1DAKA

Dethiobiotin synthetase from escherichia coli, complex reaction intermediate adp and mixed anhydride
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
224
structure length
224
Chain Sequence
b'SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Snapshot of a phosphorylated substrate intermediate by kinetic crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 75
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dakA00
2BJVA 1UF9A 3VHXA 1XMSA 5FTMA 2AX4A 4ARZB 5EXXA 3CF2A 3IGFA 3MGCA 4BLSA 4F91B 1W36B 3RS5A 1CLUA 1MABA 3CRQA 3FHCB 1ESNA 2YOGA 4GT1A 1AGPA 2IK8A 4M1SA 4CT4B 4DCNA 2IS2A 2R6FA 5AUQA 3X1YA 2ZVQX 2PZEA 4UNPA 1S3GA 3K53A 1JR6A 3VKGA 4Q7MB 3UMFA 5EP2A 4AG6A 2AD5A 4YXWD 4CEIB 4Q19A 5BXQC 2VH5R 1U8ZA 1AQYA 1Q12A 5BQ5A 2DB3A 4FCTA 4C9BA 1OJLA 1DVRA 3BD9A 2HV8A 2GZDA 2HF8A 4BLPA 3QENA 4TSFA 2Z43A 4X8MA 5KYKA 3OFND 4QM6A 5KSOA 2YWHA 3I61A 4Q48A 2R65A 3HU3A 2GCNA 1G8YA 3EWAA 3PENA 5EP4A 5EXTA 4HUQB 1W4CA 4JVSB 1KI2A 5LD2C 1VTKA 2AL7A 1OW3B 2ODEA 1TEVA 3AVTA 5FPHA 4LC0A 1MOZA 1QHIA 1FW6A 3HU1A 5H8WA 4IVRA 3K70D 1II0A 4EJSB 5DIFA 1ONBA 1FFHA 1XU4A 3D31A 3AVOA 4V0LA 4HDOB 3CH4B 4XWAA 1LNZA 3S1AB 3VFDA 2QRZA 4E09A 1E79A 1GWNA 4CEHA 2WPDD 2QAGC 5A4JA 1ZCAA 2QQEA 5TY0A 1P2TA 3LV8A 2ZVPX 3RWOA 3NBFA 1XPUA 3A8TA 3L0OA 2AK3A 2X19A 3HDTA 4DEXA 4F7WA 4BRWA 4LX0A 2V1XA 4RCZA 1UKEA 1N5IA 4V03A 1G19A 3MAAC 621PA 3SQWA 2ZETA 1UM8A 2ANCA 3ZD6A 3KB2A 2C5LA 5J4YA 1Z22A 3LVQE 4C30A 4C0HA 4JLJA 3R8FA 4MYCA 5KSZA 2FOLA 4G5SA 4URZR 4YMUA 4BLOA 3NG1A 1OXSC 3U6BA 4KLZA 1BKDR 2IUTA 3FMFA 1QZXA 5DGXA 5KSYA 2I4IA 1RIFA 4MUAA 3CO5A 3SDZA 1G7TA 2ZUDA 3AF1A 4PHFA 4DVGA 2PX0A 2FZLA 3CPEA 3LAWA 4IOKA 2VRWA 1OHHD 3R9WA 2QNRA 5LBIA 2PT5A 2QRNA 2QPTA 3BFXA 4B34A 2C99A 3P32A 4V0ME 4C2TA 2JLSA 4LYAA 3Q3JB 1G3RA 4TMXA 1K6MA 3AEZA 4Y0VA 4AIIA 3I62A 1XXHA 1E9CA 4U02A 2PMDA 2OFOA 4NBSA 2QROA 4URUR 1ZMXA 3VU9B 3QXJA 4FN5A 4EFLA 3T1OA 2A78A 2V3CC 2BWJA 2UZ3A 1I4DD 1NN1A 1BOFA 3W6OA 3K0CA 4M1WA 4GNKA 3Q5EA 4HLDA 2XSZA 1KI6A 1A82A 4RD4A 1E2IA 2CJWA 1YR9A 4NHOA 3RSLA 1G7SA 1J90A 2RHDA 3TLXA 1DS6A 3RNLA 1AJEA 5CIWA 3RS0A 3BERA 1Q44A 4TN1A 1UJ2A 3OE7A 1YRBA 4MKFA 1G20E 1JJ7A 1ZNWA 2J5XA 1GM5A 3RRNA 1HUQA 1R0WA 4P4UA 1QVAA 3NH6A 3I5XA 4OQFA 1DELA 3AB3A 1Z83A 3UG7A 4B47A 2G77B 3U3RA 2J9RA 2EFGA 2ZREA 2XAUA 3B6EA 2OXRA 2H7VA 1P7CA 2BOVA 4TL6A 2G83A 2QORA 2VP4A 4QBHA 4BFVA 3U44A 4Q1EA 1Q1EA 1JAIA 1VDZA 4GI7A 2G0TA 3QKUA 4PC1A 1HA3A 3KQHA 3EZ7A 2BBSA 5L3SA 1D6JA 2F1HA 3ZZ0A 2O8BB 3ETLA 4EKDA 4B2LA 3KL4A 4DCSA 4QNMA 3RRMA 1MO4A 1MH1A 2BMFA 3T06B 5JWRA 3HYTA 5DNYB 5FOUA 1YE8A 2RAPA 1OIVA 3IEVA 5FTLA 4R71A 4RD0A 4ASUD 1AM4D 1GKUB 2ZJAA 5DH9A 3D8BA 4FI3C 1NG9A 2ZRHA 4GFDA 2WWWA 2XB2A 2Q21A 5EE5B 1WRBA 1E2FA 1B0UA 1WXQA 1NSTA 2QMHA 1AS3A 3PV0A 3KJEA 4XTRA 5E95A 4QXAA 1W5TA 4WW0A 1DAMA 3NWJA 821PA 4A9AA 1GG2A 2VSXA 3VQTA 4B76A 2GVDC 1JR3D 5B64A 3QKTA 2WBLC 4UXIA 5E7MA 3ASYA 3THXA 2KE5A 3EASA 3FB4A 4BRUA 3NTUA 5H68A 1QVRA 2YWGA 4OHWA 4AG5A 1NVWQ 4PSAA 4PO8A 1NN5A 2UKDA 4QBGB 3ZQJA 1YZQA 2ZU6A 1ZBDA 3AKCA 1KJZA 5HCNA 2BJWA 4Q9KA 2CK3D 4KYIB 1S1CA 4KSBA 1QHGA 1QHHA 3K8YA 1OT3A 4GBMA 2NOAA 1KMHB 5L3QA 2QENA 2WJJA 3ZZTA 1TEXA 2NQ2C 1WBDA 1G3QA 5FI1B 1YQTA 3U3MA 3TSZA 3A1TA 5AWFC 1KJWA 2AK2A 1R0ZA 5DISB 3CNNA 3TSWA 2CL6X 4A8JC 4WA7A 4QGHA 3B1VA 1X6VA 4TLEA 3PITA 4EPVA 3I73A 2L0XA 3W3AA 3QKRB 2JDID 3GLGE 2IS1A 1DE0A 4YMSA 3GEIA 4DIDA 2GAOA 4GSYA 4HB3A 3WMGA 2C9YA 4BFWA 1DTSA 4US2R 2B6HA 2ONJA 1DBSA 2JLRA 4QFMA 1VG1A 1YZLA 1O3YA 1U9IC 3HJNA 1E0JA 2IYQA 1ZUHA 4HAVA 1RKBA 4MRVA 1D2EA 2J1LA 2VYFA 4V0KA 3GLHE 4BEBA 1E1RA 4CRWB 4TYNA 2JLVA 2CNWD 1OFTA 3DHWC 1VCIA 3DL0A 1ZU4A 3QXXA 2EU8A 3PUXA 3C8UA 4FCVA 1IXSB 2BM0A 2QTFA 4B3FX 2RGNC 4M8NE 1ZNYA 2NG1A 3OIWA 1TAGA 4LY6A 5L3VA 2HYDA 3AVPA 2JIZD 1JBKA 1GRQA 1NVVQ 3C5CA 4PZZA 4IW3B 5GJBA 2G9NA 4JVLA 1QHNA 4B35A 1S96A 1MO6A 2I1QA 1RW4A 2ZRLA 2ZUBA 3LLUA 2P5SA 2ZRMA 3PQCA 1KYIA 4LJ6A 3THXB 1XBTA 3MD0A 3SJZA 5KSPA 5ANRB 3IHLA 4GL2A 2IX3A 1S9DA 5CK5A 2LWIA 2PLRA 4TWZA 1E9EA 1TU3A 2WJHA 1R4AA 4Q4AB 1P72A 1C1YA 2UZIR 4B3GA 3ZYCA 4CW7A 4A15A 1HQCA 1EXMA 4BFYA 2ZS7A 1LVGA 2R8RA 4UNQA 4AYXA 4HZIA 4PPNA 5C18A 4JSTA 1OFIA 1P2UA 5DI3A 2EQBA 2W2TA 1TU4A 3NH9A 2HUPA 1CTQA 3I1FA 3EAQA 4M2LA 4URVR 2VA8A 3IO3A 1IOZA 3U7HB 1R0XA 1Z07A 4JJKA 2P2LA 1W48A 3K0SA 4L5BA 1ZM4A 3V00A 1Y3AA 2RHMA 2E87A 1A2KC 1GNQA 2ZSAA 1Z8FA 3FGNA 2FN4A 1Q22A 3T12A 3WYFA 2ZRCA 3EC1A 4CZ2A 1KNQA 1PV4A 2O0KA 3B1WA 3CX7A 1RRGA 4LV5B 4JLAA 3KKQA 3WHKA 2VHUA 4XWKA 5FFMA 3RANA 3JZAA 2OZEA 1MRSA 2QT1A 2DFNA 4LJYA 1NMYA 1RFLA 3FFBA 3MWKA 4Q5IA 5AJWA 2Z4RA 4M9XA 3GFTA 3SBDA 4ZCMA 5BYKA 1G6HA 4IFBA 4AKIA 2JJ1A 2YYZA 5HZHA 3VMFA 2ORIA 4C0QC 3K0EA 3QVVA 4FMDB 4LPKA 2ZS9A 1IY2A 3CPHA 3RS7A 1XD8A 1ELOA 2VF7A 1TX4B 4JZKA 4RZUA 3BB1A 5KNCA 2V8OA 3NHBA 2ZXUA 2GK6A 4X8HA 3O47A 1SHKA 5FL7D 5J40A 4A36A 1N6PA 3IQWA 3GLGA 2J0VA 2GWHA 3LQRA 4Q00A 2D4HA 4OQMA 4URWR 2J7PA 1XFAA 4UNRA 1VCNA 4EIWA 2WKRA 4LBZA 4P4SA 1UBCA 2GETA 5HPYB 1JXOA 1OFHA 1DAGA 5EJEA 3DEFA 4D4MA 1OKKA 4TT3D 4E5UA 2BMEA 2D2FA 1HEIA 4DT1A 3NC0C 4AKHA 1GFIA 4PX9A 1E9FA 1IY1A 1LY1A 1G17A 2I3BA 2GEUA 1E94E 3EPLA 2HYIC 4LHXA 5DI3B 1KY2A 2RCNA 4H1UA 3LW8A 721PA 1P6XA 1S0UA 4NCIA 3UATA 2WSMA 3OEHA 2Q3HA 3TAHA 3X1WA 1L7VC 1S9HA 4OI4A 4WXPA 4IXMA 3ADCA 1N6KA 4M9QA 5CJ2A 3EWSA 4KAXA 2C04A 2FX3A 2GJAA 4JT2A 1NI3A 3CRW1 4HAZA 2B8TA 2IYUA 3ADKA 1NMXA 4RJLA 3CR8A 4XH9B 2QTHA 1XMIA 4M22A 1IONA 5TARA 4Z1MD 1UPTA 5JEEA 1Z0AA 3QPUA 3RHFA 2ZJ5A 4DLTA 2Z4SA 4Z54A 1OIXA 4JL8A 4BASA 1ZM2A 2WTUA 4P31A 4PHHA 5B57C 1S8FA 4FMBB 1ZC4A 1XZPA 2GTPA 3QOFA 5A5GA 1VPLA 1HV8A 2AKYA 1NSFA 4PFSA 4LI0A 4XD7D 2RGXA 2WIBA 3QUSA 1TF7A 5J4VA 1U90A 2KJQA 1Q1QA 3OFNA 1LB1B 1I2MA 1CBUA 2ZI4A 4FMDF 5FR2A 4US0R 1E98A 3EX7C 3RYTC 4Q01A 2R2AA 3MG9A 3P20A 3K0CC 3F3YA 3RRYA 4IKEA 5JI3E 3GPLA 2B7BA 4OHYA 3AF2A 2VP6A 2FSGA 1S2MA 4PC7A 3U3JA 1CR0A 3U4QB 1P9RA 4OI0A 3GLFB 1E1QD 4HZUB 4W7SA 3I4LA 5FOVA 2VL7A 3BFVA 1BS1A 2YHSA 4IVPA 4GMXA 4MYHA 3K9GA 1Q21A 4MYTA 1ZVQA 2B92A 1QBKC 1OLOA 1RRCA 1HE8B 4P4SB 4PR0A 4AD8A 2WPDA 5K8IA 2CE7A 1ZC3A 3CNOA 3MFYA 5HE8A 2BDTA 5AJXA 4EDHA 5KDDA 2EFDB 2A5GA 5P21A 1JR3E 2AFIE 2FZ4A 1HH4A 1NKTA 2QM8A 3I8SA 2HF9A 3QBVA 4JT4A 4S2EA 4MKGA 3EIHA 3OAAA 3RS3A 5GJCA 3VR6A 5DI9A 5AUPB 4NKRA 3TUZC 1XPOA 3MLEA 3WBJA 3P1JA 3NC1C 2C8VA 2JLQA 4MGYR 1KIMA 1R2QA 1WB9A 1P73A 4MH0R 3SYKA 2OBMA 2ODNA 1AK2A 2QTVB 4LHVA 3U3KA 4DUGD 2PJRA 4P33A 1IAQA 1W0JD 1AZTA 2H18A 2JLXA 4P4TA 4TLDA 1GKYA 4JVNA 2IEZA 1TPZA 2B8WA 3AF0A 4EPWA 2IYLD 3R9IA 3LXXA 3THWB 4PXAA 5FUYA 5JEDA 1E9DA 4LV8B 4A0GA 4G5OA 4YMVA 4H1VA 1P9WA 1KKMA 2D3WA 3PUZA 4NYJR 3K0FB 1KK2A 5C2JB 1LW7A 1N5JA 5FOWA 1E2QA 3ZH9B 4F4IA 4R2HA 1GL7A 2EFEB 1XMVA 3QBTA 2ZUCA 1W46A 2KWIA 4LK2A 4Q4LA 1UEJA 5D3MA 5DLQC 4AY2A 4KFTA 5HR5A 4Q03A 3W6PA 2XTNA 4JKIA 1UBGA 1II8B 4A2QA 2F6RA 4CF7A 1XCGB 2GVZC 3HU2A 1TL7C 4TL9A 5FBVB 5JFGA 1T3HA 3GCGA 1NKSA 5G41A 1N5LA 3DDCA 2F1JA 3ND8A 1XPRA 1E2EA 1I4LD 4RD2A 4KVGA 3E1SA 4JJZA 4CYMA 3G0HA 4Z51A 3HR7A 3GFPA 4DDVA 2OAQ1 2WV9A 3BAFA 4ARZA 1P5ZB 1FQKA 5JSZB 1TMKA 3K70B 5FBRB 4NYIR 5KOYA 1YZKA 2FGKA 2ZRBA 1G7CA 4GP6A 4BFSA 4XVUA 4RCYA 3IBYA 4D25A 1IJEA 3D6TB 5JCPA 1KO1A 1W0KD 5FPKA 2GHIA 1US8B 1WBBA 4CEIA 1OB2A 2W83A 4I99A 4MKIA 2QPOA 1E2LA 4GOKA 4NCNA 1Q57A 2HJGA 1TTTA 3FWYA 3GJ6A 1NIPA 3OEED 4LV6A 3ND9A 3IIKA 1KSJA 4EAQA 1F48A 4DLSA 1DO2A 1UADA 2WJGA 2VPPA 3THYB 1TQ6A 4JS0A 4L9WA 3B7GA 3PEUA 4Q1AA 1P62B 1SULA 3TRFA 3ICEA 2FFBA 4R9UC 2CBZA 2YVUA 5KNBA 1W44A 4HUQA 2J0UB 4DB2A 2G3YA 2IEYA 1DO0A 2ZAMA 4QGAA 2QP9X 4A1FA 3B5JA 2J0SA 2ASEA 5TB5A 1ZM9A 4LJ7A 4TMKA 5SZJA 1ZIOA 3KJGA 1XNJA 4MRPA 1IBRA 4ASUA 4TZ6A 3OIVA 4EJSA 4I1VA 1HT1E 3Q72A 3WBKA 3S1AA 2NMVA 3PEYA 4LBVA 3GJ3A 2PX3A 1SXJB 2NZJA 4X8OA 1D8TA 3BH0A 3KJHA 1QHYA 4P32A 4B73A 1T3SA 4KI0A 2OBLA 2B21A 1JR3A 4PSVA 4A82A 4US1R 5K8LA 1HY3A 3UWOA 2OFXA 3QG5A 5F9HA 1CF4A 3ZZUA 3CR7A 3EPKA 2DR3A 1G21E 3AF3A 4Q9LA 5B30A 3X1DA 5D3MB 3VNVA 2ZJZA 4HLUA 5CYOA 2GXUA 4A6PA 2ATVA 3E2IA 3T34A 4TYYA 3B9QA 3FMOB 3BRWD 4NYMR 5IT5A 4DLUA 4KBFA 3PFIA 2CK3A 2IYZA 2WJIA 4UJ3A 6Q21A 3JZMA 2C95A 4BECA 3U60B 4DJTA 3PEVA 2HXSA 2W2VA 4F4CA 2CXXA 3MWYW 2ZRAA 2XNDD 4DXAA 2H1LA 4Q21A 4I1OA 2W6JD 1IM2A 2J41A 4XSGA 3REFA 4BPBA 5HCIA 1KMQA 3Q7PA 4XJXA 4G1UC 2GRJA 2C03A 2DWQA 5A0FA 2V9PA 4BZQA 2B7CA 1Z0FA 2N42A 2VP9A 3FVQA 4LYFA 2V7QD 4NL4H 5SZKB 1UFQA 1YRAA 2IYWA 1Z0IA 2BBOA 4KLNA 1T9HA 4QBIA 1KJYA 3THOA 2WAYA 4URYR 2ZR9A 4NU0A 2X1VA 1E6CA 2REBA 1JECA 4DZZA 2JDIA 1WMSA 5KPDA 3LBHA 1G9XA 2JEOA 1E2MA 1G6OA 4MDEA 4ZPXA 3A1UA 1V43A 2CLSA 3CH5A 5B58C 2LKDA 2PBRA 1CEEA 2HXYA 4WBSA 3C14C 4LJ9A 3VU9A 2HDNB 1VHLA 2VF8A 2R6CA 1X8KA 3PIRA 4BFZA 1UKVY 3IBGA 3K09A 1Z6GA 5DSZA 1F6BA 3I8XA 4WOPA 1CJTC 1MO3A 4GRAA 5LPNA 2CNWA 2OG2A 3B1YA 4ZI3A 1G16A 1PLKA 1DOAA 4OJQA 1FNNA 4BE7B 3TVDA 3R20A 2W0MA 1MV5A 4P3YA 3A6PC 2N1BA 1N6OA 2JIZA 3CKLA 3GJ8A 1KSHA 2QMOA 4ZIRA 2ZI7A 4ABYA 2OAP1 4B2IA 4QHTA 4BLRA 1PZNA 1XEWY 4Q1FA 4E07A 1VG8A 2GEVA 4RZ3A 3IIJA 2FEOA 5HKKD 3VNUA 3LQQA 1VHTA 3AP1A 2R44A 4TQAA 5AUNB 1NJGA 5KUTA 3LFUA 3BB3A 2R6GA 1TUIA 2OO7A 3B13B 1EFCA 2W00A 2O8BA 1FNMA 1IY0A 4LJAA 4O2LA 3KXLA 4QKQA 1PVOA 1BH2A 1N6NA 1E0KA 4FWTA 2FE4A 4Q9JA 1JJVA 4A0HA 4ZDWA 2NPIA 3IPXA 2D7DA 3AGQA 1C4OA 5GVSA 1ZD8A 4QC2A 4BLQA 4WXRA 1MT0A 2BBTA 1CIPA 1TADA 3GJ4A 1SXJD 3LRPA 2RGEA 4GDFA 2YWEA 4HLQB 4JL5A 2BHRA 5AR1A 4B71A 1IXRC 3KUCA 1M6NA 2DPXA 1KO5A 2IT1A 4LDJA 5JJIA 4KCGA 4TMWA 2WMNB 2NIPA 4L8GA 4DHEA 5F9FA 1XEFA 3AP3A 3ZIAA 3LLMA 3TUIC 1ETUA 4J0QA 4EUNA 3WP0A 3TKLA 2P6RA 1ZD9A 2GJSA 1EFRD 3A1VA 4TLBA 2CVHA 2ORVA 3TMKA 4NH0A 4EPYA 1KDRA 1KDOA 1HQYE 2O5VA 3IHWA 1KMHA 1G64A 1G8GA 3GFOA 1GDDA 4M0LA 3RWMB 2XOKD 3BC1A 5CB6A 4FINA 3WYAA 1YR7A 2ODBA 3C5HA 5CLLA 4BUJA 1D2NA 1ZNXA 2QY9A 5DN6D 2WKQA 4ZIRB 4CEJB 3AGPA 3K70C 1XJ0A 5FL7A 2KBEA 2XTZA 4PPQA 4V0OA 4PQYA 2J46A 3NHAA 1Q1BA 1ZAKA 3QKRA 3U7GA 4EPTA 2IC5A 4OK5A 1FOEB 1HURA 2ZI5A 2IYYA 4N0EA 3NXSA 1ZCBA 1LV7A 3R9XA 2P3SA 2O52A 2OV2A 3M6AA 5E7JA 4TT3A 1JPNA 1CRPA 1Z2AA 1J8YF 3QJYA 1R5OA 4Z8XA 3W3ZB 2QU8A 4ZDJA 3JVUA 4F4JA 3SYNA 1ZUIA 1Q1ZA 4KHZA 1XEWX 1NNEA 5B2ZA 4NPHA 1IHUA 3NDBB 4OI1A 2C98A 4MGKR 1NF3A 1QF9A 1X8JA 2Q3MA 4DLZA 5JHHB 3BOSA 2GESA 1KHTA 5DE3A 1N3BA 1U99A 1WF3A 3CRMA 4LJ4A 4FIDA 4JYBA 2FDCA 2ZROA 1UAAA 4TLAA 1MO5A 3J81k 5JJLA 1YZUA 3RS2A 2CL7X 1E2HA 4LZZA 1XJCA 3UK6A 1S4QA 2FPMA 4D80A 3KQKA 4TQ9A 2F7SA 3LBIA 3MRSA 4W5HA 3B78A 3MCAA 3W90A 4Z1MA 2GDJA 2AFHE 2AWNA 2JJ2A 4H9GA 4II7A 3T5DA 1VYTA 1N2CE 3KFXA 3FE2A 3GJXC 4PO9A 1WQ1R 1NP6A 2QMEA 5C1BA 1SVSA 4Q4AA 4XD7A 1F2UB 1DPFA 3VR4A 5JCZA 1P3JA 4MUBA 1OB5A 3AF4A 1SHZA 1NRJB 3GEEA 4QRHA 1P60A 2QN6A 5GVRA 1OH6A 1U0JA 3EIEA 2IXFA 1T8UA 4LUCA 5C4GB 1W36C 3A36A 3QEOA 5C4MA 5J5CA 3P4XA 3GLFE 2NO1A 2ZE8A 5TDHA 1NBMD 3U7FB 3Q85A 2A5DA 1X86B 2AN9A 2VIIA 3KKOA 3MSXA 5TXGA 1OXUA 2YV5A 2MMCA 4UXHA 3H86A 3QPWA 4QGFA 4Q1BA 2ZRNA 2D74A 4DSTA 2LCFA 2DFLA 4KU4A 1PLLA 3FKSD 1U81A 1GVNB 3LXRA 4DLRA 2GJKA 3H84A 1B23P 1GITA 4HEJA 3R8CA 2FSIA 4IOLA 3CZQA 4PO1A 5J4LA 2NGRA 4NYJQ 2TMKA 4LPSA 2ZI3A 1FX0A 5AJZA 3ASZA 3UPUA 1XTJA 2VP5A 3H2YA 2O0JA 5FBQB 1F60A 1K5GA 2YNMA 3ZS9A 3DOFA 1H8HA 1SKQA 3AUXA 4TSFD 1VECA 4DUGA 4N0DA 4G01B 3CNLA 4R2IA 5KPJA 1SVIA 1W0JA 2H57A 3N5CA 1E2PA 2PCLA 2IUSA 4EJSC 4DLWA 1NVUQ 3L0IB 3DZDA 1QG4A 2IUUA 5JRZA 2XB4A 4OQLA 3GJ0A 2BM1A 2IS4A 4NYIQ 2QM7A 2YJTD 3Q5DA 2ODWA 4R98A 3UIEA 1SVKA 1CJKC 1U94A 3E5HA 5CYPA 5FTJA 3L82B 4HLUC 2R9VA 4LGMA 1E79D 1Q3TA 3OIYA 1JI0A 4QM7A 2A5JA 5CM8B 2EYQA 4ACBA 1BO6A 1R5NA 4OYHA 2A9KA 1N6HA 4YLGA 2BCJQ 2FWRA 3LVRE 4IJMA 2GCOA 4DIEA 5FTNA 2CHGA 1N0VC 2P6NA 3FMPB 4KV9A 2IHBA 1W7AA 5HTKA 3DOEA 3W5IA 2XX3A 2JLYA 4JMPA 5JHGB 3CWZA 3X1ZA 3KKNA 2FG5A 4LBYA 1IN8A 1Q0UA 4K46A 2ANBA 2QA5A 4HLCA 4NDZA 1XP8A 3U5ZB 3LWNA 4YONB 1G7RA 2EYUA 1E0SA 3GD7A 4LRWA 2REOA 1SVMA 2QL6A 4AC9A 1FP6A 5SZIA 1JEEA 4ZDIA 1N6LA 4Q4HB 4B32A 1FX0B 3CF6R 4OQNA 4BEJA 4Y0AA 3K0AB 1DEKA 2VHQA 5G3YA 3WNDA 3K09C 1SZPA 4O3MA 5AUOB 2WSSD 3WRXC 3MWJA 3B85A 2PCJA 1FTSA 2QSYA 2ERYA 1QHXA 2V4ZA 4GZMA 5IRCD 2IYRA 5TV2A 5H70A 1OXVA 1BMFA 2GXAA 4LSGA 3U4QA 3ADDA 4NYMQ 4DB4A 4MGZR 3GLFA 2N46A 2GAAA 4A4DA 1AN0A 1RE0A 3BGWA 4HZUA 2BKEA 2IXGA 3P4YA 1F5NA 2YWFA 3I32A 4RZ2A 2HEIA 3P27A 1M74A 4Q1CA 1G5TA 2IYTA 3CLVA 2QBYB 3D7MA 2GF0A 4M1YA 2XJ9A 1L4UA 2O8DB 2O8EB 5EE1A 4XVQA 2CE2X 4LJ8A 3QNUA 4LHWA 4LYHA 1AGRA 1SXJE 2OESA 2ZRGA 3GEHA 3CX6A 1GSIA 2WWYA 1IN7A 4RD3A 3SS8A 2X2FA 1M34E 2GXSA 4RFVA 3R7WB 3ZJYA 1IN4A 1XDBA 2ZRFA 3A4NA 2DHRA 1NLYA 3OESA 4NE2A 1S3SA 4Q4JA 4B75A 4C7OB 2ZJYA 2QT0A 1KK3A 1NIJA 2GCOB 3DMNA 5EP1A 3SJBA 4JLKA 3BH6A 4JLMA 3C7KA 4JLOA 4GMDA 4AWXA 4EFMA 2YC4C 1E2DA 2VSOA 2DWOA 3RDPA 4S35A 3VX3A 1U8AA 2CEAA 4IDPA 4G5RA 5EQTA 1L8QA 5KO2A 5IDVA 2RGBA 4HATA 1EFHA 2Q3FA 4I1UA 1RJ9B 3UXMA 4UNSA 5BN5A 2NO6A 3TSOA 1CULC 1IJFA 5G3ZA 2EWVA 2IS6A 1Z3IX 2ZANA 4DWJA 4D2IA 1V5WA 3CZPA 1TQ4A 3THWA 1T3LA 2ZU0C 4GOXA 1X8LA 1ZNZA 1PJRA 1LF0A 1KSFX 4YXWA 1P2SA 2G0NA 3DKVA 3K0FA 4PAOA 1E99A 1FPMA 5BN4A 1IN5A 2RGAA 1NMZA 3L8ZA 1G41A 3NBZC 5KDOA 2Z83A 1AA9A 2XITA 2ECKA 5TVKA 1Z63A 4ESHA 4WZ6A 4DCTA 2ZRKA 1NN3A 1WDTA 2EFCB 4JLVA 3REGA 5FOSA 3QY0A 4B48A 2FFAA 2QG6A 1II8A 1Z6TA 2QPAA 5BW8A 4GPTA 2F9MA 2CHQA 1NL3A 2JAQA 1YU9A 2OCPA 1TF5A 2VHCA 5H1YA 3EA0A 2XJ4A 2WOOA 4F92B 2QI9C 3QF4B 4ITRC 5FPYA 5JSZA 2UVQA 3PUWA 3FDIA 3TH5A 1A1VA 4LOAA 2G6BA 2WWIA 3FPAA 3KTAB 1XZQA 2P5TB 2J45A 4IDNA 4IRUB 3CRRA 3EA5A 2VO1A 5LD2B 1ZM7A 1YR8A 2Q0HA 4KITB 2BVNA 3SOPA 2IW3A 1US8A 1KZGB 4N3NA 3F0TA 5HKKA 3U61B 2BEJA 1D5CA 2A30A 3V9PA 4WZAE 4MGIR 2YZ2A 4W5WA 4Q4JB 2AWOA 2QAGB 2R6AA 3EZ2A 3TE6A 3FTQA 4YDSA 1LF5A 2PL3A 1GNRA 2F43B 1EX6A 2WWXA 4AYTA 1J8MF 4A2PA 3THYA 2WWFA 4EQ6B 4DKXA 2WOJA 2VP0A 5F2EA 4TTQA 2OT3B 4JLBA 2J0UA 1G4UR 1T5LA 4U5XA 1I2DA 1GAJA 3RVBA 4V0NA 3NBXX 3TGPA 1AS0A 3GLHB 2V6JA 1T4GA 2ZR7A 3LA6A 5DHAA 3TW4A 2C2HA 4TTPA 3MJHA 1JEDA 4KSCA 1JB1A 3BBPA 4POAA 1M1YE 3WMFA 1SXJA 3BK7A 1OHHA 2JLWA 1VYVA 4TMZA 1EFTA 2HT6A 3SHWA 3T5GA 4XVRA 1KO8A 1CR4A 4TL7A 3GLIA 4MDFA 2QMUA 3FHOA 1PUJA 1XEXB 3QEJA 4I81A 1FTNA 2G1JA 3A1SA 3VR5A 1UKYA 3IQXA 4TMVA 4JLPA 4HAXA 3SR0A 3TK1A 1A4RA 4BLTA 2H17A 4RFSB 1UBFA 3WP1B 2WWGA 1EFRA 1AS2A 3W8NA 1AZSC 1AKEA 2V54A 3FYHA 3U7EB 2IL1A 1AKYA 1COWD 5G40A 1TQDA 2CMKA 2XOKA 3WNCA 4D6PA 5IF9A 3FMIA 3UMRA 1CS4C 4DSOA 5DN6A 5BN3A 2E1RA 3QKSB 4IVQA 2YOHA 2XGJA 2VBCA 2Q9AA 3QXSA 2JLZA 1DARA 1GTVA 4QOSA 5M04A 1QG2A 3QQ5A 2HT1A 4TYPA 5TMPA 2ZITA 1P4SA 2MSEB 1CJMA 1N5KA 2OXCA 3DM5A 3E70C 3TJZA 4CIDA 3U2QA 2RB4A 1FL9A 1G291 1LFDB 3HPRA 5JWOA 3DVLA 3ZVNA 1TNDA 1XTRA 4WIAA 3EARA 3KFVA 1KDTA 1ANKA 1CP2A 1MRNA 2W58A 1NG1A 1XCPA 5F98A 2W0SA 1EGAA 3VR3A 4Q1DA 5IK2D 3W5JA 4DLVA 4HAYA 2CLCX 3TW8B 4PAQA 4JBYA 4I1SA 4PSKA 1E4VA 2Z0MA 5FPSA 4CT5A 1XWIA 1Z47A 3CX8A 4LHZA 2P0EA 5EE3A 5SZHB 2JJ1D 1RC8A 1XRJA 2QUZA 3LH5A 4B3DA 2RGDA 3Q7QA 2PZGA 3JVVA 1GP2A 4AI6A 2ZQ5A 4IFEA 5E7IA 4EPRA 4W9MC 2HLDD 2FJUA 3GLIB 1OIWA 2QP4A 1KI9A 2WMOB 3ECCA 4FXPA 4EFNA 2JJ8A 5CM9C 4KJZA 5K8TA 2IXEA 5UKDA 2GF9A 3LX8A 2NO0A 3GJ7A 4QNRA 3SJAA 2BKUA 4C2UA 1LTQA 1E2KA 1SVOA 3ZDQA 1G3MA 3PVSA 1T5IA 3SQXA 1J2JA 421PA 4AKGA 4MKHA 3K1JA 3QPVA 4DLXA 2V6IA 1IN6A 2NPFA 4DRZA 2DCUA 4LCBA 2RKOA 3TUJC 2OEPA 2C9OA 2ATXA 2NO9A 1MKYA 1KI4A 4M1KA 3VR2A 4D26A 1XTSA 5FH9A 1CU1A 2QE7D 4RZXA 3CPJB 2ONKA 2ZEJA 3O8DA 1NBMA 1DG1G 4DSUA 1H8ED 3TR0A 3SE0A 3O8CA 3BWDD 2ZJ8A 4K81B 4HAUA 1Z06A 4QL3A 5KTYA 2CVFA 2ZYVX 1FZQA 1PLJA 1XD2B 4GOJA 1R8QA 2ZPTX 3IILA 4HSEA 5BYJA 3FKSA 4DEYA 2EWWA 5GJVC 4A8JB 3BFKA 5KDLA 4A92A 3CONA 1E32A 1F2TA 5CIQA 4Z8YA 5BWMA 2P65A 2FEMA 4HDQB 3DMDA 2AD1A 2XXAB 3AM1A 1KSGA 3CW2A 4KYUA 1GRRA 3ZVMA 1E4YA 1XD9A 4NTZA 3KQNA 1KNXA 3IUYA 4JSYA 3O8RA 4B3CA 3Q9LA 3SN6A 4KFUA 3LO5A 1UKZA 3KB1A 4OQXA 3IKJA 4RD1A 4IOJA 3U3OA 1J70A 1Z2CA 3BH7A 2KSQA 2XZPA 1E9BA 2H16A 3EG5A 3TAUA 5JBQA 4CEJA 3IEUA 4E22A 4WZBE 3KQLA 3W6NA 2YC2C 3ICQB 3HR8A 1N0UA 3BE4A 3F5FA 2JCSA 3L0SA 3MUFA 4JKYA 4A2WA 1OXTA 4FCWA 1VMAA 2VLIA 2O8FB 1W47A 5LDDC 1FMJA 4FMCB 4M21A 4KXFB 1PUIA 4RVCA 4XIGS 4TTRA 4C4PA 4ZI2A 2ZYTX 4G0NA 2FPKA 5L3RA 1AQUA 2XTMA 3TBKA 4ZO4A 4DLYA 1A5TA 2SHKA 3HYRA 3PG5A 1FQJA 2ZJ2A 3PJRA 2OSBA 2ERXA 4EPXA 1KOFA 3Q8XB 1FUKA 5KHOC 1Z0JA 3QF7A 2CLDX 3OAAD 1G4AE 2GEDA 2ZSDA 2QSZA 5FPTA 2CCJA 2RGGA 5FR1A 5DO9A 4ESVA 1W4BA 2VEDA 4O0MA 1OE0A 5K8UA 4AURA 1CJUC 1L2TA 4ON9A 4PHTA 1Z6YA 4A6XA 1EK0A 2ZJBA 1NVXQ 1N6IA 1LS1A 2A5FA 1XJQA 3KXKA 2J59A 2ZM5A 521PA 3T15A 1U0HC 1DAEA 2K5UA 2BBWA 3NEJA 4OI2A 3W34A 4YMTA 2QP3A 2WWHA 3U6KA 2OCBA 3C41J 2G88A 1MABB 1E2JA 2PT7A 4OK3A 3BJIC 2AHOA 4B43A 4JLNA 2D7CA 2RMKA 4DCUA 1EX7A 1EESA 3PEWA 5E4FA 4B74A 1F2TB 1SKYB 2WICA 4KVAA 4D4KA 5JS8A 2IF0A 1KI3A 3B2EA 1F2UA 2WHXA 5CJPA 5JJKA 3AH8A 1ZP6A 1M8PA 4R7ZA 1OPXA 1RYFA 5JLJA 2VHJA 1T91A 4G5QA 1EFUA 1R10A 1XB2A 4Q66C 4Q9HA 2WSSA 3OHMA 3RABA 4YQFA 2ZSEA 1ZINA 3AKYA 1VCOA 1P9NA 4MRSA 5C46F 4OJKA 3KX2A 3ZS8A 4UKDA 1TUEA 3FKQA 5FUWA 5J4KA 1KI1A 1OF1A 4ZKEA 4AK9A 2IHYA 3SBEA 4C0LA 5EXPA 4C0BA 4FMCF 2ZE6A 3QE0A 2PH1A 4IDHA 4ZCIA 3QIAA 1Q3HA 3RC8A 5IHPA 2JATA 3FHTA 1T6NA 4Q9IA 3PUYA 2IYXA 1GL9B 1W36D 2A5YB 1EG7A 2RH5A 1E2GA 5CITA 1VG0B 4A0RA 3L0PA 4B3BA 1Z08A 1L4YA 4CEHB 2HJVA 4D0LB 1X3SA 4BFUA 4LBWA 4A0FA 1QHSA 3IDQA 3EW9A 4PANA 3GP8A 4QHYA 3PXGA 1E96A 4WAUA 4O25A 1T0HB 4DDTA 1G8FA 1OH7A 3IIMA 1GUAA 1J7KA 2VQSA 4HAWA 4QBFA 3ZLJA 4Q7KA 1NJFA 4BZPA 1RYHA 3QXCA 2FNAA 3DM9B 3KDSE 3LW7A 3K9HA 2IWHA 1UDWA 2Y8EA 4YMWA 2AR7A 4C0AC 1KK0A 5HZKA 3AVVA 3AVWA 2NZ8A 4LHYA 3T1QA 3C15C 3FFAA 5AJYA 2A3RA 4BGDA 1G3UA 4F38A 1M7GA 1SXJC 4NCKA 4RY2A 1DG3A 1Z0KA 3M4YA 1KAGA 2ZE5A 4ACAA 3C16C 1R0YA 1P75A 3AKEA 1D2MA 2J7KA 4KFSA 3GMTA 3K9NA 4LC1A 2W6ID 2FSFA 1R6BX 3NVAA 3AVQA 2MSCB 4PTLA 4JBXA 5CK4A 3F8TA 1KI8A 2OLJA 2EFHB 3SFVA 1KO4A 2LKCA 1XF9A 3V4RA 1W2GA 3CM0A 5E3HA 2PJZA 3QVUA 2X8AA 3B1ZA 4GP7A 3UANA 4DDUA 1X1SA 1XXHB 2Q9BA 4DCVA 1W2HA 5EE9A 4XTCS 3ONWA 1EWQA 2AXNA 4IEIA 2JGNA 1NN0A 4YDHB 4M1OA 1YJ5A 1E1QA 4IDOA 1R8SA 1KO7A 1Z5ZA 1JAHA 2PEYA 2OILA 5AJVB 1D9XA 3B1XA 4RKFA 4QG7A 5EZ6B 2OHFA 1DAHA 3L8YA 4FWIB 3K9LA 1KI6B 3M1IA 1S1MA 1WP9A 2CJWB 5JECA 3VTKA 3KKPA 2D06A 3CF0A 1Z29A 4MA4A 1KTVA 4UJ5A 2RGCA 4C0JA 5AK0A 1OV4A 3B9PA 1IXZA 3ZQ6A 2OCAA 5J47A 4Q4HA 5JZVA 2C78A 3K0AA 2Q9CA 2CCKA 1D9ZA 1NY6A 4V0MA 4M53A 3WNBA 3AV0B 4PZLA 4MQBA 1TQ2A 1YZGA 3VR1A 5EUQB 1CXZA 3CIOA 4Q18A 1BYUA 3U44B 3QSYA 3DKPA 3SI7A 2VP2A 4HB0A 2H92A 3X1XA 2FGJA 2MSDB 3WYGA 3X2SA 5L3SB 4OL0A 2C9CA 1HE1C 1A2BA 4OBEA 2EW1A 2FFQA 2GXQA 2QGNA 1WA5A 2Q6TA 2QBYA 1N25A 1E9RA 4O2RA 4B3XA 4V02A 1G18A 4L16A 2O8DA 4L15A 4F93B 2O8EA 2GKSA 2GJ8A 4OHZA 3TQCA 4E03A 2OE2A 2GZHA 5JMTA 1P2VA 1SVLA 3WMEA 3TNFA 4HI0E 4B6EA 2DY1A 3EC2A 3VKHA 2FPLA 2GBLA 4C3ZA 3BIFA 3R7WA 4N1AA 3OF5A 2X77A 4K8OA 4IXNA 3WRYC 1KK1A 5JS7A 3PCRB 2FA9A 3B60A 3RRZA 5DHFA 4C7OA 3CBQA 3VKWA 1JPJA 1Z0DA 2BMJA 3W8RA 2F1RA 2ORWA 4HYYA 1JNYA 2H5EA 4TYQA 3AKDA 1HT2E 3EZ9A 4D0GA 4FW9A 1G5RA 4JLDA 3TQFA 3N2IA 1COWA 1FUUA 3ADBA 1RJ9A 1E69A 3QG1A 5CLQA 3MMPA 1HTWA 1QHHB 4IEEA 1M7HA 1VG9B 1YZTA 5J4HA 4PHGA 4XSHA 4NMMA 1CR2A 4M1TA 1E9SA 4UXJA 5L3QB 4BZXA 1AIPA 4NONA 1XTKA 2JLUA 1FP7A 1W0KA 4ILEA 1VIYA 4QJ4A 4WVFA 1UEIA 3SJCA 1JXMA 3HP1A 1XTQA 3TVTA 1G5PA 4B6FA 4G3XA 3OEEA 3N70A 4MRNA 2ZRJA 4G5GA 4X8LA 2ZRDA 3ZD7A 3AVXA 1KAOA 2WJYA 2VSFA 2WAXA 2W2XA 3P26A 3QXHA 4XOIA 3SEAA 4ZCLA 2Z6VA 3RSOA 4ZDKA 2F3RA 1YR6A 3GQBA 2ZJOA 1W5SA 1U98A 2FV8A 2BC9A 4MRRA 1LS6A 3ZIAD 4M4SA 3SU8A 5JI2E 1W4RA 4TLCA 1RPZA 4UQOA 2KBFA 5IK2A 1J99A 1YHNA 2WVJA 3QF4A 5ELXA 2ZR0A 1K5DA 3LX5A 3IPYA 4LWZA 4CVNA 1FMLA 4RKEA 3KTAA 1I4TD 1E2NA 5FL3A 2XSZD 2QEQA 2J3EA 5FBWB 5CDFE 4IHQA 121PA 5FI0B 3SFZA 2R6DA 3A58B 1QDEA 3OE7D 2PMKA 2QQ0A 2DWPA 2F3TA 3AUYA 1ZM3A 3NIBA 3T1TA 2V1UA 2HLDA 4RSGA 1R7RA 1X1RA 1YKSA 2FSHA 3HWSA 4ERNA 3GLIE 4JIMA 3SHFA 3T61A 2NO7A 3N2EA 5DYGA 2J0QA 4D0NA 3DO6A 1OXXK 2QAGA 2FU5C 4BFXA 1CKEA 1GKIA 3G82C 4B2PA 1QRAA 3OZXA 2F43A 4FD2A 4ZV4A 2VTKA 5LB2A 4EQ6A 1VKJA 2XNSA 2YOFA 1CJVC 2ZRIA 1G3IA 5KNDA 2XNDA 4AKEA 2W6JA 3GLHA 5GADl 3LD9A 4JVMA 4W5JA 4KO8A 1SQ5A 3NBYC 2D62A 4L4UA 1GNPA 2GA8A 4NP6A 2GCPA 2QE7A 2V55B 2V7QA 4I4LA 5EXSA 3BS4A 3ZVLA 2O8CA 2ZTSA 1P61B 1UBEA 1H8EA 4QJ5A 4LJ5A 1KKLA 4TZ0A 4PC6A 1RRPA 1Z6AA 1XEXA 4HB2A 4D81A 1ZW6A 2IYVA 2H8KA 2WKPA 2X2EA 1ZIPA 3UWKA 3V4FA 2WIAA 3ZVRA 5EUMA 2C77A 2ZI6A 4NCHA 2E9SA 1ZYUA 3SC3A 3IO5A 4D4LA 4U7DA 4RFSA 3VHLB 3CRVA 3VAAA 2JJ2D 1CRQA 1N0WA 4KODA 4PQRA 4PQFA 4JBWA 3RC3A 4MYUA 2OUKA 3EPHA 2QGZA 2YINC 3I72A 2ZSBA 3EIQA 3BXZA 1WCV1 4HDCA 4QHSA 2AXPA 1KI7A 1K8RA 4P0TA 5FOTA 4QJ3A 3BORA 5EP3A 3CB4A 1BIFA 5HE9A 3PUVA 1F3OA 1JALA 4PPGA 3EXAA 3A4MA 1GL6A 2CCGA 4C0SA 4DBLC 3QKSA 1T0JB 3KKMA 2OFWA 2NTYC 4PC2A 1GRNA 1M7BA 2XEXA 1GZSA 3KUDA 2P6UA 1ZJ6A 1OH5A 1CR1A 4JYCA 4KFRA 4B44A 1NLFA 3AP2A 1NY5A 3PR1A 2F55A 1G1MA 1ZRHA 2PZFA 1U8YA 1W49A 2F9LA 2IA5A 1E0AA 1O87A 3AQ4A 3B82A 3T1VA 3GLGB 2G1KA 1KY3A 1W1WA 2A7QA 1XTIA 1ZUNB 3LDAA 1EWRA 2ZSFA 2R62A 1E9AA 1OSNA 2DBYA 3C4JA 4Q47A 5EZ5A 3ZGXA 1OYYA 3AVYA 1U2RA 5JWHA 1VYUA 3G5UA 5LB4A 2QZ4A 3DZ8A 1G8HA 5FOXA 1OFUX 3EZFA 4DT1B 3H4MA 2J87A 1Z6XA 1HYQA 1ZD1A 1DAKA 3MJRA 1GILA 3SNHA 1E1RD 4PAMA 1RRFA 3QI2A 1XX6A 2FF7A 1II9A 1SGWA 5FBLB 1WE2A 2BV3A 4TYWA 5CDFA 4QGGA 2O8CB 2A2ZA 2BCGY 1YZNA 1R5BA 4ZKDA 1NBME 1H8HD 3A1WA 3GJ5A 1Y63A 4BFTA 2BMDA 2VHTA 2AKAB 4HUTA 3T35A 2YKGA 2KI5A 5G53C 2BIFA 1XCMA 4PZYA 1XMJA 3H0KA 3W9YA 2KB0A 4RD6A 1GOTA 2IBMA 3CWQA 5FTKA 1JQJC 4AYWA 4IDQA 1U0LA 2OCYC 3WXMA 3OIUA 1SKYE 1H65A 3O8BA 2CL0X 4L9SA 2ZYUX 2F1IA 1JQLB 2GZAA 2MMGA 3KXIA 3LNCA 4M9ZA 2JA1A 4DDWA 2ZAOA 8OHMA 3I92A 4OK6A 3EZ6A 4KBGA 1OH8A 3UKDA 5F3WB 2C96A 4JL6A 1KGDA 1ODFA 3NEYA 2GK7A 2FH5B 1BYIA 1NVVR 1G8PA 3UMSA 4HB4A 1NLZA 3HPQA 1UDXA 2PEZA 2JASA 5CB8A 1GIAA 3KQUA 4DC9A 1M2OB 2OBNA 1E3MA 1ZU5A 4GZLA 1XD2A 5FUVA 4BQSA 4TMTA 3M0EA 2HCJB 1T8TA 2I1VB 3H1TA 3WY9A 3MWLA 1YVDA 4A8JA 2CHVA 4PPFA 2ZE7A 4IOMA 2IF2A 5EE0A 4C0KA 2ZRPA 2OM2A 3NDPA 3LY5A 2XXAA 1DADA 3BB4A 2WZQA 2D2EA 1ESMA 3NKVA 2GJ9A 4OKSA 1A7JA 3VX4A 2DFTA 3AVUA 3CUEF 3I5YA 1SVWA 3UG6A 1U9IA 4XWOA 5D3QA 2ZYWX 2WM9B 2ZI9A 4NCJA 3SYLA 4DSNA 4TL8A 3TR5A 2PLFA 1KDPA 2REXB 2ZIAA 5JRJA 4CGZA 4YC7A 1W4AA 221PA 2P67A 2HCBA 2EVWX 3WHLA 3KZ1E 5L8VA 3TIFA 2DYKA 1BMFD 4D4JA 4Q7LA 3A4LA 2IWRA 1Q20A 2IYSA 3RS4A 4M9SA 5FUXA 2RGNA 3A37A 3I3SR 1IQPA 5DYIA 2O8FA 4Q02A 3FOZA 2XZLA 1C9KA 4NZYA 4B33A 4M1MA 2GBLC 2W6IA 4UNNA 1VIAA 3RAPR 2J7PD 4CDGA 2XZOA 2GNOA 3D3QA 3L43A 2OLKA 4BWYA 1TF2A 3DPUA 2BEKA 2FMXA 2ZS8A 5KU1A 1VCMA 1RVDA 1OKKD 5GJWC 2WJVA 2FFHA 4MITA 2GILA 4Q7JB 4OHXA 4LYJA 3RLFA 4PC3A 4TQUS 3EPJA 1MR3F 3SZRA 2QAJA 1N6RA 1XXHE 2Z5FA 1Z28A 3KJIA 3B8HA 1RZ3A 1OYWA 4OHVA 1DAIA 2DFKB 3L2OB 2O0HA 4U00A 4URXR 3OEHD 1KZ7B 4D82A 2CDNA 1DAFA 3LBNA
chains in the Genus database with same CATH superfamily
3BVPA 4FK8A 5TQ0B 3R7BA 1UF9A 4HFJA 3VHXA 4V24A 1RRMA 1XMSA 1C8VB 5C0OE 1P0MA 3PQ4A 4E6EA 4BLSA 2JAXA 1JLRA 1W36B 1OJ7A 4BO8A 3ZHVA 1C0KA 1OV6A 1WNFA 2CJXA 2C2WA 2VTBB 1ESNA 3U7FB 2XF8A 4YRFA 1AGPA 2QF7A 1P9LA 2VK1A 5KC8A 1GSOA 3F7TA 3HXPA 4MV4A 1UBKS 2V9CA 4QATA 4RKWA 3KQSA 4ALIA 3IMFA 3F73A 3SYTA 3VKGA 2VDLB 3K53A 3QH4A 3UMFA 4YXWD 2AD5A 2QNBA 3ONVA 5GONF 2BFNA 2E4XA 5AI6A 3GD5A 1GPAA 1AQYA 3Q9UA 1ODKA 1FTGA 1Y8AA 1DVRA 3BIWA 3AG6A 3VBCA 2Z43A 3SWWA 1B8NA 4QM6A 3E35A 3ZCQA 5DKFA 4QWWA 4YK7A 1RQNA 3HJUA 2PDAA 4C7VA 3OBIA 3CU5A 2W2QA 5FQNA 3E22A 2CNLA 3WB1A 4WVLA 2XE4A 2J67A 3AERB 1WULS 5EXTA 1F6DA 4CLXA 4F6RB 2NSJA 3FTCA 4JVSB 1NMEA 1PR6A 3EXFB 5BSEA 3MA0A 1U3WA 2ZJ3A 4OIFA 2FQQA 5BSMA 1VJCA 4UU0A 2FZWA 3AR8A 1M67A 2BD0A 3AVTA 1SHJA 2R8XA 1JFFB 1MOZA 2O7SA 1QHIA 1MUUA 5JYEA 3HCWA 1UIMA 2O48X 3M9XA 4BVKA 5H8WA 4HDAA 5DIFA 2QQGA 3LBAA 1TKRA 4H18A 5KYXA 3ELUA 1REQA 3UUWA 2QRZA 1E79A 1LLQA 5CB4A 3LUAA 4C88A 3VOBA 3R75A 4R1UA 4XJTA 1P2TA 3F74A 1QS0B 5D1NA 2HRZA 4DA8A 1U8EA 2ZVPX 2ETXA 1O0SA 3N2KA 3NBFA 3A8TA 1WXGA 5JDIA 4CL3A 3T6KA 1RWPA 4YMHA 4L73A 3DHNA 1IZYA 3IAM6 1CUJA 1LQ2A 5AYVA 1UKEA 3TLJA 5EHNA 3OE1A 5AKZA 2YHIA 4ZZ3A 621PA 2ZETA 1T3ZA 3M6WA 2Q7DA 2V0GA 3ZD6A 2IHVA 2HGSA 5FI3A 3LVQE 4MHOA 4HDKA 4BQFA 1HKHA 5KSZA 2B9EA 1ZAYA 1TMOA 5L7TA 5CW2A 4QEDA 4CMIA 3U6BA 3P45A 2C94A 3I30X 1ZN9A 1BKDR 1J2UA 4KLZA 2OYCA 3ESCA 1HG0A 3CF4A 4AKSA 3EPPA 2I4IA 1RIFA 1Q14A 5AVOA 1JEYA 4MUAA 1OCEA 3CO5A 4HH1A 2P41A 2HIHA 3W2HA 3EBOA 4JD5A 1CR6A 3AF1A 3ENNA 4CF3A 4DVGA 2PX0A 1T35A 1PR3A 5ELMA 3SSOA 1OHHD 2C3UA 5HZMA 4RACA 4CMAA 2PT5A 3BFXA 5SY4A 1ZOLA 3ZU4A 2RIPA 3V1MA 1AHIA 4U2GA 3P32A 3V2HA 2JLSA 3LDFA 1DIBA 2J09A 3AOEC 4LYAA 1JI3A 2E0IA 3Q3JB 4TMXA 4C04A 2F62A 1JG7A 2PA0A 4AIIA 2JHFA 5SY6A 2E4AA 1DG9A 1NMQA 4R2WA 5DTIA 1OX5A 1AKTA 2YJZA 4U2BA 5F23A 5IAOA 4EY5A 1Q1GA 4OXXA 5ALIA 1ST3A 2UZ3A 1AUPA 2O2YA 3QMVA 5F33A 3A2KA 2PQMA 3LG2A 3NCTA 3R7AA 2BDEA 1QTNA 3IRUA 3JQ9C 4O8ZA 3Q5EA 4M0PA 4S05A 2XSZA 1A82A 3Q7SA 4UOEA 3K7EA 2WKSA 1D07A 1N5MA 1YR9A 1ND5A 1ZGZA 2FPGB 3Q1KA 1MAVA 1BVRA 2RHDA 3BCHA 3ITDA 3IVMA 4KIGA 4BNLA 1AJEA 5CIWA 4WK6A 5GJCA 1UJ2A 4FNGA 2BFAA 1V26A 1BRMA 5BWNA 1TVEA 1WABA 4X65B 3DUFB 1A9TA 3L4BA 3MTIA 4REQA 6REQA 3NH6A 3DDOA 3EXIA 4QUEA 4OQFA 3AB3A 4RHFA 4JEMA 1JX6A 4WOBA 3INTA 3C4QA 2M6KA 5KOIA 4MWSA 1WVGA 3PKIA 3B6EA 5E8JA 1MW9X 3KR2A 2OXRA 5DLYA 4BV9A 5HSGA 2H7VA 1P7CA 2G36A 3PC8C 3E9EA 2G83A 4IJUA 2BGWA 4U7PB 5BPFA 3BM5A 1A76A 4LXXA 3UWPA 3ROQA 3D3KA 1CC1S 3QMPA 5AOCA 2X0JA 2B25A 3D6FA 2BBSA 4FJ0A 2AQKA 2AE2A 3TB4A 3UA3A 2PX6A 4NMXB 4OG2A 4CNBA 2RAVA 1K7FB 3T52A 3KL4A 5HJ2A 4DCSA 3L1KA 3IDFA 3QNWA 5MGNA 2B2CA 5DNYB 1CUVA 2P4HX 3HYTA 4HGZA 5CPFA 1B43A 2Q5FA 3A6FA 1OIVA 3P9PA 1QUEA 4CN8A 5DM70 2K2WA 4XDGA 4U8HA 3EW7A 4M1ZA 5FA5A 1NVEA 2ZG6A 3V6LA 1AM4D 3IJPA 4NE9A 2HCRA 4ASUD 1U0RA 2QD2A 3DQPA 3D8BA 1NG9A 2HMAA 3KALA 2W71A 2CB9A 2ZRHA 3BGOS 4IQ4A 3CCBA 4AUEA 2Q21A 1M75A 2NT4A 1E2FA 2R6JA 1YC2A 4JASB 1THGA 821PA 4D8XA 5E9WA 3NWJA 2F8SA 2ZPUA 2H51A 1MQ8B 4RMJA 2GVDC 4EUNA 5B64A 1U0OC 5JV5A 2GM5A 1AKWA 1G6KA 1NQVA 2WBLC 4UXIA 3ASYA 3MLBA 1YI1A 3HUEA 1BXZA 3UFXB 4YROA 4EYSA 1ZHOA 1PKXA 4YR7A 3AUFA 1KEWA 3D4NA 4OHWA 5LZ4A 1T4CA 2ORED 2PVSA 1ZXXA 4AT1A 3OP1A 4PSAA 1O77A 3PWKA 4IILA 4PO8A 1WXWA 3GPBA 5L7WA 4W4TA 1BW9A 1ZBDA 3LDUA 1B0AA 1K2WA 3AKCA 2HU7A 3MHPA 1KJZA 4PCAA 2VDUE 2VT2A 1MP0A 4MNTA 2ZP1A 4N5DA 1S1CA 1Z82A 4S1TA 4F9GA 3T4XA 5IJZA 1OT3A 2QN9A 1W73A 1LJ8A 5ALOA 2NOAA 2LIPA 1KMHB 3TW6A 1Y5NA 1MAHA 3UJNA 5IUNC 2NQ2C 4BJ1A 4C4OA 5FADA 5FI1B 1OI7A 1W88B 1L5YA 1RLOA 4Q9AA 4DPKA 1OVMA 2C7VA 2AK2A 2QU7A 4OHYA 3ZEIA 3TSWA 4X94A 1BQEA 2C2XA 3OZTA 3HI4A 1Q91A 4A8JC 4RLFA 1X6VA 2RH8A 3PITA 1HDIA 3OT1A 4PYQA 4ZPJA 10MHA 4RW0A 1YTLA 4KFCA 2L0XA 5KYVA 3I23A 4FBLA 4L4YA 4OJYA 1T9AA 3OKFA 3VGPA 2IS1A 4KIJA 1CZNA 4GSYA 3ZWCA 2YXBA 2C9YA 3ED1A 2PUWA 1GLNA 4YT2A 2CY0A 1FVHA 4W5NA 5CFOA 4XWWA 1DBSA 1W8IA 2NUPA 5DW0A 3QEAZ 2COUA 4LJKA 3P52A 1RWKA 4G4IA 4V3BA 1K7CA 1ZVJA 2HW8A 3NXKA 4ISBA 3EB9A 3IVXA 2B83A 1RKBA 2ONCA 4M6WA 4MRVA 3UV3A 2SKDA 4V0KA 2XUPA 1AN9A 2HQ1A 4ER6A 2BGRA 1SPXA 3DHWC 3DL0A 4QDKA 1YD7A 2Y1OA 2PRYA 1X9GA 3KVYA 3WG9A 4GI1A 3UB4A 1Z5VA 4ATNA 1RWWA 3FTDA 4OY3A 4FCVA 4F96A 3EGEA 2FUG6 2QTFA 2I91A 4JP3A 4FEGA 4L85A 1FNDA 2P9CA 2RGNC 1GT91 4YV7A 1NXQA 4OKIA 1NXVA 2Q5OA 4LY6A 1IMOA 1IQRA 5ALPA 5L3VA 1VI5A 2ZBPA 1GRQA 1YS9A 2EFJA 2WSBA 3MGGA 3QFHA 4IW3B 5KVSA 4ZQCB 1SOWA 3RUEA 3EXG2 3ER6A 4GWLA 3QV2A 4E11A 2FG6C 4HS4A 1KZ1A 2RHHA 4FVTA 2IBSA 1KYIA 1LH0A 1XLTC 3TOXA 4BDTA 3BMOB 4M7WA 4MQ4A 1FW8A 1ZH6A 2C54A 3IUEA 3EODA 3L1IA 3MD0A 3KB8A 4C29A 5KKAA 4P80A 4E5VA 3EUEA 4ER3A 4L22A 1NQUA 4TWZA 5FF9A 4LMBA 3MPUA 4Q4AB 1EDZA 2BCEA 1C1YA 1YIOA 1L4NA 2CLOB 2FN3A 1MIHA 4W1RA 2OL4A 3UJPA 2CNOA 3A6HA 4AYXA 5JT1A 1X7YA 3IIEA 3NX4A 3MILA 3ZKWB 3B3AA 3OMLA 3P4UA 3R5XA 2RSLA 3JTEA 2HUPA 1POXA 5F77A 1QC5A 1T4MA 4RDCA 3ZE2B 2ZBGA 3DFUA 3EAQA 3I6YA 4ETWA 5JYCA 2QX6A 3EEFA 3TIXB 4K26A 4RXTA 1YL6A 2BZ0A 3PS9A 4JJKA 3AEUB 3NVKI 4ZWNA 1MX1A 2OHHA 2ZBRA 4PSDA 3G9TA 3VDNB 1UXJA 2AJ8A 2B1JA 3D4LA 4DXDA 5DWQA 2J3JA 3ID6C 1Z8FA 1B26A 4IHJF 3CN9A 4OLFA 3R7NA 1K68A 4PRKA 2UUBB 2ZRCA 2ZIGA 1KNQA 1V47A 5HFJA 4YT8A 1DC4A 3U4GA 4DV3B 1FFGA 2Q5QA 1DBVO 2EX1A 3NM4A 5FDFA 4RAOA 3B1WA 5BVGA 3RFXA 3FZGA 5HUJA 4LV5B 4JLAA 3KKQA 1VE9A 5E0KB 5LLSA 3WHKA 4ZAFA 3WWPA 1SCJA 4PFKA 4XWKA 4RSRA 3UVEA 3FI9A 2NSHA 2Q46A 1JUDA 4UU7A 1BG6A 3HKDB 2Z5GA 3ELBA 1WD5A 2JFPA 1NMYA 3MWKA 4QUGA 1MJFA 1PJZA 4D99A 2Z4RA 5KDOA 1AXGA 3QA9A 1X80A 5BYKA 2Y66A 3QY9A 4EHFA 1H6AA 1SHLA 2GTHA 1J24A 3HYNA 3LBFA 3LL7A 2JF0A 4XUCA 5ENDA 3DD5A 4MYSA 5C1IA 1W5AA 4FMDB 3IMEA 1SXGA 4OHRA 2ZS9A 4YPFA 3RS7A 4ALMA 1C30B 1YV9A 4UVHA 3LY9A 1XD8A 3U4AA 3VZDA 2DHCA 4JZKA 4RZUA 2AI3A 5KNCA 1Y8ZA 3ABSB 1YCFA 5EMKA 4DV7B 4ZV9A 2I66A 3IP5A 1FFXA 4X8HA 5IJAA 2OG1A 3ET5A 1YQUA 3FZQA 5B58T 4DWWA 4KQKA 5AP9A 2KLBA 3GLGA 2AUMA 2IEIA 3VH4A 4Q00A 2QRGA 2J7PA 4URWR 3VNQA 1VCNA 4NCAA 4N54A 1HDOA 4IV5A 1CS0A 4EIWA 3DDWA 5JAMA 5JZMA 1XEAA 1RC0A 1UBCA 3N86A 5IYZA 5E4JA 1S89A 2VAPA 3RODA 1JXOA 1EDOA 3DEFA 5CNIA 3RFVA 4HDMB 5BVHB 5CPBA 3HUUA 4YY3B 1DDIA 1AQLA 3I6MA 3KYDA 4HN4B 1NVMB 4IUYA 5E6SA 2HH9A 4KAFA 4DMKA 1LD3A 3AEXA 3ZWVA 2GEUA 3MXOA 4J94A 4CIWA 5MGBA 4YRBA 2QTGA 3D6UA 2VHEA 3CW8X 2HBYA 1V4NA 3K0BA 5ITVA 2XVMA 5E1DA 3VBEA 5DI3B 5ARCA 1KY2A 3LW8A 4WXYB 1S0UA 3P0JA 4R1PA 3IQHX 3WIDA 2VRNA 3UATA 2WSMA 4BBAA 2FW9A 3G0DA 3OEHA 1W85A 4HG2A 5CA1B 2Q3HA 1CD5A 5AT1A 3WGKA 1O2DA 1F4LA 4MP6A 2C7OA 5EMHA 5JVDB 1S9HA 1R9MA 1FK8A 1IVNA 5FNVB 4M9QA 2JFZA 3BXXA 4MPDA 3T3IA 3WX0A 4K9DA 2Z58A 3EWSA 4EKNB 4MV7A 2C04A 5AM4A 4JT2A 1NI3A 4HAZA 2JEYA 3D8HA 4RJLA 4B7CA 1A0OA 4BMOB 1HK7A 2QTHA 3AI7A 3QVLA 4HRVA 1FC0A 1EP1B 1UPTA 1VJDA 1Z0AA 5FXMA 3ZBQA 5FWNA 4DIKA 4DLTA 4Z54A 2GAIA 3HJAA 4NENB 4JJ7A 1ZM2A 4F04A 2DX7A 1D7AA 3VU8A 5B57C 1I3KA 2RI6A 3EVFA 1W87A 1S8FA 3LT2A 4LRXA 4OYLA 3TLCA 1RWXA 3TZEA 1NU6A 3DEJA 2QIPA 3D0OA 1LX7A 4CTJA 4CCAA 1ZN2A 3VR4D 2WIBA 1ENYA 1BXRB 3QUSA 4J2HA 3GT0A 5K7SA 1V3VA 2KJQA 3U7IA 1JG2A 1CBUA 1I2MA 2PWAA 1QZUA 3E7PA 4US0R 5FR2A 5HQ3B 1R0BA 4P2BA 3P19A 3RYTC 4Q01A 3WMWA 1BH6A 4B6SA 2NP6A 1CQPA 1F8YA 4E33A 4C4SA 3CE6A 4WKBA 3W2GA 4Y6GB 1SEPA 2E6UX 2PRZA 2W6ZA 3KSRA 5JI3E 2D13A 3RHZA 1XCJA 1CUSA 2PSSA 3U56A 2RGUA 4B31A 5D84A 4X0EA 3CH7A 1YAJA 5BWBA 2BTEA 1JWBB 1C2TA 5FORA 5EMJA 4YRKA 4HGNA 3WTCA 4QLAA 4YRRA 2EEPA 4ZALA 1MC1A 1Q21A 2DMRA 3OH8A 1K6XA 4MYTA 1IEQA 2B92A 3AX6A 4I6JA 3UMBA 4N76A 4F4UA 3A1CA 2W6NA 3K1YA 1H0RA 1HE8B 1RRCA 1QYRA 5C5EA 2CE7A 1TU0A 1KMCA 3MFYA 5JE8A 2BDTA 3HCOA 1HI9A 4X90A 3JALB 3VHRA 2R7LA 4BJ6A 1W96A 4XUGB 5JJ5A 1OAOC 1JR3E 4HWRA 2AFIE 4RK6A 2QM8A 3RS3A 1Y48E 1PNOA 5C52B 3OAAA 3MRVA 5D00A 5DI9A 1RZVA 1FMFA 2H9IA 3LWZA 2AVDA 3W6ZA 5CDGA 1XPOA 4CIBA 3SVLA 2XIQA 5TQ2A 3RYIB 3WBJA 4YYEA 3ZHZA 1D5WA 3S8YA 4V3CA 3GBSA 4MGYR 2JVJA 4MH0R 1UAYA 3SYKA 1WZEA 4OU4A 3HXQA 4RHUA 1JF8A 2G5PA 1J25A 3ZXIA 1BFDA 2QTVB 4E21A 2AYYA 4E13A 1GGKA 2Y4NA 1CNFA 2H18A 3L4SO 2QTLA 5BV1A 1GKYA 1PEDA 5F73A 1TPZA 3C8ZA 4U1RA 3FIJA 1X7HA 5LMCA 5H3CA 1SCDA 1KEVA 4YQYA 1IHPA 1OC2A 1UM9A 3L79A 4EB6A 1E9DA 4XM1A 4ZVVA 5JEDA 1E6EA 2OLEA 2QR5A 3ANNA 3FAZA 5K0SA 1M66A 3W5BA 1QNFA 1E4EB 1KKMA 3PUZA 4I50F 5J63A 4NYJR 3K0FB 2NNLD 3JWEA 1KK2A 2FPOA 1NDHA 3L05A 3ZWWA 4ZRDA 2OHVA 3LGXA 1XSEA 4RKYA 1LRLA 4R2HA 1J21A 1QYDA 3TMYA 1ENZA 1Q7RA 1GCOA 3ISTA 2ERCA 4RULA 2EFEB 2ZUCA 3U7RA 4CKEB 3RSZA 2K6GA 1EZ4A 2C88A 2J0EA 1O6ZA 3W6PA 3AR9A 4C6TB 4JELA 1ZJZA 1OI4A 3U7QB 4Z7OB 2M9MA 2BONA 3ZXSA 3LK6A 2GWRA 3HU2A 4EG1A 4NJEA 5JFGA 1T5HX 4R6XA 2X8BA 4BKPA 3GAMA 1N5LA 1EFKA 2F1JA 3DDCA 3EVZA 1XPRA 2YXNA 1E2EA 4RD2A 1DHTA 1YJBA 1PT8A 5TQ0A 2BPOA 4OV6B 4IJWA 2Y1WA 5F4BA 4CKYA 1E3EA 3DFIA 2WV9A 1U1DA 5JZOA 2AG5A 1FYVA 1TCVA 1V5GA 3GT7A 2V6FA 5ALYA 5FBRB 1DX4A 2VTBA 4G4JA 1G7CA 1L7EA 3OWXA 4KLRA 3ZNNA 3MBIA 2XMRA 4RCYA 3NWEA 4ZU3A 1T0PA 2OOSA 5JCPA 2H54A 1KO1A 1W0KD 1N7JA 4ZVMA 4EMSA 2J3LA 2FUKA 5D3KA 5K0BA 4M54A 4Z3KA 3WSTA 4QQ8A 3RIHA 3L4KA 1Q57A 2HJGA 1T9ZA 3LIPA 3OEED 1HSZA 2V58A 4RPIA 5G4LA 4INAA 4EAQA 5IJWA 5K0FA 5KEIA 1KR2A 2PRKA 2SECE 1DO2A 3K3PA 3B3QA 1JQEA 1TIPA 2I6GA 1X8XA 2EZUA 4JS0A 4Q1AA 3EVDA 1ZZEA 1L7XA 2W5UA 3AERA 3K0KA 4F6RA 3ICEA 3TXXA 4DB2A 2WILA 1ZHHA 3CLSC 5KNBA 1JIJA 2GM3A 2IEYA 5A0TA 1XNHA 1DO0A 2D1RA 2XZDA 3H9QA 3OC6A 2RKWA 1I6MA 1A77A 2VI5A 2J0SA 4G37A 1ZN8A 2ASEA 3IE1A 1JFFA 4AMZA 1MH9A 4TZ6A 4CBVA 3OIVA 1V9LA 2DP4E 3Q72A 4ZQIA 5J5VA 2AN3A 3CVOA 5ECDA 3PX3A 4LBVA 4XE5A 2VYNA 4GECA 1K8QA 1SXJB 5ISMA 4ID3A 1DI0A 4C7XA 4B73A 1T3SA 3EY9A 3VPGA 1TYAE 1HY3A 4H1WA 5ALXA 2OFXA 2W2LA 5F9HA 1CF4A 4RIHA 4IIUA 4C0WA 4NR0A 3ZZUA 4BBPA 4DC0A 2DR3A 4Q9LA 5B30A 3JSAA 4XCXA 4K9MA 5FULA 2P2DA 5I7AA 4QAQA 2ZJZA 5GGXA 1UL1X 2ZB2A 1J7JA 4HLUA 3IPLA 1AMUA 5L40A 1JQKA 5IUJC 4TYYA 3RUIA 2PX5A 1MBZA 4MEJA 3IEIA 4H0FA 4NYMR 2PD3A 3HGTA 4KP7A 3WGIA 2P9QA 3OG9A 1Y8QB 4KKVA 4AU1A 4BNHA 1R8JA 3L1JA 1H69A 1L4BA 1U2SA 2WJIA 3V1TC 2Z6QA 4ZVLA 3NATA 1I3OA 5IKPA 2ZUVA 4CMCA 3PEVA 1QO9A 3HN7A 4F4CA 1MAUA 1HETA 4JI7B 3MWYW 2ZRAA 3N07A 3UGQA 5JAUA 3E4DA 5D51S 3AR6A 1IM2A 3B48A 3P2MA 3REFA 3RHSA 2F8LA 1ECLA 4JP8A 3QX8A 3INNA 5HCIA 4FB4A 1KMQA 4DA7A 5LQRA 1J5EB 1L8AA 2DWQA 4C3UA 4B3MB 1IATA 3AG5A 1YZ3A 2N42A 2VP9A 3FVQA 3L7NA 4LYFA 2J6HA 1UFQA 1YRAA 3O26A 3OZ7A 4KLNA 5HILA 4JI1B 4BXOB 3F49S 5JS1A 5KVCA 1K97A 2HPAA 2X1VA 3D4BA 1THZA 1OLUB 2GD2A 2JDIA 3OP4A 4ZAVA 3LBHA 1G9XA 3ND5A 3TJMA 3C5EA 2PSDA 1UZLA 5AXDA 5LMUB 3ZWKA 1K9SA 1H4SA 5M29A 1I13A 1TXGA 2IQIA 2PBRA 2HXYA 4HKTA 5ALUA 2FPXA 1SCQA 3C14C 3EVNA 3PI6A 4ARVA 1V8BA 3D7RA 2VF8A 4F46A 2P79A 4WJKB 4O29A 3CNEA 4M9CA 5DHUA 5L6MB 5DASA 1Z6GA 1QFJA 1F6BA 3PQ2A 2AEJA 3F1LA 3U5TA 2CBGA 3PD7A 3U3ZA 5HMLA 1HBJA 1J5XA 2CNWA 2TECE 1LZLA 2OG2A 4WEQA 2GS9A 3TL3A 5B7QA 2HWYA 3AFNA 1ISFA 3ICCA 4HNAB 16PKA 5GMOA 3RVMA 4CM3A 2QT9A 3KOWA 2FPGA 4IFIA 2HL6A 1FA9A 1L9XA 3R20A 5I7HA 4NZNA 1JILA 3HUTA 4TRRA 1YS4A 1J97A 4OHFA 5BXYA 1B2LA 2DTDA 2N1BA 3CKLA 3GJ8A 3DUFA 4OQPA 3RQIA 3A04A 4C76A 3SVTA 1N33B 2QMOA 2PHZA 4ABYA 1LPAB 3IOCA 4EM6A 1YA8A 5HG0A 3B1JA 2Q27A 4DQXA 1Z4MA 3EVTA 1AQIA 2E89A 2Y0CA 2GEVA 4UBLA 4COOA 4B6QA 2FEOA 4DJDC 1CV2A 3LP8A 2LUOA 4B3SB 2ZW9A 3WGNA 4YRCA 1VHTA 2Y9MB 3QW2A 3AP1A 2I2WA 2NZVG 2R44A 4OEHA 5IBPA 1ZRSA 3LFUA 3N8GA 4RGVA 3WAKA 1E7QA 1N2ZA 3BB3A 2JFQA 2MIIA 1TUIA 3B13B 3NNSA 4QDJA 5P8WA 3UF0A 1O0CA 1TK9A 1ZK3A 3FIUA 3WLJA 1FJ2A 4QQFA 3V8MA 3H99A 1FNMA 1IY0A 4O2LA 1EWTA 4N12A 1G5HA 1YRYE 2DSTA 4QKQA 5LL6P 3WKBA 3LF1A 1KAQA 1YNSA 2FE4A 4MV9A 4Q9JA 4GMKA 4R6WA 3F6CA 5L3ZA 2ZWPA 5DMHA 4AN1A 2YW9A 3IYLW 2WU1A 1OBCA 2FK8A 4XUEA 4QC2A 5ULLA 1W9HA 4ZN6A 3PF9A 3Q9NA 1M1YB 3R40A 1V0JA 1RXYA 3FZNA 4UAGA 4WXRA 1PZFA 1Y0BA 1TADA 1IBKB 1EJ2A 3LRPA 1JMKC 1NJ6A 2RGEA 1FLVA 1PT9A 4HLQB 2BHRA 1P44A 4EVQA 3STYA 3AJ9A 1RCFA 2O57A 3H75A 1ZVVA 3UFXA 1JT2A 3GROA 4YP6A 3RAFC 5I7EA 2C5SA 4GUDA 4LDJA 2Q1WA 4GEGA 3KQVA 1NYTA 4KCGA 1V5EA 1ZLXA 4MKRA 2IW1A 1QJCA 4KPEC 5CVVA 1NBHA 1ZO8A 1SELA 3VR5D 3LLMA 3ZIAA 1QM5A 2P77A 1T1SA 4J0QA 3ZY5A 3TKLA 3UW3A 2WFZA 2R96A 5JD3A 2P6RA 5JAIA 3IX7A 2HA7A 1JIXA 1P74A 3FR7A 1QB7A 2I2DA 4GPD1 4QRDA 3TMKA 3ZWBA 1MXHA 1OBOA 4JQSA 1RJGA 2F4VB 3H2JA 1T9BA 2EGUA 3PGA1 3Q9SA 1Y6GA 5AM2A 4XB6B 1KMHA 1G8GA 3RWMB 3KZMA 4D0RA 1F8XA 1FVOA 1GTMA 1E64A 1PK8A 1B0PA 1TAHA 1VIDA 1VP3A 2HIAA 3G23A 1NUQA 4LSZA 5CLLA 3T7KA 2ODTX 1ZNXA 2I2BA 2IOFK 2WKQA 2WUEA 1Z4LA 2HWXA 5CLIA 3QPAA 2A9RA 1QCZA 4XZ3A 2X7JA 3NOQA 2KBEA 1F0NA 2XTZA 1NQTA 4RYLA 1F8FA 3NAZA 2J46A 2PRSA 3WK7A 1KWKA 3LQFA 2OBBA 1I6WA 2YXEA 1E3SA 3V42A 4DLPA 3U7GA 4NV1A 2IC5A 2VCYA 4MVJE 1IY9A 4DA0A 2PU7A 1CUZA 3HXKA 4HWPA 4BE4A 2IYAA 1ZCBA 2D6FA 3ZV5A 3SZ3A 2Y1KA 2O52A 1JHXA 5E7JA 5EIAA 1JPNA 1Z2AA 1ZSYA 3MERA 5JTTA 4Z8XA 1K0UA 4ZDJA 3E53A 3OHSX 1XZGA 3WGJA 3A4YA 2Q6KA 3VM6A 2BMWA 1ZUIA 1RJEA 4GKBA 3JWHA 2JFWA 3VC2A 1XEWX 4GXQA 5TJHA 3R74A 3MRTA 2IDKA 4CM5A 1ADFA 3LWDA 5B2ZA 3ZHCA 2P69A 2XQVA 2CMFA 1ZCFA 5KTMA 1FFEA 2Q3MA 4JHXA 5JHHB 5LIRA 2WYIA 1E59A 3PPXA 4GKJB 2GESA 1NBIA 3CRMA 1WF3A 4LJ4A 1U5AA 2I87A 2FDCA 2CNKA 2ZROA 1IL0A 3WWYA 2QGFA 4O4LA 4E5MA 2ST1A 3RS2A 3ZGVA 4DG5A 2A88A 5FOQA 2FPMA 2NACA 3KQKA 1DIOB 3WAJA 5J2UF 3I9OA 2F7SA 3LBIA 4UMDA 3MRSA 5DCYA 2QSUA 1DEXA 1UKAA 2XRMA 3QLVA 4B3JA 1N7GA 1Z34A 3CW9A 3MCAA 2GT1A 3ZV6A 3ZE6A 3NWOA 4RKRA 1USGA 5A02A 3BMOA 2GDJA 3O9ZA 1Y80A 3N0RA 4JJGA 5A4IS 2HA4A 2C5GA 5H4HA 4OOEA 4H9GA 1AY0A 4HDRB 4KRGA 4GPAA 1QIFA 4FYJA 1N2CE 1SUDA 2WVAA 3ANTA 3KFXA 4QULA 4Q15A 3GJXC 4RVSA 4D92A 1WQ1R 4FE4A 4XGRA 3ZDYB 3BWBA 1MAAA 3H5WA 4Q4AA 3PFCA 4BO4A 3QVGB 1OGYA 1F2UB 3FWNA 1DPFA 4GQAA 1U8TA 4ENQA 5DXAA 3TINA 1NWCA 3MT9A 1P3JA 5EIFA 1GPYA 4NICA 1ISJA 1TEHA 3AF4A 4B82A 1OB5A 5FCDA 2O19A 1FRFS 1OLXB 3EULA 4EYGA 1A4IA 2I2FA 5GVRA 3TYXA 1OH6A 4LRUA 1IE3A 1TGVA 5LNK1 2ESRA 5DEIA 1T8UA 3GNSA 4MI1A 2VJOA 3MD9A 4X44A 2BY4A 4ZK6A 5C1DA 3FLMA 1HLGA 3AXTA 1AA6A 2PIAA 3A36A 3AEUA 3P2YA 3QEOA 4QUBA 5J5CA 3GLFE 4PU0A 2ZE8A 5IP5A 3IV9A 3PWSA 3P0IA 3TTWA 1VC2A 2VIIA 1I4WA 2B34A 3W4KA 4CI9A 3TEMA 2WDZA 1VHQA 4LA4A 4CR8A 3K6SB 3QPWA 1AMNA 2ECPA 4Q1BA 4OO3A 2NVWA 2X4GA 4YAKA 2LCFA 3TOSA 2DFLA 1IZ7A 1EWKA 1I2AA 4KU4A 5FB3A 3SE7A 3FKSD 3EGCA 2QV0A 4AJPA 2H5IA 4I4TB 1DC8A 4B4KA 4JAVC 3I9V6 3F7MA 4HEJA 4PO1A 5J4LA 2NGRA 3OJCA 4NYJQ 2QTAA 2EL7A 1EGQA 2VRCD 1VLJA 2DQSA 4H7JA 4ZANA 1RAIA 2OO5A 2ZI3A 1XN1A 4KGVA 2WF8A 2X6TA 3HKDA 3O91A 1MO2A 2Q4RA 4HT3B 3UPUA 3OCVA 4JP1A 2Z2JA 4WQMA 3VVCA 4BDSA 2XUJA 4RTPA 2ECOA 3GDGA 3ZS9A 4ZP1A 5KX5F 1WXHA 1HMYA 3C3EA 4N0DA 4MW0A 4Z7JA 3A27A 3LPMA 3T4UA 2PKXA 4PCVA 5AJZA 2IGBA 4YCAA 3VI4B 5THQA 5B3JC 4CM4B 4DQKA 5KTOA 4EJSC 3B3FA 4AY5A 2YZNA 3RTEA 1U0EA 4ZZ1A 5LM3A 2XUDA 3L0IB 1H4QA 1X3LA 4IL5A 3JX9A 2IUUA 2OCXA 2WAMA 2BFCB 2XB4A 4G63A 5BY2A 3GJ0A 1USIA 3C3KA 1U8FO 3ZQ4A 2IS4A 2LIVA 3AHGA 1VXRA 2QM7A 2YJTD 1TJ3A 4IWXA 2OGSA 4PLFA 4RFLA 2ZIUB 4UUBA 5C8DA 2ODWA 3KR1A 3H2ZA 3UIEA 5KU7A 4JJIA 4HDMA 1SVKA 4PPYA 4BNYA 5BVHA 3QUBA 5J2TB 3M4ZA 1KH1A 3ZU6A 1FFSA 4LGMA 4BX0A 1UBSB 4FGSA 4P5DA 4OGKA 1KARA 5EHGA 1JI0A 2Q1YA 3PXXA 3FYSA 3JQDA 4LJSA 4NU5A 4QM7A 4WXHA 2VH1A 4WFIA 1GA1A 2V65A 2BCJQ 1YS6A 2VRBA 1IUOA 4IJMA 2GCOA 3ZU3A 2ZXFA 2WTXA 3ZHTA 5DYWA 5BWCA 2R8YA 5CA1A 3C43A 3L8DA 4FGLA 4G5HA 4HNSA 4HMQA 3DOEA 3BD7A 3W5IA 3GDFA 3PGKA 4IS3A 5ARDA 5JVDA 3II6X 4UFOA 1PDVA 3S6JA 3VISA 2QMYA 2Z2KA 3EYWA 3X1ZA 3KKNA 5E8RA 1WZIA 5I9NA 1Q0UA 3GUZA 4KUHA 4MHSA 1QH1B 4HLCA 4V2IA 4CQNA 2ZTLA 2G9UA 1SCUB 1PL8A 5DN9A 5C34B 4W9NC 3L7AA 4NENA 4HFRA 5KS2A 5IT9A 1KJNA 2AG8A 4YONB 1S2IA 2W93A 4QOIA 1S2OA 1FTYA 2O2ZA 2YN0A 2GAFA 1SVMA 2ALJA 3PDIB 1JEEA 3EF3A 5B1SA 4N8DA 1OPRA 3H1BA 4OB6A 4ZDIA 4RTQA 4B32A 3DR3A 1FX0B 3CF6R 3D3WB 4OQNA 4YRJA 3GCDA 3DH0A 2HDOA 4ZHQF 3TTSA 5HQ3A 1H0KA 4O3MA 2WSSD 2C59A 1CQJA 3B85A 2CC2A 4YCCA 1KRWA 2JIBA 2ERYA 2QSYA 2V4ZA 3D6VA 4BU1A 2IE8A 2XMCA 3LXMA 3TFOA 5IRCD 2HO4A 1Z26A 3VOSA 2WTAA 4M1QA 2GCEA 3OT5A 4NYMQ 3VU0A 4DB4A 1IHDA 1A8UA 2N46A 2XGMA 2GAAA 5CFMA 4Z6KA 1UKBA 3VNRA 2BKEA 1ULBA 3PJEA 4RZ2A 5FBHA 3C1AA 1M74A 1G5TA 3HFJA 1C0IA 2ZSUA 3D7MA 2P4EA 2XKAA 2O8DB 3KQTA 2O8EB 1OGJA 3HA5A 1TLFA 5EE1A 3QLJA 3IJ5A 1AGRA 2WJWA 2ZRGA 1UR5A 1X39A 1G20B 3CX6A 3HCRA 4G85A 3TI9A 4TYQA 3HO6A 3JALA 2ZB3A 3UMCA 2C3OA 1A98A 3SS8A 2X2FA 4TYMA 3R7WB 4IVNA 3KWJA 1XU9A 2YUIA 1NLYA 4DY4A 4NE2A 1RQXA 1S3SA 3JQ6A 3W1VA 4Q4JA 3M3HA 3RYIA 4TTAA 3W2TA 4BRZA 3WYNA 2ZJYA 3WDSA 2I4MA 1R74A 2R5FA 4M86A 3SJBA 1CG6A 5AVXA 4AWXA 2O2CA 2VPWA 4JLOA 4GMDA 4JLUA 4OFZA 1OI2A 4GXTA 4KNWA 1SXIA 1NRXA 2R8EA 2YC4C 4DA6A 2X9VA 1Y4UA 3QQPA 4GR9A 2B7LA 5F2KA 3VX3A 3SM9A 5C8VA 3IVGA 5ICSA 1J0EA 5FQOA 5IDVA 1KC3A 2RGBA 4XD2A 3RU7A 4F71A 3WLEA 3QP9A 3SXJA 2H0QA 2WIJA 3OTOB 1O58A 2H5LA 1IJFA 2JJQA 4JLWA 3AFGA 5AKKA 1W35A 2HHLA 3WADA 1TMGE 2PBZA 2PZ8A 3UW1A 1T3LA 3WA6A 2XDQB 2ZU0C 3IUQA 4MK4A 1PJRA 4FNOA 5EG5A 3WNVA 1E4EA 4DCPA 4YXWA 2G0NA 3FTPA 3K0FA 4PAOA 5JPCA 4BBJA 1N4AA 1NMZA 4FTWA 1NNLA 1W5EA 1X1CA 1YVEI 2Q9UA 2QLMA 1NOKA 5C32A 1USUA 2Z83A 5DX1A 2XITA 5IW8A 4ZGGA 4C6SA 5TVKA 1VJ1A 4CKEA 2HKIA 5LJLA 2VHVA 4U0JA 4TWIA 2FZKA 2FMFA 1WW2A 2ZRKA 4JLVA 4UCFA 4C6TA 3D3NA 2QG6A 1V8PA 4AN0A 3V9AA 3DC2A 4CCWA 5LLTA 1SVUA 2RDMA 2QPAA 2AJDA 2XRFA 3HA3A 4EHAA 1T1EA 3O5AA 4GWKA 4GPTA 1M2JA 2G7ZA 3AHIA 4NNJA 3F4KA 1XKTA 3OD5A 4TV8B 5SICE 2VHCA 3R3YA 1XIVA 3ICPA 3T0GA 4F92B 2NXEA 4ACAA 1UBJS 1RI5A 3D2BA 5F7ZA 3TH5A 2YZGA 3OQMA 3FPAA 1RVV1 4M46A 1XZQA 2P5TB 3SK0A 1G2OA 2J45A 3Q11A 4XX1A 3EA5A 4KRXA 1Z6PA 1ZGCA 2Q0HA 3WQSB 4MUNA 1SK9A 1O94C 1GARA 2BVNA 1PL7A 4B2YA 4IIFA 4G36A 4FGKA 3RQSA 1C7EA 1YR1A 2WSIA 1NPYA 1H2ZA 3BHMA 3S5JA 2IPMA 3ISJA 3F0TA 3ZBUA 4E2YA 2BEJA 2QYHA 1C7JA 3DEHA 3FSRA 4MLPA 4PTYA 1IB6A 5IF3A 1P4JA 3WSVA 3GVHA 2GFIA 4MQEA 2OHXA 4WFKA 3EZ2A 3PVZA 3FTQA 4GX2A 4YDSA