4AP5A

Crystal structure of human pofut2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
389
structure length
389
Chain Sequence
SRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 2
publication title Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A02
3ZY3A 3ZY5A 4AP5A 3ZY4A 2DE0X 3ZY6A 2HHCA 3ZY2A 4AP6A 2HLHA 2OCXA 3SIWA 3SIXA
chains in the Genus database with same CATH superfamily
1KDPA 5IKPA 3U4QA 1ZMOA 3TRHA 4PZ0A 3GJYA 3KR2A 4DJJA 2PMCA 2FSGA 4H16A 4D92A 3QEOA 3MWDB 1B15A 4LZWA 2H18A 2YXPX 4P53A 5DF1A 2FXIA 3CO0S 4IS3A 1K7SN 4CU5A 5A4FS 1RRCA 2C2ZA 1Q3KA 1CEQA 3P8ZA 1HX7A 1O3YA 1Q7BA 4M3NA 4P4UA 5GOZA 3OQVA 5A9RA 5IT5A 1ECBA 5CFRA 5FAKA 3RAFC 1CDOA 2NM0A 4FTWA 3AUXA 3FYTA 5TDHA 2GKSA 5CDYA 3NM6B 3JVVA 2O7VA 2ZSUA 4GXRA 3JYLA 5IZ4A 3SSNA 2ONCA 1NQUA 3EH1A 1PGPA 4X61A 2D2EA 3MK31 5B7PA 3RWMB 4WJKB 1Z4PX 3IAS1 5DWDA 3WJ1A 2LD4A 4EM6A 2ZUVA 4FB5A 4KBGA 3F6BX 1EINA 5D3ZA 4ENTA 3IUYA 1ZD1A 4K6OA 5BQXA 3KSMA 2RHDA 2WKQA 3EIQA 3MGCA 3RRJA 5DXFA 3AX6A 4Q4JB 3C1OA 1U9ZA 2IP1A 3S55A 2NO9A 2GD2A 3WIDA 1QHSA 5L95A 1P7CA 3A9SA 3IELA 5U1PA 4J9UE 2QTCA 4X66B 4QU0A 3CZ4A 4PYOA 1K3UB 2XNCA 1Z4QA 2YINC 4JB3A 1V5IA 2CJWB 3G85A 4FYMA 3TZ6A 4ZQBA 1I7SB 4OB8A 1ZK1A 1NKVA 1FJ2A 1VIMA 2JI6A 3PENA 5JAQA 2OXIA 2DB3A 1UC8A 4Q9AA 3LUPA 2ZUUA 3FLAA 1NFFA 1BVRA 2WC1A 2R1ZA 4F12A 5BUQA 4POOA 3HDYA 4YDHB 2ZCJA 3OOHA 3GFBA 1V4NA 4MMYB 1C3VA 1HDZA 1PZXA 2X8AA 3W4JA 1AU9A 3DMGA 1O8BA 1TXGA 1S2LA 2CJYA 4YRIA 4ENUA 1KOJA 2HAEA 3H19A 5GGXA 5BNFA 3EHDA 4EWLA 4XOUA 2Q1YA 1PWXA 2YYYA 4WINA 3ULKA 3RGGA 4LYYA 1GG5A 2R6AA 5K0LA 2J3EA 1L8LA 2FZGA 4Y6QA 3FTPA 1C1XA 1C1DB 1O77A 4IR7A 3U1BA 1Y4UA 1UFQA 3TH5A 2ZZMA 4MV5A 3K0FA 3UY4A 1I6MA 4CQJA 4HGZA 1T6NA 1W4RA 2WHXA 4GOLD 4I55A 4OUDB 3TSWA 2Z2JA 2C94A 3A2NA 3D8RA 5IS2A 1E7QA 4XSGA 2NPOA 5DHQA 3WNVA 1ZONA 4ER0A 2RGBA 4HX5A 4RD3A 4LI0A 3W5VA 1ZR2A 1L5LA 4IO1A 3N7UA 3RYCB 5I47A 1XFDA 1Y7PA 3KKKA 4MA0A 4A5SA 4FSDA 2Q9BA 1LV8A 3SGLA 3AR5A 2VYFA 2O1WA 4ZVRA 5ITVA 1UMBA 2G71A 2NWQA 4GZLA 5F3DA 4F92B 1V7ZA 5KVVA 3THWB 3N0VA 3VYSB 3D3EA 2I1WA 1XZKA 3D6NB 3NAQA 4NZNA 4QICA 3SFZA 4C04A 4QT0A 3T0IA 3AV0B 4X84A 3WGYA 4ZJZA 2VDMB 4BNLA 1E9CA 2XGSA 3E0XA 3N2KA 4L6IA 3HY6A 4TXHA 5ANRB 4ZI3A 4PVDA 3BFKA 1ECFA 4FFBB 4UBKA 5G0VA 5HJ2A 3T7AA 1YOVA 5IUNC 3ADBA 4KAAA 5KNBH 1Y6GA 5I7AA 2VK1A 2CHQA 1CZNA 3QKRA 2BF7A 4BASA 3HBAA 3RLFA 2HA2A 1NASA 3P2IA 4FMBB 4DQKA 3OC6A 1MX9A 3R3SA 4AJJA 1EX7A 4C7OA 3GDOA 2Q4RA 3O4GA 3RQSA 1Y6QA 3I6IA 4MJLA 1RLMA 5H82A 5IDWA 3IP3A 2Y2UA 4MQFB 2O2JA 5EJ4A 1WB5A 2EAUA 1NW6A 1KAGA 2QMHA 2FZCA 1UEJA 3ZDAA 1WHTB 1YOBA 2QMZA 4FNAA 4GO1A 3ZXIA 3QFCA 3HGTA 3E0QA 3V1LA 5BR7A 4N5IX 5JZVA 3JY6A 4M37A 4PNHA 4GBED 5KSYA 1AGXA 2F48A 4HFJA 1TK2A 4AG5A 2H7YA 4LHVA 4FFRA 5SICE 1L6IA 3EJ6A 3T5GA 4DMUB 3PNOA 1P77A 2VDQB 4CM4A 4RZ2A 2BGIA 4LVOA 1SELA 1SUBA 3M5PA 1M72A 1KMHB 1Q74A 1MAWA 3PVSA 4F5ZA 1A8PA 3O31A 2AFIB 4YX9A 2PE5A 3HC7A 4Z2AA 1KY4A 1FZTA 4FOPA 1MVOA 1IHYA 2BHRA 5LMUB 3PDWA 3E4CA 4WASA 1Y8RA 3WLLA 3MS2A 3WRXC 1IBSA 2DHRA 1P6QA 3LDUA 1QOQB 4WCFA 5F7XA 5JCJD 3HXOA 3TWOA 3X44A 4HQ0A 4PSUA 3VH1A 4E3WA 2IEIA 2ONJA 1C9KA 1I4TD 2X8WA 4R2IA 2OA0A 1H2YA 4RMHA 3R6WA 1UKAA 2CSXA 5CITA 5C4GB 3IKLA 2HLHA 1WMSA 2C29D 3EXIB 5ALFA 1VLMA 1QORA 2ONYA 2O59A 1BN6A 4KK4A 1KBQA 1P7YA 1VGRA 2EKLA 3ORQA 3OOYA 3BTVA 3REQA 4MVJA 1B1AA 3OD1A 3U4DA 3E53A 1FMLA 3I9OA 4WZAA 1I2MA 1VKJA 5BMVA 2VWPA 2JEYA 2XUQA 2I4MA 3CNBA 3RS5A 1R0WA 2LVBA 3DXXA 1KEKA 3ZJTA 4MUKA 2BRUC 4C0HA 4P0PB 1TD9A 4HO1X 4OM7A 5AMXA 1JG7A 4B3TB 3QLTA 5E7QA 4QT4A 1U0BB 3UPTA 3CB2A 1SHKA 4LRUA 4G4IA 2UZAA 4M8SA 3E81A 1YXMA 3O9VA 4MV4A 1GZDA 4JP1A 2FUG1 4O2AA 1DAIA 4FGKA 4QWMA 1HETA 3TLYA 2NZ8A 2NYAA 2PGXA 3TOSA 1AQLA 3A28A 3A4YA 2AF4C 2HRQA 4TWBA 5G0UA 5GWXA 1A9ZA 1PJLA 1XKTA 5BW6B 4PANA 4XAQA 3VH3A 3M6WA 1FF9A 2VHEA 3W1EA 1KAOA 1UIRA 3IOMA 3H3JA 1Q0RA 4Q16A 3I01A 3W8FA 1MOZA 1W44A 1BXKA 2PH5A 3OIWA 2FEKA 3RSOA 5DNYB 2DKOA 4RWZA 3ZKWA 2IPAB 2FEMA 4QVKA 4DBLC 2OENG 2CK3A 2HDWA 4GEKA 3TI7A 3VR4D 5HFAA 3C3DA 2XH8A 1NLUA 5G1OA 4FMCB 1OVGA 3COWA 2QP3A 1QJCA 4BNTA 1RWWA 2PUJA 1R0ZA 1WA5A 2WJ3A 5MHTA 4D1YA 3ZTTA 2HEIA 3TO5A 4BB5A 5B3KA 4TYWA 1BMTA 1GLGA 1IK6A 2P2DA 3S68A 4UEOA 1W19A 1XROA 1SM4A 3TUJC 5B4VA 1QPZA 4MVJF 2OAP1 2OAGA 2PGIA 1NUHA 1GZ3A 4NCXA 1OH5A 3CZMA 2MR6A 3W5UA 3ZZTA 2XY4A 1LKZA 1EEXB 1NSTA 2YIJA 2HR1A 3D3JA 2AYZA 1B41A 4GZ6A 4RH0A 3KZMA 3BN3A 3WWCA 5HS6A 1P1HA 2QYTA 2WTBA 4FW9A 1UJBA 4Z9FA 3X1DA 2O3QA 3D4IA 1DJOA 1EZ1A 1PZGA 1QIMA 2QZ4A 1ONSA 4CDMA 5LQMA 2NV2B 1D1SA 1J9ZA 3AKDA 3PQFA 3ZJ4A 5JSUA 4GGOA 4QOIA 1C3EA 1GPWB 1U8XX 4KGXA 4IUCS 4PLHA 1G6Q1 1XQ9A 1TYZA 3LQQA 1I7PA 3QVVA 5EQDA 1RXIA 1W8DA 3TPCA 3EDCA 3U7QA 5GOTA 1C1XB 5AKKA 4D2IA 3BCUA 4Y9SA 4DCNA 1TZBA 2PSSA 3K0FB 4AURA 2C78A 3IQGX 1HDIA 2NNWB 4AY3A 1Y1SA 4I55B 3FG9A 5JS8A 2EG9A 4ZODA 3PHIA 3B6KA 4NBWA 5CJ2A 1P4HA 2Z8ZA 1J2RA 3ETJA 1JBQA 1DZIA 3IURA 3ANMA 4JBXA 4MKIA 5AK6A 1COZA 4AZ3A 5AESA 2LUOA 2PJRA 4RSRA 2QMQA 5E0OA 1U8CB 4JH0A 1QQBA 4ARVA 2Q9AA 3CNLA 2PNFA 1I1HA 2I4LA 4URUR 1UMBB 4ND8A 2QTBA 1EWVA 5CTJA 2O1SA 4L07A 1V2GA 3K70B 2WIAA 1GAWA 4IDGA 2V7EA 2W6MA 1G0OA 1F1JA 2BR4A 1QH0A 1HG1A 1C7ZA 1V8ZA 1VSVA 2J31A 1FNBA 3E22A 1S9DA 5B37A 4UMFA 3HEMA 3OHMA 4UHHA 1YOVB 4HQNA 4OG2A 3PNBA 3LRPA 4OJKA 4U0KA 2AL7A 3RTDA 4K5QA 1BKSB 1J8DA 1ZHFA 2DCMA 1QKJA 3JQEA 3O1IC 5K3AA 5CM8B 5U4XA 1WQ1R 1GAXA 3HV2A 5K0NA 4C7OB 3M6LA 1C7EA 3KJFA 4L5YA 3RTAA 1YASA 4MUAA 3KZXA 1KSHA 2AG6A 1O87A 3TW4A 1CJBA 1D8TA 3CIOA 4NFYA 3X1JA 5AKGA 2GKOA 2PYIA 5JNSA 3FTNA 3EE6A 1EVEA 1HR0B 2BFAA 4J90A 1Z5VA 4TVSA 1TU0A 1WUJS 4GYYA 4XD7A 3SF8B 1AHNA 4D3SA 1P2UA 2JIOA 2WA1A 4NK5A 5WRFA 2CWDA 5EIOA 3HCDA 5EZYA 2GWHA 2PS1A 3L8GA 1FFWA 1HI9A 3I04A 4DRXA 1Y7HA 3MT7A 1GRNA 2ZE8A 1A4XA 1WETA 2FV8A 3WOHA 3OX1A 1EVLA 2ZITA 3L41A 2L17A 4LXUA 4PPYA 3DAYA 4YRGA 2FHPA 3SMVA 3B5JA 2HU7A 4MGHA 3HV0A 1UWVA 3MBKA 4JITA 3WXMA 2E5LB 2GD6A 1NBWB 2CFIA 3HSKA 3HVIA 1Z7BA 3Q2KA 4MMZB 4NZYA 3IEPA 4AVYA 4GG1A 2O3JA 4MRSA 3BWCA 4UBIA 3NCHA 3UFXA 4KKVA 1H9AA 4RYDA 3NDPA 3GLGB 1MJHA 3C6MA 1HT1E 3EEYA 3BXOA 4MEAA 4P2GA 2WYOA 4W9RA 5E7IA 4A8TA 1T2FA 1Y8RB 1S8NA 5IK2D 3BM5A 3EN0A 4J7XA 1MQAA 4KI0A 3UYKA 2G7ZA 4RPGA 1FC0A 2V7GA 1J5EB 3HWSA 2GCEA 1G8GA 1XMSA 1IOWA 1NW8A 2QR3A 5ALWA 4TUYF 1DE0A 3Q7TA 4IMRA 4F3NA 2G3YA 3NOQA 3RIYA 2A4KA 4G8DA 2OLKA 3WLHA 1O97C 1SBQA 2ESRA 2E6KA 2QPAA 2R3SA 2YHIB 3A7EA 3CRVA 3PPYA 4HAWA 5K5EA 5CA1A 3VR0A 4LOIA 5JQGB 3HLKA 2AC7A 2VRNA 5I8PA 2UZ1A 2J5QA 1IJKA 3NJ4A 4MDYA 1QYCA 2C31A 2YHAA 1ADBA 5EIBD 1ENOA 5BMVB 3OPNA 1USVA 3N6RA 3RAEC 2HBRA 1EUCA 4FN4A 2FPRA 1NG1A 3TE7A 3HPQA 3K1TA 3ONEA 1GQSA 1T8SA 2I3DA 2BP7A 1W0CA 4YAEA 5KQMA 4QG7A 2XCOA 3I83A 3TCXB 1Q0TA 5LKRA 3Q5DA 4HYYA 4O2AB 1WXDA 3WRYA 3AL0C 1T2UA 1KF0A 4O3FA 3RVOA 3DDOA 4MI6A 4DDVA 1E6MA 3HR4A 3SX4A 1E79A 2GJ8A 3BMQB 1DX6A 1M8KA 2GCOA 3HVJA 3KYCA 1JFLA 1TLLA 2AKYA 4BYGA 4JXJA 2R6ZA 1AS2A 3L8EA 1YL6A 4JAVC 4PAWA 3HK2A 3LQ2A 2VRWA 4G5RA 4KYIB 2XE7A 1XLTC 3EBOA 4S1TA 1ODIA 5JSHA 3IQHX 1VL6A 3PFGA 1IPFA 3G8CA 2FK7A 2AEEA 1I1NA 2PKQP 3G9XA 3JQAA 3RHSA 4MR9A 3ZKWB 4R0MA 3C4JA 4D6XA 4JLNA 3HJNA 2RH8A 1BYIA 4M89A 4NYIR 4NMMA 3NNNA 3NYRA 5KJ6A 4ZYXA 1XDBA 2HSJA 2CMHA 4ZICA 1N33B 3VV2A 1NA5A 2HFKA 4TLLB 4ZGGA 2I0FA 3I1YA 1OCEA 4QRIA 1Z33A 1C0IA 1ZAKA 2EKQA 2WSSD 3LUDA 3MJCA 1TE2A 3VR6A 4CR8A 2JKYA 5CA1F 3BL8A 2JLAA 1RXCA 3PLAE 2PUTA 2PQ2A 3L6DA 1J00A 1JAYA 1NZJA 1RI4A 2P69A 4LDQA 3ZY3A 4A91A 4OI1A 3PFKA 3LCCA 1IXZA 4KFCA 2JFUA 1YQUA 4R1QA 3DZ8A 5SZJA 1N34B 3OX4A 2RGDA 4FT2A 3CISA 1JFTA 4PX9A 1REQB 2OXRA 3FA2A 4O2LA 1F0NA 3OIVA 4HYTA 2E37A 1D2AA 5CA0A 3RU3A 5I9SA 3L0ZA 3K6SA 1VG1A 2PQMA 2XXBA 1RM3A 2V7TA 3FMGA 2PL5A 4HS4A 3U37A 3VC7A 2RHCA 3FWNA 3ZQKA 3RKUA 4MUEA 4YMIA 3U7QB 1JHPA 3RI3A 2WYHA 3CN9A 3K9FC 4ALNA 1TJ3A 1Y37A 3KOMA 3QX7A 3CR7A 4AWXA 2QORA 3V7WA 3TUZC 4D9MA 5A4JA 3QSYA 4INOA 1V3TA 1XDGA 1UJNA 1H2XA 2G9ZA 1SCAA 2P6OA 2ZJ7A 2H6EA 5K2OA 2WG1A 3I5AA 1PCXA 3DDCA 2PL3A 3T9FA 1T5BA 2H1OA 4E5SA 1XXHA 2PD6A 3B1VA 3PUYA 3AY7A 4HBGA 5HF9A 2R00C 3SC2B 4WAUA 4EG0A 3ZGZA 2FN8A 2H9YA 2BI7A 4ND8B 2WILA 4RORA 4ADSG 1C9JA 2OHJA 1DTWA 2ZIAA 1F3LA 4XSHA 2YYSA 4IVQA 3P0JA 4JV5B 3B3JA 1DC7A 4AKSA 4KXMA 4EO4A 1WY7A 3E22B 5J5CA 2I65A 3QUBA 4GX2A 4K9KA 4MA4A 3RREA 1NAIA 3I6QA 3PEEA 5AHXA 4O63O 5FV7A 5HIAA 5K0JA 5AM3A 1EGHA 1UJ2A 1QNFA 5F33A 5KOHA 3ZE0B 4QQ8A 2SKDA 3CF4A 4KEAA 4TS1A 1GIAA 3DZBA 3S5UA 1SU6A 1V8BA 1RLTA 4S1WA 3I58A 3AQIA 1QLHA 3L3BA 3HCEA 2A3NA 3C48A 5MDHA 5DNDA 1ID1A 1Q7TA 2FKNA 1GKYA 2DF8A 2MDTA 3OOJA 4KBFA 4LXIA 2UYGA 5L45A 3J81k 2ILTA 1N1GA 3RUIA 1R3DA 4N54A 4MP3A 1U11A 3P5BA 1Y4AE 2C0CA 3Q8XB 1PQPA 3LY5A 3CWCA 3UK6A 1SWVA 1SBHA 1MX5A 3GZNA 5E2IA 3TZEA 3CE6A 3T3DA 3V8NA 4O25A 3VSBA 4M9ZA 3AKZA 4Y2RA 1G8MA 1R8QA 5EZYB 4BEVA 3RO7A 5AM1A 3CPJB 1PR3A 1HC7A 3A3OA 2GZAA 1HZZA 4FMDF 4BQNA 1USUA 1JU4A 2OZKA 2Q1WA 3N2EA 3U2QA 1LW6E 7YASA 2DX7A 4EP1A 2QMEA 5A1JA 3E9EA 1BQEA 3AGQA 3LW8A 3TIFA 4CCYA 5CLFA 4V1CA 4HDCA 3AETB 2CHGA 2QIOA 2XYQA 1I33A 1W4ZA 4JELA 3D5EA 4CLDA 5HGXA 3TJZA 5G0WA 2OCXA 3HUEA 2C2HA 1B73A 1SVWA 1GCUA 1U8UA 2HLDA 1L7DA 4RHTA 3VGJA 2Z6AA 5IW8A 1CQIB 3WMFA 1NZFA 3LQKA 3SSMA 1CIJA 2QRVA 1BRTA 2W6JA 1FP1D 1ES9A 2GBIA 1XIVA 3JQ9C 1WDWB 2IYTA 1PF7E 2BEJA 2BDEA 1LF0A 2V03A 3BHMA 4URZR 5AWFC 1CJUC 3ZD8A 4XYMA 3STUA 3ZCVA 4YAFA 1KL7A 1Z4NA 1AKNA 3RASA 3NANA 3ZI4A 4B2PA 1HLFA 1YE3A 1IXYA 5CNMA 4ZCTA 4G1BA 4GZ5A 1YBVA 2A1TR 5HUQA 1J70A 3EUFA 1Z74A 3PITA 4TXMA 2F3UA 3G23A 3OJOA 3MOGA 2FW7A 1EXWA 1KS9A 1B8OA 1H5UA 1ULHA 2YZKA 1H0RA 3C3WA 2NO5A 3CEJA 4ZRMA 4I3HA 1DV2A 2UZ1B 8OHMA 3WHLA 2AQIA 4BKRA 3AW9A 1QYWA 2CXOA 2RE8A 3NQ41 3B9PA 3QENA 3U44A 3W05A 1B6SA 3EC2A 3QTTA 4Y6RA 5E7JA 2YCBA 1OC2A 5LZ8A 2C82A 1EUCB 1C0KA 3MILA 1EFDN 5HMLA 4X45A 1SU4A 4JOCA 2BP7B 3B60A 4QKQA 4EJ0A 1SKYB 4EW3A 1V9LA 2B3TA 1Y7IA 2JD1A 3C3MA 1E5LA 2JGMA 3R6GA 4NYIQ 5BPFA 3SQDA 2WHPA 3HSYA 4IXTA 1RC0A 4R41A 5KTMA 1BQ4A 3TEJA 2GCOB 3KYCB 3O75A 1WD7A 1T9HA 3SHVA 4AZTA 3W2FA 5IN4A 2P2SA 1BHSA 5IWAB 5C0OE 3PHHA 4CKXA 2ID9A 2NU7A 1RXVA 4J1TA 1RWVA 3DQQA 4MHOA 1JHYA 3IR6A 4LHSA 1ZI8A 3JQAB 1U4NA 3CBQA 4M76B 2WD7A 3CNEA 3O93A 1SOMA 4MR9B 2ZQ5A 3O4JA 3M7IA 3ZG6A 3U09A 5KU7A 2EW2A 3A1NA 3WMGA 3RSHA 5G0SA 5LOVB 2CDNA 3NP7A 3IC5A 4DGSA 3DZHA 4WY2A 5G0TA 3I0MA 1MOPA 4DYHA 4XWGA 1O95A 421PA 4G4SO 1W5FA 2NSJA 5U9CA 3FOCA 4BYMA 2BTEA 3FF1A 1V8DA 1P1CA 3KEQA 3MAJA 4JR0A 1D6JA 4Z3OA 2PUHA 3BRWA 3HB5X 4GM1A 4LRTB 3PTAA 4LSGA 1T15A 5E3HA 3L4SO 2QD2A 1E2EA 2OXFA 2X13A 3C97A 2CNBA 3KOOA 4XGQA 3V6LA 4KOEC 1DB3A 1S5PA 2QRNA 3WWOA 2X7XA 3ZHQA 2F00A 5HA5A 5CA0B 1ESMA 1GNTA 3L93A 3VYUB 4PSAA 3QPWA 3FDFA 4TQUS 2VZ0A 4CL2A 4MULA 1NRWA 1TK3A 2QE7D 5CYPA 3UJPA 4B7ZA 1NJGA 3IIKA 1XU7A 4EVIA 3WGIA 3M9XA 3RNLA 4C6TA 3BF7A 1QIIA 2H1SA 3LPCA 3P26A 4REQA 5IBQA 5BORA 5C1PA 5DRTA 5KEIA 1B8NA 3BXXA 5BWLA 2QAJA 5TMPA 1KORA 4UU7A 2A5GA 4FMDB 2IGBA 4KUHA 4WBXC 3PZBA 1U1CA 3KAJA 4DLVA 3LKVA 1K0FA 1K2VN 5CNIA 1ORVA 3RV3A 3VBCA 4E5VA 5AVXA 3TRDA 2FX2A 3EEBA 3BK7A 2PCLA 2W98A 3FCOA 5HRAA 4BQPA 3A6PC 3F9CA 1RE1A 1LXCA 4IKPA 4L5JA 3AM4A 4G6ZA 3UHPA 2G06A 4MPPA 4Z7NB 1T2EA 1VSBA 1L6RA 2NYRA 2JIQA 3DS8A 4LA4A 3RBAA 2C9MA 4L95C 3UICA 2ZJFA 1E2IA 3DAHA 3GUCA 3VH2A 4C76A 1J6UA 2IXEA 1X1EA 3OZGA 3B20A 1ISJA 3H5WA 5JZOA 2I80A 4I3FA 1F14A 4V03A 2JAUA 1CD5A 1FP6A 2NO1A 3O2NA 5FL7A 4KREA 4MV9A 4A16A 1IVYA 2ZWMA 5ALUA 3AEZA 4DSTA 1K9SA 1KK1A 4RVDA 3AM1A 5KOHB 5LQUA 5EERA 2VRCD 3HQ4O 5C2JB 3VQTA 5I3ZA 3S2EA 2AN1A 4AKHA 1XP5A 3IVCA 4V0SA 5BW8A 1C2YA 2WJAA 5K8TA 3IULA 1SXJA 1NJ2A 4E6PA 4Y6LA 2FDRA 2ZRIA 4OPMA 3ERCA 2YCLA 1QP7A 3CNOA 3JD1A 5IDVA 1U0GA 1XEFA 2QUJA 2QX7A 4FJ2A 4L15A 4LV6A 3TSOA 4A27A 1GFIA 4O2RA 2R0QC 4E2FA 4KR3A 5F2EA 4U39A 4DCMA 2BSQA 3GZNB 2HWKA 5CDFA 5JASA 5P21A 4JSYA 2QR5A 1XNRB 5DCWA 3BJRA 3CLVA 4S05A 4FKBA 2EDAA 1MW8X 2BGJA 3ZLTA 2D0DA 3N86A 4JL6A 1ZM7A 4JVNA 4FGUA 3TBFA 4EYSA 1R8JA 4ZJYA 1N2GA 4BJHB 2BHSA 4M1TA 4I99A 3D7RA 4AKGA 2AFRA 2CNLA 2HNKA 1U3CA 4CCYB 2PKQO 4V1CB 1W581 4NQRA 4GUDA 1E18A 1V3UA 1WSDA 2ZYIA 3BGVA 4E5PA 4GI3A 5KCMA 1KI9A 1XTPA 2E4AA 4QM7A 4FPXA 4V0MA 5JFGA 2W7TA 3OT1A 4MGZR 4MQ5A 2BM1A 1UPTA 2OV2A 1C4KA 1Z8FA 3PYMA 4BTLA 4DAEA 1ZX1A 1E94E 5EQTA 3HMQA 2X42A 1GCIA 1AX9A 3TMKA 5TVKA 1A9SA 1R5BA 3PR2B 4D5EA 5K0EA 1E6UA 2HMAA 1I1OA 2IIQA 3GR6A 3I32A 3ROGA 2F64A 4L75A 4W1PA 2XB6A 2WABA 1H4QA 1TEVA 2BE9A 3OKCA 4CF7A 5I7RA 4JCOA 3B3FA 4A26A 1EI9A 5L9AA 3PL1A 1Q1AA 3OQJA 3EC1A 2VT7A 4MKGA 4CMIA 1RM4A 4N0EA 3A7DA 1A4IA 1DIHA 4U9HS 4TWAA 3LSTA 2YN0A 1WD5A 3VR3D 2FMUA 3HO6A 4UHDA 4Y2PA 3W06A 3C3PA 5JJ5A 1NRIA 4DILA 5BMOA 3R5SA 3DFIA 4IW3B 2FZEA 2YOGA 3SPXA 4RU1A 4GKKB 3NEAA 3IIIA 4PGHA 4B7AA 3IB3A 2ZYHA 2L2QA 4LDZA 5THQA 1ZC3A 5KHOC 2ZIFA 3K5HA 1BNCA 3B2NA 4B0PA 4PZDA 4IFBA 1GN9A 2WHPB 3SLGA 4A6XA 1K7CA 1QFJA 3M1IA 4RIHA 1B16A 1GKIA 2DWPA 3WAKA 3ZGLA 1M6YA 4FWTA 1JECA 2QHXA 1QDEA 2B8WA 2W2MA 3G9TA 4UUQA 3SR4A 4D98A 1NVFA 3IMCA 1YRYE 2NU7B 3GP3A 3L5OA 2VKQA 3QFSA 4HI0E 4O02B 4U0JA 3QYFA 5EHQA 1XU9A 1UQTA 1Z28A 3I5UA 1WUTA 2X0NA 2VOEA 2WD7B 3H5NA 3W77A 2ZBEA 2CB0A 3OWOA 5IH3A 3OT4A 4OI4A 3W3AH 5BWBA 3R23A 1VKRA 3TKLA 4IZ6A 1KJJA 3IV6A 3RCBA 1KE1A 4ENQA 5H70A 2JI4A 3V8VA 3WK7A 4RV5A 1XA0A 1LDYA 4Q6WA 1X7YA 3TN7A 3U7JA 3WZ2A 3ZVLA 4I8DA 3CW8X 1Z6TA 3LBIA 3Q7PA 4UUMA 4FLFA 3UG7A 5IT0A 1EU1A 3FIJA 3CQ9A 3ZE2B 2WP8J 1GADO 2GDJA 1LPMA 5CX1A 1L7XA 4HCJA 3S1LA 4HXFB 3L0PA 4Q1FA 2Q1TA 5AOBA 3ZJYA 1ORRA 2Q6KA 3NYWA 2HRCA 4BHTA 1Q14A 5CUQA 2F8TA 5EMNA 3ZXYA 3R7FA 4WADA 1VL8A 1YJ8A 2HC9A 3ECAA 5IULC 2JJ2D 1CY1A 2IZ0A 3ZGOA 1C7FA 3E82A 3KHSA 1SQFA 5B4UA 1DI0A 1LVUA 2QGFA 2C42A 2COUA 4ZEVA 5LXTF 4KH0A 4Q47A 1PJ8A 5KTRA 1CJSA 3PKIA 4F4HA 2DPLA 3PEWA 3R9XA 5EXEA 3ENNA 2ZJAA 1FOEB 4HHEA 4OAQA 4REQB 2GF9A 4YLGA 2X6RA 1DT5A 1XA3A 3V2HA 2G88A 3CXUA 1LBEA 1O5OA 2WAOA 4IM7A 3ER6A 3VNSA 1PEDA 4HNTA 3ODPA 3UWPA 2F9FA 4KHZA 3JQFA 1QO0A 3AUKA 3GPDG 3MGKA 3TLZA 3UJAA 4Z9YA 1UDWA 3WKAA 2HIAA 1AGPA 3OAAA 1L7AA 4PN3A 4CIAA 2X2FA 1ZJ6A 1QOZA 2BMFA 2MSKA 2WYWA 4X92A 3D3QA 4YXWA 1B43A 2ZRJA 4IUDS 1E2QA 1NVTA 4M0MA 3PXGA 5MN6A 4BLSA 2J6HA 1Z0SA 3NC1C 4HZGA 4B3HA 1Z2NX 3KQUA 1BVUA 1QQ6A 4Q7LA 4R83A 4TMXA 3ND5A 3GL9A 5EHIA 2IYYA 3TDNA 4DT1B 3DC2A 3GMDA 2XMQA 2BGWA 2QV7A 2HY7A 4I9FA 3F78A 3ZCPA 4FJ0A 2FPWA 3L6OO 1FCJA 2CUTA 3UHAA 1E2MA 2F6RA 2Q46A 1NYQA 1XC7A 2ZB8A 2ZTUA 3KKEA 5C81A 4ND3A 3OUUA 1OMOA 1MXFA 4FNGA 3BIJA 2BWJA 5FOVA 2QRQA 2WINI 2F9LA 2ZCUA 2HJWA 2PGAA 5ESXA 4C43A 2Y2VA 4ZALA 4EAQA 4KGDA 2PWZA 4WDQA 2G1PA 2CXTA 2Z5LA 1QM5A 4DCJA 1ILEA 4MRNA 2RI0A 2HO5A 3ZNNA 3BS4A 1Z4JA 1EIZA 2JHCA 3DFMA 1QPGA 3H87A 4RE5A 3WL4A 2ECFA 3W4IA 2IU4A 4M49A 1IHDA 1WTCA 4AJEA 2V6BA 3PKJA 5D8DA 5U4QA 4GC9A 2XYHA 1FPQA 1ISMA 1E7MA 3HCCA 5J4VA 4EG4A 3RRNA 2A84A 3WBBA 3BDVA 3KZKA 4ZHSA 3U6KA 4NXNB 2I76A 3I4FA 1QGED 2B7BA 3WL7A 1QTNA 2CEKA 1T8WA 1FRVA 4P3OA 1GQ2A 4RDHA 3T4UA 2NO7A 5HVNA 1C7JA 2I2BA 1FUYB 4ARCA 1PSDA 4OHVA 4BJ5A 3GF4A 4LSZA 3HY4A 4IXWA 4DRXB 4KPYA 1SC1A 1U6IA 4OQZA 5FBLB 3TXYA 2CL5A 2YVUA 3G2MA 2FWIA 1XZAA 2I6SA 2DH5A 3PFWO 5L8VA 5ETJA 1M76A 1ZVMA 3AWIA 3HSSA 4Y2UA 3NHJA 4KQWA 2A33A 3O9MA 1RC1A 1U0OC 4C05A 3O1JC 4P80A 3PA8A 3GVCA 3ODGA 1Y3FE 2VYVD 4B5KA 5FWDA 3K71B 2QN2A 3AMVA 4PTYA 2OGTA 2GRUA 1UOQA 1CUGA 5BQOA 3UUGA 3QBEA 3Q8WA 3VYRB 2BVNA 3HMKA 5AVYA 4TTQA 3SU8A 4CM9A 4KIFA 4A0SA 1OFTA 5C7LO 3KZVA 3U31A 4PIMA 1JEJA 2JAQA 3EDOA 3OFVA 3U3RA 4NONA 2WLTA 1K86A 4AYWA 4C88A 2O8FA 1C3OA 3OIFA 1GUYA 2H5EA 3FOBA 4B4DA 2FLKA 2QXUA 5TS2A 4CN8A 1KVRA 3UMGA 4DQVA 4INZA 1QV6A 2AG8A 2F67A 2P9GA 2PKCA 1H6DA 2H65A 3NAMA 1CE8A 1DWPA 1NXXA 4KN5A 3RS3A 2PV0A 4PYJA 1DWQA 1JQBA 4HWSA 1IFXA 2HHAA 1DQZA 1PR4A 3IIJA 4UNIA 3NHKA 2E82A 3PRYA 4UJ3A 4B5LA 3MD0A 3R3XA 1IPHA 2PZEA 2QUIA 5YASA 3FFAA 2HU5A 4XQCA 4LJYA 1SEVA 2CMFA 4U2FA 5TV2A 1DT3A 2VPTA 3ETCA 3E7PA 1V5FA 4IG9A 4QDUA 4KL8S 4LTDA 4MITA 2W8BA 2WAAA 1Q0PA 2GQ0A 4MGYR 1J23A 2EZ8A 1Z5WA 2VS1A 1D04A 5CFOA 1GTJ1 4NE7A 2VDUE 3PXCX 4G0XA 5E6RA 1ISFA 3RUAA 5ALSA 4K86A 2IK8A 1RJEA 3PGKA 4CR6A 1G2IA 4DLRA 4UREA 3KETA 1HQYE 4DCTA 2XXAA 1EDBA 3WA6A 2ZYAA 3LKZA 2QMUA 3OVMA 3QLUA 3GRAA 2VP6A 4LY0A 4OFXA 2CBZA 3CUWA 4XASA 1Q95A 1ULBA 2QD4A 3GJXC 5ICSA 4WKBA 2W2NA 5DM0A 1L8XA 3VU8A 2FAXA 1CY4A 4X8LA 2P1ZA 3GO4A 3SFVA 1P1JA 1X7YB 3WNQA 1UWKA 2UZIR 4DBZA 1MRZA 2MYTA 2VI5A 2XA9A 5L3VA 3AY6A 2GA8A 4PHFA 2YC2C 1TQ2A 1AK9A 1H2BA 1TTPB 4H6VA 4HR7A 5ALEA 3ZVNA 1L4EA 2QGNA 5CX1B 1YB6A 5HDQA 1F0PA 4WBSA 3R75A 3WQBA 1B0PA 2HUPA 2YJ6A 5L7WA 3L2OB 3T0GA 1Y98A 3I45A 4BBPA 4F71A 4AFNA 1RCTE 1VLHA 3BEOA 1PWHA 3IX7A 1F6BA 1YZLA 4L5CA 1I4EB 4L72A 2XDWA 4OHPA 1J0XO 1Z2PX 2ODPA 4AMZA 3M5DA 1QONA 1ADFA 2Z6UA 5CNKA 3T5CA 3IHLA 2PKRA 4HPXB 4WGFA 5G4KA 4CDNA 3FWKA 1Z13A 2NU9A 3KKZA 3R3WA 1FSSA 1Z16A 4X44A 2J1LA 1VA4A 3IUNA 4TXJA 4PLCA 3GOQA 1MU0A 5I51A 1NXQA 2OV3A 1PJQA 3WTBA 3IEUA 4I9GA 3DHEA 3CZ9A 5B1HA 1XKQA 3QOWA 3UAGA 3G5AA 2H08A 5AJWA 3WQHA 1XMOB 2ORVA 4EGFA 3PE4A 1XTQA 1ZUIA 3GRFA 3HFGA 3O7MA 4C7XA 4ZA2A 1GCGA 2JCVA 1E98A 1PZFA 3VPBA 4BU0A 4NCHA 3CC8A 4UJ5A 3I72A 1Q7GA 4G56A 1OU0A 2G17A 3FBTA 1SUSA 2C2BA 1M7HA 1A9YA 2AVDA 2BBTA 3D2BA 1YJ5A 4GXNA 2VOJA 4ZV7A 4HNQA 5CXUA 1AK2A 3BD9A 2XAAA 4M6WA 1TADA 2DVMA 3QHAA 3BAFA 4R81A 4D3DA 4F4IA 1NVXQ 2OCLA 2EOAA 3ND9A 5FYDA 1ISRA 4BQRA 3U4QB 3OJEA 3AHJA 4HTFA 4J16C 5ER9A 4B2YA 4C7BA 3RJZA 2ZJ4A 1XTKA 1IZ7A 1Q50A 1Z5PA 2IOFA 3NP9A 1X39A 2XUJA 3HEAA 1L5MA 4WE3A 3PGJA 4GVLA 5KPDA 1O0CA 2ECKA 2P8SA 4NAHA 4QGSA 5MN5A 1BDBA 3OETA 4B8ZA 2CUKA 3RHZA 3W04A 4YAKA 1DQPA 1OAKA 4BX3A 1RFLA 2OE2A 3OEHD 4YJHA 1QTIA 3NYIA 4QL3A 1SCDA 2YV1A 4P9NA 3WGZA 5ALVA 3IPRA 2WVAA 3L1IA 5IF9A 3NBKA 2OGZA 1BJKA 4QOGA 3FPBA 3HCOA 2PMDA 4ZDWA 1C4XA 4FX2A 4CYMA 1YMQA 3DEAA 4MVJI 1V7PC 4JMLA 4H7HA 4PHTA 5B57C 1GR0A 5COBA 3A8TA 3G0GA 3CN7A 4BRWA 5K0TA 4NOLA 1YR2A 2XF2A 1JNXX 1DBIA 4UM9D 4C7JA 1CC1S 3PU6A 3ZIAA 4D8WA 5CT8A 6PFKA 1AOXA 1PIWA 3T9EA 2X4DA 3ZY4A 3ZHOA 5EWLB 1DINA 2EYQA 2HA0A 3EVFA 4PBRA 4L9AA 1JEQB 1UBTS 2HV8A 3D1LA 3DO6A 3GFFA 4LWQA 4OXKA 1VE7A 3SICE 1I2BA 1LI4A 3ROPA 7AT1A 5DEOA 2QVZX 2IUUA 1K6EA 3JASA 3HFSA 4UBOA 5NLLA 5LYJA 1MT0A 1YRBA 4YNBA 1WSBA 3MZ0A 2QTHA 2YVKA 2CSUA 3HNOA 1LSJA 4FILA 5LZ7A 4PNEA 1I6LA 2CC2A 1N8TA 3CTPA 5AK5A 2OXCA 1UUFA 2PUAA 2GBCA 1ORIA 1SD2A 1DAHA 2KQUA 5ELXA 1BO6A 3ROEA 4ZOCA 3MJSA 1NMQA 4BLQA 2QIPA 4D7AA 1UAYA 2HA3A 4ZCPA 1SD5A 3LFTA 4CMHA 2ZDGA 4X1YA 1X8KA 2O8FB 1CQZA 2PRZA 4RDXA 4YIHA 1GQFA 2XCIA 4GS5A 4RZUA 3GEMA 3QWAA 2FW8A 2BZ1A 2NV6A 1QJ4A 4Q15A 1KK3A 2Z3WA 2PX5A 3IP8A 3IQFA 1ZBDA 4I1UA 2MR5A 4K3UA 1K7XB 5B2FA 1CE8B 3KDAA 4MB6A 5CLQA 1JKJA 1OBVA 1YBHA 2IHYA 2PZAA 2UUOA 1RYFA 3Q88A 4QELA 4RWEA 5E1OA 4X95A 3WIVA 1IZ0A 3AF3A 4R8LA 1KEPA 1Y6RA 3AV3A 2QW0X 2OBXA 5ICGA 5JYBA 1V16A 2W2LA 5K0ZA 2HA4A 4D9KA 5DP2A 1KNQA 4IXDA 5MF6A 5BV7A 1W59A 1UBUS 1WCXA 4GMDA 4HS9A 4URWR 1NW3A 1KZYC 1EFRD 3PWSA 3DR3A 2GAFA 4MKRA 4Y6SA 4D0SA 5M7EA 1SR8A 2PKYX 2J48A 2YW9A 4BFUA 2V7XA 2B2NA 2W8BB 2XUAA 3DOFA 2JLCA 3I34X 4IINA 4ILKA 5AYVA 3ZWDA 4CIYA 1AMOA 3C8ZA 5JAPA 3H04A 2QRMA 3MS4A 3WKDA 4CM3A 1CLEA 2IIPA 4NAUA 5E6RB 1EZ4A 5LYJF 3EYAA 2ZIGA 2EX4A 3AEUA 2HWXA 2CFSA 3NHZA 4JP3A 4P3YA 3WL3A 4FXPA 1H1LA 2XXAB 4IKEA 1HBJA 5HTKA 3FNEA 1GILA 1TCUA 2RHJA 2JLZA 3QHPA 2W93A 2F3QA 3I23A 1D07A 4M1YA 2VHWA 1D9XA 2Y1GA 2AR0A 5GM1A 4YLYA 4MI3A 4ONEA 4EHLA 2VXCA 1CR2A 2XNHA 3O94A 3U3XA 1ST3A 4EA7A 3J81A 1SGWA 4BKMA 3BH6A 5JAZA 2ON6A 2X0EA 2BCJQ 2Q8QA 4MCAA 3VJKA 2K5UA 2QVCA 2E2WA 4NCIA 1UOPA 4MJ3A 2VNSA 3FX2A 2FK8A 3OE7D 4DLLA 1BIFA 4NBSA 1SZCA 2HRBA 5EZ6B 5GAJA 3AF6A 2WVHA 3VPSA 5SY4A 4TYNA 2YS7A 3SKXA 5JS7A 1T3TA 2EP8A 3PNVA 1KMCA 5J4YA 2Y9PB 1ZVQA 1F20A 1WO8A 4JUCA 4LDAA 1MABA 9GPBA 3KZNA 4OU4A 1LLCA 3QI2A 5G4KB 3KCNA 1FFBA 1NL3A 5HHTA 3UMMA 5H8WA 1RZRA 1I9GA 2H4FA 4FOOA 4CU2A 2C57A 1OXMA 1WOYA 3HR8A 1Z7EA 3KPJA 4BP9A 2VQFB 1NUQA 4QREA 5HCIA 1J7JA 4XSVA 4D4HA 3NIGB 3ABIA 3H2IA 4Y2YA 4Z9BA 2PX4A 4ZZ0A 4HAOA 1NF2A 3K8YA 4AYTA 2DU8A 5AM0A 1E3LA 2V7QA 3HYNA 3JQ7A 3TXXA 4G0MA 5AVTA 1HPLA 5KYYA 1TUBA 3P4YA 3PGMA 5DDIP 2AEJA 3KUUA 1QH8A 3EF1A 2ZVJA 2X9GA 1IY9A 3E9CA 4P08A 3NKVA 1JJVA 4POAA 2BHLA 3HI4A 1NJFA 2J9YB 3Q9UA 4WLEA 3KPYA 3KV1A 2X5OA 3RF6A 3NKFA 1VE5A 3HP4A 1N7JA 3I9V1 4FFNA 3O95A 5ERGB 4U4AA 4B3CA 4DBVO 2CHVA 1D9ZA 2BFCA 4HN2A 1QRRA 3WLKX 3ZNOA 2QXYA 3NVMB 4HDAA 1H2HA 2FFHA 2Z1MA 4Z4IA 2WHYA 3V8QA 4FZJA 3WLTA 1TJ5A 1V41E 2R5WA 3ON5A 5J4LA 3QJ5A 3OCUA 1KEVA 2PUBA 1NQAO 3BKXA 4MUJA 4Q9DA 4TL6A 3UAXA 3VDRA 4G8CA 1VIAA 4RDCA 2HLNA 3HU2A 4YJHB 3ACBA 3FWZA 4GRIA 1ZH2A 4TMKA 2AI1A 1XSEA 2C2KA 1P2SA 5K3OA 1I6KA 1XAHA 2A5LA 4LS3A 3RUDA 4HATA 2G8LA 4BLUA 3UOWA 4RTPA 2E89A 5CYOA 4UCWA 4PO8A 3HVRA 2ZU6A 4JXXA 3CVVA 3F7OA 2EFJA 2NSDA 3HVUA 1DCMA 5LLSA 4G0WA 1ZEJA 4MW6A 2EGGA 5F2NA 5D86A 1F51E 1IUPA 1D1TA 1PR5A 1RP1A 2Y6VA 2ZPAA 3DR5A 3F1LA 1L4HA 2KBEA 4JX9A 4Z3DA 3W2TA 3TG2A 2H2FA 3STTA 4HZUA 4U7JA 2AMLA 1Z7GA 2E9SA 3LAWA 1YZ3A 5FA8A 1YQGA 1HDXA 4R1NA 2PRSA 5A7FA 2I2FA 4JJEA 2F1OA 3CEPB 3IJ5A 1NW9B 1MMFB 1U8YA 4R2XA 2QMYA 1WLYA 2DLDA 2G7MC 1Z0AA 2R25B 3JASB 1XZPA 2IHUA 4IV0A 3ZE8A 1NU8A 1R5NA 2V97A 1E9VA 4Z2YA 2QRPA 1AO3A 5DE3A 4RHEA 3PNKA 3SDBA 3QVWA 4HDMA 5EFOA 3W6PA 5DBOA 1QH1A 1WUKS 1KWGA 4QBGB 3GHHA 2YN2A 3T9CA 4CG2A 3GA0A 4D8TA 3DVRX 4IEEA 1GL3A 1W5BA 4UEJA 5DU2A 1S8OA 4N49A 3NHAA 3CSDA 4X8MA 1G3RA 2BF4A 4F72A 4X1YB 5HPYB 5C53B 1PSZA 5A3VA 1N6PA 1ZIDA 3MC1A 5FXMA 3E7XA 3OPVA 1EUQA 1AUQA 3GGGA 1G5HA 4B44A 1JG6A 3KQPA 1XR3A 3QQPA 4EHKA 3QVTA 4D0LB 4IV8A 2CE2X 3FGPA 5TJ9A 1Z4LA 1F8UA 4RACA 1JKJB 1KYXA 4MPTA 3ZDFA 3VR1A 4F9FA 4LSMA 4DV7B 1JJIA 2FOLA 1JAZA 3UJ9A 1P61B 1NUAA 1G60A 1KRWA 1V16B 2RJOA 1W5AA 2AXNA 1EK1A 3EGWA 3FVRA 1R8SA 2XTNA 3D5TA 4NYJR 3OO1A 2G5TA 1P44A 2P9CA 3KXIA 3CMMA 2ST1A 3R40A 3ZCSA 4I8XA 1RHMA 1SC9A 3PQ2A 4YVFA 3ZX4A 2XYVA 1EG2A 3A1CA 1YAHA 1DDGA 3QU4A 5HUJA 3DHYA 2FEOA 2JJYA 3HN7A 4BRZA 4DLAA 4EGSA 3JQBC 1NVMB 1O94D 3MT0A 3WDSA 1DJQA 2A9PA 2O4CA 3AEUB 3AGPA 4I4LA 4L8GA 1X6VA 4P3KA 1H1LB 2NZ2A 4FE3A 3NHUA 1WW2A 4PR3A 1PP4A 2W70A 4AP6A 5LWQA 2I4IA 4X94A 4RZXA 5L3RA 3TIVA 2P0YA 2HTFA 3OY7A 2ZI7A 1E9FA 1UMCA 3DVQX 4ZI7F 5FWNA 2H4YA 4UAVA 3WIOA 2HQ1A 1S8AA 4X85A 4BBJA 5KWVA 3ROKA 3E3NA 1PTJC 2ZRFA 3QE0A 3E5MA 2VK8A 5FNVF 1E0KA 1BWSA 5DN6D 5K8JB 3UT5B 1OLXA 2R65A 1U2ZA 3UTCA 2ODAA 4UCFA 1OLSA 5FQOA 4IOKA 3RIXA 4OAPA 3WK9A 4YHBA 2WF8A 1ZQ1A 3N74A 2YWHA 3P2KA 1XMQB 1J24A 4C22A 4IJQA 2F2TA 3EGXA 3REFA 1SHLA 1SUWA 1MRNA 1ZWLA 1Z29A 3PI6A 5E7MA 3KFLA 2FUKA 1B76A 2QL6A 3L0IB 3QMMA 4NZ9A 4P4LA 4RZIA 5ENVA 3MAAC 3CV3A 1MABB 3NTXA 2NTJA 4J0IA 5JZMA 4YRNA 4XUDA 3S6JA 4IIJA 4Z9XA 2BCEA 1Q20A 2AFHE 3ACCA 4JT4A 1TMKA 3ANYB 2F3TA 4OIFA 5FUBA 4GWKA 3OCWA 5ECWA 4PQGA 3DE4X 1HL7A 3E7FA 1DOHA 3PUXA 3WC4A 4D8YA 2BTOA 1GEGA 1ZW1A 4LE0A 4OGKA 2UZ4A 1YDGA 2Z5FA 3O4VA 1M2HA 1BXRA 3UPDA 3JQ6A 2JIDA 3R7WB 1P7WA 2ZEJA 5JIBA 3KB2A 1DTSA 2Y1DA 3AJAA 4NF2A 3JQ7B 4DR1B 3UJHA 3VSAA 3I30X 1E64A 3TX2A 3UV3A 1DEAA 1RACA 4HX2A 3MF4A 5KYYB 2VSOA 1TUBB 2ONZA 4I7EA 1SC4A 4FE4A 2NUTA 2LRHA 3OPXA 1QH8B 2OCGA 3K9BA 4N47A 5BWCA 4GBJA 2BBSA 3G0HA 4LX0A 2QTAA 5C80A 1U7ZA 1TYCA 3GFVA 5JJCA 4V1CI 2J6IA 3OP1A 5GP1A 1KQOA 1W73A 4HGQA 1T2DA 1IBKB 4N6NA 1MH9A 5FPPA 1VRVA 2Q5JA 4RFVA 1G18A 4KFRA 3IT3A 1R66A 4QYWA 5E95A 5HEKA 1GTL1 1C0EA 1UEXC 3OF3A 3PA6A 3R0IA 1AUXA 2GLXA 2PMEA 3STXA 2C7RA 4J07A 3IESA 1A7JA 1NE7A 4OXXA 5DYYA 1JIIA 2C84A 1EJ2A 3D4BA 3KTFA 5DLYA 4EHJA 4GQBA 2VQ3A 4XUGB 5IBPA 4BVGA 1N57A 3FYCA 4QRDA 4RZHA 4NJEB 3UOGA 4QLBA 1M1XB 5F51A 1FP4A 4HUJA 1FU8A 3BICA 3RAJA 4NECA 2GNPA 1U5BA 2FF7A 9ABPA 3IVAA 1MKYA 3ZDYB 5BSVA 2VK2A 4I5FA 1B8UA 2VTKA 2ZWAA 4BV9A 2VAWA 4RQAA 4CF6A 2AJDA 1M2GA 4N0PA 1XJQA 2Y27A 1HURA 2BI4A 2PJUA 1G64A 1CZHA 4FOTA 3O6VA 1POXA 2XZOA 4ZCIA 3Q3EA 4WHMA 5F9MA 4N12A 3TLCA 2Y77A 3P0EA 3ZEAA 4A8JB 4OY3A 7MHTA 3FZEA 3U62A 4ATNA 5EFZA 3WMEA 4HZUB 1KFJB 2FMIA 1DG3A 4NZOA 1E5TA 3GDFA 1V6SA 1L1EA 1NBOA 2JCSA 2R6FA 3I8XA 2YJ5A 5CM9C 1GA4A 4IAOA 2PMFA 1I3NA 4I8IA 3A4VA 5DLDA 2B4AA 4PCVA 5CCXA 5E1MA 4NP6A 3I6MA 3R7DA 4EQ6A 3GLSA 1KOFA 2ZRQA 3F49S 1BX1A 1OB2A 1FYFA 2A9OA 1PL0A 1CUIA 2HF9A 3NTUA 5H81A 4TKZA 4HEHA 1AZLA 3AEQA 1W4CA 5JNUA 2AHOA 1B4DA 1GSHA 1X1CA 2CE7A 2J4CA 3L8FA 4HDMB 4JYPA 4MW7A 3YASA 1QH1B 4I6JA 3V4LA 3IT0A 3O92A 1O4VA 2RGYA 4H18A 2BN4A 1GO2A 2XCQA 5CDGA 4KMSA 1E1LA 1RQXA 2GBLA 3ITNA 3SIPA 1BFUA 3F3SA 4ID9A 4RK7A 3RKRA 4X71A 2WF5A 3PD0A 3QVUA 4TMVA 1KO8A 3T1QA 2R60A 1MR3F 1U7WA 1VJTA 2QX4A 3M4NA 1GNLA 3KT8A 1W9MA 2I29A 3EDYA 4NYJQ 1E99A 2VHTA 1XU4A 4EKIA 3O3OB 4NU0A 4BNVA 1R12A 4GSLA 1M6WA 2PVSA 1X80A 4CEIA 5AJVB 2P78A 3UB3A 1R0SA 1U8TA 1SC6A 3PQ5A 3BB3A 4LZNA 5B7QA 3WKCA 2OY0A 3OFSA 4OHCA 4BCDA 3EQZA 4U63A 1JVSA 4KJZA 4QNNA 3KPWA 1QCYA 3HWX1 3VPXA 5L3SA 2PRYA 1K63A 4MZDA 3PYXA 4NXMB 3M5CA 3RS2A 2JLXA 2PXXA 1IY2A 4M0UA 4BNMA 5AHKA 4F1WA 4CKWA 5IZCC 1BC5A 4EARA 4WV3A 3X1WA 4L51A 4PPNA 4G36A 1RYYA 1TZJA 2ZXFA 3OG9A 3JWEA 5JEDA 2BDUA 3O3NB 3Q7EA 3J7TA 4HB4A 4M7OA 2IV7A 2H0QA 3ZW8A 1ZCFA 2XZTA 4CRWB 4S2UA 5KVSA 2A92A 2GASA 2OSVA 1A96A 3UMYA 1G7RA 1JZSA 1SA0B 1OYYA 1NMXA 1QIDA 2PLFA 2XDAA 3E1KA 4HG2A 1MJFA 1JLRA 1OI4A 2PANA 4RMNA 4B40A 3KKLA 1F0YA 1A2KC 3RH0A 3ZVRA 4DG8A 4O4HB 1LU9A 4RLSA 2GAIA 3ZGVA 2AFIE 4GMFA 2GBGA 4KVZA 4XVUA 1MZPA 4RL4A 1A82A 1UMCB 2V9CA 4FSXA 1TEXA 4HLUC 5GVRA 2QM3A 4RDIA 5FAXA 2JLRA 3E9DA 4BLVA 3BG5A 6GPBA 2JF0A 1E3DA 1LEHA 3GLHA 4J0GA 1FFXA 1WV0A 3FPLA 2PX3A 1OLXB 2EIHA 1LPNA 2Q6OA 2ACVA 5CPBA 3CVUA 2W2TA 4JDPA 2XUIA 1J06A 3LM8A 4H7EA 4JEHA 4B34A 5J40A 5CVEA 4EG7A 1MLDA 4G26A 3TAUA 1O96A 2ES4A 3W7AA 2FQQA 3MTDA 1WDMA 4EGQA 3EGXB 3FSGD 3L1HA 4GIBA 3RIGA 2TECE 3PC7A 1V8PA 2QYSA 4LXHA 4IEFB 3KQMA 4YC7A 1EK2A 2QL9A 1E4EA 2NT4A 3AKYA 2WU8A 5DNEA 1OTHA 1E4OA 5TR9A 4IIJB 2FSPA 3U26A 4CPDA 3QEAZ 4FOSA 1Y80A 5G02A 5BSMA 3K9GA 4YAWA 3G9ZA 1PX2A 2E48A 3FJYA 2YOHA 1NVGA 1IHOA 1N7IA 2IYLD 3PQEA 2RKWA 1JHDA 1NFQA 5JPIA 1NF9A 2K87A 3W8EA 1JHVA 3WKEA 3AHEA 1G21A 2QOEA 3EZYA 4L1KA 2WFMA 1D09A 1GGHA 2CVFA 2CXRA 1KWKA 1NXTA 1ADCA 5FO0A 2I7CA 2B83A 4A8JA 5JRZA 4H7JA 4C7MA 2NUTB 5CHEA 4PHCA 4R2JA 4TVKA 2WWFA 2AK3A 2K4MA 1OPXA 2M9MA 5CPFA 4URFA 3QUCA 1XNQB 1AXGA 1R64A 4M1WA 1GTZA 3IJPA 3EWAA 3L0BA 5FTMA 4OK3A 1W5SA 5DCUA 4JYAB 3R77A 1WRBA 4HNHA 2ZDQA 4PGMA 4LAFA 2X9LA 2XIQA 3E9ZA 2Z9DA 1VMDA 1D0IA 5AW9A 4TWZA 1JV2B 5I45A 4LNHA 3DFZA 4DJFC 4O5AA 2K7FA 1T6ZA 5HP4A 2N1BA 1WDLA 2VBFA 3DM9B 1WPQA 3F73A 1CFJA 1CDEA 1ZI6A 2RB4A 5EUMA 3WZMA 3CA8A 1US8B 5SZIA 4HN9A 2IV3A 2D0IA 5AI6A 3WGOA 2I67A 4LF4B 1P3DA 1VA5A 1Y1RA 4RY9A 3OIYA 1FW6A 1VKZA 1OWLA 2JKZA 1Y1PA 1KSJA 1UBSB 4IOMA 4UNNA 1T9CA 1X13A 4J2TA 2ATVA 3E84A 1QS0B 1U5BB 4PWZA 4L0DA 3VX4A 1O4WA 1SUDA 2PR2A 4EJSB 3QPDA 3NWBA 1F5SA 4IZIA 1UPBA 1A88A 2AG5A 1KJYA 3WAJA 4HGYA 2GCIA 5CXXA 4PYNA 2QTLA 1DKNA 3H1TA 1FLDA 4X60A 2XADA 1NHGA 5B58C 2QX8A 2P6MA 5CFZA 3QEBZ 1UK7A 2C3MA 4G2TA 3U7GA 1GA6A 1DKLA 1QG0A 3CEAA 4JMPA 1E2HA 5HJEA 2V45A 1ZITA 3GEPA 2E87A 4JI0B 1PS9A 4F2DA 4MW9A 2VXBA 2DUUA 2HCTA 1K8RA 4B7XA 2Q1XA 3B7PA 4OKIA 5B55A 1IZZA 4Y7DA 1KJWA 1YNOA 1LX7A 2DLNA 2G67A 3JZIA 4KSYA 4AO7A 5ADHA 1L7VC 2BC9A 3UB2A 4E22A 4FCVA 2EXXA 4EUFA 1R16A 2RAFA 3RSZA 5H3HA 3DQZA 3N8IA 4E1VA 1NW7A 3SR3A 3IHWA 1XA4A 2E49A 2QN8A 2QPLA 2QLMA 3AOEC 3I39X 3DG9A 2Z1NA 3BGWA 3V80A 4J1NA 4FGWA 2C77A 1WW3A 2I1VB 5C1DA 4X1KA 5I9BA 2V65A 3JD0A 4BGEA 1RABA 1L4GA 1WBBA 1KI1A 4UZSA 2PZBA 4EUSA 5BYJA 3H5TA 1SUCA 3S3TA 4BGVA 1GDTA 4N3NA 2EJBA 3FBGA 3EZ9A 3FGOA 3SQMA 2TMGA 4EYOA 4HNVA 3DZDA 3AB3A 5CVCA 3LCVB 1JWAB 2VNAA 3TI9A 2C2WA 2QJRA 1X80B 5J5AA 4KO8A 2ZQZA 4OJQA 5JECA 1P9RA 4GX1A 1JQ3A 4C7VA 3G2OA 1NNLA 2XW6A 1R0CA 2B34A 3C7TA 4OYYA 3HXLA 1VMEA 3BD6A 3C87A 2D13A 5EJFA 2ANBA 2DFPA 2BW0A 3DGEC 4NBLA 4RKQA 1YWGO 4TLCA 4TTSA 1RQGA 1UJ4A 1SOUA 1SVIA 3TIIA 3UBMA 2FJ0A 2F1IA 3L1UA 2ZSEA 3EW9A 3LUBA 3BZBA 1WXWA 4DEXA 4CV3A 3BMXA 5LZ2A 1T0PA 4IUYA 4FEYA 5FWYA 4DC9A 3IBCA 1M8JA 1SRQA 3PRJA 3M2PA 5D5PA 3OOEA 3GJ7A 3F4BA 2EKPA 1MORA 5JE8A 2C7OA 2ABWA 1T6XA 3HKBA 3I4LA 3GW8A 4PX3A 3F97A 3LH5A 1IHPA 4RFSA 4BEWA 3W5AA 4TRNA 3OA0A 4IIVA 4OVKA 3TLGA 4BO0A 5HK9A 3LDGA 4QEDA 5KNCD 4HAZA 3KT6A 3I9JA 3LUFA 4CF5A 1KI6B 3G0CA 1CQWA 3D9QX 2R2GA 3G8BA 3RVJA 3A1EA 4DUGA 2IDMA 1RBYA 3GARA 1Q11A 1HLGA 4YRCA 2WJHA 2EP7A 2W4QA 5DCLA 4G0PA 4JR1A 4L6AA 1J7KA 5BUZA 4IJKA 4UTVA 1CEEA 3FYHA 1GKUB 3GLHB 5KTOA 2P5UA 1F06A 1FFXB 4P38A 2X23A 2ZLBA 3N7AA 1PJ3A 3VOSA 1VHTA 2HW8A 2WE8A 1FUIA 1CUJA 1TW2A 2BEWA 4HEA1 3ZN2A 2QSUA 1M2FA 1O96B 3FMVA 2V8OA 3GD5A 3IS3A 4G1FA 4KQIA 3NT4A 1QFYA 1ABEA 1TW3A 2C4UA 2V7BA 3UW1A 1IXKA 5I9LA 1OT3A 3GGDA 4LZLA 4YMLA 4OX9B 2QVGA 3TIXB 4Y2JA 1FU7A 2GSWA 3TQRA 3ZU6A 1JHXA 1VE3A 1E4EB 1OVMA 1E61A 4OXYA 5DGCA 3X1ZA 1EM6A 5JVDF 3L40A 3VUFA 3RKSA 2Z6QA 4W1QA 3PQ8A 4LWZA 2HUNA 3ZKAA 2XZDA 1WM1A 5EZ5A 5CH5A 4Z5XA 1DIOB 3O03A 1ND5A 2G72A 4HNSA 4TV8F 3IERA 3TOXA 4F8JA 2DPGA 4JP5A 3II6X 3S40A 4AMUA 4EB0A 1T5IA 3JR3A 2ZIEA 4C0SA 3F6YA 3SKYA 2I6FA 3CF4G 4YBZA 3PXUA 1PGOA 2GRAA 4LXQA 3VM6A 1NC3A 3QVXA 5KMGA 2O0KA 2QTNA 4CWAA 1VYUA 4WH0A 3HDQA 1M34A 2CDCA 3QUTA 1Z4OA 3O1LA 5CW2A 3MXTA 4MUXA 1QCDA 1GY8A 1SUFA 1W8IA 3LQRA 3Q5EA 3R8CA 1VBKA 1VB3A 2UVDA 4GWGA 5TPZD 2YS6A 1WKCA 2B36A 2O3TA 5JATA 1MENA 5NULA 3RG8A 1VJ5A 2A5FA 1FQJA 1VBMA 2HXGA 3O3MB 3QVLA 3T7RA 3DLTA 3A4TA 1JMKC 2UDPA 3VKWA 4OMFG 1V7QA 4OLHA 4IG4A 2DTEA 1BROA 1Q0SA 2R4QA 2XQFA 3FZQA 2L19A 2XNKA 5A02A 5FI5A 4H17A 4JXKA 4LMAA 1EE1A 4KYVA 2VF4X 1EHYA 5BOSA 1QHIA 1KJ9A 2EW1A 3HZRA 4R9VA 1B26A 1W0KA 2BPOA 2Q2NA 1HYQA 2WHEA 1HDYA 1ZD3A 4KLCA 3RC7A 3T3IA 1BU8A 1ESCA 2C98A 3IQDB 2ZRPA 4WNAA 1BA2A 3KU4A 3PE6A 1A9RA 2F1JA 2LBPA 3F5MA 4NBTA 1ULSA 3D3KA 2EFGA 1S1MA 3D59A 4KV9A 4M7WA 2AMJA 4ZQGA 2ZKLA 4JA0A 1E1RD 3DNFA 3R9KA 2A9KA 1A76A 3D8NA 3HBLA 3N8DA 3ZQ4A 3ZC3A 4DKJA 4BP8A 2PSDA 3P0RA 4E08A 1TIKA 3DDUA 2X19A 4KKXB 4RHUA 4IVNA 2FR8A 4JEUA 3JZFA 3K0BA 5BXYA 4I5DA 2EATA 2XVZA 3DV2A 4HAUA 4L4ZA 5ALKA 3EIWA 1BVHA 4JLBA 3TGLA 3G79A 4JODA 2Z0MA 4UBLA 1TB4A 1U9IA 2B0JA 5CIWA 3U17A 2DFKB 4KXNA 3E5RA 4IIUA 4RKRA 2IU0A 2KX7A 4QULA 3ENQA 1C3LA 3C3YA 3I4CA 4E5UA 1CERA 2NOAA 1OBCA 2YXBA 1YULA 4JI8B 5FPTA 2ZFUA 1H6BA 1CVLA 5DFAA 3ELWA 4KOAA 1E2BA 1WPGA 4P5PA 2I8CA 4FU0A 4BUZA 1IC6A 3S8EA 2IS4A 4UEQA 2WSIA 3IOYA 1NF3A 4C08A 3IBFA 3OZRA 1FXUA 4P3NA 1ZN7A 2CXUA 2B4YA 3MTAA 2MYPA 4YLEA 1HDRA 3I0ZA 3AP1A 1DUSA 3ZQJA 1NP6A 2Q5CA 5TJHA 5A03A 1OTXA 1JDBB 2ZUSA 3RYFA 2IS1A 3E2PA 4X1KB 1RWXA 1E96A 2AR7A 2XIJA 3U7IA 4IH9A 4EL5A 4KLAA 2ZSIA 3HJHA 1R0BA 3NOXA 3VYTB 4YRAA 3IPCA 4F0JA 5HZKA 1K06A 1EB9A 2WQ6A 3QPCA 4YRKA 1BX3A 1GP2A 4HLQB 3UVEA 1HEYA 5K8CA 3LGAA 5LMZA 3FTFA 1XTSA 4G0QA 3VO1A 1UDBA 4FONA 4BO1A 1F8FA 2YY7A 2VSFA 3AK4A 1PDVA 4V2UA 2P91A 3UHFA 3VA7A 2QBYB 3THOA 3X3HA 3JVDA 3K2IA 3GY0A 4Q18A 2VXOA 4Q4HA 3GLVA 4HF7A 4W9NC 2X76A 3LCMA 1YZYA 3QKTA 5M5BA 3WK8A 1AGYA 2A88A 1L7EA 3V7NA 5A3JA 4H15A 2JZCA 3C16C 3RK4A 3WYDA 4G23A 2FKAA 3TFWA 3CYFA 2CJXA 1UBRS 5FWYB 1AKVA 1DPGA 2RIPA 4JZKA 1N9KA 1NV9A 3DOJA 3F9IA 3OBIA 4PZPA 2AN5A 4CI0B 2A3RA 2RGNC 3FW1A 2E21A 3COYA 3HKBB 4FVTA 4IQFA 4OLFA 2A35A 2JASA 3PJFA 3VPFA 4RFSB 3V2IA 1BU5A 4G3XA 3TLGB 3GC6A 4G5XA 2C8KA 4E46A 4FI3F 5ECDA 4QQFA 3FB1A 3TQFA 3IPXA 3UAVA 4JJGA 4IXNA 3CKKA 4G07A 1WOMA 4XUCA 4EECA 1IRIA 3MTJA 1CB7A 3QELA 3R76A 1VP9A 2OUIA 1P73A 3ASZA 3I0NA 4L78A 1AURA 1CJVC 1E9SA 4RXTA 3FPKA 3PQCA 1S0UA 2BIFA 4PWYA 4E5KA 1SNYA 1DIAA 2DR3A 5EKXA 1KI4A 2JVIA 4EVRA 4M36A 1W6UA 1T24A 2V6FA 1M8PA 1ZU4A 2GSDA 4JBHA 1XEAA 4MA5A 3F2VA 2BEWB 2YMQA 5LCXA 4Y18A 1WPXA 2QT1A 2BGNA 3RU7A 1L5WA 2GVNA 4RY8A 4GKVA 2AOTA 5ITZA 1X38A 3OE1A 4HB0A 2W5UA 4ZO9A 3QKUA 4FCTA 4NKRA 3ZBPA 1Z6PA 2XCLA 3IVXA 2Z1DA 4L9RA 3VX3A 2QI9F 5B30A 4RH3A 3KPUA 3J80A 4PC6A 1DKUA 1CRLA 3FUCA 3NALA 5GV7A 1THGA 4QO8A 1UODA 3W34A 4O4LF 3H6GA 1NLFA 3OJWA 4DEVA 5ER6A 1M6EX 5BSWA 2HSGA 4N0MA 1A1VA 3FY4A 3K96A 3OIDA 4ID3A 1CRQA 1P9NA 3LX6A 2PLWA 4NBRA 1QAOA 1VKHA 4Y2SA 5FBWB 1TZ2A 1P2TA 5KO2A 3COSA 1UM9B 2XMZA 1AO0A 5IVKA 1GUBA 1WWKA 1W4AA 1MHTA 1AD2A 4HB3A 5DXJA 5A71A 2OV4A 1SKYE 3IQIX 5DRYA 5BN4A 2FPPA 3E61A 1Z4MA 3PWZA 5IK2A 5TEWA 5KMGB 1RAEA 1P0CA 3RE1A 5LPNA 2QW8A 4ZEWA 1M34B 1ZWKA 3OMLA 3ISTA 5E2BA 1KJZA 3BFJA 4WA8A 2IKQA 1G7TA 1PFQA 1ZLYA 3MUNA 3NTQA 1Q6ZA 3RC2A 3KQOA 2P9HA 4XFKA 1AM4D 1YIDA 3F5SA 3OLWA 4OSEA 2DUMA 3SJCA 1SN7A 3V8MA 5CBKA 2XMDA 5EGSA 1ULAA 1L4LA 2JIZD 3ELBA 3LPAA 3OO0A 3S28A 4BE7B 2OMKA 4URXR 4Q0MA 4E21A 2OO3A 1UAAA 1EEHA 3KWMA 1NVWQ 2GR9A 4RZQA 4PU0A 3L6RA 4XFJA 5BOSB 5HYVA 1Z6ZA 5D5HA 3GCGA 4L08A 3VHXA 1D2CA 2BFEB 2PLRA 3B36A 3QIVA 2JS7A 1EQUA 2OT3B 1UEIA 2QX9A 1HM5A 2PRJA 1U81A 3K8QA 3NKLA 3ORRA 4N8EA 4K8RB 1IBRA 4QU9A 2HMVA 4ARZA 3TZBA 3B1ZA 5DBHX 1ESDA 1IWBB 2E4UA 1JKMA 4M87A 4NE9A 2UXDB 1RAGA 4CTNA 3B7WA 3FCEA 4H0CA 2JLWA 1VFPA 3SJUA 2VJKA 5AD1A 5DKFA 1PR9A 3WYAA 4ALLA 1R0KA 3KTDA 3UHJA 5BPHA 3OQBA 3LD9A 1FVOA 4EGAA 4QOJA 3WFIA 2O1XA 1OY1A 2WIGA 1T3HA 4N48A 1DFIA 3C39A 5K3FA 4FYWA 1QANA 3W2GA 4B73A 5K0BA 1EWRA 3F8SA 3DZFA 4KDEA 1X2BA 3SSOA 3SVTA 3N8KA 3O8CA 2BYTA 4OLAA 2C8VA 3CKYA 3QKSA 1USGA 1HL3A 3O8LA 1GQQA 4BNJA 1BDJA 5EHZA 2CNWD 3PRKE 4P83A 1U0JA 1ZH0A 2VSNA 3VV3A 1N0UA 3NTVA 1SXIA 5L3QA 1FNMA 2XUGA 1DO2A 3JYPA 2SICE 2VWHA 1VIVA 1XZIA 2X2EA 1N3YA 1PGNA 4OK5A 2C7GA 5DLEA 3ZHBA 4WJLA 4CIWA 3MRVA 4MEBA 1O0SA 3RYFB 1A2OA 3HLYA 1E7SA 1RRMA 3PD7A 2ZR7A 2C5LA 5DNVA 4E0BA 4WK2B 1AKQA 1BCRA 2CYAA 2JJ1D 2MWMA 3AP3A 3WGJA 1D2GA 3FVTA 3VZQA 3R20A 1PNOA 3OZBA 3Q3HA 2F1HA 5BW5A 5KTNA 3U3MA 3IJEB 2WA2A 1LZKA 1XJ5A 2KPOA 3K6RA 1IZYA 1EXVA 1U2SA 3KBOA 2NO0A 4P4SB 2GPTA 5HQ3A 4TTJA 4X8HA 1U2GA 2H4WA 2P4EA 2FY8A 3BWDD 3IQEA 4PHHA 2PBFA 3BA1A 1LPSA 1INLA 3HDGA 1L0BA 3OQ6A 2OZLA 2JAHA 2B25A 2GFHA 2OOKA 3A6JA 1R18A 3N70A 4L02A 2VQDA 4OMCA 1HRDA 3SSAA 1ATZA 3H2BA 1T4DA 3F7MA 4IXMA 4A2WA 1AZSC 2JGIA 1B7GO 2ZYUX 1KZHA 3P0FA 3QYAA 1AKEA 1SCUA 3HBMA 3EVNA 2Z4RA 4UTZA 3U3JA 4W8HA 3JATB 5AVWA 3SK0A 1C8KA 1T5OA 3NYQA 4A4DA 1GCAA 2XWPA 1DAFA 3TECE 2OHOA 3FLMA 3T1YB 1DBVO 3OJXA 4UMDA 3QNMA 4H3HB 2Q4EA 4ZPXA 4ZIRA 1M7BA 1QHHA 1E0SA 4K6GA 1PFUA 3GQBA 4RADA 3V4ZA 2XUDA 3B3GA 3AVOA 2D7DA 2G4CA 4WVFA 4A2QA 4A8PA 3NXSA 1X7ZA 2JC3A 3B48A 2M6KA 2FUCA 1N5DA 3PVCA 4DUZB 2R9VA 3CT4A 1YO6A 3ICCA 3HB7A 1QX3A 3U16A 4LV5B 3WAGA 1ZM2A 1Q22A 4HFRA 1EDDA 1N2OA 3QELB 2J3JA 3E2IA 4YO7A 1QFMA 1BEZA 2QLTA 3P9YA 3BWYA 2OD2A 2X0JA 3BL6A 3PNQA 4MVJM 1VYTA 2RBEA 4MR8A 1G1AA 3QW4B 4YGYA 1ZINA 2ZBUA 1Q2UA 4UDNA 4YDSA 4GEGA 3W2IA 2VYCA 2J85A 2AOTB 4NCBA 5GONF 2GPYA 2EFDB 1FP7A 3D4PA 1UBHS 4B9EA 3FNGA 1BE8A 1Z18A 2YQZA 1N7GA 2IY7A 5JH7A 3DE6X 1P0MA 1Q0QA 3LPNA 5JSQA 1L5KA 1QGOA 3V9AA 4WY5A 3UK0A 2PKXA 2O14A 2OBYA 4P84A 1XD2A 3X1YA 5E1BA 4LYJA 4HVAA 3IB6A 5LA6B 4GF5A 3H05A 3RODA 4X1IA 3X1KA 3P4UA 5LA6A 1YRWA 1NJ5A 2OORC 2HGSA 4QQNA 3DXFA 3FUWA 4TZKA 2YHBA 1IE3A 1XXLA 2QUBA 3MPUA 4FDLA 4NPHA 3DAGA 4Z9AA 4EJ6A 3D6VA 2X14A 2D5IA 1UIMA 2B1JA 3K4QA 1Q7CA 2G77B 3UGQA 2IE8A 2ATCA 2EBWA 3I01M 3B1YA 3OKPA 2FPPB 5BN4B 5TX7A 2GZDA 4C5CA 3OJLA 3UMJA 3JV7A 1PT5A 3LOQA 2R1TA 1ACMA 2YWDA 5F4ZA 3RVNA 3TW8A 1ZN2A 3TZHA 4ALJA 4NZPA 3F6CA 4JQYA 3B3QA 2AT1A 3IAUA 4TSFD 1JJ7A 5FHQA 5KWIA 4CKCA 1AJEA 3QTBA 5IBCA 2JFVA 1A5TA 2HOQA 3UMSA 2H1VA 3E6AA 5F9FA 1P2DA 5ULLA 3T3EA 5P8WA 5LNK6 2H2IA 3ZDDA 1MEJA 3TL2A 3RPEA 1J33A 2Z2KA 4K9DA 2VLIA 4KQ6A 4NEHB 1F4LA 2DTXA 2HIGA 3B3AA 3EGEA 4RF3A 3H8WA 3RVPA 3VJRA 1AUPA 2I7TA 3M6AA 4I81A 4MYHA 1K5HA 1EDZA 2GN6A 2H57A 2J0UB 2RHWA 1BFDA 3JSAA 2NU8A 1PW5A 3BMOA 3EA5A 2GXAA 5K99A 2D1YA 3SAJA 3KP1A 3WHIA 4E51A 1GTRA 1EJ0A 4AP9A 2WDPA 2VYND 2F55A 1PUJA 1HH4A 1RAAA 3ED5A 5K0GA 2PRKA 5JH7F 5F2KA 4ARZB 2FSFA 4XQGA 4QASA 1YFZA 4K46A 1APBA 2ZAMA 3ZD7A 1Y5RA 4G2NA 4BB0A 1VDMA 4FBMA 4FIDA 1BE6A 3A1FA 3AJRA 2XNJA 3AR7A 3DL2A 1W30A 2FB9A 3B5EA 1H4TA 2FZVA 3BIXA 4ISBA 4GQAA 2O2CA 3ITDA 2XT9A 3ZDXB 3T5AA 2CBGA 4B3SB 1OI2A 4S0XA 2UUCB 4CMKA 1S2GA 2MHCA 3SBOA 1NURA 1PR2A 1RQNA 4RKWA 1N2ZA 2GM3A 3KIPA 3AI7A 4IJ6A 1LC3A 3IP7A 4LXTA 3SQOA 2IE0A 5JEEA 5BSTA 3ZI0A 3D0OA 2QQ5A 5K3FB 3MD9A 1NXVA 4QUBA 4HWRA 3VSDA 1IVSA 4XYEA 4DQUA 2VP2A 1OXKB 1MIHA 1X9GA 4DA7A 4ZHQF 3ZDCA 1T0UA 1A4RA 2Z8YM 4KW7A 1I13A 5C3UA 4HQLA 1KARA 1M1YA 3TEFA 2VH2A 3GVHA 2V0GA 1Z8NA 3G6KA 1K5GA 2AK2A 1R4MA 4FDTA 4PR0A 4QGGA 1Z35A 4M2LA 3TZQA 2CD7A 2SCUA 4D42A 1KEEA 5HILA 2B4TO 1I6WA 1KGSA 4C07A 2EBUA 1Q7RA 2GM5A 1JFSA 3WP1B 1YS2X 3DL0A 3RFUA 3PC8C 3ZU5A 4C0XA 4CUJA 5C5IA 3AF4A 1OXVA 5L3QB 1KR5A 1C2TA 3ENKA 2WWTA 2QTZA 4BFZA 4NWIA 3DL4A 1NN3A 1U0HC 2ZROA 3PFHA 3PFCA 5DLQC 4TS3A 2G1KA 3E1SA 1WBJB 3DOHA 1YZTA 4I66A 4ND7A 2GDZA 2JZNA 1U7DA 3C70A 3G59A 4JKOA 1GZ7A 1ACLA 1K7FB 3RQIA 1K3TA 1EGQA 1WXXA 3AESA 5CVJA 4JI7B 5KX5F 1E9RA 2BE7A 3LECA 1IULA 2O9JA 3Q41A 2BMEA 3WDKA 4A03A 8ATCA 3CJQA 1WF6A 3TLJA 4O4JB 1S1CA 3M4YA 4TXLA 5ICCA 1QK5A 2ODWA 1R74A 1YTLA 3N0TA 4TLAA 5HQ3B 5AKEA 1GQOA 3I76A 4WMLA 1KHHA 4EI2A 4FCWA 3U7HB 4HNGA 4KTTE 4ECAA 3EF0A 4IFEA 3RSFA 5F52A 4AJLA 4LYFA 4U2BA 1DMRA 5AKXA 4LHWA 4ASUD 4YAGA 4ZN6A 3F74A 2OZLB 4LYGA 1K5DA 5E9JA 3VPHA 5F7OA 1JH8A 2EL7A 4R9UC 3I04M 3QH4A 2JK0A 1NP3A 3R0XA 5M3BA 1VYHA 3SQNA 4DV6B 1E2LA 2CWWA 2M1ZA 3NC0C 3HGMA 5LBUA 2PGLA 3HDTA 4O2BB 1ID8A 1NJ8A 1OAOC 2WUWE 1VCIA 5LQRA 5JWRA 4MW5A 4PICA 3UGJA 5B6PA 4U3JA 1KAEA 4CHGA 5CDFE 1M2WA 2C4HA 4MKZA 1C1HA 4H4CA 5AVQA 5EZSA 4FYHA 3S2UA 1GGVA 1R4ZA 3FDIA 3I2HA 5AO9A 1DLIA 1UJCA 1LSSA 3OTWA 1N2SA 2ZYSA 4CV2A 1SH7A 1C50A 2NXNA 4R0NA 1V4BA 4XXHA 1A8QA 1J8FA 1QHHB 2QQEA 3GQBB 4FOLA 2EJTA 4XW2A 1XYYA 3D4OA 4DMRA 3OQHA 1Z7YA 4L5IA 2NVWA 2HPAA 4LNAA 4X8OA 1NI5A 1X7ZB 2YWJA 4S2EA 5AI8A 4RM2A 3T7SA 1JQLB 5ESRA 5FO1A 3Q1KA 1GTSA 4ZAVA 4V0ME 1IEVA 4J3NA 2QJFA 2OAQ1 3LWZA 4MLPA 1NVAA 3IR7A 2ZR8A 4QHSA 3CVXA 5HIMA 3ZUPA 4X20B 1O7JA 1V8OA 1VECA 1X0VA 3C4QA 3L9XA 3TL3A 3UAYA 3LFUA 3UHOA 5FPSA 4WZ6A 4WL0A 3IMKA 2CMDA 3FJ1A 5TS3A 1L3BA 4MR8B 3V8RA 1CUHA 1Z82A 1ENPA 5IYZF 2R48A 4DM3A 3G13A 3UWSA 1RS0A 4QHYA 4QPCA 3HCPA 4ZO8A 3GZTB 1DJNA 4M4SA 2Q1SA 3ICVA 5HKOA 1TECE 2BV3A 3W78A 4XB2A 4WLUA 5EJ7A 1GM5A 3EIXA 1MPTA 4MJXA 2JGJA 3T34A 4AX8A 4F2HA 5HSGA 4JP2A 1XD2B 4EPWA 4FN5A 1PL8A 4YH1A 1H2ZA 2Z30A 4NBNA 2HSZA 1NTRA 4IX9A 3GJ0A 4O4IF 3IKJA 1B8PA 1J8MF 1GYPA 2HEGA 2PQ0A 3DDNA 3N3BC 4Q1VA 4CR7A 1EVKA 1Y42X 1ZM9A 3LYUA 3RSSA 3DMTA 3VVMA 3S8YA 2PJZA 2ZI9A 3LT2A 3ORYA 3AVVA 2EU8A 3VPGA 3T95A 1PSWA 2CL7X 2MMGA 3VC2A 4PYLA 4QUHA 4QLAA 5H1YA 3SYKA 1AMUA 1DSSG 3E70C 3TW8B 1NRJB 2WKRA 5EEGA 1X7HA 4PG5A 5BNWA 2RKBA 3MUFA 1MCZA 1QYVA 1IUKA 1YKGA 5BV2P 3N2NA 3VKGA 1XWIA 2ZKIA 3EY9A 3KM0A 4CKCB 2OILA 3HG7A 3AVUA 2PJDA 2FE1A 4G5FA 3STYA 3NAGA 1X8LA 1S8FA 1SRRA 1HF3A 3E3OA 4DMLA 1TVMA 4MARA 1HYBA 4COOA 3KZ1E 4LZJA 4Y6GB 4UQPA 2V59A 1GG8A 3H16A 4UCQA 4DREA 1NVDA 3C5WP 4U2GA 1PWZA 4A8HA 5C51B 1BN7A 1JB9A 1MJGA 3VR3A 4M38A 2FRDC 3AM3A 1E63A 2JFXA 3K0CC 3WA7A 1F60A 3BMOB 3FUXA 3BIWA 4P0QB 4IHJA 1NR1A 2WYUA 4YV2A 1KQFA 2WWWA 4YBRA 5FTLA 1LK5A 4F5YA 1TRKA 3AFGA 1A8SA 1F4PA 4FHZA 4R8MA 3UXYA 4KWIA 4JSRA 2WG0A 2HK8A 2OL4A 3I1FA 3NH9A 1H05A 4D4JA 1BXZA 1KZ6A 5JFOA 3HB4X 1M2KA 4RGVA 3R9IA 1F9AA 1IM2A 3DVSX 1OH6A 2WUEA 1ONBA 5KDDA 2DFVA 1VYVA 5KQGA 4R5MA 1L8AA 3R3HA 3B8HA 5EVJA 1VHLA 1R4NA 1ZL0A 4DPMA 1LRKA 3PICA 1A0OA 2ZB3A 2CLDX 1F8XA 5C4IA 2QRKA 1U9YA 3X0DA 3MERA 4E7PA 4EHFA 1JHQA 4YAJA 1M1YB 3OCYA 3V1TC 4MS1B 4C2BA 4OYHA 3LKDA 5CFPA 3WFZA 1R4MB 6ADHA 4BCCA 1UPCA 2FP4A 2WF9A 2J7PD 3SHTA 3C7KA 1FFDA 3CH6A 2IUSA 1KP9A 3PJRA 2FRVA 1IAVA 1QSGA 2YHUA 4NV3A 4R1PA 2EARA 2GCPA 2FWPA 1YQQA 3KQQA 4CFYA 3F8TA 4II7A 1CJCA 1JJAA 4JBIA 2VAMA 4WTOA 3SOZA 4DVJA 4BP1A 3TB4A 2FN3A 2R11A 2W2PA 5KTTA 2Q07A 1ZOIA 4CQMA 3TRKA 2EBFX 2CXSA 2V96A 2D0OB 4IHJF 5AJXA 4DNQA 1ZSYA 3AESB 3AY3A 1KE2A 4KNWA 2O7RA 2X1MA 1DQNA 2FP3A 1P75A 1PD0A 2C4WA 1F48A 1NONA 4HPJB 1OFHA 1XEXA 4F4DA 3JZDA 4UTOA 5KNDA 4EY5A 1SULA 1WU8A 5DNAA 1CHNA 4RHCA 1WLSA 1TTHA 1SWWA 3CCFA 4Q9JA 3RT1A 1A50B 4V0RA 1L4UA 1JJFA 1FXSA 2I6QA 4R2KA 3N8HA 3ZGYA 4DDUA 1MUUA 1JQDA 1PLLA 3OM9A 1YL5A 4DSUA 1T6BY 3DEKA 2QNIA 3PQ4A 3Q10A 6CHYA 1Z6QA 3BB1A 4I4TA 1UKZA 3SIXA 3K5IA 2VWGA 1KK0A 2CXNA 3WWDA 3RS8A 4CKBA 4DG5A 3O82A 1SCIA 1F7UA 3LNCA 3PC3A 1XWWA 3ET4A 4MKHA 5FOTA 5HQTA 1ENZA 4U3JB 3H42B 3DBOB 1PUXA 3QUAA 1JJBA 3RDPA 3ETHA 4OKNA 2BFFA 4KUEA 4R69A 2HB6A 2O7QA 2QTVA 4Y0VA 3ZE6A 1UXGA 2PL9A 13PKA 5K6AA 5IRCD 2B1QA 1T4MA 3LUJA 4IWNA 5HKAA 3B1FA 2QD5A 2OESA 1ORTA 3FHJA 3NIDB 1Y9EA 3AFOA 1RYMA 3OICA 5AM5A 3W2HA 3OLCX 3KHUA 1HMYA 3ZD6A 3K1AA 4YO8A 1KAQA 3KDSE 4N4AA 3RD5A 1PFGA 3OZDA 1OW3B 2FPUA 3H84A 5JNRA 1G4HA 2DKFA 2GPJA <