4AP5A

Crystal structure of human pofut2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
389
structure length
389
Chain Sequence
SRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 2
publication title Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 133
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A02
3ZY4A 2OCXA 3ZY6A 2HLHA 4AP5A 3ZY3A 3SIWA 3ZY2A 4AP6A 3ZY5A 2DE0X 2HHCA 3SIXA
chains in the Genus database with same CATH superfamily
1LB1B 2IHJA 1S9HA 2DY1A 3I30X 2ZZMA 1KEWA 1QSGA 1W0JD 2FR8C 2GAAA 2ZI4A 2P11A 2Q4TA 3DS8A 1YS9A 3NBYC 1A9RA 3VM6A 4NJEA 5K8TA 2QF7A 4LSZA 2RAFA 3WLAA 4LISA 1CQIA 3AUJB 3LQKA 3MJEA 2C2HA 2JLBA 1E1MA 2XMRA 3DEIA 3IP3A 3W2TA 4A2CA 1M2NA 4GXNA 3CW9A 4X95A 1P5RA 2ZIXA 3LQ2A 4N8DA 3VC1A 4DSNA 1YQ9A 3F8SA 1JWLA 2GBLA 4YMTA 2ZSBA 2VNHA 3LY5A 3RO7A 1W35A 3ZHCA 2GVNA 2WJWA 2Q99A 4J07A 2QAGB 2ZRHA 4BNMA 3JVVA 4L3OA 4UEJA 2IUEA 4D98A 4E5DA 1U2DC 2AI2A 1X15A 2IODA 1Y42X 1IPHA 4AKHA 3L06A 3T5TA 4UHDA 1ZKDA 4LSWA 1FTWA 1SUFA 4LOJA 3T5PA 3OA2A 5CVDA 2ZE7A 4CCAA 1P5ZB 3CVJA 2C9DA 1AXRA 4QUJA 5BV1A 4JLDA 2AJBA 2M1XA 2Y9MB 1LNSA 4INPA 1D2AA 3W4IA 1A7AA 2NSDA 2HIAA 1EZ1A 1E1LA 1Q7BA 3DV2A 3X43A 2XOEA 3WTBA 1E99A 4J0EA 1KOJA 1W76A 3RABA 4E12A 4E30A 3H9QA 3KEFA 3X1DA 1JWAB 2HGZA 2WU3A 4U2GA 1RC0A 4GDFA 4EI9A 5C80A 1IHXA 5HK9A 1L5GB 3JATB 2GHQA 1YOBA 2PBRA 4OJTA 5FEUA 3LYHA 3WQHA 2IKSA 3A6ZA 3RT9A 2VPTA 2YH2A 2VATA 4ZT2A 3NJ8A 3S27A 2HMSA 2PMCA 1SXJC 3R3VA 2IBTA 1CJKC 4UTZA 3R4VA 3SLGA 3OO1A 2E4ZA 2HQSA 4AYWA 1R1DA 3DH0A 1W0KA 1F2UA 3CO0S 3RSQA 4MV9A 1LPMA 1ISIA 2ZI7A 3L18A 4YRJA 1KR2A 1LPSA 2VF2A 3QG5A 4P9NA 5LC1A 4RTJA 2BEKA 4V1CA 5E8JA 1E89A 1LA2A 4JHXA 4N40A 1AGYA 4ZODA 5DULA 2EFGA 2AK2A 3ZX4A 4DUPA 1C7RA 2G0AA 2JCSA 4IHKA 1YUNA 4WEQA 3SAJA 4CM5A 4LJ6A 3FNBA 1ID8A 5LQKA 2IOQA 4XGQA 1XQ6A 3IT3A 4OA8A 4NBNA 2ZULA 2R8EA 1WUTA 2CLHB 2QXTA 3B51X 2BGMA 5F3RA 4GL2A 4HWKA 4WZZA 4E2YA 3ITKA 2E1RA 5IH7A 1XRMA 1U11A 3QVXA 5I8PA 5HZGA 4DGQA 3CEJA 5A4MS 4YR7A 1B2LA 1GQQA 3B13B 4OHZA 2VQ6A 3LUPA 2C9MA 1REQA 4QHSA 5SYNA 4KWEA 3UT0A 4I5FA 2XY4A 4DLPA 1Y3FE 2NU9A 1SBZA 2PNJA 4BX3A 1J1IA 5F1YA 3IJEB 1CP2A 1GKUB 2QTMA 1MA0A 1G38A 2NTEA 1JPNA 2I2DA 2IXBA 3VSAA 3KJEA 4ZAXA 4HGQA 2XCRB 3C7DB 1NW6A 3NYIA 3IC5A 4NPCA 5K05A 5A02A 5KIAA 2FOLA 2PE5A 4YMSA 1YBHA 4NBKA 3VVMA 1P2GA 3HBNA 4KJXA 4D56A 1QP4A 1USWA 2J6CA 1WUYA 3F3YA 4TKMA 3P9PA 3QU7A 3TLGA 1AKRA 2H7VA 3LKDA 4F96A 2G63A 2OCAA 3RSHA 3QHAA 3EGEA 3FN4A 3Q7TA 5EL0A 4F6CA 1DKMA 3B48A 1SGWA 4X1YB 3FYUC 1T36A 4H3VA 4US0R 1JDZA 3RJ5A 3THSA 4AMZA 1E6EA 2P2GA 1K5DA 1O9GA 1SZCA 1V0JA 2Q6LA 3WMFA 1CS0A 1VOTA 5A1JA 3QE9Y 3UAVA 1P5HA 2WUWE 4FB5A 2V65A 1QB8A 5TLSA 4D8VA 1LK0A 4XQEA 5I7FA 5DYTA 1D09A 2XECA 1WMEA 1JSCA 4MV6A 1XDDA 3AFOA 1WP9A 2GDZA 2A9PA 2OQRA 4G56A 4NK4A 1UXJA 1DRWA 1T9CA 1PVOA 4K3UA 1EVKA 2AOVA 3USES 5I4KA 2I1QA 2FG6C 3NDJA 1A8HA 4YT8A 1ULAA 2GN6A 3K1TA 1R5BA 1R6DA 3OPXA 2AFVA 1WY7A 4H7FA 3QOFA 1JAYA 4CF5A 3HZZA 1DJMA 1S2IA 3HLTA 3BXGA 3WL4A 1SPXA 1R8QA 1IL0A 1C3LA 1I4WA 1ZSVA 1T91A 3CIOA 3RVQA 4DJ5X 4FHFA 3PLAE 4QNNA 4BX0A 3C8DA 1V71A 3GMIA 3HK2A 5EPEA 4IIJB 1T3LA 2L69A 3DHNA 4Q5IA 3VPFA 1BHO1 5KNCH 3I62A 3CSSA 4MO9A 4ASUD 1IEVA 2FG7C 1RAFA 1EVZA 4DWJA 3IS3A 3DE4X 4QYIB 4YT5A 4UAVA 4FFLA 4RFSB 4Y1RB 1OI4A 2PH1A 5FOWA 1QKJA 3H3FA 4JT9A 2G6TA 2WG1A 3KE8A 2QR3A 3QKSB 3A04A 3A9CA 2NLOA 4QUDA 4H4DA 3I23A 4U5XA 5EIHA 3A6PC 2F3UA 2A3NA 1BD4A 2W4IA 4H7JA 5LZ8A 2AX4A 5EZSA 1H0RA 1G8FA 2PKEA 4KR0A 2FCRA 1L4KA 1NW5A 4M8SA 1G59A 1VSQA 2BRUC 5B6PA 4OI0A 1TKAA 2C8LA 3KQVA 3PYXA 1YK0A 1WEHA 3STXA 1FRVA 1E0KA 4BO4A 4C4XA 3LX5A 4RXTA 2J4FA 1FLVA 4G6ZA 3M4XA 1Y7PA 1Y5NA 1TJ5A 3ZJVA 2B30A 4D99A 4DCVA 2GN8A 3BMXA 1Q0PA 3JQ8A 2IYRA 4M1ZA 5C0OE 3SHQA 1QS0A 3LLSA 1JHQA 3DFMA 4JC8A 4Y18A 3H5RA 5HM6A 1K97A 1XEFA 5KSYA 1CY8A 1XFDA 4QEDA 3RLIA 1U9IA 2FRDA 3TZQA 3H18A 1NVFA 1GSAA 5FLEX 3CUEF 2VUUA 2ISCA 2WMOB 1FDRA 5TT0A 5D5PA 4TVSA 1EUDB 4HAUA 1DHTA 3E9ZA 3EOAI 1YR3A 3R7AA 4FR0A 3W77A 5IK2D 2VBCA 3NBZC 2PSJA 1ODCA 5C34B 2VYCA 1GU1A 4KR7A 1GADO 2YWHA 2DPHA 3OZFA 5TQJA 2CF6A 2X3YA 3TL2A 4WWHA 2MINB 4XWWA 3ZVMA 2DWPA 3AF5A 5AR1A 5JR3A 1UJ6A 1ORRA 3N5CA 4MAAA 4JROA 5DGXA 1VIAA 1NN1A 2EW8A 4UXIA 2CJYA 2ZJFA 4EA7A 3R9IA 3V8EA 2VLIA 4DV1B 4OAPA 3C3KA 2W6CX 4QO7A 2ZIFA 5IJ0A 3SM3A 1YA8A 5JWOA 4EGAA 4FWBA 2H7YA 1LD3A 3GRCA 1GPYA 5BQPA 4MLZA 4KXVA 3JVIA 3T3HA 2HSJA 3MCVA 5FI3A 4CG0A 3LC2O 3WFZA 1IAQA 3M2PA 3EZNA 3R5TA 1PJZA 2YXNA 3G59A 1F38A 3HUEA 5LUBA 5TVGA 1R6BX 5J1TB 1M34A 5DBFA 4J1NA 3TBFA 4AK9A 4ZN6A 5ES3A 3OQIB 4M99A 1K75A 3PA8A 3LRPA 3NM5A 4YYZA 1SKQA 4BNUA 4MUNA 3TF5A 3PJDA 4D46A 4MDEA 4DM3A 3MBOA 1C8VB 3AP1A 3UMBA 2FSPA 5B7NA 3HR7A 4ISCA 3PC7A 3KE9A 2XYRA 4I2NA 3V1YA 1XVIA 2KPOA 1NBIA 3QI7A 1Q0RA 3C3WA 4ZICA 1Y48E 3UC5A 3MRTA 1W5AA 4U8HA 1XR3A 2CMGA 4LI0A 5REQA 3VVLA 4E1AA 2YJZA 1H2FA 1G64A 1KE2A 3SNKA 3C8UA 2X5NA 4DGSA 5ECDA 1B6GA 1MV8A 1ODFA 2WIJA 2C2BA 3K0CC 5H81A 4JQZA 5H80A 3SX2A 3T7JA 3UK7A 5KWSA 1ZU4A 1QRDA 1SAYA 3N1UA 3TDKA 4IWYA 1KY4A 1ZCZA 2VZ9A 3ZY3A 3OWXA 4TRJA 3GHHA 1FSFA 2HA0A 4NU0A 5IDXA 5IZCA 3DMPA 3F5QA 2NP7A 2V98A 1Y6ZA 4DQUA 2ZKIA 3ZH2A 3K71B 3FPHA 1VE1A 5H1YA 3JZIA 1EFDN 2FWIA 4OSPA 3GUZA 4QFMA 3FIJA 1KP2A 2EGUA 2P4SA 5LA6A 3OEHA 1U0OC 4CMBA 1I4LD 4DV0B 1YS4A 4JLUA 4ARCA 2PXAA 4R4JA 4J1SA 4BQSA 2R6R1 3P45A 3JWHA 1VZ3A 4UFNA 3DMDA 4XD7D 2WB4A 3EXFB 2CUZA 1AKVA 4FDLA 4YUVA 1MC5A 5IN5A 3WLQA 1PFGA 2IF2A 3IERA 2GJSA 2C77A 3LKVA 4U7JA 5I9SA 2PPVA 1ZIXA 1R6XA 1VLZA 1R4MB 1XK7A 2Y3IA 4IRMA 1ZL0A 4RQTA 3W34A 4DZTA 2EC5A 2VJOA 3QLVA 2KMLA 3RQIA 1YB1A 2R8BA 4NFHA 5JD5A 1W4CA 3OEYA 2YJ6A 5LDDC 1NN0A 4Z2YA 1UAAA 5BXYA 1Q1AA 2ROQA 2QU8A 3F9IA 5TB5A 3BMCB 2HRDA 4B3GA 2HWXA 1QBGA 1GGJA 1ILWA 3FA2A 4F7WA 4D9BA 3CF6R 5DEIA 4C4YA 4BQQA 4RU1A 2EBHX 1BW9B 2B0CA 4WACA 2IDKA 2NT3A 1QGAA 5HE8A 1PJ4A 1EFVB 2AJ8A 3ZIAA 1E6UA 2Y0BA 3RG2A 4BEBA 4ENWA 4YJ3F 5BUSA 4MJ7A 2QL6A 1KKLA 2OBMA 1EWTA 1GFSA 4PSAA 3LWNA 2OLJA 2P6NA 3NANA 3TX6A 4ZYWA 3O1HB 1T4BA 3L7AA 5AJXA 3A3PA 3ASYA 1P7WA 5DT2A 3AB8A 1I80A 1GL3A 3I76A 1A4UA 5FIUA 3TJMA 4BNTA 4EG7A 3D6TB 2VHTA 5JBNA 4X7RA 1X2EA 3JARB 5C8ZA 4IR7A 5B36A 2D1TA 4J75A 4HDKB 1ONNA 4IDPA 2BGNA 4LHYA 3P9XA 1RI1A 2R7MA 4TMYA 3UMJA 2FZGA 1KAMA 2WYOA 5ICSA 1ODTC 5HIJA 3ZUPA 1EK5A 1KJNA 4MIOA 3N3BC 2AIRA 3QGMA 4PTYA 2XMZA 2X0JA 2GRUA 3TZBA 2J5QA 2E6UX 2JFXA 1AQIA 2FZ5A 4LK2A 3JWEA 4PGGA 3IR5A 3ZWBA 5HRCA 1I7DA 3G9UA 3HB7A 1E32A 1XRJA 2ASVA 1H69A 2W6ZA 4DIFA 2IH4A 2UZ1A 1JJ7A 4JBNA 2WWIA 5A6SB 3EEIA 3TN7A 3QX9A 4RVHA 3D4NA 4Q03A 4BFUA 3OPNA 3WMXA 1W34A 4M7RA 1PGPA 4MX8A 1IUOA 1ZGHA 1GD1O 2BFDB 3DR5A 3P97A 4J9UE 4YRPA 3JR7A 4KVFA 1ZH0A 4E5PA 1J24A 1Y8ZA 2GZDA 5GIPE 3CCCA 3AESA 4YO7A 2O2YA 4J3FA 2X15A 1WHSA 4KNVA 4W8HA 5JAHA 2LRHA 2CMHA 3QVJA 4K05A 4FFPA 1BX3A 2P2DA 2VTEA 3TEMA 3MELA 3W8RA 3PZBA 3S1AA 3E22B 3E7XA 2XCUA 2DBZA 3QTLA 5CYFA 5CXXA 1RD4A 2IYWA 1JG4A 1U8EA 3L1UA 1NNI1 4H2DA 4CYMA 4D79A 5ITWA 5LZ9A 3K0HA 2AR9A 4KH0A 4REQB 2Q62A 2Z3VA 5GVRA 1TQHA 1GUYA 1H0SA 4OBXA 5AJTA 3ZD9A 3QLJA 3THYB 1D6SA 1FMCA 2PWBA 4WNIA 4L02A 1J56A 1PQYA 1D2MA 1V3QE 2O4UX 3AEZA 2HXSA 4WFKA 2ZUEA 5HRUA 1T10A 1P3DA 4F3TA 2D74A 3IUSA 4DSUA 1AIPA 5EHQA 5MN5A 4Y9TA 1OFUA 1VBKA 1M2KA 2NSLA 3F78A 3F7TA 3MTJA 4OFBA 4QDJA 1CCWA 1D03A 4WESA 4L74A 4RD1A 2G76A 2LNDA 2QY9A 1NU8A 4KEAA 1WL8A 2XW6A 1GTMA 4UZEA 4X63A 4W1RA 4AECA 1DAIA 4FT2A 3IV7A 3NNNA 3HI4A 1LZLA 1FY2A 4AM8A 2A67A 2NO1A 4QTXA 3ADDA 4ISBA 3EIEA 3FHLA 4NARA 1E79D 1P5FA 4GNKA 3QH4A 3QUAA 3T0FA 2V7PA 5CH3A 4UTOA 1V5GA 4LVNA 4TYPA 5SZHB 4LGMA 4YDQA 5KNDD 3IMCA 3I01A 4E2WA 4EPTA 1VSUA 1RHUA 3CEMA 2CMKA 4TTTS 2WHPA 4ECEA 4C0HA 3RR2A 1WVIA 4GP6A 2E1PA 4DLRA 1ECFA 2J0UB 5GAJA 1WDLA 2FZKA 4FHCA 3LDFA 4XB6B 2X9GA 3OIGA 1OX4B 2RFLA 3EGDA 4HDAA 4BLPA 2PX2A 4XWYA 5AM5A 5E1MA 4FFNA 5ESWA 1PWYE 4CRWB 5HQTA 3MMXA 3VR5D 3FTEA 4B43A 2EFYA 3B1KA 4HS4A 3U6KA 4JXZA 2VTVA 2Y0CA 3CV3A 2PD6A 2Y2UA 1EFKA 3NHZA 4Y6PA 3S2SA 4CEHA 4J43A 2CNOA 3C1AA 1KZHA 4NZMA 1ZK3A 4C0JA 3C70A 2W2LA 2Q29A 1YQTA 2APJA 4CI0B 1CJTC 5AI4A 1NMZA 4DV6B 5C9ZA 2Q27A 1Q22A 4FIZA 1JT2A 4OQYA 3SBDA 2SECE 1LX7A 2J9YB 3D4IA 3OOWA 1J39A 5AXDA 3T38A 2CYAA 4OM7A 1Y6GA 2P2YA 2PVPA 4K9RA 1Z16A 4LPKA 3AP2A 1XZPA 5K0TA 4YUAA 1EWQA 4MUHA 2P6PA 4PV7A 4ZZ1A 1VSVA 5ICCA 4TTQA 2CE2X 2Y68A 2YY7A 3SEFA 5LD2B 4LYDA 3P96A 4Y67A 1MGPA 4P5DA 4B8YA 5JH7F 2J3JA 3MJSA 4MVJG 4DRXB 5JVDF 4HY3A 4QVKA 3G82C 2GZ1A 3VKUA 3CFYA 2ZWAA 3A9SA 1EGVB 2QD4A 2G4LA 2GEVA 3S99A 3GR6A 4L4XA 4OBBA 4DREA 4Q3AA 1LVGA 4F85A 5K8LA 2UUBB 3H2GA 4RJ2A 2Z6QA 1KZ6A 5EQJB 2CWWA 4E7OA 4P4SB 1PI3A 2JHGA 2R00C 1P17A 1ZICA 2O7QA 4XDGA 5JE8A 1ZX1A 5C3UA 1U94A 4HDNA 4KO8A 1R4NB 2R4UA 1IRIA 1C4KA 3ZZ1A 3TNLA 2I71A 4C7OA 5ARBA 1HGXA 3VX3A 4YI3A 1Z06A 1Z0ZA 4YPVA 1LH0A 1C7FA 1M1YB 3EXIB 4HZGA 2X14A 2DHCA 4HWTA 5ADVA 2ZUSA 5IF9A 2ZYIA 3AIKA 1EHIA 2HSWA 5CCXA 3D0QA 2PNFA 4B44A 5HF6A 4Q3BA 5ETJA 1QQ6A 2VYVD 2X1LA 1U0GA 4OYHA 4M0KA 3L7DA 5AD1A 5KX5A 4HDSB 2WTUA 3BT7A 3WWYA 2I7VA 3FWYA 4C6RA 3PEUA 2E4AA 3IB6A 5LIPA 2RI0A 4JGBA 2MSLA 3QKRA 3EHDA 4B48A 4EGCB 4G2NA 3S2IA 1QHHB 2GZRA 4MMXB 2WSYB 5COAA 3QENA 2BM8A 1ZESA 4TROA 4BCBA 3KQPA 1WBDA 2JEOA 1E0DA 1Q57A 3WIVA 4HAXA 2HLPA 4DCGA 4B6PA 2RHLA 5A4KA 3JQGA 4H31A 1PP4A 1Q7CA 3ICEA 3OT4A 4RAQA 2IOYA 1KXZA 1ZJZA 5JS2A 1UFOA 4EQZA 1MJFA 3NC0C 1XMVA 3SHVA 1U02A 2IZ0A 4RPLA 3O8LA 4FCTA 3E5MA 3HJFA 2WVJA 5B3LA 1JLLA 1V48A 2AC7A 3SS7X 3PD0A 3TJZA 4MVJP 1P44A 1DP4A 1I5RA 2JFPA 4YH1A 5BT9A 4A6EA 2ZFUA 1H6BA 2VHWA 3E9RA 1W59A 1ZOLA 4R0NA 5FA6A 4BB6A 1UDBA 3GGPA 2D6FA 2PMBA 1U3GA 3B78A 3OIYA 1ZUIA 2BMJA 4G4SP 2ATXA 4RORA 3FDXA 3URMA 4M9CA 3R40A 4CVNA 5KJ6A 1X0XA 1Z45A 2QRQA 4M0DA 4D44A 3WHLA 5K03A 3PEWA 2O5CA 1K92A 2D4AA 3D02A 1YJQA 2X2OA 4V0QA 1MOSA 3RREA 1CE8B 5THKA 4EO7A 1CKEA 2DTEA 2H59A 4TPKA 1OROA 2IHZA 1KZ7B 2O1XA 3OBBA 1VXRA 2FUKA 2RBKA 2XQKA 4BRUA 2PMFA 4D45A 5K0NA 3WRYC 3VR1A 3HO1A 2PJRA 1FTSA 3IFSA 3KJNA 5ALTA 5FORA 5H3HA 1V5IA 4NZPA 4MWBA 1YVRA 3ZHUA 2C3YA 2QTVA 3A9TA 4OI4A 5KJEA 1XZ8A 3OLCX 4HO1X 4R8MA 1GXSB 4NZNA 3SXUA 4BU0A 4EGQA 1WBBA 3GT0A 5KVVA 2Q7OE 5BMVA 1MABA 2HA5A 2VJPA 3EVNA 4JBIA 3GJRA 1ZGJA 5DTIA 3DM9B 2B94A 2RJNA 1HSZA 5EMKA 2F1HA 2ZYDA 3GFQA 3H5WA 4QUBA 4Z9XA 3DZGA 4L8FA 3V9AA 4DL9A 1GU7A 3B9RA 4PO9A 2JIMA 1NFQA 1QHIA 2J67A 4YACA 2WUDA 3EDOA 1TEVA 2VJDA 3C43A 5DPMA 4G0WA 4LHSA 2KX7A 2P0EA 2QUIA 4ZVPA 3IAFA 1SVSA 3JQ9A 1EXDA 4LC1A 5LZ4A 3ON5A 5DH9A 1PT9A 2RGWA 1F6BA 3IEMA 1SC9A 2ZQZA 3K20A 1XTUA 4C7XA 5LP6F 1XTZA 4Z1OA 1JQAA 4NOKA 2YFYA 3E7PA 1XZEA 5JAIA 4CLEA 2V3WA 2E9SA 5LMCA 3TSWA 5GPBA 1E3WB 2BMAA 3TZEA 3PEFA 4D9CA 1NY6A 1OX6A 1SCDA 2FRVA 3F9CA 3N28A 4BQFA 1RM5A 2R86A 2VDQB 3OLQA 5BY2A 2AOUA 2ID7A 1J5PA 3WL5A 3NHUA 1E6WA 4A8PA 8ABPA 5A71A 1O7JA 1TDJA 4EB3A 1TMGE 4BU1A 2QJOA 3UCEA 3PI6A 4XEHA 2PM8A 3I5UA 3PNPA 3LCJA 2HFJA 5ES4B 2LE0A 4X20B 4DC9A 5TPWA 1WCIB 2HMWA 3EW7A 1DL5A 1L5FA 1LJ8A 2IDJA 4UMVA 3GXBA 3LUJA 3LUKA 3PQFA 4QARA 2HMYB 5KYUA 1G8SA 2C4TA 4CIVA 1E5XA 4UNRA 3WO0A 3DCIA 1AGNA 1DWUA 1NM5A 4Z7QB 3UY4A 3KLPX 3RSGA 4JN6B 2HUNA 3LBFA 2CXNA 4IV5A 5JHGB 1YZUA 5F1OA 1X7HA 5DYYA 1YS7A 3UG6A 2Q7XA 5DTEA 3H2HA 3RDPA 3AHDA 2Z6AA 2WHEA 3IQGX 3CR3C 2PU7A 4M1OA 4F4UA 3JAWA 2XA1A 2Q5OA 2ZATA 5DT9A 4TTPA 3W6ZA 3KKEA 1G55A 1NZFA 2HLDD 3G85A 2YWRA 4AS2A 1CF4A 3PNOA 1GZUA 1C9MA 1X1TA 4BMNA 5FUXA 2WHYA 2PS9A 2FPIA 2ZYSA 1E2QA 3PCTA 3WYCA 1O0BA 2NQ2C 3DKVA 4Q01A 2WAMA 2G67A 1NOIA 5JD4A 4QAQA 1EDOA 3KLBA 1TVKA 4BE9A 3DT6A 2FGKA 1HMPA 3A70A 2QL7A 4RXMA 2JAPA 1OLSB 5CX1A 5EKDA 3VHXA 2EJTA 4B8ZA 5K6RA 1I36A 4I5EA 4WADA 2H7CA 2GPYA 4D0LB 5TMBA 5EXTA 2BZSA 1VMIA 2CVPA 1VJDA 4QDOA 4BQPA 1H2WA 4PYQA 3DDCA 3WLTA 4FONA 3HRIA 1V96A 2DOKA 2X6RA 3ABRB 5BNZA 1Z5GA 3NTUA 1A4IA 1SK9A 5H9WA 2VJCA 3D5EA 3IP6A 4PZ0A 1ZCFA 3IDAA 4PLHA 4GC5A 3OIWA 4Q3LA 2JKYA 5AM2A 1XZFA 3DC7A 3I1YA 3BB4A 5IXYA 1RM3A 3KT3A 3LXUX 5HILA 3ZHQA 2QMHA 4KXYA 1MQAA 5H0IA 1Z5ZA 5CA1F 2XCIA 1LTQA 4FHGA 4OHCA 3TQFA 1UKCA 5CVJA 5EOVA 3E03A 4JKYA 1A82A 2HNBA 3L0OA 3RK1A 4CXMA 4IILA 3HSSA 3N2ZB 1E0SA 1YSCA 2ENWA 2H9IA 3HPQA 2I6XA 4X1IB 4L4SA 1VL1A 4FFSA 1FFWA 2P75A 2OP1A 7REQB 5J23A 2QMOA 3KZNA 2IHNA 3LY8A 2ZT6A 3RVKA 4BHTA 3W2GA 3NVKI 1W46A 2G71A 1JQ3A 4EL5A 1FDUA 1HT0A 2JFQA 3OQJA 4CIBA 1DFGA 1UZUA 4E3ZA 1XEXA 2YFQA 4O4JB 2NNWB 1RJDA 2W2XA 3JYPA 2FW0A 3U4HA 2WAXA 1QYIA 2Y99A 1ND5A 4OK6A 4DWOA 4KQWA 1T1GA 2A5DA 2QX8A 2PIDA 2WF8A 1CUEA 3EMDA 3L0IB 2N0SA 3PC6A 5ALIA 2O2HA 3GVHA 4ZU1X 4TX1A 1ULBA 4IJUA 4ZYVA 4O02B 5K0GA 2QLJA 4XVQA 2HA2A 2ERYA 3EEFA 3ZPXA 3F71A 4AC9A 2EG9A 2ODEA 3CLTD 4NULA 3Q9SA 4WXEA 4Y8VA 3UAZA 2W6NA 5FP0A 1CNEA 1Y9DA 5LXTA 5AHKA 1IULA 3V4SA 1H1LA 4FFBB 4PZYA 2NGRA 1NR7A 1AQLA 1FP1D 3EDYA 3R20A 2Z4SA 1WCXA 4RJIA 4L6CA 4Y6OA 4IINA 1BNCA 1XWWA 2FSVA 4FYHA 1N6OA 3H6GA 1Q5PA 1EGAA 2C4UA 3KTAA 2QRPA 2F3TA 4IOKA 2L82A 5HHTA 1UMBA 3FWKA 2A5YB 3O9VA 2FPUA 4MYTA 4TQUS 2JS7A 4LXYA 5AW1A 3DLTA 3BZUA 5A0FA 3RRXA 1KIFA 3NHAA 1E77A 1I9GA 1K2WA 1LFAA 2GCOB 2BDTA 2YJGA 3AGQA 3EIQA 3P0FA 2QDXA 1JLHA 4PANA 1XJWA 1MRSA 1XDUA 1V37A 2PA0A 3KYDB 2J0VA 3QVOA 4M8KA 3A9RA 2P3LA 2WWGA 5E4TA 1TTPB 5EJ2A 4R2MA 5HK8A 4D9GA 5L7WA 1KJ8A 3KPUA 3UUFA 2V03A 4AT1A 1GVHA 1PL6A 3MJRA 2SNIE 4L5BA 3JWGA 4LQCA 1QH1A 4XRGA 3N59A 3I73A 4EGSA 1ODIA 3CB4A 3QE2A 4XWAA 2IV3A 5BSWA 4ESVA 5A05A 1NPDA 1M8KA 2C0PA 1TF5A 1VC2A 2FN9A 2XRMA 2XUZA 3MUEA 4URHA 5A2QA 1GTZA 3GDFA 4GDMA 2FR8A 3PJRA 3WRXC 4D4LA 2PUCA 4C5CA 3FNHA 2ZJZA 2CHEA 2X4DA 4PX2A 2GA8A 2XAAA 3ZWXA 4CCYB 3M3DA 1IBKB 2D06A 3WK7A 5TGZA 1KGSA 4P2GA 4PXAA 3T95A 4CMKA 2BMFA 2VDKB 1K8XB 2O2EA 3HEAA 3TDMA 1YUMA 2XUPA 1X74A 1U7UA 2YS7A 4HRXA 4ZEOA 4RDIA 2YYAA 4QL3A 3JX9A 1FJGB 2DH6A 1Q21A 2G0NA 4I3HA 4X93A 4D41A 4CF3A 5JALA 3AT1A 4KXUA 1DJOA 2D5CA 3I1IA 3WJ7A 2L42A 1JHVA 4H16A 1GIAA 1E4EA 2PAFA 3OZIA 4FGSA 5JG7A 3HE3A 2QPTA 4XUGB 4CEIB 3AUYA 2NADA 2UDPA 4B3HA 4A23A 1DKLA 2N42A 4NZZA 4FP9A 2AN4A 4UM9B 3DO8A 4L4RA 4GBJA 3BCUA 1QDLB 2R87A 3P9SA 4O4IF 4N6GA 2KLBA 1EFAA 3PUXA 1TVMA 3P1JA 5IT5A 5FKJA 4MW5A 3V6LA 4EMUA 3H8VA 1IOWA 5IYZF 2UZ0A 3SXJA 2O2IA 4EATA 3SYKA 4PY2A 4DWWA 1EE2A 3BD8A 2XB9A 1NX9A 2WU1A 3IMEA 4UM9D 5CDSA 3AEXA 5KX5B 4F5YA 2GF0A 4LV8B 4CPDA 5KDDA 1OMOA 4NCIA 3WYEA 2CEKA 1KPIA 4LY6A 2XNKA 2A4KA 1XJ0A 2IGBA 4JKIA 1WXIA 3K30A 2X5XA 3AK4A 2V97A 1POWA 3LCVB 2IHBA 3OY2A 4EKIA 3K6SB 4V1CI 2DFPA 4D02A 2WE7A 5LKAA 2QRZA 1F0NA 4KFTA 5EXDA 5I7AA 5KCZA 3BMQB 5FPTA 3WYDA 4RZHA 2HWKA 4OCZA 4OI1A 3QEJA 2NUPB 4R81A 2DX7A 1T5DX 5I7HA 2W2KB 1C80A 1A50B 1Y8RB 1Y5LA 2KLHA 2A4MA 2HL6A 2VK4A 2Y1XA 1BHSA 3DO6A 1ML3A 3BQMB 3FB4A 2GBIA 3L8MA 2XODA 2DHRA 3LT0A 2ECPA 2VUIB 3OZTA 4OMUA 4IZIA 5IDVA 3S70A 1K2VN 2BDEA 3KOUA 4B5KA 3VR4A 1R5OA 1SN7A 2NTJA 3DAFA 3I8SA 1PW5A 1VBMA 2CW5A 2JIRA 3NH9A 2RCNA 4MHSA 2XUAA 4OREX 2CLSA 4M8NE 5F7OA 3IEVA 4NOMA 2AEMA 1XTPA 1AZTA 1S8FA 5PNTA 2I6SA 3KQYA 3W1WA 1V1JA 3F5MA 4EFMA 4EHBA 1RJWA 3FWPA 1P2FA 3D59A 5K8VA 3ACBA 4K1XA 1RMTA 3QPVA 1X9GA 1LW7A 1YBVA 5EIOA 4Z4HA 4Z4QA 3JQQA 1ORTA 3I4FA 1LPPA 4P58A 4B8WA 3D8BA 4DANA 2I8AA 3BDIA 1VYTA 2QN9A 4MV3A 2Z9DA 5C8YA 4ALJA 4AO6A 1YIAA 4C7VA 1G8GA 1V4VA 2EEPA 4R1PA 5E9WA 5KHLB 3HDHA 4IXTA 2WFZA 2BEWA 1IZ9A 3JQBA 3E7FA 4MZDA 4O0LA 3RBXA 1ZRSA 2Q49A 1NV8A 4HLUC 1IHUA 4UW9A 3ZDCA 5J5AA 5EQDA 4ZCTA 1DLIA 4RW0A 3U31A 2I1LA 4GQBA 1GSOA 4L8LA 5BWBA 1C3EA 2AVNA 4TGLA 1XTVA 2Z56A 1MW8X 1BE1A 1Z25A 4W7HA 2OESA 2NV6A 3L8FA 4CIYA 1Z0SA 3LUBA 4LXHA 5KC9A 2ZSAA 4QPZA 3RUIA 4D4MA 1UK7A 2R8OA 2WPDD 4NMHA 4FBMA 3H9CA 1J9ZA 4BP3A 2RGRA 5I7RA 3G0IA 3M5DA 1UH5A 2GERA 3SR3A 3K5HA 2XB4A 3KJHA 4WL0A 3W5VA 3B6JA 4HNQA 3L8DA 5MGNA 4WZBB 4PG8A 1DUSA 1PG2A 4J8PA 1C1HA 5ARCA 5DISB 2XPCA 3L4JA 2GS9A 2NUTB 3OTWA 4C1NA 3VSCA 4XZ3A 3ETLA 1V2GA 4RLHA 1Z0IA 2OCBA 3GEBA 3U1TA 3NRJA 2CDNA 4NU6A 3IVXA 2WOJA 4MGYR 4JP3A 5EAIA 3FWNA 1UXOA 2G4VA 3BCSA 2FJPA 3QZUA 4EEXA 2FR0A 1WRBA 1XTRA 2IPXA 3EQZA 1CERA 1SXPA 3PT5A 3CVXA 1YB7A 1B00A 5I7OA 4JITA 2I80A 3ENQA 4ZJPA 5CEJA 3JV7A 4RCVA 2K5UA 3PIRA 3CMCO 4WN9B 4ITUA 4LMAA 2H2WA 1QHXA 1Z3CA 1L7PA 3DLIA 3VSEA 4DIDA 1N7HA 2C04A 2OP0A 3QBDA 1C1DB 1GNQA 2VJNA 1P2VA 2AKAB 1IZYA 2WA1A 4JX8A 1KQGA 3TK1A 3RF7A 5DSZA 4F6RA 3AIIA 5K3BA 4V3CA 3LU1A 4BNJA 3P9QA 1GPAA 1NSYA 3VJKA 5HRAA 3I4LA 3KKKA 3UOAB 2UZ4A 4XRRA 4B7ZA 1R2QA 2C7OA 3DBHB 4JBGA 2I6QA 1Y8QA 1Z5VA 3IE1A 3FOEC 1UT5A 1T24A 4Q3OA 1T6ZA 1Y5RA 2FPRA 3SKXA 1WB4A 1M67A 4TZKA 4D5EA 3OFJA 2HQOA 1UOEA 1QH0A 4W99A 3DXYA 5E6RB 4EFDA 2ZIEA 1YGYA 2A35A 1U8FO 2ONJA 5JROA 4D8UA 3LK7A 4AKIA 4OQLA 4G8JA 3I2HA 2IYPA 3A1UA 1ISSA 1H2YA 1XTQA 5AVWA 4PZZA 1MJ5A 3RRNA 4BO7A 1L8XA 1U2GA 2AG0A 3E9CA 1YBMA 3KX2A 4P34A 3FPJA 4WOJA 1SPBS 2JGAA 3RS4A 1F6DA 4UBJA 4UAUA 2C29D 3K09A 1ZJYA 1LKZA 2GSDA 4J03A 2OYSA 5F1KA 2JD1A 3LF2A 3R7WB 1SXIA 1GUZA 1Q7EA 2NYUA 1XIVA 3F98A 3M4YA 4KDRA 1G2IA 4N5HX 3WHPA 4M83A 1BAPA 4ZC8A 4QPCA 4E5SA 4YXFA 1MT3A 2HA6A 2IX3A 3DSRA 2PGOA 2C0CA 3AVYA 4YJFA 2ZVJA 1DG1G 1G41A 1ZGGA 1I2CA 5CMLA 3HCEA 4P4GA 3C97A 4FSHA 1PUXA 1M66A 1CVIA 2WSIA 2QI9F 5LQAA 4JLKA 4PHCA 4LTMA 4DIBA 4BX2A 4QJ3A 4OXNA 3FD8A 4TWIA 1N3YA 1ZMXA 2QQ0A 3H87A 3QJ5A 3WADA 1GAXA 4WSOA 4YCLA 2A0WA 4TKVA 2XYQA 3H0EA 1ZLYA 5HNKA 2I91A 2WT9A 4JUIA 3VPXA 4A3SA 2I87A 4ZQBA 3NP9A 4KGZA 1AK1A 1EFTA 2ZBQA 3BXFA 1CFJA 1RRVA 1MW9X 3OX2A 4IYJA 4WX2B 2PPLA 4YASA 2IZ6A 4JB2A 3WY9A 3ZE9A 4CKWA 1IN1A 2Q5IA 2BONA 1BS2A 3G9TA 1W93A 1X14A 2FHPA 4G1UC 3IPLA 4GMKA 1N5IA 3ZWYA 1DCTA 2PUFA 3UUWA 4NR0A 1TT5B 2J41A 2HJWA 3WV4A 1KMMA 1L5OA 4U02A 2G5TA 2XQIA 1N2BA 2Z04A 4L22A 2P8JA 1NN5A 2XVZA 2VG8A 4OBWA 2WHXA 1EX1A 3NO4A 4IIDA 2X5KO 4C06A 1VPEA 4UKDA 4PLYA 3WGZA 3QNWA 4PYLA 2BN4A 3MJTA 4LKOA 1YL7A 3GJ5A 1BVYF 4TL8A 1R5JA 4XX0B 4YROA 2WFLA 1C2YA 2O2DA 4MULA 3MINA 4UEQA 2TMDA 1HDGO 4URFA 1ULZA 4QT4A 2JLUA 3HU1A 1XDZA 1DKNA 4UASA 3PZRA 5G0UA 4R54A 3REOA 3R3XA 1HQDA 2BAGA 4WLUA 3SC2B 4A8JC 4ZVQA 3QKUA 1EGQA 3WIDA 1TUBA 4JK3A 2LTAA 1NQXA 2JAUA 7GPBA 1PWEA 2PXXA 3G02A 4B6JA 4FD3A 1T1IA 3BPSA 3HSYA 4CLDA 5LOVF 2WYIA 1H23A 3FOBA 1HNXB 1WKCA 2ZAGA 1XCBA 3LX8A 3WK5A 1T4MA 1QIGA 5KQSA 2AVDA 1GVNB 2VYNA 3BEDA 4M0CA 3V4VB 1FU4A 5CVTA 3RYHA 1FQWA 5BWNA 5KOYA 3GZ4A 4TTIA 3HP1A 3OMXA 2F1JA 3AUKA 1NI5A 5LQJA 3I0MA 3BJEA 3QXJA 4BO3A 4K28A 1WZ2A 4MPRA 4KLZA 1M1UA 2AYYA 5HUHA 3OE5A 4TRRA 1UBFA 1Y33E 2AG1A 2OCDA 1CC1S 4MKIA 3SR0A 4D80A 1EEHA 4EKDA 3FTDA 3TOVA 4FGZA 5HG0A 5LP1A 2QL5A 3GMSA 1MH9A 3FAZA 3LWDA 4MDHA 1JTFA 3MSXA 3NHBA 3SBOA 1NVGA 2CMDA 4P81A 1COWD 3ABSB 1H1DA 5IANA 4Z3DA 3B6ZA 4IEIA 3IUNA 4UUAA 3LCMA 2YNMC 1WHTB 3G8AA 2R44A 4U7HA 2HBRA 5C35A 3EGXB 2RJ3A 3V2UA 1ZBQA 4DLAA 2PLWA 2GXAA 3HN7A 4MR9B 1J1ZA 4QC2A 1RFLA 4QU9A 2GARA 3M33A 4JYCA 1I0LA 5JD3A 1TUGA 4F3NA 4LS3A 5I7VA 5JO0A 4ZVOA 2HU8A 3KOOA 1GCOA 2AI1A 1ISHA 2PCJA 4ND1A 5IAOA 3LQ1A 5JSHA 2OM2A 1H3FA 4JLNA 3BB3A 1B23P 1RZVA 2CNWA 4HDMA 4BNZA 3RJMA 5L45A 3NDRA 2IP1A 3H1PA 4Q3CA 4XGKA 1MU0A 3PC8A 4BLVA 2HI0A 3JWIA 4FDVA 1N57A 5ER6A 1KNQA 5A06A 4C87A 3U19A 1T9GS 1VI6A 5CITA 1KWGA 2I2WA 3WNDA 4RY2A 3CZ5A 2NG1A 5AOAA 1LI5A 3WZMA 4LYAA 2XVMA 1B14A 3H0KA 1KSGA 1LBTA 2B78A 1USKA 3PIDA 1CHNA 2ACWA 1ZBDA 2ZXEA 3H19A 3KYJB 4FYMA 1UKAA 5F64A 3S2GA 4W6QA 2LKCA 2W48A 4NQZA 4OTZA 5EE0A 2CFIA 3VQTA 3WKAA 5EHXA 4EEKA 3SYNA 1A4XA 3DE5X 4FDUA 3I12A 1NW3A 1W75A 1A8SA 2RHRA 1T2NA 3BL5A 5DN6D 1WU7A 3H5LA 4BZQA 1OKKD 2B9EA 3OQHA 4HXGA 5COBA 3ZX5A 3KEQA 4RY8A 1LK5A 721PA 5HYVA 4EA6A 3OTHA 1GYPA 2OV1A 6GPBA 2I29A 1D1TA 1HG1A 1VM6A 3ZV6A 1MNQA 5KPJA 4Q16A 2PBFA 1ZM9A 4NFYA 3EXHA 3I83A 2VJMB 4DA8A 1SZJG 1HTTA 3NR2A 4BLQA 1IY0A 1JXAA 1HK7A 1NF2A 4D2IA 1W5TA 4CL8A 1G17A 1GZSA 2QVXX 3LVRE 3VKFA 3RLFA 3FKSD 1KJ9A 4KWHA 3YASA 5JCPA 2H6EA 4KUEA 3ML1A 1SVWA 4I1IA 4P7FA 4UTPA 2FKNA 2RGDA 1N7IA 3K2QA 3AILA 1ITZA 2OCXA 1QFXA 3MQFA 1I51A 5IJXA 4C3ZA 4JI5B 1U8UA 1YCHA 5FX2A 4M37A 3Q0IA 5AKEA 2OPBA 2ORIA 5EJ9A 4HX5A 5B57C 5EUQB 5JJBA 2VR1A 1Z18A 5D7BA 1OBVA 1OZHA 1US8A 3AFMA 4IH9A 4ER5A 1YS2X 4N5LA 3AY7A 1Z28A 2ECFA 2XNHA 4ZO6A 2UUOA 1DIOB 1ZKMA 2IEIA 5F21A 3TX2A 5JHHB 3D3JA 3K70C 1GG8A 2VDOB 3HYCA 1AUXA 4PAGA 5BUCA 5C32A 3GJ8A 4RGQA 4LJAA 5BSTA 4Q21A 1SXJB 4ZAFA 3WC4A 5IAAA 2FZ4A 1N5OX 1N9KA 3D7KA 1MO3A 1NDQA 4YV7A 3M1YA 1KP3A 1KYQA 1YONA 2JH9A 4O4LA 4OLJA 1TRHA 4RPGA 4URWR 3CY6A 2XB8A 3EGOA 2NVUB 3VUFA 4CI9A 3U1BA 3GF4A 1HRDA 2QN1A 3PUVA 4IOLA 4D8TA 2BFBB 4O33A 3EC2A 2K7FA 3ZHSA 2YHUA 4R1QA 1AKEA 3IV6A 1GT91 4N54A 1N2OA 3U44A 4NS1A 1DIGA 3OJWA 3OVMA 3QX8A 4NJMB 1BCRB 4RC9A 3JALB 4RMHA 5G0TA 3OKPA 4NCNA 4BDTA 2VZLA 4EF6A 1NFRA 1P3JA 1DX9A 2YCLA 4Y2HA 5EGNA 2AMFA 3PQ7A 4RK6A 5A4AA 1PK8A 5FLXA 5BQFA 1WCYA 3QSYA 1XO1A 4DDKA 2CL7X 2ORVA 4CKBB 1T8SA 2XUKA 1G20A 4NMXB 1SC1A 1TNDA 1Y1PA 2PH3A 2R96A 5HCIA 1K3UB 1Z7BA 1QVVA 3GUYA 4CUKA 4FOPA 3HQ4O 1OH5A 1CLEA 4IFTA 2WJJA 3DB2A 1X1QA 3WWOA 3I39X 5CGZA 1T5SA 4R2JA 1A5AB 4JZYA 3OLXA 4IMRA 4ZA2A 3UJNA 3ZGZA 2HBQA 2VJYA 1K4MA 2IWHA 4DLYA 4LYGA 4KXWA 2FHSA 5DVZA 1W29A 5I01A 3U09A 2XXAB 3BZBA 5A3RA 3P9CA 1VHDA 5IEJA 1JHOA 1YR1A 5LA6F 3OJOA 1FVFA 1SU4A 4ZQGA 5GP1A 4DBVO 4FILA 1GG2A 4DUGD 2G3YA 2AN1A 3SEQA 4MW4A 1TOAA 5DNVA 5FPKA 1D1SA 4BVEA 3BUSA 2HTFA 3IP7A 3PC2A 3R23A 4JSYA 3FYUB 1IXYA 5LP6B 4U4AA 1KH1A 1VI2A 2ZREA 5B6JA 1DV2A 4DM7A 4Y2PA 2R47A 1Y63A 2FWNA 4PN7A 3SDZA 5JISA 2B7BA 1LWNA 1EUYA 3FSRA 4QM6A 4KI0A 4EB6A 4EUKA 3BXHA 1A9SA 2QUJA 2QRJA 3GZJA 3H5NA 2ZR8A 3A4NA 3SJUA 4CMCA 4DG9A 1FQKA 1BIFA 1NXPA 1ZUNA 3EGVA 4G25A 3RRYA 1EP1B 3PEEA 1E69A 2IK8A 2Q5JA 2RHBA 3GGDA 1U0RA 3HDYA 4RSMA 3NHRA 2P2NA 3DA8A 1Q0SA 1X87A 4A9AA 2GWRA 1K88A 4DAEA 4PYRA 4UCXA 4NMWA 1B0PA 5BNIA 2FSSA 1Y1LA 3E9YA 6AT1A 3DUWA 4C2TA 3JQFC 3L6CA 1M2VB 4WOKA 3SR4A 9LDBA 2M9MA 3BWCA 1XD9A 1I7SB 3SFVA 4HOYA 4CGZA 1THGA 4MW0A 5AI0A 2Q4OA 1Y98A 2OEPA 4GX0A 4TKLA 2BKUA 2HT6A 3HFRA 2O06A 1X1CA 3HY3A 1LQUA 4NH0A 4ZT4A 4WRRA 3TAHA 4BWGA 2KQUA 1YS1X 4R8SA 1J25A 1RM4A 1O6CA 2C5GA 3IJRA 3RUEA 3VKHA 3B6MA 4ZVKA 3C4VA 4JNKA 3HYRA 2OD7A 1KQNA 4M4SA 4EPVA 1HKUA 2EJUA 3I32A 3VNSA 2W4QA 3BTUA 4IDBA 3ZZNA 1NX6A 1QV9A 1YMUA 2PO7A 2WYWA 3DE6X 3IR6A 3R6TA 3TOZA 1RW4A 3AM1A 3E9QA 3FI9A 3PQDA 3RD5A 3X1YA 5BVGB 3I3OA 2EBFX 3COPA 3OKFA 3QFHA 1WMDA 2W2QA 2PQ0A 3QV1A 3QSGA 4BNYA 1K86A 2ODPA 2P6OA 3HV2A 3K0EA 1E3QA 5JD6A 4I4IA 5IUNC 5LQNA 2C2GA 4RMNA 1CEXA 4TV8A 5I4BA 1MAAA 1JFTA 1CUGA 4QO8A 1C41A 2GZ3A 3PGJA 2CNNA 3GZNB 2RB5A 5HZKA 1I5EA 5C51B 1WQ4A 4BEWA 1JXOA 1HBJA 1X80B 1GPJA 1Z36A 2J6HA 2YL2A 3OE4A 4G41A 3PHCA 4ZDWA 3STUA 5AM3A 5IFKA 1OR8A 2A8YA 3LO5A 3RVLA 2JKVA 4OHVA 4EUSA 1AGXA 3R0XA 1YAHA 4EHNA 5EZYF 3BK7A 2MYNA 2Y1WA 4N12A 4AB1A 2FN7A 3HKBA 1LCIA 3KB1A 1M1NB 4AWXA 2BSXA 2WM9B 4C89A 5LDGA 1BHQ1 1Q7GA 5ENVA 3EPLA 1YJXA 1FS6A 3MTIA 4J4BA 2DETA 4V0SA 3ZU3A 5TMPA 2D4HA 1ZJWA 1I8TA 1T26A 1JB1A 1F0KA 4Q4DA 4ZALA 2ARKA 4FK8A 3DD1A 5HKKD 5BPFA 2VI5A 9MHTA 2REQB 3VTFA 4WXHA 2CLEB 4A0SA 4YBRA 1P2BA 1JHYA 4BMDA 2OM6A 1T8YA 3WLEA 1SFRA 2V5UA 4NHEA 1UPXA 1RJ9A 4XARA 1D04A 3SZ3A 2JGMA 4LN1A 5INTA 4N0DA 3CLRC 1S6YA 5AVUA 3AOEA 3THWB 4Y2UA 3L05A 4PG7A 1SCAA 3O9MA 3RS5A 5L4NA 1SQSA 1QJCA 2DHEA 3H6KA 3TW4A 3LQ4A 2NOAA 2WIFA 5D5QA 4BB0A 2V1UA 4JP5A 2QNBA 1N78A 1EBUA 2DRIA 1I6MA 1DTWB 1XQYA 2V0GA 1JWBB 1KYXA 5B55A 2DZDA 2Q46A 4XVUA 1Q0LA 2C8KA 3L0PA 3KQKA 2I34A 3FKQA 4NNPA 4BAGA 2AJDA 2W37A 4RA9B 2BE7A 1CRPA 4QKQA 4QPNA 1T15A 2AR0A 3K35A 4X0EA 1H2XA 1GLGA 1O94A 3O3CA 3U3KA 1N77A 3OI7A 3A4LA 1EX9A 4TV9B 4YREA 3WB2A 4QPJC 1PJTA 1KZ1A 2AD1A 1HI9A 3ODPA 3QXXA 4LJ9A 4BE7B 4W82A 3NBMA 4D3DA 4F9EA 1LS1A 5B4UA 1ZVKA 2GK3A 1BMTA 3EJWA 3CSUA 3HEBA 3MTAA 2GM9A 3FYTA 4K9KA 1KAGA 3L6OO 3Q12A 1FYWA 3RWBA 4RESA 5K0CA 1ZN2A 1DS6A 2BWJA 3HBAA 3IRVA 4JODA 4KX3A 1DBRA 4EG4A 3RYFB 4JU9A 4XIJA 2I9KA 1UR5A 3MJDA 3NHKA 1EUCA 2P68A 1I33A 1Q77A 4M7PA 3L6EA 4NKRA 2C3MA 4L1KA 2DBVO 5LBUA 8GPBA 1YA6A 3LPAA 1P81A 1SD5A 3G0BA 2ZIZA 4K9MA 4A2QA 3V4FA 3W5JA 5BOSA 4E14A 5FDFA 3DDOA 2L2QA 2H16A 1RNLA 4JC4A 4OFZA 1GR0A 4LSGA 4ZARA 1YR6A 1RLMA 1MVNA 1YE5A 3CIFA 3DULA 2B82A 3UMVA 1TLLA 4PO1A 1MG0A 2CXQA 3MUOA 1DXOA 4OQNA 4D8YA 4MWEA 4LMRA 1JFFA 2MJLA 4W5TA 4OJMX 3QEBZ 5IC4A 4XYLA 4P38A 2ZAOA 2ONYA 3TVTA 1SUCA 3FPSA 4YC7A 1J7JA 4J0FA 1KDRA 3O8QA 3QW2A 4N9WA 3GLHA 1U8XX 4TTRA 1JFVA 2HCFA 3GJ6A 4Q19A 4EQ6B 5DWQA 3RRZA 4MRMB 2GM4A 2ORED 1LLQA 4PLZA 2G1JA 1YB5A 4Q34A 5GJCA 2QUAA 3EFOA 3CNNA 5TQ0B 3W90A 3ZXXA 5KQRA 4YAWA 1YB2A 4KFRA 4QUIA 9ATCA 4GT1A 2CJXA 1QPGA 2RHOA 3LJKA 3C8MA 1NP7A 2GWHA 3UWMA 3T9FA 1FFGA 4A92A 3DT9A 3NOXA 4RL6A 5ITZB 4N47A 3HBLA 3BVPA 5MN4A 3EZXA 5FOSA 1E92A 3O75A 2Z0MA 4RJKA 3RKSA 3I9OA 1KP9A 1C3OB 3ZGLA 3VV2A 5CRIA 4TS4A 5E6SA 4F2GA 3QELA 1LBEA 1PO7A 3GFFA 1DG9A 2RONA 2VZ8A 2J32A 4G9GA 1RI4A 3PDIB 4UBMA 1EFRD 1GEGA 3LY7A 1AUQA 4LNAA 4QDTA 4ZRMA 3IDSA 2G1AA 4M9RA 1G5IA 2RHGB 4PZCA 4QU8A 4CLRB 1JR4A 1V7ZA 2HIGA 2V7GA 1W94A 1PGJA 4CQMB 2IEGA 4ZVUA 3DT8A 4IGKA 1O4VA 4E21A 1LJLA 2G7ZA 1QRTA 4BMZA 1JEQB 1POXA 4KNYA 1NT4A 3LT2A 5ERYA 2GAFA 2AHRA 2PZJA 1ZM2A 3O94A 3QWBA 4KSCA 4BFWA 3FUUA 1PQ4A 3WNBA 3ZE8A 3LDHA 5G4KB 4QGSA 3RYCA 2CCGA 4PSCA 4CQMD 3LLMA 3QBEA 4B2PA 3ZDAA 3KTOA 3W7BA 5C18A 1AG9A 2OGZA 3IRUA 3O4HA 4UU0A 4NF2A 4YP7A 1TD1A 1XHFA 1SUAA 5HEKA 3PHJA 2N47A 1YQGA 4YDRA 1KJWA 1TECE 3FB1A 4TMWA 2JH3A 4RZXA 5AXCA 4GGMX 1A1VA 1KEPA 4NBUA 3TUJC 4IXMA 3UJ6A 2NIPA 2JIDA 1UK8A 1K7YA 1T2EA 3HO6A 3KSUA 4HC4A 4Z1MD 1QF7A 1BCSA 2B4KA 3UW3A 4TRMA 2XOXA 3ZWKA 3JQ7B 4R40A 1BJTA 3Q7PA 2GR9A 5CJPA 5ALGA 5TGTA 5AMXA 4MHOA 3PQ2A 3GN2A 2OAP1 3I9V1 4MQFB 3UHJA 3AJEA 1PBTA 3AI3A 4RWZA 3IIJA 1EDZA 4EHIA 5AM4A 4D43A 2QDKA 4XYGA 1SIOA 1UKZA 4L9RA 4B4DA 2O3TA 4MPDA 2YVQA 1QTNA 4Z3KA 3FHCB 3LPNA 3O3MB 2P41A 1II8B 5BNTA 2RAPA 3R8XA 2XGMA 3OECA 4EFLA 4DMKA 1NATA 2G28A 1X6VA 3PXCX 1HH4A 3ZHZA 4O6VA 1TUEA 3VAZA 1T1RA 2FQXA 4UPDA 4D9JA 4KQGA 4ND6A 2WP8J 3KWFA 3MERA 4YGYA 4ENPA 1GUAA 1O5TA 2EWMA 2WZDA 3KAQA 5AHOA 1PS9A 3FTPA 3WHIA 2QD3A 3FJYA 3O4GA 2YV4A 4JASB 1VLMA 4YLGA 3I1JA 1M33A 2OLEA 4QFDA 3IBTA 1PFUA 3TMAA 3A4IA 4ZVNA 2BFNA 2PCLA 5BMVF 2QLMA 3MAAC 1DJNA 4A27A 2O0LA 4HR7A 1LQTA 3WMWA 3ASUA 3WGUA 1N92A 3EXEB 4B5LA 4DRYA 3EGWA 2ZPTX 3FUTA 4WGFA 5JEDA 4A0QA 3CF2A 1J06A 4LV6A 5B1DA 4P4TA 5CXQA 3R1IA 2IZZA 1UWCA 4ER3A 2GASA 3HH8A 4RGVA 4YRSA 4RL4A 3R7LA 2DFLA 5CNJA 3BD6A 2ZYVX 1UXKA 1R15A 2V54A 2W11A 3L0DA 4IUCS 2DSNA 3H5TA 1HRKA 1T4CB 3H5VA 1JEOA 1L5KA 3ZBTA 4CM9D 2AJLI 4FQ5A 3KKLA 4N0MA 4WLEA 2YZKA 1N3LA 3C3JA 2DPYA 1X39A 3GIDA 4UPVA 4C6TA 5CNKA 3MUNA 4O25A 5CUQA 5HMMA 1XC7A 2EW2A 2PSSA 1P19A 1UPFA 1K7CA 2XOKA 1NW7A 2ZTMA 1G2PA 3L6RA 3MBIA 1ADYA 3KT0A 4MUMA 4WIAA 4WLFA 3ZH9B 5JZ9A 1SHZA 1H42A 2BDUA 2YW2A 1KFKB 2I1WA 3DMYA 3EBLA 3LA8A 1A5ZA 4QHTA 3GFVA 1FFCA 1FTYA 1PLJA 1ZWKA 3K1JA 3RVSA 1TAHA 1UEXC 3N05A 4DOMA 4G85A 1FFEA 1JJFA 1EXNA 1SXGA 1ZA2A 3TPCA 2VHUA 1YDMA 1EVIA 2W71A 4ETWA 3L7OA 2VSYA 3MWDA 4KPUB 1Z17A 1CQIB 1UZLA 2CDAA 4WA8A 2DSTA 2CJPA 2WDZA 4E1VA 3DKIA 1FZQA 2UZIR 1Z47A 1VJTA 1IOZA 1V8OA 3UKOA 1ORHA 3F1KA 4BUZA 1XRPA 1RBQA 2FPGB 4ZYXA 5JDCA 4H1VA 2XNJA 2Y1KA 4YRTA 4HDCA 3BRWD 3ZBUA 1A2BA 1PR9A 2YN0A 4RVUA 4FWTA 4CT5A 1UUFA 4IJMA 5F4BA 2D0PB 3RV3A 3TQHA 2HJVA 5HFJA 1YDWA 4RFLA 4CIAA 5J2TA 4XUCA 5AI8A 4UQPA 1LU9A 1IB0A 1O89A 3K53A 2P0YA 1OGIA 2YHIB 2ZRKA 1ZGBA 4Y9RA 1ZRMA 4OQQA 5KQGA 2UYOA 3GRRA 1OFIA 5G3ZA 3PHIA 1UBRS 1AK9A 1BOFA 1FPMA 1K9VF 3WNQA 1Z08A 1JZQA 3MMSA 1FYXA 2VEDA 3FMPB 3VNQA 1PHPA 2GO1A 4RENA 3RROA 1UZNA 2XADA 3HU2A 3ND7A 1NDHA 3U4MA 2RIRA 1M5RA 3NBFA 4F4JA 2O14A 1D1QA 2V7UA 2XZTA 2W70A 4NQRA 3RFUA 5CD1A 1FDIA 1E94E 4I4TB 2YV3A 5IC5A 1M8GA 1R16A 4P32A 4GPBA 1DMRA 5F52A 3HJRA 4Y0AA 2F67A 1KHHA 2Y1EA 4FDAA 1IY2A 1IDOA 2XIJA 4Q7MB 3VUEA 3WKCA 1QUEA 1YE8A 2OZLA 1PFYA 5CDUA 1Y8AA 2HEIA 4HPWA 2YWBA 1OAKA 4K40A 4HXEB 2ZBDA 4A5OA 1LLDA 4MSUA 5BN5A 3TNFA 3U61B 4KPYA 2Z83A 3PUJA 4G0ZA 4YUWA 1QGYA 3FRHA 3SFZA 2JVJA 3G6WA 1UMCB 1W96A 4MO2A 3A05A 4OQ4A 4D3ZA 1IJEA 3KLMX 2WKWA 4R0VA 1YVDA 4RYLA 1VL8A 2W6QA 2WPNA 3N8NA 1V1MB 2NTNA 3AF1A 1QRSA 4BEVA 3WGGA 2WQ7A 4B46A 5E9QA 1W0KD 4QWWA 3K9HA 3WKEA 4PG4A 4EH1A 4YQYA 3T0GA 1HE1C 4YMIA 1YJ5A 1GT6A 5B2EA 3PEYA 1GGFA 4AJNA 1OJLA 2B61A 2SCUA 1I13A 4KTVE 4J3NA 3WGNA 3ZD6A 2H1SA 1JI0A 2MIIA 4WLNA 4J16A 1QV6A 4Q9DA 4C7MA 4DLBA 3SYTA 2H9YA 2PH5A 1N0VC 1HT1E 1WZNA 3T3GA 4C04A 2H2GA 1ZXXA 3OPYB 5SY6A 2ZRDA 3C14C 3OLYA 2JGFA 4ZPXA 1Y7LA 1SXQA 1L1RA 1Z0UA 3A6FA 2IH5A 1H2BA 1R64A 2C7GA 4GOKA 5FHRA 3WAJA 4FKBA 1H6DA 2IXFA 3R8CA 4LJRA 1UL1X 2PUJA 1DU4A 2ZYRA 2AQIA 2YJNA 4GU5A 4N3CA 5LXTF 3RGGA 4F2PA 4W9MC 4BY9E 2V58A 3SE7A 1ONPA 1JYSA 2VT6A 4B71A 3QITA 1DC5A 3KHKA 3AF3A 4H7DA 2AMLA 3NUQA 3G2QA 1ZGAA 4B7XA 4UUMA 4FD2A 4KQHA 3ZXIA 3GG2A 3CN9A 2OCGA 1Z2PX 2WSBA 4KQMA 4P98A 1U98A 1JS1X 3MJCA 3HVIA 5CTAA 5J40A 4RDXA 1NONA 4YNBA 4DKXA 2ZRFA 1YVPA 2YYZA 3JCZA 4UDXX 3DVQX 4FINA 1T5IA 4MLPA 2BFMA 5LOVB 1CZOA 1YU6A 5JNLA 1AKNA 4G63A 4K86A 3O8RA 2YXLA 2OV3A 5JQGA 1B4DA 1ZG3A 1EGMB 1ZO8A 3I9JA 4ZANA 2X9LA 5DW3A 4PCAA 4HEQA 2P3QA 1C9EA 5J4YA 4PZ9A 1ZYUA 2QGFA 3WO1A 1ZL2A 4LYJA 1W47A 3URKA 4KWCA 5IMSA 1IH8A 2XTZA 3MXOA 1V35A 2PDAA 5DNEA 1VPLA 4JJEA 1XVLA 3AEKA 3BE4A 3DO5A 1FMLA 3MJVA 4ZVLA 5BVHA 4DUZB 1ZSYA 5T4FA 2ODWA 1AS3A 2LCIA 4L8VA 3L7CA 3UPDA 2PV0A 2PYZA 5D01A 1DBSA 2X5JO 2ZBVA 2CZGA 1CY6A 1XB2A 3D2AA 5BW5A 3AUFA 1DAPA 1N2CA 3ZVKA 1XTTA 2C57A 4R2XA 1VTKA 4PLWA 4U6QA 1XLTA 4GMHA 1DKUA 1T6NA 2Q6TA 1ESNA 3ESDA 1QH8A 3LP5A 3RPEA 4CG3A 1KVSA 3H3XA 3WTCA 1OFUX 4GYKA 4ITVA 5ESRA 4KOEC 1YE3A 5BN3B 3SICE 3WA6A 2E2WA 3ESYA 1U6JA 1YFZA 2W43A 4WAUA 5A5GA 1OI3A 1YDGA 1UXIA 5GTDA 1H0KA 4C01A 1Z6ZA 3AF2A 4OJNA 2W6IA 3ZWMA 5K01A 5EE5B 3ABOB 2YXBA 4IG4A 1F1JA 1NJ5A 1RYEA 1D0SA 1KO4A 4EOGA 3BGVA 3QWHA 1ZISA 5ULLA 3PKJA 3ZY5A 3F8TA 3AVOA 3H4MA 2LDXA 4Z7JA 2B7LA 2QJRA 3Q8KA 2DCUA 1UBLS 3F6SA 3P0EA 4XFDA 4AJLA 3Q11A 3OPVA 1MB2A 3UQZA 2V9ZA 2R7NA 1M1ZA 3UWOA 2EBUA 4YAFA 4BNLA 1UP4A 5ALJA 1ONOA 4A2WA 2EJWA 4WFIA 3KT8A 3MT0A 3PFGA 1WY5A 1O0SA 4BQNA 1P7VA 1I6KA 1CXZA 1N9GB 1MJGA 1I30A 2QBYB 5CU7A 1GRVA 3A1SA 3EY4A 2I2CA 1KDZA 4QUAA 5LQSA 2V3CC 3IBFA 2FSUA 3UYLA 3K0BA 4WINA 4KSBA 3UXMA 4B7AA 2QLNA 3ZI7A 1TJNA 3HL0A 1QZXA 5F3WB 5JPIA 3BH7A 5T3YA 3CZMA 4Q4HA 1PR5A 2Z1DA 4KIUA 4EMBA 2HY7A 2OZEA 4PZLA 3N53A 3PDWA 1R0YA 2JAQA 3N6RA 3FR8A 5JDIA 4X41A 1KVQA 4FBLA 2YWDA 3LI2A 5BT8A 3PNBA 2ZXFA 4QPPA 4DZZA 2ANBA 2WF9A 2WHQA 4FGJA 1CR6A 3Q9NA 1OA0A 2ZJ4A 3P71T 4HH0A 4EAAA 1H5QA 3RRFA 4JJZA 4ZV7A 1L3BA 3IGFA 3T54A 3QNMA 2NXJA 3BEOA 4GI3A 4J7UA 1WTCA 5K8CA 2VOEA 1G21B 4EYEA 1X1BA 4ZHSA 1EXWA 2QTZA 4U7TB 1V2HE 1FRFS 3PGMA 3K8YA 4G84A 4BFSA 1RCUA 1CPYA 4UEKA 4YO8A 4CM4A 4JMPA 4L50A 1H2HA 1SOUA 2DQSA 2QJTA 2WD9A 1BGXT 1NVXQ 2OGWA 1S4MA 2QB5A 4GYYA 4OGWA 1GPMA 1KDYA 1F51E 3OZSA 1SOVA 3U48A 3OF5A 4N41A 5C8YF 1LI7A 3ES9A 1ZMTA 3QYPA 1O95A 4QQRA 1JZSA 4I99A 3L4KA 1LBSA 2OVFA 1M34B 2PX5A 5AW3A 1GZ3A 1OU4A 1RXUA 4JLSA 1DO2A 4M2LA 2JEYA 2R84A 5B7GA 5AP9A 4F4FA 1JAHA 1AHIA 1H05A 4FQ8A 4IYRA 3T9DA 4G4JA 3AFGA 3ZHYA 2FF7A 1LVUA 1Z8NA 1E2NA 1F3OA 5C4GB 1Q92A 4EFKA 5H9VA 2D1QA 5DMHA 3NBQA 5AK5A 4AWAA 3DEZA 3DMTA 2LDBA 2O20A 4C0XA 2ZRGA 3S0JA 2PZFA 2WV7A 2WWRA 4J0JA 5CB4B 1MCZA 4Z4FA 2ONCA 3HXKA 1GY8A 3Q7SA 5IH3A 3BQ9A 4ZOLA 4V0OA 1A7KA 1MTZA 3JU3A 3CZAA 3P0RA 2E85A 2PX6A 1CNFA 1NKSA 1Z0FA 3L7KA 4OQDA 1V5EA 2Q0HA 2XLBA 5CDGA 2ERCA 1FP6A 1W85A 4F93B 5EI5A 1A9TA 3QVLA 3AUAA 2NXCA 5BV7A 2AJCA 1EEXB 2HPHA 2ID8A 2VK2A 1MPTA 2YOFA 1PJLA 4I50A 4A6XA 2FEOA 1UM9A 3DBOB 4Q3KA 1F48A 4MROA 2LD4A 3WWZA 2IHVA 4R0MA 1P9OA 2W2NA 4FHEA 4OOFA 3D7NA 4H7PA 3AEUA 1T8TA 2X8JA 4RD2A 3ROMA 4OI2A 1XV5A 1AB5A 2JL1A 4FKZA 2PX8A 4FGLA 1N25A 3GCZA 3GLVA 3SYRA 4JLVA 1GA6A 5IVDA 3NWPA 2WWFA 1ZXBA 4JBLA 2HF7A 1O58A 1WIWA 3FSGA 1VLJA 1HZZA 4N0EA 1RCTE 1UPTA 3C3XA 1BWRA 3CYFA 3Q3CA 2R25B 2V4UA 2JGEA 4P53A 3OQOA 3COJA 4MIEA 2EKPA 1V43A 2I7DA 1WW3A 1YCFA 3DFIA 3BWXA 4PQFA 2V6BA 1VJ1A 1F6WA 2WD8A 2F1IA 4CIDA 4D9MA 3KTDA 4ZT7A 4L95C 4GE3A 4IIVA 1NC3A 7AT1A 4NABA 4TLDA 4P4LA 1C1YA 2WILA 1E2DA 2JFHA 4ZZ3A 1W36B 3TRDA 3KR0A 1ORIA 5EKSA 5ERGB 1M2OB 1THMA 2E4WA 4F2DA 5KTOA 4K03A 3ROXA 3GA7A 2W83A 2H5IA 4CIXA 4DQXA 4JXXA 2Q4DA 3G88A 1D6MA 1MZPA 1DC8A 4TT3D 3ANYB 3W9SA 3WGOA 1U7TA 2G77B 4LYHA 7MHTA 1W36D 1W87A 1RXEA 3OHSX 4JBXA 3CISA 1DBQA 1SA0B 1AURA 1KMHA 1AHHA 1BN7A 3IUJA 3OJEA 3SJAA 1A9XA 3JVEA 2WRZA 2PR7A 3OLVA 1X8KA 1M2HA 2HMAA 4I4LA 4E70A 4WFQA 1PJ3A 2V4ZA 2AMVA 1LC0A 1DT5A 3IMFA 2QVLA 1HUQA 3U37A 2O8BB 3NIWA 2F2TA 2SKEA 3ZDRA 3RFTA 5JCXA 2INGX 3O4FA 4M0FA 3REQB 4JI1B 3WE7A 1AC5A 4RJTA 1HLFA 3DLAA 4OJKA 2V0CA 3S40A 1Y7TA 1VE9A 3BL8A 4CHTA 3IHTA 5KOJA 1XN1A 2G7MC 3IPCA 4OV6B 4HGRA 1Z7GA 5TS2A 1NJ1A 2G6BA 2ID9A 3R5SA 4LDQA 5IBQA 1EGHA 4GUAA 2BCGY 3DLCA 3V2IA 1HLGA 3FOCA 2CGEA 2CLFB 2I66A 3IELA 4RKEA 2G88A 4YQEA 1WETA 2RBEA 3GFRA 1A69A 4IUDS 1KBZA 3BD7A 4UHFA 4AZ0B 4MWDA 1ADJA 1CW2B 1PJSA 4NFLA 5DHSA 4UDOA 5EP3A 5KTNA 1BROA 1JMVA 4MA0A 4U7DA 1XJQA 1WLSA 2OBFA 3B9QA 5DBGA 3NDBB 3AINA 3VHQA 4H0CA 5ALHA 3HZHA 4PAMA 3GLKA 1W44A 5F12A 4ILEA 4QSMA 4AI6A 1S3IA 4P92A 1E3EA 3SJCA 5I47A 3QXGA 1L7NA 4JL6A 5EZYB 1UBNA 3NT2A 3VJRA 2P5TB 1KTIA 4YCBA 2AF4C 3UAGA 1JNXX 3CG4A 4O4HB 1KARA 4N6NA 5J2UF 2HLHA 3IP8A 1KOFA 4Q4CA 4FMBB 5EWMB 1IQPA 1WDKA 2VF7A 1R4AA 1VE6A 5B37A 3E48A 4ZK6A 5HKOA 3L9XA 1BU5A 4RHCA 4BB9A 1IE3A 2R1TA 4JJIA 3CR7A 3HVKA 3KJQA 1TADA 1LF5A 2BR3A 3D7MA 4P3NA 3AETB 3IQHX 3KKZA 3I64A 4NCAA 2I8LA 5TQ2B 2BMWA 3UOGA 2FH5B 1ZIYA 1JIQA 1MXHA 2JGIA 2P1DA 3GPLA 3VNVA 4ZD6A 1YHNA 5HXAA 4UUPA 3WYGA 1EM6A 3C3YA 4C3OB 3EK2A 3K96A 2PWYA 4GX2A 4CM8B 4DZRA 3DWIA 2K4MA 4RHUA 5G3YA 2NXEA 2ZVQX 3IIMA 1CQPA 1YQQA 4DIOA 3CZ4A 3F1LA 1SVKA 1D4ZA 3D0OA 4QE3A 2O57A 3NWJA 4ENUA 4UUBA 1N8KA 2EFCB 4CNBA 3QA3E 2HJ9A 1SY7A 2FZVA 4L4ZA 1V25A 2H4WA 4OHFA 1MFZA 5EJ4A 4D0SA 2B3DA 3BH0A 3C1OA 3INNA 1HE2A 3GEPA 4KAJA 4KFSA 5FWDA 1V26A 2ZIAA 2VHZA 1X7YB 2EV9A 2UYYA 1VSBA 4V0RA 1G6HA 4MPTA 4QSHA 2QLLA 1DX4A 3GV0A 3CKMA 3ZDZB 3EEOA 3MEQA 2CLOB 3ZNQA 1G3RA 2Q3LA 4TVOA 5KOIA 3E5HA 5KYVA 2NZWA 4YJ2A 4E5YA 4KXMA 1YAJA 4U2EA 4G89A 4QULA 5CX4A 4ND8A 4QQFA 3IQXA 2QQ5A 3K0FA 3NX4A 1D0VA 2QZ4A 4PCLA 2NYRA 3RK0A 4ADSG 2UUPA 5JXWA 2QR5A 1GAWA 1MFPA 4H15A 1BRTA 4Y0NA 3VXKA 4C43A 3BILA 3GJ0A 4DS3A 1TC1A 3TL6A 3ORFA 2H18A 3RS3A 2VP9A 3TRJA 1ZVVA 4Z49A 3EUAA 3E0QA 2Q4EA 1GZ6A 2A5LA 3EA0A 4M1WA 3SSOA 2OWDA 4HB3A 4YYEA 3C5HA 5BSEA 5CA0F 1VG8A 4FGUA 3ZG6A 4GKBA 1H4SA 4QRIA 4YB8A 3EA4A 1ISRA 2C7RA 3A1WA 1UJ2A 1VB5A 2RE8A 1E1RA 2QZZA 4R2HA 1USGA 2Q3EA 3QVSA 4WVLA 2ZJ2A 5THQA 3RVJA 5DNUA 5EJ6A 3T5AA 1JQEA 1JV2B 3MFYA 4IDDA 4OMDA 3E4DA 4A6DA 5AVOA 4G1MB 1OWLA 3L1IA 1EA5A 1Z0DA 2IE0A 3B8HA 2QQEA 2R1UA 3R0ZA 4TMTA 2IYSA 3EIOA 2QAGC 4IDOA 4N01A 3THRA 2AW3A 2VSQA 1QGED 3GEEA 2VKTA 3WIOA 1KZYC 4J0CA 4HYTA 2X0NA 1UBHS 1YC2A 4UNNA 4B1FA 4FI3C 3DVAB 5CNIA 4DMLA 5B2ZA 2YMPA 1E9DA 5AHXA 3H9EO 4EI2A 2IY7A 2CWDA 3DF7A 3MTGA 3DE2X 2H54A 2PRIA 4KMRA 3AKZA 1WULS 4RKQA 3A6EA 3UGTA 5AM0A 4HRVA 5KQMA 2ZXUA 3CT4A 4BV3A 3PPIA 5EN4A 3OOYA 4R1UA 4G0NA 2CDCA 2BEUA 2FWMX 4MYDA 4ENVA 3P2KA 4GPTA 3QY0A 4G5OA 1W1IA 1ZM4A 1GV1A 4GZ3A 4N49A 1GILA 1VG9B 4K9LA 4EWLA 1A4RA 3OEEA 3WRVA 1UWKA 2D1RA 2Z2XA 4D0GA 4BN4A 3V1UA 2BY4A 3A2NA 1XKTA 4FYXA 2CHQA 3EARA 2GA9A 3WYNA 3T3DA 1MUUA 2NYVA 1B2RA 5L3RA 1DRKA 1U2TA 1XLVA 2DFVA 3UOWA 3BIFA 4EHAA 3T1TA 1N2HA 1O96A 3FMIA 3TR0A 3UF0A 5BQ3A 5AW6A 2ZB7A 3J80A 3R9XB 1G4AE 1N2JA 1ZMBA 2PZLA 4LZLA 1ICEA 4LCBA 3FOAA 1A3CA 1L4YA 1KK0A 3CF4A 3LLCA 1CQJA 1E1QA 1N6IA 1S02A 1V45E 1AOXA 1YRLA 2ZYTX 3L7LA 4ARVA 1KVRA 2A9RA 3RTEA 4MR8A 2QYSA 1EWYA 4QOEA 2HR1A 2JFGA 2HV8A 4JU8A 2Q6KA 2PQ2A 1FW6A 3T34A 2O8EA 3IV9A 2QG9A 4RH3A 2P90A 2P9CA 1LDEA 2ZVDA 1GGKA 3C5VA 3LGXA 4GNRA 5CT9A 4ZAYA 3SSMA 4DQDA 3W6PA 1B16A 1SC4A 2AZXA 4PHGA 3VNAA 3BZWA 1W73A 2IOFA 4O4LF 5FBLB 1Y89A 3TW6A 4YCJA 2L0XA 2PGAA 2QSZA 4DLUA 1TFUA 2FMFA 2GFHA 3BIWA 4XUEA 5FTWA 1GUFA 3RUHA 1VQ1A 3SHTA 1Y5MA 4TLEA 3SPXA 3CTPA 2RSLA 5F5NA 3AJ9A 3O4RA 3SFTA 4BP9A 3CX3A 3OFND 4MAMA 4U2DA 1U81A 2AGVA 2IV2X 3VU1A 2AN3A 3KPYA 3SZLA 2UXDB 2P9HA 3AERB 4Y2RA 4MVJA 4PYMA 2YZ7A 1I1QB 4I1UA 2QLTA 2QP3A 2O7VA 4EI7A 1QANA 2O2CA 2TYSB 1T5HX 1V11B 1UT6A 4KU4A 2AUMA 2BF7A 5FOXA 5JSFA 1P7ZA 6NULA 1BS1A 1OXUA 2EZTA 3OZWA 5DHRA 1FDOA 2X2FA 4AG3A 5GIOE 4DNPA 4F3KA 4R01A 4C29A 3PWTA 1IHOA 2X0DA 4KXQA 5KJCA 2O8DA 4E5MA 1OV6A 4N76A 1VPTA 4FZ3A 5L6MB 5LQDA 4LXUA 3MWEA 4OQFA 3TTYA 1F5SA 4KVAA 1HM5A 3HPRA 4B74A 3FBTA 3O47A 1EPUA 2O2GA 2XQGA 1KI6A 1E7MA 2ZLBA 4HJRA 3U81A 4AVYA 1E9SA 1Q1EA 3UN1A 4DMUB 1G63A 1QFSA 2FXIA 1X38A 1YI1A 3TLZA 3WQBA 1JU4A 4BFZA 2V6FA 2POQX 4F11A 2E0IA 1E1CA 4OHPA 1X7WB 3NB0A 3KWMA 4Q12A 3PLNA 4CL0A 4OLAA 4XQ0A 1R66A 3QVUA 4HXYA 2XA9A 2R8PA 3BICA 1YMVA 3CW8X 1QCCA 1T9HA 4KN8A 4XPIA 3VSBA 4K88A 4AJ2A 4F38A 2XCSB 2BC9A 4XB2A 3GLIA 5CT5A 2HU2A 4R68A 2Z1MA 4XYBA 2BTQB 4RIGA 3GRKA 4Y6LA 5G02A 3BB1A 4KBGA 3WIBA 2GN4A 4YUXA 5A4DA 2QKYA 5F9HA 4BBJA 2VP5A 3I3SR 3JYQA 1Q50A 2DQ4A 3VR6A 5KTMA 3JZFA 2ZSUA 1RHRA 2IYLD 4EYOA 2ZE5A 1JA1A 2G9RA 1GRRA 4YT2A 1W52X 3H11B 3PG5A 3MXTA 1BGVA 4WERA 3IPAA 1XLWA 4XVRA 4PSUA 2QE7A 5JWHA 4J0QA 1KA9H 4B0PA 4EARA 1C7JA 4DR5B 4H0NA 3D2BA 1RZRA 2B8WA 1MAWA 5AKIA 1W9MA 5B53A 4IRXA 3WLIA 5J4HA 2R1VB 3E0XA 1SBHA 1H93A 1U1EA 1DQYA 1I4EB 1WW8A 2VL7A 3F2VA 3ITEA 4FTWA 4K2HA 4ZTBA 5HMLA 4CUZA 3R6LA 5ICEA 2HQ1A 2ZJAA 2IIVA 4DTIA 4FS3A 3EGCA 1C30B 2Z2JA 1D9XA 1RP7A 1CR1A 4N7RA 2HSGA 1JKFA 2CCKA 2YZ2A 4Q00A 1I1HA 2A14A 2VN8A 3NXSA 2HHJA 3N9IA 1DV1A 1P75A 2FE1A 2I4OA 3LL4A 1NYTA 3JD3A 4WOBA 4W5OA 3PX7A 3GJZA 4C0BA 2YNMD 4BE4A 1EFPA 4OQZA 1BFKA 2R97A 1ENOA 1H8EA 1VLLA 3EEQA 2WWWA 2JLZA 3LDAA 1L5VA 1XXLA 2G5GX 2G8LA 1FFHA 3CXRA 2Y92A 4N39A 2VDMB 4JLPA 4ARZB 1QO9A 2VZ0A 4TV8F 3U1VA 2D5BA 1E2PA 3RHZA 4C08A 1EUZA 3WLFA 1T4DA 3MCWA 1G66A 1KFJB 2ZBUA 3DFZA 3SJBA 4DLNA 3A2MA 3PB3A 3TKYA 4UBNA 2C7PA 5F98A 1QG0A 2Z2KA 3UG7A 3WL8A 1DZIA 1EJ6A 3U7IA 2D3WA 4TLCA 1U0SY 2FOIA 3V2GA 2CJWB 5GGYA 3TIIA 1OHHA 4N6OA 3BAZA 1O3YA 3L79A 5L7YA 1NMXA 3QVTA 4J7AA 1KPHA 4KYUA 3Q3EA 5SZKB 3VO9A 1U99A 2X8LA 3W5UA 2X5OA 4KN9S 2V6GA 3Q0EA 1P73A 4K8RB 4QUHA 4QXMA 2W8BA 5IX8A 3JD4A 121PA 2E4UA 3PPWA 1S3FA 4M6WA 2BGIA 4N3NA 1CUSA 4NH4A 4OK3A 2NSYA 1NPTO 3ILYA 1UJNA 4IHJA 5I7SA 5A3VA 3KOZA 2P2LA 3MB5A 1BJRE 4Y9SA 4RM3A 3S44A 2A0KA 3N0VA 3CRVA 1FNCA 1JF8A 3N70A 4EZBA 4WCFA 4L0CA 2PMWB 4J94A 4BCDA 2ZBEA 2QRLA 5DJ5A 4HTFA 1X7ZB 4PC7A 1LSUA 2NZXA 3HZOA 2XBMA 3HR4A 3HCFA 1B3BA 4TS1A 1X9HA 4EYSA 1JDVA 2VNSA 1N1MA 4AJIA 3HA3A 5JCOC 3EIXA 3N8HA 4X92A 1L7XA 1TK2A 5EZ6B 4O3FA 2AXQA 2JRCA 3ND5A 5CM9C 3TQIA 5J43A 1E1YA 4HDRB 3LSTA 4KL8S 4ME6A 3ZW9A 1Y4ZA 3I6QA 2HXGA 5DM60 1ML4A 5DLEA 2JFFA 1YVEI 2CK3A 1W4RA 2D1SA 3RVPA 3VH2A 1CZNA 4JI6B 4YPOA 4AN1A 5FOTA 3PIIA 3K70B 1BS9A 2OBNA 3AW9A 4FLEA 4U8GA 5K51A 5LZ7A 3PX3A 3O03A 2OBXA 3ZV3A 1IG0A 4G86A 3AVXA 3BIXA 1PX2A 1QHSA 1WXEA 3G7NA 3ZDFA 2ZDQA 1SQ5A 4TL7A 1L5HA 4K1LA 5D85A 3I6MA 2HQBA 4D9KA 2ZT5A 2B83A 1HQYE 3ZV5A 4C6SA 3FBWA 4FGWA 2CJFA 1IATA 1WABA 2DTXA 2EL7A 3H16A 4ND5A 1TM5E 2EF0A 5CFLA 4PW0A 3VR4H 4RUKA 3G1WA 1GPUA 4ZAWA 4P6VF 3PICA 4L3WA 1Z4QA 2D8AA 4FCCA 4LRTB 3SIWA 3R6WA 2PX4A 5JSZB 5DGHA 3R3ZA 1VLQA 2C3PA 3TG8A 2OZVA 2PL9A 3LM8A 5E2IA 3KNZA 4BJ1A 4MGEA 4UOZA 4IDAA 4GIBA 3MB8A 5JRDS 1NYQA 2G1PA 4FFOA 4I4CA 4KQ9A 1ADGA 2NU8A 1AA6A 4XGIA 4K6KA 3VR0A 1GKYA 1R0BA 4C30A 3PUHA 1PR6A 1TZ2A 1MEOA 4U1RA 1UFQA 2IYXA 1T2DA 2EAUA 3FTQA 3G2IA 3GGSA 4JWTA 3HDTA 4M89A 4MUKA 2IZ5A 3WGLA 4BTVA 1KEEB 3UPUA 2WY2D 4PHFA 3L7IA 4KE7A 4H77A 2GK4A 2R65A 3DG9A 2AOXA 3ROPA 4ZRDA 3FPLA 1GTJ1 1WA5A 2JHPA 2OBBA 3W7VA 2C99A 2Q2QA 1A5TA 1EWRA 1ODSA 2X1HA 4RLFA 4F21A 4W5JA 6ADHA 3OJXA 1P1JA 3LPMA 3N7UA 4GOXA 4GO1A 1M8PA 3RTDA 3FOFC 2CVHA 4TKUA 4MGKR 1QX3A 5EUCA 5K6AC 3CZQA 2VT3A 4TSKA 3ETEA 5FUVA 3W8FA 2O8CA 1NJ2A 5JQWA 1UC9A 3CE9A 4TVKA 4UUNA 3P4YA 5IUKC 4YCDA 3E35A 3L46A 1M34E 2VUTA 2O0JA 1G1MA 3RWMB 1ZK1A 2V6JA 2XYHA 3NQ41 4YALA 1I3OA 3B5JA 2X1MA 5ITSA 3THXA 4G0VA 1TX4B 2V6IA 3KZ1E 4OP2A 5FT9A 1SEVA 4ZHQA 4OATA 1G1AA 2XEDA 3C5WP 2ST1A 2Z5VA 3DE1X 5CLLA 4Y7CA 3E2MA 2JK1A 2RARA 3FYHA 4YDHB 1DQZA 1USUA 2VPQA 3D6VA 1DAEA 2WK1A 3CWCA 3ER6A 2DTDA 3IUQA 1LPAB 3F8WA 3B12A 2X8WA 1P2DA 4LXGA 2QZSA 2XE8A 2X86A 1JEYA 1YZFA 4LW8A 3VTAA 3CE6A 2H31A 3DW1X 2GN0A 4MKRA 2J9FA 4O2BB 2VHCA 1Z2EA 1CR2A 1OOEA 1W19A 2QUBA 2SICE 2J45A 4GXRA 3AG6A 4DXHA 5KQPA 5HWSA 5CFMA 2XDQA 5DM4A 2WSMA 2P5YA 4RHYA 5FBWB 1UFKA 4G5RA 4JVNA 4LK3A 1Q0QA 3DL2A 1P0FA 4MUXA 2ZJOA 3OU6A 4WY2A 3M70A 3IBGA 5IJAA 1FVXA 3EA5A 4HQKA 4A5SA 5G1PA 3N2GA 4XFJA 1HNZB 3V7NA 1FUUA 4ONEA 3OQ6A 1A71A 2HU7A 1UBMS 4RVSA 2DY0A 2H1CA 2XTNA 4FOLA 4PGFA 5TMDA 1G2OA 3AM3A 4AKSA 3LC1O 5B3AA 3EJ6A 4EEZA 4GKKB 2EZ8A 4QQ8A