1DAKA

Dethiobiotin synthetase from escherichia coli, complex reaction intermediate adp and mixed anhydride
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
224
structure length
224
Chain Sequence
SKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSEKTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINLALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DETHIOBIOTIN SYNTHETASE
publication title Snapshot of a phosphorylated substrate intermediate by kinetic crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 75
structure length 224
sequence length 224
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 1998-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dakA00
1UDWA 4IOKA 5AJXA 1II8A 3GFPA 1I2MA 1EWQA 4AC9A 1K5DA 3NHAA 4DKXA 4DXAA 4BPBA 1X6VA 2EWVA 1CBUA 4LRWA 2HUPA 1JAIA 5J4VA 2ZI3A 2IWRA 3RSLA 1GIAA 4H1UA 1D2NA 2O8BB 4HLDA 4NYMR 2IYTA 1S9DA 1U8ZA 1A1VA 4LSGA 1G18A 3B1XA 4WAUA 5FOTA 2ZI5A 3UWKA 1JR6A 1E3MA 2F1HA 5G41A 5CJ2A 3B5JA 3FKQA 1OT3A 1HV8A 1OYWA 3NBYC 3RANA 2ONJA 1AIPA 2QROA 4M9ZA 5JSZB 2J7PA 1MRSA 2CHVA 1MH1A 1OIWA 1S2MA 2WPDA 1HUQA 3H2YA 1DAEA 1KIMA 3FVQA 2Z4SA 1DAHA 1VHTA 4NYJR 4NTZA 3T06B 2W2VA 1SVLA 1E32A 4D25A 1TEVA 2HT6A 3P4XA 3BS4A 4F38A 4XD7A 1ZMXA 1OLOA 4LYHA 1NIPA 2GAOA 2WAXA 4G5OA 4HAUA 1AQUA 5JRJA 4QG7A 3ZZ0A 2E87A 1CTQA 4QBGB 3R20A 1N25A 4BUJA 3MFYA 4JBXA 2PZGA 2V7QD 5KSPA 4F4CA 4BQSA 1E2FA 1QBKC 2RB4A 4Q18A 3MWJA 3NC0C 4TL6A 1E2DA 5JZVA 2PH1A 1E79A 1OHHD 3CKLA 4PC1A 5L8VA 4JVMA 1II8B 2F3TA 2HDNB 4DUGD 3NBFA 1KHTA 2FSIA 1XJQA 1X8KA 4IOLA 3P20A 1OPXA 4Z51A 4BLRA 4QXAA 1EG7A 2A9KA 2VHJA 4LYJA 1P9RA 3SJCA 5GVSA 5F98A 3NXSA 1T6NA 4B32A 1ZD1A 1IQPA 4RD1A 3AVUA 2ZR7A 3ZS8A 4JZKA 4RD6A 1QHXA 4RCZA 1P9WA 1CJTC 1VG0B 5CITA 2J87A 3MJRA 1E2MA 1Q1ZA 5G3ZA 4HEJA 1HH4A 3B85A 2ORVA 3GLIA 1A2BA 4LWZA 2IUUA 1WCV1 3CF0A 3AVPA 5DN6A 1GRNA 2XEXA 3MRSA 4S2EA 2GTPA 3BERA 2NG1A 1P2SA 4EIWA 4Q7MB 2BMEA 1QRAA 3GP8A 4JS0A 4MH0R 4US1R 3HU3A 1E0AA 2OSBA 4MYUA 4FN5A 5JHHB 3Q72A 5HKKD 2PMKA 5AJVB 3KQNA 4MDFA 4M1KA 3AVTA 2XTNA 4XSHA 3THOA 2NO1A 2P2LA 1NVVR 4MRPA 4Q02A 5G3YA 4LPSA 4XSGA 1IJFA 1NMZA 3W3AA 3BB4A 4DEXA 4OI1A 3TH5A 5JHGB 2FGJA 1FOEB 3EZFA 2A30A 2EFCB 2HLDA 4RFVA 3TNFA 3GFOA 3QBTA 2OAP1 2QE7A 1SVOA 3OIWA 3V00A 3CPHA 2E9SA 1IAQA 2ZUDA 1Q1BA 3BH7A 1MR3F 3QIAA 2QTHA 2D7CA 4B2PA 4PAQA 1G8PA 2VP6A 1ESMA 5JWRA 4V0ME 1M2OB 2DWPA 2VP0A 2BCGY 4D4LA 4ZKEA 2XZOA 4AWXA 5F3WB 4FMDB 1TQ6A 1AN0A 4DCUA 2R2AA 2JA1A 3JVVA 4IHQA 4KU4A 4AIIA 2VBCA 4I81A 2WWIA 3U3KA 5SZIA 4NONA 4PPQA 3QKUA 1DAMA 4Q4JA 2WJJA 1WMSA 4HAZA 4JLBA 4OJKA 1IY0A 1KDOA 1RJ9A 2LCFA 3MAAC 1H8ED 4TLCA 3TJZA 4R2HA 3WMGA 1EESA 2VRWA 1E2HA 3CPEA 3UATA 4E22A 3PG5A 1Z3IX 4OK6A 1GNPA 3VMFA 3ZQ6A 3OIUA 4TWZA 3SNHA 3IPYA 2F55A 2EW1A 3I4LA 2W2XA 4OHVA 3OEHD 4A0GA 1UBGA 3A36A 1GRRA 1D2MA 3S1AB 4RD0A 4UNPA 4F4JA 1QHHA 4G5RA 3KQHA 1JR3E 3FKSA 4PZLA 4Q21A 3RNLA 2GK6A 4JVLA 1W2GA 1Z0JA 2WJIA 1Q1QA 1GKUB 2W58A 4JYBA 3ECCA 3T12A 1DO2A 1CR4A 4B3FX 4ERNA 4ZV4A 3FWYA 1XU4A 2FEMA 4LBVA 4C7OA 3GPLA 3CRMA 4JJZA 3FDIA 4B43A 5KU1A 1KO1A 2Z4RA 4HB4A 4MYCA 4A2WA 3WP0A 4FMBB 4HDOB 3DM5A 3TAHA 4B6EA 3U3RA 1TF2A 1Z5ZA 4PO1A 4EQ6A 1IXRC 2PBRA 4QRHA 1GDDA 1T8TA 3KXLA 2XGJA 2V9PA 3I5XA 3AV0B 4FCTA 2JASA 3NTUA 1TL7C 5AR1A 2BEKA 3QENA 1JAHA 4Q4JB 1G8FA 2VTKA 4KSBA 4F93B 3OEEA 2H7VA 1RJ9B 4A0RA 2RGAA 3OIYA 4US0R 1YZUA 1M7BA 3IO3A 3NEJA 4PSVA 2FOLA 3B2EA 4MGIR 2O8FB 3SZRA 4JKYA 2VP9A 3GLGA 4DLZA 2AD1A 1AA9A 4OBEA 3K9LA 3UK6A 1ZRHA 1OH8A 2XOKD 3K0AA 1XPOA 1KO7A 2QMHA 4TMVA 2HV8A 1Z28A 4G01B 2ORWA 1D9ZA 3BXZA 2VL7A 1QHHB 3DM9B 4V0MA 5JBQA 4FMCB 2C9CA 4MA4A 3VQTA 3AP2A 5IK2A 1YRAA 3FMFA 3TUIC 4QKQA 3EZ2A 3T61A 1BMFA 3EARA 4TYQA 2RGDA 2V4ZA 2CEAA 4QGGA 3BFVA 3A58B 4CEHA 5EZ6B 1R6BX 4HDCA 5TVKA 4HSEA 4URWR 3HPQA 1VDZA 2IWHA 3THYA 1SXJD 4PC7A 3QF4A 1OFIA 2ATXA 4U5XA 4Q00A 2AN9A 1DG1G 2V1XA 421PA 3RS4A 2QGZA 2RAPA 3P1JA 1W48A 4DB4A 1JEEA 3GD7A 1NIJA 3SC3A 5E7IA 2QAJA 4E5UA 1G6HA 3QY0A 1GNQA 4K81B 2IYRA 2QL6A 3KKMA 2GVDC 4KI0A 5JRZA 2AX4A 1G8GA 2FPMA 2XB2A 3AUXA 5UKDA 2JLWA 3C5HA 4QGAA 4Q7KA 1Q20A 4IEIA 1Q12A 4PHFA 5DSZA 1JR3A 4IEEA 3I61A 4A0HA 1FZQA 2ZRIA 2ZJOA 4PPNA 1E9FA 4Q01A 2DR3A 2GJSA 1U0LA 1VG8A 4HZIA 1BOFA 5EXTA 3HR7A 2PCLA 1CJUC 4HAXA 1R4AA 1FTSA 2QRZA 4DLUA 4KFRA 4RZ3A 6Q21A 3GLGB 3ASYA 1Z0DA 4IXMA 3U2QA 4CDGA 3I32A 2ZRFA 4IVQA 1RZ3A 1YU9A 1KJZA 3ZVMA 2QQEA 2C8VA 3A1WA 3OESA 1W36B 2GAAA 3WNDA 2HCBA 4LYFA 3AQ4A 1ZYUA 3LLUA 4K8OA 1BS1A 3GJ8A 2ZAMA 3BIFA 5E4FA 4O3MA 4IDNA 2GILA 4RCYA 3IUYA 1Z6YA 1EWRA 3CWZA 2ZEJA 1OFHA 2OBLA 3UANA 2FPKA 4B75A 3AF2A 3EA0A 4Z1MD 5JWOA 4PHHA 5TY0A 4ARZA 3AVWA 4LJ6A 3TQFA 2RGNC 5HZKA 2V7QA 5F9FA 1F2UB 2H5EA 1ZNWA 3HYRA 3PUZA 1GNRA 3QF4B 3DOEA 2ASEA 2ZJYA 3ZJYA 3BAFA 1UKVY 1OHHA 4EJSC 2D62A 1XX6A 2BKUA 1JB1A 2IYLD 3K1JA 3KZ1E 1KMHB 4BZPA 3RC3A 3I5YA 2WPDD 3K0EA 2A5GA 4LPKA 4HLCA 3LLMA 2BVNA 1GSIA 1KJYA 3WYFA 2RH5A 2DPXA 3A4LA 3L0SA 5HZHA 5JCPA 4OQNA 2E1RA 4XD7D 1MO4A 2GCOA 1UBCA 1OFUX 4WXPA 2WKRA 1GITA 3BH0A 2EFGA 4AK9A 3ONWA 3OHMA 4GNKA 2OM2A 4RD3A 1R8QA 5KSZA 2JLYA 1SHKA 3CRQA 2IEZA 3OIVA 4B74A 5F2EA 2KE5A 1Z07A 4ZDJA 1RRGA 1GUAA 4NCNA 4PPFA 1LS6A 5HR5A 2PLFA 1Z47A 4O2RA 2FFQA 3LW8A 3LVRE 2ZETA 2PLRA 3ETLA 3NHBA 1EFRD 2VHQA 5HKKA 2OESA 2ZS7A 3IO5A 2BDTA 3PITA 2FX3A 1HT2E 1FMLA 2FSFA 5IDVA 1LTQA 3U3JA 2VSOA 2TMKA 1A82A 4NL4H 4D2IA 3R9IA 1Z0IA 5CM8B 1ZCAA 2ZRGA 4M1WA 3T1QA 1P2TA 3HPRA 5AJYA 1VYVA 3U6KA 2JLXA 4QHYA 4NYIQ 4KV9A 2BWJA 1VCMA 1PJRA 2FG5A 3QF7A 3B60A 1W0JA 5FTMA 4GL2A 3LX8A 1EGAA 2WSSA 4PZYA 1M1YE 2GF9A 4JL8A 5ANRB 4BLOA 5JFGA 4Y0VA 1CF4A 4Q1CA 3NBZC 4DWJA 1W46A 2GCOB 2P0EA 4I1OA 1GWNA 3WYGA 4CF7A 4KHZA 3GLFA 3AKCA 4ASUA 5JEEA 2ZITA 4KVGA 4LJ7A 4OYHA 4TMTA 1U0JA 4GOKA 1N6RA 1BKDR 3TLXA 2OE2A 3MD0A 4M2LA 2HLDD 2HF8A 4RFSA 2EWWA 5C18A 4IVPA 5EQTA 1ZP6A 2BKEA 2ZVQX 5E95A 4LHWA 4C3ZA 1H8EA 1UAAA 1N5KA 4TLAA 1YZGA 1WRBA 1KKMA 2JCSA 4M21A 3Q7PA 4HZUA 5EP2A 721PA 1U98A 2W83A 1COWA 2QU8A 4D6PA 4C2UA 5FBLB 2GXUA 3QQ5A 1YZQA 3L43A 4TLBA 4G0NA 4C9BA 3DMDA 2RKOA 3TW8B 3PJRA 3GJ5A 3L0OA 4ZCMA 4BFZA 3KXKA 1E2JA 4MKIA 3DVLA 1ZIPA 3P4YA 2QNRA 4NCJA 1NSTA 4QBFA 2IUSA 3RYTC 3AP1A 1W0KA 3DKVA 4PSKA 3KQLA 4CEIA 2A5DA 3CONA 2OFWA 4Q4HA 3QSYA 3GMTA 3A1UA 3ASZA 3VNUA 3LX5A 2FWRA 1NSFA 2VEDA 3B9QA 4GT1A 1ZCBA 1KO8A 4OQMA 3UMRA 5J4HA 2BBWA 1PZNA 3MJHA 5FFMA 1W44A 4F92B 3BFXA 4Q7JB 1NN3A 3SFVA 4DCTA 4LV8B 1DTSA 5FBWB 1AJEA 5K8IA 3GLFB 1XMVA 3MLEA 2O52A 1Q3HA 3X1WA 2JAQA 2G1KA 3G0HA 3TR5A 4GZLA 3GFTA 3ADDA 4JKIA 2GBLC 1HY3A 3T15A 4LHXA 5AJWA 3CNLA 4QBIA 4N0DA 4L9SA 2YOGA 3EIQA 1AKYA 2K5UA 3FKSD 1KTVA 1KZ7B 2F1IA 3QXHA 4RFSB 3SEAA 3T1OA 2ERXA 2CHQA 1GKYA 4WVFA 1OYYA 4B48A 3ZGXA 5LD2B 2ZPTX 2PL3A 2QQ0A 2YNMA 2BMFA 5AWFC 1OSNA 1E2LA 4LHZA 3J81k 4BFTA 3AF0A 2BJVA 4H9GA 1E2PA 2XZPA 4K46A 2VP4A 2YINC 3QG1A 2XOKA 4EFMA 3AKYA 2QP3A 4TZ0A 3GJ6A 4MITA 4JT2A 4MUBA 1SVSA 5GADl 3U7FB 2ZJ5A 4XJXA 1II0A 1T0HB 4JLNA 3P26A 4URXR 3NBXX 1Y3AA 3KL4A 3BB3A 3CNOA 4QGHA 2ZREA 1S3SA 4CVNA 2IXEA 3LQQA 4YXWA 3RS3A 2XTMA 4Q4HB 2H16A 4FW9A 2ZJ2A 1VYUA 4PC6A 2Q9AA 3SJZA 2BJWA 1XBTA 4D4KA 3U44A 1JJVA 2R6AA 5DGXA 1T8UA 1NLFA 4RZXA 2WAYA 4NHOA 3X1XA 1OH5A 4FINA 2KWIA 3CO5A 1N6LA 2IYUA 2C99A 1GVNB 4B76A 4JLJA 1SKYB 4BRUA 3X1YA 2IYXA 2LKCA 1E4VA 3R9XA 2ZRNA 3QPWA 4B3CA 5JS8A 1NJGA 2G0TA 4DBLC 1QVRA 2CLCX 4NMMA 1HE8B 2R6DA 4I1SA 4ZI3A 1EX6A 3H86A 3AF1A 3I92A 4BEBA 1KNXA 3CH4B 5IK2D 4NDZA 1D6JA 3LXRA 4CIDA 4Q48A 1G5PA 3LXXA 5DI3A 1YR6A 4LUCA 1BMFD 1TNDA 3GCGA 1OF1A 5B2ZA 4GDFA 1KDTA 4KLNA 3TGPA 2NTYC 1Q22A 4ABYA 2EFHB 5SZKB 2EU8A 2QAGC 3AF4A 1JALA 3WHLA 1SVIA 1NMYA 1TF7A 1WXQA 1G21E 1XMIA 1C1YA 3C5CA 1TQDA 3NIBA 4PAOA 1OH7A 3ICQB 1YVDA 5BQ5A 3LQRA 2I1VB 2Q9CA 3HJNA 4PO8A 4B71A 1Q21A 1SKQA 3LD9A 1QHYA 3OE7D 4TYPA 4GPTA 1UDXA 4DLVA 1QHNA 4LBWA 4XOIA 1CJVC 1KZGB 1T3SA 3QBVA 2V6JA 3EG5A 4BLSA 1P60A 1KSGA 4AY2A 1SULA 2ZJ8A 4UXJA 1JQLB 1XD9A 4Q9JA 4ZDIA 1E0SA 3CRW1 2GEVA 3RS5A 4AG6A 4KFUA 2JJ1D 1PLLA 3B1WA 1M7HA 4Z1MA 3FYHA 4QHTA 4JSTA 4ZCLA 2EQBA 4B6FA 1CXZA 2DFTA 1K8RA 1JR3D 4UXIA 5FBRB 1Z6AA 3K70C 3KUCA 4EKDA 1W4BA 2V54A 1BYUA 1SHZA 3PVSA 1E9AA 1RIFA 1SXJB 4TMKA 1Z2AA 4TSFA 2B8WA 3GEEA 1W5SA 1OB2A 3W90A 4JYCA 3M1IA 5JCZA 5LDDC 2YJTD 2J45A 2XNSA 3FE2A 3I3SR 4YC7A 4YDHB 3A4MA 3K09C 5JECA 4Q9IA 3BOSA 4UNSA 3LNCA 1YJ5A 2IYYA 3R7WA 3IILA 4AI6A 5EE5B 1OW3B 4D0GA 4B44A 1WBBA 3ADKA 5DI3B 4C30A 2WJYA 4QNRA 4BFSA 3GEHA 4LC1A 2O8DA 5J47A 3DEFA 2AD5A 2OCBA 3ZDQA 1NVUQ 1RYFA 4M1SA 2OLKA 3QVVA 1R5BA 1GFIA 1DS6A 2CBZA 2FFAA 2PX0A 3X1DA 4DIDA 1HQCA 1KKLA 1S4QA 3EW9A 2G77B 2H92A 4Q1EA 4UNRA 3EX7C 1KI2A 2D2EA 1FNNA 3TIFA 1X1SA 1NL3A 2X2EA 2DBYA 1E9CA 2QORA 2LKDA 3TBKA 3LBIA 3TVTA 1FQJA 1G3QA 4WOPA 4DDTA 1LNZA 4PHGA 4RKFA 4IDOA 1EFRA 3M4YA 4Q9KA 5AK0A 5EXSA 3KQKA 1XPRA 1IN7A 1R0YA 1GG2A 4L4UA 4NBSA 4HUTA 1FMJA 2QT0A 3CLVA 2XB4A 2H8KA 4LHVA 3U3OA 4GSYA 4PANA 3A6PC 1Z6GA 3SR0A 3IPXA 3CZPA 1ZNZA 1FX0A 5F9HA 5FOXA 3IGFA 4NYIR 3SOPA 1HEIA 2QAGA 4BECA 2IHYA 1YZKA 4F4IA 2IYVA 2FJUA 2P5TB 3LRPA 1LB1B 4V0OA 2J59A 1XJ0A 3GJXC 4BRWA 1KY3A 2ZYVX 3TR0A 3TSWA 1FW6A 3MG9A 4KITB 2ZAOA 2ZTSA 3FTQA 4GRAA 4NU0A 5EE9A 3RS2A 3REFA 1IN6A 3RRMA 4C0LA 3R7WB 4LJYA 3ICEA 3TKLA 4C0JA 2Z43A 4MKHA 4XTRA 3R8CA 2HXSA 3O8RA 1HE1C 3DPUA 3UIEA 2VLIA 3FHTA 4ZCIA 1ZU4A 2O8DB 3O8BA 5EE3A 3EWSA 1NY5A 4US2R 2XXAA 4KODA 1XP8A 4A8JC 2IXFA 4C0QC 2DCUA 4QM6A 1E69A 1P5ZB 2HXYA 1LV7A 2R6GA 2Z5FA 4M0LA 2LWIA 3K8YA 2Z6VA 4Q5IA 5A0FA 4A6XA 2CVFA 2KBEA 4HAWA 1KOFA 1JBKA 1W0JD 1E99A 1N6KA 3CX7A 5DIFA 2WSSD 1W4CA 2OHFA 2Q6TA 4ON9A 4I4LA 4QJ3A 1N6NA 1BH2A 2AWNA 2QTFA 5CIQA 2CNWA 1NN0A 2W6JD 3W8NA 4Q1DA 1G19A 2OBMA 1RFLA 3PENA 4ASUD 1A5TA 4W5JA 3LY5A 4HUQA 2ZXUA 3NKVA 4XTCS 4OK5A 1ZINA 3GLIB 4XIGS 4OL0A 2CLSA 1NLYA 4J0QA 2UZIR 4BEJA 2ZRJA 1XTJA 3QKTA 1UF9A 1Z6TA 4YMTA 1AM4D 4EPYA 4MUAA 3ZVLA 2UKDA 4Q4LA 2JLZA 1NF3A 2QA5A 2NO9A 2ORIA 5FUWA 1W1WA 2NGRA 3W6NA 2ZANA 1DPFA 4B2IA 3CB4A 5HCIA 4LDJA 5SZHB 3LBHA 3CW2A 3RABA 4ZKDA 2D4HA 1COWD 1KSHA 1P7CA 1ZW6A 4LC0A 4EPVA 2B8TA 1LFDB 4AG5A 4C0KA 3VKGA 2RCNA 1RRPA 3K9HA 5DI9A 1ODFA 4CRWB 5D3QA 4BLPA 1QG4A 5J4KA 3RLFA 5FPKA 5HTKA 2WKPA 2ZE6A 2XITA 2ZYUX 4Q7LA 5C1BA 1AKEA 1KK2A 2YWGA 3QXSA 1WQ1R 1W0KD 3VR3A 4IXNA 2IHBA 4ZIRA 5FUYA 4ITRC 4YONB 3UWOA 1F48A 4G3XA 4OI4A 1R10A 3AB3A 3NH6A 4IFBA 1P4SA 4POAA 5D3MA 5CDFE 4TYNA 3HU1A 2NZJA 4IFEA 4A8JA 2WZQA 4WZBE 2DWQA 1U2RA 2QTVB 2OO7A 2FZ4A 2B6HA 1GOTA 2IS4A 4G1UC 5SZJA 5M04A 1XXHE 4YMVA 5JWHA 3ZZUA 2ZSEA 1RPZA 3WNCA 1MRNA 2OFOA 2G1JA 2QPOA 2IUTA 4HUQB 3AM1A 2GK7A 1IXZA 4TQUS 1QZXA 3W5JA 1ZM7A 4E03A 1N3BA 2ZIAA 1ZC3A 1IXSB 5AUQA 2QP9X 4LJ9A 3W5IA 2I3BA 4XVQA 5GVRA 5B57C 3FB4A 2HJGA 2FEOA 1C4OA 1MT0A 5FPHA 4U7DA 4B34A 3KJIA 3X1ZA 4D0LB 4MKGA 2VF8A 2OAQ1 3HYTA 2QBYA 1DVRA 2C78A 4OKSA 4E09A 4M53A 3Q8XB 1XJCA 1KY2A 3AKEA 2ATVA 3KJEA 4TTPA 1DO0A 3NC1C 3D6TB 1VCNA 1DARA 1EFHA 2MSCB 3E5HA 4HB0A 1I4DD 1P9NA 3IHWA 3SE0A 4DC9A 1UBEA 5DYIA 1S96A 4L5BA 2AKAB 4V02A 4DRZA 4YXWD 4OI2A 2FE4A 1TMKA 3WBJA 1OV4A 3EZ7A 4Q47A 4ZIRB 1G7CA 2ZS8A 3GLHE 3IEUA 4URVR 2NMVA 3NDBB 1GRQA 5KDDA 4C7OB 2RGBA 4QFMA 3ADBA 2GXQA 5EJEA 4D0NA 4JSYA 3VX4A 4MQBA 3LBNA 2BIFA 4A8JB 3T1VA 2KBFA 2JEOA 1G6OA 5FBVB 2JDID 2ZRCA 5BWMA 4M22A 3OE7A 4EQ6B 2QSZA 1F60A 1UEIA 4U00A 4LK2A 4JLDA 2QN6A 1NBMD 1J70A 1KSJA 5ELXA 4L15A 5FR2A 2ANBA 1J7KA 2JLRA 3QNUA 4TMZA 3SS8A 1TPZA 4PZZA 2JJ1A 2XZLA 3QG5A 3SJAA 2FSGA 1Z8FA 2IYSA 2VSXA 2ZU6A 4WW0A 3C8UA 1KO5A 2VYFA 3SDZA 4DCVA 2NZ8A 1H65A 1NJFA 2FV8A 4GBMA 3H84A 2GZHA 2QRNA 2J41A 1Q3TA 3FPAA 3R9WA 2QBYB 1DAKA 3K0AB 3U7HB 1UFQA 3QPUA 3M0EA 1A4RA 2ZE8A 4Z8YA 5CDFA 2Q3FA 4KAXA 4L9WA 4TL8A 3BFKA 2A5JA 3ZD6A 1HT1E 3CPJB 3H1TA 4GP7A 3WP1B 2DFLA 5H8WA 1QVAA 5E3HA 1T3LA 3NEYA 2PJRA 1XTRA 3WRYC 3SHWA 1XXHA 2OCAA 4JL6A 3Q7QA 4MKFA 221PA 1F2TA 2PMDA 1Z0AA 5L3QA 3QEJA 2OV2A 4KFTA 5FL7D 4V03A 2FPLA 5KPJA 4CEHB 3E2IA 4PQYA 1QHSA 4UKDA 4DDWA 1YHNA 1TAGA 3C41J 4DZZA 3THYB 2R8RA 2ZR0A 5JI3E 3AGQA 2P65A 4MRVA 3DHWC 4TSFD 3CBQA 2N1BA 4KO8A 2VP2A 3QXJA 1GZSA 2MMGA 3EZ9A 1ANKA 4B35A 1AGRA 1JNYA 2IYQA 4IDPA 3E1SA 3FHCB 1GM5A 3VFDA 2QM7A 4FCVA 1R0XA 3SBDA 4MDEA 4KYIB 3UPUA 2OLJA 4ZO4A 3LW7A 5FR1A 3HWSA 4A2QA 3RRYA 1YR8A 3HU2A 4BFWA 2H17A 2WWWA 3N5CA 2KSQA 3EPHA 4RJLA 3PEUA 5BYKA 5KNBA 1OE0A 4GZMA 3TAUA 3V4RA 5JJIA 2J0VA 1E9RA 3AVOA 3IIJA 2B21A 3AVXA 3AF3A 1W2HA 2FSHA 2Q21A 5BXQC 2PEZA 2O8CA 5TDHA 1XCGB 1L2TA 2AK2A 2IT1A 4EUNA 1Q57A 1E2IA 1HTWA 3C16C 2VHUA 1US8A 3U3MA 1OIVA 1ZNYA 3CRRA 3KFVA 4W9MC 2NQ2C 1OKKA 1XRJA 2BC9A 3H4MA 5GJBA 4WBSA 2OBNA 2FF7A 1BYIA 1G9XA 2DWOA 3CH5A 1IONA 1GKIA 1JXOA 1V5WA 2BM0A 3NVAA 4HAVA 4JLKA 5P21A 3ZVRA 3KUDA 4LYAA 4PTLA 4DLRA 4NKRA 4DDUA 1JPJA 4HB3A 1XXHB 5CYPA 3X2SA 2GNOA 2P67A 2IBMA 4YLGA 1ZM3A 1ZD8A 1JPNA 1OIXA 1F2TB 5L3QB 2WJGA 4ARZB 4NCKA 3C15C 4C0HA 1XZQA 3T5GA 5EUMA 2YHSA 4AKGA 4I99A 4PR0A 4AKHA 1LVGA 4QC2A 3A8TA 1YR9A 4DIEA 2C98A 1CRQA 3D3QA 3TSOA 3MWKA 4LHYA 1EK0A 5DNYB 3K0SA 1U9IC 5KNCA 4JLAA 1L7VC 1T9HA 2CE7A 2N46A 2QUZA 4HLQB 1KAGA 1H8HA 4MYHA 4EDHA 2FDCA 1TQ2A 1E9SA 1G5TA 1GL9B 4XWKA 5HE8A 4V0NA 5KOYA 3AUYA 1EFCA 4WZAE 2X77A 1E0JA 5HCNA 1TU4A 2GKSA 5HPYB 2G0NA 2OILA 2P6UA 4XH9B 2V1UA 2C9YA 2Q3MA 2QPAA 2GVZC 4JBWA 3TUJC 2W6JA 4TLEA 3K70D 2RGNA 5KNDA 2VQSA 3U7EB 3KKPA 4KVAA 3MUFA 1XCMA 2O8CB 1FUUA 4P0TA 1WA5A 2VPPA 1YE8A 1VMAA 3L8YA 4D80A 4RZ2A 4EJSA 2AXPA 1Z08A 3G5UA 1US8B 3DMNA 2J0UA 3SN6A 3KQUA 2XSZA 2YC4C 4JVSB 1FP6A 1DELA 3UXMA 4GFDA 1FL9A 2CLDX 1JECA 1FFHA 1M74A 4DCNA 1N2CE 2Z0MA 1P2UA 1PLKA 3FMOB 1G7SA 4HI0E 4JIMA 4WXRA 5B58C 2ZRDA 2EYUA 3QXCA 2AXNA 3VR1A 3OFNA 1NBME 1Z2CA 4LJ5A 2OT3B 1Z6XA 2CNWD 1XF9A 1E9BA 1NVVQ 1CJKC 3U4QA 1Z63A 1DEKA 4R98A 2VA8A 4HB2A 4EFLA 3SJBA 4GMDA 5C4MA 5AUOB 2VSFA 4URYR 4Q9LA 5J4LA 1ZUNB 3PUVA 5K8TA 1CRPA 1KMQA 1G1MA 2R62A 3EWAA 2GRJA 4M9QA 4DCSA 1MOZA 3P27A 4TMWA 4WA7A 2BCJQ 3Q85A 5K8UA 3LVQE 3VR5A 2CDNA 1GP2A 2WWFA 5J4YA 4UNQA 4PQRA 3D7MA 1L8QA 2O5VA 1E9EA 2NO6A 1IN4A 3AEZA 4HATA 4OQFA 3TVDA 4DLWA 5GJCA 2GJAA 5IT5A 4DLXA 5KDOA 3U7GA 2WWYA 1XMJA 3EXAA 3LA6A 4DDVA 1RE0A 1L4UA 1M8PA 3T1TA 1XTSA 4RD4A 1OFTA 1KO4A 4Q1AA 4KXFB 1TF5A 4ZDWA 5CB8A 1ETUA 2B92A 2CCKA 1XCPA 1GAJA 3K9NA 1R2QA 1HYQA 3PV0A 4JLPA 4EJSB 5B30A 2YWHA 3DDCA 1NVWQ 2IXGA 3C14C 1P73A 4H1VA 5GJWC 1M7GA 2G83A 4A4DA 5CYOA 3MSXA 2ODEA 3WYAA 2QZ4A 1JEDA 3SYLA 2HF9A 3AKDA 2BBSA 2Q9BA 1XB2A 2REXB 4HZUB 2HJVA 3W3ZB 4HYYA 4HAYA 1KI6A 1LW7A 5FTKA 5BYJA 3U4QB 1M34E 3VNVA 1NN1A 3KDSE 3SYNA 1KI3A 5G53C 1KI8A 4V0LA 2OFXA 2C04A 1I2DA 2GA8A 2QMEA 3C7KA 5FPSA 3QVUA 3A37A 1T3HA 4TQAA 1RVDA 1IY2A 4IW3B 3KKQA 4PC3A 2OZEA 2ZU0C 1J90A 4CEIB 4B33A 4P4UA 1U81A 2OEPA 1CR0A 1OXXK 1S9HA 3KB2A 4QOSA 3RHFA 2RHMA 4BFVA 2CJWA 1Z06A 3VU9A 5KSOA 3EIHA 4UJ5A 1M6NA 4M1MA 1T0JB 2DY1A 1NMXA 2DYKA 4RY2A 3U61B 2O0KA 4KJZA 4IRUB 3RWMB 2YKGA 3TK1A 4KSCA 1E94E 2JDIA 1IJEA 4C0BA 1XEWX 5KTYA 1UBFA 4BWYA 1R8SA 4LBZA 1I4TD 4M1OA 5FPYA 1ZBDA 4TL7A 3OZXA 4FWIB 3SYKA 3ZIAA 1NBMA 2CL6X 2Q0HA 1KI4A 3IDQA 1W4RA 2XTZA 3JZAA 1SVMA 4N1AA 3HP1A 1RYHA 3O8CA 3WXMA 1CULC 3TSZA 2IK8A 4UXHA 4EAQA 4LY6A 3CM0A 4BZXA 4LCBA 3B6EA 5FOWA 3SU8A 5KSYA 2GCPA 1WB9A 1QHGA 2ZVPX 4ILEA 3I8XA 2VHTA 3IBGA 2AHOA 1KI6B 1OJLA 2R65A 2GBLA 2GESA 4MYTA 2QGNA 2W6IA 2VF7A 2ZM5A 1Q1EA 1DADA 2XX3A 1E96A 2F3RA 3CR8A 5DYGA 3RS0A 4R7ZA 3TQCA 5C4GB 4URZR 2REBA 5B64A 4BFXA 3U44B 2P6NA 1YZTA 3QKRA 5EZ5A 5FL7A 1WDTA 2RGGA 4M1YA 3SI7A 1Z0KA 2CJWB 2ZSFA 3VU9B 2AK3A 1AK2A 1G17A 3DL0A 2YYZA 2ODBA 3PXGA 3Q5EA 1U8AA 2CVHA 2O0JA 3ZZTA 2DFKB 2NO7A 4MGZR 4KLZA 1QDEA 2IC5A 1OXTA 2ZE5A 2ZI9A 2BOVA 2G6BA 1LF5A 1WP9A 2QP4A 4II7A 4HLUC 2NO0A 1UJ2A 2C95A 1DE0A 1PV4A 3PEVA 4DSNA 2GJ9A 4OJQA 1VHLA 2J0QA 1ZIOA 3O47A 3CRVA 3EC2A 3KFXA 2CK3D 1DG3A 1G8YA 1R5NA 4DLSA 4DJTA 4M4SA 2PT7A 1RC8A 3IIMA 4BLQA 3TRFA 1VG9B 4JMPA 2VIIA 1E1RD 1MV5A 2F1JA 4D26A 4DLYA 1E2KA 4BASA 1GL6A 4B3XA 1E1QD 1UADA 1VCIA 3ZYCA 2VH5R 2QMUA 4LZZA 1KSFX 4KBFA 5TARA 4AYWA 1HURA 1ZM2A 1P3JA 4O25A 4CYMA 5EE0A 3KX2A 4RZUA 1OB5A 1KDPA 3CF2A 2NPIA 3AVVA 3DZ8A 5LB4A 1Q44A 4LOAA 2ZSDA 2YOHA 4JLVA 1ELOA 4TTRA 2H18A 3PUXA 821PA 1ZUIA 4Z8XA 2IS1A 4DVGA 4JT4A 2GWHA 1G64A 1MO5A 4KCGA 4DSUA 5BN3A 2F7SA 3K0FA 1D9XA 1FTNA 1F5NA 1CIPA 2L0XA 4M8NE 3Q5DA 1U94A 3SFZA 2AFHE 4YMWA 3QXXA 3DZDA 3QKRB 1RRCA 3T35A 3HDTA 1VG1A 2G88A 1JQJC 2WV9A 2R6CA 1KI1A 2A5YB 4GMXA 1K6MA 2EYQA 4YQFA 1NRJB 5KUTA 2J46A 2D2FA 4AKEA 1VYTA 2GZAA 3RSOA 1OKKD 2FH5B 3WMFA 3KXIA 2D74A 4TL9A 3KJHA 3E70C 1VTKA 4A82A 4CT5A 3EZ6A 4MRNA 2B7CA 3GJ7A 3T34A 1N6HA 4JLOA 4B3GA 3F0TA 1UEJA 2WWXA 2UVQA 2JJ8A 121PA 1TUIA 4NCHA 4IOJA 2REOA 2RMKA 1XZPA 3BJIC 2ZRBA 1GTVA 1ZUHA 2D06A 1YZLA 1XMSA 1S3GA 5DO9A 3AH8A 5GJVC 1DBSA 5CK4A 3AGPA 2FFHA 3I8SA 3Q9LA 4IDQA 3IQXA 5FI1B 4BGDA 3DOFA 3O8DA 1XEFA 4HLUA 3WMEA 3K09A 4C0AC 2RGEA 3QPVA 1H8HD 3ZH9B 2B7BA 2Z83A 5KO2A 2XNDA 1W7AA 4EPRA 3MGCA 5E7MA 4EPTA 3QKSA 5C46F 2CCGA 2FN4A 2WWHA 3K0FB 5DE3A 2IYWA 2VHCA 3EC1A 3S1AA 2KJQA 2NOAA 3NG1A 2ZRLA 3PUWA 4A9AA 4MRRA 3UMFA 1FX0B 3L0IB 4UQOA 2QAGB 2F9MA 5TB5A 4LJ4A 1E0KA 1MO6A 3UKDA 3IBYA 3CZQA 5H1YA 3THWA 5EE1A 2WHXA 5EXXA 5AUPB 3N2IA 4JBYA 3GLGE 4P32A 1OXSC 2KB0A 5FOVA 2N42A 4DB2A 3FHOA 5TV2A 4FD2A 2XSZD 4NP6A 1E98A 1II9A 2MMCA 2J9RA 1AQYA 3THXA 1XTIA 1XTKA 2FFBA 2H1LA 2JATA 4A15A 5KPDA 1IN8A 3LH5A 3LO5A 4PX9A 1NG1A 1U90A 4Q1BA 4ZPXA 5FTNA 4EFNA 2BMDA 5DISB 2BBOA 4DT1A 3D8BA 4QM7A 1SZPA 2ZRHA 3ND9A 5J40A 3K70B 4TYYA 3RC8A 3OFND 3BE4A 1W36C 1Z0FA 2IS2A 1G3IA 2C77A 2XXAB 3CUEF 4O2LA 2HEIA 3MCAA 1KJWA 1MO3A 3BBPA 2DHRA 3L82B 4B47A 2JGNA 1IY1A 3JVUA 1IOZA 1E2GA 3VX3A 3W34A 4B2LA 2GJKA 2ZJBA 2WIAA 4OHWA 2XAUA 2R9VA 2O8FA 4F7WA 3IIKA 4XVUA 4LBYA 1E9DA 4NPHA 4TMXA 4FCWA 3KKNA 1AS0A 3V9PA 4PQFA 4AURA 1ZM9A 2GF0A 3QKSB 2W2TA 1G41A 2JJ2D 4LV6A 3A1SA 3L8ZA 5FTJA 2ZR9A 1E2NA 2ZQ5A 4ACBA 4D81A 1Z22A 2CE2X 1TUEA 2ERYA 3FMPB 1D2EA 1UKEA 2ZUCA 3LFUA 4N3NA 4MRSA 1NVXQ 8OHMA 2V55B 4M9SA 2WOOA 2QENA 3TUZC 5JI2E 5LB2A 3THWB 2A78A 2IYZA 5CK5A 1T91A 1KK3A 1DAGA 3PR1A 4RKEA 4ACAA 5FOUA 5L3VA 3EPKA 2JLVA 2NIPA 2AKYA 3JZMA 4R71A 1BO6A 4FMDF 3GQBA 4P31A 4EPWA 2YWFA 1UKZA 4F91B 1G16A 3Q3JB 1ZD9A 4Q19A 3THXB 4C2TA 5A5GA 3RDPA 1W47A 1UPTA 3RRNA 2J7KA 2GEUA 2XJ9A 3BH6A 4KBGA 3LV8A 4D82A 4G5SA 3H0KA 4DT1B 2HCJB 2C2HA 1JI0A 4IOMA 2MSEB 4HDQB 2WVJA 4I1UA 2J0SA 3F3YA 2WWGA 1RRFA 2YZ2A 2ZUBA 1BIFA 5CM9C 2IX3A 1UM8A 3KB1A 4QJ5A 5DH9A 1XWIA 2I1QA 2F6RA 4XVRA 1ZVQA 2ZRAA 2ZYTX 1NI3A 1SQ5A 2P3SA 3B1YA 3SHFA 3P32A 3NH9A 3B1VA 2AR7A 1FQKA 3B82A 2H57A 3QE0A 2G3YA 4P33A 2GXAA 1R0WA 4W7SA 3RVBA 1B23P 3CF6R 4B3BA 4RSGA 1S0UA 3AVQA 4LV5B 5AUNB 5D3MB 2QPTA 2BBTA 2BHRA 5JJKA 1Q0UA 4PAMA 4C4PA 2GJ8A 1PLJA 2J1LA 3F5FA 4Q9HA 1O87A 3UG7A 1L4YA 4Q03A 1WBDA 1IM2A 2BV3A 1J99A 4YMUA 3KKOA 2QSYA 1GILA 3B8HA 3BORA 2A5FA 1KGDA 5FI0B 2YWEA 3WNBA 1X86B 1YQTA 2VO1A 3ZIAD 1N5JA 2QT1A 4DEYA 3N2EA 3KJGA 4BE7B 3SQWA 2JIZA 1XD8A 4LI0A 5DHAA 3CNNA 5JEDA 4AYTA 4LGMA 2WM9B 3RAPR 4OQXA 5C2JB 1F2UA 4B73A 3WRXC 1TQ4A 1P75A 4IKEA 5LBIA 1CJMA 3EASA 5FPTA 1XD2A 1J8YF 4MGKR 4TLDA 4CEJA 3PQCA 3TW4A 1T5IA 2CHGA 1KMHA 2J5XA 1KDRA 1NLZA 2W0SA 3V4FA 2WMNB 4WZ6A 1K5GA 4PFSA 4CW7A 1B0UA 2W00A 3PCRB 2W6ID 3QJYA 2PCJA 2OG2A 1G4UR 3K9GA 1TTTA 2ONKA 1ONBA 4Q66C 1AS3A 1CR1A 1MABA 2ZROA 3A4NA 2CK3A 5H68A 3QOFA 2DFNA 3OAAD 4E07A 3U60B 1W5TA 3KTAA 1J8MF 4TT3D 1E1RA 2YV5A 3OF5A 2O0HA 1E1QA 3MMPA 4FMCF 5CIWA 5IRCD 4GOXA 5CLQA 1FPMA 4GOJA 1G5RA 4OHZA 2V8OA 3B7GA 3CX6A 4B3DA 1WF3A 3ZLJA 2FMXA 3GEIA 1WE2A 1U8YA 3I1FA 4PPGA 3RRZA 1A2KC 5JLJA 4P4SA 5JS7A 4PO9A 3CIOA 2X2FA 2X8AA 4JJKA 3CX8A 1OH6A 1QF9A 2G9NA 3ADCA 3C4JA 4WIAA 3GLFE 5FUXA 1DOAA 1S8FA 2PT5A 1KNQA 5A4JA 4QL3A 1VPLA 1PUIA 2CMKA 5FBQB 1I4LD 1KK1A 3L2OB 3EA5A 4G5QA 4AYXA 2ZRKA 1AS2A 4N0EA 4KFSA 3DO6A 4XWAA 3EPLA 3PIRA 4QJ4A 2EVWX 5FOSA 2QEQA 1E4YA 5DHFA 3AP3A 1XD2B 5KHOC 4NYMQ 1ESNA 2WTUA 4CEJB 3NDPA 2P5SA 3ZD7A 3BB1A 1NKSA 4ESVA 2ZRMA 3GLHA 2D7DA 2J7PD 1P62B 2OXCA 3BGWA 3EAQA 2ANCA 5DLQC 4DUGA 2JLUA 4JL5A 4V0KA 1G4AE 2NPFA 3I62A 3BK7A 2Y8EA 4X8OA 5LD2C 1W4AA 1G7RA 1D5CA 3CR7A 4U02A 3ZS9A 5L3RA 2ZRPA 2IEYA 2FNAA 4AKIA 1N6IA 2VP5A 1F3OA 4OK3A 4PHTA 3B78A 2AL7A 1TX4B 3QUSA 1MABB 3RWOA 2AFIE 2IA5A 2QY9A 3I72A 4BFYA 4XWOA 3MWYW 4DLTA 4GP6A 4NYJQ 4UNNA 3KTAB 4DSTA 5JMTA 3U6BA 2QM8A 4A1FA 2ZI7A 2W0MA 4A6PA 4CT4B 2I4IA 1ZAKA 3CWQA 5BN4A 3W9YA 1NG9A 2WJVA 2CL0X 1PVOA 2IF2A 4NCIA 2IL1A 5TMPA 1E79D 4W5HA 2ZS9A 4A92A 4P4SB 3BD9A 4JLMA 5K8LA 1SKYE 2PJZA 2GZDA 3GJ4A 3VKWA 2EFEB 2ZE7A 1N5IA 2GXSA 3D31A 3W6PA 4PSAA 1FUKA 4R2IA 2J3EA 1N5LA 1HA3A 1XFAA 4Y0AA 3VTKA 4X8HA 2JLQA 1CR2A 2PZEA 3I73A 1XNJA 2O8EA 2MSDB 1G3MA 3VHXA 4Q4AA 3A1TA 3R8FA 5TXGA 2OUKA 3BC1A 1XPUA 2HT1A 2PZFA 1P61B 2WJHA 1CKEA 4TTQA 3VHLB 3UG6A 4LJAA 4PXAA 1JJ7A 3U5ZB 1HQYE 2PEYA 2AWOA 4FI3C 1A7JA 3VR4A 2Q3HA 2C03A 4RVCA 2QMOA 2WICA 3GLHB 3ZQJA 4ZDKA 4FIDA 5DN6D 4A36A 4OHXA 2HYDA 5EP4A 2C9OA 2YC2C 1NP6A 2F43A 4DSOA 1AGPA 1KK0A 521PA 1DAIA 2WKQA 3GJ3A 3WY9A 1T5LA 2X1VA 4PC2A 5CJPA 1QG2A 2HYIC 1ZC4A 3IEVA 2XNDD 1N6OA 2V3CC 2PX3A 3FFAA 4ZI2A 2GEDA 3IKJA 2GETA 4P3YA 1G3UA 2R44A 1N0WA 2FA9A 5FUVA 4IJMA 4D4MA 1E2EA 2IS6A 1ZJ6A 2C5LA 2QI9C 1SXJE 2QE7D 1ZU5A 2OCYC 3B1ZA 4RD2A 1SVWA 1O3YA 2CXXA 1GL7A 4NH0A 4A2PA 1V43A 2EFDB 1NN5A 1EXMA 2C96A 3UMSA 1XEWY 5KYKA 1SVKA 4A0FA 4YMSA 5E7JA 1D8TA 5KDLA 2ODWA 3HR8A 5EP3A 1YR7A 3EIEA 1SXJC 1VIYA 4IDHA 1YKSA 4ESHA 3OEHA 4QGFA 2V6IA 2O8EB 1N0UA 1U0HC 2JJ2A 2KI5A 4Q4AB 1Y63A 5CLLA 3QEOA 2R6FA 1C9KA 3LWNA 3L0PA 4BFUA 1QHIA 1LS1A 5EUQB 4W5WA 5J5CA 2P6RA 2X19A 4EPXA 1Z29A 1PUJA 3RS7A 1LY1A 2IF0A 1R0ZA 1G291 4NZYA 1T4GA 4TYWA 4X8LA 1U9IA 3PEYA 2OXRA 3DKPA 1KAOA 2WMOB 5H70A 4FXPA 4BLTA 1XEXA 1R5OA 2F43B 2WIBA 4L16A 4M1TA 3PFIA 2J0UB 3TE6A 4OHYA 2F9LA 5EXPA 4D4JA 4Z54A 4BZQA 3FGNA 5JJLA 1X8JA 2DB3A 3NWJA 4MGYR 1W49A 5AJZA 3AVYA 1CEEA 5LPNA 1AZTA 3SQXA 4IVRA 3K0CC 2QG6A 1P6XA 5CB6A 5L3SA 3A1VA 4LX0A 2RGXA 4OQLA 3B9PA 4CZ2A 3B13B 1EX7A 1VECA 1P72A 4GI7A 2WOJA 3FFBA 3WBKA 3F8TA 1KI9A 3GJ0A 4KYUA 4TZ6A 4UJ3A 1F6BA 1U99A 4Q1FA 5EP1A 2D3WA 1XDBA 2ZJAA 3G82C 1TADA 4URUR 2BEJA 2RGCA 3BWDD 3PUYA 3IHLA 1KI7A 1G8HA 2ODNA 3TMKA 3EPJA 3K53A 1RKBA 4DHEA 2ZJZA 2ZSBA 5BN5A 4L8GA 4R9UC 1VCOA 1UKYA 5FL3A 3N70A 1IN5A 1P2VA 4S35A 3SBEA 1DAFA 3VR2A 1CU1A 2YOFA 1CP2A 1IHUA 4X8MA 3PEWA 1CLUA 2A3RA 1Z83A 1YZNA 1IBRA 3VAAA 1ZNXA 3QI2A 1N0VC 4M9XA 3BRWD 2WSMA 2RHDA 1R7RA 3FMIA 1VKJA 2GDJA 2ECKA 2WBLC 3W6OA 1YRBA 2UZ3A 1MKYA 1J2JA 2ZSAA 1AZSC 2FU5C 4O0MA 4FWTA 2JLSA 3OEED 5BW8A 4QHSA 1XEXB 2CCJA 3VR6A 4AD8A 1E2QA 2O8BA 4QBHA 1OXUA 1S1CA 2A7QA 2BMJA 5HE9A 2YVUA 2FZLA 1CS4C 4I1VA 1S1MA 1SXJA 1X1RA 4CGZA 1NNEA 2BM1A 1G20E 1RW4A 2ZI6A 2XJ4A 4NE2A 1TEXA 1XTQA 3VKHA 2ZI4A 1E6CA 5G40A 3LDAA 5JSZA 5FTLA 5L3SB 5IF9A 1W36D 3ZVNA 1JXMA 4JVNA 3T5DA 3W8RA 1LF0A 3MWLA 1FNMA 4G5GA 4TQ9A 3REGA 3LAWA 1G3RA 3WHKA 4OI0A 2OCPA 3ND8A 621PA 1TU3A 2IW3A 2A2ZA 4YDSA 1NY6A 1VIAA 1FP7A 5FH9A 1NKTA 1N6PA 1SGWA 1ZM4A 1KYIA 3OAAA 1EFUA 3GLIE 2CL7X 3FOZA 2F1RA 1OXVA 4LJ8A 4TN1A 2ZYWX 2JIZD 1X3SA 4TT3A 3M6AA 3IQWA 5IHPA 4C0SA 1X8LA 1EFTA 2GCNA 1G7TA 2FGKA 3K0CA 4P4TA 2SHKA 4QNMA 2GHIA
chains in the Genus database with same CATH superfamily
3OMXA 4IOKA 5KAMA 3GFPA 1KH1A 4BQNA 1SXPA 3WNZA 5HQ3B 2Y4NA 4Q3DA 4AC9A 1K5DA 4RAQA 3V6LA 2Z2IA 3NHAA 4UOEA 3R6GA 4AS1A 3TB4A 4MR8B 1I1QB 4GS5A 3IOBA 3H6HA 3DCJA 1X6VA 5E1BA 4L22A 1CBUA 3SC4A 1UZNA 3K2IA 1L5MA 4WEOA 5LZ8A 1ZDMA 3R9KA 3MJTA 2ZI3A 4QXOA 5CXUA 4H1UA 2D0OB 1FY2A 3GOHA 2O8BB 2XRFA 4BNVA 1IN1A 3EGIA 1K7XB 4LSGA 4WAUA 5CR9A 4PLPA 3H11A 2DBVO 1USKA 1VLVA 3CUTA 1E3MA 4IWYA 4DMMA 3GRFA 3VISA 5CJ2A 2Q3LA 3B5JA 3FKQA 3F8SA 5C0OE 1ISGA 2QR2A 1BCSA 1LX6A 3U4GA 2PKXA 1HV8A 1OYWA 2W48A 4BYGA 5D1NA 2QROA 1MORA 2GYVA 3OEWA 1MRSA 5IASA 1BSVA 4M99A 4QU0A 1GNTA 5B58T 3TOSA 3OPQA 2BGNA 3ZGYA 1KIMA 4LZPA 4P92A 1YV9A 5IVPA 3LUKA 1VHTA 4YV2A 3LQ1A 2DBZA 4NTZA 1SVLA 2LRHA 5EKTA 5BSVA 1FJ2A 5HTOA 4D25A 1LK0A 3P4XA 1DJQA 3FOCA 4F3CA 1Z5PA 1QE3A 1U1DA 1Y9DA 1QR6A 5KIAA 5JRJA 4QG7A 2ZG6A 3IVMA 3MHPA 3U80A 5AESA 5IT4A 1P7PA 3SGLA 1G0OA 2V7QD 3EJ6A 1IQUA 3GA5A 1UPAA 4W5TA 1FJGB 3HZZA 4W8OA 3MWJA 3K5WA 2VYCA 5CX4A 1E2DA 4E5VA 2X4IA 2BFOA 4N0QA 1E79A 1OHHD 1Q0ZA 3CKLA 5L8VA 1ISMA 4ZAYA 5T7BA 1VE6A 4DUGD 1YKGA 1UR5A 1SRRA 3EUWA 3PB3A 1XJQA 3DAHA 3DP9A 3P20A 2C94A 1FFWA 1QHFA 1OPXA 5C37A 5IAJA 4JBNA 3SJCA 1CB7A 4HDMA 1RC1A 1M2OA 2PSEA 1EM8B 3NXSA 1T6NA 4I5IA 5DTMA 4ZT4A 3ZWWA 1P2FA 3AVUA 4EHLA 3Q6NA 1M34B 4Q16A 2E48A 1BDHA 1CHDA 1RU3A 1P9WA 4RCZA 4Y6QA 4F7DA 5ECWA 3IESA 1MA3A 2J87A 3HO6A 1R8YA 3P9RA 1MRZA 4NU6A 1QSGA 5JNWA 4ZJZA 3QMWA 3G2PA 2B3DA 1O5TA 2VYVD 4H17A 3V1TC 3FM9A 3IQIX 1V26A 2R4TA 4MUEA 3I2JA 1IUKA 1W87A 4D9GA 2FPSA 2XF2A 5IZCA 2EBUA 3C97A 1GRNA 3MRSA 1CY8A 4RL4A 4S2EA 2H0RA 4BO4A 4X71A 4US1R 3ZK9A 2PMKA 3JQDA 4TXNA 2MR6A 4M1KA 3THOA 4AMYA 3HVKA 1H2EA 4DG9A 3DXXA 4UEJA 1TIBA 1DI0A 3IE0A 3L4JA 2DC1A 3CH7A 3FW1A 4CLOA 1J5EB 1SA0B 1XU9A 3OTIA 4F3YA 3EGOA 5A4AA 3HZRA 2Z5VA 4OO3A 3BAZA 1IUNA 4FYPA 3TH5A 3T3NA 1U28C 1VP9A 2FKNA 5GQSA 5BT9A 4F8YA 2VSQA 3EQ6A 4UZFA 1ZGGA 1FOEB 3EZFA 1Y33E 1EKXA 2EFCB 2Y0EA 4TM7A 4BHTA 2CMDA 4AX4A 3GARA 1RKQA 2O2IA 1MQAA 3L7IA 2E9SA 1BJTA 5EWJA 1G20B 3UM9A 4LGYA 2LBPA 4JLUA 1M73E 1Y1TA 3N9IA 2ZUDA 1Q1BA 2C3UA 4I4IA 5CH5A 3BH7A 4PIMA 2JD2A 2O06A 3QIAA 3TZEA 5BWOA 1N1EA 1ISFA 1TVEA 2QK4A 3LQFA 3LUAA 4MK4A 4K3VA 4B2PA 2GN4A 1LUAA 3R6LA 3VH3A 3EVTA 1JIVA 1H2AS 4D4LA 2BCGY 1T0PA 4RSRA 3TXXA 3MAJA 4AWXA 3QVWA 3DUWA 2A9PA 2R2AA 4DCUA 4UHJA 4M89A 2FZKA 1LLCA 2QUBA 1KGSA 2YRFA 4IHQA 4KU4A 1ORVA 1GA6A 5F4ZA 1WDKA 4YRIA 3LDFA 2VBCA 3ITEA 2Q5LA 4I81A 4BO9A 3QEBZ 1EFVB 2PYIA 1CQIA 4JELA 4U39A 4Q4JA 4XRRA 5EFZA 3HUFA 4HAZA 3AUSA 1DIRA 2ZW9A 4WK4B 1RJ9A 1GQRA 2HN9A 2WTMA 3MAAC 3WMGA 4R2HA 1JEYB 5DBIA 2VRWA 1DJOA 4AUKA 3GLQA 5LQJA 4CMAA 4K86A 5EXEA 4HBGA 4UAVA 1KJJA 5H4HA 4FFRA 3QV1A 4ARVA 1RVV1 1T5BA 4QTUB 4WV3A 1DEXA 1TCCA 5A3SA 2PWYA 3AI7A 1H0KA 3HY4A 5A9SA 4F72A 1S3FA 4A0GA 5BSWA 4QSHA 1S2OA 2P8JA 2F55A 4CBVA 1UBGA 2OP1A 1GRRA 2QRPA 2C4TA 3TYXA 3KQHA 1X15A 2LUOA 4BNLA 4ND3A 4LXXA 3WIBA 5I48A 2YV3A 1U0SY 1J42A 4DS3A 3EZGA 3D81A 3HQ4O 4BB9A 5DK6A 2Y1XA 1NDUA 1A97A 2ZAGA 2NSYA 3B2NA 4JVLA 2BE7A 4QGSA 2NTVA 4LXUA 3WYNA 4N82A 4DBVO 4MV0A 1BTOA 2BEWA 4RMGA 1LPSA 3FWYA 4RZIA 2FEMA 4ZV4A 5F7JA 4FZVA 1QQBA 3GPLA 3CRMA 4RO0A 2AN4A 4JJZA 4B43A 1OXKB 5BSFA 1ST3A 3HS3A 5DXAA 3SX4A 3ZE8A 5T5QA 4D92A 4I14A 2CGEA 3DPIA 2BKAA 4GPD1 3G02A 2Z4RA 1SCJA 2OHVA 3ACCA 4A2WA 1GG8A 4CKCB 5TF4A 2CNLA 3DM5A 2NU6B 4B6EA 1M67A 4MIOA 1VLJA 4K2AA 2P9HA 3IP9A 4PO1A 2BR3A 2NX2A 3KXLA 3LC0A 4I4TB 4C03A 3I28A 3H75A 4ZYTA 6CHYA 2Y99A 1BJKA 3EOAI 2RHJA 2OXEA 5KQLA 5AR1A 2BEKA 1LBEA 3C70A 3KETA 1EGQA 1G8FA 1O1YA 1PJCA 1F14A 4HGOA 2OZLB 3OEEA 1XZMA 2H7VA 3CUKA 4NE9A 2B94A 2ODQA 3CXRA 4I3FA 1DXYA 1YZUA 1ISHA 3MK31 5IAGA 3HM2A 3DTYA 1AZWA 1A5AB 1ZLYA 3EBLA 5AK4A 5BV1A 3AI3A 5C3UA 5LDHA 3NWBA 3B2EA 2XNCA 4GLOA 4MGIR 4DOMA 1J07A 1Y8RA 2JCYA 4OBEA 3EUFA 4Y9SA 3K9LA 5CX1B 5AVZA 5LZ4A 2XOKD 4H2DA 4QQRA 4WCFA 2W70A 3CA8A 1LFAA 2IXTA 3CO0S 3FYDA 4PO3X 4QRIA 2HV8A 4G01B 4OD0A 2ORWA 1A9QA 5DRYA 4R2KA 4RPCA 4H7PA 2E4WA 4OGLA 4DABA 1QHHB 3DM9B 4KK3A 4Z0NA 1XZLA 4B4UA 4FMCB 4WOCA 1T9CA 3IB6A 1WD5A 1ORDA 1R6AA 1YRAA 3AHIA 4QELA 4L08A 4KXXA 4QKQA 3EZ2A 3H1GA 4HWOA 4AJ4A 1PQUA 1P6UA 3AIIA 2WA1A 3C4VA 1P18A 3EARA 1FYFA 2LDXA 3IP1A 3OOEA 4J0DA 4WKGA 4EECA 3I2FA 3KT6A 1FLVA 1HEUA 2V4ZA 2WSLA 4EB0A 1RC8A 4L9AA 5K03A 3VR6D 4CEHA 4LMBA 2GT1A 3V2IA 2XWPA 1XRQA 2QLTA 3IEIA 4E3ZA 5BURA 3B6MA 3R7NA 3F73A 3HPQA 4LN1A 5A4FS 2Y9MB 1DDGA 1SXJD 3OWOA 2VN8A 4PC7A 3SCZA 1X14A 3UYLA 1P1FA 2VA9A 4KUEA 4GC5A 4PBRA 5JQGB 3R0VA 3CC8A 1EUDA 4MW4A 2J9XB 2QGZA 2RAPA 1ETHA 1P45A 2HJ9A 1NIJA 1MUUA 5E7IA 3NZEA 3QNWA 2X42A 1G6HA 1CZLA 3JD2A 1ZOOA 3MWEB 4P86A 2NZXA 2I6XA 4XVCA 1NZFA 2IYRA 3ZUGA 4KI0A 3PHIA 3F3MA 3WG9A 1FMTA 2AX4A 1ZMBA 4CXMA 1C4KA 3AUXA 4WQMA 2OQRA 4QGAA 1FNBA 4PLZA 5E7QA 4AQYB 3NDRA 1Q20A 2FSSA 1Q12A 4PHFA 5DSZA 1J0AA 4IEEA 4TRJA 4IVNA 4E46A 5ICCA 3NR2A 3I61A 1RAEA 2ZRIA 5IS2A 4QOEA 1E9FA 4DIUA 1NVKA 4ERXA 5GY7A 5IJXA 2GJSA 5FA5A 3PYLA 1KQNA 4O4HA 1C81A 4KR2A 3KYCA 3BXOA 1N5DA 2H2IA 1K88A 3G7NA 4KFRA 3K73O 3TD9A 2DLNA 3F2IA 3HE3A 3I0NA 4WRRA 2E4UA 1XHEA 4ZVKA 3K4QA 3I32A 1GSOA 2GDZA 3U2QA 1AA6A 2QTAA 3FCOA 4L2IA 2XMDA 4HGYA 3V5NA 4C88A 1LA2A 1GNVA 1ZD2P 1HDEA 2PU7A 4EHIA 3A1WA 2X14A 5EKUA 2GAAA 4Q15A 4LYFA 1UBLS 2N75A 3LLVA 3ER8A 2A84A 1DV1A 4MVJD 3WYBA 3AQ4A 2VF5X 3H2GA 1ZYUA 3H17A 3LLUA 1D1TA 1WSBA 4NIMA 5E4FA 2NUPA 3PUIA 4JFRA 3MXOA 1I7QB 1QIIA 1KEPA 4TVBA 3FYCA 4XLTA 4HS9A 2FPKA 3DTVA 2WIGA 1Z26A 3DNFA 3FR7A 1V4NA 1M83A 4OHRA 4A10A 4G1EB 4HWRA 3BRQA 5JR3A 3TQFA 3E7DA 4M0PA 1PD0A 2PS9A 4CQLB 1NXQA 2H5EA 1CFJA 3HYRA 2BI8A 5LBUA 1HBJA 3WO0A 3Q41A 1OLUA 1MJGM 3PNBA 3KQPA 1UKVY 4RGVA 1BRTA 1JB1A 2IYLD 3K1JA 3TCNA 1UDRA 1N32B 3K0KA 3U26A 4BZPA 3I5YA 2VCYA 5CW2A 4INOA 1NZDA 3O0DA 1WV1A 4LPKA 4N8EA 1VQ1A 2FR8A 3OSUA 2NYUA 3TLGA 3NTRA 1KJYA 4IF4A 4K9OA 4KVFA 3VU0A 1B8UA 1GT91 1VMIA 2IYNA 4OLFA 1WUYA 2I76A 5HZHA 3H13A 3OPYB 5CG2A 5JCPA 5JYEA 4NU8X 4XD7D 1GV0A 2GCOA 3N75A 1BNCA 2AR9A 4OXNA 1BRMA 3ML1A 2J3QA 5BNWA 5JZBA 1GITA 3BH0A 5IWAB 3HYSA 1EDOA 5DBFA 4AK9A 3OHMA 1LDMA 1XNGA 2Z2XA 5ECYA 3CRQA 3ZHVA 1U3VA 5G02A 3G5LA 4B74A 2KE5A 2XWBF 4M98A 1HZZA 2HTFA 4FU0A 1UJNA 3R0QA 4TXLA 4EARA 1XAGA 5AIAA 1KZ6A 3IXMA 4F6RA 4NCNA 2WHRA 4PPFA 3OQVA 2DERA 5M29A 5HRUA 2PLFA 3FIUA 5DMXA 3LVRE 1RWOA 2E1PA 4UVEA 5KYWA 4M76B 2PLRA 1M2VA 2WKWA 3DWIA 1UJCA 4AJPA 4YPFA 5HKKA 4WBNF 5J2TB 2OESA 4AWAA 2R6HA 1NXOA 3K6RA 2E5FA 1NSYA 2GRAA 3H87A 2A58A 3R7SA 3ACDA 1THMA 4H31A 1WHSB 2FSFA 1DZ3A 5CTAA 2C31A 2GN0A 1ECJA 2VSOA 1Y6FA 2AC7A 1T4DA 4D2IA 3R9IA 4ZVNA 5CFOA 4UCFA 2G82A 2BEVA 7ABPA 3U39A 2QN9A 2YYSA 4M1WA 1ZUNA 3HDQA 3T1QA 5K01A 1B6TA 3TXYA 2PK3A 1X1CA 2I6FA 3R3WA 5CYFA 1WPRA 3E0XA 2BWJA 3HVJA 2FG5A 1Y4AE 4QBTA 2BKXA 1W5FA 3WK6A 2VJCA 4CT0A 2JFOA 4CLRA 1XWFA 3HFJA 3KTFA 4PS1A 4YQYA 5EWMB 3V1MA 3A9WA 3RTDA 5EZYB 4PZYA 1AUPA 1HO3A 3OQIB 1EP3B 4DV2B 3MS4A 3PNPA 1NC3A 3FDZA 4NFHA 1PTKA 4RGYA 3UOWA 4CCYA 1VKHA 2YNMC 1B7GO 4Y0VA 3WQRA 2ZK7A 2WLTA 2R1VA 1H6CA 3KR0A 4R2XA 2JLBA 4EM6A 2FQYA 1FFSA 2FG7C 3IX7A 1ECGA 3H5NA 3M4NA 2D0IA 1JDVA 1O94A 3FRHA 3QLUA 4IDGA 4R2MA 5CT5A 3UJ3X 3WGVA 1XLTA 4C7MA 3WYGA 4CM7A 2GFQA 3IP7A 5CDSA 4KHZA 3A0UA 4ENRA 3GLFA 2HI0A 1WY7A 2QUIA 4QIHA 5JEEA 3TMAA 3TIFA 4DGSA 4YCAA 1CUUA 4LJ7A 4OYHA 4TMTA 5CHEA 4ZYVA 5CFZA 3GO4A 3TIXB 1QYWA 3T4EA 4D0SA 1MG5A 1LW6E 2OTCA 2WWRA 4J7CA 3D2AA 4FK8A 4CM4B 3MD0A 4MUKA 3DV0A 1W35A 2HLDD 3IR5A 1ZI8A 3G0DA 4FGZA 3WGKA 4RIIA 3X43A 4IVPA 3PEEA 5E95A 1FRNA 3CCFA 1ISPA 5CNIA 2JGDB 1U5BA 1N5KA 4TLAA 4MVYA 4NNPA 3CVXA 3K6SA 4AF8A 4CMEC 1XCBA 4EHDA 3ZEIA 1K86A 5IBRA 3T3IA 4JJAA 3FCEA 4TV9A 1M2GA 2JCSA 1QF7A 1RP1A 3R5XA 4M21A 5CD9A 2F1KA 1Y82A 4YYEA 5JCOA 1DKLA 3IVGA 3TPFA 4D6PA 5FBLB 3QQ5A 2WFZA 1YZQA 3L43A 4S2UA 3RFVA 5T3UA 3V48A 3NCTA 4N5IX 4C9BA 3D4OA 2RKOA 3UPDA 5BMOA 3GJ5A 4U7GA 1BH6A 3L0OA 4P6VF 4KV7A 3U9SA 2PGOA 2AGVA 3R76A 2F59A 1E2JA 2Q2VA 2VWGA 3FCXA 1T8SA 1ZONA 4OIMA 2WFLA 3P9ZA 1AKRA 1NSTA 3CURA 1Q3KA 3GIWA 1E1KA 1JDNA 3QYPA 1QKIA 1WCIB 1SO8A 3MA0A 2A5DA 3ZHSA 4CEIA 3A1UA 3ASZA 4PLCA 3WMXA 3LX5A 1CQWA 5A0TA 2ZBEA 1ZRMA 2VEDA 3B9QA 5AI0A 5E1OA 5EPEA 1ACLA 3DMFA 2PNJA 4A0QA 2WVAA 4HNAB 1ZGHA 1OAKA 3BFXA 4RLFA 4YUXA 1H5QA 2MJLA 4YAJA 1N9ZA 3C3KA 3C8MA 5K7SA 3KWMA 1AJEA 5BMVB 3TAXA 1QVWA 1XMVA 1VBFA 3OHSX 4QICA 2JAQA 2G1KA 2VT3A 3D4LA 3TIIA 5C8ZA 1X19A 5ICSA 4JKIA 1HY3A 3MIIA 4KZKA 4MI9A 4LHXA 4OH1A 5AJWA 4BBPA 4QBIA 4N0DA 3HA7A 4L9SA 3UYKA 1AKYA 2K5UA 2CW5A 5B7PA 3OHPA 4F11A 3HJGA 1S8OA 2WUEA 4RFSB 3SEAA 3QOYA 4DLAA 4EB6B 2CHQA 4RGQA 2ZTLA 2WTXA 4WVFA 5LZ7A 3RRXA 5CA1B 1KRWA 5BR8B 3AUUA 3I1YA 4P54A 2PL3A 5GWXA 4GMGA 4PGAA 5AWFC 3KZOA 3OE4A 1KPHA 2A0KA 2H6EA 4LHZA 5TPWB 4R9RA 3WLJA 3J81k 1C1HA 1MCZA 3PRJA 4HNQA 4Z7JA 1E7MA 1GGNA 1QH9A 4INPA 3BMOB 4WASA 5LFAA 4C5BA 5I8WA 3KEFA 4AULA 3SHQA 1XIVA 1G5HA 1AUXA 1FU7A 3PWSA 4MYRA 4AMZA 2PIAA 1NXSA 2PGJA 2FQQA 2TRSB 2B8EA 4OYLA 3D8SA 1FBTA 1ORIA 4PGMA 3L7CA 3EXFA 4DC0A 3KVRA 1JWBB 3BZBA 2YYYA 2GLTA 3P26A 4URXR 3NBXX 1Y3AA 2QE6A 1XZHA 3KL4A 4M0FA 2ST1A 4F9FA 1OFUA 3CNOA 1WSWA 1S3SA 3W0LB 4E6EA 1W59A 4CVNA 3L7MA 2IXEA 1DCTA 1UXHA 1K6EA 1MX1A 2EBFX 4DSAA 2PA0A 4YRAA 5C32A 4GZ3A 3TLAA 3SKYA 5AXDA 5HSGA 1Z3CA 4OQDA 3FF4A 4FW9A 3U44A 1VYUA 4PC6A 4TTTS 4D4KA 1XBTA 2JI6A 4FYVA 2R6AA 4Z9AA 5H80A 4HRXA 4R16A 4RZXA 1E3WB 1UFRA 2KWIA 1PGJA 3ETEA 4WKBA 1N6LA 1SUCA 2B2NA 3NFRA 1DFGA 2C99A 2EX4A 1LVHA 2AUNA 2W2QA 5I9LA 5IZ4A 1FDOA 4JLJA 3V4OA 3ZDEA 4ARIA 3JQGA 1F8YA 4H6WA 4BDSA 4QJIA 2IYXA 1BXRB 2P9CA 3R9XA 2NSJA 5I9NA 3LHIA 1QVRA 4NMMA 5CTJA 5T4HA 1WSAA 2JFNA 3HYLA 1DJNA 4ZVMA 1PFYA 4CR7A 1ZA2A 2IDKA 4NARA 2QYHA 5TJHA 4CIDA 3UMVA 1G5PA 5E9WA 3NTXA 1YR6A 2Q5HA 1P80A 4U7JA 2WTBA 5B2ZA 4N39A 4FQ8A 1EVKA 1KDTA 3WYDA 4Q05A 4HYEA 4GWKA 2QVGA 1CETA 4UUPA 3AF4A 3F9RA 1R4MB 4D9NA 5IKMA 2R4UA 3HEMA 4NICA 4JODA 4K28A 4KE6A 1MFPA 4PZ9A 4ODIA 1XMIA 1C1YA 4BFCA 3NV9A 2W2NA 5D8DA 3I9FA 4GWGA 2O0MA 1HYEA 5A2QA 1QAOA 1B8VA 2OYRA 2FEPA 3AU8A 2I1VB 3HJNA 3DOOA 2CMHA 1A4UA 3E9MA 5IEBA 5EJAA 3I04M 5JSYA 1QFYA 3AUAA 1UDXA 1QHNA 4LBWA 3DBRB 4HK4A 4OGWA 1T3SA 4XOIA 3SF8B 4YCLA 1VI5A 3IKVA 4O33A 1JQLB 3DOHA 4MVJH 4X6LA 3EFEA 1E0SA 3CRW1 2GEVA 4AG6A 2IJGX 4BBAA 2W6QA 2ZBQA 3B2QA 3KR9A 5FXMA 3VO8A 3Q4GA 4WNCA 3B1WA 1M7HA 3F6PA 2A5LA 3R3ZA 2ZAYA 2IDZA 1CXZA 5FBRB 1K8RA 1LBQA 2FPPA 3PHJA 5JXIA 5CP8A 4K2HA 5BP7A 3GLUA 2JJYA 1E6MA 2BFBA 3PVSA 2F3SA 1E9AA 2JARA 2PVPA 4ND7A 4DCOA 5BYAA 3ROPA 4YRNA 3G8CA 2B8WA 4OGGA 2WIFA 2ZT5A 3W90A 3C3WA 3JYQA 4JYCA 1YQGA 2O14A 2YJTD 3O1IC 2GRUA 3FE2A 1JIKA 2DHCA 4ZYUA 5JT1A 4UNSA 3BMQB 3IJEB 5ALJA 4YT2A 1EXDA 1YJ5A 1GTG1 1T25A 2X8WA 3QU7A 3R7WA 2Q45A 4BE4A 2XMBA 1M6YA 3WLEA 4D0GA 5G0VA 4EEZA 5K0ZA 3SLGA 2EARA 1YKFA 2UZAA 1NXXA 4Z4QA 4ZRDA 2O8DA 3VOBA 5A62A 4DAOA 4NRDA 4YO7A 1JHMA 2EL7A 1IXKA 2GGSA 3CCCA 3HUDA 3A6FA 1HLDA 2OLKA 3QVVA 5C5DA 3OUZA 1R5BA 3ERCA 1GFIA 1ODCA 1E8NA 2BZGA 1OTXA 2CBZA 4KR3A 3VUEA 2RHRA 2A3NA 1E5DA 5CB4A 3T5CA 1KKLA 4NZNA 4WLNA 4KQHA 2H92A 3HLTA 1E1CB 4Q1EA 1TLFA 1FNNA 4P3NA 5LSAA 3TDMA 1X1SA 3COJA 2DBYA 1QGED 3C7CB 4FEAA 3EZYA 2BEUB 1FFBA 2LKDA 3TBKA 4DDTA 1X1QA 1JVSA 1MMFB 1LNZA 3HDJA 4GQBA 4IDOA 4FLFA 1M8KA 3RSQA 2PLAA 2W6ZA 3NV7A 1R0YA 4OXRA 1GG2A 1TK3A 2F3QA 3HB4X 1RXEA 2QT0A 4L4UA 3TO5A 4PN7A 2JFPA 5HRCA 2XB4A 2H8KA 1PFUA 3DGFC 4D9CA 3GGGA 4GSYA 3W9BA 5C1DA 4ZQEA 3A6KA 5IJ9B 1FP1D 4QYMA 1NVTA 5G0SA 1AXEA 5FO1A 2AMYA 3CZPA 3C8DA 3GNLA 4K9KA 3R0IA 4G26A 5I47A 1JWAB 3ZWXA 2IHYA 1YASA 4RVNA 1JEAA 5T64A 3SYMA 4C7VA 2FJUA 1VLMA 4QFCA 3S27A 2AX3A 2CY0A 2VATA 2XE6A 2Y71A 2W6CX 4FQ7A 4V0OA 1DL5A 2J59A 4HN4B 5A9TA 3TBHA 3WB0A 3KOOA 3PTLA 1Z74A 1RBZA 4AP9A 1Y1LA 1KY3A 1O9GA 3GGCA 4XI9A 5ULLA 2Q1XA 2IHZA 2ZTSA 3W6ZA 3LQ2A 3H05A 3EEBA 1G8SA 3MJDA 4BATA 3HA5A 1PNOA 2JIMA 3REFA 5JSHA 1U6JA 5JXJA 3ES9A 1LDYA 1PJ3A 1P9OA 3GLKA 5DM70 2MWMA 4QU9A 1Y37A 1GO2A 3TBFA 2AC4A 2IH2A 3OZVA 1FDIA 5GAJA 3UIEA 1NHGA 2OMEA 1J25A 4HGQA 3AETA 2P0YA 3BSSA 2V03A 1SCAA 4KDRA 4LE0A 3O3CA 3NPAA 5KTOA 2PAAA 2CV0A 4BN0A 2GOYA 4JR2A 2XXAA 4N76A 5GONF 1IDN1 3T7AA 1CY0A 5F77A 1QK5A 3F6CA 2DCUA 3W3AH 3P45A 3NOQA 4RAOA 5FFFA 1WPXA 3D6FA 3N8NA 1QH1A 1W76A 1PGPA 1VLZA 2R2GA 2Z5FA 3EGDA 1Z9BA 3K8YA 3KL2A 4ETWA 1ABBA 4XYGA 5A0FA 1CQZA 3WB2A 3H2IA 5DKFA 1HNNA 2CD7A 1ACJA 3LS2A 4HAWA 2BGKA 4ER3A 2PRZA 4DIFA 1O96B 3ANYB 1THZA 4PCVA 1N6KA 3CX7A 5DIFA 4DNQA 1FP4A 5KYXB 1ATZA 2UVPA 1W4CA 2OHFA 4QVKA 4UHCA 4L0CA 1X9IA 1KORA 3LY9A 1XA4A 1MVOA 1BH2A 4HDMB 2OCGA 4L07A 3QU5A 4A27A 3RSHA 2VNSA 2W6JD 3JQBA 3V34A 1SIBE 1GLNA 5F7OA 5HQTA 2QR3A 3W8NA 5K9ZA 4PS0A 4DBLC 1FDUA 1PJLA 1IATA 3MBKA 1UZLA 4RJKA 5NULA 1CUWA 3TCKA 4LF8B 3PENA 4FFDA 4OEHA 1RWPA 4P83A 1UMDB 1G55A 1GXSA 3GEPA 4W5JA 3HNOA 1YMUA 4KMSA 3BUSA 3MQ2A 4CUJA 4DSZA 4F06A 1ECLA 2UZIR 3LO8A 2HR1A 2HMVA 3ONDA 3QKTA 3PC8A 4CCWA 2LZ0A 1JIXA 3H42B 1Z6TA 2O8VA 1AM4D 1PV2A 1R64A 1U2GA 4XIIA 3TLZA 3WLRA 4YMTA 8MHTA 2FPOA 3FWZA 4Q4LA 5FBKA 4L4YA 2JLZA 2NO9A 4TN5A 2ORIA 4ALIA 1TCVA 2D2VA 5FUWA 3NHMA 4OP1A 3RK0A 1L7DA 2F90A 2K7ZA 2PQ6A 3L6RA 5BW6B 3W6NA 2ZBGA 1NJ8A 3OLVA 3TRJA 1E1MA 3A6LA 4YCMA 4LDJA 1EBFA 2V6MA 1PJQA 1PZXA 5SZHB 5BOSA 3P0JA 3ZK7A 2AI3A 4DCJA 2D4HA 3VUFA 2VCHA 1PF7E 1S6YA 4LC0A 4F4UA 2C3OA 2QR5A 3VO1A 5C52B 3WDMA 1R9MA 2VUIB 1RRPA 3K71B 2B4AA 3D8HA 2GMWA 1N5RA 4RMIA 5J4KA 5HIAA 5FPKA 3A9UA 2P4HX 2XITA 2JHGA 4Q7LA 1JB9A 1SCUA 3HGQA 3FNFA 2VBIA 2YWGA 4JZYA 1GR1A 1U3UA 1WQ1R 2Q28A 4IXNA 3VR5D 1FVOA 4UUOA 3VR3A 4ZIRA 5HYVA 2AVNA 4YONB 1YI0A 3PDHA 5B2FA 3U7QA 1DBWA 1F4VA 2OPBA 4ZZ1A 1NVGA 1Z6QA 4IO0A 5AW8A 3K2BA 5IVHA 3T5MA 5CDFE 1USIA 4TYNA 4DR4B 3HU1A 4MJLA 3E4CA 2VAXA 1TAHA 1VL5A 1WLYA 1O9BA 4E4YA 2R751 3LG2A 4TTIA 3ROXA 1W73A 3IUJA 2QLJA 5JALA 1U2RA 1HRDA 1O0SA 2FZ4A 4G1UC 5SZJA 3RYFA 1XXHE 2FXVA 2FZ5A 5JWHA 4C5AA 5ARBA 3ZZUA 5JNTA 3VYUB 2OFOA 2JAHA 5AFSA 5FUQA 5TIIA 5TSDA 3TQHA 2ZTMA 3T3PB 4TQUS 3WIEA 3DXYA 3FJYA 4C6TB 4UTRA 3C48A 4REMA 3DFKA 3H1BA 3GRAA 2DUJA 1ZAYA 5CBPB 1UQTA 2YNMD 2RI1A 3LT5A 3PJGA 4RXUA 3U5TA 2FEOA 1C4OA 1MT0A 3E9ZA 5L4NA 4B34A 3PRYA 1ATIA 1ODIA 3KJIA 3X1ZA 1W93A 2XWSA 4OFBA 2R8ZA 2IHVA 4QDXA 2DXIA 2A8YA 4IR7A 4MV3A 1DVRA 2H1RA 2XYQA 3WL3A 4D4GA 4E09A 1E2BA 2V0CA 3E03A 5A9SB 3NKLA 1KY2A 2G7MC 4ZQCB 2Q4DA 4FJ2A 5IKOA 1SBQA 1QYDA 1BDIA 1U8UA 3MW8A 5LP1A 1DC6A 3D6TB 5DN9A 1YDEA 4FHZA 4V0QA 4AECA 1WB5A 1YB1A 2W6PA 1EFHA 4RZSA 2WE7A 3WWCA 5DNAA 5GVSA 3SE0A 2HRCA 1UBEA 3QMPA 4UARA 1M1ZA 4MWDA 1ZD4A 4ZVSA 4DRZA 1ZWKA 4BVJA 4QXPA 4DV0B 3MUNA 5IX8A 3IMKA 3OA0A 1IBCA 2VZ0A 2AVDA 1AGXA 3K5HA 1MNAA 2P3QA 4RNCA 2RGUA 3RUFA 4W5RA 2NMVA 4G4GA 1AH2A 1LC3A 2BEWB 2JD1A 1XVUA 1HYBA 1MJ5A 3BWBA 3NDBB 1GRQA 4MAAA 4O8CA 2RGBA 4QFMA 3FBGA 5H9VA 2NYRA 3K35A 5LQSA 3UMJA 4UDNA 3W5HA 3ADBA 1QRDA 4OMUA 4M6WA 2AOUB 3VX4A 2QJFA 4F8JA 1R0RE 4KXQA 1H6DA 2XKBA 3CEJA 1U9ZA 1UZUA 2GK4A 1U1IA 2BIFA 4A8JB 1IZ7A 4R0MA 1S02A 4ZYYA 2Z30A 1G6OA 2FPGB 2JDID 3Q87B 4YREA 4W5NA 4PIPA 3NM5A 3OE7A 4UBJA 4BKRA 1YJAA 3FNIA 4RVDA 2X8BA 3QQPA 3ZCRA 3A9TA 4JLDA 1BKSB 4P81A 2QN6A 5DTEA 1NBMD 1MG0A 2NVBA 1SM4A 3KWJA 4LY9A 1ULBA 4O59O 1EUQA 4JXJA 3SS8A 5BVHB 3LM8A 4B3HA 4JYMA 2Z4TA 4OAQA 2VSXA 2DM6A 4G9BA 4WW0A 2GEKA 3TOZA 1TCUA 3F98A 1IDOA 1KO5A 2YQ5A 3B6JA 4JUIA 1CV2A 3JZFA 2Z57A 1H65A 2I3GA 2XUZA 3EW7A 5JDIA 2R84A 2GZHA 2XB6A 2YMMA 3FPAA 3D2CA 2QBYB 5BWBA 1N2BA 3K5IA 1IPFA 3PUJA 4YMGA 1BMQA 1MHTA 3M0EA 4CMCA 4KGDA 2HK9A 4XX0B 4ZARA 1JFRA 4R8RA 4JXXA 2NNWB 4F3NA 2IEIA 2XNKA 4LDAA 5JZOA 2L17A 3COWA 1GZUA 2Q27A 1LQUA 3HXKA 4KE7A 3NC4A 3GFQA 1W8DA 3O3NB 1FXWA 2ZZNA 1G2IA 4RTOA 3GVHA 1EJ6A 3H1TA 4GP7A 4HTAA 4DTIA 2WUWE 4X1IB 4XGQA 3ZDDA 4OF4A 1T3LA 2PJRA 3SIWA 1M2EA 1ZIYA 3SHWA 3WRYC 2OCAA 3SYRA 5AXBA 4MKFA 221PA 4MKXA 2OV2A 4CEHB 5KQPA 4UKDA 5JNLA 3DONA 2H63A 2ISSD 3C41J 2ID4A 4DZZA 4F2PA 2R8RA 1J33A 4H6VA 3AGQA 4LNAA 5MGBA 2P65A 3QELA 4MRVA 3DDNA 3WGOA 4YIHA 1WW8A 1ULSA 3CBQA 2SKCA 3IT0A 4E33A 4J49A 4K6OA 3EZ9A 4BP3A 1ANKA 4FOSA 1AGRA 3EFHA 2IYQA 3JD4A 3RTBA 4EKNB 4OXXA 2QRLA 1GM5A 1Y7LA 3NVDA 3H5IA 4HY3A 1B4DA 4UBMA 2OLJA 4ZO4A 3QBEA 3HWSA 5FR1A 2PH3A 2WM2A 3CN7A 3RRYA 1YR8A 3GROA 5JJCA 3CEMA 2PZJA 2BFWA 3C39A 3BTOA 5KNBA 2DWUA 1I4OA 4XPIB 3D6HA 1E9RA 5IDYA 4DMGA 2B21A 5E4JA 1XNQB 4O4HB 4LCEA 2RHWA 5JY6A 3RTCA 3AVXA 1W2HA 1PYOA 2J5RA 4F56A 2ZIXB 5CAEA 3C3YA 2VAPA 2UYCA 4EUNA 4G0XA 1Q57A 1E2IA 4F45A 3F4LA 3OLCX 2Y77A 3NTLA 2A1TR 1SXHA 3QY9A 2IELA 1ZNYA 3CRRA 3LLSA 1AK1A 1QCZA 4HDRA 4M0KA 5DW3A 4D9KA 1UAYA 2D1TA 2WTNA 2QZSA 2OBNA 2IQIA 4QOIA 1NPTO 4NABA 3GT7A 5DNUA 2X7HA 1GKIA 4JLKA 2BM0A 3B52X 2NUPB 3TS1A 1SIUA 1LXCA 4LYAA 4FFPA 4RE5A 3HO1A 1Z62A 4CIXA 4DDUA 4UATA 2DT5A 2P67A 4EG0A 4YLGA 1ZM3A 1JPNA 1GGJA 1YL6A 1F2TB 4FBGA 4PNPA 2WJGA 1NUTA 1P0IA 3FSJX 1Q1GA 3AILA 5CA0B 2D2IA 1GARA 2YHSA 1V3UA 3AV3A 2VNAA 4MRMA 3RYCB 2I66A 2D2XA 5BWLA 5JVDA 4AKHA 1Z4MA 3ISVA 5HF5A 1DUVG 1OLUB 3NONA 5JAPA 2NYAA 4TZKA 5BSUA 3QE2A 4RWZA 3K0SA 1U9IC 1ENZA 2P4EA 3FF1A 1BHSA 3M6UA 2C82A 4JLAA 4PRLA 2DLDA 4HLQB 2NZ2A 1FMFA 4EDHA 3QMVA 1HFKA 1TQ2A 4RDCA 4UFPA 1RXCA 4KXVA 5HE8A 2C7PA 2RHBA 4B3MB 1WU8A 4HPJB 5KOYA 5GM1A 5EJ8A 1R0SA 1ZQ9A 3AUYA 5C7OO 2UUPA 2X77A 2XEDA 4HS4A 5HCNA 3WL5A 4ZCRA 1ZRNA 1J20A 2FQ1A 4U8HA 2BY4A 2P6UA 5JTUA 3QEAZ 1EX1A 3BHMA 4G4SP 2X1MA 4GEKA 1WPQA 4G4JA 1DFIA 2C9BA 2P75A 4IXTA 1U0NA 3FDXA 1PQWA 2KHZA 5AQEA 5KNDA 1BEEA 3H04A 3UCFA 3AJAA 1AQLA 3GFSA 3BDIA 1Q91A 4D46A 1E4EA 4N4AA 4RTLA 1K3TA 3L8YA 4D80A 3AWDA 4RZ2A 3HYCA 3W2FA 1U2TA 4KI7A 2V96A 5GPBA 1RM0A 5EERA 3SN6A 3KQUA 4NBLA 3K30A 1DELA 1JDBB 3HMKA 4IKOA 3CCBA 3LF2A 1NMSA 1M2VB 3IIIA 3M81A 3FTDA 2J67A 1FFHA 3OCVA 3QIVA 4Z0HO 3KLBA 3E7PA 3I0ZA 2FUNB 4P4NA 3N59A 1PLKA 3ZHBA 3FMOB 1MH9A 4AJEA 4F9TA 2ADFA 1UKBA 4WXRA 5EMNA 4MICA 2ZRDA 3KZCA 3F8WA 1NBME 4LJ5A 2OT3B 1IQ0A 2WYIA 5AT1A 3NRJA 1LV8A 4KW7A 2X0NA 1U9YA 3FA2A 1Z63A 4LF6B 4RPIA 3SJBA 3EXIA 4GMDA 2RAVA 4IPTA 2BEVB 5LYJA 5AUOB