4AP5A

Crystal structure of human pofut2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
389
structure length
389
Chain Sequence
b'SRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 2
publication title Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A02
3ZY6A 3SIWA 2HHCA 3ZY4A 2OCXA 3SIXA 3ZY5A 3ZY3A 2DE0X 2HLHA 3ZY2A 4AP6A 4AP5A
chains in the Genus database with same CATH superfamily
1SAYA 4ILKA 2QTCA 3NTUA 4KV9A 2Q5CA 1IN4A 2EATA 3C3DA 1KF0A 1KYZA 2YWRA 4ZO4A 2H16A 5HDBB 3A4IA 1CZUA 2JCVA 4AKGA 3I9V1 1K7XB 3DTYA 2FJ0A 2H4ZA 2OFPA 4JUDX 1Q0ZA 2BBOA 4G8DA 3EQ9A 4QAJA 5IYZF 5F2NA 3NM5A 4CHTA 3VZDA 3W5AA 1XVTA 3T7RA 3CWZA 3AZOA 2QRQA 1ZAYA 2XITA 3I6ZA 2PGOA 4QE3A 3JD3A 3V8RA 3I83A 3ZHUA 4NATA 4KXQA 4WKPA 1ILEA 3G5AA 1H05A 4CI9A 1T15A 4LTNA 3N8IA 4CLXA 1MH9A 2HGZA 3GAZA 5FOQA 3BS4A 1E2JA 2Z9DA 1ZKDA 3WHIA 3JRWA 5BMVB 3FZNA 2ONZA 2VYFA 3VPBA 4XJTA 4PYOA 3OZBA 1CW2B 4BQRA 1LZKA 1OKKA 3WLSA 1JQEA 1U5AA 2QAGC 1A0OA 3EUAA 3HADA 5T4BA 3WGHA 2XDAA 4ZYVA 2O57A 5J1SB 2I7TA 5EWLA 4LI3X 1Q7RA 1KZGB 2WAOA 3BGWA 2JRLA 4KDCA 4RSHA 5ELXA 2V8BA 4XSHA 3VR3A 1MC5A 3Q9UA 3VH3A 4ZJZA 3FVVA 3UT6A 1DIRA 3REOA 3C16C 2ZTUA 4QGHA 4YDQA 1KZ9A 3H5IA 1YDHA 5ALLA 3ZWXA 1USKA 1Z13A 3IEUA 4Y9SA 3RGWS 3WK7A 4BPRA 5B6JA 5LL6P 4QOSA 1YL7A 4MSUA 1N2CA 2R9VA 4PIMA 1KH1A 1BS9A 1OWOA 2QW0X 4Q6BA 2QTMA 5JQGA 1X3SA 3LDGA 4PIVA 4OQYA 1NXWA 3C3XA 3FAZA 2B4TO 2AJ8A 3DNFA 3X1MA 1K63A 1ZRSA 2B4RO 3HCCA 3WMWA 2QVZX 4IJ6A 3ZXUB 3MWGA 2PGLA 1M8PA 1GILA 2OG2A 4G81A 2NVUA 4M7PA 1TZBA 4D8UA 1WPGA 3R0QA 1ZY2A 2LV8A 3MNFA 1G4HA 3DTVA 4LISA 3SLKA 3K70C 2VF2A 3ZGVA 1CP3A 2OXCA 4Z4EA 3R5FA 4IJWA 2I55A 3H2GA 4L5IA 3CVXA 3GMTA 3JV7A 4MQ4A 1DBIA 4R41A 4ZOLA 2AKAB 3PNYA 4CEJA 3NWBA 4HGNA 1MQSA 2Q3EA 4RKRA 2HDWA 3O2NA 3WZ2A 2NO4A 3FDXA 4J6EA 5CVDA 1WOYA 4F21A 1VP9A 4QRDA 2Y1LA 4NCKA 1GN9A 3NJ4A 3ZZTA 1VG9B 3HYNA 4A6DA 3EC1A 4TWIA 1BHQ1 1I2ZA 3V6MA 5ICMA 1V5IA 1JDJA 1F8FA 1Q0PA 3IUPA 4IFEA 4JB0A 5AW4A 4J29A 1E8NA 2G1KA 3UHPA 4QOGA 5IW8A 3H5NA 3NIGB 3RSLA 4IO1A 3A04A 1U3FA 1PYOA 5KJFA 3PUYA 4U8HA 2IPMA 5AUQA 3HJGA 2ZB4A 5FPSA 4TXLA 5BNFA 2EJTA 2R1VB 4QFDA 4QIHA 4ZOAA 1Y37A 3JAWB 8OHMA 3HS3A 3OKCA 3P9IA 3MWKA 4TWJA 2A9OA 3A1DA 4UCQA 1JTEA 3FWKA 3EC2A 1KXZA 2BEWA 2G9QA 2TRSB 3NBUA 1X7DA 2PMKA 1J97A 5DHAA 4I5GA 1E2UA 3PI7A 3VQTA 2UDPA 2P5TB 1GQSA 4JVOA 5IJ0A 4BNDB 2EZTA 3EAGA 4FS3A 3A3KA 3VA7A 3AEYA 2H1CA 2AOUB 3AX6A 5E7JA 4Q01A 3AHCA 5FUYA 1KPHA 3CBQA 3N8GA 3V1TC 1OCEA 3KQSA 1XVLA 3PDCA 2PWPA 4GEKA 3H18A 4ABTA 3A3YA 2XUQA 3IXMA 4PSCA 3RJTA 1H8EA 2WSMA 4TROA 3I5YA 1R18A 1R4ZA 2V7QA 1NC3A 2ZS9A 3DBIA 3MWEB 1AX9A 4YBRA 1KP3A 2NYVA 3P9RA 4RF2A 1BYUA 1AUQA 3K1AB 1WG8A 3KO8A 3QPVA 5CPBA 5FQOA 5KZMB 1EP2B 2VDWA 1GUYA 1ZNQO 2ILVA 4IEFB 2DTEA 4RUKA 4ZVQA 3B52X 4V3BA 2QM3A 4NBSA 3BL8A 3CF4A 1RLTA 3EXHA 4H27A 4LZNA 4AT1A 1I0IA 4ESVA 2XYQA 3DAYA 1Q91A 3ZE9A 2EEZA 1E7SA 4OYYA 1THZA 2PMWB 3O4JA 4Q4DA 1S4QA 2P67A 1WCIB 1JR6A 5B6IA 3FETA 5B3AA 2O7NA 2EEPA 4DCNA 5IBCA 4IMPA 4B6SA 1FQOA 1A8UA 5K3FB 5HFJA 2ZAIA 3B6IA 5REQB 5CLFA 4PTLA 2G1AA 1E5XA 3LHKA 3P7MA 1SIOA 2FPGB 2ALJA 2IEIA 2X8BA 4P3KA 2IHBA 1L7QA 1SKBA 2VWQA 5TQJA 2X19A 1WZIA 3INTA 2VATA 3WG9A 1ZXBA 3ZN2A 1VHQA 2GO7A 1GM5A 2IZOA 1TECE 4ZAGA 3PC6A 4LOAA 3Q88A 2W9XA 4G9BA 3N6XA 5GPBA 1WUKS 2H5LA 1CX9B 3R9IA 1YU6A 1U6KA 3GJ6A 3K1ZA 3MD9A 3NHYA 3PE4A 3QU5A 4PHCA 4UTZA 3TGLA 1G59A 4K3UA 1P1HA 3L8EA 4CQMB 5HUJA 3OLYA 1SA0A 3ZJUA 2PGJA 2IHTA 5SV2A 1PLLA 3D4OA 3K2BA 4L3WA 4OATA 1FL9A 1G42A 4XGQA 3PVCA 1TIPA 3CVYA 4HDRB 4GUDA 1F6DA 5CDHA 2DLCX 4PSDA 4PQYA 5BQOA 4ASUA 3GFPA 1V71A 4ZQIA 1TFUA 2A0FA 5CK5A 4ZZ3A 3F6EX 5F7XA 1XRLA 3NWJA 4IIEA 4YLEA 5JRZA 4RY2A 3E23A 1T5OA 2I91A 1XSEA 5CDTA 4NZNA 3K16A 1WW2A 4ALMA 5IH7A 2YICA 4DR6B 4DV0B 2GLUA 2OCPA 4WKBA 3L07A 4GYJA 1J20A 1XROA 3UANA 4CG0A 5E7QA 3TNJA 1QS0B 3TI7A 3ZK8A 1VB5A 3R1IA 5LBIA 2IYZA 5KYGA 2VIIA 1UH5A 2BEVA 2XOKD 2H2GA 2VXYA 1AK9A 3T3OA 2FE4A 3LYAA 1ECBA 5FULA 4O63O 4GW3A 4TLMB 2YX1A 3ZJ4A 3SFVA 4ZJYA 1LBHA 4YNBA 3U4QA 3AVTA 4C43A 1PJ2A 4ZKEA 4RO0A 3R0JA 3M2PA 1O89A 2JJQA 4IQ0A 4W7IA 4WXRA 2CVHA 3GDFA 3S55A 2C95A 1Q7GA 2C7GA 3EIWA 1VJ5A 3RRXA 3GUZA 2HCBA 3GJ0A 3IT0A 5CT4A 5AKEA 5ITWA 1X7WB 4YAJA 4P84A 4D4KA 3JQBC 2VJPA 3JTEA 5LSAA 4D97A 2IPLA 1SVKA 2ECOA 4O4JF 4WKOA 4DLVA 3ZZMA 1TLLA 1YHZA 2R11A 4PGGA 1W96A 1XPJA 3DAGA 2HIGA 3B60A 3LQKA 4P3XA 4UFNA 3QTBA 4BWVA 1VLZA 1AZLA 1BWRA 3LQ4A 4AZSA 2Z8YA 3UJAA 3UG6A 4Q1CA 1KC3A 4M8NE 1Q1ZA 3UBMA 1J8DA 3AF2A 2ZYHA 1Q1NA 3D0OA 5J5CA 5BQFA 2QMZA 1IYZA 2R4UA 4NYIQ 4OJNA 4RLSA 3FZGA 5FBKA 2VDLB 2QUJA 2Y92A 1KBOA 5M04A 4OXQA 4XJSA 1Q50A 1ENZA 2J5QA 4R2MA 2IDKA 1ZM3A 3SHFA 1KY4A 3PNSA 1UFOA 3PNMA 4N47A 2AG6A 4FCCA 4INPA 1XMXA 4TMXA 3JZFA 5HRCA 3GLSA 3WQRA 4IWYA 4PZDA 3TTSA 1P7VA 2WUGA 1LNSA 2NU9A 1MNQA 1U3VA 2O5VA 3VR6D 2WAYA 1ZI8A 2GILA 2DC1A 1G18A 3CRQA 1A2BA 3FIUA 4NMXB 3KYDA 1OZAA 4BP3A 1GCAA 2NXEA 3HGQA 1M2KA 3TE6A 3OT5A 2ZUVA 4REQA 3O8CA 2GCNA 3DVSX 1IXSB 1N36B 2CFSA 1TC1A 2R6DA 1LBIA 1IVSA 3NWPA 2PUJA 3G1UA 1AE1A 1XU4A 3L4BA 1XMPA 2IU6A 3PYLA 4IS2A 4ZT6A 5I8ZA 3AM3A 3VO1A 2K5UA 5ADWA 4F97A 2QU8A 4CQMD 2GS9A 1VLMA 1RHMA 4CL0A 5JBNA 2FHSA 1HE4A 2ZJFA 3ZW8A 3Q9NA 5E2BA 2IEDA 1KJIA 5SZIA 4Y0AA 5DLEA 5DM0A 5BY2A 4L5JA 3CZAA 3UA4A 4Y8VA 4F4UA 1G5PA 3ULKA 3M1YA 5B58C 4ZI2A 4JVNA 5F23A 1XK6A 1QHHA 3LKDA 4JX8A 3ZHYA 1GQ2A 1J4AA 2EQ5A 4Q39A 1U3GA 2ACWA 4CLDA 1SCBA 3IDQA 1KFJB 4L6IA 2BGKA 2ZIWB 3QVXA 2G71A 2WM3A 3WIUA 3V4PB 1J42A 1EBUA 1KI2A 2BMEA 2GN9A 2XDYA 2E48A 1ULAA 3EK2A 3F8TA 4MP3A 3NHBA 1XALA 2VHTA 3L8FA 4OHZA 2BSQA 2PLNA 1KGSA 4CCSA 4KPGA 5LYJF 4ITRC 2F90A 2R4QA 2ZAYA 4HX2A 5AKKA 4XVHA 4JJZA 3E3OA 1KA9H 2DYKA 2HSDA 2IEBA 2DR0A 2NT4A 1M34A 1NG1A 1R0RE 5EKUA 3ZDZB 2B35A 2XT6A 2II6A 4E15A 1Z4JA 1U3TA 3T9BA 4RF5A 2H2DA 2YWGA 2ZI6A 1A7AA 2PLFA 3PR1A 4QDJA 3WKBA 4JYBA 1SG9A 2VF4X 1F6WA 3ZHVA 4Q3BA 1FJGB 1WLYA 4FNGA 1ILWA 2CHFA 2Q1UA 4UXIA 3T52A 1VYHA 3HDVA 4BC1A 5FYQA 1NMEA 1KPIA 3SR4A 4BHTA 1P31A 3BIJA 5I7HA 3ZHSA 3HWRA 3K96A 4GOND 5E4YA 2HRDA 1S3IA 4NAUA 4RETA 3IEKA 1L2TA 3AHHA 3LUJA 1JDPA 1YKFA 3KLBA 3T7TA 3ZE6A 5F9HA 1TU4A 2FWAA 2Q5QA 3H4MA 2FWPA 1R0BA 1TMYA 3D2LA 3QLUA 3SHQA 4IRMA 4DQDA 1L1QA 4OMUA 2ZJ0A 1NLMA 3AEQA 5K0JA 2POCA 1IBKB 2R60A 5DRTA 5JT1A 4HHEA 1R37A 3TRFA 3EXIB 2CY0A 2WQZA 3BRWD 4U6QA 5J2UA 1G4UR 4N3CA 1N25A 5B1DA 1N5DA 4L0MA 2EL9A 4O5AA 5FI5A 2I2DA 1WETA 4RMIA 1H8HA 1F9AA 1XZEA 4PO9A 3D6FA 3JQFA 1SXJE 4PXSA 3EB9A 4QUJA 4WGFA 3TR5A 5D7NA 3TUZC 2ZR7A 3TQOA 1I4TD 2FI1A 4Q3CA 4TUYA 4B6JA 3OJ0A 4RZQA 1UBEA 3FB1A 2XE4A 4UU1A 2EF1A 4P7FA 3S5UA 5JZBA 1KJ8A 1HK7A 4WXEA 4FWTA 3EUEA 4IIJA 1D03A 1WXHA 1IHDA 3R7NA 1W581 3JTMA 1X15A 2J3LA 4ZHQA 1CDZA 3AI7A 7ADHA 1GNRA 4JA0A 1XWIA 3UWSA 1IOLA 1QLWA 4R2JA 4FWBA 4N48A 2AJLI 1CJKC 2RHJA 3L18A 4UVIA 3ZWPA 5CLGA 1YAHA 1ZD2P 4HNAA 5A03A 4NBNA 1U6IA 1DAGA 3LKZA 2VHVA 2W8ZA 1JHUA 4J0DA 2L2QA 3G2JA 1GPNA 1J8YF 3O3CA 4RFSA 4UOQA 3BK2A 4XUGB 4CKWB 2UUAB 3DTNA 2RI0A 1R0LA 1S2LA 4W5JA 1FUUA 2QR5A 1PU2A 1XTSA 3IPAA 4FNOA 2CHUA 3X2EA 1NI5A 1UMBB 1PTJC 3Q7EA 5KYUB 3QI7A 2E4AA 4JI0B 4MR9A 3TLJA 2PVPA 4Z1MA 4DNQA 3EXAA 3MCAA 5DCUA 4FE4A 2C2ZA 5ELMA 4CLRB 2QM7A 2CXXA 2NU6A 3QBDA 2W11A 1QV9A 1L4HA 2XKAA 2H31A 4U5XA 3URKA 3G6KA 1NR7A 2W4IA 4E4TA 3PT9A 1P0QA 1OWNA 2VHXA 2ZWMA 3EJ6A 1DTWA 1T5SA 2HEGA 3LT2A 2ONJA 1IBRA 4HDNB 5J4LA 1U9CA 2JH8A 2CC2A 2ODNA 2LIPA 1WZCA 1FP4B 4DA0A 1JSZA 5THQA 2P6UA 3IUEA 1ZD9A 3VR4A 1V0JA 4Z7JA 1DJPA 3HA7A 3L77A 3SXUB 3G8YA 3CEPB 5JXIA 2AWNA 1FY2A 2XUOA 1OZ0A 4C3UA 1IY8A 3GB9A 1P8AA 2QLNA 1R15A 3CZCA 1P6UA 4HTFA 5J5AA 1OU0A 3NP7A 4X1KA 5AW5A 1AMOA 2HSEA 2CK3D 1O6CA 1JVNA 4YJHA 2Y1EA 3M6UA 2BEUA 1LBQA 4RV4A 3U81A 3ENZA 5EJIA 5JTUA 5CFRA 4HDKB 3N74A 1QAOA 2KMLA 3OA2A 5DYTA 4CDRA 3W6NA 3C3KA 5JZ9A 2JI6A 4IZIA 2ZUFA 2N9UA 1QHIA 1U4NA 5ANRB 2Q3FA 3OIWA 3WLKX 1QG0A 1XT6A 4IEEA 1DJQA 4M8SA 4MUIA 4KMMA 4QLBA 5JY6A 4DY4A 1U1CA 3AV0B 1CC1S 4CM7A 5GVRA 2ZIAA 4GXQA 2QTAA 2WJJA 2ZRJA 3H8SA 4BKQA 2NYUA 1Y5LA 1C9KA 2JKVA 1A71A 1SOMA 4UUMA 5BW5A 1RKXA 3TSAA 1CRLA 4Y2PA 1WE2A 3WNQA 1PJQA 3AY0A 1KYTA 4DRXA 3U3RA 3OIFA 2M32A 4M1YA 2PZFA 2EHDA 3GEBA 1T1IA 5IVIA 2JHAA 1AS3A 2P62A 3FMOB 2V0NA 3F8WA 4TYQA 4Y6GB 5ALRA 2R7LA 1V26A 4B3MB 1S3FA 3MJDA 3U6KA 4RTMA 4HWRA 4ND6A 3SXJA 4JBIA 1IZ0A 2FDRA 5KC9A 4D3SA 2QVXX 1A97A 3IV7A 2FLWA 1OILA 2B8NA 3DCNA 4IL5A 2PM8A 2PK3A 2QN7A 4Q21A 4R1PA 3FPSA 3QKRA 4UHDA 2ZJ7A 1RXYA 5DLYA 3VKUA 2WPDA 2I1VB 2JBWA 2BAGA 4E5UA 2PT7A 2ZXUA 3PQDA 3N2YA 1O94A 4HGRA 2V97A 2F3TA 3ANYB 5EWJA 3TTTA 4FS8A 4CIDA 4IMIB 1B73A 3RWMB 4E5VA 3PGKA 3HU1A 3EZ9A 3HBJA 3LL7A 1KS9A 5EWLB 1XYYA 2PSJA 2EW1A 3A1CA 5D3MA 4ESHA 1W5TA 1VKNA 4CFYA 2HF2A 4AJ4A 4XWOA 4Z54A 4KGXA 1WLSA 5MF6A 3G49A 4P2BA 5KKAA 4FYWA 4FZ5A 4YRJA 3W5DA 2Y05A 5CR9A 1QFXA 3NHMA 3NBQA 2Q9UA 2ZCVA 1S7CA 2Z1DA 2IH2A 5ALEA 1SXHA 1N2CB 3CX4A 4XIIA 2Q3BA 2DM6A 4QYSA 4OJTA 2Q07A 3LRTA 2DP4E 4UEKA 2PZGA 4HD8A 2J5BA 3R4CA 4QEDA 4EPRA 2X4LA 3K0AB 2UYHA 3AQ4A 1D7OA 2B7BA 1NBMD 1G1AA 1IHUA 4GOKA 1SBNE 2P1DA 3WRWA 4BE4A 5CIYA 3QIVA 2B92A 2C9ZA 2FF7A 2YRWA 1KAGA 4KI0A 4F5EA 5CVTA 2Z8YM 3BQMB 3N8NA 4ARIA 5HJEA 3OI7A 1HDRA 2GRAA 2EBFX 3MUOA 1J0XO 2R6JA 1JHOA 3DTVB 4D3XA 1ZPDA 3OAAD 1K4YA 2I2WA 4I5FA 2GYWA 4TMTA 3IQEA 4FB4A 3ZS9A 3T4XA 4ZOLB 1K4KA 3V4RA 3JX9A 3FCYA 4PTYA 3U3KA 3FLEA 3ZU4A 3R3JA 4XTCS 2C0PA 4QT4A 1PT6A 1WSDA 3ENVA 4PFJA 3SQNA 4B74A 1HY3A 3EHEA 3FSRA 3TTXA 5CT5A 3PLAE 3LYUA 2DPGA 1QRRA 2FRDA 1E66A 2GBIA 2HA2A 2YV1A 2Z1MA 3L8ZA 1ZLXA 4N3GA 4PLGA 1CNMA 2IGTA 2Z4RA 4NJOA 2VBCA 3GFSA 9ATCA 4HQLA 2VHEA 1E9AA 5HJ5A 4MS4B 1N7IA 3NX4A 1E4EA 3SLRA 1CJTC 3AESB 3WZMA 9GPBA 3ZWVA 1EWYA 2JAWA 1A5ZA 3LOQA 2X58A 2JLQA 2ADOA 4FIZA 3K5HA 4U7FA 3KQUA 4PG5A 3NH9A 3K73O 3ITKA 4RANA 3RIMA 1HT0A 1QG4A 3E22B 3V55A 3GNLA 4DLNA 4EZIA 2RAFA 2BEWB 4H2DA 4TSKA 1ZN7A 2OCLA 3ZDXB 5FADA 4MHTA 4DR7B 1K6XA 1UPAA 1RKQA 3QMWA 4H16A 3UT5A 1N1GA 4CTMA 2D1YA 1FFDA 3KSRA 2MMCA 3QELB 4FB5A 1EGHA 2OY0A 2F8LA 1SXJA 2FPIA 3AB8A 1QKKA 1IG0A 2C59A 2QRHA 3ME5A 3OFND 1QX3A 3PC4A 4E13A 2XBUA 3KTAA 4EI9A 2FVXA 4G1VA 5DSTA 1TC2A 3DE3X 1D2EA 1ZWKA 2Q4RA 5AO9A 2YOHA 1MJHA 2O20A 2DZDA 5FNVA 2FPUA 4LSZA 4U7PB 4BMOB 1IQUA 2Q8QA 1IN7A 1L5QA 2EBWA 2GJ4A 4CM1A 4QGGA 2NPFA 1ZUHA 1YQDA 4ESEA 1V1MA 3H8JA 2LVBA 3GT4A 2VDWB 1F2TB 4LN1A 2X2OA 3UGQA 1W8DA 1P2VA 3ADKA 3OIGA 3ZHOA 2GZ3A 4CUJA 2IODA 3OQPA 3EXHB 5EP4A 4CIWA 3MBKA 5ARDA 3LVQE 2VDKB 4MYHA 3S27A 2RHWA 2JRCA 4FXOA 3RVOA 2WFZA 1OXMA 1Y1QA 2NACA 1T9HA 3QWBA 4PQRA 3DYIA 3EDMA 4UCXA 4YFYA 4YRTA 4RS3A 4ZVLA 3TEMA 5HSGA 4H17A 4A3SA 4IIYA 1Y42X 2FMUA 2ZROA 3GDHA 1QHYA 3NBZC 2TSYB 1VGRA 1FTWA 1ZRHA 4B6RA 4CNBA 1NULA 4ARUA 2IZ6A 1BXRB 4TT8A 3T6KA 2WEKA 5JE8A 4N7RA 4U0KA 4DMUB 4DDUA 2P5SA 2RGUA 3GPIA 3MT9A 2WLTA 1WB6A 4CCAA 1PT7A 5T3YA 1DC5A 1WKVA 5KOJA 4QAQA 4FFNA 1Z0JA 2ZIZA 4X1YB 1T2UA 2BDEA 1PGNA 2H07A 3R0XA 2AXQA 4NV1A 2P2CA 3UYLA 4GOXA 4EMSA 1H94A 1G8FA 3TQHA 1G7SA 5TGDA 3DE0X 2OFFA 3P5SA 1P39A 3SVZA 3NDPA 1GWNA 4OQMA 3RANA 3C45A 2FK8A 1AQNA 2KSQA 5ALOA 1I8TA 2F4NA 4KN9S 5ED0A 2Y93A 1Z68A 1EHCA 3AINA 1QDUA 4EUNA 1FB5A 2E6UX 1FUEA 2DVMA 3T12A 1MZPA 4EB8A 4LYGA 4RD4A 3DR5A 3RKRA 5JR3A 1PK8A 3F5QA 1IDOA 3C15C 2XIJA 4PYRA 1WY5A 4M76B 3HBMA 1EGAA 4KE8A 4MV7A 3KG2A 4MWDA 2VK4A 4PF1A 4EO7A 3TYXA 3CLVA 3OLQA 3A6PC 1HKHA 1RI3A 2FP3A 3DDOA 5AJTA 2C4VA 5ESRA 2J33A 2G17A 4DNXA 5I8PA 3I6MA 1NURA 3VSEA 3GDWA 4BFZA 4OA8A 2VQDA 1Q2XA 2JI9A 1J70A 1RDFA 3PEEA 4MVJE 4PS1A 2ZYGA 2ID4A 4QSMA 2R5FA 4KWCA 4Q47A 3GROA 5FFNA 1RXIA 2Y1KA 4ALLA 1Q14A 2RGNC 2IS4A 3E1SA 2CFOA 5B3KA 1B4DA 5KNDA 3FHOA 4OI0A 4UULA 1KYQA 4BQPA 2BEVB 2C31A 4TTJA 1IUKA 4L51A 5C7YA 2BFPA 1K7FB 4ZPJA 4DBLC 1OZFA 1U0EA 2GPTA 3PTLA 2W6QA 2FDCA 2VJOA 1T0HB 3PUVA 5B3JA 3PWSA 1RPTA 1TYDE 3HUFA 3N2NA 3QMMA 1P73A 4FZRA 4HDCA 1KP9A 1HDZA 3KAKA 1QO0A 2KS6A 1YWGO 4O4HA 4DLWA 1U8ZA 4CKZA 2OHXA 4FJ2A 4Y0NA 4QPJC 3PHHA 2M6SA 4PCLA 5EMLA 2C9YA 2WU3A 3W7BA 4RHFA 4KACA 5CJ2A 4NJMA 1CZHA 3E05A 3WLHA 4FMDB 3CZMA 3ZXIA 3SSOA 1CQWA 1O5OA 1RHJA 2ETVA 2Q7XA 4BWFB 1O58A 1RZVA 4Q9AA 4BRWA 4HVLA 5E0OA 1XK7A 2AZDA 1J1ZA 1OUMA 4HFMA 1BEUB 1R6TA 5LA6A 3STYA 4CMIA 2WWWA 3WLTA 3E7WA 1FYFA 1JT9A 2A57A 2DLDA 2NNWB 4NCXA 3ZJ5A 1W7AA 2K4MA 3M33A 3DFUA 5LBTA 3SQMA 2CLHB 2XLBA 1CB7A 3B7PA 4MMZB 5I4CA 3MG9A 1JA0A 3O74A 4BO5A 2W2KB 4BV9A 1VI2A 1RFGE 1VDMA 2CCJA 4ZCPA 3HI6A 5HCUA 3G68A 2JI4A 3W5VA 3AF5A 3HB5X 2A30A 1ZM2A 2WHXA 5AJWA 1MTZA 4U1RA 1PT9A 1EA5A 4QPCA 2HDHA 4ZEWA 1NVVR 1WA5A 5IS2A 4G1CA 2I99A 2NO1A 2CJWA 4L76A 3CZ9A 1VYUA 5J2UF 2G6BA 3FVTA 2WYVA 3LZCA 5CEEA 3O73A 1WTCA 3MXOA 2JIMA 1XD8A 4RABA 4YAFA 4EK9A 4REQB 2D0PB 4UOZA 2YRFA 3L0SA 4DJDC 3HCAA 3WP1B 5JROA 1UKBA 3IJEB 4XIFA 1I2BA 2PCJA 1WSWA 2PWAA 4EPYA 4PBSA 3OVMA 2OEPA 5JAIA 3P2EA 3E8XA 1Z2NX 3KJHA 3I4LA 4FR5A 2AK2A 5K6AA 5GGXA 4ACAA 3GCGA 2JLZA 1UBLS 2PUAA 4CMEA 4Q66C 3U7JA 3O8BA 4XYBA 4I4TB 4P4LA 4B4DA 2QB5A 2O9JA 3TRHA 4A27A 1YB5A 4ZO7A 1ND6A 3QKIA 4XWYA 4Z2AA 4ZHQF 2D6FA 1YZHA 1TK2A 2Q7DA 4QOFA 4NF2A 3ZY6A 1EK5A 4HZGA 3TXXA 3HR8A 4DBVO 5IWCA 5JO9A 3HDQA 3IOYA 3TCKA 5C9ZA 1T24A 3BA6A 3I72A 4H6VA 4Y2HA 6GPBA 5BO5A 1ZEMA 2C77A 1O6GA 2X7JA 4L9AA 2INGX 4XB6B 3TPFA 4CLEA 1UM8A 1L8OA 2Z5VA 2V3WA 3I09A 5I9BA 3RVRA 1UMCB 1TZKA 3AOGA 3NR2A 5FPKA 4LRXA 4FC6A 1E6MA 4HXGA 5CUQA 5ALNA 4KU4A 2DUJA 2XE8A 3H3FA 5A1TA 3M82A 2QQFA 3BHIA 4ZT3A 2MT9A 5L53A 2ZAMA 2X4GA 3FNEA 2EKZA 2YS7A 4L73A 3LVRE 3NBMA 2QLLA 3WA6A 3WWCA 4E33A 2AN3A 5F9MA 2RH5A 3H2KA 1VE1A 4ZYXA 2QQ0A 4XWAA 1SCNE 3HUDA 3VYSB 1HEIA 2HFKA 1NN5A 3HYCA 4G5OA 4MVJI 2PMDA 1KEZA 4NU8X 4YR7A 2Q28A 1Q0LA 3E5HA 3IE1A 1KGDA 4CF7A 3SYKA 5C8YB 4MICA 2QMUA 3SYMA 2Q46A 5KHOC 3SKVA 4NEGA 1TCBA 3O03A 3KJQA 2BFEA 2FSGA 2WJ6A 2I2FA 3JVVA 3E9QA 2QA5A 1P1RA 3H2JA 1KYVA 2LGJA 4HZUB 3UUFA 3ZZNA 3IS3A 1ULBA 1UP6A 3IMCA 3HMKA 4L6CA 4QGBA 1SOVA 3TXYA 2BRUA 2P6MA 1QM5A 2FWIA 3A6LA 1YZUA 4EY3A 4GLOA 1W4CA 4OHUA 5GZ3A 2H4WA 5FLEX 4AURA 3MBIA 1TAHA 3IUJA 1BH2A 1ZI9A 1EE1A 4HUQA 1QVWA 1UFQA 2WD9A 3EGIA 4FOLA 4M1ZA 3C4QA 4A4DA 3HNOA 3IB3A 4EF5A 4ETIA 5ALKA 4KJZA 2XDQA 4ND8A 2CCGA 3HB7A 4IUCS 2CXNA 1C7EA 2QHXA 3D8UA 3N2GA 4LYHA 5A0FA 4LI0A 4JNKA 2BISA 3BFKA 3NKVA 4KXYA 4P7GA 5FB3A 4K1XA 3R6TA 4UUBA 1HFJA 4UTPA 4EZBA 5CXQA 1XCMA 1DZ3A 2OBFA 4B75A 2A9JA 3LRPA 1G21E 3DPSA 3T7SA 1HX7A 4RVSA 4XJXA 3IP3A 1DPGA 3IIIA 2HBQA 4QT0A 2PTGA 3L1IA 3I76A 1DXOA 1V43A 3ER9A 3VNVA 2CUZA 1JR3D 4TUYB 4Z8YA 3BVPA 3T1VA 3PKJA 2OC9A 4MQ5A 2UU9B 3HXTA 2AEFA 3R9WA 3LYHA 3GA7A 4GUAA 1E60A 3L7BA 1CS0B 4LHSA 4XLTA 5JDCC 2WC1A 4IIJB 2HAEA 1LTHR 1X9HA 4L5BA 3STVA 5IDXA 3ZC3A 3OESA 1P7CA 1JZQA 3IPRA 4I1PA 4DL9A 1QTNA 1EKXA 5LP6C 1DC8A 2QLFA 3HKBB 3C6MA 3AERB 3N59A 2GAJA 2QYOA 4KC0A 3TB4A 4AWAA 3ZI0A 1ZXXA 5DF1A 2KLBA 5IM5A 3TFOA 4GEGA 3OZVA 2FE1A 1XCBA 2GPSA 4WBNF 3WLIA 1RHRA 2RJ3A 3ZIDA 4YCCA 2GZ2A 1RRCA 2XMQA 4HDAA 1R50A 1P62B 3DMGA 5DHUA 3RFCA 2PRZA 3BIWA 2GRUA 3C39A 3OTWA 4XYLA 5CT8A 4PHHA 2YY5A 3ABOB 3PI6A 4JOCA 1YS6A 1F5NA 4RFSB 5I45A 4D98A 2LCFA 3KQWA 3SQLA 4YCJA 4X6YA 4AYTA 4JDUA 1T3GA 3V4LA 1COWD 4RY9A 1BOOA 2F1HA 5EGNA 3AONB 2WPNA 4HT3B 1TQ4A 1XZDA 4FYKA 3RVJA 4IBOA 4MR9B 2DSTA 3FPEA 1OD6A 1Q7TA 4B40A 4YMIA 5IKEA 5AXBA 1TUBB 1FPQA 1A69A 3UA3A 2CSUA 4MWTA 2Z9BA 1LI7A 4IMJB 4WI1A 3BRSA 1E2PA 3B1KA 3VPFA 2Q9BA 5BURA 4FCVA 3AEUB 3ESQA 1AQIA 4MVJA 4C4PA 3CNHA 4HJRA 5IM4F 1SH7A 3DO5A 1SEPA 4NSNA 5ALUA 5K8TA 1LJ8A 1U8AA 1U4SA 1KQNA 3T1NA 2G88A 3LDFA 2ZT8A 2IYEA 4HEJA 3KFVA 4LVNA 3TDNA 4Z4HA 5LDHA 1NP7A 2ZIVB 4P1ZA 1TD9A 4NEQA 3DNMA 1YQQA 2JCSA 4Q3LA 1U99A 4X1KB 1RWBA 3ZV5A 1VI6A 4JWKA 1UPCA 3WAJA 4I1VA 1TM1E 2W6JA 3C5WP 2WY2D 3WVNA 1EGQA 1RW4A 4IHKA 1HE3A 4Z9XA 2CUNA 3PLRA 1RXCA 1RQPA 3GCDA 3JQ7A 3LCRA 4CMBA 4N18A 3DBVO 3C1UA 3IILA 1SJ9A 3M2TA 1TD1A 1Z3CA 1EVJA 3IKJA 2D5AA 1E6EA 2QRLA 2UZAA 4RYLA 1NW4A 5A02A 5CW1A 1L5VA 1GUBA 4J4BA 1K0FA 5K05A 2PWBA 3GJZA 4CMAA 1F0YA 3A4LA 2R00C 5ALWA 3UO8B 1A5AB 4G85A 3VVLA 1PZHA 4BV3A 1GDTA 1LDMA 4TMWA 3DV0A 3FUTA 1IB6A 4DRXB 1GA4A 2GF9A 4Y1GA 4LDAA 1GD1O 2HIMA 4MGIR 5FPYA 1OHHA 2L19A 5AK5A 4XOIA 2OBLA 4E09A 3WGOA 4FZVA 4IHAA 4ZVMA 5BSGA 2RI1A 1WCXA 1ZSNA 1HQCA 1PAUA 4GG1A 4GSLA 5B1HA 3DE2X 5CFPA 4NXNB 1VOTA 3KXLA 3NTQA 3OPMA 4FYVA 4P8RA 3U13A 5HHTA 2ZYVX 5JNVA 2Q2NA 2HNKA 1HQYE 2JFHA 16PKA 4LOJA 4RTOA 1U8CB 4UCFA 1G7CA 4BAZA 1KZ1A 3I2IA 3KTOA 1UPFA 1E96A 1RI4A 1ZEJA 1WEKA 3BIFA 5EWJB 4H3VA 3OCWA 4ERNA 3PXGA 4JHXA 2V7BA 3ZLBA 2FR8A 3W2EA 2SNIE 3S40A 3MFQA 1JBEA 3FDFA 2NO5A 4QYXA 2FPWA 2G1JA 4NXMB 4PPNA 4AKIA 3SF8B 1W76A 2BPOA 3HXQA 1U7OA 5AKZA 2EGHA 5D3MB 3F97A 3M9LA 1W35A 3KSZO 3SPXA 5KTYA 2FQXA 2OSBA 2XNDD 1HPLA 2GD0A 2O2HA 2REXB 2W58A 2PUFA 1SVSA 1RQGA 4K6MA 3FFWA 3OF2A 4P34A 4S24A 1XTJA 4F96A 2ZBUA 4LVCA 4O08A 1QPBA 5L4SA 3HQ4O 1MGPA 2G9VA 3K8ZA 5FLXA 3DMFA 1MVNA 2D5CA 3OLXA 4HPJB 4RD6A 3AU8A 3U26A 3C48A 2D62A 3L6DA 5ILQA 4EHHA 1AUPA 3V2UA 4J2HA 3F71A 1XZIA 3ISTA 4HMPA 1J8QA 1UDWA 3AJRA 3EX7C 2ZSDA 5CT9A 1YT5A 1NT2A 3I30X 3QYPA 1WO8A 4TYMA 4Q4CA 3VISA 1E3EA 3I0ZA 4J1SA 4OAPA 2HA6A 2BGTA 4WY2A 3HJBA 3H2HA 4JC4A 2MSLA 2H85A 2H2IA 4PPGA 1CCWA 2I76A 3JASA 5MFZA 1LC0A 3ND8A 3AFIA 3COJA 3H2ZA 2XMPA 5LMUB 3HNPA 1XMQB 1PYGA 4FDTA 5FL7D 3PNOA 5DM1A 2FEMA 1ZVMA 3AFGA 4P93A 3T41A 3ZS8A 2J6BA 4F4CA 1YB2A 4PG6A 1X1CA 4D56A 4LJ8A 5D2CA 1CUAA 4BFSA 1N5LA 3JWGA 1ZGJA 4PM4A 4RXTA 1FU4A 2D06A 1E3SA 1DAOA 2A8YA 2ZTVA 2QV7A 1M6HA 3AHJA 3DKRA 3F0TA 1RD4A 1RI5A 2WU0A 5KMGA 4OU4A 4BVKA 5CAEA 3DD5A 3VMFA 4NJEA 2KYRA 1Z8DA 2PSFA 3OOWA 2F1IA 4XASA 2HHAA 2YNMD 4Q7EA 2HQBA 2IPNA 1K7EB 2OD2A 3T1HB 1QQAA 4D9KA 1WULS 2ZIXB 5AIBA 1U9IA 1T5HX 1XDDA 3TZLA 4CG2A 2YN2A 1VL8A 1CERA 2E1PA 1F06A 2M1XA 2RGEA 2V5AA 2CKMA 3PXDA 5KHAA 2JAXA 3RB8A 3RJ5A 3WLMA 1XWWA 1JP7A 2HQOA 1YMUA 4TKMA 5JADA 1BD3A 5IJZA 1KJYA 1CUWA 3TPZA 3UK0A 1CY8A 4CQJA 2WQ6A 4K87A 4DN6A 4CXMA 1V2HE 1VLLA 4FHCA 1F3LA 2XODA 5AVRA 1N4DA 1JI0A 3NTXA 1ORTA 4FFWA 1GDHA 2C2GA 3HN7A 5AI8A 3GO4A 1HUQA 1EM8B 1ZHOA 4IRXA 1FUIA 3AF1A 1G21A 1LPMA 3C7KA 3T7AA 4Z0HO 2ANCA 4FQ7A 3RTAA 2FEKA 5H9WA 3KEFA 4HQNA 2KM1A 4GR5A 3DGFC 2ZITA 4L6AA 1W2WB 3KZCA 1XZBA 2GTHA 1RKUA 1SC4A 3ELUA 4PYJA 2B5VA 1E7QA 3DPUA 4UC0A 2CVFA 2B69A 2ILTA 3BWYA 1DDGA 4BX2A 4ROTA 4FE7A 4C5AA 3JQDA 4DE5A 4DNPA 4DMGA 1XVUA 4TWBA 4DF3A 4NI5A 3B9BA 2BHTA 2VP2A 1VIAA 2Y1FA 3E18A 2GLTA 1ZR2A 1MX5A 1X9IA 4F3TA 4E14A 5FFMA 3N2LA 2M6KA 2I8LA 3HSKA 3RM3A 2P79A 3T5MA 2OAGA 3I6QA 4BQFA 2QT0A 2CB9A 2NSLA 5A3JA 3GZNB 2VDQB 3OTHA 2BMWA 1L5ZA 4YR9A 2VZ8A 2NVBA 3KD2A 3E7XA 3NNDA 2O1WA 5ECGC 3W6UA 3DDHA 5CURA 3DDNA 4GKKB 2HWWA 2JDID 3RAPR 3UM9A 2ET6A 3DZBA 1VP3A 2O1SA 3DO6A 2ZS8A 1L9XA 1PFKA 2VP3A 4BTVA 2DMRA 3BCHA 4DQUA 4E5NA 5DM70 5DVZA 2ZGVA 2RSLA 3QYJA 4A26A 1U0SY 3HCWA 4IHJA 3UPTA 1SVLA 2O0LA 3QKTA 3CR7A 4RHYA 3P9YA 2FZCA 1XZGA 3N07A 2D0OB 1KDVA 1MV5A 4CTOA 3RYCB 4EECA 3FWHA 2EZ9A 3KVOA 1EHYA 1LPAB 1A2KC 1RXUA 3PEUA 4FGWA 4O0MA 3DLTA 3H5AA 4M38A 3ELWA 2C42A 3V8MA 4KTTE 4GDMA 1LJUA 1MB9A 1OA1A 1YDEA 3H9QA 3HBNA 4IGFA 4LQ4A 5DEIA 2RGRA 3LH5A 1WQ1R 1XZCA 1F4VA 2QL6A 2XTMA 3IH5A 1R8JA 3E9DA 2HHCA 1VA5A 4XDZA 2WA1A 3FGOA 4L75A 3KYIB 1N32B 5E9WA 1I3OA 1I2MA 5A5GA 4MO2A 4BASA 1ORVA 2WVAA 3W5SA 3O4RA 5C18A 2ZB7A 5JYDA 5LN1A 1LF5A 1H4TA 1KNXA 1V25A 1ID1A 3CW9A 4EGJA 4NFSA 5KSWB 1ZCBA 1WP4A 3QU2A 1L5SA 4ZYWA 3N2KA 4NMWA 3MT7A 1PEKE 1RJEA 4PLPA 5G0SA 1VMDA 4EFNA 1J25A 2WJIA 3FHCB 3RW9A 4ZK6A 2WD8A 4RGQA 5I5GA 1CETA 4FZJA 5LB4A 3RS5A 1JDVA 1RHKA 2GN0A 3BQ9A 3RYHB 4FFVA 4I66A 5HKKA 1ZD3A 3QVKA 3ABZA 4AO8A 3PUHA 4DIDA 4DLZA 2I8CA 2RC5A 1HOXA 4XWTA 1JIQA 2NUAA 4JP1A 5TMBA 5A3QA 3S8MA 5ALIA 2VJDA 1N5RA 1LK7A 1YF3A 4O2LA 2X9VA 3HZRA 3CN9A 3DLBA 1W36C 4F3NA 2HFJA 1W52X 2WHEA 2QNIA 5SYAA 1JMKC 1E7WA 2IYRA 1P2UA 3A1EA 3TOCA 4C0KA 1IQPA 4GI1A 1M0EA 2JW5A 5KYVA 3KAQA 4ZVUA 2H54A 3WDMA 1GIAA 3F6CA 4OFBA 3C7AA 4DARA 4LC9A 1XZPA 4JODA 4KXLA 5GTDA 3RAEC 1U8YA 1YQGA 1WXDA 1E2KA 4NJMB 1UBKS 4KBGA 3IBGA 1HQDA 1VPEA 3SOPA 2REQB 1M2GA 1U28C 1P3Y1 2WIAA 5H1YA 4JIGA 1XU7A 3PDIA 4D9MA 4GECA 4H1WA 4HCJA 1AVTA 5KYYB 1H2BA 4MVJM 3SBDA 4Z86A 4F12A 4B35A 5JY1A 1QOPB 5ALZA 2LE0A 5H0IA 1L4LA 1DAEA 4JLNA 3D54D 2HH9A 3TMYA 5AK4A 3FH0A 1FDWA 2CNWD 3L43A 1JH9A 1FFGA 3WLNA 2CW5A 1RQNA 5EXPA 2NSJA 1BA3A 1I9GA 2I3GA 3OY2A 1LQUA 1IOWA 1EDEA 3LE8A 4ENWA 3FMGA 1PQ4A 2B37A 1WAMA 4PG8A 1GU0A 1JAIA 2NTNA 4KNYA 5DI3B 4EX7A 1I3CA 5IUJC 2CDNA 3W90A 5K6TA 2LKCA 3ZH9B 1GTJ1 4F4JA 3GLIE 2GD2A 4P38A 3R20A 4MUMA 5CB0A 5IPFA 4Z6KA 3NOXA 1KEPA 4O8ZA 5KOIA 3DFZA 2VKTA 1T3TA 3O6VA 3A4MA 1XKXA 3SEZA 2F67A 3JQGA 2GETA 4F6RA 3ZH2A 4C87A 1GZ5A 4K28A 4R40A 5AW6A 2A9VA 3NT2A 1E1LA 3CA8A 3ESYA 4HWPA 3D8NA 4IXDA 4X95A 3UOGA 3DKVA 4HNGA 4TKVA 2YWHA 1PNOA 1KSHA 4CV0A 5TX7A 4XR9A 4MVJG 4QRIA 1QAQA 2FMFA 1NF9A 3VI4B 5JNUA 4XQCA 4JC0A 5E0KB 3SIRA 4ZYTA 3HWSA 3S28A 3DV9A 3PLNA 1O95D 3EQ2A 4YJKA 4TOIA 4ALKA 5DLQC 2G36A 2B25A 1GNPA 1R4AA 4PWYA 4UBIA 3H5OA 1V5EA 2A9FA 5G0TA 4U2KA 1NW5A 1LJLA 4NZ9A 2YN0A 3D1LA 4G63A 1OJLA 4EPXA 3TQCA 1L7PA 4TZ6A 4XARA 4JIMA 2WOJA 2WWHA 3ZVKA 1V37A 1RYEA 3DQZA 3QEJA 3SHTA 3TQIA 3Q15C 1JJFA 1TJ5A 4OFXA 1Y3DE 3I1YA 3JQPA 1EFAA 1XMJA 2X0EA 4PW0A 3OQJA 4WECA 2HLDD 1FTQA 3L6BA 3KVYA 1Y3BE 1QJ4A 5AXCA 2ZRAA 3RTBA 4D9HA 4JH0A 1DO8A 4H1UA 3AK4A 1NUHA 4M7RA 1FUKA 5KTRA 3H1AA 2WSIA 3ENNA 4FYXA 4C08A 2C92A 2G09A 4LJSA 4Q5IA 3U48A 2BFWA 3CH6A 5A7FA 5KNBA 1ZCZA 4TMVA 4X6LA 2JFPA 3FFBA 1IY9A 2C0QA 1R6AA 2D2VA 3ZU3A 4BATA 1UK9A 4UVEA 1M6VB 2J0EA 4L8WB 4MYUA 2Z4SA 2QS9A 4DLRA 2ACVA 2J9GA 3FNIA 3KQVA 3VZCA 2X2FA 1C80A 1MA0A 1GUFA 5HDQA 2D1QA 3LL4A 5C7IO 5L95A 2WD7B 4D8VA 2GEVA 4W9MC 2IXFA 4HS9A 5FORA 4DDWA 4NCHA 3EZNA 4AJHA 1QGYA 1DELA 2O50A 4WWHA 3B20A 2H7YA 5A5FA 4FEYA 1HE5A 2XDQB 3K1JA 3KWJA 4W5WA 5EPUA 3OEWA 3P2IA 3SJBA 3Q0TA 4F9GA 5CB8A 1YJQA 3MFYA 2C07A 2CEAA 2Y71A 3IC5A 5BT8A 2V7EA 2XWBF 2DHQA 2WSSD 3ZE0B 3WWPA 5ABPA 3GPLA 3C3BA 4UUOA 3LT0A 1H69A 1QG6A 1RC0A 2OCBA 3RAJA 4PZ9A 2VYVA 3OJEA 1KYIA 4UD2A 3LY7A 3OEHD 6NULA 2YXEA 1J99A 2A67A 3KC2A 3G3EA 3K2QA 3N0WA 1V8ZA 3LXRA 4IH9A 3SFTA 2VP5A 5IBPA 1C7ZA 4ME6A 3LPMA 4MEAA 1Y4UA 4XGKA 2AG0A 2IEYA 3G9ZA 4OKIA 3LQ1A 5GZ6A 1NBEA 2JL1A 3GH1A 2AFIE 2PA3A 3SE0A 3R7DA 4B6QA 2PH5A 1VB3A 2P11A 4KN5A 3OM8A 4PBTA 1Z6YA 3E1KA 2QV0A 3DT8A 4PBRA 3IAUA 3AFNA 4JBLA 1RJ9B 3D2CA 3E2IA 1JHQA 1PQYA 1RCTE 2GZ1A 5KYXB 1YCHA 1E7RA 2UUPA 2V96A 3UYKA 2BM0A 1T5LA 3A3NA 5IYZB 4OQDA 1UXIA 3L0OA 1G41A 4MVCA 4DUZB 2UZ0A 4DUPA 1ICIA 1Y4SA 3PKIA 4RORA 1OASA 3B5JA 2JBAA 3HA2A 4YALA 4FDMA 4D92A 3T1TA 1U5CA 5TDHA 4IQ4A 3JALB 3RUEA 4XDHA 3P9PA 4C0WA 5DN6D 1RCUA 2X0JA 9ABPA 4Z4QA 2YIDA 1PR1A 4Z9FA 2ADMA 2R8XA 3G82C 1K06A 2YWDA 5AKGA 4XVUA 3UGTA 4JZYA 4FHZA 1BQ4A 1F2VA 1H5UA 3MF4A 2WJ3A 4O2BF 2GXAA 2WE8A 4KHPB 1I1QB 1COZA 1SD5A 4X8HA 1NN1A 2C9DA 4O4IA 4NK4A 4NE2A 5HIKA 1T26A 3HJCA 2Z3VA 5LQJA 4ZK2A 3NHPA 2CLDX 5LYYA 1JE0A 1R6XA 2WKPA 2ZAOA 1N75A 1WUJS 3DAPA 4GKAA 3RK1A 4DPKA 3LHDA 1VCIA 1FU8A 3K9HA 4PQFA 3FKSD 3HACA 3FLMA 4RH0A 4EFKA 1S0UA 1YB1A 4OQQA 5HG0A 1BXGA 3R7WB 4EJSA 2CBXA 3AUUA 2B7CA 3CO5A 4RQTA 4JI6B 1JGTA 3B8HA 1ELOA 4M49A 4G56A 1JMVA 2Y1CA 4TKUA 2C03A 2R68A 4AF6A 3IAXA 1QOQB 2J9RA 3TVYA 4ARZB 2BSAA 3QTLA 3BFXA 1B2RA 2X7HA 3RUAA 2C57A 3R3VA 4Z2YA 3TSWA 2Z6AA 4CZ2A 1SK9A 1V1JA 4TLLB 4XW2A 3KSAC 2OC4A 4PTZA 4X41A 1OXUA 4DNFA 2GAIA 1OX4B 1EDZA 5FV4A 2C2HA 1GVNB 3UAVA 4ZAWA 4DSZA 4KR9A 2H0RA 1DBVO 1PZXA 3HHEA 1JDUA 1KE2A 1XMOB 1B14A 4EYOA 5HJ2A 4UW9A 3MRXA 2EWVA 1JTVA 2COUA 4RJJA 4XWGA 2VCEA 2R7NA 2DWCA 3JATA 3W8EA 4QUBA 5KVAA 2UV8A 4C7JA 2GTPA 4D3FA 5BXQC 2ZCJA 1I2AA 1QFMA 1RXVA 5AW3A 2Z43A 1RRGA 2I4NA 2W6NA 3NC4A 4RF3A 4HNVA 2B0JA 1KL7A 3GJXC 4ARBA 1FNNA 3WO1A 5GOTA 4LF7B 1M5TA 5BW8A 1I6WA 1L7BA 1N9ZA 4MW5A 4GOOD 4G23A 3EVEA 4W5HA 3UJ9A 1M2FA 1EWRA 2OQVA 5ECDA 4I6JA 2GNPA 2X1HA 2AR9A 2V7TA 3BMNA 4LJKA 2IOYA 4M0EA 1ZFNA 4BMSA 5I7VA 3OPYB 1F4LA 1GNLA 4KNWA 2ZR8A 5CA0A 3OO0A 1QGUB 5BMOA 3W5JA 3K9FC 3ZVNA 3CTPA 2Q50A 1KZYC 4X93A 4ZFNA 4UEWA 4JI8B 2J41A 4CIBA 2XECA 1N6IA 2MOKA 2G04A 2GCIA 3O5AA 3E1GA 4FOTA 2G4LA 1ZUNB 3EYWA 3MMNA 4FFLA 5SZHB 4TYNA 3HJRA 4ZV4A 3VSAA 1PHPA 2ZW9A 3GDGA 2ZBDA 5JI2E 1ARZA 2Q6KA 4G0UA 1KH2A 3NGLA 4MW9A 1HT3A 2PKCA 5LZ8A 5KIAA 1JDBC 3ECCA 4PHGA 5IVDA 1RBYA 4JUIA 1RAFA 3VU3A 4EI8A 3GLGE 3PJRA 2JLVA 4PS0A 1ULHA 4C2TA 1X8KA 3A3OA 3PQCA 3RAFC 2ISSD 1JLHA 4RK1A 1SUBA 3C6YA 3H6HA 4RCVA 3BORA 4G2TA 5ALDA 5TMEA 5I9NA 4YLGA 2DHEA 2G1PA 3E3NA 3ESBA 1Q84A 4P5DA 4UVDA 1IATA 1P72A 1TF7A 2X86A 5FIUA 3T5DA 3TR0A 3ZQ6A 3GUYA 2Y6UA 4G01B 3PP8A 2AN5A 3FWYA 3AKEA 4X3PA 4D41A 4A73A 1S02A 2OT3B 2BZ0A 5CEFA 3F3MA 1HA3A 4EG4A 5EJ4A 1BGXT 2P8SA 1M1ZA 3JASB 4IHJF 1RVDA 4DLSA 5EXSA 4F4DA 4CIYA 1ZDMA 2FWMX 2XA1A 4Y67A 3EBOA 2ZYRA 2OKGA 4L4UA 1N1DA 5ICEA 1MEJA 4Q02A 5FPPA 1DP4A 2VYQA 1XHEA 4MVYA 4Q1DA 2XCUA 3K2EA 2QTRA 2AJBA 3K5PA 1T6ZA 4YCNA 2FVYA 3L9WA 4ZV9A 1AS0A 2H59A 5CD1A 3T1OA 1AHHA 1E1DA 1PW7A 5BW6B 4JYZA 4M0PA 1NLYA 3VPSA 4CFZA 4ZYYA 1D07A 4BE7B 1DQNA 3M9XA 4UM8B 3VXKA 1P74A 2ATEA 1BW9B 3NO4A 2EERA 3GGDA 5KMGB 4NJEB 4MVWA 3THXA 1TEHA 4C0QC 2QZ4A 1NXSA 5THKA 1FDVA 4RXMA 2GB4A 4YRPA 5JC8A 2O07A 2C9CA 3A37A 4MW7A 1L5MA 1O3YA 1DIGA 1IY0A 1STOA 4OQXA 5EQDA 1VE7A 3AKZA 4HOYA 2VDVE 3CU5A 1SPBS 2L18A 4FW8A 2PKRA 4F4IA 2GBPA 1KEUA 1M33A 1V8OA 1OXKB 4I55B 4LHYA 5GOZA 3WAKA 2OPHA 5JNSA 2XBMA 1Z07A 4TZ0A 1N2HA 2ZBFA 5K4GA 1ST3A 3KKNA 2IYSA 4DBZA 2NUPB 1FBTA 5K99A 3SR3A 1NMYA 2ZU6A 1GPUA 2TYSB 2BZSA 1HKUA 1WQ4A 4Y9UA 4BBZA 2ZYIA 3GRVA 5BR7A 5DNUA 1I2DA 4L8LA 1G60A 2QROA 1G21B 4U9HS 2PQ0A 5LMZA 1O6ZA 3R3UA 3UCEA 1EAYA 3ONFA 4FQ5A 3VYWA 5TF0A 3U7FB 4IIUA 3GP3A 4EQ6B 1TT5A 2V6MA 2YOGA 1UJ2A 3LQ2A 2ODWA 3T1QA 1DINA 2QN3A 3MM4A 5DWDA 5IMBA 4WINA 5JVDF 5HTKA 3GA5A 3PWTA 3U4GA 3LBYA 1CZKA 2O2ZA 3SWWA 3OF3A 3FHJA 1NZDA 2OE2A 1ZD1A 4YPVA 4QU5A 5E4JA 2QMHA 4EPTA 4AG5A 1P1IA 2F7SA 2VPTA 5TJHA 2F43A 1R8XA 3VTAA 1XZHA 4AZ3B 5AXAA 3VX4A 1D2GA 2AFIA 1AV7A 2A86A 4UNNA 2WHPB 5CH3A 3BGOS 3DMNA 5G0WA 2BFMA 2O2SA 1US8B 2AW5A 3H9GA 3PQ4A 4D8WA 2Q1XA 4M0FA 3CLTC 5FBHA 2WB2A 3KWMA 2I6XA 5L4LA 2WINI 3EZ7A 1HG0A 4TTQA 3WMEA 2MIIA 4PNZA 4UHJA 1WXGA 2GDJA 2R8BA 3G7UA 3V34A 3AR4A 3V46A 2J9XB 3VYVA 5BXYA 2F8SA 4F86A 3CJRA 3PHIA 3NBFA 7MDHA 2AKEA 2NADA 3H83A 4BVFA 3ITNA 2QRJA 4X3CA 3OE7D 1ZS9A 1TEVA 3TIGA 2W43A 2UZ1A 2ZI4A 1H9BA 1YE5A 2MINA 1YVDA 3EBLA 1SCKA 4O4JB 1FTSA 5KKNB 4C4OA 1ULTA 2LDBA 2ZJYA 4N82A 2C1EA 3Q5GA 3O1IC 3LIIA 4Y2JA 3VNAA 5DHQA 3ZU6A 4JQYA 5DGHA 4PFQA 1IUPA 3O9ZA 3UMCA 4BMDA 3IMGA 3PXCX 1DVRA 3DZKA 3TLMA 4EJFA 5BSKA 5EJMA 2SBTA 5KVQA 2J0VA 3T5TA 1XQ6A 2BGJA 3R7AA 5EFOA 4R0VA 4H77A 2CFRA 5HA5A 3ZBQA 1IRIA 1XTRA 4QVGA 4R2WA 3HABA 2HSWA 1DIHA 4GR9A 1C1XB 4Y6LA 3U0VA 2GEKA 3JAKB 4MLDA 4WLNA 2DH6A 1GNQA 1SQFA 3Q5EA 3VOSA 4XVQA 1XC7A 2EKQA 1ISMA 1UPTA 2RIPA 2BR5A 3O82A 1E9SA 4PXAA 4YJFA 3GEPA 3D4NA 3IXLA 3FWZA 3LVFO 1IAQA 3FJOA 3N2KB 1VBKA 5F78A 1O54A 2AUMA 2I1QA 4KCGA 5CH5A 5J2TA 4RIFA 2FPSA 4B2IA 1NW8A 4PZEA 4A6XA 5EP3A 4B3HA 3T7CA 3EXG1 4GMFA 4LF8B 1LKZA 3MTAA 4KQGA 1IVYA 2FZ4A 2WHRA 4MUAA 3DDUA 3KHTA 2VNHA 3AVPA 1ZLYA 3FRIA 4F91B 1T2FA 2GO1A 3EQZA 4JY7A 1QKJA 2X6RA 1RYZA 4J0QA 5CXSA 5GONA 1EFLA 2WYOA 1EB8A 2FFBA 2Q3MA 2Q6TA 1VHWA 2G77B 3IV6A 1NXPA 1O08A 2PU5A 1GP2A 1L7AA 2QN2A 3NEYA 1WMEA 2HU5A 5KJ1A 1W88A 4MQBA 3QF4A 2BL4A 3VKHA 3Q6MA 1NW7A 3W6OA 1CE8A 3AGPA 3JWHA 4K05A 5IKXA 4AXBA 1CY6A 4R8LA 5JDIC 1V7CA 3TLEA 1UC8A 1V47A 3CLSC 1S2DA 4OSPA 4TVOA 4BGIA 1IBCA 4J1QA 3ZV7A 3IX7A 3JQ8B 2O6LA 2Q0QA 2VQ3A 3ZE8A 1DL5A 4WJZA 4GXNA 4OI4A 5JAPA 2RK6A 2WF7A 4XWKA 1DX9A 4B3XA 4MXDA 3PDIB 5ERGB 4COOA 4FYJA 3JYQA 4DAOA 2WOOA 3HPRA 4HVCA 1XG5A 4PC2A 2IWHA 3VJLA 2RHHA 4RJTA 5A4DA 1P7PA 2R2GA 1SU8A 1KBZA 2Z3ZA 4TMFA 3QSGA 2GD1O 5K8IA 1UEJA 2FKNA 4GBMA 1O0BA 1BKSB 3NRCA 1OFIA 4GPAA 5JNLA 3B7WA 2PX8A 1J8VA 1GEGA 2R86A 1PF7E 1GRVA 1OC2A 2QMQA 1RLIA 3NV9A 5DYIA 3WNCA 1MOPA 4D4MA 4K9RA 2SICE 5CVJA 1MB0A 4XPIA 2EJCA 1G5RA 3SC3A 1UBGA 2QTNA 3C6ZA 1M8JA 3L01A 3FD8A 4EYGA 3DCYA 3GLGA 4WZBB 4PLCA 2P8JA 4PNEA 2C94A 3PDHA 4A10A 1Y1LA 2NM0A 4AZTA 1F1JA 2V7XA 1BRTA 1EQ2A 1H6AA 1SCUA 5JFOA 4M89A 2WWTA 3OQIB 2PWYA 2NO6A 1T13A 4HEHA 2AG1A 4EGAA 3GVIA 5KQSA 4QM6A 1WXIA 2CLCX 2ECKA 3RF7A 1SHJA 4LA4A 4BTLA 3JQGB 1X6VA 3PNBA 5ESWA 3CVWA 2JKZA 2VTVA 1Z0FA 3QBVA 4S1VA 3PA8A 4YAIA 1SOAA 2UYGA 4TKVB 2VKQA 4G5FA 3PCRB 4X54A 1B41A 5JHHB 2OA0A 1DBWA 4RKFA 4XGIA 3OZTA 1PFYA 3E8SA 4FHEA 3EVNA 3RBVA 1QYDA 1FSZA 2HN9A 2ST1A 3JVEA 5EIEA 3NG1A 1ENYA 3A4VA 1FVHA 1F51E 2JI8A 1JE1A 3FJ1A 3QNUA 4YXWA 2Q9CA 3VYUB 3AF6A 1UOOA 3MHTA 2X9QA 4QYWA 3E4DA 4O4LA 5DXAA 3M6WA 4ZVVA 1GAXA 3DYVA 3MGAA 3I8XA 3SQXA 2ZRBA 4CPDA 4I9NA 1I6LA 4GM1A 4RMGA 4ZOBA 4IUYA 2GZDA 1GSAA 4C05A 4Z4GA 1Z6TA 3IHWA 4Z7QB 2WF9A 3A31A 3T94A 3U37A 3V8VA 1GA1A 1ZESA 2DR3A 4UBKA 4NONA 1X1BA 5AH0A 4X45A 5KX5F 3I2KA 1V7ZA 4GSYA 4ZT7A 4ZCTA 3KQOA 1MJFA 1RM0A 5C32A 3HU2A 4Y6SA 3TOXA 2W37A 3NHZA 2FHPA 3C3MA 5GGYA 1L7VC 1QG2A 1VG8A 4JKOA 4KPEC 3DP9A 2XUJA 4DR1B 3F2IA 4YT2A 4OFWA 2E5FA 1FSFA 1JFFB 1S5PA 1QPZA 3D3JA 3GN1A 5I9IA 4BVJA 1WCWA 3TNLA 3TECE 1CUBA 2BFNA 3M3HA 1C3EA 2XMGA 2JGAA 2QTWB 1PEYA 1OJ7A 4YN3A 1KYWA 5CX1A 3UB4A 2H4JA 4L7VA 4CODB 3K09A 3LAWA 4MCHA 1MA3A 2WJAA 2W70A 2HUNA 3A1TA 4H7PA 3MWJA 5JSUA 2GJ9A 1SVOA 1L5KA 1C3OB 1MEOA 4L5AA 4C14A 1NVKA 1RYNA 2JJ1D 3SVTA 2VTEA 2X77A 3ZV4A 3DPIA 1E1MA 2JFGA 4HAZA 3O8RA 2HTFA 4UNRA 1GG5A 5A9RA 4LXTA 5JXGA 3RFVA 4S1NA 1XLTA 5A1JA 4NFLA 2Z2ZA 4KX5A 1KDPA 3WMGA 4B9EA 1KIFA 2OLKA 4MGYR 1SY7A 1XDBA 3LPNA 3DQPA 4BLSA 3LHFA 5E3IA 2AMYA 3LO8A 4LZLA 3IUYA 4DVGA 1XTPA 4RKWA 5CX4A 4MJLA 2OFXA 2E4YA 3A6FA 3UEOA 3M5CA 1PS0A 3QFFA 3TW8A 2P3OA 1VLJA 2PMFA 4H3SA 5F1OA 1Z6PA 4R83A 1DWQA 4E6EA 1DKOA 1JIVA 3HE3A 3HO8A 3LPAA 3WK9A 1CYDA 1SN7A 5L3SB 1OTXA 4M6WA 1KMQA 1GUDA 2H7XA 2M98A 4AI6A 3EQ8A 5F64A 3QM1A 3KV1A 1CQXA 2FWRA 3FFAA 1WMFA 1TT7A 3KJXA 4A6PA 5IX8A 1SUFA 4X20A 3DW3X 2PD3A 4MWCA 4OK6A 4D9EA 3EXHC 4KXVA 4EA7A 4EB6B 4DTCA 4ZYUA 1OTYA 2WNHA 3A2KA 3B9RA 3WSWA 1SGWA 4RNDB 3JQAB 1U31A 2IXTA 1K2VN 2E49A 3OO1A 3QV1A 4OBBA 1AGNA 5IMSA 3CX6A 5G4LA 4BRSA 2Z2JA 3LBNA 1G5FA 3CH7A 5CA0F 1FNCA 4XE5A 2HYIC 1FFSA 4NTZA 1DE0A 2CGEA 2XVXA 3P96A 3K9LA 4BZPA 4F6CA 5L3QB 1ZA2A 3UICA 4JJGA 5JCJD 1WVMA 2ID7A 2I2AA 3NBYC 5AI9A 4PSKA 2YZNA 3D8TA 3W9UA 1AJEA 1YJCA 1NSTA 4R9NA 1I4OA 1MHPA 4J75A 1UZUA 4NY1A 4P4TA 5BQ5A 4TLAA 3UH0A 4MW2A 5A3VA 1RM4A 3KZMA 3WBFA 1TQDA 2M6RA 4Z3KA 3BJMA 2FW0A 2HA7A 2HU2A 3OM0A 5K6RA 5C4GB 4JYAB 1G5HA 3PHLA 4BWYA 4DRZA 5BN1A 1CY2A 1Y8QA 2PY6A 3FAKA 3E0QA 4BDSA 4D99A 5CFZA 3THRA 4PYLA 1XA4A 4UPVA 3SJUA 4Z7NB 1AXEA 1MORA 4NPAA 4BB6A 1I4LD 4EZEA 1TW3A 3A9UA 4HWGA 2MSWA 1ORRA 1D4OA 2N0SA 3JYNA 3ZHTA 3ADOA 4EJSB 2XB2A 1XXHE 3K05A 4L4YA 4RY8A 4TN5A 5AHOA 1KI6B 3C98A 1JDSA 2MSCB 4MCIA 2OOKA 3DOCA 3RVBA 2EX1A 2IUTA 3S81A 1XQYA 5K01A 3OH8A 4X90A 3TVDA 3EMKA 3X1DA 1L7OA 4TKUB 4QQRA 1IVNA 1E0KA 1PZGA 3AUTA 3SZ3A 1WBJB 2VH1A 4C4ZA 2Q5EA 1Z82A 3UJBA 1VPLA 3KEMA 1A9SA 5AW9A 5FQNA 3NOVA 4GMXA 1M1UA 3KVNA 3PF9A 4UEOA 3UIEA 2QEQA 3A6HA 1JEYA 1U7TA 2W83A 3T3EA 3JS5A 4RQBA 3RG2A 2OM2A 3CUVA 2B82A 4DA6A 1MRNA 2VP6A 3E2MA 2VO1A 4ZO8A 4RCYA 4MB0A 2ASEA 4RH1A 2RAVA 3I32A 3CINA 3KB1A 5C2JB 4DMCA 3FMFA 2BN4A 2E5WA 4R7GA 3I9LA 1C7QA 2XUPA 2IZ1A 3D1JA 1PZEA 3CT4A 3JATB 3OE4A 4ZA2A 2XQGA 5EWMA 2HK7A 3AG6A 4MHOA 4IZ6A 4D74A 3T61A 2I9KA 5K3OA 2BCJQ 3O1HB 2GAAA 1EFRA 4CN9A 1IIRA 1N5JA 1OX5A 2XCIA 3F6RA 2BBSA 1LU9A 5D3KA 3V2GA 2YBDA 3PKZA 2QRZA 1UP4A 2ES4A 2ODQA 2ERYA 3HCDA 4YASA 1TJ4A 1EEXB 1Z33A 1QWSA 4LGVA 3ILXA 4A92A 2IPOA 1RHUA 1JPVA 3BMCB 4X9XA 3E2PA 1VMKA 3M3PA 4MQ6A 4MV0A 4LE0A 4QQ8A 3GLIB 2RK3A 4B09A 2BGWA 2G25A 4BKOA 1ECPA 1CZOA 1MO2A 2VHWA 3KIPA 4GYKA 3ZXYA 2XQIA 2GPNA 1AQYA 1LS1A 1GJRA 1VI5A 2VNSA 1QF7A 1KI8A 2ODTX 3PFNA 2HF8A 3HR7A 1OVMA 1W9HA 3DXYA 4JU8A 4M9RA 2GM5A 3ZTYA 5DIFA 1DAIA 2FGJA 2VF7A 3FM9A 1XEAA 3FYCA 3JQAD 2PSSA 2QD2A 3IB6A 3KKOA 4LSMA 2VZLA 2OHJA 4M0CA 3T34A 1KI9A 5JYCA 1AUXA 1LY1A 1OYOA 4GMHA 4UHKA 1HRDA 3PITA 4E5DA 3FCUB 2NGRA 2XXBA 1IZYA 1PJTA 1QOZA 1WF3A 3ND5A 1YBAA 4L3OA 2AFHB 4DR5B 3UXHA 3QE0A 3ZDYB 2DB3A 4UZFA 1KHTA 1ISHA 4CVNA 1KO8A 4BEWA 1SRRA 1XD2B 1YI0A 1Q22A 5DOVA 4LC0A 3LXXA 3UW1A 2PJZA 3N76A 7MHTA 4IJKA 4NOKA 3MTBA 1K08A 3M83A 2PX4A 1GRRA 1X42A 3DZCA 3MJHA 1QFZA 4MGKR 4BYMA 1G3QA 2O8DB 4J0EA 4CUKA 2PZBA 5D1HA 4AWXA 4J2OA 2JLYA 5TS3A 2Z2KA 5LJIA 2IYVA 3H19A 1UZLA 1O6FA 3P8ZA 3BKWA 4PYIA 1H8ED 1QH1A 4ZREA 5C53B 5I7EA 4WPGA 3AM4A 2C8JA 2NXNA 4BECA 3PGA1 4MUNA 5AM2A 2JVJA 4P36A 3F96A 1MP0A 1N9GA 1SRQA 2WF6A 2F9MA 3NXSA 3UH1A 2VZ9A 2VL7A 4LFCB 3GCZA 3DBRA 3HKCA 3OBIA 1WUIS 2GJ8A 1U1EA 4WZ6A 3V3KA 4DV4B 2FX2A 5TMDA 1YJXA 3B82A 3TFWA 1CSEE 5I9LA 5G02A 1YS1X 4G0PA 1UJ5A 1PSZA 5L9AA 1XYVA 3KZVA 5FF9A 1Z6AA 4BNJA 1BVYF 1E1YA 2E1RA 4P82A 1NPDA 2B2NA 3IULA 5F2OA 4DLYA 5A4KA 4NCBA 2DBZA 3H42B 4JUAA 4WFKA 3D0QA 1ZXLA 5EVCA 3HCPA 2DT5A 1ZRNA 1U2ZA 4MUEA 4GI3A 4YAKA 4A0GA 4IILA 5F73A 4ZC8A 2XRMA 1NBWB 2FQQA 2OUIA 4P0PB 4OHRA 1RZ3A 1C8LA 3Q9LA 1NV8A 1E79A 4WJLA 2Q2OA 2R6R1 4HGPA 2ZDGA 2UVPA 1RAEA 2LCQA 5DXJA 4CCYA 1D04A 2BP7B 1QUEA 2HSJA 1PJRA 4BMXA 1TTTA 4Z0PA 4JENA 1KFCB 1OLUB 1ULZA 2B4KA 4B87A 3DONA 1RC8A 5EYPB 2F64A 2Q62A 2XB8A 4LJ7A 4MUYA 4U7GA 5EXTA 5ILOA 1QMPA 4G0QA 3UWMA 1TT5B 4C1BA 4U7DA 1CTQA 3EF0A 2VXCA 4K8OA 2H1SA 3TJZA 3PFIA 5LWQA 5JG7A 1MJGA 5DO9A 3GEGA 1GRCA 4K3VA 2V3VA 4OL0A 5EOVA 1QYXA 3SMQA 3VX3A 3COYA 3ZJYA 2PH7A 1CIJA 1H6BA 1TQ8A 2SECE 1VKHA 4TYPA 4LF5B 4NL4H 5M5BA 1P9RA 1UK6A 1XL1A 1FU7A 2WM9B 3L7NA 4UNQA 3U9TA 1I7SB 1SBZA 1UJBA 4M8LA 2O54A 3TW6A 3USCS 3GD5A 1VSTA 1SXGA 1C9EA 2WKRA 4HAXA 2WZCA 4ARSA 1C4KA 3OIUA 4Q19A 1CJVC 1LI4A 2FWBA 2CLFB 2PV7A 4EFDA 5C8ZA 1WIWA 4BV8A 1Y7PA 4M9QA 3BE4A 3JQFC 2BGLA 3SICE 3U4CA 4E11A 1NAHA 4GPZA 2C3YA 1G8KA 4JVSB 4DJTA 2OD7A 2AYZA 3TRJA 4N8EA 1ATIA 3ER6A 3AI2A 3NTLA 3RYIA 2GNAA 1XKLA 2IXBA 2VPWA 4BNWA 1GCOA 5IJ9A 2RE8A 4WESB 3IE0A 3OZAA 3EFHA 4Q7LA 1OXBB 1HOTA 5AYVA 1YBVA 4LWQA 4TRMA 1T0UA 4MW4A 3T3IA 1KRXA 1ZIYA 1YI1A 2EP7A 3D3QA 3MW8A 4HAIA 3KXIA 3NATA 1Y6JA 5CB6A 3HRHA 4JI3B 4K9OA 1CUGA 1HETA 1U9JA 4XKJA 3IQHX 3TF5A 3D6AA 1VLHA 4CL8A 1BX0A 4NZYA 2N42A 5ALSA 4YUAA 4N0DA 1Q6YA 2QRPA 4QDKA 2IYUA 2XPCA 3F5DA 1DEHA 3JSAA 2ZKIA 3H0EA 3PUZA 1OI4A 3WYDA 2QX8A 4BNNA 1EK2A 1PWXA 4A7PA 2IDZA 1XP8A 3BE8A 3T06B 3L8HA 3A9TA 1W5SA 4CKXA 1F5SA 4I0WB 4WEQA 4O1IA 3BD7A 1DDOA 1LDBA 4YJFB 1XXHA 1KMNA 2AUTA 3HP4A 3N75A 4WLEA 5JCOA 5BVGA 1AO0A 1QGDA 5AW0A 4NCIA 1A27A 4DA7A 5J2TB 1A5TA 2FTKE 3Q8MA 3PWZA 1DC6A 1L9KA 4FSDA 2Z0MA 3TLCA 4QNMA 2WNIA 4LJ6A 1PHRA 1VM6A 2AXPA 4Q9LA 2P68A 5C81A 1XF9A 1TCVA 3TJMA 3CM0A 3FY4A 3I64A 4KE9A 1XRNA 1E8MA 3RSZA 4JUCA 4GMGA 4MS1A 1Z5OA 1E1RD 1P9NA 1W88B 3HKDB 2E85A 3O91A 4H6PA 2OZLB 4I1OA 4YO7A 3TJRA 5ED4A 3MSXA 5I9MA 1CQJA 4NYMR 3QV2A 4TM8A 2VYND 3DA8A 3GZJA 1Z7YA 3EZFA 4S1TA 4DG8A 1Y5MA 1WZ2A 4DV2B 4WTOA 3C6KA 3FPBA 4OCZA 1NOKA 4HKTA 1F12A 5HUHA 4G0VA 1YA4A 2IHNA 2Q4BA 3V48A 1E0AA 5HCNA 3THWB 4NC9A 1BX1A 5CM9C 1KAQA 4OHBA 4FFOA 1PNRA 2FP4A 3HVHA 1Q77A 1V95A 1R5NA 2NZ2A 5MFPA 1NVVQ 4OBWA 2W4MA 3ZYCA 2QNRA 4HN4B 2BFDB 1JI3A 1U3CA 2Q6LA 3CONA 1TXGA 2CCKA 3H8WA 3ICVA 3MRVA 1SC6A 1TF5A 4FHGA 4MQLA 5TPWB 4ARAA 3IAHA 4CYMA 2GYYA 2VJCA 2P0YA 3CUEF 1Z6GA 1ES9A 5AKHA 4BIIA 5FTLA 4IXWA 1WXQA 1GFZA 4GF5A 2GZSA 2ZTHA 2XZPA 4RS4A 2XXAB 2J5RA 4D4GA 6ADHA 1TYBE 1AN0A 3OHSX 4KGVA 2XR1A 1Q1AA 3RWOA 1IC6A 4X00A 2A9KA 3DCJA 1CJBA 3NPMA 2ZDHA 3B1VA 4QG7A 1HEYA 3GLGB 4PYKA 2BDUA 1JU9A 1K8YB 1GR1A 1T2DA 1Z74A 2PX5A 1Z34A 2QL9A 3U3OA 2CSXA 2CLOB 2VUUA 2TS1A 2PIAA 4K6HA 3JY6A 3KSDO 4ID3A 4PPYA 7AT1A 1ZM7A 4MP6A 4OJQA 2EX4A 1GGFA 5LZ4A 4F4FA 3EA5A 5K9ZA 1GPH1 1HT1E 3GI1A 3PB3A 3OP1A 4LYAA 2ZTMA 1KOLA 5DKFA 1AURA 1O94C 3JD4A 1UT6A 5LBUA 2Y66A 4TV9A 2W48A 2OXTA 4B3DA 4KDEA 3B3AA 4W5OA 3K9NA 1GPYA 1YNSA 1GSOA 1J56A 4FINA 5MN4A 3UHJA 4UPEA 2OILA 3I9V6 2YDYA 3Q41A 2P2GA 4X1IB 3KT0A 3ST7A 5IF3A 5MN6A 3MCZA 4K7JA 3FA2A 4MS3A 3ITDA 4AY3A 2FMKA 3A4TA 4Q1BA 1MAUA 1RSZA 1V1RA 3I9MA 4IQFA 4DKJA 1MB3A 2I4RA 2KJQA 4GBED 5IDYA 5C5DA 4O2AF 4X92A 3PHJA 3KU4A 4OQEA 1HMYA 1NC1A 2RHGB 4WN3A 5FR1A 1QB7A 1N1MA 1URPA 1VRCA 1IWPB 2W2MA 2DBRA 1N3BA 4C3ZA 3D7KA 2R3SA 1T8SA 4F2HA 4N6GA 4CU5A 3CLUC 4ND1A 4OB8A 2WWRA 3SOZA 3KR0A 2GK7A 1CF9A 4PLYA 1A8IA 3HHPA 3R3YA 3L84A 1DBSA 3C4VA 4YMGA 4Y2XA 3LK6A 2XNHA 3C1OA 4KXNA 4GZ5A 4MA0A 4UEQA 3FJYA 2IS1A 2GH1A 3BCUA 3DHWC 1G64A 4G1MB 4EYSA 1E1CA 4YP6A 4ZJUA 4XQ9A 4ZJPA 1YS4A 1C8KA 3EMBA 4YUZA 3D3EA 4EW3A 2PAFA 1PSDA 1VHLA 1ADJA 1MQ8B 1S3GA 2ZJAA 2JFVA 3PENA 4R2LA 5K0LA 3SSAA 2KLHA 4RAOA 5HIMA 1PGQA 4I7EA 3ZXSA 3QWFA 2ZM6B 1KZ7B 2PO5A 2IKSA 3NS7A 1SU6A 4OQLA 1KC1A 4W1RA 2X15A 2W22A 2FRDC 5ENDA 5JSZB 1FMTA 3AY7A 1UWLA 2V9ZA 2Y4OA 4G26A 4CMJA 3UMBA 3GT3A 5C1OA 3COWA 4FMCF 1NZJA 2ZVPX 4ZQHA 4FX2A 4RTLA 1N2ZA 3BMQA 1EK1A 5IXYA 1B8UA 1QYWA 2RC6A 3K9WA 3S99A 1YDGA 3D8RA 3G02A 4QHYA 4DILA 2V1UA 2IW3A 3GT7A 1NL3A 1YA8A 1E18A 3SHWA 3OD1A 1XN1A 3KQTA 3M6XA 3MOIA 5CPFA 3UAWA 4DNOA 3OUTA 3KZNA 3MWLA 5DCLA 4GMDA 4E32A 1W4BA 1CIVA 4YCSA 2R96A 1D3AA 2CXSA 4MI1A 1E1QD 1YZQA 5KSPA 1L6IA 2C4KA 1JQAA 2NPIA 4KLCA 4L57A 2DWQA 4Q7MB 3VJMA 3QKUA 4OLBA 3KS9A 2BJWA 4B8ZA 4KMRA 1E3MA 1SXJC 2HBYA 2BI4A 2WJHA 3IVAA 2HWKA 3JVUA 1H23A 3TW8B 3ZOZA 1K8QA 1YULA 3BERA 2R62A 3ZX4A 4B3CA 1HDYA 1FTYA 2EKBA 2I65A 2N1MA 2RGXA 1QBKC 3GWZA 1NMZA 1TQ2A 4WA7A 3ZDBA 8ABPA 3QVWA 1XVVA 4YCAA 3UJPA 2B21A 2ZRNA 1LV7A 1P80A 2YJ3A 1YONA 4RIHA 1Q92A 1GPJA 7GPBA 2P9QA 2O2EA 4JLBA 1UXOA 4Y1RA 1B1CA 1WHSA 4ZEXA 1S2OA 1TYEB 4KQHA 4X20B 4EUHA 2W42A 4GOJA 4R5HA 1IEQA 3OZWA 4JCCA 2BYTA 2C99A 3HCRA 5JXWA 1JXMA 4MR7A 1YJ8A 1PFVA 4R54A 2H6EA 3CKYA 2XCQA 3NRJA 1V96A 1E2LA 3H5LA 2PH1A 5EUQB 3SVLA 4P3OA 2HU7A 3UMGA 2OL4A 1QO9A 1K5GA 1DTSA 1UBSB 4MRMA 3V7YA 5E6RB 2D1TA 3F3KA 4NRDA 3UF0A 1JJ7A 4X84A 1EX1A 4HFNA 4C4YA 5LC1A 3H1BA 4I9HA 3E4CA 4H1VA 4KUEA 3V8BA 4KK3A 3GJYA 1J5XA 2X42A 1EAMA 4MEJA 2C58A 2AWOA 3SEQA 2Q29A 4JS0A 3VNBA 1MJGM 5L7TA 3N2EA 2JIPA 1RZRD 1TZ2A 3KJFA 3OC0A 3W34A 1P4HA 5HZMA 1POXA 4BXOB 1W4AA 1Q15A 1X86B 1XOIA 3TKYA 2ENUA 2XE7A 4X24A 1WB5A 1YZGA 4OHCA 4QATA 2QZZA 1PD1A 3W8DA 1TJ3A 5ARBA 2XMZA 4MTLA 1OY1A 3LW8A 3E5RA 3F7NA 3MB5A 5CITA 5HKOA 5TS2A 4R71A 3EIUA 5IAGA 5FX2A 1GHTA 3ONDA 4R0NA 4F11A 3VDRA 4J16A 3RC7A 1VCHA 1S9DA 1XX6A 4Q16A 3E8MA 3UK7A 4B84A 4UQLA 1H9AA 4BNLA 1RQRA 2MYPA 3BSSA 1C1HA 4QYIB 1U65A 2P30A 3W05A 3UUWA 3QEAZ 1UFVA 1F2UA 2D0DA 2ZB8A 4XSGA 1ZU4A 1P7YA 2AQIA 1ZK3A 2XB9A 1IOVA 4EQZA 5G4KA 2H1WA 2AHOA 3CMMA 2DQYA 5JEEA 3FR8A 2P4UA 4GXTA 1SKMA 4JP8A 4MRSA 3U1TA 1JEYB 1UK8A 2JD2A 2GBLA 1CY4A 4YGXB 3ZW7A 3PFKA 1LUAA 2GMWA 4H4CA 1PFQA 2EIXA 4RIIA 1HI9A 3X44A 3FCOA 2FZLA 4KQ6A 2EL7A 3EZXA 3REGA 1YJBA 2FY8A 1V11A 4I19A 3DC7A 5T67A 1SXPA 1JIIA 4BX0A 1XQXA 2JBHA 5LDGA 1OMOA 3SDSA 4HSGA 3A11A 4D0LB 4WY8A 2P65A 2P3SA 2HNBA 5B3JC 5EWMB 3HY6A 3W8RA 3INRA 3FYDA 3C3YA 4JJ7A 3DEFA 3I34X 3QVJA 1WOMA 1ISRA 4XAQA 2Z2YA 5DBGA 2QD5A 3GQVA 1WVGA 1LDEA 2C3MA 4BJ1A 1VJCA 2JIQA 1SD2A 3EOAI 1HTTA 2FKAA 2P3QA 3CZPA 3LA8A 4BMPB 1TM2A 1Z29A 1OLOA 1BHSA 2LWIA 3IHLA 3QMVA 4RF4A 3AR9A 4UJ3A 1YXMA 3OPNA 4WADA 2WU8A 5AIAA 3TWOA 1K86A 1TK3A 3SQWA 4G0MA 2VUTA 5DISB 1A82A 1IUNA 2COEA 3MMXA 2EKLA 4IDBA 4J94A 3R7FA 2ZRDA 3PV0A 4IGAA 1RAHA 1ZQ9A 3FVQA 2GCPA 2JATA 3G79A 2C8KA 1W30A 1K98A 2I3ZA 5DGTA 1YC5A 1RQLA 1PNVA 1VKRA 2A92A 2AMVA 2EFGA 5BSTA 1FFEA 3PEVA 3ORFA 3RODA 3HL0A 5TXGA 2AX3A 4TTRA 3VBCA 3H1FA 3D64A 3PFCA 4QDUA 1Y3HA 3P4YA 3W2HA 4BNHA 1IHPA 2JJ2D 5KB3A 1UMKA 1K9VF 3JVIA 1PL8A 1FFXA 3NHKA 3RTCA 3CVJA 3DBHB 1IAVA 3G2OA 5AMXA 2FPPB 1BS1A 1CU1A 1NUQA 1YIAA 1YI8A 1IXYA 4DG9A 1NR5A 3M5DA 2AEMA 3CF2A 2R6FA 1ESEA 1S3SA 3A0UA 4RK5A 5E7IA 4HLUC 2JAHA 3BTSA 4UDXX 2DY1A 3SIPA 1WUHS 4NICA 1F9EA 3A05A 3UCFA 4E12A 1ZJJA 1LB1B 3QY0A 1OLSA 2IZZA 1IQRA 1CQIB 3NAZA 4KO4S 4XI9A 3ZE7A 5K6AC 4Z0TA 1UKYA 5LZ7A 3PA6A 3PVSA 4P08A 3VYRB 1OZHA 1XA0A 4CMEC 4JROA 1P45A 5AFSA 3G5TA 4D0RA 3AQIA 2GEFA 1JLKA 2R6GA 3TZKA 1EG2A 3Q3CA 1R5BA 3OQBA 1PSWA 2B1RA 4MB2A 4TTVA 5EJ2A 1SHKA 4RVOA 4IGKA 4J2TA 4X1OA 4NIMA 4G0XA 2QVCA 1JRLA 5T4HA 3DBRB 3C3PA 4S2UA 3G1WA 1WF6A 4U63A 5P8WA 3DT6A 2NTJA 2G0AA 2FSHA 3FNRA 3OJFA 4NOLA 4CI0B 1I7NA 1BNCA 2DPYA 2X2EA 3KLMX 3Q3GE 3HBFA 1T10A 2PN1A 3L8MA 3AVOA 3AC0A 3Q8WA 1T9CA 4IOKA 4TVKA 3P20A 5BYKA 5JNWA 5L45A 4R2IA 3IP5A 3P9QA 1M76A 4E2XA 1Y9DA 1B93A 1FXUA 1PEDA 1NVBA 1PQPA 1T3LA 1TJYA 4IXMA 1W5EA 5A6SB 2WSBA 4E07A 4ECEA 3AJDA 4CM8B 3BWEA 4YRDA 2D54A 3EVFA 3TL6A 3CWQA 1L8AA 1XJ0A 5G2OA 1OLXB 2ZJ4A 4KGDA 3G1TA 4PNPA 3IQXA 2PEYA 4OH1A 4TLEA 2IDJA 2P0AA 2ZJ5A 4Y2UA 4B3IA 4D81A 2WILA</