3R3VA 2NYRA 4LNHA 4R1OA 3ANXA 4W8OA 4X1KB 3OD5A 3BM5A 4EYGA 4C3ZA 4I5EA 3FSRA 3AETB 3TTUA 1E63A 3W5JA 5JQGB 1Q92A 1PWEA 4K9OA 2Q07A 2CXPA 4MJXA 3ZS8A 2EFJA 3WNDA 4YQFA 2ASEA 4CIWA 1MA0A 3QE2A 3GRKA 2NAFA 4YT2A 1HURA 4UHFA 5AK6A 3BIWA 3DOEA 4ZPJA 4E03A 2N1MA 3CRZA 1ZM9A 1YBFA 2JD1A 1TA0A 3LDUA 5AI9A 3ZVLA 3BJMA 2GPWA 1G5TA 4QUJA 2ZWOA 5LOVA 2WF9A 1S3FA 2PE5A 3MFQA 1QQBA 3BJZA 4JI0B 1PDVA 2IK8A 4KPFC 1ECFA 4B74A 3UWDA 1L5QA 3R9IA 4BBPA 4BWYA 2Z5VA 3K1AB 1ZA1A 3QSYA 2DUUA 4MV8A 3W6ZA 3GLGA 1QH0A 2R68A 2G07A 2QG6A 3DWGA 5D01A 3EA5A 3OEYA 1P0QA 2IYUA 1GVHA 2MSWA 3BK1A 3VZRA 3IQFA 5KYNA 1YAJA 1YBHA 1H8EA 3TKYA 1RFLA 1RI1A 2AJTA 4MKRA 2OCDA 1AKRA 2WIKA 4MWGA 1ZEMA 2F6RA 3A9WA 1CF9A 2FGKA 2XUAA 3IOCA 2KBFA 1Z29A 2E49A 4GEKA 1BN6A 4M9UA 3LLUA 4PG6A 3RFFA 4V0SA 5DN6A 2AG0A 2AOWA 3S27A 2PMWB 3UH0A 1XNJA 4CMIB 3RVDA 5AHRA 3QTLA 4XXHA 2H31A 4INOA 1MR3F 3NOQA 4NECA 1Y9DA 1TIKA 1DC8A 1P29A 3AHHA 4KQIA 4C7OA 2WFAA 1KBQA 1I2CA 2FPUA 4LVUA 1NUPA 4LYYA 4Y98A 1HNNA 3W8DA 4AP5A 1EBUA 4EX7A 2RFLA 4X1IA 5L3SB 4HSGA 3T3DA 4PLFA 4I14A 5EKTA 4OM7A 3GD5A 4KO2S 1WSWA 1WDMA 4H7JA 5F1OA 4KV7A 2Y1FA 4RK5A 3REGA 1NA5A 1YL5A 1V37A 3LBFA 2A9OA 2WU4A 4DAOA 2I4OA 1AGXA 1E2DA 3VNQA 4EI7A 2LR0A 3FI9A 2VLBA 5DIFA 3NOXA 3CLTD 3FPGA 4C4YA 4EUEA 4R2HA 2D54A 1PVVA 3KP1A 3HB5X 3R7FA 2F67A 2I0FA 1ZY2A 1ULSA 4J90A 2SCUA 3GLHA 3BREA 5KX5A 3EIXA 3T7AA 4B7ZA 5IBRA 3ENKA 3M33A 4M36A 5KVQA 4QXQA 4DJDC 5A1JA 1QRTA 1NLFA 4B79A 2IKSA 2O7VA 4JQCA 3RIXA 4NDNE 4FLMA 4YUVA 3OOEA 4CPDA 2W6PA 2O7SA 3JYHA 3I9KA 3ZU5A 3UG7A 1PVDA 4ZYUA 3EDMA 5C4IA 3T99A 2REBA 3NG1A 4XFDA 2OAEA 4NCBA 2WMOB 3ESCA 2QD4A 1K08A 5LBUA 1ACMA 4QM7A 2CUZA 1CULC 4Y1RA 1OYYA 1PJRA 1HMYA 2GMWA 1D7OA 3AJ9A 1NYQA 3HI4A 4O0MA 5CNKA 1R4ZA 3ZTWA 2BMWA 1ZRNA 3LP8A 1XZEA 4RXTA 3E2PA 4P35A 5HXAA 1Y8ZA 3NDBB 4EHDA 2H16A 2PD3A 4RH0A 2EU8A 2ANCA 5JCPA 3AL0C 2F4VB 1DZIA 3T4UA 3QF7A 4E14A 1Z6XA 3B6MA 2LTAA 3I8SA 2PVPA 1CUZA 3PGXA 3QEJA 4G5XA 4AN0A 2NSHA 1ODFA 2EJBA 1WF3A 3LBAA 2XUQA 1BX0A 4C1NA 3UAGA 1JHYA 1FU7A 3AF4A 1W5EA 2JFUA 2PG3A 1SY7A 4XWTA 2GXSA 2XNCA 5BV0A 1L4YA 4CMBA 5IUNC 1TVKA 4NFLA 3T7TA 1NUQA 5CB8A 5BUSA 3Q7EA 1Y8QB 1LVGA 1RC8A 1PFGA 1AA6A 3P45A 3JWIA 1DXOA 2FEPA 1S8AA 1XYYA 1BE1A 1AUVA 3R3ZA 1AHIA 3GCGA 1JQ5A 1ZJYA 3CX4A 4KXVA 1HYBA 4RPJA 2C5EA 3S0JA 3L84A 2IBTA 2IDZA 3F3MA 4EO4A 1LX6A 3DOHA 1UBGA 1POWA 1UDBA 1FFGA 2NLOA 2PUJA 4ND4A 1SELA 4FR2A 2QZ9A 3BDAA 2BFWA 3JSXA 5AUNB 3IMKA 3T3HA 3VAYA 3C3BA 3QTBA 3OQOA 1R10A 4P84A 4RVSA 2O0KA 4BN0A 2BE9A 1CU1A 4KREA 1XN1A 1EFLA 2NPFA 1KEWA 2JIDA 4EDFA 4RMGA 1CUEA 3SEQA 1YNOA 1YR3A 4KQKA 1PUJA 1D2NA 2EG5A 3AQ4A 4I2VA 4ZKEA 4LF9B 2ZSAA 1PYDA 3MWKA 3BSYA 5AM1A 1VCOA 1UJBA 1T6BY 2P7HA 4LQCA 2A5LA 2CXQA 1K8ZB 3AIIA 4EMUA 5LYJA 1Z3IX 3KDPA 4XQCA 1EFCA 3K0FA 3K6SB 1SCQA 1OIXA 3QWAA 3PC4A 5CA1A 2G9NA 4MTLA 1H0KA 4UXJA 1XCBA 3LUPA 4WAUA 5U1PA 2HSWA 4IINA 4XCXA 1E9RA 2V1XA 3DKVA 3OSZA 5GIPE 3IJ5A 1JF8A 3RUPA 4L4ZA 2QV0A 4YCBA 1OH5A 1DRUA 3OZUA 1KTIA 2ISQA 4YJGB 4ILKA 5CT6A 2OWEA 1CVRA 3GXOA 2YZKA 2W2KA 2PV0A 4S2UA 2DMRA 2ZCUA 3I39X 2J59A 1E3IA 2EIXA 2AEEA 3QUSA 1WS6A 5JALA 4IQFA 2NX2A 2ZTLA 1BXGA 4OYLA 2FOIA 5KU7A 1XQWA 3HWX1 3IT0A 3SHWA 5KSWB 3FTPA 1EBFA 2NPOA 2QMHA 3HUTA 2WOJA 4LJ4A 2E87A 2Z3WA 1J5PA 2NTNA 3B8HA 3DBLB 2OHGA 3H3FA 5JXJA 1E2PA 2VRNA 1ZYUA 1EJBA 1OA1A 1MFZA 4QBFA 4RY0A 4NPAA 4IHJF 2OP0A 2PBFA 5F1YA 3RSLA 1RYBA 1K7CA 1ICIA 2VF5X 3A1TA 3AH8A 4GVLA 2XOKA 1ULZA 4YBZA 3IERA 4LVCA 2O8CB 5KQRA 1PJAA 1M1ZA 2H48A 3D3NA 5K8IA 2QTHA 4CM7A 3L0ZA 5LLDA 3LHDA 3VHRA 1N8NA 4S0XA 3SF0A 3QVOA 2AZTA 2CSUA 4KV9A 1GQ2A 4A36A 3UWKA 2D1SA 4I1RA 2MJLA 3PPVA 4JI6B 3KPVA 1P80A 2G25A 1DELA 5AOAA 3O4VA 2V7BA 5JO9A 3OIWA 3I8OA 1UT8A 2QJOA 4UQPA 1U9ZA 3C8HA 2XNKA 2P9GA 2HC9A 4N8DA 5L7TA 3WO1A 4FUTA 5IZCA 1OXSC 2JHAA 2ZGVA 5JCJA 1NVMB 1UDWA 1ZITA 3MQFA 5THKA 1QWSA 2P69A 4FW9A 5CAEA 5IJ9B 1ZU5A 2NVWA 4FKMA 3SJ7A 4OGFA 3WLKX 1JNYA 2P5UA 3KAQA 2PQMA 1QFXA 2ETXA 1N2SA 3DPSA 1ST2A 2VHTA 2TMKA 1Y5RA 4OI4A 1ENPA 2O8BA 1WKCA 2BLLA 3OBBA 1SU4A 2X2OA 4O33A 1UBMS 2H8GA 4JELA 2Y4OA 4ZTZB 1NXWA 2QD1A 2FZ5A 4BNDB 3SYRA 5HTKA 4NAHA 1P2GA 1HDCA 1ZK3A 2I4LA 5IHXA 2C94A 4IGKA 2BP7B 3L6BA 4YBRA 1SFRA 2XE6A 3O4JA 1OB2A 1CT9A 3FOFC 3IQGX 1A1SA 4NV0A 2WINI 3Q6NA 4BV9A 4ZI7F 4DCNA 4ID3A 5IG2A 1LQTA 4JUBA 4YJGA 4DCPA 4AI6A 2FPOA 4LZWA 3VSDA 1NOIA 4FIDA 4D9IA 5J5CA 3UZUA 1PR5A 5B30A 4W5NA 1FFXA 4GMXA 1RQ7A 4DJAA 1QBKC 121PA 1OQAA 1P62B 4F97A 5HJ7A 4IOJA 3EZ9A 4OH1A 4XLLA 1H23A 5KS2A 1CEXA 4ED9A 4OH7A 4QYXA 2ZB2A 2VBIA 3FDZA 3ETDA 5DCLA 1EMDA 3HP1A 1JEEA 3RSFA 4Y2JA 3ZKWB 4C0BA 1MJ5A 4TV9A 1NYLA 2FG7C 1C9MA 3DAOA 3TLKA 3W9BA 2DH5A 4F8YA 2GXUA 2P4EA 5EJ5A 4J0QA 3G0BA 4D9KA 3OZEA 1P6UA 1WV1A 3AHFA 2XYQA 1YQEA 2CWWA 4FMCB 3TD6A 4BVLA 3OQNA 2FJUA 3CVVA 4RHFA 1ADGA 4DQDA 2JD0A 2AOVA 1EK1A 2ZAIA 4A10A 2X86A 1WCWA 3AR2A 3H1FA 2XNSA 1OV6A