4AP5A

Crystal structure of human pofut2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
389
structure length
389
Chain Sequence
SRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 2
publication title Structure of Human Pofut2: Insights Into Thrombospondin Type 1 Repeat Fold and O-Fucosylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 389
sequence length 389
chains with identical sequence B
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ap5A02
2HLHA 2OCXA 2HHCA 4AP5A 3ZY3A 4AP6A 3SIXA 3ZY5A 3ZY6A 3ZY4A 3ZY2A 2DE0X 3SIWA
chains in the Genus database with same CATH superfamily
3LT0A 1EWVA 5AM1A 1KZYC 5T64A 2JDIA 5JYBA 4IS2A 1GNPA 2OFPA 2ZG6A 1N6LA 4J0FA 3O7MA 4EQ6B 2BH9A 4OQNA 1M3SA 1Z7YA 1QHEA 3JALB 1XEWX 3KQPA 3ZVNA 1T36A 3RROA 2RK4A 3VPBA 1W47A 5CFLA 2IE0A 3BERA 1O6GA 1ULHA 1JQKA 1QH8A 4IMPA 5J1TB 5FOVA 4TL8A 2B2NA 2WW8A 3B1FA 4XVHA 3RARA 2IS1A 5FTMA 3F7NA 2GEKA 4O1HA 3VOAA 3SLKA 4YPOA 5IXSA 3WP0A 4RABA 4AJIA 2OZEA 3L0ZA 1Z2PX 3F5QA 3PRHA 4D4LA 1SELA 3LOUA 1M2WA 2ZWIA 3O93A 2MCFA 3IAFA 1ISHA 1VLHA 2G7MC 2WD7A 5K0GA 4P0QB 4P3OA 4UBMA 3OQVA 1T5TA 2NXWA 3WLHA 1M2HA 3ACDA 5JSYA 1MTZA 4PPQA 4LVOA 3F6BX 3ZY2A 3ONVA 2NUTA 4BY9E 1VYTA 3M6VA 4HEQA 3WO0A 3WDKA 1E7MA 1G5RA 2G25A 3WIUA 4DVJA 1SZCA 5CCDA 1AY0A 3AI2A 3T7RA 5AI8A 5TT0A 5BXYA 5A4DA 4JYCA 3HNRA 2OCKA 1JKJB 1KF0A 2QMUA 1OTYA 3NXKA 5BPHA 5C7YA 4K1LA 1MIHA 2VJCA 3IJRA 2O4UX 4NMLA 4QQ8A 4R9NA 3PUHA 4UMFA 1RLTA 4HXYA 2OUKA 4XVRA 4B83A 4KEAA 5CD1A 4URWR 3B5JA 2C5LA 4LF6B 3D6VA 3C3YA 2ZRAA 3I52A 4P4UA 1ECGA 4WPGA 1G8HA 4C6TB 1YFJA 4C2AA 4KU4A 4ZVNA 2FPMA 1EK0A 4KRXA 1E3WB 3EFEA 3HCEA 3TI9A 3G2LA 1E1RD 1VIAA 4MGKR 2JH8A 2PJZA 1WAMA 3D1VA 4K6OA 4MVYA 4KMMA 1PZHA 2GVZC 5TPWB 1AKUA 1G9TA 2IHJA 3NDJA 3NIFB 1APBA 1Z82A 2HK9A 1US8A 3FWPA 5L6LB 1VHJA 4G2TA 1GPH1 4I5FA 5FH9A 1D4OA 3KX2A 4IJKA 1WPQA 1E7QA 3CH6A 4LNAA 4DQVA 4YCMA 2QI9F 4HNAB 2FW1A 4KV9A 5JMPA 3VC3A 4R0NA 5GONF 2ZSBA 1M1ZA 4KR3A 2BSXA 2QXYA 3WK8A 1F38A 4RA6B 1IBCA 3GZNA 4OUDA 3SEAA 3O9MA 5AOVA 2OV8A 3CX3A 3JWGA 4ZAGA 4BASA 4DNFA 5K8JB 2HOQA 3WQHA 5KTYA 5I7AA 4JVSB 1MRSA 4FZ5A 1AHPA 5FJIA 4G5XA 1ZRNA 1GRNA 2C4HA 1E1NA 2YFKA 3ASVA 2IYUA 3KXDA 3OZRA 4IQ4A 4X94A 5FNVA 4B8YA 4C0BA 5L3SB 1XTKA 3GV0A 3C3AA 4BO1A 2QEQA 2Q7OE 1TEVA 2CNWD 2EYQA 2WK1A 4GKBA 2ACKA 2X1VA 1HI9A 1CVIA 2Q07A 1N0UA 4FFPA 4P3KA 3U2QA 4EI9A 3FF1A 3F8SA 4L8YA 4A73A 3VR5H 4ACBA 4DS3A 5BSWA 1P77A 2O23A 3U49A 1AK1A 1BMDA 1PGPA 2IIVA 3KZKA 3KQTA 3GAZA 4M8IA 4Q93A 4TMWA 2Q5IA 4GVLA 1ZD9A 2DRIA 4LYDA 4WBSA 1YI8A 6NULA 1ZHFA 5KKAA 1F9EA 1HEUA 2WM8A 3ZV7A 5KHOC 2QMEA 4DB2A 3NRJA 4PX3A 1DV1A 1A1SA 5IBRA 1WOYA 4PZYA 1U2GA 2XUHA 4Y9DA 1GRQA 3BB4A 4MW2A 2VHWA 3EY4A 4EEZA 2LCFA 3O4JA 4IJWA 5IMBA 1ISGA 3B3AA 4DC9A 4ESHA 5FWNA 4FFBB 1DX9A 5M04A 1Q2XA 3W8RA 1OY1A 4CKZA 5T4HA 3V8RA 4Z49A 1YKFA 2X2PA 2QNIA 4EWLA 5E7QA 3CA8A 1UPFA 1F3OA 2A3RA 4E3ZA 3I5AA 3Q6MA 1E2UA 1TEXA 3DMNA 1YB4A 3GVCA 4IDQA 5DTQA 3T7SA 3AUYA 4YMGA 1YGPA 3B89A 4EAQA 2RHJA 3SF8B 3LNCA 3OVMA 3PWTA 4LZPA 4P93A 4NBUA 3LVRE 3AGQA 1ZI9A 3TX2A 2ZROA 4RZSA 3KE8A 4B2IA 1NY5A 2J67A 3SP1A 4JBLA 4LJYA 2WILA 4KN9S 5JNWA 4AF6A 1MAHA 4WOCA 5K3EA 4Q4AB 1F17A 2I2WA 3MWDB 2YC2C 4HCJA 1U2GC 1GWNA 2CCKA 3BMOB 5JISA 2GFHA 2EG9A 1QH9A 5KYKA 3A4IA 2Z5GA 2NXEA 1WZUA 1QGUB 4N9QA 4IJ5A 1QDLB 1T5OA 2HZBA 4PRYA 2NU8B 3IQXA 1QM5A 2IEAA 4CMEA 5H9WA 1N6KA 2BRUA 3K6RA 3S28A 3U37A 4P53A 1AK2A 4WOPA 4G85A 1F51E 1HQYE 5EKDA 2P0EA 2Z95A 3ZWWA 1NYQA 4OB6A 1Y3FE 3RS7A 4DR4B 4BAGA 3GG9A 3RIXA 2WNSA 4EKNB 1EZZA 2NTVA 3RSHA 1QK5A 1GG8A 1ISJA 2PLAA 2HGZA 4YCBA 2B1JA 2WJYA 5CEFA 5I7FA 4S05A 1GPAA 2Q3LA 3ESBA 1E9SA 3I9MA 4BMXA 3JQFA 5BY2A 2LD4A 5HFNA 3QE0A 1Z08A 2P4SA 1SAYA 3LUAA 4NBVA 2QN7A 4EDHA 1IQRA 1VJ5A 1RP7A 3EA5A 3I72A 4FHCA 3JPWA 4P3XA 3UXYA 1XWFA 2Z2YA 4NAVA 3SPXA 4BVAA 5JAZA 3TNJA 4DMRA 3LBNA 2AOUB 4BMVA 1PR2A 4K9SA 2SNIE 2YNMD 4U0JA 4G3XA 5LU8A 3GLFB 2P27A 1EM6A 1KR5A 2BRUC 1ZEJA 1ZZGA 2AYXA 2TSYB 1DEXA 4L9RA 2J3KA 4DA6A 3E05A 1Z28A 2ERXA 1DC4A 4D3FA 4I9GA 3HSKA 2DWOA 2JGMA 4ROTA 4DSNA 1FSSA 1PSDA 2NXJA 3AVTA 4KLNA 4IDBA 3G7SA 3GR6A 2GM4A 4D0RA 2G17A 1PSZA 4V0KA 3Q3EA 1QB8A 2QX8A 3ZCUA 1BFDA 2D5AA 2EFJA 3L1HA 4DMGA 4F12A 2WKRA 4X8MA 2IWRA 4XEUA 3JQFC 4RX1A 3U62A 4F38A 3ND8A 1ZOIA 1WXQA 1KJIA 3PUYA 1RJFA 3QYFA 1NUTA 3G9TA 4BE7B 3N7UA 1ZJ6A 3LQFA 1WE2A 4CE6A 2EBHX 3VHXA 2Z3ZA 1FDRA 3RUAA 1XCOA 3NTUA 1IWPB 2OM6A 2OCIA 3Q11A 4P34A 2I6GA 1ZR4A 4KNYA 4L5AA 3L1JA 4CETA 2PR2A 2Z6VA 3RU7A 1SUBA 3DE5X 4FJ1A 1JQAA 4MO2A 2NWQA 3LECA 3TXXA 4KWEA 3IALA 5JSUA 1J7KA 3HWX1 1T0BA 5TSDA 3RE1A 1KQFA 2QRJA 1W30A 2B4QA 3K1TA 1SUAA 5C4GB 6PFKA 1CRLA 5ICFA 3ME5A 3Q40A 1E6WA 2QDXA 2OM2A 2Q8PA 4YEDA 4ITUA 4XGRA 5EMNA 1E3JA 1R88A 4RSGA 3L8ZA 4IEFB 3R3JA 3DJFA 1NKTA 5HMMA 3KR9A 4AX4A 4Z4HA 1ABBA 1L6RA 3Q7RA 2M9MA 4YDQA 3JWEA 4KYTA 3O8OB 3TLYA 3NQ41 2QAJA 3GWGA 4G0ZA 1NUUA 3NOVA 4JMPA 4PX5A 5HKOA 4GHWA 4PAOA 1RMQA 2VSYA 3IUYA 4JJIA 2H51A 4BGVA 4P82A 4Q3KA 2WFLA 1QGZA 4TRJA 4ZHQB 4R6WA 1RRPA 3OLWA 3ABQB 5LBIA 1T2CA 4COKA 4JJ8A 2MYPA 4WJLA 2R2AA 4YT4A 2XMRA 4QGHA 3G2HA 5I4IA 1VE1A 5HM8A 4JP8A 3R6TA 3S27A 2I2AA 1WUHS 2YZMA 1J07A 2I2DA 4QGSA 4E11A 4MW5A 3NWPA 3T7CA 2WB2A 3IP6A 4RQAA 4M46A 2BLLA 1QAOA 3EIUA 5SYAA 1C1DA 1UQUA 1F14A 3FSJX 3MS4A 1RYEA 3ZLVA 3E18A 5AVKA 3SOZA 3TQRA 3NYIA 1DC8A 4DZRA 4F21A 1Z5VA 1IXKA 1ZLYA 3M6WA 3TLKA 1S7GA 3QW2A 4TKMA 1NW8A 4QDUA 4EY8A 4F3KA 4S2UA 5BYKA 3QVUA 1IOZA 3QYJA 4WZAA 3E3LA 1YASA 4EECA 4QXAA 4KTVE 4WZBB 1QGOA 4M0UA 5BVHB 3GEDA 1Y3HA 2PMEA 2HHCA 2I6UA 4QUBA 2LIVA 4YROA 3W5DA 2OVFA 3AHIA 1Z4OA 4I19A 4YI5A 1HL7A 4MUJA 1ULTA 2IYOA 3F78A 4Q66C 4ZI7A 4H7DA 4A9AA 4R68A 5IC4A 4H0NA 3WDMA 1G21A 3HJBA 4XTCS 2CZGA 1OH8A 1GTRA 3GRPA 3I1YA 3SFTA 2FZVA 3KT8A 4C78A 3QPAA 4ER7A 2OFOA 1YVRA 2Z0MA 3C85A 4E15A 3MT0A 5BMVF 3GT3A 5C5CA 6Q21A 4PLHA 3N74A 5JLJA 3VGPA 1QOPB 1U3UA 3DDCA 4HYYA 3URMA 3R8CA 1YCGA 4IGFA 4KRFA 4NKRA 2HU2A 1L7RA 5A7GA 3RAPR 4BO0A 3YASA 1GJRA 4UHHA 4V0ME 2WTNA 2ZUVA 1H69A 1FS5A 1L4HA 1UWCA 3FG9A 4O4JB 3DKPA 3RWBA 1CS0A 5KVQA 1UC5B 1W52X 1Y9DA 3PE6A 2GUWA 5B58C 1YFLA 4TWJA 4KHPB 3IERA 3MEQA 1VMEA 5GY7A 2A9JA 4AQ7A 4W8OA 3TIFA 2JJQA 2Q62A 2JIMA 3FWHA 2CF6A 1U3WA 1J2UA 2B7CA 2HC9A 1J09A 1XB2A 4GSYA 4HGZA 3FFXA 4YRPA 4DPMA 4MJ3A 2EXXA 1A69A 3TAUA 3VR6A 1YJQA 4F4IA 3KKQA 4O29A 3GVHA 4M8LA 3CONA 3ZVKA 2ZSJA 2OK7A 2D3WA 3I9FA 1HFKA 1RKVA 2VQ3A 4WK2B 1RS0A 1WCXA 4LHWA 1WBDA 4E4TA 1WB6A 3ML1A 3C5WP 3M6MD 5CK4A 2H0QA 3G0DA 4FCVA 5LD2C 3GYGA 1G2QA 1NAIA 4MH0R 4N7BA 4OHCA 1SXJE 2JRCA 2P11A 5LSAA 1NNUA 2PX2A 3KRTA 1KH1A 1M83A 5IJ9A 4F5WA 2V7EA 1XYYA 4NR0A 4U2GA 3JD0A 3TKAA 1P4RA 2Y76A 1J1IA 2WAXA 3BE6A 3O2JA 3OM8A 4C0QC 3IUBA 2H2GA 4ZI3A 1P45A 1YIAA 1T6BY 3GLUA 3RTGA 5JDIA 1W5FA 1UBFA 2FE1A 2VEDA 3CQ9A 5F1KA 5ARCA 2Q4RA 3MRVA 1V5WA 1CUSA 2YOHA 1SUPA 5ES4B 1OAOA 2WHQA 4HLNA 1F0PA 1V1RA 1JSLA 4Y2GA 2RGXA 2GCPA 4A6PA 3R7BA 5CDYA 1AUPA 4PG7A 4MKGA 2GN4A 6REQB 7MDHA 3RAFC 3OECA 5EYPA 4IKEA 3KM0A 2ZWPA 3LWDA 2R65A 4NLLA 2O07A 3L6BA 4LHYA 1DUIA 1LPBB 1PDOA 1Z6GA 2H2FA 2HREA 3JD3A 3IBCA 4PZDA 3D7MA 2GGSA 4K46A 1D03A 2X19A 3PVCA 5HE9A 1BWPA 1K3TA 1VYVA 4LUCA 3HYLA 1UODA 2WJZB 4TWAA 2C5GA 2CDRA 3I37X 3PP8A 3MUFA 3WKCA 5T3YA 4J7UA 4NX2A 5JDIC 3BDVA 4RK0A 2NP6A 3LC7O 2ZIGA 2GEDA 1KNXA 2EFGA 2A7XA 4G9BA 4D4IA 3H2YA 3WBBA 3EQ7A 1OAOC 1ORWA 2BFDA 3KYDB 4EMUA 4PNEA 2PS0A 5JEDA 3HJNA 5L7YA 1NSTA 4JJKA 3DGFC 1NF8A 4BZXA 4O8ZA 3FD8A 4UJ3A 4Y6GB 5DN6A 3VYRB 3CPEA 1E2FA 5H02A 4DT1A 2PGLA 3LJKA 2A0XA 3QKRB 3UJPA 3CKLA 2ZKLA 1VB3A 1CJMA 2G4CA 3B3FA 4UEJA 3PQ3A 3IURA 5EGNA 2ORYA 3WGHA 1P2DA 3ZNNA 5JROA 3VR2D 2ZIEA 1DOZA 1K5HA 2I8LA 1JEOA 2KQUA 1LBHA 4ZYWA 3IV7A 1AV6A 2A92A 3FB4A 5BW8A 1XPJA 3AR3A 4L2IA 4MDHA 5F5LA 1G20B 3HZRA 5CAEB 2MSWA 2FQXA 4TTQA 1SVWA 3EPKA 1Y5LA 2GB4A 3O73A 3CLRD 2AN9A 3BEOA 1DL5A 1XJCA 4B3JA 2ZRKA 4Z51A 4WXEA 4D46A 1TZKA 4OFWA 1EB8A 4BNLA 3FTCA 2CL0X 1MC5A 4LW8A 1PEYA 4YP0A 1MAVA 1PNTA 1TM1E 3HADA 1ZIOA 4BUCA 4ETNA 4K40A 2NZUG 2ZR9A 1YC5A 2YXEA 3QBVA 3KPUA 1L5OA 2G40A 1RI4A 3FBGA 5CH8A 3SZ3A 3A4YA 3NDIA 1DQSA 3Q4GA 3KNZA 2PRSA 1E9EA 1JVBA 3DEZA 2GJ4A 4FW9A 4U2BA 3DE3X 1TJ4A 2IV3A 3WKEA 1GQFA 1V8DA 2R1UA 4DAOA 1IH8A 1D4ZA 1FRFS 4FC6A 1B8UA 2HU7A 4JJGA 3DQQA 3BD9A 1WM1A 4GECA 5A71A 1GTJ1 4ETIA 4RPGA 2Y0PA 4CR7A 1CUFA 4D9BA 4DA4A 1YB1A 1UJ5A 2V98A 5JXGA 4Q5IA 3TNYA 4EF6A 2DUUA 3WWOA 2Q0SA 2R751 4M2LA 1KIAA 4AY6A 4CJXA 3PPYA 2B7LA 2FZLA 3A27A 2EEPA 3BFVA 4WEOA 3OMXA 4HLUC 2W6JA 1KMNA 3A1EA 2VEOA 1DKPA 3LA6A 5K6AA 2ACEA 3I6IA 2WF6A 3P4YA 4JEUA 5H3HA 3SFZA 3I9V6 3OLQA 3L04A 5IMSA 1LJLA 4HF7A 5ALFA 3WLPA 2HIAA 4MLZA 4FYHA 4I2VA 2EWWA 1A2OA 3ONDA 1A8PA 4RVGA 3ANYB 2G72A 2GWHA 3GOHA 3R7WB 3EQ9A 3D4OA 1EDOA 2WFAA 4XJXA 3VPXA 4CKWB 2H5LA 3H05A 4L0QA 3I3SR 1X3SA 2PIAA 1H65A 3QWFA 1E94E 1QSGA 2XYHA 3LKBA 4JELA 3PC4A 2CZCA 5E1OA 3DLTA 5IDYA 4BP1A 3MGGA 5CEEA 1ADYA 1BWSA 3LUCA 1U99A 3GFGA 1XDSA 2EBWA 2XRMA 2JLCA 3P0HA 1RYHA 4I5EA 5JDCA 4UUNA 4G4SP 1W73A 1Q0RA 3MGKA 5HUHA 2O3QA 2Z98A 3H8VA 5ALSA 4XDYA 2YHSA 1WDLA 3AEUA 2WR8A 4ZU6X 1V1JA 2OL4A 4MAMA 3BSSA 2C84A 3Q8MA 2E1RA 1JE1A 4EFMA 3FCAA 4XX0B 1WUJS 1RCFA 2CY0A 2BP7A 1HLDA 4EY6A 4GLJA 2EERA 2RAUA 4X63A 1J8MF 5D85A 3AP1A 1I0ZA 3WKBA 3HSYA 5FI5A 1YZTA 4P7FA 4PFJA 3JAWA 1AN9A 4BKRA 4RD0A 5HDBB 3GLHB 2NZXA 2F1RA 1S3SA 2BTQA 2RCYA 2QRHA 3KQQA 4JY7A 1MC1A 2YHAA 3TEMA 4CM5A 4ZJYA 2H52A 3CEJA 4OHBA 5JAPA 2QN3A 2A0UA 2HHHB 2YICA 5A1TA 2E87A 4LKRA 5BN5B 3SYMA 4DTIA 3U3ZA 2X3UA 3FDZA 4XGIA 2VYVD 2FP4B 2ZYSA 4Q9IA 1UZLA 4RU1A 4BN4A 5JDCC 3EIOA 3HVRA 1WB4A 3NVMB 4Y6SA 4QEDA 4M9RA 2XJ9A 1N9KA 4YONB 3BGVA 2YFQA 1RAEA 1K9VF 3BA6A 4UHDA 3RNOA 5EIHA 3C5VA 4Q7MB 5HKKA 4D0LB 1IATA 1T4MA 1E96A 3QUBA 3GDFA 5DF1A 1TVKB 5B53A 1AXEA 2VTEA 4U7JA 3V55A 4WK6A 1HYHA 4MS1B 1KPGA 2VDNB 3WC4A 4DIMA 4NCHA 1G5TA 1Q14A 4GZ5A 3DF9A 3IAM6 3E53A 4HZUB 5LKAA 5BRAA 1DG1G 4GXNA 4PXYA 4DIFA 5KKNB 1JG2A 3MYRA 4MPRA 3QNMA 4D42A 2RD2A 3HXOA 4F45A 4QDZA 4KIWA 2YVAA 3KJGA 1PJAA 1RDFA 3VPGA 5A5FA 1C7RA 1Y3CE 5A4KA 4HWKA 2QLTA 2W9XA 2HLHA 2WYUA 3QU5A 3OPNA 5FX2A 3OEED 1HO3A 5MDHA 4YPVA 1QH0A 3NTRA 4KWHA 2XCSB 4Y2VA 1MJ5A 5BOSB 4ROSA 4MKFA 4K81B 1G16A 4WV3A 4YHHB 1U65A 1C4XA 2ASVA 2IOFA 2JFXA 2JGEA 4IHJA 4N8SA 3WHLA 4BNIA 2I4LA 3IJPA 3DO5A 3PIIA 3ROMA 1KVRA 3VU9A 5ULLA 2VOEA 2ZQ5A 1SR8A 1NBHA 1ML3A 1VIYA 1YR6A 1T8WA 3OQIB 3R75A 2LGJA 2PDAA 2G6TA 5KAPA 3W4IA 4BFZA 4UTVA 5CDHA 1P5ZB 1JLRA 2F48A 2R60A 1NTOA 3CLKA 2R7MA 3R6WA 3N0VA 3THWA 3ENNA 5CMLA 3EXHA 4AX8A 1BDJA 1KSFX 1FRZA 1V8PA 3A3OA 1USVA 3A11A 3OAAD 1I30A 2GI4A 5EJIA 5EE1A 4K87A 3M6UA 3TNDA 3UYLA 1J7JA 1Z4PX 4LDQA 2HRBA 2V6FA 1XZ8A 4BLOA 5DSXA 2EGUA 3AVWA 1OW3B 1RM0A 2J30A 5DTEA 2HHJA 5AJHA 3QELB 4A0HA 3I23A 2OYCA 1KYZA 4ND2A 1WXWA 5AIBA 1JLMA 1OJ7A 5JQGF 1J2TA 4OJMX 1B3BA 1ESEA 2D5IA 2HCFA 2IKQA 4JSTA 4MK4A 4V0QA 4Y2UA 3PQFA 4FLFA 5EIWA 3UK0A 3VUEA 1FBNA 2QR3A 1R3UA 5AKKA 5GMOA 5B55A 1V35A 1U1GA 4CQLB 4DR2B 1WZ2A 2J9RA 3D8SA 3RAEC 1JB1A 1PFYA 1YOBA 3DBIA 3UAOA 1F5NA 1ZCAA 3H75A 3RS4A 1E6LA 3ZDZB 2J87A 3EXHC 3EDYA 4BLRA 4YJ2F 1I3MA 3EB9A 1Z56C 1GFIA 3H84A 1XZKA 5EZYF 3QKUA 5A3SA 2BFMA 3B1WA 4M76B 2QTZA 4ITRC 1XDZA 2BJWA 2ZR7A 2HHLA 3HVJA 2BAGA 2PWYA 4ZKEA 3GLGE 3ZWPA 4CCWA 3F9CA 3RODA 4F2HA 4PX9A 4Q4JA 1VE9A 4JNCA 2FCRA 1WCV1 1W0JD 1EXDA 2O3RA 4EY4A 1BCRB 1JILA 1G5QA 3L9XA 3PE3A 1PWHA 3PUWA 4HGYA 1U7DA 1Y5MA 4N7RA 3RV3A 3OUZA 2BM1A 3ELUA 2X8LA 2ZR0A 4WLVA 2JW5A 5DSTA 4CGYA 4LRSB 3THXB 1EK6A 3QX9A 4FFLA 1YS7A 4XYGA 4MR9B 1MPXA 4GMDA 5IW8A 1YRHA 2XRYA 4RGVA 3TMKA 4G67A 2ZPTX 3WYEA 1FFHA 4P4SA 1BA2A 1P5FA 2QMHA 1G8PA 4CRWB 4XTRA 2J5XA 1JFSA 1AKVA 3ELDA 5H8WA 2XNDD 1QTRA 1XSEA 3BZBA 1NVDA 1J22A 3ST7A 1TZ2A 1EUZA 2ORIA 4RPLA 1OB5A 4MGYR 5E0KB 2O8EA 2IA5A 1A7KA 1Z2CA 2W71A 3H1FA 3C5HA 1C4KA 1SUIA 1K5GA 3ZU2A 2FSPA 3NTOA 4FCTA 1QQBA 1ZH2A 4B48A 4XEHA 2C3YA 1FS6A 4X8OA 3UJBA 5DT2A 3KEQA 4M22A 4UC0A 5U4XA 4FEGA 3U17A 4ARBA 3KZXA 4QXOA 3ABSB 4Y2QA 2GN6A 4XE5A 2UYGA 2WWFA 3FA2A 4FINA 3MIZA 3I1FA 2B0CA 1ZIXA 5JPIA 2DMRA 4MUKA 4EW1A 1WLYA 2DPHA 4J1NA 3GVXA 5LJLA 3GIDA 4MLPA 2CVQA 3ZWNA 4A82A 4JLKA 2QXUA 4RV5A 3LU1A 5BQ3A 3U4IA 1L3IA 1ZJYA 1AE1A 2B1QA 3OIWA 2GVNA 3NJ4A 1JFFA 2DTDA 1RXIA 1V43A 2A30A 4Q9KA 2JVIA 2YV4A 2FFHA 4W1SA 2E48A 4XKJA 4CW7A 1WL8A 3HCOA 3G89A 3L40A 4R2IA 2PRKA 5K3CA 3MB8A 3T94A 2A94A 2XTJA 4A03A 4CF7A 1XVVA 4PYNA 1MOPA 3AKDA 1R5JA 2PLNA 4N0MA 3LVQE 4Z1OA 2DR3A 2P5TB 4RNDB 3TD9A 2AEMA 2IHKA 4EA8A 1MO6A 3DBVO 5BNZA 3TW0A 1EFRA 2G77B 4GX2A 1EFVB 1VDZA 2EKQA 5T5QA 2ZULA 1E5VA 4LWZA 1P6QA 2RGAA 1VBMA 4I55B 1QG2A 5CJPA 2QTNA 1K7EB 4TMVA 1EYZA 5G1OA 1YXMA 1HK7A 3PPIA 1H0RA 5A4JA 2EHJA 3C3DA 4MI3A 3UAVA 5B1YA 1VZ2A 2J3JA 4YLGA 1W1IA 3WRVA 2C7BA 3HFRA 3O84A 2F55A 1CUXA 4J4HA 2AX4A 4F1KA 3AR4A 1MX5A 5DASA 4YDSA 2AZTA 3UMCA 2FGKA 2UZAA 1UJBA 2H18A 3L7DA 5FAKA 3AVOA 1OZAA 2WAAA 2Y1FA 1ZWKA 3QOFA 1P0QA 4BC0A 1DG9A 3M83A 1KIFA 4BQRA 4ZK2A 1IVYA 1SN7A 3FI9A 4TTVA 4YQYA 3GQVA 1SRQA 2I6XA 2V4MA 4LYEA 4DCVA 2VF5X 4UBNA 1CJKC 1I4WA 2A0FA 3KAJA 5IF3A 3KS9A 4H3HB 5HYVA 5IKXA 3GBPA 1FYEA 5JMOA 5FWDA 5IC6A 3O82A 3TTUA 4DC0A 3CVYA 2IYTA 3GPDG 3SD7A 4EG4A 1BX0A 2GPNA 5HZGA 1W96A 2R6DA 3D3KA 4TTJA 1L5YA 4LHEA 3RUCA 5LQUA 1A88A 2HY7A 4LI0A 3IP5A 3Q3GE 3E22A 3DDWA 2HFKA 1S8OA 2QTTA 3Q9SA 4HLCA 4GDMA 3EIFA 4FHZA 2R1TA 1W46A 2R6GA 3G8AA 1X1TA 1BMTA 1F2TA 3QPDA 4J9UE 4MITA 2JIOA 5CM2Z 3GJ6A 3TLAA 1L8OA 4GOOD 3W6OA 1CB0A 1HT1E 1TQDA 4H18A 2IX3A 3PFWO 1KVQA 2A5FA 3ADKA 4H4DA 3NT5A 3BTOA 4L95C 4BV9A 4O4LF 5GWXA 4OHPA 2CZQA 3LP6A 5TX7A 2HNKA 3UATA 2ZUFA 5EP4A 1PJLA 3AJ8A 3ANLA 3H2IA 1KWKA 1JAYA 3S1AA 1DPGA 1FC0A 4W1RA 4BMNA 2R85A 4TWBA 3F6CA 4UD2A 4Z0PA 3EEOA 3SIPA 3VVLA 3M4JA 4GPZA 4KX5A 4RTSA 1BD3A 2W2KA 3VOSA 5H68A 4REQB 1FNMA 3TS1A 1GIAA 2ZRHA 1I4TD 3S29A 4U5XA 2XLBA 1VHTA 2ISCA 4L3WA 1IXZA 2D59A 3LPNA 3CPJB 5HPYB 3GMSA 1YDWA 1XX6A 3L7OA 1S5PA 1HE4A 3OH8A 4S0XA 4OI4A 1J2YA 3NO4A 4RYDA 4YRLA 5E6RB 3KUUA 3R41A 3WI7A 3ZY3A 2IQIA 2GKSA 2PBRA 2OORA 2ID8A 2VSFA 5IANA 4UEOA 2GA8A 3DBHA 4MP3A 1ZX1A 4RL4A 1NZJA 4AN0A 3QY0A 3IEUA 1NJFA 1IM5A 2C2XA 2V6BA 1KORA 3PDUA 4G89A 4HB0A 1PGNA 1TF5A 4WLUA 2V3WA 4FEAA 1V48A 3UUFA 2ZT5A 3P20A 3H4IA 4RLQA 2DQZA 3QUCA 3SJUA 3GFTA 2PV7A 1D1PA 4M1QA 5CM9C 2FSVA 2IYPA 2OBLA 3VV3A 3ADCA 5HFJA 1FEZA 3DUWA 3JD4A 4UDYX 4JEMA 1OXKB 2IDKA 2XH8A 1GLVA 2YOFA 3ADPA 3ZWMA 1WVIA 5C7IO 5EJ7A 2RBKA 4OG2A 3OPXA 1YZLA 1KO5A 3CX4A 1AVTA 2WD9A 2VH5R 2E5FA 1RJGA 3R5FA 3B7PA 2QLBA 1AM4D 3PPWA 3AZQA 3SZLA 3B8EA 5F7JA 5J4KA 1IRXA 2XUPA 5E6SB 1DBWA 2DH6A 4JASB 4NMMA 1YMVA 4K6KA 2IZ5A 2LPMA 3SEZA 3UJDA 3U7QB 3SXJA 2OORC 3NWOA 4J29A 2PBZA 1ECBA 1I7DA 4OBXA 1BQ4A 5I47A 1TZBA 2HLPA 4ITVA 1QWOA 4V0MA 4GXQA 3SC4A 4G1FA 2GN1A 4D0GA 3IUSA 1TUIA 1W29A 2FSVC 3PC2A 1O9HA 3WLLA 1T15A 2C8KA 4F4CA 1PEKE 1XYGA 1NQXA 5GONB 1K27A 4J3FA 2HF8A 2B78A 1N2IA 2HA0A 1RLJA 3ANSA 3MGBA 4I8IA 4PC6A 2AHOA 2X9VA 2PRIA 4K3VA 5CJ2A 4R7TA 4CGZA 4AXXA 3A1WA 1JDVA 5FRDA 1MJGM 3AH8A 5L7WA 1UDXA 1ODJA 2PD6A 2EFHB 2PZFA 4BNZA 3T3GA 1WNTA 4QNMA 3JY6A 4BMCA 3QV2A 2E21A 5FCDA 2VNKA 2NU6A 2QUIA 3LCVB 3VZPA 4PZ9A 4TMFA 1M2NA 2C9MA 3NOOA 1II9A 1I6WA 3CRRA 2FKAA 4WY5A 2XDQA 4OP1A 4LGMA 421PA 4ZJZA 5LPNA 2MSNA 1RI2A 1QU3A 1MB4A 2VUSA 3LGXA 5M5BA 1L4BA 5FFNA 4FFWA 3IEIA 1V4BA 3K9LA 2FFQA 1SXJA 2XNDA 2RGDA 2ZBFA 2DSNA 4OKSA 2VWHA 4FHGA 2K7ZA 3RYIA 3U3RA 3EYWA 3X1WA 3GQBA 4IXWA 1OU4A 4AP9A 2OYRA 3VR4D 3R3ZA 3RSGA 2QPTA 1CYEA 5EWLB 4Z9YA 1PQ4A 1SHUX 2OG1A 4B6GA 5KC8A 3NATA 1OASA 1L7BA 3U5TA 1J8VA 3O83A 4JJZA 4X00A 1ZM3A 5TE9A 4QPPA 2XI4A 4GLBA 5K3DA 1ZRSA 4HBZA 2GDJA 3KUDA 1FFXB 1IHOA 3GH3A 3VPSA 1SC4A 1IHUA 2MU1A 2B35A 2FZWA 3BIJA 3T4EA 2ZANA 1LRLA 3W79A 1OYVA 2FETA 3VPAA 1F7VA 4MWTA 2IXFA 4CMHA 3JQBA 5CFOA 2JJ1A 2OYSA 1VHQA 2C2BA 4Q47A 1JHUA 1ZONA 4KYIB 3TIXB 3KELA 4BJ1A 4RH0A 1IXSB 4FXPA 1NKSA 1NJ5A 1H5QA 1SXJC 3GZJA 1DRJA 4MEAA 4N5LA 4YWJA 1ZVJA 4IQ0A 4MYTA 4JNKA 1VYUA 2EKBA 5DKFA 3S1LA 4QD3A 4KO4S 3PA8A 2ZUTA 1MV5A 1DC3A 2OV3A 2VHUA 4ZJUA 3PQ4A 3FBTA 4WMLA 3L1UA 1IB0A 4WZ6A 5KX5A 4GNRA 3DL7A 4WKPA 1ZKDA 1LDNA 2P6UA 3UWDA 5TPZA 4OHYA 1KVUA 1QC5A 1XRQA 4HBGA 4CMIB 4GMKA 2PYDA 4LPKA 2GSWA 4F6LA 2NPIA 1DBSA 2VFAA 3WY9A 4YMUA 1MZVA 4INZA 3EOZA 1CUUA 2P6MA 3OCYA 1OWOA 1Y6RA 2HNAA 5AT1A 3SJ7A 2ZVJA 2Q5CA 1CLEA 3JQBC 3T1NA 2QT9A 4V1CB 1FP1D 3DDSA 1X70A 3ISTA 5MGNA 5TS2A 5BSGA 1RI5A 3FETA 1NVXQ 3GHYA 1FMFA 3SZUA 3I6ZA 1JIJA 3GFOA 4AUNA 1X7WA 2R6R1 2POQX 5K05A 2O54A 2G80A 1IUKA 3GT0A 5ESDA 5G53C 3S99A 3F5MA 3WG9A 1UPAA 4DR7B 1XK7A 5K0TA 2VR1A 2BMJA 4CEJB 1I7PA 1RYBA 2CF5A 2DQYA 2ZK7A 3D2BA 3ORRA 1SKYB 2YTZA 4KQ2A 4MWDA 5CYGA 5CB4A 4C2BA 5IJWA 1HXHA 1EVJA 3ZE7A 1MJHA 3DVAB 3EXEA 2CXSA 2LKCA 2PWPA 3G8BA 3ORQA 5D87A 3ZKWB 2XAUA 1H6CA 3CEPB 4MQUA 1Z4JA 3ASYA 3DHEA 3C45A 3GGCA 1G6HA 3LY7A 3G8DA 4PCAA 3RK1A 4DR1B 4X1KB 1AGNA 1Z2AA 5AM5A 5IRCD 3ZDEA 4TYNA 1FX1A 1R8JA 3CJQA 1QK3A 2OB1A 3EUAA 5LDHA 3PR1A 1OD6A 4G84A 8ADHA 4C08A 2CFRA 3H19A 3QLEA 4A6EA 3ER8A 3K0AA 2FJPA 2A7QA 3SM9A 1JLLB 4GW3A 4TMYA 4LOAA 4OVKA 2EG5A 2CB0A 3K4HA 1Z6QA 3E0QA 1VQ1A 1D2AA 1THGA 5EXSA 1MX3A 3K1YA 4ZYZA 1HOXA 5I4BA 5E3JA 4BO6A 4M88A 3P2MA 1PFVA 3QFRA 1Q20A 1TCCA 2QSZA 3K73O 1X1SA 3I6MA 1IXRC 5EOVA 3FM9A 1XMOB 3P4UA 2F4VB 2R2GA 1DBIA 3A25A 2BEWB 1PJBA 2D2VA 1RLIA 3DLCA 4FTWA 3VC1A 1I1OA 3FFAA 1ZD2P 3ONFA 1RQ2A 2O3SA 3QOYA 3N2GA 2J9FA 4LJ8A 3ICEA 1KC1A 4JXJA 1CK4A 4MWCA 3W9SA 4BB5A 3MIIA 4RM2A 5DBEX 3SF0A 1LBQA 3NH6A 3WQQA 2V8BA 1CNMA 3UMGA 1X7ZB 4BNNA 4QM6A 1I13A 4AKHA 2REBA 1MHTA 2YIJA 2P9TA 1F60A 4UU7A 1HPLA 3RBVA 1U94A 2CL5A 4KQ1A 1NMQA 2EF0A 3AP3A 3L02A 2KM1A 4C7JA 5KQMA 1A5TA 1Z5NA 1OXMA 1V1MA 4YQFA 1SCBA 2YY5A 4PS1A 3ZI0A 1JIXA 3MUEA 3ORYA 1P5HA 1LQTA 3DD5A 5EMLA 3WZMA 2V1UA 1ZCZA 1KYXA 1WF3A 4W9RA 2QTHA 2BFFA 2VP3A 4Y1FA 3SC3A 1E2MA 1JMVA 1L1FA 2Q9UA 2M2IA 2ZW9A 3MMSA 3F4BA 2JGDB 3CZMA 1TYDE 2R1ZA 4PF1A 2AKEA 3C3MA 4RQBA 2F64A 2HQOA 3L5KA 2JAXA 4JJEA 1UT5A 4YAGA 1AZSC 1FLDA 4JDPA 1NAHA 1XLVA 2R5NA 4MRMA 3SJZA 2D0PB 2HJ9A 3JQ7B 3MPUA 3EUWA 4IDHA 4WSOA 2DWUA 2NM0A 3F7TA 1NBEA 4KXUA 3MJSA 2GF2A 1CWUA 2JFYA 4QQFA 3DP9A 3RYCA 4RE5A 1K6XA 2I7CA 2Q6TA 4BVLA 2QK4A 4NAUA 4NFHA 2R6JA 1PTKA 1UAGA 1IUNA 3NC0C 4UBOA 3WA6A 1GKYA 1RRGA 1NM5A 3T5BA 4HDOB 4Z4GA 3VI3B 4GFDA 2NQ2C 4UU0A 4C7BA 5HIMA 3TLMA 4LJKA 4JLPA 2YXBA 2HA3A 3OICA 3EQZA 4AS3A 4JR0A 4GBMA 3WKDA 1P7YA 4QTTB 5C1BA 3E3AA 3KEOA 1GL9B 1G20E 3CMCO 4ZRDA 2G04A 3PF9A 2N42A 5IBQA 2JH9A 2YJNA 1SZPA 5G3ZA 1QYVA 4QHSA 3H5VA 4B3MB 2IYFA 4FGKA 4LXUA 5ALYA 4EFDA 5JY1A 5JYDA 3ENVA 2C2MA 3HP7A 2VH2A 2ZYGA 4B35A 4W5OA 3ORSA 1RQ7A 2E4XA 3QMVA 5EIBD 4TMXA 1SVIA 3ZX5A 4AMUA 5JNLA 4V24A 4IWXA 3LF1A 4JWTA 2C9BA 1FFSA 1ZUIA 1G4UR 4MUXA 3H5LA 3D81A 5DM2A 3F6EX 4BFVA 5AVRA 1Z38A 5DM0A 2ZXEA 4EJ6A 1HZZA 2YRXA 4US0R 2ASEA 5CRIA 3UJHA 4EMSA 1NM5C 4C4RA 1W9HA 1H4SA 1JECA 1DAMA 1W0CA 1QS0A 3EASA 4RY9A 1XZAA 4BVEA 4F91B 1VCNA 2BZ0A 2I2CA 3NIGB 3GZTB 2ZJ2A 1JSXA 4M86A 5BMVB 1U63A 2Q29A 3GBSA 4LCEA 3C8UA 1D2RA 1PGOA 5AOAA 4PAQA 3NHMA 1S89A 4TVBA 1TXGA 2WFMA 1C0IA 4Z7JA 1PD1A 1KVSA 2C1XA 3DQPA 3DAFA 3V33A 1BE8A 2E55A 1LCIA 2OENG 5EE5B 1SHTX 1I9GA 3JARA 4PRKA 4DUZB 4CKCB 1PR0A 1TYZA 3P97A 1XLUA 5CA1A 1WPXA 4K9QA 3O8CA 1W25A 1RQXA 4BZWA 3MJ4A 4II2A 4LV5B 1FP4B 1L5QA 1FY2A 2JEYA 1YJCA 4GR4A 4J2HA 1UZNA 3FSEA 2IPMA 3GP5A 3PJRA 3HZOA 1HZZC 1EK2A 1PT6A 1SC9A 1VPEA 2X8WA 3R77A 4DEVA 4DGSA 2GEVA 5HRUA 4F71A 2JFPA 3DPSA 4IQGA 5K0BA 5JZBA 3ILYA 3TQHA 4RD6A 5KTKA 3RJ9A 5LJIA 4W4TA 4IFBA 3LPAA 1YK0A 1HMYA 3TSZA 3WMGA 4ZA2A 1A82A 1NNI1 1TX4B 2XUFA 5DO9A 2V6IA 5LWHA 2EX4A 2BGUA 2EP7A 1AKWA 1F8YA 3G85A 4QOEA 4RVOA 3F4KA 4D3YA 1HURA 3MWLA 4L4UA 1RHRA 3WADA 4W5RA 1IK4A 5EP2A 3U7FB 1HYQA 1QWSA 3PR2B 3ZDFA 5KYYB 1T5SA 3C5EA 1PQUA 4P2BA 2YHIB 3G23A 3K6KA 4BWFB 2B21A 3I61A 2FDRA 2JI6A 1KEEA 1XXHB 3N1UA 4XWAA 2H8KA 2XTAA 2CHUA 4N54A 2LTAA 4BQPA 4CL3A 4E5NA 1XRPA 1TGVA 4CI0B 4RNCA 5KJFA 2B4RO 1E9DA 1E60A 5FNZA 1XF1A 2PZBA 3NHAA 4LFBB 1BXGB 2CJWA 1NUSA 2BFCB 1TTHA 2OZLA 2Y1DA 3AI1A 4GYYA 3V2IA 2A5DA 1OTXA 4EHJA 4NBSA 1RWKA 2WYIA 1SQFA 3B9BA 4G0XA 3CUSA 5FPHA 5GP1A 2DFDA 1ZM9A 3GUHA 1M2VA 1YZKA 3QBEA 2IH2A 2JLWA 4OP2A 3GLHE 1TYAE 2ZAMA 3OCXA 4HL6A 1CEXA 2H6EA 4GE3A 1LZKA 2B3TA 4Q0MA 4GMFA 4R1UA 3QA3E 2IC5A 4WH0A 4MV1A 4DAEA 1PW5A 3KD2A 5FWYB 5BYBA 5HJ5A 1A9YA 3GLGA 4U7FA 2DTXA 1GGFA 3PNPA 2QENA 4Z0TA 2FMTA 3UEOA 1DQYA 2P2NA 2HPZA 1CY1A 1EINA 4B6OA 5KVCA 2RHRA 1YGYA 2ON6A 2C9CA 4CN8A 4EQ6A 1X1CA 3AM5A 3JALA 4YUXA 4OHKA 5KWSA 1X14A 2ZU6A 4DANA 1VG0B 1H4VB 2X0EA 2JJMA 4NVRA 2QRNA 1PUIA 1SEPA 4IUBS 3L01A 1CUZA 1RT9A 2AVNA 3SYTA 4C43A 4FQ8A 1J8DA 4FSDA 3FCCA 3QXSA 1N4AA 3VGJA 2WD8A 1R5OA 5AI0A 4GRIA 1Z22A 3OT4A 4M9SA 3ZE6A 4EAAA 3NP9A 3OJXA 3FNEA 1WG8A 4HAVA 1JSRA 3I2FA 4B3FX 4RS4A 3U4HA 1GA1A 1ISSA 2HFJA 1VMDA 3AHFA 3W34A 8AT1A 2CLEB 4CUJA 1CQIB 2LVBA 3LXMA 1W8IA 2YYSA 3F9RA 2HSWA 1BN6A 4RWZA 2QR5A 3AGPA 5CH5A 2E49A 3HBFA 4QXPA 2SICE 3D5QA 2AT1A 3KTAB 1FMLA 3KO8A 1MBZA 1UP7A 3JAMA 1MW8X 2P2LA 1SHJA 1XFAA 3K9QO 4RV9A 3HRKA 3EWSA 3JD1A 4CF6A 1UBOS 1OGYA 4GKVA 3LYAA 3QUSA 4PYLA 1JKJA 1H85A 3LUDA 1GZHB 1MDFA 4H1TA 4PANA 3NM4A 3UY4A 4C0HA 1UK6A 2EEZA 3FX2A 3SR4A 3M6AA 4JENA 1IZYA 1NJ6A 2AG0A 3PWZA 1O96B 2IXEA 4C6TA 1MFZA 2QTWB 4WLNA 4Z7QB 1E3WA 2F3QA 3IT2A 4FGJA 5AJWA 1Y4AE 2C88A 2OXEA 3QY9A 1Z7EA 5TPWA 1K8RA 1IY1A 2Y9PB 4AZ0B 1Y7HA 4N5DA 1R10A 1B16A 4DV1B 3RYTC 2B8EA 3MCAA 2V7TA 4A2PA 3ILXA 2PMFA 2XQVA 3BC1A 3UOWA 5EXEA 3E6AA 4KDFA 1TGYA 3JQCA 2BC9A 4HNAA 4M49A 5JFOA 5LFAA 3MJHA 3W4KA 1DOAA 1F0NA 2B82A 4OQEA 4TLDA 4RA6A 5EN4A 5JSFA 4XWWA 2X4LA 5AKLA 1I5RA 5DMHA 1DJOA 3TBFA 2OHJA 1I24A 1JYFA 3VMMA 1QFZA 3DFKA 4HWPA 1Z9BA 5LYYA 1N8KA 3CC8A 2X41A 1OCEA 1ZXBA 5J9FA 5KU1A 2BE9A 3UG7A 2ORWA 1WCYA 2VTDA 3ZK7A 5L3SA 3FKSA 2XA9A 5LZ2A 1WW2A 4R54A 1F4VA 2C54A 5EAIA 3OY7A 4QJ5A 1A98A 4A23A 1XD9A 3PDCA 2QE7D 1DC6A 3PGLA 4L8VA 4RMJA 4AW9A 3OWHA 3ADOA 2WUGA 3KVVA 2A59A 4GR9A 4REOA 1W94A 1W85B 3ZTYA 1PFUA 2VHVA 3D8TA 1OLSA 2QTGA 2ZOSA 2ZJFA 3RRBA 2V97A 1LV8A 2YCBA 4DCJA 1KYTA 4BMPB 2M6LA 1VKHA 3PFCA 1M6NA 1Z8DA 3H2GA 3FMVA 4L7VA 1FYFA 2HADA 3HUFA 2A86A 2UZ0A 4CDGA 2P6RA 4OLBA 2EWVA 4NEGA 3ZGNA 1Z37A 1NVBA 3QVVA 5CX1A 3FOBA 1UUFA 2B4TO 1TADA 1BG6A 3LVFO 4JJAA 2ZU0C 1W5SA 1Z4MA 2GK3A 2BF4A 1PAUA 3HY6A 1XD8A 2XQFA 3RNLA 3ZHSA 3VHRA 2GXSA 3GEPA 3PRYA 3OZUA 1L4UA 2WKSA 4RVSA 1WZEA 3LLSA 2QGFA 3QZUA 4W6ZA 3U4MA 2OVBA 4PS0A 3OZEA 3BXFA 3W5VA 1N5OX 1FU4A 1R6XA 2GYUA 3A26A 4OX9Y 1I9CA 5JIBA 2PGIA 1M8FA 2R7AA 1A2BA 3IBFA 4R8KA 1DUVG 3K0KA 4KCGA 2JFOA 3HCDA 4L4YA 1OF1A 3CG4A 1QO0A 1IRIA 1WHTB 2R6FA 1OE0A 3AR2A 1EBFA 2FR8A 4HHEA 4BTEA 4L57A 3LZCA 4B3GA 3A9SA 1UXIA 5CYPA 4PZCA 3LBFA 3TUJC 2B7BA 1DIBA 1RAGA 3B70A 4K88A 3KCNA 4XR9A 5K0LA 4ZVVA 4RULA 3N6VA 4Z4EA 3IH5A 2OKCA 2BR3A 3G88A 4KX3A 4E31A 4WJKB 2OZKA 1Z18A 2ZCVA 1HTTA 1S6YA 2FEMA 3E03A 3KZOA 4GI3A 4ME6A 4V2UA 3ZZMA 4DCSA 4Q4AA 3M3DA 4CLXA 1NSYA 1RIIA 2EZUA 2I3BA 3MWDA 4OP3A 4B3IA 2X6QA 1E6KA 4FIZA 3BMOA 3FSGD 1NRJB 1N0IA 1YRWA 3P0EA 1OB2A 5BWMA 3PEFA 3O4HA 2GCOA 3DNMA 3RC7A 4MDFA 1XCMA 4IRUB 4P1ZA 3L6EA 5BQXA 4IJQA 3VH4A 2J6HA 3EDCA 1QGUA 3L05A 5IULC 1V9LA 2IEZA 2UVPA 3GI1A 3HN2A 1U7OA 4JLVA 2JKZA 2NU8A 5H5JA 5DNCA 2WE8A 3DHWC 5I9BA 4I50A 5KCMA 1OGJA 3HL0A 1Q95A 2FR8C 4AS1A 1C1YA 2FVYA 4F92B 3Q7TA 1R15A 3UMBA 2P1ZA 1BN7A 2MINB 1ZHHA 2QD5A 4ZCIA 1ITZA 2YHBA 1NXVA 4Y9SA 1IL0A 3I8SA 2QQ5A 3RVOA 5IDXA 8GPBA 3D4PA 1E63A 3QSYA 1V4NA 4GKAA 3ZHCA 1KZ1A 1LUAA 2QL6A 5K2OA 2O8FA 1Y1QA 1H3NA 2EBFX 2ZRGA 3S55A 1GOTA 2CUZA 4BQFA 1DIGA 2AQKA 1OR8A 4N9WA 3C41J 3DZHA 1E0SA 3L8CA 4UM5A 4X61A 3WMRA 1T4BA 2I65A 2Q9AA 3W8EA 2AOUA 4QM7A 1CF4A 2I3ZA 3PE4A 4B3SB 4KBYA 4RADA 2O52A 1QVAA 1R8YA 1NOIA 2NVBA 4TMTA 3W1VA 3ZHXA 4PE5B 1V96A 4C3VA 5EPUA 3EH1A 1HBJA 4BNTA 4RY0A 1V6SA 1IEXA 3NPAA 5CA0F 1L5FA 3IV9A 3L7CA 3PU6A 4GI7A 4V0NA 5DHFA 5ADVA 4KZKA 4TTPA 4Q4CA 2PUCA 3L6RA 1Z68A 4RTPA 4Y67A 4B6SA 3T5CA 3SIWA 3P45A 2C29D 1KY2A 2KI5A 3F90A 3GRZA 3V1LA 5KNBD 4W1QA 5B5SA 4L76A 5L3QA 2BI4A 1HDYA 1X80B 3FHCB 1CY7A 4QRDA 3ID6C 1FBTA 1RC0A 1LPAB 3NHSA 4JKIA 3IT3A 3RVSA 3D0QA 4WECA 3V97A 1XZHA 5ALNA 2J4DA 5LLDA 3HNOA 1UIRA 3JQAB 5C52B 1IXYA 4MGIR 4X66B 3F71A 1EFPB 1OLUA 5B3JA 4BP3A 1DU4A 3E9NA 3U81A 4OJYA 5A9RA 3NMUF 5EVCA 1UKZA 2B9EA 5FUYA 4LFAB 5JQGB 2AUMA 1F20A 2VZ0A 1EX9A 3AB8A 4OBEA 3WYGA 4G8BA 2N1MA 3E1SA 1E2QA 1TAGA 2IHVA 3W78A 4FFSA 5LIRA 1SBYA 2R6HA 3ZWVA 1GKUB 3ZCXA 4DA8A 3WGUA 1QHSA 4X84A 5E2IA 3WWDA 3DLAA 4UPDA 3SI7A 1SD1A 5FL7D 1K0FA 3DULA 4FDVA 4JVMA 4L3VA 4OBWA 4N0PA 4WKOA 3G6WA 1OWNA 2TMYA 4YJ2B 4HVAA 3EGOA 5MN4A 3H0KA 4GQAA 5EZYB 1EPUA 4EJFA 3SQXA 1SIBE 4WCFA 4LNUB 3ROKA 3D59A 2Q0XA 1Y42X 3GOQA 4H7PA 1NONA 1KOJA 3OF2A 3F7OA 4ER3A 1C1HA 3O8OA 3QPCA 4GZLA 4PCUA 1ZGAA 1QLHA 4EEKA 1LK5A 1Z12A 2IHUA 1Q1BA 2W6IA 5B3JC 2DSTA 3EMVA 5LQSA 2JD0A 3UWSA 2A1UA 3UJ6A 1EFKA 2YFHA 2P2DA 1ZH4A 3HRIA 4M7WA 1DI0A 4TS4A 4ZHQA 5A9SB 4A36A 2B4AA 4NAHA 1EQAA 5JFGA 1PF7E 1CC1S 1OA1A 1P1JA 1TI7A 2P3OA 3I04M 4EMBA 3BH0A 1NW5A 2WUFA 1EVIA 5CFMA 1YI0A 5KWVA 1NR5A 3TSOA 2GPTA 4LMPA 2QR2A 4Q1EA 1C0EA 3LUFA 4G56A 4OY3A 3ABRB 3FMFA 4KRYA 3VZSA 4FSXA 2QX6A 1GG9A 3AHDA 4AMGA 3LOPA 3PXCX 1HEYA 4WW0A 3KZVA 4WCFC 5G4KB 3LSTA 4JOCA 2NO4A 2PFSA 3HZZA 1SU4A 3T0FA 1RQGA 2CSUA 1CFJA 3AM1A 1XRSB 1GPNA 2WTEA 2J7PA 3QU2A 4B74A 2VSOA 2JFWA 4WDRA 2PD4A 4B9EA 3BORA 3TZCA 3W2TA 3TTWA 2VAVA 1CJBA 2YWGA 3R7FA 4PBSA 4AJPA 4YRDA 4JLAA 3RD5A 3EZFA 2BBWA 4CM3A 3GMDA 1D7OA 1SRRA 1FXUA 3WYBA 2ZTMA 3U3MA 3CUUA 3NTLA 2POCA 5BVHA 1KR2A 2GBFA 3GFBA 4TLCA 2JLZA 2ZT7A 3LCJA 2R0QC 1KJ8A 1GN8A 3AJ9A 4O8CA 4CF5A 4OU4A 1GPLA 1FFCA 1WULS 2OGTA 4DE5A 4DM4A 3DR3A 4BU0A 1FJ2A 4KSBA 1RYFA 1TCBA 1BOOA 2B0JA 4PTLA 2KSQA 3LDGA 5ISMA 1WKCA 5ITSA 4K6HA 3H9QA 1UKVY 4FNOA 1XTUA 4IEIA 3ZEAA 4MKZA 4PLGA 1VG1A 4GC5A 4NV1A 2BPOA 3O03A 1B8PA 1UAYA 3WZ2A 4HQRA 4M6WA 5G0SA 1E9RA 1EB9A 4JJ4A 2V1XA 1BC5A 2OB2A 3P9YA 1R00A 4K9DA 4NYIQ 4CTKA 3R9WA 4LWPA 1YL6A 4R01A 1P74A 3KAQA 4CVNA 3FOAA 3MT7A 2V3VA 4K6CA 2VC2B 1O87A 3FRHA 4G8CA 4U7PB 3OMLA 1D2MA 4UNQA 4EUEA 3I12A 4CF4A 4ARUA 2JARA 3P2OA 3B5IA 3KKOA 1JHZA 2A1TS 2R9VA 2FEAA 4AKIA 4R4JA 4Z0HO 3OSUA 4RDIA 2J3MA 1DOHA 3QVWA 4GICA 1RYDA 1UMDB 2UZ1B 3ODGA 2W4MA 4KXFB 5AQ1A 4PU0A 4KAJA 4NPAA 5FOXA 1H2AS 1Y1KE 2AKAB 1UJMA 3ASUA 4ALIA 3S8EA 1XTJA 3W3AH 3DF7A 4WLFA 3PNQA 2PS3A 4MUNA 3T52A 3K15A 1R4NB 1ZK1A 4MULA 4YQZA 1HRKA 3NAMA 2F8SA 1Q1QA 2COUA 2XB9A 2HWYA 1W59A 3GLVA 2WDPA 3OLYA 2JAOA 4UVGA 1HE3A 1KJZA 2VDWB 4E7OA 3J80A 4IP0A 4B8WA 2JLSA 1I7SB 2J31A 1SMKA 2O0JA 4RANA 4MMYB 1G66A 4RZXA 4KITB 1SKAA 4LZLA 2B69A 3RSZA 1T6YA 3DMFA 2O3TA 4MSUA 2OD2A 3KCQA 2PQMA 4ZPJA 4AI6A 4GBJA 4AQDA 1CF2O 1RFGE 3Q7QA 4OXRA 1VCMA 5TLSA 3RJZA 3C8MA 3PKJA 4RVDA 4QELA 1L5KA 4YH1A 5A9TA 5EHXA 4FDAA 6REQA 4R41A 5J4HA 5LP6A 2GD1O 2FW7A 1LNZA 2NN3C 1XAGA 2XZTA 3SHTA 4MHTA 4MWOA 2CCGA 4AK9A 3KL2A 1QE0A 4N6NA 1XA4A 5K3AA 3MTAA 2AKYA 5KNCA 3RHTA 1X19A 2AZXA 4HGRA 4LYHA 5C46F 1VIDA 3SLRA 1XXLA 2D3TA 2ZQZA 5IM4A 4X44A 4JX8A 1KO8A 5LZ5A 5KTNA 3PT9A 1B6TA 1YS4A 2MYTA 1KMHB 4XWYA 4S35A 3DXFA 3I0ZA 3Q41A 3P52A 4L6CA 2PUGA 2RGEA 1C8LA 3EA4A 1SBCA 3R5KA 2OHHA 2XRFA 1Y82A 2HRQA 5DXAA 4RK6A 1TT5B 2J3EA 3SZOA 1IN4A 1PJ4A 3HKCA 4EY3A 1E0KA 1N77A 3HC7A 4Z53A 4DZTA 3AJEA 1TYEB 3CH7A 2XKBA 4FWIB 3BAFA 3OJEA 2BGLA 3AKYA 3EFOA 1RZVA 3B6MA 4A3SA 1N2JA 5I4CA 2WUDA 5AI5A 3W5SA 2P79A 2KHZA 5LP6C 1ESNA 3CH5A 4L08A 1G41A 2ZCJA 4UAJA 3K5PA 3E8SA 1PV2A 3ZIUA 3FUWA 5DFAA 2AI1A 4EHFA 2DFKB 1NXQA 3LT1A 3HVKA 3TD2A 2PANA 4GH5A 2I7DA 1RPTA 3FVTA 1WTCA 4F0JA 3UMSA 3DOHA 2YWHA 3GGDA 1G6OA 1U9CA 2WAMA 4QGBA 5FUBA 1FXSA 1G20A 1SKYE 1O9BA 3I6BA 5CAEA 5HQTA 4QUHA 4QWMA 2EQAA 1KKUA 2JATA 2MR6A 4NZNA 3B52X 4IVNA 3W6ZA 3UGTA 3ZCPA 4DLVA 4CF3A 4Z2AA 5KTSA 3SN6A 1RWBA 1M1NA 4KPUA 1ADBA 3GW8A 4INPA 5H80A 4XVUA 3IEMA 1E2PA 4V2IA 4L22A 2D5LA 2HTEA 1Q7GA 2OLEA 4OXXA 1ADFA 5D6NA 1WXIA 1UH5A 3LUHA 2FRDA 4PR0A 3UJ7A 5F23A 2CD7A 3JVVA 2NU7A 5A7HA 1GYPA 1YE5A 4NDNE 1WO8A 5H16A 4HSGA 3QUAA 2O5VA 3TB6A 3Q1LA 1Q6YA 5AHOA 3TQCA 3W5IA 1PKEA 3PRJA 1CRZA 4R2MA 3LI2A 4CCYB 3MJRA 4GU5A 3GB9A 1P80A 2WG2A 4HYEA 3VSDA 3DVLA 1OIVA 3BB3A 2JCVA 2BM0A 4M0PA 2ZP1A 5DV9A 3NAQA 3CZRA 1AZTA 2FSIA 4ETWA 5C7OO 5PNTA 3A1SA 3QM1A 1ILEA 3T1TA 1LBEA 1QG6A 3VMFA 3WTBA 2Q5FA 3X1ZA 3RCBA 4CIAA 4N7JA 2D74A 2P3LA 1GEGA 4JJFA 2NXCA 2E6UX 1UQTA 3M4NA 1ZRMA 4XCQA 3EZ2A 5JI3E 3TGLA 4OAPA 5IJXA 2W93A 3PDIB 3WSVA 4XSHA 3ZZTA 3BMQA 4E22A 2FRDC 4QO7A 4HB4A 2QUJA 5EIAA 3OD5A 3O26A 3OTOB 3KUCA 5BQOA 4B4KA 1JDBB 1URPA 2V9ZA 1UPTA 5CK5A 2ZBRA 4YAOA 4BKUA 4HDNB 1KI9A 1LTHR 1RE1A 2DLNA 2FLVA 2NXNA 3LUKA 4RYLA 2D1QA 2IZOA 4AMZA 1YL7A 4I9NA 5HA5A 1CNEA 2OWDA 1IVNA 4JKYA 3DYIA 1QP0A 2Y05A 5EXDA 3LC1O 2VWGA 1VPTA 3FPJA 3FVQA 1J2RA 3BJZA 4I1SA 1KWGA 1R7RA 3RR2A 3PQ7A 2VDRB 1QHNA 3FYSA 3FHTA 4UCXA 4N8EA 5CB8A 3MTDA 4OX9B 1ECCA 3R7SA 5LUAA 1GQ2A 5K0SA 4J90A 2C07A 4PQEA 1CUVA 1N3IA 1C8BA 3ERCA 2H17A 4I08A 4NOJA 1S2GA 4MMZB 1QNFA 4OFZA 4RFSB 4IGAA 2C61A 2MSKA 3WL3A 4DBVO 2GS9A 2OCPA 2QM0A 3NYWA 4R1QA 2Z6UA 3OOEA 1ST2A 1ANKA 1YUNA 3MTIA 3O2QB 3Q9UA 4KAAA 1AXRA 3KTDA 4MW7A 3UFXB 1W36B 3AIMA 2PUDA 2PSFA 1V8FA 2YWDA 3GLHA 1GRVA 4C7OB 2CW5A 3G17A 5E7IA 4L73A 1F8FA 4V0LA 3SJAA 4F72A 1UK8A 1VMAA 1T35A 4QDXA 4HV4A 1RKQA 3OEHD 1T24A 5DGIA 1EKXA 4DCCA 1X86B 5EQTA 3OCUA 4WHMA 1MVOA 2OGZA 1HR0B 1CYDA 4O4HF 3COVA 3GGJA 2ZT6A 5C18A 3JRWA 4ZV9A 3AT1A 2FWAA 4IH9A 4XYEA 1DKOA 1U7WA 2F7SA 3PGJA 5FO0A 4B2YA 2HEGA 2I1VB 2AFRA 4X9XA 5ALLA 1TVKA 2ZAIA 3AEYA 3MXOA 1EE2A 1N5MA 2CXUA 2AMJA 5K0EA 2F62A 2BZGA 4YIKA 3QF7A 3A6LA 1KU6A 3Q3VA 4MS1A 4HAUA 2HPAA 3GJTA 2PX6A 3WK4A 4ZGGA 2WZCA 1JAXA 4JUAA 1H2ZA 3R76A 4AMVA 1Y8ZA 2VLBA 3OTGA 4D57A 4LTNA 1P7CA 3ELYA 4NJMB 3HUDA 1QOQB 2O0MA 1M8JA 1NA5A 1Z4QA 3RFFA 2XHZA 3OP1A 4KQCA 3RGGA 5K20A 2O2GA 4B6PA 2OHFA 4Q3OA 3TLCA 2YZNA 4E09A 4OSOA 3T1YB 1X1DA 5EIFA 4XYLA 2BV3A 2VQFB 3AHGA 4IZHA 2VN8A 1MC8A 2O0KA 3WYCA 1XZGA 1TD9A 3DAGA 4N8DA 3RVKA 4FN5A 1BAPA 3DSRA 1CUHA 1LQUA 1VA5A 1XZNA 2HU5A 2X2FA 4M83A 4PM4A 1R0ZA 1TYBE 2OAP1 5DI9A 4F5DA 5IK2D 3WB1A 1WB9A 1YJ8A 1OFUX 1HDOA 1UF9A 2J9GA 3UHPA 5DGCA 3B12A 5AW3A 1QK4A 3P2KA 1GGMA 2B8TA 3OQIA 2H4HA 8MHTA 1WZCA 1VJTA 3L18A 1BMFD 4WCVA 4YFVA 4DEYA 1B0AA 1QORA 1P17A 2WVAA 5D84A 2NTNA 3OPYB 2V7BA 3L7AA 2RHHA 4RTNA 5J2TB 1YOVB 2W8BB 3TRIA 1K3FA 1A96A 1QONA 2AG8A 1PZNA 1MX1A 2I8CA 3QPVA 5F7OA 3U3OA 4ER5A 5BURA 1ZK3A 2P9JA 3DXXA 3S7ZA 5JRZA 4H27A 4KO1S 5GZ3A 4DBZA 2JD2A 2W37A 4HWRA 4CNQA 1EEHA 1V71A 2RGUA 3ITKA 4YRCA 3W7VA 1ECFA 3TTYA 4IZ6A 1HQCA 4LYGA 3ZN2A 4AJKA 3PYMA 5IBPA 3ZU4A 3Q8LA 2DHEA 4JUCA 1D9ZA 2DWPA 3SDBA 1UMBB 1Z33A 2WHEA 5AXDA 4CM6A 3EVAA 1NE2A 1WDTA 1XJWA 3C74A 1J33A 4ZVRA 1X7XB 1WZNA 2UVDA 4LHZA 3HG7A 2XT6A 1BFUA 4JU9A 3QA9A 1AMOA 4FYJA 4YGYA 1NL3A 5FI3A 5P21A 1IEQA 5K01A 3D4NA 4IZOA 1O5IA 1S8FA 2XY4A 1TLLA 3FB1A 4OKIA 1RKXA 1X1RA 3NBFA 2VCHA 3EXFB 4EVQA 1LDEA 2OY0A 4M9XA 4AKTA 1IBRA 4NYIR 1G8GA 4F8EA 4FM9A 5L8VA 4CQMB 4BUZA 2I6SA 4HAIA 2JBWA 3HJCA 3TNLA 5A2GA 2JHFA 3DDNA 3G1TA 4CMBA 3RUHA 2E4ZA 3CWZA 4HMPA 4S1PA 2O20A 5C3UA 2AC4A 2WE7A 4PZUA 4BC1A 1XV5A 2GKOA 4CN9A 4CEIB 5DI3A 1PUXA 2AF3C 4ZAXA 3ZWDA 4H1WA 1BCRA 3AF4A 1QF9A 4B3BA 2P5YA 5F9HA 2F3RA 2X2OA 1SEVA 4AO7A 1I51A 1N32B 2RAFA 1DQZA 1P33A 3THXA 3GIWA 3H5NA 1SURA 2YRFA 1GZ7A 3CCFA 2O8CA 2AFVA 5ILQA 3AP2A 4Q03A 1L5LA 3CRZA 4KV7A 4MV0A 3C4JA 5ESWA 5KYVA 3P9RA 5K8CA 2X77A 1EIWA 2GN8A 5L4LA 1G8FA 4LQ4A 4XD2A 4E4RA 1C8KA 2RCNA 3QBTA 3WK7A 5PGMA 5AVQA 1R4AA 2RFLA 3BRWD 5FUXA 3UHOA 4F2WA 5BRNA 3W2HA 1NJ8A 4KXNA 3WLTA 2D6FA 2HMSA 5JYCA 2Q7XA 4LZAA 4FBMA 1Z83A 1FZQA 4MR8B 1N5DA 4G1MB 1R8QA 5C5EA 1QVWA 2EV9A 3OTHA 4MVJF 4DV7B 3GPBA 2QYHA 2H0RA 3PENA 5AJYA 1Z63A 4RZIA 4CQNA 2JI9A 1TO1E 3WK9A 4DMMA 3H86A 3RQIA 2EZ4A 3M8KA 3PQDA 5ALXA 4S0ZA 1F1BA 2F6RA 2P4UA 1HYBA 1KMIY 4A1OA 3RM3A 4U6QA 3VBEA 4BNMA 3WNDA 5T41A 3ZUPA 1Z3CA 3KEFA 2I9KA 3IT1A 3T7EA 4FUTA 2FCAA 3GJ5A 5DLPA 3DNFA 3PJGA 4ZT2A 4G1VA 3HPQA 4O63O 4B5KA 2GM9A 1ESDA 4HT3B 2NPOA 3OJ0A 4KE9A 1DXHA 1OXTA 1YQDA 1CW2B 4XYBA 5BN1A 3UF0A 4WGGA 4BUJA 4J8PA 1T2FA 3VKGA 1P1FA 4FR0A 4PZZA 3B13B 4UE3S 3DAYA 4QJ3A 2O06A 3JCZA 2RK3A 4RM3A 1Z4NA 1ZOOA 3IEKA 3I30X 1V11B 2WTXA 1KMCA 3AZOA 4IMRA 3SBEA 1NZFA 1ODSA 2Q1TA 4OYHA 1PR6A 1C3OA 4ZQHA 4BLQA 4TYMA 2FPLA 4Q01A 1E9VA 3BGIA 1K4MA 3C6YA 5ECWA 3V2UA 1OZHA 5HIAA 1K8ZB 1X3LA 4FZVA 1L8AA 5CB6A 1STOA 2V7PA 3A9RA 4G2NA 4E5UA 1PG2A 1ZCBA 1G3UA 2P9YA 4EX7A 4YCJA 4XVCA 4JL6A 2P2YA 2PGJA 2NV0A 3AFGA 3FHOA 3NFRA 5CURA 3ZHUA 4JD5A 1TK9A 3AFIA 3BL5A 3RK4A 5CDSA 4RTOA 1E1DA 1VI5A 2AFHB 5GJWC 3UB2A 2F1IA 4QOIA 1KHHA 3FWKA 3AF5A 4J6EA 4U7WA 1SIWA 5BN4B 1CJTC 3BGSA 3PJEA 3JRXA 3TH5A 1RC8A 3Q87B 1IQ0A 2ZVPX 5IHXA 3JWHA 2EKDA 2QJFA 3G2IA 4JBXA 3LL7A 2FDCA 1TF2A 1XU9A 3FZEA 2YWBA 4C6HA 3N6XA 3D2CA 2Z6AA 2IHZA 5JZMA 3L6OO 2QRKA 1DAKA 5FLKA 3ZE8A 1B73A 4RJTA 2WAYA 1CJVC 1YR3A 1E2EA 4CIWA 1CEQA 1DFHA 3OQJA 5IVKA 5IUKC 1BXRA 4QUKA 1Y7LA 3IAS6 4S1VA 2B8JA 4RH1A 4C07A 5K8IA 3QEAZ 1WRBA 2G9UA 1LRKA 2ODNA 4UNPA 4QUAA 1PQWA 3P19A 3IPYA 1U2RA 4PRZA 4Q9HA 1RWNA 3T3OA 4ZYYA 5ECDA 1L4NA 3LQYA 3QKSA 1W5EA 1GU1A 4GZ6A 4LE1A 4TS3A 4WX2B 4UAGA 1SVKA 4XPIB 4BNUA 3H1TA 4LWQA 2ZATA 3ZWAA 4OQXA 1R5NA 2Q3HA 3H13A 1SG6A 5JFTA 3VJMA 1N34B 1QAMA 1ZOPA 3PD1A 4UXIA 3L43A 3EMKA 3WSTA 3KZ1E 1QPZA 4LJ4A 2NNWB 3FDIA 1X39A 4YUVA 2IZ7A 2GVDC 1KP2A 1P4SA 2WJVA 1XZBA 1LH0A 2HAEA 1P29A 2KE5A 3WX0A 3KBBA 2B6NA 1XMXA 2BFWA 2G9ZA 3LHDA 4IFEA 4F2DA 4E3WA 1T8YA 3U61B 3AERB 1BVRA 5AKGA 3IDZA 4LXTA 1FRQA 1QIKA 1XG5A 2P75A 1YMQA 1NQWA 3KTOA 5U4QA 2PNJA 2C92A 1OFVA 2Z6QA 4URVR 1MMFB 1W93A 4H7EA 4Y6LA 4CLOA 5JW6A 4M99A 1FFAA 4TN1A 1PNRA 1DEHA 1IYZA 2CHFA 2Y9MB 4IG4A 4O2AA 4MARA 2SBTA 5I8ZA 4D8YA 3OFND 5IH7A 4GM4A 5E6RA 4L8LA 5D51S 3DWGA 2O8FB 2V45A 3WL8A 2ZI5A 5DE3A 2D2FA 4WN9A 3EE6A 3G2QA 2NUBA 5DNYB 5ALHA 5LQDA 1YHNA 1XMPA 3FVVA 3LA8A 1ZC4A 4QBGB 2RI1A 1YE8A 3UWPA 5ERYA 2SCUB 1SC3A 1TFRA 2ZWAA 1PNVA 1QZXA 5FBKA 2DHCA 2EKPA 3U9TA 2QTVB 3WWPA 4DG5A 4E0BA 4Q9AA 3RH0A 5KTRA 1S01A 2XE7A 4B4VA 1F3LA 3U16A 4GOMD 1Z5UA 2XQKA 4XM0A 2QUAA 3D6JA 4O2LA 4DJJA 2XEDA 1B1CA 3V2GA 4GPBA 3QEJA 4QQKA 1Z5GA 2EP8A 1ZS9A 4YBRA 5JNSA 3G7NA 3NHWA 1L8XA 4K9LA 2PUJA 4YPFA 3ZJTA 3UYKA 4XQEA 5EUMA 1E2HA 5E6SA 5JXJA 3GAAA 2G36A 5FTWA 3IEVA 3DTVB 2HMWA 4XOIA 4M3NA 3U7QA 4YUYA 3ZGYA 2A5YB 4GZMA 3MELA 3DFUA 4DSTA 5DBGA 1D7AA 2BDTA 2NX2A 1AX9A 4LOLA 2HQBA 1YQEA 3ASZA 3QPWA 4WXRA 4WLOA 4O2RA 5JZ9A 1NASA 4A8JB 2CL7X 4D3ZA 5I9IA 2RHBA 2ANCA 1G4HA 3BZUA 3G3EA 2J4FA 1Z0AA 4JJ7A 1M6EX 2DCMA 1R9MA 2BBSA 1DC7A 3IQZA 2DBVO 4I9FA 5AQEA 5A6SB 4EKDA 2W2TA 5GONA 3ND7A 1XZDA 3SZRA 3T0GA 4EI7A 3SKXA 3WL6A 3RUIA 3EDOA 1RLOA 5BP7A 4H35A 3ZW9A 2ZJ8A 3HGTA 2DE0X 1OFHA 1UKAA 2F3SA 4OAQA 3RFXA 3DVQX 3GUUA 4KQ6A 3ECCA 5DTIA 5EXPA 2D0IA 4DLNA 4XD7D 1UDBA 4IG9A 4FWBA 5JZOA 5F35A 4FYXA 4DR5B 3OOHA 4PSDA 1GGKA 2RHLA 2WYVA 4NMXB 3QWHA 1NGSA 3LKVA 2C3MA 3UO8B 3WIOA 4YP5A 4DFDA 4YCNA 3BILA 4LVUA 1E5TA 2R8XA 3H11B 1JEYA 1NDUA 4CG1A 2JZCA 1Q11A 5TJ9A 2XMBA 4JQZA 4BNYA 2QPOA 5DIZA 3LYLA 2GT1A 2IPAB 4M1TA 3TM4A 1OZGA 2FAXA 3RVMA 4ICIA 1SQ5A 4R8RA 1SKBA 1RJ9B 4WERA 2X9QA 4NIMA 1QF7A 1C9JA 2QI9C 2O1SA 3GJQA 5JNTA 3VC2A 3TOSA 3P32A 1GCUA 3K8ZA 2NIPA 1MNAA 2CLHB 2A58A 3KJNA 3O94A 4OMCA 4UATA 2XWJI 2G67A 2J6CA 1T0UA 4RVHA 5KEIA 4ABTA 1SVUA 1WVGA 3ENZA 1KK2A 1QCZA 3R74A 3R3UA 4QU0A 4Y6RA 4DIOA 2ZB3A 3UCXA 5EIOA 1JZQA 2EJUA 4WKNA 4C0KA 4EYSA 1TW3A 2FWMX 2YWEA 3QK7A 3SR3A 3VVBA 3D6AA 4AUKA 1R8SA 4G8DA 2HLDA 1MQSA 4NATA 2JLQA 3G5LA 4F2PA 4HWGA 2QIOA 4Q3DA 4GYWA 3OOSA 4N03A 3B20A 4CM9A 1HNZB 1U6JA 2X0KA 1T4CB 1ESMA 5T6BA 2FQWA 4G65A 1FSZA 3SQWA 2E6KA 1VSTA 1DWUA 3MK31 3OCWA 3CBQA 4K2HA 4KJXA 5HMLA 5EP3A 1KEPA 1Q1NA 3AEKB 4KDRA 5COQA 4MKXA 3IKMB 3H1EA 3NDPA 5AW7A 3A9UA 4ZPXA 4Z9XA 3KU4A 4EZEA 4KGZA 4BGIA 5EIEA 2BM9A 2YZ7A 2ZIXA 2OC4A 3DS8A 3CZQA 4ZD6A 1CV2A 4KI0A 1OPXA 1WP4A 4NRDA 1JIVA 2L17A 3AV3A 4OCZA 2WRZA 4WOBA 4BECA 2PHZA 4I4TF 1R6TA 5FUWA 1DO0A 5CT8A 4U9UA 3WTCA 4TWRA 3FUCA 4YR7A 1WX1A 2CDCA 2XXBA 4IDOA 3AU9A 2VDUE 1OX4B 4AWAA 2N46A 3DOUA 2FMHA 3Q3HA 4QT0A 3G0GA 5ER9A 5B3LA 4R1NA 4J1TA 5BUCA 2F67A 4P92A 3VR3A 5KQGA 4W9MC 1EE9A 2PMKA 1E5DA 4Q12A 3BEDA 2WABA 1KK0A 4IDEA 2XYPA 3AR9A 5EWMA 2R5FA 3VKUA 3JAKA 1WUIS 1FFDA 2A4MA 3DC2A 5JS8A 3CNBA 4NXNB 3I4LA 5B1IA 1TJPB 3NUZA 2B25A 2Q1WA 2WSYB 3QGMA 1ZL0A 5IHPA 5CNMA 2NT3A 4F9EA 1PDWA 2E85A 1EJ0A 1JR3E 2B2CA 3QEMB 4J0IA 4CR8A 4OHUA 3L0DA 4CIYA 1X7HA 4BBZA 1KSGA 4ND5A 3ZKWA 2QS9A 4JB0A 4NZMA 2J5RA 5TC4A 4Z9FA 4HZGA 4TTRA 3U7JA 2B8WA 3F74A 3IHKA 4JVNA 1WTAA 3LLMA 2ZS9A 1NBIA 3R6DA 3IVMA 4L5YA 3AF6A 1YACA 2OECA 2WMDA 5E4JA 1MU0A 4MRRA 1KFCB 2Y77A 3C39A 5ALJA 4WESB 2GEFA 2K4MA 4KFCA 1BZYA 3QVGB 2UVQA 2X13A 1DCMA 2D8MA 5KNDD 2VK1A 2Z9BA 3H4MA 3OZAA 5CA0B 4J1TC 5CW2A 5LM3A 3HXQA 1JLLA 3FYDA 1D0IA 1LI7A 1T9CA 1XCGB 4RLHA 4P31A 2QRQA 4E51A 5IU6A 2AWNA 4IXDA 3IPAA 3AONB 1B93A 3E7DA 4ZT5A 2ZZKA 4ER0A 4C3OB 4ENTA 4FKZA 5JPCA 4EP1A 2WFZA 2FWNA 4C4SA 4GX5A 3UWMA 5KTOA 3THYB 2XIJA 1TDJA 4CV0A 4X91A 2VRCD 4GYKA 3SQDA 3OZWA 2CWDA 3EZLA 1TAHA 3K30A 5AOBA 1OVMA 2QZ9A 2CDBA 1ZVQA 2G07A 2PX3A 4BX3A 4C4TA 1AZWA 2WWHA 2QSYA 3GRUA 3TLEA 2PJUA 3C7KA 3ZH9B 2G1JA 3R44A 1DEAA 1FYWA 2ZS7A 2F8MA 3NHUA 3WMXA 2Q3MA 2ISQA 1TU3A 4YAJA 4L9SA 2VT7A 1A9SA 1NBMD 4JMLA 4PO1A 3SLGA 2REQA 4YP9A 1QO9A 4QBKA 1X7ZA 3QKWA 4QPCA 5CLGA 4UM8B 1SUSA 2XZLA 4L78A 3GLSA 1KEZA 2NZ2A 1QFMA 4TTSA 4C4OA 1IZZA 4AJJA 4RXMA 3AKCA 1U2QA 2ZRFA 4BB0A 4DABA 4EZBA 2HDHA 3OMWA 1TZMA 3LG2A 4RZ2A 1PN3A 2LZ0A 1S3FA 4BEVA 1OFUA 1XUOA 1D6MA 2G06A 4C0AC 3TUIC 3EHDA 4ZO7A 4LYJA 3PYLA 1VKRA 2AI2A 1TRHA 2QLJA 1X8JA 4F3CA 1H2YA 5CT4A 4DMUB 4J91A 4NCJA 1JIKA 4QBHA 2BHLA 5F3RA 4NYMQ 4P84A 2JCYA 3UT6A 3W90A 4BJ3A 5FIUA 4BE4A 4KDCA 1FX0B 2AXQA 2BGRA 3QUTA 4MW9A 2IV2X 2VZEA 2W98A 3WXBA 2V03A 1IBLB 3DVRX 3X1MA 9LDTA 4IGIA 2AMVA 4UW9A 5TEVA 2R96A 4R9UC 2YV2A 1GGHA 5E4YA 1BQEA 1A04A 3MBIA 1ZZEA 4C6RA 2DETA 2WVJA 1K86A 2MDTA 2HO4A 2QPLA 3VKWA 2IVZA 5JY6A 2V7QA 1P91A 1ZD3A 1PT5A 5AH0A 2JBHA 4R9VA 1M7BA 3ICCA 5SZIA 2VXCA 4BLTA 1QX4A 1YRQA 4OXNA 2P7IA 5CT6A 4FLMA 5BR7A 4US2R 1HNNA 2FUG1 3COJA 1JJIA 5EHZA 1BE0A 1YB6A 3C3CA 1XHLA 1VFNA 4EJ2A 3R2JA 3RYFB 4P7JA 3ACBA 1BS9A 2V96A 3I73A 5C31A 1MA0A 2E18A 1N36B 2CNBA 1JDZA 2N3ZA 3OE4A 3VYUB 1KOLA 3RU3A 1W0KD 3H2ZA 3QLTA 1LLUA 3EIHA 3A7EA 2HQSA 3OPQA 1HLGA 4XQGA 1PV4A 1QRRA 1SXGA 1P5RA 5F5NA 5BW6B 2D0OB 2IUUA 5CFRA 5HK9A 3UUGA 3K9GA 3IR5A 3PUIA 5DK6A 4DEXA 5JRJA 1CJUC 3QOWA 2OCLA 3FTDA 5IP5A 4BQOA 5FOUA 2A1TR 1FTQA 1WV0A 3AIKA 3PC3A 2G0NA 4M0KA 4WBXC 4XD7A 1AKRA 2R48A 4N01A 3O9ZA 4P4NA 4RC9A 4AN1A 2I4OA 5A5DA 2ODBA 1E8NA 1MJGA 3FPKA 3DLBA 3DDZX 2L18A 2ZBGA 1ZITA 5BMVA 2FSUA 4BQEA 1NG1A 2F3UA 2JIZA 2VF4X 4HGOA 4WDQA 4XGKA 4ZU1X 3SSOA 5F9FA 2YMLA 1GITA 3PX2A 3PHJA 5DTRA 2VK4A 1FUEA 1BJTA 1I5OA 1RWMA 2Q6OA 2RHWA 3DV2A 3L0PA 4GI1A 4XH9B 1X8XA 3DMPA 5SY9A 2CVZA 2ETVA 3GGSA 3ZV3A 3QXXA 4G0PA 4RCVA 4IUCS 4TXHA 1KSJA 2ZIVB 4X71A 2P8SA 2QAGB 4X20B 3D2LA 1ZAYA 4G5RA 1F6WA 1TO2E 2R84A 3PB3A 3UWKA 2IYAA 4Q4HB 3EPJA 5C34B 1KTIA 3EF3A 4JV5B 3VZRA 1CXZA 1I33A 2VSNA 2IODA 3IBGA 1N6HA 2JGFA 4HQFA 1PEDA 3WBJA 4HXFB 1I8TA 2W70A 4ZCSA 1NYRA 1V8ZA 3K3PA 3OPMA 3CX8A 2GOYA 1IN6A 3I5MA 2WTAA 3I32A 3WP1B 1VBKA 1DE0A 2GH1A 2KBEA 2P9QA 2O2EA 2RSLA 3LDFA 5ES3A 1SCIA 2P0YA 3KDSE 3KL4A 2P91A 1UT8A 2HBRA 1FLVA 2JJ2A 1U28A 2ACVA 2ZIAA 3O1HB 1DAHA 4UQOA 5FNVF 4B40A 4R0MA 5I7EA 4R6XA 3K70D 4KXWA 1XD2B 1JTEA 2ZYRA 2BFBA 2K7FA 5EJGA 2J45A 1XOIA 4C05A 5KYYA 3DFZA 1A5AB 2YHIA 1UM9A 3EGXA 3VU3A 1A97A 2CE7A 1GZSA 4C0WA 1Q7TA 3EXIB 3AK4A 4CL2A 4YMIA 4H6PA 3CEMA 3CLVA 2MOKA 3FMPB 5K03A 5MFPA 1U5CA 2JHGA 3AUUA 3B8HA 3R0IA 1XA3A 2ZSHA 4HLDA 3PNKA 4ZC8A 1BXGA 2IPLA 4N40A 5CYOA 2C2OA 4HDRB 1XL0A 1NVGA 1PJ8A 2XTZA 3IPCA 4MIEA 3PHCA 4UTZA 2ONZA 4K9KA 5DNDA 1QRUA 4RD3A 3HDVA 1P72A 3MCVA 3U9SA 4YXWD 1MB3A 2ZT8A 3I2YX 5EHIA 1EUCB 1FTWA 1U28C 5FWYA 2JCGA 4HQ0A 4ND8B 5AIAA 3JYNA 3CN7A 3K9HA 1X9GA 1T3HA 2CSXA 4I8DA 5DEOA 1N6RA 4JK3A 2XAAA 4UM9D 5IWAB 5EPEA 1N1DA 1ZNWA 1U0FA 3H0CA 5BMOA 3V4PB 3CYFA 1Z2EA 1ZSNA 4C0LA 1GZ5A 5DH9A 1VECA 5IFKA 3JQDA 2P9FA 5E6UB 2ZDHA 3SQMA 3GF4A 2WSSA 1LSJA 4JLSA 1FTNA 3VZCA 4E2FA 1XNQB 1XPOA 1EQUA 1CQJB 1X1EA 2JFBA 1RXSA 1A4IA 3B1JA 3OA0A 4IGKA 4KI7A 5FPTA 2HIHA 1XP8A 5LQRA 3U1BA 1DKUA 1MXHA 2I1WA 1U1IA 3RTBA 1YKSA 1DJLA 3HZHA 3K8YA 1CQIA 2QN9A 4Q3CA 3WWYA 4LMBA 3DV0A 5BR4A 3JXEA 5EJAA 2J3QA 4NMWA 3M81A 3OEYA 5LYJA 1R6AA 1TIKA 1ZGJA 3G2MA 2G8NA 3HB7A 4GD3Q 2MYUA 4R1TA 3EDRA 5C1IA 4J2TA 1QV9A 5JJLA 3STVA 5ESRA 2FUG6 4KMOA 2FPIB 2WZBA 2E7ZA 1XEXA 1VJRA 4MROA 1ZA1A 3T5MA 3FBWA 2A78A 1NHGA 3H9UA 2FZGA 4IDDA 1TUGA 5LQCA 3DPUA 3H9JA 4YP1A 3AY7A 1T1RA 1SCKA 2WJJA 1ZMTA 2I66A 3KPVA 1Q0ZA 1E66A <