4AP5A

Crystal structure of human pofut2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
389
structure length
389
Chain Sequence
b'SRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 2
publication title Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A02
2HLHA 2HHCA 2DE0X 2OCXA 4AP5A 3SIXA 3ZY4A 3ZY2A 3ZY3A 3SIWA 3ZY6A 3ZY5A 4AP6A
chains in the Genus database with same CATH superfamily
3OEHA 1IBKB 3H7AA 2C3UA 1QUFA 4NF2A 2UXCB 2FQXA 1M7HA 2TSYB 2ZIWB 3IJPA 4RD2A 2CMKA 3NC4A 1ZH2A 4TWJA 5K09A 5T4EA 1KO4A 3O4IA 1GLNA 3BGDA 4DLNA 1IJEA 4MP3A 2PUDA 1DJPA 3HXTA 2R85A 4TMXA 3KVOA 3AF1A 3LUKA 4FONA 2IUEA 4Q3KA 4DRXA 1M8JA 5DRTA 4URXR 3WSVA 4ER0A 4RJ2A 4MUBA 5BY2A 3GLFA 4LF9B 3I64A 5TE9A 2ZGVA 1FSPA 3IQEA 2Q6IA 3LTEA 2BGRA 1ZP6A 2DQSA 3OD5A 1JHRA 4BRWA 4MA0A 1F48A 4FQ7A 4MVJP 2O8FB 4WZBA 3EIHA 2FVYA 2JJ1A 3GP3A 3BZUA 1IB6A 3DBVO 1IIBA 3M4JA 1MC1A 1TAHA 1DWOA 1WXQA 4CIYA 3V4RA 4J0QA 2QXYA 1COWA 1XTQA 4TWZA 1F2UA 2R79A 2H17A 3C74A 3GPBA 3WTBA 2R7KA 1LK0A 3AY0A 2Y93A 4C0BA 4I5FA 4N12A 4D9BA 4QG3A 1LTHR 4AMGA 4ZT4A 4Y9UA 2H11A 3DHEA 2HHCA 3I23A 4QQKA 2QW0X 5AKKA 2IUUA 3TAUA 1LFAA 2X2EA 4GMFA 2BY4A 1NV8A 1UZAA 2OR3A 3JPYA 1NN3A 1VM6A 2Q2QA 3ESRA 1TW2A 3H5AA 3O93A 4Y9SA 2Q0QA 1TRHA 1Y33E 3QVLA 5CX1A 1YQGA 3QH4A 5AVYA 4D25A 3DUFA 4H7KA 1ZI8A 2ONYA 4X20B 3BFPA 2VDWB 3FWNA 4HVTA 3VYWA 4QVGA 4CDGA 4G5QA 3ZH2A 3GYGA 4RNCA 2QW8A 3W9YA 1V8BA 3MT7A 3THRA 1HM5A 3MMXA 1D6SA 2XTZA 2BPOA 2DT5A 2JGJA 2QN3A 1OGJA 3ESCA 3KB8A 3O84A 3RO7A 4LF5B 1SCUA 2XF2A 2EKPA 3UMSA 4G5XA 2VH2A 4MPPA 1ND5A 4XJTA 2RDMA 2OAGA 2WOJA 3QOWA 1QGYA 3GLVA 4NMHA 4WY2A 3I2YX 3L2OB 3S40A 3LVQE 1DHRA 3LVFO 4ENTA 4AULA 1M0WA 1RACA 3H2IA 1TF5A 1NUHA 4EPXA 5KWSA 3WA7A 1W59A 1NNUA 1X8XA 2PSEA 2A14A 3EVZA 5E4JA 3EEOA 1OFGA 2WW8A 3E35A 2E4AA 3CVXA 4FFBB 2YIJA 4UAJA 1M2WA 2X4GA 3PQFA 4H4DA 4R68A 4LQCA 4PGMA 4BFLA 2Y6UA 4MS3B 4PLHA 3V34A 4AJKA 1DZIA 1BVRA 4P4LA 1X70A 1L5KA 3AUFA 5AI8A 5T8KC 2QE7D 4CYMA 4YUZA 1PVOA 3PXDA 4GR4A 4PCUA 1OKKA 4ZA2A 4PIVA 1YMQA 4QBGB 3FOFC 4MYUA 4LRXA 2KWIA 5K99A 2J08A 3NAMA 5CFZA 1KZ9A 1Z6XA 3Q3EA 2Q5OA 3DUWA 4MVJE 4RGVA 1NZDA 1R0KA 1YCHA 4HGRA 2PSSA 3UMCA 5CVEA 2PD4A 1YDGA 1E60A 2W0MA 3OE5A 5B2EA 1NVWQ 1ORRA 4DY6A 3LHFA 3NHPA 1C7RA 3VNQA 3L4JA 2IXFA 3NAQA 4KOEC 3WAKA 2Z2KA 3HN6A 3VUFA 5JAPA 4ITUA 3IL2A 5JS1A 3F74A 3G6WA 4IJMA 4DRZA 2Y92A 2QQFA 5KS2A 5ITZB 1H5UA 1XVUA 3DB1A 3R3UA 4BVBA 2C83A 2GPTA 2BGLA 4NJOA 1G8GA 1AUOA 4QEZA 4X1KA 3R6TA 1KO8A 4TVBA 5DGIA 4E94A 6REQA 4QU8A 3RDPA 4RVSA 3SJ7A 2XA2A 4B2LA 1P62B 3U3JA 4U2DA 2IYXA 1P1FA 2BGMA 2BGNA 2AXNA 3HVUA 5T4FA 1I6KA 5I7HA 1E0AA 5CLQA 3JQ7A 3W4JA 5A1TA 4F4JA 5JJLA 1ZU5A 4DCVA 3CPJB 3RHZA 2N42A 1NBOA 3E61A 4JB0A 2JLYA 1ZNWA 5A62A 1E9CA 3ASUA 4S35A 1ZN9A 4LNAA 3TTUA 2O7NA 1Q57A 4LOLA 2VQ6A 2MYPA 1MEOA 2YV1A 4PZZA 1PT7A 4ILEA 1NQTA 3ZWOA 4C7MA 3N0XA 4LVCA 3QEKA 2W2KA 3IT1A 4KO4S 3T1OA 3FGPA 3H17A 4U6SA 2DKNA 1HE5A 4I1RA 4BRSA 2ACKA 4FX5A 4HH3C 4FFLA 5CYPA 5FIUA 1FTQA 4ZT5A 1UFVA 4RZXA 1ZO8A 2F9MA 2GRUA 2ZTVA 3G5LA 3MSCA 3TR6A 5AVTA 2VJMB 4O8CA 3R8CA 4O4LF 3NMUF 2HIAA 3MB8A 1Y81A 3I09A 3PITA 5G41A 3TD6A 1DAHA 4Y6SA 3CTPA 1NLFA 3A6KA 3RTBA 3J7AC 5A5EA 4BMDA 4H2DA 4ZI7A 4D0RA 1YRLA 1ADFA 1KP2A 1RI3A 4LYAA 2IS6A 2CLOB 1XG5A 4IYRA 1LV8A 4PPYA 1OLUB 2OVFA 2B37A 3ORYA 1RYDA 4XWKA 4BX3A 3RS5A 3ROPA 4PNEA 1A7UA 3RU7A 1RWVA 4YUVA 5EQFA 5C53B 2O2XA 2JGIA 3K1AA 5AYVA 3Q72A 2J3LA 1D2MA 1H2FA 4M8IA 1U2RA 2VSYA 3AEXA 1NUSA 4AM8A 3ANSA 1G16A 3P96A 5AWFC 3AIIA 3O2QB 4M0PA 1O03A 1Y4UA 1J9GA 1JKXA 3L05A 3LPCA 2Z8ZA 3AF0A 3NALA 3HGTA 8AT1A 3CY6A 3MFQA 4JI0B 4IX1A 3FF1A 4DDWA 4K9QA 4A0FA 4X71A 5FT9A 2X3FA 2E1RA 4P08A 3H86A 4QQRA 2OHVA 3K0CA 3G2OA 4WCFC 5ALZA 3WRYA 1BRMA 4CDMA 4QDZA 2I2XB 1JA1A 1SXIA 2B7CA 2WFAA 3C3BA 2QN9A 4OBWA 2HOQA 1GV1A 1VHDA 4ICIA 4MJLA 4WA7A 3BEOA 4YDHB 3TI7A 2BGKA 4QFCA 3VSAA 3NWPA 4HS9A 3GF4A 1UF9A 1AXRA 2MYUA 1S1MA 1YZHA 5C4IA 3OCYA 1NY6A 3AKDA 1G98A 3KLBA 4XPIB 5E7QA 4M9UA 1J4AA 2AG5A 1FFSA 2GUWA 3JQAA 2I54A 3GLUA 4HPXB 2AI3A 3BD8A 3VTAA 3OF2A 4IIBA 2I9KA 1KQPA 3MCWA 2J1LA 1BH6A 2G07A 1K88A 1K7CA 2FJUA 3MEQA 4C0XA 4QXMA 1XMPA 5IDQA 1W85A 3OESA 4QD3A 3RS8A 4YJ3B 5LA6B 5D3ZA 2GN2A 5IVHA 3E9RA 1OCEA 2JD0A 3COSA 3DOHA 3MGBA 5LIPA 1T9DA 4E7OA 4HUTA 4GOJA 3ZY6A 2ODEA 1N2OA 2JFVA 4K7JA 4UDNA 4EENA 4US0R 2KE5A 1QHYA 3U4QA 4M0KA 4LSGA 3RWOA 3O5AA 2EP5A 3GAMA 3AM3A 4JU9A 4U0JA 3U7QA 4N8DA 1E2FA 1ZITA 1ZNQO 3BYZA 3MWLA 3N2GA 4TWBA 2BTEA 3V42A 2BC9A 3EF0A 3D0KA 1OZFA 2YXDA 4L0DA 4RK6A 4RWEA 4XB2A 3AKZA 3JRXA 4MVWA 1BC5A 4K9OA 2X86A 3CR3C 3GX1A 1SKQA 3CHYA 4BJ6A 4WBXC 3P0HA 1NXSA 1N78A 5DM0A 1CUCA 1TAUA 1VA4A 2WSMA 1UDCA 4J0JA 3PU6A 2E5WA 3QKRB 2HSEA 3V48A 1V9SA 1J23A 1V45E 1XEWY 3F6YA 4JB8A 4OXQA 3MAAC 5IAEA 3UA3A 2QBYA 3ET5A 2FPUA 2CBXA 1US8A 5TPZA 1K6XA 1TECE 2XKBA 2XUQA 2PFKA 3MTJA 3AT1A 1VCHA 1XMVA 2HD4A 3V8QA 1QFXA 1D2NA 1OWNA 3NNSA 3ICQB 2J6CA 1KFKB 1YB1A 3EWNA 3OTHA 3A4TA 4MIYA 2GF9A 3KNZA 2I8LA 3JR3A 4GSKA 3DZHA 4GIBA 4GXTA 4LXXA 2PRJA 4OL9A 4OQPA 3LX5A 4EB6B 4KBFA 1T4DA 3ADCA 2FCRA 3ZGXA 1VL1A 1F3LA 3OUUA 5I01A 1OPRA 4NOLA 2WIFA 2PZLA 4ZIRB 4QX6A 1ACLA 2VF2A 2VHJA 4J76A 3HCWA 1KI8A 4OLHA 4LCJA 2ERXA 3AVUA 2LDXA 3ESZA 1XXLA 2O1SA 3H1FA 1ZIOA 1IY8A 2H1WA 4ZJZA 1VLQA 1Z36A 3A9UA 3C5CA 4H6VA 3R7WA 3VPXA 4ERNA 5BVGA 3F73A 2IY9A 3CW9A 3FDJA 1Y8QA 2PKXA 1E92A 4OI0A 3FD8A 1UKBA 2IYYA 3RVRA 2OLKA 3K7EA 2GXUA 3VR2D 3OMXA 1LWOA 1J8VA 4HAIA 4X62B 1Y37A 3L7CA 1RCTE 2CFIA 4NI5A 4KKXB 4WLFA 4DY4A 2W6CX 3VAAA 3ZBPA 3GY0A 3EPLA 1RP7A 2GERA 2VPIA 4MV4A 4YMIA 1YI1A 1BU5A 4ZVPA 3W6UA 4OKIA 1XQWA 3SKYA 4WK0B 4F11A 1E5XA 1RRMA 2C5FA 2COUA 2GARA 5E4YA 3RLIA 3I6BA 1WOYA 3PDUA 1W5TA 5JD4A 5JXJA 3UMMA 4GPIB 1RWOA 4QTYA 1O2DA 3KQTA 4GM0A 1HNNA 2GX6A 2RJNA 2WQ7A 3HQ4O 4L8VA 1WS6A 3CKYA 5JSYA 2WD8A 4TLAA 4D8VA 3VHLB 1AY0A 4BB6A 3I04A 3SQDA 1I2DA 2DF8A 2QV7A 3OE4A 1JPJA 3KDSE 1RLMA 1JFRA 1T6ZA 1ZL2A 5M04A 1QVVA 3AI1A 4B3BA 1FMJA 3DMHA 3L0PA 4L7QA 1WXFA 2DGDA 1C30B 4O4HF 3RI3A 3RAFC 1ZOLA 4HF7A 1GP2A 1HBJA 4X64B 2PCJA 4FLMA 1CUXA 1Q7RA 2ZAOA 3OZBA 4W8GA 4P2GA 4YAOA 1RC8A 1GFWA 4F04A 2QVZX 4F72A 2R4TA 3ZVRA 4FR0A 4CMEA 1GTVA 1A4XA 4PPGA 4QVKA 5JPIA 1KJJA 3VSCA 4D41A 1KY2A 1B23P 4FC6A 2WWXA 4NKRA 4C7JA 5JFOA 3HDHA 3LCUA 3AQIA 4JFAA 5ALWA 1XZAA 3BQ9A 5IZ4A 1J09A 1XF9A 1IL0A 4IIFA 1XLVA 4S3MA 2IEDA 4PZCA 4X63A 3RVDA 3UFXB 1Q95A 1ND6A 1YUBA 2VRCA 4TRNA 4XX0B 3SE7A 2H4JA 3ZIDA 5IK2D 1P2GA 2IYWA 2W2LD 1YS2X 3H2HA 2PX8A 1KKLA 3BWCA 2H5LA 3FCUB 3FYUA 4AROA 3CFYA 1RBMA 1DFGA 3RS7A 9LDTA 1G5RA 221PA 1O96B 2IYLD 2XNHA 5C7YA 5LFAA 1CS4C 1F3OA 4R05A 2IS4A 4ZRDA 1GPDG 1OYOA 1QGUB 5JD6A 4JYBA 3WB0A 3AOEA 5JDCC 1D0VA 4GYYA 2CVPA 3BSSA 4MQMA 3DKKA 3VC7A 4BEWA 3E9CA 4KFRA 4XUDA 5TS3A 1E7RA 2CL0X 1H6BA 5CT4A 3L0SA 3ZV6A 2RBGA 1C4OA 2VIIA 3ZHVA 2GM4A 3QE0A 1IVNA 4IH1A 5JY1A 5CPBA 3EBLA 4KQWA 4LMBA 4RTNA 3OAAD 2QRZA 4JQYA 4LFCB 1RKXA 4C20A 1JECA 4R51A 4OK5A 4ZAYA 4LV6A 1ZCAA 2UU9B 1FCJA 3CNNA 4XWAA 3FOAA 4D57A 3TEFA 5L4LA 2AS0A 4GE0A 5AW9A 4CKXA 4GO1A 3QY0A 3K6RA 2J3HA 4XGRA 2VYVA 2FG6C 2XMRA 4RVGA 1TKAA 3D6MA 1P2BA 3G9XA 1KMQA 4WX2B 1CR6A 4KK4A 1P44A 1O8BA 1YKGA 2GN9A 1O95A 3MM4A 4RA6A 4CMGA 4EF6A 4ES6A 2HLDA 3CR8A 3ZHZA 1XNQB 4AS3A 2WSLA 3USES 2XVAA 1VCMA 2PGIA 1AZLA 2JC3A 2ZRJA 4V0ME 2WYUA 1ADGA 4UTVA 4ARUA 3O4FA 5LB2A 4QWMA 4IIDA 4MOWA 4JBLA 1M1NA 1Q83A 4R2MA 4J9VA 2PKQP 4CUJA 3QI2A 4OBXA 4CFYA 4CW7A 4A36A 3Q6NA 1DT5A 1PP4A 1ZEMA 2OYSA 4PIMA 5EINA 4AY6A 1KQFA 2Y1DA 1RLIA 1G3UA 1XA3A 3HWWA 2MMGA 3L5KA 4NWIA 4RENA 1HFJA 4TKVB 3ZU4A 5ABPA 5C32A 6LDHA 1QZZA 2QN1A 3H6KA 3RV3A 4RL4A 2AHRA 4YMTA 3O26A 4UMDA 5THQA 1BO6A 2WZCA 3C3XA 4QXRA 3BH0A 3QRWA 1H1DA 1IZYA 4GBJA 3ESAA 4CCSA 2J46A 2YZGA 5FDFA 3DHVA 4XZ3A 3FVTA 3UMGA 3ZXXA 4AO7A 1OTHA 3MPOA 4IDQA 3P9QA 4IJQA 3ZPXA 1UBJS 2JRCA 4X93A 5B3LA 2Y99A 2J0UA 3MOSA 3TVYA 5K0NA 2ST1A 2VWHA 4ZV7A 5TPWB 3W5UA 4AN4A 1S0UA 2B99A 4TMFA 5BR8B 5DLEA 4MW5A 5IAKA 1QM5A 3LNTA 4EPTA 1V5EA 1YS1X 2XJ9A 3UIEA 1A9RA 4A8HA 1KTVA 4A4DA 4CWAA 4HDCA 2EGHA 1FLVA 3QX3A 5BW8A 3FKJA 4L4RA 2H92A 4ZDJA 4MA4A 2HU8A 3ZGZA 2HA7A 2H4ZA 4OU4A 1MXFA 1F9EA 4TMYA 2OM2A 1EM6A 1II8B 5DSTA 1P0QA 2B0CA 1G1AA 1RC1A 1VLZA 1P2UA 2VJBA 4NYMQ 3FJOA 3V5NA 1YV9A 2IXAA 2Q1TA 2BISA 4Q15A 3AI2A 2I7XA 5CB6A 1KFEB 4LRQA 5MF6A 1Q1GA 4AMVA 3V2IA 2QZSA 5DHAA 4BNGA 3HUDA 2QTHA 2RFLA 3GVHA 2Z43A 3F78A 3T5CA 2GT1A 3C6XA 3HM2A 3SLRA 3A9WA 3OQVA 3JVIA 1SHZA 3ROXA 5JW6A 3KYDA 2XV1A 1SBZA 5DBIA 3ZH9B 3ZKWB 1W1WA 1Q2UA 3QLTA 1E7QA 3PR2B 5IVIA 1QUEA 3TDKA 1JFFA 3TIVA 3HCDA 1EDOA 1LH0A 2P4HX 2P6NA 2CV1A 1ZJ6A 4KPFC 5FJJA 4TKUB 2IIBA 4BQIA 4KAJA 4NBNA 2BD0A 2RI1A 4URYR 3TLZA 4BQQA 2HA4A 1UC8A 5ELXA 2AKYA 4D79A 1TZKA 3P9IA 4MR8B 4KBYA 3G79A 3PEUA 4S2EA 1RFGE 2C2XA 1FE8A 4WZAE 4B8YA 3ZJ4A 3QPDA 2BKXA 4KN5A 1FZQA 3ZVMA 4KAFA 1J0AA 2XR1A 2WFLB 1CTQA 2GM9A 3V4FA 3TSCA 4KWHA 2F17A 2XYQA 3WO0A 4WN3A 1RHQA 2C8VA 1DAOA 4X3OA 1XC7A 5BRNA 4CV3A 4O2AA 1HMYA 3AW9A 4G24A 3X1WA 1PDVA 3WWYA 4DDVA 2VYCA 1XKLA 5CH8A 1BXKA 1JLSA 3JYPA 3ED5A 3WY9A 1L8AA 4JV5B 3KYCB 4QAQA 3RVJA 3LQQA 3ODPA 3K2EA 1J90A 3DVAB 4J7CA 4X7BA 1E3WB 3RC8A 3HPQA 2WT8A 3DOJA 4TUYA 3OCCA 4BFZA 4BNVA 1FFXA 4JAVC 3I62A 3HBAA 4ABYA 3HO6A 4I8IA 3Q40A 5JZOA 2PYDA 2YASA 3L01A 4AKGA 1X9GA 4MMYB 4NR0A 1EUDA 1UJBA 2NU9A 2UYOA 4PSCA 3RAEC 4YBRA 2CLHB 1AB5A 3E18A 3ZIUA 4E0BA 1SHTX 3CH6A 4NOMA 1CX9B 1XEWX 4YRMA 4GR9A 2GXAA 1CUZA 1A50B 3WE7A 5CXSA 2BMJA 1K66A 1L4FA 1NYRA 4PYNA 4JX8A 4BNYA 1VCOA 3CRQA 4MEJA 2XUIA 3UH0A 1CZKA 5BV0A 3OX4A 4LS3A 1GY8A 4MVYA 3VPDA 5T64A 4UPEA 4AG3A 1WHTB 1F1BA 2AUNA 2YDXA 4Q9HA 1WKBA 3MHPA 3RJ5A 2ZYIA 4RKEA 1EVJA 4I81A 1NOKA 2HKIA 4K0RA 3R44A 2FR0A 4DLZA 1WUKS 2H2AA 2W9XA 2YZMA 3CW8X 2EF0A 3AUXA 3TLGA 4D0LB 1NXXA 1U4NA 5KNLA 3DTNA 2ZJ3A 1NGSA 4LJ6A 4MV3A 5FWAA 3IFSA 3ADPA 1WHSB 3GWGA 1JXMA 2XTAA 3AH8A 4LXHA 3ESYA 5BV8A 4H6WA 4EEKA 2C5GA 2R2AA 2ZYRA 2M2IA 2XMGA 1PR6A 2NPFA 3GGJA 1PNQA 4I1YA 3HL0A 3CLRC 5IJZA 4OQFA 2C1XA 3L93A 3BWYA 1TADA 3M82A 4LRSB 3T41A 2E48A 4JQOA 4B3IA 2IWHA 5JPCA 4EMBA 1OFHA 4RF4A 3HR8A 4FFDA 4EJSB 2HLPA 3AR3A 3DVRX 4U3JB 3S5UA 3JQFC 1HQCA 2VHTA 3GNSA 3JTMA 5TEVA 3RNOA 4UDOA 1M7GA 3F2IA 3FWYA 1IY1A 1B16A 3L0OA 1Y3CE 3IAAA 3C5VA 4KIGA 1IY0A 2GD2A 2ZROA 3A7DA 3CCFA 1PT6A 3QFSA 3VZQA 5JZSA 8LDHA 5I4KA 3K2QA 1YO6A 1A8SA 3K5IA 4D7AA 4CI9A 5A4FS 2ECKA 2BWJA 3KWJA 3AWDA 1PR0A 2PQ0A 1CUDA 1L1EA 4Z86A 5A4DA 2HO5A 2BI7A 2PWBA 4BC1A 3DO8A 3BPSA 1KH1A 1GG2A 4KXUA 2IHNA 3OIDA 1ZJZA 2BJVA 1UIRA 1X1TA 4HDKB 2WUWE 4JKIA 4Y6RA 1GIAA 1Z3IX 2Q7XA 1NF8A 4X95A 4DDUA 2NUPB 3QPBA 2A9RA 4U7TB 1UAGA 4LZNA 3PWTA 1ZEJA 4F8YA 1AA6A 1C1XB 1CJBA 2E1PA 4WXHA 4FFRA 2G71A 4QQNA 4OSEA 1A88A 1M74A 2W4QA 4J90A 3TGWA 4MQFB 1C2TA 4AYTA 3NH6A 1X15A 1ZCBA 2JLBA 1JDSA 1MRZA 1Y1LA 2Q4RA 2QRQA 3NETA 4RFSB 4EBFA 4EX7A 3SJAA 1K89A 4WL0A 2CHEA 3DAGA 2ATVA 1JHMA 3ML1A 2QAIA 4QG7A 3T7JA 1MAAA 2HIGA 1Z39A 2IYOA 3OOHA 1GA1A 2P8JA 2MJLA 4LYJA 4Z7NB 3FIUA 2B34A 3L8EA 3L1IA 1RRCA 1HF3A 1KDZA 5K8CA 2DYKA 2ACEA 3GFSA 3LKDA 4Q4LA 5E95A 3X1DA 1VMDA 5A0FA 1C50A 1DCMA 5B7QA 5TEWA 2XVMA 1DC4A 3LRPA 4EYQA 2P9TA 3S2UA 2WG0A 2C82A 2B8JA 3ANLA 1IN6A 1EDDA 3GFRA 3PE4A 5JYCA 1YVUA 4N8EA 1UM9B 2K7FA 4FSXA 2CHQA 2IU6A 4KPEC 4HGNA 5HJ5A 1RP1A 3OPNA 3OSZA 2XE8A 2Z3WA 3M49A 4BFUA 2C57A 4I2NA 5DV9A 1L5LA 1LI4A 3GRAA 1EFAA 2QR2A 1H4VB 1VHTA 2VEOA 4U6NA 1J2UA 4G89A 5DP2A 3WAJA 2JL1A 4ND2A 1CWUA 1O97C 3HKDA 5HP4A 1S4QA 4YXWA 2HQRA 4G0XA 3NHLA 4PVDA 3JZAA 4KLCA 5M3BA 3QLUC 3DDNA 2O0MA 2FMHA 1QHGA 2YOFA 2Z2YA 1V3TA 2MINA 2XRFA 1MQ8B 5HBRA 3ZWCA 5DEIA 1Z4MA 3V3KA 2PUAA 4H7IA 1JZQA 4OQ4A 3PHHA 2NW6A 3NWJA 3QK7A 4HADA 2VUTA 4JXKA 4MUYA 4RKRA 4BU0A 3S1LA 3WIDA 1JEYA 4QPPA 1FOEB 3V2GA 4BEVA 1RWQA 4AMZA 3PXEA 1F8GA 1ESMA 4I6EA 4N8SA 4PR3A 2AFIE 2NXWA 4RK7A 3DSRA 2ID7A 4FOLA 4G3XA 4DLYA 4ZVTA 4J94A 5AIAA 2Y68A 4RY9A 4CDRA 3JD3A 2I03A 4GMDA 4NE7A 5NULA 4L3WA 1BKYA 3EGDA 3VR1A 2DQ4A 4R41A 5C8VA 3U3KA 2XWSA 1T0BA 2YS7A 1GOTA 1QGAA 3BL5A 1SWWA 5CVTA 3I6MA 1YJAA 3NLLA 1JEQA 3KHKA 2V96A 1VL8A 2D8MA 3BDVA 1FUUA 3RC2A 2MU1A 2PX0A 4ARSA 3G0HA 5K3FB 4I8DA 4IFBA 2E3JA 5ALFA 2JI9A 4DRXB 4ECEA 3I3SR 3PUJA 1JQ5A 3MK31 1YZNA 2H18A 3A6EA 2LIPA 1WRBA 3GLFB 1SXJC 2WHQA 3IDSA 2C2BA 4YV7A 2EOAA 2IF0A 2Q4OA 3ZDEA 3UJDA 1JI0A 4U9IS 1OZ0A 1I5EA 1P6XA 1RHJA 2XDQB 3NOXA 3HV2A 4WZBB 3EIWA 3G02A 3CNHA 3QP9A 3RG2A 3WKAA 1NE2A 1JALA 1T8WA 2CB0A 2J07A 4O1MA 4RXUA 4UU1A 3G2HA 5ALRA 1J00A 5JJBA 1UKVY 1VE1A 2RC6A 4ROTA 4DJEC 2XUFA 1F2UB 5IDWA 1QTRA 3WGOA 2B3TA 4QVIA 4ESVA 2J4CA 2YICA 5FUXA 3U3XA 5SZKB 3NHBA 5CNKA 2QD4A 3MXOA 1KYYA 4V0LA 4DZZA 2YZNA 4UFPA 4J1QA 1Y48E 1JHDA 3HU1A 4C6HA 1U9YA 1FL9A 2P1RA 4PO9A 3AXTA 4XI9A 5ERGB 1WJGA 3UB4A 1ESCA 2OMKA 4QT4A 5CA1A 1XTZA 3MRXA 2E89A 3GGOA 2P5YA 2VTVA 3E8SA 4NG5A 4HWKA 5CX1B 3DUFB 2XDAA 5BSKA 2J3DA 2Y9PB 3RBVA 1U9IC 5BSEA 1QAQA 4U8HA 2FFAA 3K9WA 1C2YA 4PYLA 4KZKA 4DXHA 1RYHA 1ZLYA 1SEPA 4EA8A 1SCUB 3IILA 2WVJA 3PD1A 2JLVA 2AQ8A 1FJHA 4R6XA 1T8TA 4I9HA 1XAIA 4AXBA 3VPHA 5EJEA 2H51A 2I55A 1QANA 3LX6A 1ICEA 3NBMA 1VLHA 1B41A 3G7SA 5JD5A 4TN5A 4EAQA 1XD8A 3ABSB 3JASA 5HGJA 1XNHA 3KJGA 1IM8A 5LUBA 4TL7A 5DASA 2F7SA 2QK4A 4JJ8A 3SEAA 1EFCA 3ASVA 3FPAA 1L6IA 1V7QA 3NWEA 4UHJA 2GAIA 4P3NA 2OQVA 4DJDC 5KYYA 4JLMA 3CF0A 1PR9A 2P2SA 2FU5C 5AXBA 3H2BA 1B0PA 3F5DA 1Z2CA 1CLEA 1U4OA 1EXNA 1B73A 2C04A 2IX9A 4KXVA 2LCFA 1Z17A 4H7DA 1YS9A 1JHYA 4WCVA 4XVHA 5CIYA 3GL9A 4FWTA 3O9ZA 3JQPA 3R7FA 5L51A 1P2FA 1PK8A 4LJYA 4M7OA 2KLHA 4BIMA 4XD7A 4FHCA 3ZD7A 4ZOQI 2V4UA 1UBMS 4DIMA 1YR7A 4FEYA 2QLNA 2Q1SA 2VH1A 2BZGA 2JZNA 3QV1A 5JDIC 2WTAA 5TS2A 2LNDA 3QVVA 1D4AA 2UUPA 4X1KB 2FFJA 3A6JA 1ICIA 6REQB 2WU1A 4LW8A 1RPNA 1CUGA 3ZXSA 5JRZA 4QHTA 3AVTA 2YX1A 4IRUB 4WLEA 3G2MA 1WBDA 2Z2IA 4P3PA 5B4TA 1D03A 1XCLA 3FZYA 2MYTA 3JQ7B 1Z56C 2B8EA 1TYBE 4P84A 1AUXA 3ZE9A 4NRDA 5I47A 1WPQA 4YDRA 1PZGA 2J9FA 3IBTA 2E5FA 3KAKA 3NHFA 4UZFA 3X1JA 2G9ZA 1HYEA 3RRBA 5IULC 3RRZA 4PHCA 1SC9A 5MDHA 1T5DX 1EINA 4CGYA 1NLMA 1V8FA 3DFKA 1E5TA 2W2KB 3G2PA 5LSAA 5A5DA 3ZHSA 1P4HA 2FUKA 5AJHA 2ZYSA 4OUDA 3Q2IA 3VISA 6ADHA 2X1HA 3KQVA 4XGNA 4JVMA 2HXGA 5FTJA 3W2EA 1HV8A 4QTXA 2EFHB 3PX3A 4BZWA 3H4IA 5FPYA 4C0LA 3HWX1 1QH0A 2PX2A 2Y67A 5AQ1A 4EI2A 1E2NA 4KOAA 3UBMA 2GM3A 2HTFA 4ZI7B 7REQA 1W35A 1JQDA 2R47A 3RU3A 3N6XA 5C37A 4LYDA 3H8VA 2RGDA 2PKYX 2I5PO 4MITA 2I76A 3QBVA 4F9TA 4ZYLA 3IA7A 5AW7A 1TTTA 1TCUA 1EJ0A 4MYRA 1GM5A 2V1XA 4IQ8A 1Q1ZA 1ZI6A 3K1AB 4GYJA 2WM9B 4KWTA 1KYTA 2QU7A 2IOFK 5HF5A 2R751 2TS1A 3UTCA 3DGFC 5T67A 3WGYA 5A9RA 4G65A 1N5MA 1N77A 3QJYA 4IZ6A 1STOA 1TTHA 2O2ZA 1G17A 4UXHA 4F4CA 5ENDA 4YCCA 2H7VA 3G2LA 3QEMA 2VXCA 1TM4E 2GPAA 4BASA 3HFRA 3G7UA 4FTWA 1J7JA 2YC2C 4ZHQF 2F8MA 3GDHA 3CLSC 3MLAA 2XTJA 1JDBB 3YASA 1RWPA 1T2DA 4ARBA 2O7RA 4UNPA 3JAMA 1GAEO 4PPNA 2A9PA 2EVWX 4MV5A 1KOGA 3BVPA 3L79A 5EJ5A 3R20A 3TQRA 3VSBA 3Q3VA 3P27A 4URWR 1BX3A 1I0ZA 4LKRA 1E2LA 3WBBA 3C7DB 1B00A 1O6GA 3IBCA 4IZIA 3B3QA 7AT1A 2ZK7A 4MCAA 3S44A 1JILA 5C8YA 3D1VA 2G1PA 2UYGA 1A8HA 2E9SA 3JQAB 2DWQA 1MV8A 1NRJB 2PA3A 1BS2A 3C3KA 4FW8A 4J4HA 4BFSA 4V1CI 5C7LO 3FNHA 4ZCLA 1O94D 5FPQA 1UPUA 1YDMA 4GPD1 2OSVA 4Y2XA 4HGQA 4C0JA 1OR8A 4FE3A 1D09A 1C0LA 5SV2A 1GO2A 1L1FA 1I3MA 1UMCA 5AQEA 2OHFA 1W85B 4LF6B 2VJPA 4NEHB 4Q9JA 4C6RA 2ZVPX 1E6UA 4KIWA 2H1FA 4LBWA 1U2PA 1SHLA 1ZWKA 3KP1A 4IDFA 4PLCA 2ZUTA 3TKYA 1AKYA 4D42A 4EMSA 3HUEA 3RYTC 4B6QA 2O05A 1NR1A 1I9GA 2FW0A 2FWJA 4B3CA 5BMVF 1J8QA 3P97A 5KJCA 5H3HA 1TMOA 2QT9A 3PNSA 4CM5A 1W0KA 3U4QB 3IVGA 2Z5GA 2FWMX 4ENWA 1WQ4A 3CZRA 1XCMA 2IEGA 3CQ9A 3L49A 4KO2S 4WACA 1EWVA 3N2GB 4LY0A 2RHGB 2DT8A 2F3UA 2WUDA 3ZWKA 2HF2A 3CIOA 1O08A 3PBKA 5BUSA 2VCEA 4LHEA 4DAEA 3W3ZB 5FX2A 1J33A 5FJIA 3HYSA 3I4FA 3TBFA 1NQWA 3EQZA 2HIMA 2HCBA 1Z5WA 1F5NA 3DMPA 2BFCA 2BP7A 4YDSA 2IYSA 2VK2A 1W25A 1J8YF 2GD6A 2QBYB 1N6KA 3L02A 2H8GA 3FLBA 3LBNA 1US8B 1AHNA 3EF1A 3LP8A 4UVGA 2GF2A 3OU6A 5M2QA 2E2WA 4D9JA 2DPMA 2YVAA 4LXYA 5FWDA 1NRXA 4XOUA 1MP0A 4K28A 5GTDA 2BM1A 3KUDA 4OLBA 1YBMA 4V2IA 5BMOA 1P5HA 3H11A 4DG8A 4F1KA 1TQ6A 2C5EA 4EGFA 3SC2A 1LVHA 2B4YA 3WHIA 5H4HA 2Y1WA 4B6RA 1Y1RA 1FPQA 2JG3A 3FMOB 3ZCUA 5I9TA 1QCDA 5KNCH 3LKVA 2ZJBA 1EA5A 3LDFA 1F4PA 5CFOA 1R12A 2EEZA 1NR7A 3EFOA 4G9EA 2NP6A 3FCEA 4D8UA 2HBZA 4Q3BA 3MIIA 1QZTA 4HFJA 3R7WB 4DA4A 1UQUA 5BVGB 1YZVA 2AN5A 5TVKA 4C08A 5JO0A 3HXQA 1MB4A 1Y8QB 1BN7A 4MLCA 5EE9A 5IBCA 4Q1CA 5KOHA 1ZN7A 4HY3A 3UA4A 1V6SA 4IHJA 4N0PA 5H7XA 3VAZA 4EHIA 5CLJA 2FNAA 2FR1A 3BD6A 4PHFA 1T34A 4YR7A 4S1NA 2QS9A 4GNKA 1FDVA 1JEDA 3H9UA 1UZLA 4ZJYA 2FPPA 4GOXA 2A5JA 2BCGY 3NOQA 3UOGA 1SG0A 1P2VA 1TZJA 3COJA 1YOBA 2YIMA 3V7UA 4GI5A 3VH4A 2O59A 5I5EA 2EBUA 4DEXA 2FFBA 1KJIA 1UBFA 3WQQA 1GJRA 1E1DA 1T15A 3GFPA 2LBPA 1Z5ZA 4YRZA 1XKQA 3MWYW 3MA0A 3H9BA 3KYJB 6CHYA 3L7NA 4K03A 1Z07A 1GAWA 2IHVA 3KKLA 5HBGA 4MUJA 2HF9A 3TFOA 1GT6A 2H0QA 2BEJA 1HOTA 1GCAA 2ENUA 1GYPA 2YBEA 3KU1A 3O3OB 1M6HA 4L4UA 1ZGAA 2OV1A 4HYQA 2OGUA 1KZ7B 1XZCA 3TUIC 2Z2ZA 4NBWA 3OOWA 1V5GA 2EATA 1A9YA 1CC1S 1DOHA 2PQMA 3CRRA 4BPRA 4TS4A 5T5QA 3H2KA 3KD2A 1NUTA 4GGPA 2A2ZA 3UCXA 1MH9A 3ZU3A 1E2DA 3S1SA 1TC1A 1Z0UA 3IE0A 1JU4A 1Y7IA 2HGZA 2H4WA 4IDOA 4YO7A 4DMRA 5BYJA 4DUGD 4FNGA 2A1TS 3LGXA 1XA4A 2AMYA 3MUOA 1NULA 4MHOA 2ZSKA 4LJAA 5CDHA 5TQ0A 4MQLA 2R8EA 2YN2A 3DW3X 5EJ2A 1IHXA 3IBYA 4BMCA 4DV2B 1OAAA 1ZRHA 4H6PA 2XI4A 4FZRA 3AHJA 1LCIA 2M98A 3FHLA 4J0HA 5ALLA 1SG9A 4B87A 5TGTA 2YOHA 2J7PA 3TZLA 3NT5A 3WK8A 1Q0LA 2C4KA 4JIMA 3AB3A 3TTVA 5L4NA 4M98A 5GV7A 1KXZA 4G1CA 3FYUB 3OH8A 4QYSA 1BE1A 3T5TA 4DBVO 5ALMA 4G5OA 4Z5XA 5AVSA 3GLFE 1KEWA 3FLAA 1V35A 3IT3A 1VLMA 3BQNB 3ZWDA 4DLUA 4K9RA 2JGAA 5KDLA 2GK6A 1Z08A 2QYTA 4BJ5A 2ZE8A 2FEXA 4YAKA 3DC2A 1L7BA 2I1VB 3R8FA 4JH0A 3A3OA 4L5YA 4G84A 1WU7A 3TW6A 3D3QA 2PGNA 4PBTA 1TO1E 4LPSA 4ARIA 4KI0A 4GI2A 2I66A 4GUAA 2X7JA 1KRWA 1YRQA 5CX4A 3PNYA 2FW8A 4MVJG 4V0OA 4FN5A 1GNVA 3QYAA 3PI6A 3PX7A 2ZR8A 4IQ0A 5DBOA 4XWWA 2GFIA 4YT2A 2YVUA 4FFMA 4L95C 1UMKA 2CL7X 3DYVA 4ZDWA 4D4HA 4URFA 5CA0B 5K6AA 2Q4TA 3PQ7A 3W0LB 3PUHA 4DV5B 2QA5A 3OP4A 4A82A 1DAFA 2Q4EA 2VWPA 3CBQA 3V8PA 1X1AA 2XOKD 5KX5F 4XIGS 4RA6B 4HLDA 3X1MA 3U5ZB 5FL7D 4R40A 5I9MA 2VDKB 1OXUA 4HTFA 5E6UA 1VKJA 3QHQA 1BGXT 3FI0A 3UK6A 5FFMA 3ZKAA 4BBPA 3HWSA 5A3RA 5IYZA 1VJ1A 3DOIA 1RZRD 5FA6A 5ALIA 1TU3A 1NP3A 1ORTA 2VZ9A 3SF8A 3MBIA 4O4IF 3WA6A 5DNAA 5LBIA 2FQQA 1AS2A 2ABWA 3HYNA 3WFJA 4P35A 2JD2A 4UBMA 4RD0A 3HY3A 2ODBA 2FWBA 3H3XA 3P4XA 5J2TF 2PWPA 4QYMA 3TCKA 2ZYGA 4MMZB 2D62A 2WPDA 3RIXA 4IIEA 4C1BA 5KIAA 3PHCA 3C7TA 3UJPA 3JVVA 5EAIA 1GNTA 1T9GS 1BYIA 2VP0A 4C06A 1N0WA 1MOPA 3E2PA 5EWJA 2GVNA 5BQXA 5AW8A 5JQWA 2ZANA 2HNKA 2PSFA 2XQGA 1LKZA 5C81A 3UKOA 3D1JA 4DSOA 2FRDC 1OWMA 1PLJA 1U2EA 3D2AA 3L7OA 4AY5A 4V38A 3MWDA 4OBEA 4ANFA 3PD7A 5DT9A 2J0UB 2BHTA 5K0GA 3JYHA 4QDOA 3RSQA 4PYJA 2KSQA 4OQMA 3F7TA 3GPLA 2ZAYA 4PZAA 3S1AA 3HU2A 4O4JA 2M9MA 3KB2A 2PVPA 1XQ6A 4E2XA 3REFA 4UTXA 2OORC 3HB5X 2OZEA 5SZHB 2QTZA 1EX1A 4R2IA 5MGBA 3HYCA 3GLSA 1AB6A 3UMJA 2NSHA 4YR9A 2CUKA 5ICGA 2DH6A 2WA2A 1BEZA 1E6EA 2ZI5A 3DC7A 2ZS8A 3ELDA 3FBGA 3SK0A 3TIXB 1IJBA 4BMXA 4EABA 3OHPA 2BF7A 1UT6A 2IJGX 1F12A 2FOIA 4ZAZA 1KR5A 3T7RA 4M1WA 3ZHCA 5LOVA 3O4RA 2X7HA 3UAWA 1KO5A 5BNTA 1E3MA 1YDWA 3ZJ5A 1GDHA 3NHSA 2ZZMA 1U6IA 1CUWA 2NZ2A 1NOJA 4CHGA 4K0KB 2DE0X 1EVQA 4CMJA 3IVMA 2JDID 2YVLA 2FXIA 4Z9YA 5FORA 2QN2A 3BJZA 3KYDB 1EFRD 4ENVA 1LLFA 3PUIA 3U40A 2GAFA 3K4HA 5AVOA 1G8YA 3B9QA 3VJLA 1HY3A 2GBLA 3C8UA 3GPDG 2B35A 1JFFB 1GZVA 3C5EA 3R23A 3KJQA 3QSGA 4F4UA 2J5XA 3HNPA 5A2QA 4WFQA 1YMVA 5IPFA 4M1EA 1X0VA 1KI9A 1MIOA 4IDNA 3LM8A 4RWZA 4QOEA 2CZQA 4OG2A 5EP1A 2NZJA 2OO5C 2PRSA 1LF5A 3BGVA 1FFEA 2W4MA 1G0NA 1VA5A 4IDHA 4W7SA 3VC1A 5EUBA 3D31A 2O5CA 2EJBA 1NR5A 2DCMA 3MAJA 4Y2JA 4DIBA 3H75A 4FXOA 2Z4RA 1ZH8A 4RHCA 1B74A 4BMPB 1WTCA 3KZKA 3ID6C 4KVZA 5FBZA 2VQ3A 2YCLA 2VHWA 1TT5A 4LVOA 1GA4A 2FCAA 1QQTA 2X0DA 4P6VF 2ONZA 4O2AB 1QTQA 1CF9A 2YVQA 3NEYA 3VVMA 1FVFA 1YB7A 2O0JA 4UD2A 5K1ZA 3QNWA 3RTDA 1EQ2A 2WWFA 4PVCA 1U3WA 4MLPA 4AY3A 3AINA 2CKMA 1ZMTA 3AM1A 4RHXA 4TUYB 1WMDA 3CZCA 3KR2A 3IQDB 3MUFA 4MVJH 4N49A 2OCYC 2BEVB 4R1TA 3UM9A 3CEHA 1EUDB 1HTTA 4Q47A 2NU9B 4B32A 3VR3D 2OM6A 4ER7A 5I7EA 4E46A 3LO5A 1E1CA 3TQOA 2W42A 3CUVA 4Q01A 2DY0A 3RRNA 4F5ZA 1LJ8A 3GR6A 2FMKA 1FW8A 4D8YA 2FN4A 3IJEB 2JFBA 1XZPA 3AVXA 2WHRA 4DWVA 2P68A 2OT3B 5C5IA 5CFQA 2O7QA 3X1KA 1YRBA 2HMUA 3HDYA 1RYBA 2H2GA 3N2NA 4G1EB 1Y9JA 4MLZA 2J30A 3BEDA 4N3BA 5KVQA 1SQ6A 4M6WA 2QG9A 1E18A 1JWLA 2A9FA 4WGGA 1CFZA 3AI3A 2VYFA 4FBGA 4IYJA 5GIOE 2O3RA 2I3BA 4MKZA 2WP0A 1SWVA 1JQEA 1TGVA 3NBUA 5FLKA 2C07A 4WSOA 4XUEA 1R8XA 4ZU3A 3TLGB 1YKSA 5BYBA 1L0BA 4D82A 4Z7JA 1P0MA 3EB9A 4EO9A 2KW5A 3ZR4B 3SM3A 2DR0A 2X13A 5G4KA 1SBHA 5KTMA 5IW8A 5AI0A 1DMSA 1JAXA 1YZKA 2PL1A 4ID3A 3RUEA 3W4IA 2CYBA 1T1GA 3N2KA 1U3GA 2O57A 4QPJC 2Q3LA 4IP0A 3DE6X 1EVIA 3E5MA 3I1JA 3MT8A 4CV2A 2P65A 3UAGA 3FCCA 4YP6A 1ADCA 1VG9B 2Q1WA 1GPJA 3L7JA 4NYJQ 4RD1A 3KHSA 4JZKA 4KODA 1NXVA 1T4MA 1Z7GA 3L04A 3VJKA 3CU5A 1SU6A 4GEKA 1ACMA 2W37A 4PHGA 1W6UA 2GJSA 3UEOA 2GESA 5KUTA 4UZEA 4D5EA 1VSTA 2WD7A 4UKDA 3CLHA 5HNKA 2C94A 4NZZA 1E2KA 3KZNA 5SY4A 3HL4A 4DLAA 3VVLA 4NICA 4LGYA 4RPLA 1SNYA 3CJQA 3SSOA 4BN0A 4EHJA 1CRPA 4HZIA 3EUFA 3SIWA 3HUUA 1Q14A 4TGLA 1NXQA 1UK6A 2FEOA 1A5BB 4UREA 4NCKA 4RJTA 4E21A 1DQRA 3KQLA 1C7JA 4N0EA 1AQJA 1GL3A 3KBOA 3F3YA 5IZCA 3R7LA 3VOAA 2RB4A 4EDHA 5C8XA 5BQPA 1TU0A 3L18A 3LWZA 3UAZA 5DGDA 3D64A 4CG0A 1FP4A 1NF9A 3IULA 3EJ6A 3NPAA 1GAXA 3H16A 3RSCA 2JANA 1E6CA 3IAFA 3QPWA 2YINC 4HXYA 3WYFA 1HDRA 3Q85A 4M9QA 1NJGA 4LFAB 1AKEA 1XJCA 3B82A 1W87A 3SS8A 3FPCA 2WVHA 4LHYA 2LUOA 4EHNA 1BE0A 4KSYA 4HDSA 1E6WA 2H9YA 1W48A 3BXOA 4N6GA 5AJUA 2BBWA 3AILA 2GLXA 2QVCA 4WJKB 1ADYA 3C48A 2WPNA 4V3CA 3U62A 4YUYA 2WIAA 1KJYA 4IIGA 2D06A 2OGTA 3DE7X 1RHRA 1VKRA 1NW9B 1PJCA 2XQKA 4IIUA 1RJDA 3VOSA 4EHBA 3SJCA 3NBYC 4Y2HA 5C1PA 2JK0A 1LPMA 4AQDA 5A9TA 4Q4CA 3U3DA 5IX8A 4IGKA 2GHIA 3H99A 4YUWA 1K06A 1N8KA 4INOA 5HG0A 2ONCA 3LFHA 1GR0A 5B1SA 1O5OA 1CLUA 2ECQA 3TR0A 1U3UA 3HKDB 5CPFA 5FTMA 3VBCA 4PC3A 3Q41A 3MD0A 1X9HA 3MBOA 5T4BA 4TVOA 3B7GA 2DR3A 2O3TA 4LRYA 3B6ZA 1E61A 1RD4A 1LW7A 4EL0A 1QG0A 2MINB 2WSSA 3DL4A 4ND8A 1UFOA 3I01M 4O4LA 1G5TA 3B38A 3EEBA 3A32A 1TYDE 3I92A 3SFTA 4EO4A 1JEYB 2Z0MA 3K31A 3R0QA 3UJCA 2A84A 1JR6A 3WMWA 4LZPA 1Y3HA 1N6OA 1XXHA 1RI1A 1OAOC 2DTEA 2YUIA 2FB9A 1ZW1A 3H18A 5DMHA 2IOFA 5C80A 5JNSA 5JZBA 1Y6FA 1TYEB 3WMFA 4UM9B 3IUNA 1JN0A 1JYEA 4CCYA 4UMVA 4YUXA 1F8UA 3S5JA 3WC4A 1N2JA 3DZJA 2P2ZA 3EGDB 4E12A 3K94A 3GEHA 2HSJA 4BO0A 3ETEA 4HLCA 2Q5LA 5FEUA 1J70A 3HFSA 3CEAA 3ZD6A 1KETA 4O3FA 4AJEA 1JEQB 1Z6GA 4E3ZA 3MVEA 1IXKA 1UWCA 3LHIA 4GOLD 3ZVLA 3WOVA 3A10A 2X4IA 1NA5A 4JCCA 1JNYA 3U6BA 5EVCA 3D7SA 3Q0TA 4BJHB 4CL0A 2OOKA 3I73A 3HCOA 1N5LA 3NU1A 1VSVA 2BDEA 2NU8A 4AZ0A 2Z09A 3NTRA 4DB4A 4OUKX 1MW8X 3L0YA 4PZDA 4WY8A 3R3SA 4G8BA 4GHWA 4JP1A 5KQMA 5AI9A 3ND9A 1IVSA 2ZVDA 4W4TA 2AG8A 2G1AA 3N8KA 5DKFA 2CVFA 3LSYA 4Z0PA 2B8TA 3W1VA 3W8FA 3W8RA 4I4NA 5CITA 3GG2A 5BRJA 1XZNA 3GCZA 1F5SA 3RTGA 3SPXA 1QCZA 1GRRA 1YVDA 4PPQA 1U8UA 3X1YA 4P1ZA 3ISJA 1CUUA 5J63A 4AJ4A 4KN9S 4LJLA 1APBA 2G9UA 3K6KA 4J16C 4DLSA 1XRNA 1IVYA 3SC4A 3L0DA 2XOXA 3G17A 4Z7QB 5EXEA 2PT9A 4KQJA 5DX8A 5CA1B 3MYRA 4JBXA 1YUNA 4ZU6X 3EVFA 4BN4A 3RADC 1QU3A 4ATNA 2PLAA 2PL9A 5IJ9A 1D1PA 1D5WA 5HUHA 3BC1A 2V6BA 3AJRA 4S1OA 3WLJA 1EPUA 3L1HA 5EIOA 4KDFA 4M0MA 5IAGA 5A3JA 5DK6A 4NECA 1YE3A 3NB0A 4KLNA 5AOCA 1MBZA 5E0KB 3Q11A 1ZDMA 2G8NA 2A5FA 1DDIA 4G5RA 4JGBA 4TWIA 5G1NA 2ETVA 3I2IA 3I76A 2IDMA 4ETMA 3F7OA 3VHQA 2P4QA 4NK5A 3H87A 3M1YA 3ZNPA 2PLFA 4C7KA 5LXTA 5LQRA 1E9EA 4M9XA 1M2JA 4NZ9A 3IHLA 2XX3A 4R8SA 1F4VA 3BRQA 3GUZA 1G63A 4YJFA 2PX6A 2AZXA 5JARA 2EFEB 2WIDA 2ZPAA 4JVNA 3TTSA 5D01A 2QUJA 2P9FA 5BT9A 3U1BA 3RODA 3TW8A 2VI5A 3JASB 3OCUA 1DBQA 1ZESA 5EPUA 3EY4A 3HI4A 5WRFA 4BNJA 3GZNA 3O82A 3OFSA 1RJWA 4ESEA 1Y0BA 4RGQA 5KYYB 1N7IA 4CCWA 4HXEB 4EKNB 3IPCA 1U2GC 5L8VA 4DLBA 1EKXA 2A9VA 3P52A 4YNBA 2C31A 4EG0A 2R8YA 4RVHA 2BYTA 1C7IA 1ZZGA 4BAGA 2I71A 3IE1A 1TIBA 1OH8A 2DU8A 1RRVA 3A6GA 4HP8A 3W7BA 2AMJA 4HNUA 1H0KA 2XYPA 1Z2DA 1HURA 3CC8A 4MI6A 4RFLA 3SBEA 1V7ZA 3GUVA 3ROEA 3O4JA 3LPAA 4PEVA 3HNRA 3PNMA 2V7TA 1PJSA 2BM9A 3ZBQA 4G0VA 4C87A 3KETA 1H5NA 1ODCA 4EGAA 1DIBA 4JOSA 2OV3A 4Y18A 4AF8A 1WL8A 4KTVE 5B58C 4EA7A 5AJYA 3AYXB 1F6BA 3SXUA 4FGSA 2HR1A 2DEUA 3VNUA 4N7JA 5L45A 1W36B 4ZCTA 1E6KA 1EFVA 4Q9LA 5KDDA 1A9PA 2J3MA 2A8YA 1CERA 3ICOA 3QV2A 4G4JA 5IF9A 2Y2VA 4YBZA 3V8BA 1QOPB 2MSEB 2J9FB 2IUFA 2YWGA 3NOVA 4KYTA 2AXQA 2M6RA 2F43A 1J1IA 4IEFB 1F38A 5EJ7A 5DTQA 4ZQCB 3STVA 1RPZA 3FGOA 2QT0A 4ZPXA 3R1IA 1SZCA 1CUSA 1VPLA 4GOND 4OUDB 3AZQA 1N34B 4BKPA 2Z5FA 4OMFG 4QXQA 1PUXA 2HDWA 3GJ8A 3LBAA 1N5JA 3EAQA 4JJFA 4QTUB 3KVRA 2NAFA 2XUHA 1C14A 1P6QA 2XSZD 2W6MA 2FY8A 2OG2A 1PLKA 2EGGA 3FMFA 3NTOA 4FILA 5IJ0A 3KS9A 3VAYA 3MCAA 3PICA 3ROFA 5G2OA 3ZVNA 4YJ3F 4LXQA 5LA6F 7REQB 5JSQA 1HK7A 1P1HA 3R74A 3WJAA 4RSHA 4O5OA 3O0TA 3W6PA 4QNNA 3D3EA 2FFQA 2DG2A 3PFGA 1RXWA 1DEOA 3MG9A 1DO8A 1O4VA 3L0CA 2ZRLA 4B33A 1X7XA 3F6EX 3KR0A 3NDIA 2GCOA 1L1QA 2XMQA 4BUJA 3BT7A 1VJDA 2GFHA 4NOJA 1AMOA 4MWBA 2WV9A 5JCZA 3P32A 3I9OA 1G8SA 1BMTA 3MWJA 5JI2E 3A58B 4N47A 2UDPA 1Z73A 1LGYA 1SVIA 3TL6A 2E4XA 2NYAA 1QWSA 2FF5A 2YYSA 3OM8A 3QEMB 4HL6A 3ILHA 2P1DA 4A2QA 2HREA 3QPCA 5AKLA 3V8EA 3EFHA 5DNDA 2CWDA 3GJRA 3NDPA 1ID8A 1ZD4A 2GRJA 1C41A 1QNLA 3HDJA 3N0VA 4GX1A 4XSHA 4W7IA 4C05A 2RAVA 4KLRA 4DIUA 3IT0A 4M4SA 1MGPA 1LK5A 2PTHA 1T9ZA 1E96A 1B15A 1E1QD 3AJ9A 3WGUA 4D0GA 4F5YA 2QM0A 1GEGA 3Q9SA 1C3EA 2F90A 3VRHA 4AK9A 1JEEA 4DCJA 2C9YA 3PPXA 5E1OA 5JMOA 3IMGA 3CVYA 3OT4A 5C8YB 3D4BA 4CV1A 4ENQA 2A6PA 1GAJA 1JP7A 2R5WA 2GHRA 4IMRA 3EVTA 1U1GA 2OHOA 4UEWA 1J9EA 4WDRA 1NQXA 4XWTA 5JLAA 1PEKE 2OQIA 1FLAA 3QKTA 1PFUA 1T6YA 2FJPA 3E03A 4TM8A 1G4HA 4YONB 1GU1A 2WTMA 2ZKLA 3OZ7A 4YRKA 1G3QA 1UMCB 4Y2UA 5ESWA 1EGHA 3BG5A 3GCWA 3CLKA 5A2GA 4RTQA 2ZJ2A 3ON5A 2BRUA 4JBWA 5TJ9A 4CVNA 4ZYWA 1K97A 3LBYA 4HHEA 3L8FA 3BKWA 4I14A 4WGFA 2E55A 5CT8A 1EFUA 4US1R 4GDFA 1ZGJA 1AKVA 1FQOA 1G64A 2ZRQA 1YRYE 2HX1A 1AH2A 3LZCA 3DFFA 2QMYA 3L6DA 1DIAA 1FDSA 2WHPA 2YUTA 2GK7A 1HDZA 2HSZA 4HYYA 4Q7JB 3BFKA 5MGNA 4GOKA 1VJTA 2OYRA 3D2CA 4QYIA 1N6PA 1NX9A 2HRRA 2VBGA 2PY6A 4TWRA 5TSDA 1KYXA 1P9LA 2XMZA 5HKAA 1I7DA 2YWHA 3DOFA 1PX0A 1WD7A 4ZGBA 2XIJA 2BFCB 1Q84A 2BP7B 2HJHA 4PG4A 5IUNC 4I9FA 4HJXA 5JS8A 3FB4A 3LY8A 1QR2A 1EVKA 2NVUA 2GAAA 1Z8NA 2PO5A 2QX4A 1C0PA 3DZGA 4HCJA 4PQRA 4TX1A 3IMEA 4IXNA 4OIFA 4YRSA 1TA4A 2ZIGA 3QQPA 3EIQA 3JQBC 4GSYA 1OI2A 1EHIA 1Z0KA 3PNOA 1HT3A 5HK9A 2JW5A 3H11B 3I5AA 1KI7A 3KVVA 1DS6A 3LBFA 3SX2A 5CEFA 2LCQA 1X7GA 1B4DA 2NQTA 3EXFA 2HMSA 5CM9C 4R31A 4ALIA 5DDIP 3NRBA 3B52X 3ZQKA 4UASA 3GUUA 2HJRA 1A76A 2ZYTX 3EFOB 1RXCA 4R7GA 3ZQ6A 1V1JA 5JROA 2VSNA 3IB3A 4XEUA 3DBIA 5CA0F 1Y82A 1Z0JA 1I4WA 4MRNA 1T5HX 2WLTA 4TMVA 1QV9A 2BI8A 4QNRA 4OQNA 5K0JA 5KOHB 4FCTA 3SR4A 1ORWA 1T4CA 2WNSA 1JLHA 4IHJB 4RVFA 1MA0A 3ZEIA 1A3CA 1V41E 4RXMA 3M6UA 4JT2A 3O1IC 5ERYA 3ZQUA 4K1LA 1XK7A 1GG9A 4HUJA 5FNZA 2RHRA 2FPPB 3RC7A 3UXEA 3KE8A 1QZUA 3AP3A 3K09A 4N3GA 3JALA 3ZG6A 4ZCMA 4UU0A 4HLUA 3M5DA 3KTFA 3UYKA 4HDRA 4BJ3A 2ASEA 3A4LA 1ECBA 2V7EA 3INGA 3C45A 1Q91A 4L0QA 1IG0A 3EVGA 3L7AA 3SMQA 1GKLA 2XGOA 3OTIA 4YV2A 3OLCX 4Q34A 1B3RA 3G5TA 1KWGA 5J3JA 4GBED 2PVSA 2OFFA 2AKEA 1OC2A 1P4AA 2VXYA 5FUQA 1NW4A 4B3MB 4ZQFA 1MO6A 4I50F 2FSSA 5KSZA 1FP6A 1PVDA 3PT9A 4FGKA 1H23A 1FIUA 1LBTA 3KXLA 3T4EA 3ITDA 3R3JA 2XUAA 4RPKA 1RYEA 2XB4A 4X44A 4LJ9A 2WRZA 2PAFA 4JLUA 4QDXA 3B7PA 1AKRA 4B2YA 3Q15C 1XN1A 4KYUA 1EUYA 5HTKA 4JUAA 1NC3A 2OP1A 2VK1A 3SHQA 3TE7A 3UG7A 3T1NA 5TQ0B 4K6CA 1CUIA 2ZIZA 1TD1A 3KT6A 3LC2O 4IDCA 4XE5A 4PZPA 1O6BA 4I6GA 4Z9XA 3V4VB 4BWGA 5CFPA 5I51A 3JQEA 1DAGA 1WPXA 5F4BA 5GP1A 3BDIA 1CUFA 4C3UA 3MTDA 2WY2D 4BLRA 2CSXA 2G17A 1FQWA 1RWKA 2WHYA 4E03A 2ZM6B 2QPLA 1M1XB 5AKZA 3K0KA 4M89A 3RIYA 3TPCA 3TTTA 3D2LA 1LLQA 1MAHA 2CE7A 3HSYA 2UZIR 3IEIA 1CUHA 2F8LA 2FEPA 3EXHA 5G0WA 2C96A 2PUCA 2QGNA 1UPTA 2VRBA 4LNUA 4ZVUA 2OD2A 4AC9A 2XBUA 4F84A 4OLFA 4NE9A 3WGKA 1P1JA 2ZSIA 4MUHA 4AD8A 3FWZA 4MAFA 5C31A 4RVUA 1QPZA 1HNWB 3JQ8A 4E1VA 4J3FA 1ISFA 4G6ZA 1AKMA 3QVXA 3DJYA 3QUTA 3CONA 3LO8A 1GTZA 3PE6A 3T9CA 1X1DA 5H83A 4MPTA 5AOVA 1WP9A 1QKJA 1ISPA 2XMPA 1LQTA 2O19A 1G55A 2AZ4A 4F85A 2XZTA 1HQDA 3ZOZA 3F71A 2Q8PA 4CG3A 5HIKA 5K0TA 2J9RA 2QAGA 1NUUA 1QQ6A 1TT7A 2JGMA 1C7QA 1AJEA 1ZK2A 2GJ8A 3WBJA 3M1LA 1I4EB 3CG4A 3NASA 1C9KA 4MRMA 4QKQA 5D7BA 1D5CA 4PLVA 1QMPA 1LZKA 1JDPA 3Q8WA 2H4YA 5KWEA 4I0WB 3NS7A 4E2YA 1L7MA 1IATA 1XDZA 4IBOA 4CI0B 1SVKA 2X5NA 4HTFB 5E6UB 4CFZA 3H9GA 1FU7A 5IYZB 1L5SA 5K6RA 3A2MA 1Z2OX 4TZ0A 2DTXA 2BGWA 2PH3A 3C8HA 1IXYA 2EJCA 1VPVA 1DBWA 2H31A 3SF8B 3ZZNA 1D9XA 2RHDA 5C7IO 3DKPA 3S68A 3GVIA 2NV2B 3N86A 1OFIA 1PNVA 1GPAA 2JI4A 5JO9A 3KV1A 2PYZA 4UE2A 4UMEA 2GEKA 5M29A 3H5NA 4FOTA 3VO9A 4BVLA 2VTDA 2PXCA 2GO1A 5JLJA 3H9CA 2DQYA 4ZODA 3MZ0A 4HQLA 5EWJB 3ASZA 5HIMA 4JSTA 2I2DA 5F76A 2RHBA 1FTYA 1A2OA 3PHBE 3KQQA 1N4AA 4A2WA 3ES9A 2VC2B 4XWGA 5HVNA 4AN1A 3H05A 3MWDB 2FPIA 1M10A 1FYEA 3LC0A 3FH0A 2X9NA 3CV3A 4OXIA 3VI4B 2ZBPA 4A8JC 5HXAA 2CLEB 5DW3A 4B6SA 4E3WA 4U63A 3DR5A 3LDHA 4LQDA 3S1AB 1J8DA 5L9AA 4O4JB 3EZNA 1EI9A 1ECPA 3ER9A 2YWEA 4M1KA 3IQGX 4IS3A 4S1PA 4OF4A 1Z5GA 4ZQEA 3SYRA 1WB5A 4QECA 1SC3A 1VE5A 3WB1A 1VFPA 2P9HA 4D9CA 5ADUS 5J4LA 2EWWA 1GT91 3LHDA 4Q1VA 4AP9A 1QQBA 3G2KA 1C0KA 4CM1A 4BGIA 4ZTZB 3CF4G 3P2KA 3T7SA 1WZCA 4GMGA 1SR8A 5TIIA 1NNEA 4GQAA 1H0HA 1XZ8A 1CZLA 1GFSA 1VYUA 3L6OO 2BVNA 3R40A 4PICA 3RRJA 2B4QA 4PAWA 5JVDB 1D8TA 2VHYA 3E7DA 3WK5A 3ZN2A 5LOVB 2PMBA 1YQDA 4IRMA 3UBTA 1OSNA 4DWJA 1UOEA 1UC4B 5J4VA 4DXDA 3STWA 3NJ8A 6ABPA 2HQBA 1R8YA 1FDUA 4JEIA 1ANKA 4M9SA 1TM5E 2W4IA 4Q7LA 3SYKA 1TO2E 5LP6A 2G28A 1UJ5A 2XMBA 5CVCA 1U7PA 3ANXA 1YTLA 3WGLA 1A5SB 2EGUA 2GDZA 1M0SA 2H1VA 2ORED 2VPZA 4HXFB 3W9SA 1L3IA 2V7QD 4TTPA 4R9VA 3SFVA 1Z26A 3CEJA 2G67A 3BD9A 4NAUA 5I8WA 1G4UR 2X0JA 4BV9A 2QJTA 4DNOA 4AUKA 3KYIB 4YIHA 1B8UA 5KOJA 1C7FA 1MIOB 2NO9A 1JI3A 5CT5A 1OBVA 1OIVA 4WERA 3V7NA 5CJ2A 3F4KA 1AO3A 4ZOLA 1CBUA 3OE7A 5H0IA 3X0DA 1Z6PA 4QHSA 1JJBA 1XRSB 3H8SA 2AMVA 2I3AA 3P0EA 2ANBA 3C8MA 1KGSA 1WUYA 1RAAA 2XDYA 4K6OA 1KNXA 1ORHA 2EBWA 3MRVA 4DJFC 1JEJA 2BFNA 4YMUA 1TT5B 2Z3VA 1OB2A 1I3LA 1F0KA 3TLMA 3SEZA 4DM7A 2WU3A 4U02A 2GTHA 4M1OA 3MOGA 2SKEA 3BCSA 3HBFA 5F1OA 2GPBA 3RVPA 3TXXA 3ETCA 4D46A 3KAJA 4DA0A 4CKWA 1YVPA 2CDCA 5BSVA 1E79A 1O58A 3FVQA 4FMCB 1OGYA 3N8HA 4L76A 3EBPA 1DXHA 4GLJA 2X22A 4KL8S 3HJBA 4EHFA 4FHEA 1L6RA 1FMFA 1ZRSA 4JMPA 2NXCA 1E1CB 2J3QA 1LK7A 3HYRA 4YEDA 5ELMA 1KMCA 1JHQA 1H2XA 3DT9A 3WMXA 3PGA1 3QWHA 1ZHFA 1VG0B 3G0OA 1V4VA 1XRMA 1KVUA 2IDKA 4PPFA 5FBVB 4BQPA 3IEVA 3VX3A 1VPTA 4R1QA 2BBSA 1PR1A 2O07A 4X0EA 4F1JA 4MJ3A 4ADSG 5I7RA 1A1SA 3V46A 2IE8A 1AKUA 2OCLA 3GWZA 5A04A 3T3HA 2OKGA 5IJAA 4M6WB 2B7LA 2JGNA 2KHZA 3ZE7A 3KSZO 1K0FA 2EFYA 4IPTA 1C3JA 4UPVA 2WWTA 5LYYA 3OFND 1R8JA 2D74A 3IEPA 4A8PA 1WEKA 3DOUA 4JYMA 1LC3A 1XK6A 2QRLA 3MSXA 5EIBD 1E3QA 1K6EA 4I3GA 3ISVA 3OJWA 4B0PA 4IIVA 3E58A 1AS0A 2O2SA 5G4KB 3TIFA 1YZGA 4ARVA 3V4PB 1Y8AA 2XD9A 4EATA 1AGXA 2CF6A 4M1SA 1SOUA 4P4SA 3X1XA 2FP3A 3N2KB 1LSJA 4ZZ3A 1Y7PA 2WKPA 2D0IA 2ZQ5A 1GTJ1 4KZPA 3W1EA 3WZ2A 5KNBA 1K2WA 4TTTS 3KTDA 1Y9EA 2BKAA 3KHTA 3FJYA 5LC1A 4TSFA 2D1FA 3GOHA 4BNHA 1DQYA 4N40A 2VJLA 3VM6A 1JGTA 2FR8C 2JKZA 4ZOBA 5F52A 5JI3E 3DT8A 2CW5A 1E3TA 4K40A 1M83A 1WCIA 2ZJAA 3LRXA 4Y67A 4ZRNA 5TNXA 1CUBA 1AMUA 1K4YA 4K9KA 3ZLBA 2P4SA 3F0TA 1WWKA 2QHXA 4K2AA 1WX1A 4UBKA 1NWHA 1G1MA 4JR0A 5BWLA 2WD7B 2ZETA 2CL5A 2G8LA 2XKKA 5IG2A 2RMKA 4W8OA 4FT2A 2Z1MA 1LDGA 4RJKA 2E85A 2YV3A 4BO1A 3KQNA 4UUOA 3IP6A 1VLVA 3LECA 3ZXIA 2VPTA 4O2BA 5KQRA 4TM7A 3CZMA 4TV8A 3PFBA 3VMMA 2VYQA 3WQSB 5HZGA 5E3IA 3U5TA 4KRFA 2ZKIA 2BBTA 1XZGA 4L4ZA 3VMFA 5BORA 2X42A 3B3GA 1JKFA 1SELA 1SU8A 4RKQA 4IZOA 5TVGA 4CM6A 4X66B 5EPEA 4R2KA 1N5DA 3FFWA 4QOJA 3TZKA 2O50A 3IPLA 1ENPA 4RABA 1V95A 1E4VA 4P38A 3I01A 2FZ5A 4E14A 4EG3A 4MWCA 2L17A 1FP4B 3V9PA 2WAOA 1X1EA 1FDIA 2FWPA 2OUKA 2AQKA 2W6OA 3AF3A 3AGQA 3AR6A 4KAAA 4PX2A 1R0SA 1UWKA 3O47A 3TKAA 4W5RA 3FVRA 2XZLA 1OX6A 4B43A 4PV7A 1OF1A 5FPKA 5JT1A 1KSHA 1FP7A 4Q4JA 4P7JA 1IN5A 3RKUA 4G0MA 1QK3A 3B9PA 3UO8B 3UUWA 4J3JA 3A6ZA 2SECE 4HDSB 2HPVA 2EWMA 1PTJA 4DMFA 4FI3C 4ZYYA 3TBKA 4G1BA 2HMWA 5F9MA 1XJ5A 2WAYA 4X60A 5B5SA 1G6OA 2P11A 1J5XA 3SVLA 5EE3A 5A1JA 4BGVA 4Q21A 2RONA 2IVZA 4OVKA 3TRKA 4AICA 1FK8A 1HZJA 2QZPA 2VWQA 1Y1KE 1Z88A 2Y0DA 4KQ1A 2HBYA 3RVQA 3VZRA 1V39A 4C4YA 4KQKA 2FDCA 1Z47A 5GIPE 5U4XA 4N5HX 4RVOA 3ENWA 1K6JA 4PYMA 3UHAA 4C7BA 4LY6A 1KPGA 1L5QA 2JJ1D 1NL3A 3HBLA 5AHKA 1Z6QA 1NU6A 2GKSA 2HPZA 2OCIA 3I83A 4YRFA 1NOIA 1W4LA 1ZCZA 1RKQA 1JVBA 1S8FA 1COWD 7MDHA 3NYQA 4ND8B 5DOZA 5FAXA 4EVRA 2NGRA 1Q0RA 3OQHA 4U8GA 5CTAA 1UAYA 2DXIA 1N92A 4K1XA 3RTCA 4ZGGA 5EP3A 1XXHB 1ZM9A 3DBLA 3CX3A 1TA9A 3PKJA 3NG1A 4RXTA 4XRRA 4BFCA 4N5DA 1B43A 4H15A 4IFTA 3OZFA 3L6EA 2AV6A 2VJKA 4CCYB 3WB9A 4Y6OA 2CHUA 3GRFA 4BYMA 1S01A 2WYVA 5KO2A 5DHQA 4AKHA 4OX9B 3E05A 2JFUA 2PXHA 2RGAA 3LDUA 5FTNA 1KVTA 5JAQA 3S0JA 4RQBA 5TQVA 3NQ41 4UFOA 2JGKA 1E3EA 4MYDA 3ZWPA 1QZXA 3PG5A 4CKCA 1QE3A 2YBDA 3RB8A 4IQFA 5FAKA 4UAVA 3RSHA 5C5EA 5E0OA 2DULA 4QZVA 5IHXA 2VNIA 3N5CA 4AZ0B 1KE1A 2NU8B 5DGHA 2FMUA 2BH9A 2UVDA 5JCJA 3QE4A 4FFPA 1FFGA 3HKCA 3UATA 2XLBA 1QGZA 2QL9A 4LHXA 4RKWA 1RBQA 3A1EA 2GZSA 2QQGA 1DMRA 2Y1XA 3H1TA 1IYZA 1KJNA 1VKNA 1CFJA 3ESXA 3HZHA 2VXOA 2BJWA 3PXAA 4M9RA 2HK8A 3T3DA 1E1RA 4HNRA 2LW7A 1ATIA 1M1YA 5ICCA 4MHTA 2OHHA 3AG6A 1OKKD 2XCTB 1SZPA 1UXHA 4JSYA 4DLLA 3Q12A 3ZGNA 8ADHA 3R9XA 3NGXA 4HX2A 1W94A 1SPBS 1TX4B 5TMDA 3QF7A 1IPHA 3ITEA 5LLTA 2G1UA 3NDRA 4G0WA 5TRTA 3VV2A 1UWLA 3VNVA 5IJ9B 4EQ6B 2WAAA 1QO0A 1I1OA 3EOAI 1YR9A 2CLCX 3GGSA 3O8DA 1DL5A 3P9CA 4GLOA 2ADOA 4ND5A 4Y7DA 3Q88A 3BIFA 4G2NA 3WBFA 4BVFA 4DDMA 4QUBA 2ARKA 3OVMA 1P4SA 2E4UA 3V1NA 5E3JA 2QJWA 2EJTA 4FYMA 3OJOA 3WBKA 2JBWA 2ZSUA 3MBKA 4FQ8A 5E7JA 3ZIAD 1ISRA 3UC5A 5LXTB 2W6NA 1Z63A 3RIHA 3LT0A 3M3DA 4F9GA 4DA7A 1SUCA 4N5LA 3MJDA 1H93A 1JIQA 5KJFA 4PRYA 3WP0A 1GTG1 3C97A 4YJFB 3B13B 3GPCA 5F3RA 3ANMA 3T5DA 1VPEA 2JJMA 1AXGA 4KMOA 1GGEA 3TW8B 2XTMA 5IBRA 4GQBA 2KLBA 2DBVO 5E2AA 1CY8A 3GZNB 5ALQA 1U11A 3LGSA 3WOHA 4DV0B 2YNMA 3OKCA 4ZI7F 3RK4A 3K4PA 5IWAB 3U0BA 1FFAA 1FTSA 5HQJA 5TF4A 2QVYX 2WSYB 1T0UA 4TYMA 3RYIA 5AHXA 3V00A 5B3JA 2CFSA 4ZTBA 2ASVA 2AUTA 2XE4A 5BYAA 4LXUA 1RAHA 1W8DA 5F51A 1I2BA 2C9DA 1SBCA 2HH9A 2NYVA 3BRWA 1OBCA 1OXXK 3L6CA 3PXBA 3TH5A 4P81A 2PK3A 4KAXA 3A6DA 1GR1A 1X7WA 4YQFA 1KQGA 3SZLA 4U7DA 2HU2A 4F6LA 3UWPA 3CB2A 1MR3F 1RXVA 1VSQA 3H5IA 3JW8A 1ZXXA 2P9BA 3ZDCA 3E81A 1HGXA 2TMGA 3KO8A 4IUYA 3DBOB 4QULA 1KY3A 5CM2Z 5DHUA 5H8WA 1CF4A 1V5WA 3MOIA 4BLSA 1PZXA 3G2JA 4ZOCA 4FMDB 1OZHA 1YBVA 4EY5A 1OY1A 2XE6A 2OXRA 3SXUB 1WEHA 3P2YA 4X41A 5DE3A 1RE1A 3AR8A 4TV9A 3ZBUA 1QLWA 1EFVB 4U2BA 3SP1A 1PT8A 3VDMA 1IOVA 5G0UA 1ZVVA 1XTIA 2V03A 2XDWA 4HD8A 4YA6A 4R9NA 1BE8A 3FCAA 2A78A 3WMRA 3JWGA 4NK4A 5LMCA 3K1YA 3ENZA 5KQPA 5EE0A 2F43B 4E5KA 4GBGA 4RK5A 4AMBA 3FVWA 1U9ZA 3GZJA 1TZBA 2V9PA 3A9VA 3BE5A 4P54A 1VIYA 3VKWA 3Q8KA 4FKZA 1GUZA 2BOVA 4CIXA 1OYVA 2LV8A 3P0RA 2QI9C 1IDN1 5BNIA 4B3FX 1NQVA 2PMKA 3D59A 4IRXA 4ND6A 3LT4A 5BPFA 1PFYA 2UVQA 3I2HA 4BO8A 3I5XA 2A5LA 1U7DA 4IX9A 1IG3A 5C34B 1XRRA 4OYYA 1YJQA 4BDSA 1HMPA 1UM8A 2GZ3A 3B1YA 3CSUA 3IKJA 4JOCA 4M8KA 4PFQA 5CYGA 2EP8A 2OC4A 5IJ0B 4QREA 2QT1A 2QLTA 1YNSA 2IFTA 2PXAA 2R5FA 4QBTA 3JQAD 1QZ3A 2BEKA 4EKEA 3WL3A 3NXKA 1GNRA 3QU5A 1R50A 4BCBA 1M66A 4AX4A 2IVFA 2NZVG 3DV9A 2ZE6A 1T6BY 3AF4A 3CPHA 3RVOA 5L7YA 1VSUA 3A6LA 3GDFA 3R0VA 3T3GA 3W5HA 3ORRA 4CF6A 4JHXA 1Q1AA 2FUCA 1ORVA 3ADKA 3JQ9A 1DT3A 3PCTA 4UE3S 1D6JA 2DVMA 1ZYUA 5JYBA 1KBQA 4LMAA 2GCOB 1NTRA 2BSAA 2FETA 5FUYA 1UPXA 3WLHA 5JWRA 1TA0A 3CF6R 4GPZA 4LOIA 3FZNA 2PXXA 4ZXPA 3AETB 3DVLA 2BZ1A 1LPOA 1UJ6A 2V0GA 1XV5A 5K05A 4IJUA 2PFGA 1IJFA 4B84A 1MABA 1EZ4A 4QLAA 4YN3A 1DKPA 2D1RA 3OECA 4FD3A 4TS3A 1Z2EA 1Z4NA 3CN7A 4LVUA 4ZYTA 1EFTA 2MMCA 2OBLA 2AOTA 2QTGA 5KYVA 1PWEA 2AC4A 4EAAA 1GZ4A 4PAMA 5E6SA 3FYHA 5ER9A 1WU8A 2UZ3A 3PI7A 4NC9A 2OD7A 1II9A 1A5AB 1HQYE 3TLCA 1L5HA 3ZEAA 2AOXA 3RQIA 1NQOA 3L7DA 2PPVA 3ROKA 5JS2A 4MB0A 1TEXA 4C7XA 1OLXA 1OH6A 1A7AA 3TXAA 3QYJA 4BS9A 2YWXA 1KAGA 5D3KA 5TPZD 1BZYA 4JBIA 2QRGA 5BNZA 3K70B 4ODIA 3TNLA 4LCEA 4TMZA 4W6QA 2HNAA 4QJIA 5H82A 3ZZ0A 5K8LA 1FP2A 4HWGA 4RPGA 3GXOA 1RXUA 2FFHA 2ODQA 2PTGA 2DKFA 2Q3CA 4YMVA 2H16A 1AN0A 2R4QA 5CT9A 2NPOA 4BGEA 5LPNA 5IM4F 1EDZA 3W5IA 5CG2A 4DCPA 5K3DA 3EYWA 1ORDA 4DZRA 5LZ8A 3Q7QA 1XNRB 1L4YA 2J5QA 2BM0A 1UXJA 4X84A 3FRJA 1KH3A 721PA 1YHZA 1AHHA 1OFVA 1U28C 4C3ZA 1XYVA 4DSUA 1KY4A 1W19A 3U56A 1RVDA 2DWOA 2JFHA 2WHPB 3A4YA 1SJ9A 1EK5A 1WDLA 3DO6A 3K8OE 1C5KA 3B3JA 3KZMA 1ZM3A 1U0RA 4JFRA 4K26A 3NCHA 4KFUA 2H0RA 1M8KA 3QUAA 5ECYA 1YHYA 4JJZA 4J43A 3CKMA 1QIKA 2FAXA 2XPCA 5JJCA 1DUIA 1WLYA 1WQ1R 3ZZTA 4AYXA 3L9WA 4HX5A 1W73A 4QWWA 2O8EA 3IGFA 1PS9A 2JATA 4BU1A 4RTKA 2B20A 4KWIA 1GRNA 1R10A 5KDOA 2Q28A 1Y5LA 2WF5A 3M2TA 2NVUB 4WMLA 3AFGA 2PNJA 4RO0A 3BZWA 4G2TA 1Y1TA 3U7RA 2XB2A 3N0TA 3AY6A 1E69A 1SC4A 5FHQA 1L7EA 1MC8A 1M2OA 1QJ4A 1Z0DA 3WL4A 3WJ2A 2E82A 3TUJC 2A4MA 3JWIA 3USZA 1INLA 1PLLA 1ZJ4A 3NPMA 1OA1A 3EXFB 4R2HA 5I7AA 4FDMA 1K7SN 3I1FA 4P36A 1AG9A 2QX9A 3T6KA 3JCZA 4Y1RA 5JSZA 1EDBA 2PUJA 1KDOA 4QFBA 2P7HA 1KEEA 4KRXA 1N8SA 4R3WA 2X8JA 2HADA 5B58T 3W5CA 1CEYA 2EFJA 4LJSA 4E88A 1VLLA 1YL5A 3IUQA 3P2EA 4NS4A 1N9KA 1VPWA 2QN8A 1NMYA 1LV7A 3BB3A 3ZE1B 4CQMB 1T4CB 1VCNA 4I99A 2EBHX 1NT2A 1JDVA 2HA2A 2K2WA 2RHHA 4H7JA 1MORA 4MYHA 4EG8A 3H5OA 4OMUA 1DJMA 1MA3A 2HI0A 2RBKA 3ETNA 1IBLB 2VRCD 4GLLA 2JKVA 2R8OA 1FMCA 1YNOA 2E49A 4INAA 5TGDA 4GR5A 2QLMA 3F47A 1M5TA 3Q5DA 4XJXA 5GONA 3H42B 4YXFA 3ROMA 3JALB 2GYWA 1HLDA 5B6PA 1KU0A 1JNXX 1RHMA 2IUTA 5KYGA 2VTBA 2C2WA 4HDRB 3UB3A 4WADA 4S0ZA 1A4IA 3G0GA 1TK3A 3INRA 5D86A 3MD9A 5EHIA 2G04A 4MQBA 3C6BA 4B3DA 4CR8A 4NBTA 2CXUA 3L43A 2O48X 4HH4A 1NN5A 4H17A 1DARA 2XGSA 2HUNA 1J1ZA 3N3AC 3TSWA 3CGGA 3BH7A 1L9KA 5ERXA 1XXHE 4OB8A 1WVGA 2IIVA 2J7KA 1BVYF 3AEQA 3ABOB 3STUA 3I9MA 1JHVA 1MTOA 1P2DA 1AXEA 2ZT7A 4PN3A 3I6IA 3WJ7A 4PNPA 2UYCA 5LQDA 1PSDA 2I7TA 2VYVD 4X54A 2ZUVA 4S05A 5ILGA 2FW9A 2P2YA 4D3SA 4R1NA 1P39A 1W1IA 1BDMA 1O95D 1WUTA 2MTBA 2SICE 3EIFA 2HLDD 4FCVA 1XROA 2QM3A 2O3JA 4JJ6A 3VPGA 13PKA 5FP0A 4FJ2A 1M8GA 4N5NA 5AUNB 3OO1A 3R09A 5CFNA 3FYCA 1SHUX 1WO8A 1ZMXA 4WKGA 1EE9A 4R1MA 3BXXA 5AM4A 3WQRA 1HFEL 1U7ZA 2RC5A 3EXHB 4OYHA 4Q16A 1GNLA 3BSWA 4LNUB 5E4TA 2HM7A 3H83A 2G77B 2NNLD 1QP8A 5EWMA 3DF7A 1B76A 2D7JA 2JIZD 2POQX 2VA8A 3KKPA 4H1HA 5EZSA 3WWDA 4A73A 4KG7A 4J2OA 4LZZA 4NU0A 5EQJB 3ZLUA 3JQ8B 3UWDA 1R0RE 2AD1A 4KX5A 1O57A 3HCCA 3W5VA 1QRUA 3AVYA 3HCEA 4GM1A 4F4IA 1PSWA 3E9MA 1GL6A 3AEYA 3EEQA 1GYQA 1R0ZA 3HKBA 4DQKA 1FRQA 1OXVA 5EA2A 1A82A 1YGPA 4J7AA 4IICA 1WPRA 4NBLA 3W34A 1RIFA 5IWCA 2QAGB 2ZULA 4YGXB 3VVCA 1GGMA 2EYUA 3MILA 1Q0QA 3O31A 4QAJA 3RSGA 2JLWA 3GMSA 4BFYA 1RPAA 4JLVA 3Q87B 3KKOA 2R8XA 1ZD5A 1U1CA 4MRMB 5H3LA 5LLSA 1YR3A 1VL2A 3PUWA 2Z5LA 4D4KA 3GRVA 2E18A 4YRJA 1U8EA 5ARBA 2ISSD 1LLCA 3G23A 3HU3A 1GQFA 1ZIYA 1VBMA 2CL6X 1B14A 2BDUA 3FCOA 1KU6A 3R9IA 4EOGA 4J0IA 1WXIA 2QPOA 5MHTA 4HSEA 1GGNA 4KQEA 2VNJA 1KJ9A 5AHWA 3DLTA 2IOHA 3NBKA 3UJ8A 4NJMA 3IKVA 4LK3A 3QLEA 5FOXA 3UK7A 2A59A 1IK6A 1IHYA 1TVEA 2X6QA 4N3AA 4KO8A 1DCKA 4TWAA 5L3RA 3U3ZA 3U4DA 4XDGA 1ZAYA 1DQSA 2X5OA 1R4NA 1IN7A 3IKLA 4AXXA 1ZGCA 3GYBA 1RWBA 1LZLA 4JXJA 5EVJA 1A2QA 1Y9DA 2WUEA 3GGPA 1D6MA 3GP5A 1QONA 3QTLA 3ZI4A 2DPHA 3STHA 4KI7A 2BTQA 3TAXA 4WBNA 1YQUA 2G36A 2GZ2A 3AI7A 3VQTA 4P3KA 5K3OA 2XNDD 4DYVA 1Y5RA 1NVXQ 2VHEA 4IDGA 4DEYA 5KSWB 2BEUA 3ZHRA 4IO1A 1DIRA 2EKDA 2ODNA 4HBZA 4QU9A 2WD9A 2GS9A 1DELA 4K5QA 2Y1FA 5BNWA 1G8PA 1DJOA 5AICA 3U1TA 4CM9D 4MPRA 1N1DA 2C61A 4IDEA 1RM3A 3UYLA 1YQ9A 1EGVB 3MLBA 4O2AF 1UT8A 5DM60 4DCGA 3CXUA 3FSRA 4DQDA 4EGJA 2Z08A 3DPSA 4I1VA 4HWOA 4N03A 3RLFA 2OFXA 2PS9A 3QFCA 5EMHA 4LRUA 3BXHA 2WIKA 4KO3S 4KDRA 4TUYF 3AUUA 4NHOA 2JFZA 2UUOA 3H0EA 2I22A 4PX5A 4HFMA 5GJWC 4H3KB 5D51S 4BDTA 1EP1B 3F2VA 1UBTS 3UNXA 2UKDA 2XMDA 1U3CA 2YJTD 4CLEA 1F0YA 4LRTB 5ICEA 3G9UA 3OIGA 3QKWA 4HC4A 2WK1A 3ECSA 1ISJA 1RMQA 1Z6TA 3KJEA 1AKWA 4UHFA 3V4ZA 2VKTA 4JB2A 4LOAA 3ZV4A 3GRRA 4UULA 1ID1A 5FI5A 1XZDA 3H8JA 2VAMA 4P5DA 3ZC3A 3AFOA 1KJQA 3GLQA 3OJLA 2DM6A 4Q37A 1W5FA 4QEDA 1S9HA 3KCNA 4IXWA 4IIXA 2WICA 4ARAA 5ULLA 3T35A 5LP6B 2XAAA 2P5SA</