1DAKA

Dethiobiotin synthetase from escherichia coli, complex reaction intermediate adp and mixed anhydride
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Snapshot of a phosphorylated substrate intermediate by kinetic crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 75
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dakA00
2DWPA 4GL2A 2ZUDA 4Q7MB 2OUKA 4Q03A 1GSIA 3D31A 4QGFA 3SYKA 4GPTA 4KLNA 4JL8A 4V0NA 1QHNA 3CZPA 3SFVA 3AF1A 3QEJA 1GL6A 1XEWY 3MSXA 2ZJOA 1CEEA 4LYHA 3Q5DA 4XD7D 4XIGS 4NCJA 2RGAA 1GILA 4KHZA 1I4DD 1ETUA 1E4VA 1ZBDA 4CT5A 2IYQA 4MDFA 3PIRA 1OV4A 2XTNA 3GJ6A 3OEEA 1HURA 1R2QA 2HV8A 4NE2A 1QRAA 3OAAA 1ZM3A 5GJVC 4TL8A 2OSBA 4IRUB 4XWOA 4ZO4A 3NTUA 1KJYA 3E2IA 4EPWA 3UPUA 2WZQA 2ZPTX 4V03A 3RRNA 1FQKA 2F1IA 4YDHB 3L82B 4TMKA 4Q9JA 2FGJA 1DE0A 4A2PA 2BMJA 3T34A 1KKLA 1KSFX 4TMTA 3BRWD 5DIFA 4TQ9A 2WIBA 3BXZA 4L9SA 2PCLA 4AYWA 3ZVMA 1UF9A 1TEVA 1GDDA 2PT7A 5CDFA 2QY9A 3PUZA 3RNLA 1RFLA 1G291 2BMFA 3K0AB 1E9SA 2GRJA 3B82A 3VHLB 3IGFA 4PSKA 4CRWB 1II8B 4MYCA 2YOFA 5JWRA 2JLSA 1C1YA 4WXPA 3KTAB 3QXHA 3ZZ0A 1VG9B 2VF8A 2ZSAA 1SVIA 2JDIA 2CJWA 4PSAA 5C18A 1W4BA 2BC9A 1XMVA 4GBMA 1SVWA 4B43A 2OFWA 2JATA 3G82C 2FWRA 3HPQA 4OHWA 1G3MA 3WXMA 4US2R 4JLMA 3QPVA 1FP6A 2VH5R 4OK6A 1JB1A 3IILA 4HAVA 4PHGA 2BDTA 5FOXA 5K8IA 4JIMA 4RVCA 1E9RA 1I4LD 2JAQA 3W5JA 3OHMA 4PFSA 4XSGA 4KU4A 4TL7A 3ONWA 1HQCA 2VYFA 2FFAA 1XTJA 221PA 3A58B 2PX0A 3QQ5A 4CVNA 1G7SA 3E70C 1AQYA 1W1WA 3DMDA 3HPRA 1P2VA 1NI3A 2ZRGA 5EXSA 3ZQJA 3EIQA 5P21A 3T12A 2YHSA 2GBLC 1OFIA 4MUAA 3OE7D 3C15C 4QM6A 1NMYA 2Q3FA 3A4LA 4ZI2A 1M7BA 2OAP1 3B6EA 5B58C 4C3ZA 4CIDA 3TSWA 4NCNA 3A36A 4IDHA 3H84A 5L3QA 2RGGA 1SVSA 2IT1A 5IK2A 4ESHA 2AK2A 2W0MA 5DNYB 1OXSC 2W83A 2Q3HA 1EWQA 2GCNA 1CLUA 1VCOA 2QZ4A 3Q9LA 3A37A 3UK6A 3Q7QA 3A1VA 1KI6A 2D2FA 4LGMA 3BFVA 5TVKA 1XU4A 1KZ7B 5B64A 3EPLA 1Q1EA 2FDCA 3OEHA 3O47A 2FF7A 4WZBE 1G16A 4D2IA 4JKYA 5EXPA 3GLGA 1MOZA 4UNSA 4KXFB 2GK6A 1VECA 1NN1A 4D0LB 2NZJA 2W0SA 2GXQA 4Q9HA 3W6NA 1WBDA 1LV7A 4L15A 1J99A 3TR0A 1XZQA 1K5GA 2RCNA 4TN1A 3DO6A 4IDQA 4G3XA 1JJVA 1CBUA 1QHGA 4B3CA 3REFA 1ZM9A 4HLUA 2WVJA 3RYTC 3I61A 4ZIRA 4M1YA 2P6NA 4AIIA 4L5BA 1WRBA 2PMKA 3X1ZA 2QSZA 2WWYA 4HDQB 1TPZA 3IO5A 1OH7A 5BW8A 1NY6A 1T8UA 1ZRHA 4D80A 4DC9A 4V0LA 4XVRA 1P75A 5CLLA 2IF2A 3ZS9A 3GLIA 1HT2E 1G18A 3BB4A 2IWHA 4LJ7A 1T6NA 1YZKA 1Z2CA 2H7VA 1WB9A 3D3QA 1WBBA 3DDCA 1TU4A 4X8OA 1RYFA 4BQSA 4DVGA 3QF4B 4NYMQ 1GITA 2N1BA 4MA4A 1CJUC 3NC1C 5CK4A 1TU3A 4B2PA 4FN5A 4KO8A 4QJ5A 5FPTA 4YONB 3W9YA 3TUZC 4I1SA 1KMHA 4LC1A 2FPLA 2CXXA 2V1XA 2ZYUX 3VR2A 4MGKR 3B5JA 5FTMA 2BEKA 3K0FA 2MSCB 3ZYCA 4GNKA 5J47A 2RAPA 2QE7A 1E2MA 3NHAA 2IS1A 3TW8B 3S1AB 1FQJA 1UM8A 2MSDB 3ADDA 1XTSA 3MG9A 4DLSA 1M7HA 2JIZD 4JLKA 1XCMA 2RHMA 4IJMA 2QGNA 1E2HA 2GEVA 1OT3A 1RKBA 1Z6GA 2EW1A 4NYIQ 2QM7A 3H86A 4PHHA 4FMCB 3FOZA 3EZ6A 4IHQA 5D3MA 1N6PA 1CJKC 1W48A 4AG6A 2FJUA 5CJ2A 3PJRA 5GVRA 3TSOA 2WOOA 3X1XA 2WWGA 1OHHD 3EPKA 3OZXA 1NMZA 4RKFA 1CR0A 1OKKD 2PL3A 3DKPA 3IUYA 2GESA 4Q1CA 1YKSA 1NVVR 2F3RA 1ZM2A 1R0YA 1AZTA 2RGCA 3QBVA 4KYIB 1LS6A 1DS6A 4URUR 4TZ6A 1E98A 4PQRA 3SJZA 3VKHA 3U7HB 4ZCIA 1X8JA 3ND8A 1U8YA 3LW7A 3BBPA 2HXYA 4GRAA 1NN0A 2GNOA 3BJIC 5AR1A 4DT1B 4BPBA 2QRZA 4MH0R 4TQUS 2R65A 1AGPA 3L0IB 2ZSFA 4KFTA 3CNOA 1SVKA 3FKSD 1F60A 4O25A 3HU3A 2Y8EA 4EIWA 4U7DA 2OEPA 2QL6A 2ZI5A 4YQFA 1YZUA 2GEUA 2B6HA 3C14C 3SHFA 3U7GA 2X77A 2ZSBA 1OSNA 1E94E 1NJFA 1WP9A 3A1WA 4HDOB 1BOFA 3F8TA 5BN3A 1QHXA 1TL7C 3QIAA 2GVDC 4YXWD 5FBQB 1G20E 1W49A 3GLIE 1N0VC 4Q4AA 3V00A 1NNEA 1FOEB 4Q5IA 3DMNA 4WBSA 5BXQC 1DELA 2IEYA 3OIUA 4TT3D 3KUDA 4KITB 4AYTA 1OIVA 1UBFA 4I1OA 4B48A 1UFQA 3FDIA 3JZAA 5EE5B 4YMVA 1CR1A 2ZRNA 3QUSA 3IQWA 4EDHA 1TMKA 2QAGA 1RC8A 1KI8A 5FH9A 1J2JA 3MLEA 5E4FA 1PLLA 3GJXC 2O8EA 4Q66C 2CCJA 3DL0A 5CM9C 6Q21A 4D81A 2R6AA 2ZJ5A 3ZS8A 3B1YA 4AK9A 2FFQA 3EPHA 1RRCA 1X8KA 2G83A 4GOJA 1JJ7A 1Z5ZA 2C5LA 3THYB 5D3QA 1E32A 4HAWA 3UXMA 2XAUA 3R8CA 3T06B 2EFHB 4ASUD 1S1CA 2X2EA 1ZNWA 3GJ4A 2GEDA 1JR3A 4QKQA 4PQYA 4S35A 1F48A 1KKMA 3CO5A 4DDVA 2J1LA 5AJWA 1W5TA 3QPUA 1S9HA 1KK2A 2J7PD 2C95A 4Q18A 3AH8A 4IXNA 2K5UA 1TF2A 2A5YB 2PJZA 4Q1FA 3U3OA 4EJSC 3IO3A 1G1MA 4Z51A 2C98A 2A9KA 1NSTA 3G5UA 3WNCA 2O8DA 4A92A 1GTVA 4NH0A 1JPJA 4RJLA 4JVNA 2Z4RA 2ODWA 3QXSA 1GG2A 2VL7A 2VSXA 1ZM7A 4DCTA 2F7SA 2A5JA 1G7TA 4MQBA 1GVNB 4RCZA 2IXGA 1N6RA 2ZI6A 1G5PA 1XEXA 4CEJB 1AIPA 3OFNA 5CLQA 1OLOA 1X3SA 1M7GA 2QTVB 3K0CA 4CT4B 1IY0A 4URWR 3TBKA 3KUCA 4CGZA 1US8B 2ZANA 2X2FA 4R9UC 3A1SA 3VMFA 2UVQA 2Z83A 2ZI3A 3I73A 1NP6A 1GP2A 3L0OA 4B3BA 1FW6A 3QXCA 2PJRA 4JLJA 1N6HA 5IF9A 1XZPA 3SBDA 4U00A 1AK2A 2YWGA 3W90A 2O8BA 4B2IA 5DLQC 2B7BA 2ZS9A 1L4UA 2OBLA 2WOJA 2F1HA 3DKVA 3QVVA 4DXAA 2DWOA 1SQ5A 1ZMXA 3AVQA 3QKUA 5EZ5A 1E9EA 5L3RA 5DYGA 2JA1A 4DLRA 1OE0A 3FMPB 2G88A 2R62A 2IHBA 1NKTA 1H8HA 3LQQA 3NWJA 2QUZA 1UEJA 1Z0AA 2XNSA 5KTYA 1Z07A 3LY5A 1GKIA 1U8AA 1Y63A 1Z6YA 3U6KA 2IK8A 5L3SB 2VP2A 4WIAA 2AWNA 2FSGA 4ZCMA 3OESA 3AF2A 2IA5A 3W8NA 4A0RA 2GF9A 4L8GA 2XX3A 3EXAA 1E2NA 2H17A 1A2BA 3RLFA 1PLJA 3CPHA 1P2TA 2G6BA 1GOTA 4JS0A 4KI0A 4DLZA 4TZ0A 1DG1G 1R0ZA 5EE1A 5FI0B 4LHZA 5CJPA 2YC4C 1M34E 2HDNB 4TTRA 3GEHA 2QROA 4TYNA 3EPJA 1Q12A 1P2SA 1U81A 4UJ3A 3U3RA 5KSYA 4Q7KA 2V3CC 1JXOA 2QP4A 4QBHA 2GXAA 3CWQA 2ZRMA 4FWIB 4KYUA 4RCYA 3KQKA 1W0KA 4C0KA 1D2NA 4DLYA 1P6XA 4TLBA 5KNBA 5EZ6B 5DI9A 1NVUQ 3TKLA 4E09A 2ZJ2A 3FGNA 5AJZA 1M8PA 5J4KA 4NKRA 4C30A 5J4HA 2P0EA 3KFXA 3PEWA 4OHYA 2Q0HA 4M53A 4GMXA 4NZYA 2DR3A 3FVQA 4AY2A 1FPMA 1SGWA 1XFAA 4BWYA 5J5CA 3HYTA 1TTTA 1G3RA 4DLXA 4GT1A 1N5KA 3NDPA 3LLUA 4Q48A 2GILA 1AS2A 1HT1E 1N5IA 2R6DA 3AVPA 3K9NA 1AQUA 1EX6A 3WHLA 2V54A 2YC2C 3KKOA 4N3NA 3SEAA 3DZ8A 2Z5FA 1RPZA 2PEZA 5GJWC 3B60A 4JJZA 1A5TA 2AR7A 2VP4A 2WIAA 3ZD6A 1Q44A 4TMVA 3OIYA 3WBKA 4NYJQ 1YZTA 1FZQA 1G7CA 1D9XA 1N6NA 2G1JA 2RGEA 2CK3A 1ONBA 4A36A 4PR0A 2WSMA 4PPFA 5LD2C 3T5DA 2GDJA 2CE2X 3QKSB 4OI0A 4TYWA 3TLXA 1ZYUA 2GZDA 3FHTA 3GFTA 1QVRA 2V7QA 5C2JB 4TL6A 2YOGA 2IS6A 3TMKA 1EXMA 4PPNA 4V02A 5FR1A 4URZR 3BIFA 1R5NA 3K9GA 1NRJB 2ERYA 4A8JC 3ND9A 4PZZA 3LBHA 1ZD8A 3QEOA 4EAQA 2HYIC 2J46A 5JSZA 3AVVA 2HJVA 3W3ZB 1YJ5A 4P32A 2R9VA 2Z6VA 5F2EA 2XJ9A 4BFUA 1LTQA 1L7VC 2GK7A 1AJEA 2R44A 4MKGA 3VKGA 5EXTA 2HCBA 4BUJA 4DSUA 4C0HA 2QN6A 2PLFA 1EFHA 1FUUA 1FTNA 1RIFA 1S8FA 3A1TA 2ZITA 4HAZA 2D06A 4Q1DA 2X8AA 5FL7A 4F4JA 2Q9AA 2WJGA 4P4SB 4B2LA 4Q4HB 4DZZA 2PMDA 3SFZA 2BJVA 521PA 5E7JA 2A2ZA 1BMFA 2ZRDA 2P5SA 4X8MA 1OH6A 4RZ2A 3C5CA 4Q4JA 1G8GA 1VIYA 2JASA 2JLXA 4DHEA 1VKJA 5JHHB 1NVXQ 1TX4B 2KB0A 2YVUA 1LB1B 3GJ5A 4A0GA 3R9IA 4PC1A 1W46A 3MWJA 3V9PA 3KJEA 1GKYA 4JT2A 2QORA 5FOTA 3UMFA 2XNDA 1QBKC 5JJKA 1F2TB 2I3BA 3KXLA 3LNCA 4EKDA 2REXB 4UXJA 2VP5A 1GM5A 1HA3A 1IONA 2FOLA 2NO1A 2REBA 1Q20A 4XWKA 2KI5A 1NLZA 2ZU6A 3P4YA 3UG6A 4M1WA 4KSCA 3RABA 2GBLA 2J0UA 4PZYA 3EA0A 1XD2B 1WQ1R 4EQ6A 1MT0A 2F9LA 1JR6A 3OEED 4AD8A 4CEIA 4B74A 3ZQ6A 1XP8A 3I5YA 1OYYA 2FV8A 2QTFA 4KLZA 1GKUB 4K81B 4LJYA 3THXB 2BJWA 2F9MA 3I8SA 2QSYA 1LNZA 4W5HA 4LBZA 3TSZA 5DH9A 3ZLJA 2OBMA 1DEKA 3BK7A 2ZRJA 2WSSD 1XMSA 1OPXA 4BEBA 1PZNA 5FPSA 3TK1A 3P20A 4AG5A 3IDQA 2W6IA 2LKDA 4B3FX 5G40A 1TQ6A 2BM1A 3IBGA 4DUGD 4Y0AA 5JRZA 2NOAA 3BOSA 2JEOA 3SJBA 3EC2A 4CF7A 3EG5A 1ZIPA 4M22A 5EQTA 1U0LA 4DLWA 1EK0A 4ERNA 1CF4A 2FU5C 3X1YA 4C0JA 1D9ZA 5DN6D 1KNXA 3QENA 5DO9A 2GZAA 3ZIAA 4M1TA 2DPXA 2E1RA 2NO0A 2CEAA 2JDID 1N0UA 4EFLA 4XVUA 1UBCA 1IN7A 2OLKA 4QG7A 3M0EA 1XJ0A 3GLHE 1E96A 3PEYA 4M9XA 4Y0VA 3VR5A 5SZJA 1EFRA 3LAWA 1ZUNB 2ORWA 2DFKB 3IIMA 4LHVA 4D4LA 1MV5A 2IWRA 3NEJA 3RRZA 3LH5A 3ZDQA 2IX3A 5EE0A 2ZRKA 2GVZC 4M8NE 5JWHA 4BE7B 3B1XA 4P0TA 2PT5A 4FW9A 3CRRA 5G3YA 2WTUA 5GJBA 4KSBA 3TUJC 5KPJA 1E0AA 4X8HA 1E1RD 3ZGXA 1KYIA 3NEYA 3ADBA 2FSIA 3KXIA 2SHKA 4A6PA 2EFGA 3DHWC 4D0GA 1QHHA 2JLUA 4W5WA 1YZNA 2IUSA 4HAYA 2J0VA 5BYJA 5CITA 5LDDC 4QBGB 3L43A 3KZ1E 3T1VA 1ZNXA 3QG1A 3VX3A 4IVPA 2OZEA 1EFCA 1XWIA 2WPDD 4Z8YA 3PG5A 2P67A 2IS4A 2QBYB 3ZJYA 1BH2A 5E7IA 2CCKA 2NTYC 2VQSA 1E2QA 4B34A 3FPAA 1E79D 1II8A 1P73A 4KFRA 4LV5B 4QHTA 1HTWA 2BWJA 2OG2A 3W5IA 4QC2A 4MGYR 1Z63A 2NPIA 1W2HA 2ZROA 4G1UC 2D3WA 4K46A 3TW4A 4NBSA 4F38A 1U2RA 5JI2E 3E1SA 3NG1A 4C7OA 2W58A 3REGA 3VR4A 4FMCF 1KSHA 3PV0A 5B57C 4HZUB 2C96A 3OEHD 3TRFA 2XOKA 2IYSA 2ATVA 1KJWA 3IEVA 2P5TB 3FMIA 4LJ6A 4KVGA 2VO1A 1EG7A 3RS2A 3T5GA 1AZSC 1Z0JA 2H5EA 2BHRA 4Q19A 4H9GA 1CR4A 5TB5A 3AF0A 4XTRA 1ZC3A 4B6EA 4EFNA 3WY9A 1H8ED 4BLOA 3EZ7A 5FTJA 1SXJC 5K8TA 3QSYA 2LWIA 1ZUIA 4BRUA 1KAGA 2E9SA 1JNYA 2QP9X 2G3YA 1W7AA 1NBMA 5GADl 3W34A 2WKPA 4U02A 3I1FA 1E2PA 1XEWX 3OIVA 3PUVA 4M2LA 1OW3B 3WRXC 5FUVA 1AKYA 3JVVA 4HDCA 3U44A 2QQ0A 1W0JD 3HP1A 3VU9B 3W6OA 2WWXA 4KVAA 2ZUBA 1KGDA 3EA5A 1GNRA 4L9WA 5AUNB 2FNAA 1RRGA 2O8CA 2O0HA 5K8UA 4JVSB 5DISB 5TY0A 4XSHA 4X8LA 5BN5A 4QBIA 1NLYA 1JXMA 1XRJA 2BBOA 1MABB 4IKEA 4TYPA 3RC8A 2WAXA 1BYUA 2NO6A 2DYKA 4NU0A 1E69A 2AWOA 2ZRIA 1U8ZA 4LV8B 4BFWA 4BLTA 1EFTA 3B9PA 5KU1A 5BN4A 4ZV4A 2ZRBA 3H0KA 4RZUA 3KQHA 2KBFA 3MWLA 4JVMA 3PFIA 4DSTA 3SYNA 1Z22A 4QRHA 4Z54A 3U4QA 4Z1MD 4ILEA 4LHYA 3CLVA 3QXXA 1EX7A 3ADCA 2FX3A 2A5GA 4D26A 2EFCB 3SJCA 2MSEB 2YWEA 1K8RA 1XTRA 1EESA 5FTKA 5HKKA 2H92A 5FL3A 4B71A 2AX4A 4DWJA 4MKFA 1YR8A 4FMBB 4EPTA 1ZU5A 1YVDA 1G3UA 1MO6A 3EIHA 4WOPA 5JFGA 2X19A 2ZVPX 2ZJAA 2WBLC 3TR5A 3U60B 3U2QA 5JJLA 4DIDA 1CRQA 2WWHA 1ZU4A 4D4JA 3PCRB 4M9ZA 1KOFA 2V6JA 4G5GA 3B8HA 1SVMA 1DG3A 4QBFA 2KE5A 5KO2A 4NDZA 1T91A 1Q1BA 2E87A 3EAQA 3CH4B 2A3RA 3TAHA 1V43A 3U61B 1SHZA 1IHUA 4POAA 4F93B 5JMTA 4OK3A 5H70A 3FWYA 2GCOA 3CUEF 3VR6A 4OI1A 2AK3A 2CJWB 2KSQA 1G3QA 3WYAA 3T1TA 1AA9A 5FOSA 4EJSA 1W36B 3I72A 5FI1B 3IBYA 4IEEA 1NBME 1S1MA 4AKGA 4LOAA 2LKCA 3GLFA 4M9SA 1KIMA 1M74A 4HZIA 1P9NA 5CDFE 5TXGA 5CM8B 3V4RA 4XD7A 2AFIE 4NPHA 4UNPA 4C0BA 4E03A 4URXR 2ZXUA 4A15A 1UAAA 4XJXA 1OXVA 2WM9B 3GJ0A 5JJIA 4BLSA 1KDOA 3RC3A 1IBRA 4KV9A 2HF8A 4YMUA 1X86B 4YC7A 1WXQA 2QA5A 2ZJBA 2OFXA 4CZ2A 5IRCD 2F55A 1E6CA 4XTCS 2P3SA 3SE0A 5LB2A 1T5LA 2QP3A 4OBEA 1E99A 1IJFA 5HR5A 1GL7A 3Q3JB 3AVYA 3GCGA 4JLVA 1NKSA 2QM8A 1D6JA 1S0UA 4R2HA 5IDVA 1RJ9A 2J0SA 2O5VA 2ZTSA 4ACBA 3CBQA 5JLJA 2HYDA 4YMSA 2FN4A 3MD0A 3OF5A 4D4MA 4QHSA 3AVUA 4OKSA 3CRQA 3X2SA 5L3QB 2ZR7A 3CWZA 4PQFA 2ANCA 2QPTA 4BLPA 5CYOA 5EP3A 4GMDA 4GZMA 2EWWA 1T8TA 2O8FA 1XCPA 4II7A 4EPVA 2AXPA 2W2XA 5ELXA 1FTSA 3I5XA 4LWZA 4HUQA 1C9KA 4QFMA 3NHBA 1ESMA 4DB2A 4YDSA 1B0UA 5F98A 1VYVA 5DI3A 2ORVA 3GLGB 3EZFA 1VDZA 2ZS8A 2C99A 4RFVA 4I99A 4IFEA 3K70D 3CRW1 4UNQA 1G8PA 2AL7A 1GIAA 1XNJA 2A5DA 4MKIA 2PBRA 3QI2A 2G0NA 2ZVQX 1NG1A 1ZINA 2VA8A 4DLUA 4JLAA 4Q9KA 2Q21A 3WP0A 3ZVLA 2FZ4A 2GA8A 2J87A 3ICEA 4CW7A 4ZIRB 2ZR0A 5FTNA 1PLKA 3QBTA 1TF7A 2GHIA 4JJKA 4I81A 4F4IA 3OE7A 4ZDKA 4LHWA 4BLQA 3QOFA 2CDNA 3GLGE 1QHSA 4TLDA 4BEJA 1U99A 5M04A 4PO9A 2PLRA 3KKMA 3LV8A 2ONKA 3CB4A 3GLIB 1NJGA 3C7KA 1WA5A 1PJRA 2CVFA 3GLFE 4DBLC 5KPDA 1MO5A 2CLDX 4WAUA 4G5QA 4B3DA 3A4NA 1LY1A 4BASA 5HCIA 2IYWA 3WYGA 3P27A 4LYAA 1DAHA 4A1FA 1KSGA 1E3MA 2OLJA 4BFYA 2QQEA 4CEHA 3DZDA 1UBGA 1KMHB 1NLFA 1E0KA 3C8UA 4HLCA 4QJ4A 2VLIA 2GJ9A 2G9NA 3SZRA 5FOWA 3PUYA 5JBQA 3A1UA 1N0WA 3K0FB 4NCIA 3R7WA 2CLSA 3IEUA 1SKYB 4P4TA 4OQXA 1VIAA 1N6LA 1FNNA 3C16C 3IPYA 1V5WA 4EPYA 4M4SA 2IYRA 3BH7A 5AUQA 3PUWA 3CRVA 3L2OB 4NYJR 1QF9A 1RVDA 2BMDA 1G41A 4A8JA 4IDPA 1R8QA 4FXPA 5A5GA 1E1QD 4IDNA 3SJAA 1U0JA 2L0XA 2GAAA 2OO7A 1P4SA 1DAMA 5D3MB 4LV6A 3K8YA 2C04A 2ZU0C 4F7WA 4O0MA 2HCJB 5F9HA 1K5DA 1SKYE 1CU1A 1GL9B 3CIOA 3GJ3A 3ZD7A 1D5CA 2Z0MA 4AURA 1T5IA 721PA 1Z29A 4XWAA 3FFAA 1XEFA 3B1WA 4FCTA 1T3SA 2GCPA 2HJGA 3VQTA 2DFNA 1UEIA 4NCKA 4XVQA 4M9QA 1W0KD 4JLBA 4B3GA 2VP9A 1Z08A 2OT3B 1MRNA 3WP1B 3CX7A 2FMXA 2Q3MA 5JEEA 2QGZA 3LXXA 3BC1A 1Z6TA 2N46A 2VP6A 2VIIA 4ARZA 1U90A 3CF2A 4RSGA 4OHZA 4IVRA 2ZRAA 3LDAA 1OB2A 1KI3A 4LJ4A 2RGNA 3BFXA 1P61B 4A82A 1SULA 2C9CA 1ZVQA 1M6NA 1NF3A 2WICA 1QVAA 3I8XA 3RS0A 4RZ3A 1IM2A 2YV5A 3I32A 1UKZA 3K09C 3LRPA 1OFUX 2YJTD 3AV0B 3E5HA 2BV3A 4WW0A 2I1VB 4A2WA 2ZETA 3PQCA 4QJ3A 1EWRA 2JIZA 1Z47A 1MO4A 3KKQA 4LY6A 4L16A 1U0HC 2RKOA 1H65A 4Q4AB 1OJLA 3B78A 4BZXA 3KX2A 1BS1A 4LBYA 1F3OA 4Q21A 2PZGA 5EUMA 3AVXA 2W6JD 1HUQA 1WF3A 2V7QD 1ZC4A 4GP7A 3NH9A 5ANRB 2V1UA 4C9BA 3KJHA 2QAGB 1OHHA 4DLTA 1I2DA 4BLRA 4TSFD 3L8YA 1OKKA 2O8EB 1XXHA 3HWSA 4JYCA 2ZEJA 1ELOA 4OJQA 4HEJA 5FPYA 2XSZD 1JPNA 3QPWA 1P9WA 1G8HA 2F43A 1XMIA 3Q8XB 5B2ZA 1DAIA 4M21A 4A2QA 1F2UA 4LCBA 4RD2A 1JQJC 4URVR 2ODEA 3MJHA 5A4JA 1J8MF 1TUEA 3M4YA 3IKJA 1W47A 2B92A 4D6PA 1OXXK 4KCGA 1T0HB 3LVQE 1JEDA 1KI2A 3DPUA 1XPRA 2OM2A 2O0KA 5EE3A 5CYPA 2MMCA 3NH6A 5DHFA 3FKSA 1OYWA 3C4JA 5EP4A 3B13B 3K70B 3GJ7A 3UANA 2JJ2D 2IXEA 3NBXX 2VHUA 4JLDA 3MUFA 2JJ8A 2VP0A 2V9PA 4YXWA 2VSFA 2R6CA 2GAOA 2OV2A 3KKPA 2O8DB 3B85A 1E2EA 2EVWX 1IAQA 4D4KA 1X1RA 2OHFA 4FMDB 4KJZA 1YR6A 1JR3E 4TT3A 4ZKEA 4C0AC 3JZMA 1P3JA 3BH0A 1IQPA 2NQ2C 2FA9A 2XXAA 1DO0A 2QTHA 2RH5A 4RD4A 1NY5A 4GSYA 4OQNA 3TAUA 2JJ1A 1R10A 4I4LA 3KL4A 1S9DA 1XEXB 1LFDB 1OIWA 2ATXA 3NBYC 3VX4A 2VBCA 3ASYA 1GNQA 1G6OA 1GRNA 1NSFA 1NL3A 1NIJA 1T3HA 1XX6A 4DCVA 2JGNA 1FX0A 2WJJA 1QG4A 1SVOA 2HLDA 2NMVA 3KB2A 2MMGA 2ODNA 1Q21A 2ZQ5A 4OHVA 1XBTA 2O8BB 5DGXA 1XDBA 4ZPXA 2NIPA 4DJTA 4RD6A 1W2GA 5F3WB 1KO7A 2EQBA 4PPQA 2NPFA 2JLYA 4Q47A 2QU8A 3O8CA 1G4AE 3FFBA 4CYMA 1CULC 2D7CA 3H4MA 1OB5A 2J7PA 1VCNA 2PZFA 2VF7A 2J7KA 2D62A 2IYZA 2Z43A 3T35A 3ZIAD 1YRAA 4QL3A 3F3YA 2CL7X 2XGJA 4FD2A 2OE2A 1UJ2A 4MGIR 3WMFA 2RHDA 3U3JA 4IOMA 3BWDD 3CF0A 5E7MA 1XXHE 3EASA 1KAOA 3IQXA 1O3YA 4HLQB 2A5FA 1SXJA 5IT5A 1BIFA 1W44A 4JL6A 2PX3A 1YHNA 1G8FA 2QT1A 3CF6R 5SZKB 5TDHA 1Y3AA 4D25A 3EARA 3RS7A 1IXZA 1QHYA 2D4HA 4JBYA 4QHYA 3EWAA 1Z28A 1CS4C 1YU9A 2H8KA 4TWZA 3WMEA 3LBNA 1OFTA 1R0WA 2C2HA 3SOPA 1OH8A 2DFTA 3BB1A 4W7SA 4TTPA 3VFDA 1N6IA 4JLPA 4JLNA 4MKHA 3KQUA 4E5UA 2DHRA 4LSGA 2VRWA 3DEFA 4TMXA 4JVLA 5FBVB 5FBRB 1E9CA 4KFUA 1WCV1 4ZDJA 1HQYE 3MGCA 1VCMA 3B9QA 1NMXA 3IHLA 3TVDA 1DBSA 3PR1A 5TARA 3Q72A 2C9YA 5CB8A 1GRRA 2WKRA 2FFHA 5TV2A 5KOYA 3TQFA 1GFIA 3BS4A 4N1AA 3O8BA 4OI2A 3FMFA 4B73A 2FE4A 2A30A 3L0SA 5BWMA 2BM0A 1YZLA 4RFSA 1OIXA 421PA 4HB3A 3ADKA 1TQ2A 3AKCA 1II9A 4UKDA 1DAEA 5KHOC 5JS7A 2GZHA 5L8VA 4MDEA 3LD9A 1G8YA 4MGZR 3THWA 3MFYA 2VTKA 5GJCA 3CNLA 3KDSE 5KYKA 3K70C 3OAAD 121PA 1TUIA 3LA6A 1R5OA 3AP3A 1N6KA 4AC9A 1UPTA 4DIEA 4LJAA 4LUCA 4KBFA 3ECCA 4WA7A 5JSZB 5HPYB 3GLHB 5C1BA 2ECKA 3K1JA 5AJVB 1NBMD 4P31A 4US0R 2CVHA 5E3HA 4MRRA 5FFMA 3HR8A 2ZRFA 5AUPB 3GFOA 1YRBA 3LO5A 3TE6A 1HH4A 4UXIA 5B30A 4GOXA 2QG6A 3NKVA 5E95A 3GJ8A 1Z0KA 3QKRA 3RWOA 2XEXA 3X1DA 1ZW6A 3HDTA 1CJMA 1IN4A 3QVUA 1AS3A 1SXJE 3K0CC 3MWKA 1Z6XA 4Q4JB 1FMJA 2OFOA 3B2EA 3W8RA 2J59A 1W36D 2IF0A 3W3AA 3CW2A 3PVSA 5FOVA 1QG2A 3J81k 3Q7PA 4TLEA 1Z0DA 1DOAA 5KNDA 3VNVA 4TQAA 4LJ5A 1YE8A 2QMOA 3IHWA 3PXGA 3QJYA 5L3VA 2NG1A 5J4YA 1N5JA 2J0UB 1EFUA 3SDZA 5TMPA 3HR7A 2XB4A 2WJIA 5JCZA 1F5NA 4EQ6B 4JBWA 2CNWA 4FCWA 3VHXA 4CEIB 3TGPA 5HE8A 4IW3B 2FSFA 4ZDWA 3AKDA 3GEEA 2G1KA 2WJVA 2OXCA 4PAMA 3KXKA 3LX5A 1DAKA 4QXAA 1G17A 1IY2A 4KBGA 4I1UA 3K0AA 4Q9LA 3SS8A 3WRYC 2QT0A 5KSZA 1KK1A 1T3LA 2BKUA 4JYBA 5IK2D 4Q01A 4GDFA 3R9XA 1IN5A 4NYMR 1KDPA 1Z0FA 3KTAA 4GP6A 4C2TA 1P62B 2JCSA 5K8LA 5KSPA 4PX9A 1PV4A 3KJIA 2CHQA 2PCJA 1HV8A 5LPNA 1L2TA 4LBVA 2DY1A 4PHFA 1R5BA 1P72A 2FSHA 4JSYA 2F6RA 1ZIOA 2XZPA 4M1MA 1VG8A 2J3EA 1DARA 1DO2A 1DTSA 2EFDB 4F91B 2UZ3A 3C5HA 3BERA 4M1KA 3CRMA 2HT1A 1ZJ6A 2WMNB 2YWHA 2C78A 4HAXA 4WZ6A 3G0HA 5DYIA 2VEDA 1ODFA 3LFUA 2XZLA 2QEQA 4YMTA 4AWXA 1KO8A 4B44A 2YINC 5JHGB 2D74A 4NYIR 5UKDA 2OCYC 1Z3IX 4O3MA 2W2VA 3Q5EA 1U9IC 1Z0IA 2VHJA 3FYHA 1OF1A 2REOA 4P33A 4RD0A 1A7JA 3PEUA 3W6PA 1TQ4A 2J0QA 2V55B 4UNRA 1ZP6A 2QPOA 5C46F 3CX6A 3K0EA 1E2LA 1LW7A 4QOSA 2LCFA 1QHHB 2ZYTX 4HB0A 1ZD1A 3UATA 3X1WA 2F3TA 2GTPA 3RAPR 3P26A 3UWKA 2WSSA 4R2IA 1P5ZB 1YZGA 2AFHE 2PZEA 1N2CE 1NN5A 2X1VA 4L4UA 2P65A 1KHTA 3P4XA 2CBZA 3LXRA 4DUGA 2YOHA 1YZQA 3IPXA 4PANA 5BYKA 2W2TA 1XF9A 4RY2A 5JZVA 4AI6A 2EYQA 5SZIA 3NXSA 4FCVA 5DN6A 3LX8A 4TLCA 2IYYA 3QXJA 3KFVA 2B21A 4P4UA 1VG1A 3TNFA 5HE9A 3EZ2A 1IOZA 2IYUA 4JT4A 3RRYA 3FE2A 4I1VA 4A9AA 3K9LA 2CMKA 3VTKA 4C7OB 1XPUA 2QE7D 2AHOA 4R7ZA 3T1QA 1YR7A 4O2RA 3I4LA 4W5JA 3VR1A 3LWNA 1E2KA 4Q02A 1SZPA 4PC2A 3CPJB 4B3XA 1D2EA 4ITRC 1CR2A 4Q1EA 5FUYA 4DEXA 1KZGB 1VPLA 1E9FA 4IVQA 4TYQA 3FMOB 3N2IA 3EX7C 4AKHA 5AJYA 2XJ4A 3SYLA 4TMWA 1JBKA 1E1RA 5KSOA 5JRJA 4NTZA 2JLWA 1T4GA 2OILA 4BRWA 1K6MA 1II0A 4B75A 1UDWA 1HY3A 2GF0A 3QE0A 3SC3A 1P60A 2I4IA 1YR9A 5SZHB 1KK0A 3V4FA 5F9FA 3OIWA 3U44B 2AXNA 2D2EA 3FHCB 1E2GA 3EZ9A 1GAJA 4H1VA 4GI7A 3QG5A 2WPDA 3K0SA 4M0LA 3VAAA 1COWA 4S2EA 4BFZA 3HYRA 4C4PA 4DCUA 2IYXA 4A6XA 3BH6A 3MRSA 3QF4A 3GMTA 1TEXA 1E79A 1RRFA 2NZ8A 1L4YA 3WBJA 2HUPA 2O8CB 1IXSB 2V6IA 1T9HA 1FUKA 4OQLA 4C0LA 4WVFA 3ZVNA 4RD1A 3K09A 3WYFA 5JWOA 1E0JA 4M1SA 3GFPA 4PAQA 1WE2A 1AKEA 2ZI9A 3L0PA 4M1OA 2P6RA 1QDEA 1FFHA 5JI3E 1TADA 3S1AA 2GKSA 4BFTA 2BBWA 1E2FA 4JKIA 1LS1A 1P2UA 2OCBA 3CKLA 5CIQA 4IOLA 3TQCA 1F6BA 1NN3A 2YZ2A 1FMLA 3CR7A 2FG5A 4B76A 4NCHA 3U4QB 2YKGA 2RMKA 2GJKA 1H8EA 4GFDA 1KK3A 2BBTA 4MRNA 4OYHA 5KDOA 4MITA 5FPHA 1RYHA 2AD5A 4DSNA 3LBIA 2IYTA 2WKQA 1DAFA 2CE7A 1ZAKA 1JECA 2FGKA 2O0JA 1GUAA 1E2IA 2GJSA 2J41A 2VSOA 2ZSEA 2Q9CA 1W4CA 4DDUA 5KDDA 3MCAA 4O2LA 3FTQA 3CPEA 4YLGA 5C4GB 4JMPA 2XITA 4US1R 1B23P 2KBEA 1W0JA 1RZ3A 2P2LA 2CL0X 1LVGA 3CNNA 1Z83A 1ZUHA 3B1ZA 1E2JA 2VPPA 4KAXA 3ZH9B 1VHLA 1KI6B 4XH9B 1ANKA 1CTQA 1ZM4A 4E22A 3GD7A 1XPOA 3U6BA 1S2MA 3WHKA 2OESA 1JR3D 2GCOB 4DT1A 1BYIA 4LYJA 3NVAA 5AWFC 2UZIR 4EPRA 2ZRCA 2WHXA 4TMZA 1S4QA 2JLZA 1D2MA 5CB6A 4EJSB 1U94A 1X8LA 3RVBA 3A6PC 5FTLA 4QM7A 4Q1BA 1XD9A 4FMDF 1VMAA 2WV9A 4PPGA 5EE9A 2OAQ1 2ERXA 3GLFB 4RKEA 2H16A 3UG7A 1CJVC 2B8TA 2OBNA 2A7QA 4ZI3A 3EC1A 1KO5A 1G3IA 4OQMA 3AEZA 1IJEA 4LHXA 2H57A 4AKIA 3NBFA 4MRSA 2WJHA 5AJXA 4Z1MA 2WWWA 2BOVA 1VTKA 3TIFA 4W9MC 2EWVA 4MYHA 1IN8A 4MYUA 1ZCAA 1RE0A 5HCNA 4PZLA 3AP1A 4BECA 1A1VA 4GZLA 3BORA 3SQWA 2ZS7A 1G19A 1JAIA 1RRPA 821PA 3GP8A 4HATA 1TQDA 2VHTA 2DFLA 5EP1A 3I62A 3CZQA 3AVWA 2WWIA 4HI0E 4B32A 2IEZA 2UKDA 3LW8A 3OFND 5DSZA 4AKEA 3KQNA 2ZRPA 1TAGA 3NIBA 1RJ9B 1P9RA 4DB4A 4JL5A 4MUBA 2ZAOA 4Q00A 1FP7A 3K53A 2RGDA 3THYA 1CKEA 1XTQA 4LBWA 4ABYA 1JALA 1E9DA 2GXSA 3D8BA 4Q1AA 1CRPA 2BMEA 4H1UA 3VR3A 4ZKDA 3ETLA 3U3KA 4OK5A 1HYQA 1HE1C 1I2MA 4IFBA 3D7MA 3AP2A 2O8FB 5LB4A 3B7GA 3AVOA 3BGWA 2FZLA 1L8QA 2QMUA 4RZXA 1JAHA 3RS5A 3N5CA 4HUQB 5FUWA 4LDJA 3TH5A 1H8HD 1XJCA 3CONA 1VCIA 5DI3B 2B8WA 1W36C 2OXRA 2I1QA 3UKDA 1Q3TA 5JCPA 1ZNZA 3R20A 621PA 4IXMA 3ZVRA 1UKYA 3AM1A 1OFHA 3BE4A 1PUIA 4U5XA 2BEJA 4V0MA 2IYLD 4HUTA 2ZYVX 4NMMA 1W4AA 4B47A 1AM4D 2EYUA 3PITA 1NIPA 4JSTA 4AYXA 3TUIC 3F0TA 3RS3A 4FINA 4LZZA 3ZZUA 2IXFA 2ZRHA 3WNDA 2ODBA 3T61A 2N42A 3PENA 4IEIA 3AF3A 4ON9A 4CEJA 1BKDR 1N3BA 4PHTA 2ZRLA 3GPLA 4BZQA 1GWNA 1US8A 2BCGY 4PC7A 1Q22A 2JJ1D 3RRMA 3HU2A 4DDWA 3KQLA 1OH5A 2AD1A 5IHPA 2IUTA 4V0OA 1KTVA 4HAUA 2CHVA 2FH5B 1A2KC 1A4RA 1JQLB 2HXSA 1MR3F 1MRSA 3T15A 2IBMA 4TLAA 5FOUA 2HLDD 1HE8B 2ZE5A 3KB1A 1OXUA 2GETA 1LF0A 4LYFA 3SU8A 3SNHA 4CEHB 2DB3A 3CH5A 3P1JA 3H1TA 2BVNA 3THOA 3MMPA 4TTQA 4HSEA 3RSLA 1XMJA 3R7WB 1G4UR 2W00A 2WWFA 4HLDA 2IYVA 3KJGA 2CL6X 2HF9A 4PTLA 5LD2B 3AF4A 1PVOA 5L3SA 4DLVA 2F1JA 3MJRA 2CK3D 1Z06A 1Z6AA 3AGPA 3CR8A 2GWHA 1BO6A 2GJ8A 4WXRA 4LPKA 1J7KA 4C2UA 1QZXA 3RSOA 4A0HA 4CDGA 5J4VA 5H68A 4Q9IA 4A8JB 2A78A 4A0FA 1SXJD 5G3ZA 1Z2AA 2ZUCA 4GOKA 1XD8A 3AKYA 1VG0B 5C4MA 3K9HA 3CX8A 4F4CA 4N0EA 4HLUC 1KI1A 4B35A 1N5LA 1KDTA 1G7RA 3A8TA 2ZREA 3MAAC 1D8TA 1SVLA 3IIJA 4R98A 2AKYA 1Q3HA 4G0NA 3CM0A 3SI7A 5FL7D 3BFKA 2ANBA 2PEYA 3D6TB 2ZE7A 1BMFD 1CXZA 4HYYA 2ZM5A 1PUJA 1YQTA 2ZE6A 3L8ZA 4ZCLA 4V0ME 3H2YA 4ARZB 4DEYA 2OCPA 1VYUA 3MWYW 2WJYA 1SKQA 1E9BA 4BFXA 3QF7A 2XNDD 4LPSA 4PC3A 1XTIA 5J40A 2FEOA 1M2OB 2WMOB 4KFSA 4QNRA 4NONA 1KO4A 4EPXA 3WNBA 3JVUA 2P6UA 1Q0UA 3ZZTA 5AUOB 2CCGA 5HTKA 1VHTA 1G5TA 2ZR9A 4PC6A 2QAJA 4IDOA 3QKSA 4OQFA 1GZSA 2EU8A 4PO8A 5KUTA 3HJNA 4ESVA 1VYTA 2QNRA 3ICQB 2B7CA 3AUYA 1ESNA 1E1QA 1LF5A 2D7DA 3M6AA 4LJ9A 4NP6A 4DCSA 1KY2A 3IIKA 1JI0A 1S3GA 1S96A 2DBYA 2GXUA 4Z8XA 3DOEA 1QHIA 4G01B 5FBWB 1NVVQ 3ASZA 2C03A 1TF5A 1JEEA 5GVSA 4UXHA 2IC5A 1XXHB 2EFEB 5LBIA 3RHFA 1R7RA 3SBEA 5FR2A 4ASUA 2W6ID 4MRPA 4PSVA 4D0NA 2V8OA 2ZJYA 5DHAA 2F43B 1GRQA 4P4SA 5FBLB 2HT6A 4Q4HA 3U5ZB 2VHCA 4A4DA 1F2UB 3UWOA 3NBZC 4IOJA 4OI4A 4URYR 4UNNA 1J70A 2DWQA 4WZAE 1P7CA 4P3YA 2GJAA 1KJZA 1G64A 4B6FA 1Q1QA 1RW4A 2ZSDA 4LK2A 3P32A 1KSJA 4Q4LA 1A82A 1M1YE 3AKEA 2RGXA 4LC0A 4HB2A 5HZKA 2FEMA 1F2TA 4TL9A 3N70A 5EUQB 4G5SA 1X1SA 2IUUA 1R6BX 4HB4A 3FKQA 1Q1ZA 2ZYWX 2V4ZA 8OHMA 3SQXA 3BB3A 1E2DA 1KMQA 1T0JB 2DCUA 1EFRD 1U9IA 2ZJ8A 3LLMA 3BAFA 4V0KA 3R8FA 4BFSA 2R6FA 2G0TA 2O52A 4ACAA 2XB2A 2NGRA 5EP2A 2NO7A 4OJKA 4DDTA 1KDRA 1XD2A 2IW3A 4TYYA 1KY3A 4Q7JB 3NC0C 2R6GA 1N6OA 4ZDIA 2XTZA 1CJTC 3EWSA 2XXAB 2W6JA 2VHQA 2BBSA 4OHXA 1AS0A 3THXA 3EIEA 5HZHA 2CNWD 3SN6A 1UKEA 1GNPA 2C8VA 2WAYA 4FI3C 4TSFA 1MKYA 3DM5A 2QI9C 4BZPA 3UIEA 5FUXA 2J45A 3O8DA 3GLHA 2QAGC 3TJZA 3LQRA 2ZJZA 1G21E 3I92A 3U3MA 1FX0B 1AGRA 2XSZA 4PO1A 3DM9B 2FPMA 2ZIAA 1MO3A 1N25A 4C0SA 4J0QA 4QGGA 3FB4A 3SHWA 3T1OA 1KI7A 2C9OA 2RGBA 3AVTA 3U7FB 4OL0A 2AN9A 1NVWQ 1X6VA 4LI0A 1Z8FA 2ZE8A 2Q9BA 3FHOA 2JJ2A 1W5SA 2XOKD 1G9XA 3DOFA 2OCAA 1XB2A 2R8RA 1C4OA 2BIFA 2IL1A 5EJEA 2CHGA 2RGNC 1KNQA 4LJ8A 1SXJB 4RD3A 3RS4A 5H8WA 2G77B 2ZAMA 3UMSA 1UBEA 1R8SA 2ONJA 3AQ4A 2QMEA 2JLQA 2YYZA 4G5RA 1IY1A 1R0XA 3RWMB 1WMSA 2JLVA 1NG9A 4MRVA 1J90A 1UDXA 1E0SA 4UQOA 1ZCBA 1KI9A 1XCGB 1I4TD 1DPFA 1ZD9A 3EW9A 1FNMA 2AKAB 3AB3A 1XJQA 2R2AA 2TMKA 4MYTA 2ASEA 1HEIA 1J8YF 2QPAA 3LVRE 5J4LA 1FL9A 3PEVA 2QBYA 1O87A 3WMGA 5KDLA 4JLOA 4K8OA 4DKXA 1G5RA 2YWFA 1MH1A 4DSOA 3RDPA 1Q57A 3B1VA 4BFVA 2YNMA 4C0QC 4XOIA 3KKNA 5G41A 1AN0A 2H1LA 3R9WA 4JZKA 3C41J 2RB4A 3HU1A 1UADA 4KODA 2IS2A 4UJ5A 1KI4A 4NHOA 2BKEA 1IN6A 4QGAA 2PH1A 3DVLA 4D82A 3AUXA 4HZUA 5H1YA 2NO9A 1KO1A 2BCJQ 2CLCX 3GQBA 2H18A 4RFSB 4EFMA 1UKVY 1XTKA 5FPKA 3O8RA 3F5FA 4YMWA 1U98A 4G5OA 1R4AA 4PAOA 1OXTA 4B33A 3PUXA 2F1RA 3THWB 4Q7LA 4R71A 1CIPA 3TVTA 5DE3A 2JLRA 5CK5A 3RANA 2QENA 2XZOA 5KNCA 4NL4H 5HKKD 3GEIA 3SR0A 2FPKA 1DAGA 2J9RA 1WDTA 1DADA 3AGQA 4EUNA 1CP2A 3N2EA 5BQ5A 4E07A 1E4YA 3A4MA 4PXAA 4DCNA 4DRZA 2C77A 4FWTA 5JS8A 2QRNA 2ZI4A 5CIWA 5JECA 2FFBA 2ZI7A 2ORIA 4IOKA 1G6HA 1TNDA 2KJQA 4BGDA 1S3SA 4FIDA 2KWIA 2QMHA 3VU9A 3BD9A 3VKWA 4LRWA 4QNMA 5AK0A 2Z4SA 2XTMA 1ZNYA 2J5XA 1E9AA 4LX0A 4N0DA 2HEIA 3QNUA 2Q6TA 4JBXA 3U7EB 3I3SR 1IXRC 1COWD 1W4RA 3QKRB 3QY0A 3Q85A 5G53C 3M1IA 1SHKA 1EGAA 3VNUA 5EXXA 4QGHA 1DVRA 2IHYA 5JEDA 3UMRA 3NDBB 4F92B 1MABA 5A0FA 3QKTA
chains in the Genus database with same CATH superfamily
2DWPA 2QN7A 3T8YA 4Q7MB 1USIA 4N48A 5JOQA 2JHFA 1FK8A 2PDAA 4QGFA 1ECFA 1GZ4A 4HNQA 5DGDA 2GO1A 3HJUA 3UT6A 1RKVA 3FR7A 2XWBF 2AFHB 3VR4H 1N2CB 5T6BA 1C8VB 3Q5DA 2P3LA 4F6RB 1JG4A 3PGJA 1GILA 1HRKA 1I4DD 1V3QE 3H8SA 1JLMA 3H3XA 4M1QA 4MDFA 5JZOA 2J5RA 2XTNA 4PBSA 5EEGA 3SM3A 3W5DA 4G23A 1EG2A 4FFSA 2GPNA 4NE2A 3ZH2A 5CFOA 4CCSA 4FS3A 2YFHA 4TL8A 4AUNA 1HZZC 2OSBA 4IRUB 4KPUA 4LE0A 3OPYI 2Y9MB 5GONF 4MDHA 4C29A 3IKTA 1NZFA 4M0EA 3O1IC 3WL6A 3IEMA 3WISA 3OX1A 3VHXB 2WZQA 2ZPTX 1QHEA 1JDNA 4PLFA 1CY1A 3IT2A 1QG0A 4R51A 1WXWA 4YDHB 5LQNA 1DE0A 1JH9A 1NV9A 3LT1A 1Q0LA 1P1KA 2C29D 3M4NA 4HR7A 5MGNA 4TMTA 4BGEA 4TQ9A 3HBFA 2GT1A 1RLMA 2WIBA 2PCLA 3E82A 1USKA 1UF9A 3S7TA 1GDDA 2PT7A 1SUCA 2QY9A 2WFAA 2X86A 1RFLA 3F9CA 1B6GA 4I3GA 5CDFA 4YGXB 4RCVA 3BHIA 2HMWA 5I48A 3B82A 5AICA 3IGFA 5J43A 1II8B 1H23A 2VDWA 1GL3A 3HVJA 3NHFA 1AF7A 1ZOSA 2JLSA 3CS3A 1WNFA 3FTCA 1T2DA 3KTAB 3ME5A 4RHEA 2E18A 3RVDA 2Z6QA 1IHYA 1XDDA 3T0GA 1HK7A 4YAUA 2VF8A 2NZYA 2ZSAA 3GELA 1EX1A 1SVIA 1TA9A 1GFSA 3W9BA 3C3KA 4IIJF 1DJNA 5AVYA 1TK9A 1MG5A 2BC9A 2ECFA 4GBMA 3BJMA 2G1PA 1KYTA 1ABFA 2OFWA 1QNFA 2P78A 3ZV6A 4OHWA 2VYQA 2HHJA 3PHIA 5J2TB 3HDQA 5F2KA 4Z4IA 4EGQA 1FY2A 3DONA 1R5JA 1FP6A 1NJ5A 2VH5R 2EJUA 3C43A 1CY8A 1Q14A 3IILA 3PC2A 4PHGA 5FOXA 3RUIA 1L4BA 3L7LA 5JO9A 2JAQA 4RTLA 2RGYA 3Q7EA 3N3AC 4CI9A 5COAA 4MQ4A 5L7YA 5T67A 3OM0A 1XTJA 3K1AB 3Q8MA 3UJ8A 1SEVA 4MV6A 2B4TO 2FPIB 4BXOB 3P9PA 2AJBA 2FMHA 4OQYA 4ZMSA 1JFRA 3ELYA 1EK2A 1MNQA 1V8ZA 4YRMA 2RE8A 1O6BA 2PO7A 1W1WA 2KM1A 3C5WP 3ZHUA 1L4MA 1C7JA 3PP8A 4MV9A 3H2ZA 2EKZA 2JAHA 2XY4A 5AI4A 4K9OA 4XFDA 5ALXA 1VB3A 3HDGA 3OE7D 4PG6A 4JI1B 1JA9A 1N0HA 2WP0A 4Q39A 4WV3A 5E1DA 3UAVA 2CJYA 2ACKA 1I3KA 3S2SA 3ELWA 2PG3A 2ZIZA 4O2BB 3IALA 4CM1A 4R3UC 3W4KA 1TK3A 3ZW8A 4B73A 2OAP1 3D3WB 4C3ZA 3CHYA 4OSOA 4IDHA 1RWOA 2BAGA 4KXUA 2XNCA 2RGGA 3JQAD 3QX8A 4DLNA 4RZQA 2XGMA 3OQPA 4O4HB 1OXSC 3R9KA 5DNYB 1NU6A 1EWQA 1NXWA 1KRWA 4BBJA 1IIBA 3PNBA 2ZWPA 1Y4UA 3Q9LA 3A37A 1V48A 4PZEA 2XWSA 3Q7QA 3CLUC 2HADA 2HHAA 2XMBA 5G0WA 2IZ5A 2R1VB 1HGXA 2NT4A 4LGMA 1GQQA 5LJIA 5LU8A 5DBGA 5BSFA 2FB9A 3BFVA 4BMPB 1XU4A 3CUWA 3EAGA 3E9YA 1Q1EA 1ONPA 5JW6A 2JFNA 3O47A 2ICAA 5FDFA 2BGLA 3FPLA 3L1HA 1G16A 4WZBE 4BVBA 4HNHA 1BA3A 3ZJUA 3AUJB 1K75A 1VECA 1NN1A 2R86A 3DAHA 3BFJA 4UHDA 4WFQA 4ARSA 5BOSA 3H42B 3I28A 2GXQA 3EYAA 3KQOA 4UCQA 4Q9HA 3TTUA 3UAOA 3W6NA 2IZ7A 3WLIA 1F7UA 2FUCA 4L15A 1ZL2A 2WJ3A 2NXNA 2ZIVB 5AKHA 3F9IA 4OXYA 1GEGA 1K5GA 1IWPB 1C1DB 2JD0A 2PLNA 2RCNA 3DO6A 2GN1A 3CKYA 1QHGA 4G3XA 4TN1A 5DBIA 1R8YA 1QIMA 3ILHA 1ZGCA 2OTCA 4ZVOA 3RYTC 2QRVA 1N1DA 5JMPA 4ZIRA 1QP7A 2P6NA 4QU5A 4AIIA 4L5BA 1ENZA 2NVBA 1XRNA 5D3KA 1X1AA 2VLBA 2ZJ6A 4RK7A 1TPZA 3T41A 2CGEA 2HCRA 4HNVA 1JHPA 5MN4A 3R3WA 1H0HA 5BW8A 3QGMA 1ZRHA 1OH7A 1TZJA 2JHAA 2NU7A 2Q7XA 2WF9A 4IYRA 2KX7A 4LI3X 1ZZGA 5CLLA 4ZXFA 1IZ7A 1WDWB 1REQB 2VJMB 5SYNA 2GRAA 3UGQA 5J23A 5EIXA 4CTMA 1NU8A 2ZRQA 3QFTA 1Z9BA 2H5JA 4TGLA 1T6NA 1YZKA 5JH7B 1WB9A 3NASA 5AT1A 1WBBA 3RBXA 3T7SA 3EIOA 4CLRB 1O08A 1ZOLA 2B5OA 3ABRB 3K16A 4H16A 4JELA 1Q7TA 3OLQA 4JX9A 3AO0B 5EZSA 1SVUA 3H2HA 4D9GA 1T5OA 2ZQZA 1MPTA 1WXHA 2HPZA 2VTVA 3GB9A 3IQFA 4FN5A 1ZN9A 4Y2VA 4G8CA 2SECE 1KMHA 3QA3E 2FPLA 1M2KA 2CXXA 2V1XA 3P0IA 4NLLA 3SEFA 4V0RA 3N39C 4FEYA 2X0NA 5CDUA 1K68A 3GAZA 1BVHA 1QXSA 3K0FA 2MSCB 1ENOA 5JFOA 4E6PA 2RAPA 2DLNA 4XIJA 4GIBA 2IS1A 4MNTA 1CQJB 1TDJA 3DOJA 3S1AB 1RWXA 3K3PA 2MSDB 3BM5A 3BXEA 4YNBA 3ADDA 5T4BA 5ESWA 4D41A 3UT5A 4DLSA 3A04A 1HLFA 1X0XA 2EGHA 4IJMA 5J5AA 2QGNA 4B85A 2XQGA 1UJ4A 2GEVA 2CLKB 1UDAA 1Z6GA 2EW1A 3DMRA 2DJIA 1I6LA 5FBKA 2OGSA 5K0NA 4DNXA 1P1FA 3VO9A 1KZ6A 3EZ6A 1ORHA 3F7NA 3TW0A 1KR2A 4AG6A 4XD2A 3L8CA 2FJUA 5JY1A 1SM4A 4CV2A 2X4GA 2DOKA 3MK31 4B6OA 3SC2B 2YYYA 5ALUA 1PNOA 2LIPA 2WWGA 4OO3A 2YS7A 4YYZA 4Q1CA 2PL3A 1TTTA 2F64A 3MM4A 3UPDA 4DJJA 1UBNA 1DC3A 3R09A 5FNZA 1I5EA 3UUFA 2RGCA 3QBVA 3U5TA 3LI2A 3OLXA 4KDFA 1E98A 2HWWA 1FP4B 2WSLA 4YIHA 1IQUA 1WG8A 2HHCA 4IDGA 1UC4B 1C7EA 1X8JA 3NIFB 4RVUA 2X0RA 3UYKA 4W9NC 5HF9A 3MUEA 4ARAA 4ZVRA 5E0KB 4GRAA 4XPZA 4ZC8A 1NN0A 5GMOA 2C42A 4DT1B 4MH0R 3OU7A 3FCEA 2R65A 1Y6JA 2ILVA 1TYCA 1DKLA 3FI0A 1W85B 4W5OA 1SVKA 1IULA 1F60A 2DLDA 2XVAA 1JFLA 3A6HA 3FKSD 3U4IA 4EIWA 2OEPA 2F8MA 2QL6A 2ZI5A 1RTKA 1YZUA 3FYUB 2ADOA 3C14C 3PXUA 3Q7TA 3SHFA 4G67A 7REQA 3U7GA 1R6AA 1WP9A 3SIRA 2OV8A 4MYDA 3LZ6A 1QHXA 3S5JA 2FWJA 4MW1A 5CA0F 2ZATA 4QDUA 3QIAA 2GVDC 1SHTX 5IS2A 1G20E 3D6UA 3D3KA 1J6UA 3GGCA 4PTYA 1BXKA 4RMGA 6REQA 2IUEA 2VWHA 1N0VC 2I7DA 3H1BA 3LE8A 4Q4AA 5HS4A 1NNEA 3IVRA 5G1OA 2GHQA 3A1FA 4FZJA 3B3JA 4ZAXA 3KUDA 2XE6A 3RTDA 1OIVA 1OY1A 3EMDA 4X1YB 3SXUA 4LMRA 4AF6A 4GQAA 4E7OA 5EZYB 4WN9A 2J5KA 2P41A 3FDIA 3JZAA 3PNPA 4YMVA 2BFEA 5CAEB 4IZHA 3IQWA 1TMKA 3Q3IA 1KI8A 5ALPA 3UHJA 4F4HA 1PLLA 2YL2A 2HHHB 2B1QA 3K32A 3M6IA 1DQPA 4Q66C 1XT6A 2CCJA 1AXGA 3MMSA 1Q77A 2JZCA 2QMQA 2W2KA 3KE9A 5ELLA 1C50A 4D81A 5E9JA 1P81A 4HDSA 2Y2VA 5E6SA 2HA4A 4FEAA 4I55A 3VC1A 3ZN2A 4CTKA 3KLNA 3EPHA 5B3JC 3DG9A 2C5LA 3WO0A 2PZ8A 3RK0A 3OM8A 3WJ7A 4HAWA 3UXMA 1P1JA 2R8XA 2W6CX 1GGVA 2XAUA 4BN0A 4EW2A 2W8BB 3T06B 4WK6A 4QU9A 3H9GA 2CXOA 2X2EA 2PKQO 1JR3A 2WD9A 4CNBA 4OGGA 4QKQA 5JC8A 2OBFA 4G86A 2SNIE 3HKDB 1YNSA 4BWFB 3G89A 2BE9A 4JDPA 3WWCA 4FHGA 4DDVA 3OVMA 4Q6WA 3PHGA 3TRJA 3QPUA 5K0FA 1E6EA 2Y92A 5IAEA 5GV8A 2VAXA 1YUBA 1F5SA 1RIIA 2CJPA 5B3AA 1I94B 2PJZA 4IF4A 2A5YB 3U3OA 5ALZA 3WIOA 2D54A 2FPWA 1WOYA 2HLPA 3O8NA 2VHXA 2MSKA 1P19A 3RSQA 1CQWA 3ANTA 4Z51A 3EF1A 3OZDA 2HWYA 1BDIA 1E3TA 2D1SA 4UBMA 2CVZA 4A92A 1URPA 4NH0A 2GZ1A 2REQA 3LXUX 3EDCA 3NUGA 4JVNA 2YCLA 3OPVA 2CFIA 2EIHA 1OGJA 2FPSA 4MKXA 4QXOA 5LP6B 3MAGA 1GG2A 4BE4A 2VSXA 1ZM7A 1M2VA 5E2BA 3V42A 2W9XA 1CK4A 5L51A 5CHEA 1RABA 5FO0A 3E7WA 4TXHA 1TQHA 1XP5A 2A5JA 1JVBA 1SEPA 2F7SA 4MQBA 4R1LA 1RJGA 1P2FA 1N6RA 4UQLA 1KVSA 2ZI6A 3QYAA 4NU8X 4XB6B 3LIPA 2O3UA 3N2ZB 4ED9A 4REQA 3C6ZA 3WBBA 1X3SA 1U31A 5FEMA 4CT4B 3PDIB 4D3DA 1EU1A 4N76A 1US8B 2H4JA 4R9UC 1JR4A 1LDGA 4NAHA 4B80A 1YMVA 3T7DA 5GIOE 3I73A 1NP6A 5CT9A 4BNDB 1FW6A 3ZWAA 2OGTA 3CRZA 1V35A 3DHVA 1UOQA 1XZPA 3ESRA 3OSUA 4CTNA 1Q1AA 1W25A 4U00A 3IA2A 4TRNA 1J9ZA 1Y4ZA 2BUCA 1Z5GA 4RPLA 5IZCA 2QT9A 1P45A 3AIOA 3IMGA 2B7BA 2YJ6A 9GPBA 3Q3CA 3V46A 2OBLA 2WOJA 3QU5A 3PUIA 3QVVA 1MIOA 1VIVA 2XKJE 4FYKA 5C5IA 3ULKA 5F76A 5EZ5A 5AI9A 4DLRA 2JA1A 1DV1A 4N4AA 3FAKA 2CXHA 3FUVA 4D96A 5H5JA 2Q99A 2IIVA 1QU3A 3NVKI 1KEEA 1GU7A 3VH2A 3LQQA 2IHBA 2D3TA 3LVBA 3NWJA 2IXDA 1W29A 4KH1A 4O4IB 3RFTA 4N0PA 5IMSA 5ELMA 3PNMA 3PE6A 2FZGA 1XYVA 2WJZB 1C3XA 2B1RA 3LBYA 4JOCA 1ECBA 4AMVA 4WIAA 1SURA 1CF2O 2FSGA 4NVRA 4XYBA 4A23A 4OQPA 3H0CA 4ZCMA 1LLFA 5AQ1A 2D0OB 5KCMA 2NM0A 3LX6A 3H11A 1QGOA 3C0KA 3EXAA 3OE4A 1A2BA 1IWBB 1EVLA 1UJ6A 1RZRA 4G65A 3RJ5A 3TF5A 2G6BA 1F14A 4DQVA 3JD1A 1DG1G 5FI0B 4TZ0A 2WYIA 2J9XB 1ENYA 2ALJA 2HDNB 3CJQA 4XKJA 5JQGB 3NWEA 3EPJA 1P2SA 2EJVA 3R0QA 5I7OA 3ILSA 1A9SA 1V5GA 3STXA 1C80A 2K2QB 2V3CC 1MMFB 3CWQA 3WGYA 2ZRMA 3BILA 1QCCA 2EP7A 1WUJS 1Y48E 3GGPA 3AERB 3HFGA 4TKUB 3RVKA 5KOIA 4OFWA 3K05A 1MD9A 1PKXA 1CUAA 4LXUA 2ZJ2A 3FGNA 2P75A 5DYNA 4NKRA 5C32A 1VKRA 4QPPA 5JYDA 3ZNNA 3IE0A 1WS6A 1AKWA 3OZBA 3UOWA 1LBEA 1KH2A 1XELA 3IKVA 2I3ZA 1M5RA 5CM2Z 4Z0HO 2NUAB 5GTDA 3IAAA 4AY2A 4GGOA 1EGHA 1QWSA 3UJHA 5HK9A 1UP6A 4LECA 4YQZA 4GT1A 2AJCA 4BNTA 3K9NA 3HABA 3V55A 1YOVB 1MW9X 4TTSA 3KKOA 4G1VA 4HYEA 3RROA 4WN3A 5LJLA 1Z0SA 1P77A 3ZWKA 3DZ8A 3WGQA 1X92A 3EMKA 1RP1A 5AI0A 3VC3A 2HM7A 4XUEA 3JV7A 1A5TA 4F1KA 4Y2XA 3SIWA 1SO8A 1P7YA 2PKCA 2YWJA 4ER7A 4Z7NB 3K0BA 2P4QA 2B8EA 2F2TA 5KYVA 2WSMA 3B2NA 4PPFA 2CE2X 4GLJA 1PHRA 3ABIA 2X5NA 5ALEA 3GFTA 2R1UA 2V7QA 4UMVA 1I0LA 4IQ0A 1OT5A 4TL6A 1PSWA 1U3CA 5B55A 1EXMA 4IEFB 4L57A 4UD6A 3UJBA 3K9GA 3A2KA 1NRJB 3OOEA 3ND9A 2DUJA 3QXGA 5CXUA 1ZD8A 3QEOA 2R00C 4EAQA 4U5QA 3LUAA 2HYIC 2HNAA 3W3ZB 3UXYA 5KQLA 1X13A 1PNVA 1QC5B 2R9VA 4P32A 3MWEA 2R44A 4MKGA 1CR6A 4J7CA 1DHTA 4HYQA 2BEUB 5JD4A 2HCBA 2W6QA 4BUJA 2GKOA 2VDQB 4C0HA 2QN6A 1N34B 3ZWYA 1BFDA 1RIFA 3VZRA 3C7AA 3S3TA 3ZTWA 2D06A 3OTOB 5FL7A 2JPDA 1LRJA 2QTCA 4TROA 2Q9AA 5LYJF 1TVKA 4P4SB 4EY6A 1MIHA 3GPDG 2PMDA 4HEA6 2A2ZA 1DUVG 4OMFG 4QT4A 2ZRDA 4X8MA 1NUQA 3G8CA 3C5CA 1XZ8A 3WE7A 1ZR4A 1OH6A 3QVGA 1L4FA 3ISTA 1D7OA 4IIGA 2JB9A 3IDOA 3JAKA 1T2VA 4JC0A 4ARBA 1I1OA 2C8LA 1SUWA 4CCAA 3LCVB 2KB0A 4DHEA 1NQ5A 1I30A 3HNOA 3R9IA 4JUBA 1M2FA 1WABA 2C4KA 5FOTA 1C9YA 1QBKC 4ZHQB 3P0FA 3W78A 1SC1A 3KXLA 4UHJA 2NW6A 1Z56C 2O06A 4ZYYA 2PGDA 1CUGA 4J94A 1HA3A 2IU3A 4X6YA 1SY7A 4KOEC 2NO1A 4G97A 3U37A 4TUYB 3AF5A 1BTOA 2KI5A 2LTAA 2CBXA 3CF4A 3PE3A 3P4YA 3JARB 1J0DA 4PO3X 3UG6A 1WCIA 3HDJA 4KSCA 4NBNA 3RSFA 2B94A 4CBVA 1LX6A 3EGWA 4G0WA 2I2AA 3E7FA 3V3KA 4BTLA 1NX6A 1J4AA 3SCZA 3EAFA 3EA0A 1XD2B 1QTRA 4FYVA 1WQ1R 2LDXA 4QXRA 1MT0A 3OU2A 1SBNE 1NOJA 5L53A 2ZWOA 3GU3A 5AVKA 2E6UX 4EYGA 3ZNQA 1XP8A 3F73A 3EXEB 3UHAA 2V5UA 1NTRA 1OYYA 2MDTA 1C1XA 3F67A 1TYBE 2JLBA 3Q2OA 2ZXEA 3DDOA 3JVIA 4L4XA 3UB2A 3TNYA 3THXB 2BJWA 2F9MA 3KWJA 3PDHA 2H7XA 3BTUA 4J16A 1LNZA 3QFFA 4LK3A 1XZEA 3TSZA 4YJ2F 3FCYA 1V1RB 3HXMA 3BSSA 1Q0RA 2WSSD 3MOIA 2CY0A 1OPXA 5FPSA 3LDGA 1CUUA 4C07A 4L6AA 4B3FX 4PXYA 1XKQA 3IBGA 4H17A 4DUGD 1NRIA 3EW7A 3WLRA 3PC6A 3BOSA 2Z1NA 1SWWA 1XWFA 3EC2A 4UBLA 3WVNA 1ZIPA 5EQTA 4HFJA 2WAAA 2R6JA 4UUAA 2FU5C 5ULLA 1WMFA 2OO5A 3JY6A 2IKQA 5DN6D 1I4OA 3SJ7A 5K7SA 3FYSA 4KO1S 4Y9TA 3QENA 5CYFA 5A6SA 5KJ6A 4ONEA 4M1TA 1YGPA 2DPXA 3QTLA 1ULAA 3LMKA 4QQFA 4JJ6A 3OBBA 1ODIA 2H06A 4Q3CA 5F5LA 1IN7A 1GSHA 1JSLA 3OQ6A 4DY4A 2EQ5A 1F9EA 2OLKA 2OPBA 3GNLA 3HYCA 3K30A 3MWGA 1XJ0A 5IH3A 3PEYA 2GN4A 3VR5A 3DP7A 4ZOLF 2ORWA 3GCXA 4D4LA 1ND6A 2NZWA 2IX3A 4JI2B 3OOJA 1EDOA 4H7DA 5EE0A 4N5NA 5JWHA 1RI4A 1B00A 4RMJA 3EXIB 1JDBB 1XDSA 3ZUPA 1XAJA 2B34A 2HDWA 5JMOA 3GZJA 3JQBA 3ZJ4A 4D0SA 4MLCA 4KSBA 3TUJC 5KPJA 3ZW9A 1Z5NA 1HDRA 3BIXA 4JASB 3E2PA 1M1ZA 2JCVA 5BW5A 2QB5A 3TYXA 3VZPA 3OQJA 4JOSA 4PRYA 4JI8B 2Z57A 2FSIA 2H8GA 2EFGA 2WYOA 4NOLA 2JLUA 1B8OA 2IUSA 2BKVA 4NI5A 5LDDC 1YTUA 3KZ1E 3KQYA 1ZNXA 2K7FA 3DB1A 3RYCB 5T7BA 4U2KA 3PL5A 1DQRA 5KVAA 1XWIA 4G2NA 4WGFA 4JOBA 4XYMA 2P1RA 1XU7A 3ZJYA 3V8VA 1BH2A 5ALTA 3RTBA 5BQ3A 3E9DA 1E2QA 5KSWB 5ECWA 2NU9B 2XT6A 4L2IB 4ADSG 3D59A 1E79D 2OVFA 1ZMBA 1HTWA 3AIMA 4ZAYA 3NHUA 1VP9A 4QC2A 4PRKA 1UMDB 3UEOA 4D3YA 1E5TA 1UWLA 4YJ3F 4G1UC 3VPAA 1MC1A 1XRMA 4GMFA 3C5EA 1U2RA 2W98A 4TKVB 1EGMB 2HSJA 2I4TA 3C24A 2PWAA 3E1SA 5JI2E 1U3DA 4AUEA 2R7KA 2W58A 3REGA 3D5QA 4FJ1A 4LGCA 3PV0A 4DMFA 2XE7A 5ALSA 5AO9A 3SGLA 3TRFA 4E46A 4ISBA 1D6MA 3MXTA 2ATVA 3KVNA 1PWHA 1PK8A 4HPWA 5IM5A 5BVGB 1EFVB 3V3TA 4PYJA 3B51X 5F2NA 4DDKA 3P5SA 4GYYA 1W6UA 2BHRA 3ILXA 3LF1A 1CR4A 4OL9A 2XUJA 1P0IA 4QGBA 4RZIA 2K87A 4EFNA 5KWSA 4NJEA 1VHWA 5GINE 4LHSA 5IAGA 1JI3A 1L5SA 1ZICA 4X3OA 3EZ7A 3G79A 3HKCB 3K0HA 1YI0A 3ENWA 1S02A 4J4BA 1SU7A 4EJ2A 1MB2A 5JZSA 3AF6A 3QSYA 2CL5A 4EY3A 4QFCA 4MV1A 1MC4A 4FSXA 4MS1A 4BZZA 3WFIA 4WMLA 2QKYA 4QLOA 3FDFA 4M2LA 4OM7A 1FP1D 5FUVA 1NHWA 3IH5A 1HMYA 2WABA 1OPRA 3FHJA 1MQSA 4GYWA 4OTZA 2PGXA 4Y1RB 2V9CA 3E9CA 4M9CA 1B8UA 1RI3A 2B0CA 1T0IA 2JFFA 1ZZEA 2RKBA 3RSHA 3VU9B 2YJ3A 3PTAA 5HFJA 5HCUA 1QMGA 2BYTA 3FWHA 4ZALA 5HQTA 1GGHA 2EX4A 2G8NA 2QL5A 1EM6A 4A7PA 1EDEA 1WZUA 4DF3A 1NAIA 2P35A 3GMSA 2PT6A 2VC2B 3M89A 4KXNA 3WXBA 1LH0A 2F1KA 2PUHA 5K2OA 3M7IA 4B45A 5DISB 1P74A 4XWWA 2VHVA 3AWDA 5LQMA 4CMIB 4WUTA 4G0ZA 5BN5A 1EJ2A 1NLYA 1XRJA 5C3MA 1B26A 2I62A 5F3RA 1BE8A 3R7AA 1X42A 4HDKB 2I8LA 1EFDN 2DBZA 4D4HA 4YH1A 1VPVA 5ESXA 5KX5A 4UUBA 4CLEA 3H3FA 2H0RA 3AR2A 5AHRA 1EFTA 5KU1A 3OZVA 3TSYA 2WJWA 2ZRBA 3Q1KA 1TW2A 3MWLA 5K4AA 4B2YA 2PFKA 1JLLB 4G9EA 4LOLA 2Z3VA 1RYNA 2CYAA 3MB8A 1BN6A 5G0SA 1ZIYA 1V41E 5HZGA 3PICA 3PTLA 3ADCA 2R8BA 5JJCA 1Y9AA 2PKWA 2IDKA 2MSEB 4HBZA 3TDKA 2IGBA 2ZWMA 5IWAB 2VUUA 5FTKA 1SXIA 5HKKA 1GGKA 4FMBB 4QOEA 4QUKA 3C48A 5CDHA 1DIHA 2AIRA 1X7ZB 3W8EA 1ZH6A 1YVDA 4X90A 1G42A 4EKGA 4DIFA 2OO3A 3L8MA 1A3CA 5HFNA 2I2DA 2X19A 1Y3DE 3W5HA 2JBAA 2FR8A 1AQNA 3DV0A 4HN4B 1YDMA 1RHMA 2O2CA 4W9MC 3AJ8A 4Y9RA 1S8OA 4J0GA 2XWJI 3G9TA 3PCRB 4H7EA 4JUFA 4G5GA 3B8HA 1SVMA 1MEJA 1DG3A 3SYTA 2KE5A 4X92A 3E9RA 1GV1A 1T91A 3VPXA 2AOUA 2O0MA 4YAJA 2H52A 1SHZA 5DCWA 3LWDA 1N2GA 3WRVA 4IJUA 2I67A 3FWYA 3O03A 3QLUC 3VNRA 3ZCSA 1DC4A 5NULA 3NATA 5K3FA 3VR6A 1RU3A 2IHNA 2CJWB 2DSNA 3GD5A 3UJ9A 1SRQA 5A05A 1C3VA 1O9GA 1UCFA 1AA9A 1W36B 2RSLA 2PBFA 3RSGA 3T3NA 2K2WA 1XQWA 3LCJA 1ZIDA 4YGYA 2QXYA 2Q6KA 1GTZA 3ZHXA 4RY0A 1N9GB 1SNYA 2A4MA 3I2YX 5I9IA 4ARUA 2PKYX 2CXTA 5CM8B 1U5AA 4XD7A 2AFIE 2PNFA 3PFWO 3BE6A 2GD2A 2O1XA 3WBFA 3V7YA 4E03A 1H1LB 2ZSUA 1F2DA 3BQ9A 2O2GA 4LJKA 5COBA 2QMZA 3AM4A 1Z25A 9LDTA 2IKSA 1ECPA 3CJTA 3KO8A 3RC3A 1KYYA 2HF8A 3FSRA 1C30B 4LVNA 5B1DA 4YMUA 4GLBA 3S8MA 4NNOA 1NP3A 3R75A 3DC2A 3AR4A 2KYRA 2LDBA 4JJ7A 2XNHA 4J0DA 5LB2A 2QP3A 3OM1A 2VQFB 4FX2A 1KXJA 4IQ8A 2WB4A 4CLHA 5C8YF 4HFMA 3C6KA 3AVYA 3GCGA 4XW2A 1NKSA 2QM8A 3K5PA 3L1UA 1PJSA 4G6ZA 2J0SA 4ACBA 3CBQA 2HYDA 2G5GX 3AVUA 2Z2ZA 4J1QA 4UUOA 3I2KA 4EDFA 3AJDA 2IPLA 1CEQA 3Q9NA 1E4OA 1GU0A 4A0QA 4PQFA 3UK7A 4IAOA 4MA0A 3W5VA 2ANCA 2QPTA 3QLJA 2ZCJA 5EP3A 5AVTA 2Q41A 1T8TA 1B8PA 1N2EA 1S01A 1DLJA 3VPHA 2G1UA 2VRCD 4II7A 1IXKA 4OXXA 2YCBA 1QP8A 2CLOB 2AXPA 2W2XA 3VV3A 3ORHA 3BSFA 4Q93A 4WVLA 5B5SA 5L7TA 1EA7A 3BVPA 3H2JA 4HUQA 2H0QA 3TOSA 4CQMD 4GVXA 3GUZA 1BRMA 5FJIA 2R84A 1B0UA 2JBHA 1VSUA 1YJ8A 1LQUA 2OFPA 1AURA 1TJYA 1VZ3A 4GLLA 1Y80A 5EUBA 1M1NA 2Q4DA 3NTOA 5B1HA 1VDZA 3WLMA 3GLGB 5DNWA 4DW8A 2GFHA 4M46A 2C99A 4HDNA 4LF7B 1XLWA 4I99A 3FGZA 2HIGA 4K87A 3K70D 4OLBA 3CRW1 1E5XA 2Y93A 4FZ3A 3I53A 2AL7A 3IMCA 4XPIA 1VLVA 1HDZA 1XTUA 4A5OA 4JA2A 1GAWA 3GV0A 2OORA 2ZVQX 1CZRA 1U9JA 1EB9A 2VA8A 1XQYA 1AN9A 4R4JA 1L7XA 5EVJA 3WP0A 2X5OA 2Z2JA 4TTJA 4Q4DA 3HVUA 2PFGA 3GF4A 1ZGGA 1O4WA 5DHTA 1VLHA 3QBTA 1TF7A 4XDHA 4I81A 4HBGA 4B7CA 3RJMA 1AVTA 4LHWA 1DBWA 4UBJA 3GGDA 5E38A 5JAPA 1UBLS 2VBGA 4ZP1A 1Y33E 4CIYA 4EG1A 4R3NA 3IVMA 3LV8A 3TFWA 5CNIA 1Y5NA 5EOVA 2HBQA 4KXMA 2P68A 1NJGA 3MT8A 4NRDA 2GBPA 3GLIB 1LJLA 1VFPA 2CVFA 1BNCA 4IP0A 3HCCA 3LQYA 1JHVA 1X9GA 4B3DA 4MRMA 3A4NA 1LY1A 5E0OA 4BASA 3QPDA 3TGLA 3KWMA 2PXAA 3WYGA 4QWWA 1YCHA 3ANNA 5GONB 1EP2B 1YFKA 5G02A 3UV7A 2EAUA 2PBZA 1JKJB 3BQMB 3WL3A 4QDJA 3G2KA 4E70A 3AILA 4C6TB 1XCBA 3IE2A 5BWBA 4QJ4A 1GU1A 1S8NA 3EUFA 1T0BA 4HL6A 2G9NA 3L7OA 1FTYA 1IEWA 3WHIA 2QLJA 3BTOA 3CRNA 4PNZA 3R7WA 2W22A 1PR0A 4JI0B 3IEUA 4P4NA 1UMCA 2RHOA 4P4TA 1VIAA 2P6OA 1B93A 1FNNA 2RDMA 2BISA 2NV2B 3AUSA 3IPYA 3EXHA 4OLFA 3CCBA 4LMBA 5EGNA 5ERXA 4EPYA 4QICA 1N2ZA 2FPGA 2AZXA 1MJ5A 3GNTA 2FSVA 4MB2A 3BBLA 3GRRA 1ODLA 5EL0A 4BBZA 4YQYA 3EGDB 4DMMA 3UNXA 4FB4A 3FJ1A 4IIJB 2NXWA 3MMXA 1BCRB 1E1QD 4IDNA 1H9BA 4XLTA 1QFJA 1C41A 2L0XA 1PF7E 2IU6A 2CVPA 2C7QA 2QTBA 1WY5A 2X8WA 2EJTA 3K8YA 1L5HB 2CSXA 2C04A 3BEOA 4RQTA 1RZRD 1X80B 2ZU0C 4F7WA 4MZDA 2XLBA 3G68A 2POQX 1IXYA 1CU1A 1GL9B 3C45A 3IP3A 3W8DA 5LC1A 1H3NA 2Z0MA 4GWKA 1T5IA 1N2OA 2NV0A 2Q6OA 4IJWA 4AURA 1BGWA 1QIIA 4P3KA 1ZW1A 1M0SA 4UHFA 3C70A 3F4BA 1BD4A 3VQTA 5CB4F 1CY7A 4JLBA 3PJDA 1ZGBA 5K2MA 3RTAA 4IRXA 3DT9A 1NF9A 1MRNA 3WP1B 3NZEA 2Q3MA 2XYHA 4G89A 1QIDA 1QCYA 2EBFX 5TQ0A 1T8PA 2F4NA 2PRKA 2VIIA 2VP6A 3B3GA 4IDBA 1U90A 4N8DA 3QP9A 4L3WA 4RSGA 1O9BA 4MUEA 1J1ZA 1YS1X 3GNSA 4OHZA 1TAUA 1EVEA 1UP7A 3A3OA 4XEUA 3UFBA 1Z2EA 3IVGA 3H2GA 1R0BA 1U5CA 1YUMA 1OI3A 2DQZA 2XGSA 4A82A 3O75A 1I10A 4NICA 3S68A 1F7VA 3P8ZA 1M2OA 1NQVA 1BCSA 1QVAA 4QG3A 5I7HA 1UKZA 2HA3A 5LZ5A 1OFUX 1ADGA 2FX5A 2VUIB 4G25A 4QUAA 5F64A 4A2WA 1RC1A 1LWNA 4X5OA 1DHRA 4QJ3A 2A88A 5ALJA 3R76A 2AW5A 1Z47A 3BXOA 4URHA 1QF6A 5JT1A 2PH7A 4LY6A 1QB7A 1U0HC 1V4NA 4ER6A 2EJCA 2MYTA 2RKOA 1LBQA 5EKSA 3K20A 2VHEA 4OX9Y 4BJ6A 1AHHA 1UWKA 2X3FA 5DSXA 3ND5A 4JQSA 1OU4A 2OCDA 4Q21A 5EUMA 2WF7A 1WZNA 2V7QD 3SS7X 4C4SA 5DSTA 4JITA 2V1UA 2AQIA 4F4DA 1WLSA 3EWNA 4Q0MA 2QAGB 4OFXA 1OHHA 3MTQA 1I2DA 1Y3FE 3CLKA 4O4LA 1JU9A 1OKKA 5T64A 5EHNA 1X15A 1D3AA 3HWSA 1QO9A 2NLOA 5FQNA 1U4OA 4D8XA 2O8EB 2ZEJA 4U2EA 4WLEA 2KW5A 3REOA 1MUUA 9ATCA 4MVJF 1OOEA 1EBFA 2FCAA 2OHJA 3FD8A 2RD2A 1YDGA 1RXEA 1B2LA 3H04A 1JPNA 1T3ZA 3DNMA 1P9WA 4G07A 2PRSA 4KQXA 4M0UA 2Q4OA 1XMIA 1JSRA 2JH8A 3EOZA 4FWBA 4J2HA 4Z9AA 4A2QA 1F2UA 4YCNA 4DIBA 4EZIA 4EZEA 1JQJC 4KN8A 1M34B 4MVXA 4FXOA 3IKJA 1W47A 2NX2A 5AHOA 3TI9A 3WGUA 2Z4TA 1OXXK 4S0ZA 3LVQE 3H6KA 3QHPA 2GAFA 2PL9A 4TXLA 4C0XA 2NZVG 2OM2A 5BSTA 1ACLA 1U5BA 5EE3A 3TJRA 2DEUA 5CD1A 4E31A 2KLHA 3NH6A 5DHFA 3HP4A 1NJ2A 2KMLA 1U1DA 2YWBA 1ZVMA 3ZHOA 5HHTA 2VAPA 3ASVA 5KYYA 2GF2A 4CKCA 1QWOA 2VHUA 4JLDA 3MSCA 2JJ8A 3UHOA 4TLMB 1U7XA 5CVDA 3CLSC 3ZHYA 1GQOA 4YXWA 1B2RA 2GAOA 2OV2A 1PD1A 4DHWA 3FSGD 1E2EA 1QPGA 1IAQA 2EVWX 5KZMB 3QEAZ 3LCCA 3LTEA 1X1RA 3BMOB 3CCFA 3MIIA 2QRHA 3OOHA 3OZUA 2I1WA 2Y6UA 3DMPA 3H7AA 4J6FA 2PL1A 5E6RB 2G76A 2CD7A 3AUAA 4EBBA 1MX3A 1ZMOA 2QTHA 4B4VA 4DCOA 1KS2A 1U63A 4K2HA 2GN2A 3TAUA 4EPWA 3RODA 2JJ1A 2WYUA 3ODPA 1R10A 4I4LA 1DKQA 4KE8A 4M0PA 3TJMA 5KTRA 2AOWA 1P3DA 3TINA 1GTMA 2ATXA 3NBYC 3C3WA 4KE6A 4MI9A 2VBCA 1E7MA 1EDZA 4JJAA 4EKIA 5A5FA 1EVJA 1NL3A 4DCVA 5HILA 1MV8A 2CYCA 3PXCX 1KMNA 1RACA 3NQ41 4UU7A 2P4SA 5D86A 1CRWG 2QQ5A 2VDLB 2HLDA 4J3FA 3KB2A 2NU8B 2GEKA 4GO1A 3OC0A 2PUFA 4D44A 1R8JA 2JH3A 3FI9A 4FFVA 2O8BB 1OJ7A 1XDBA 2D1FA 4S2UA 2CD9A 5I9TA 4HEA1 4RD6A 5I4IA 1FUYB 3M82A 3G2NA 4KXQA 1J09A 4Q47A 3SS9X 5EJ5A 3FFBA 4HZGA 3BCRA 4OCZA 3ZY2A 2UUCB 1D03A 5BR8B 1OB5A 2J7PA 3Q7RA 1YC2A 3DVSX 2VF7A 2EV9A 1EXDA 3T35A 1Z4PX 4N5DA 3ZU5A 1JZSA 2GMWA 4QL3A 3DJYA 3F3YA 4ZICA 1U28A 3LOPA 1UJ2A 1VE1A 4MGIR 2PS3A 2RHDA 2Z2KA 3FPEA 3NHSA 1I9CA 4BFLA 3CF0A 2B25A 3EY4A 3SAJA 3ZU3A 5CT4A 3A6KA 4GH5A 1SXJA 2BFBB 2ZB2A 1CZLA 3OFVA 1M0EA 2PX3A 1YHNA 2BH9A 3H2SA 3I6IA 3RBVA 2CN1A 2YUTA 5K6TA 4L07A 3LFHA 1EINA 3GZNA 4TV9<