2EBUA

Solution structure of the brct domain from human replication factor c large subunit 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
112
structure length
112
Chain Sequence
GSSGSSGKALGSKEIPKGAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIAVETE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords Replication factor C subunit 1
publication title Solution structure of the BRCT domain from human replication factor C large subunit 1
rcsb
source organism Homo sapiens
total genus 17
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ebuA01
4XQ0A 3K05A 2EBWA 3T7JA 2EP8A 3QVGB 2AZMA 2VXCA 3KTFA 2LE0A 1Y98A 4Y2GA 3SQDA 4BU0A 1CDZA 2HTFA 3FA2A 3PC8A 3K16A 1GZHB 4XPZA 4N40A 3L41A 3SHTA 3EF0A 2R1ZA 2COKA 1KZYC 3SZMA 3L46A 4Y18A 4JLUA 3K0KA 3T1NA 4BMCA 1WF6A 2K7FA 2VXBA 1Z56C 2D8MA 1T2UA 1L0BA 1IMOA 3II6X 4U4AA 3HUEA 2COEA 2COUA 3PC8C 2E2WA 3QVGA 2DUNA 3OLCX 3U3ZA 3I0NA 3SHVA 3HUFA 2XNKA 3UEOA 3AL3A 4BMDA 4OFBA 3JVEA 2ADOA 3L40A 2L42A 3AL2A 5ECGC 3UENA 3COJA 3PXEA 2JW5A 3K15A 1L7BA 1N5OX 2INGX 1T2VA 2WT8A 4IFIA 1JNXX 1OQAA 3PA6A 1T29A 3PXAA 4BU1A 3I0MA 2M2IA 3EF1A 1IN1A 2XNHA 3K0HA 2EBUA 1T15A 3PD7A 3PC6A 3PC7A 2ETXA 3PXBA 2NTEA 2K6GA 3PXDA 3PXCX 3T7IA 4IGKA 3T7KA 4ID3A
chains in the Genus database with same CATH superfamily
4BZXA 4XW2A 3K4PA 4HBZA 2PMFA 1E6LA 1JJFA 3LQ2A 4L2IB 3NYQA 2BTQA 4N1AA 2R6JA 3AZOA 5EEHA 5ECDA 4LF5B 1Z74A 3OTHA 3D1JA 1KVUA 2C78A 2QZPA 3LKDA 1U7DA 4JL6A 1PYGA 4K26A 5K8IA 2Z3ZA 2CL5A 2B1IA 2OFXA 1MTZA 1XMOB 5EA2A 2Z1DA 1NFRA 1RP7A 2P1DA 5F21A 3K0FB 3S5JA 4JSRA 3CVUA 1QTRA 2RDMA 5AI0A 3WLAA 4OHKA 3UKJA 1P8AA 4A8JC 1EK1A 5B30A 5BY2A 2PXHA 1VLLA 4OBXA 4JUIA 4JEUA 4LTMA 4P4SB 4YQYA 3R7SA 3LYAA 3E6AA 4U9UA 4HOYA 1IPEA 1KO4A 4HTAA 2VUTA 4PSKA 3AR3A 5DX8A 5IANA 3BS4A 1AM4D 3L8HA 4KXWA 2AZTA 2I7VA 4FFOA 4WRRA 3U39A 4H7PA 1ONNA 4M86A 3DVSX 4L0DA 1BX0A 1JMYA 4LNUB 2OP0A 3KD3A 3AEUA 3KHKA 1ITZA 1JU9A 1M34B 2E1PA 3KZKA 3QKSA 4JB0A 1H9AA 4KHZA 2ZRPA 1R5BA 2WUVA 2ZWIA 5TF4A 3ZJ5A 4U4AA 4Y0VA 3ENQA 1K8XB 2FMHA 3BFXA 3GRKA 3LA6A 1E2NA 3U3KA 1J2UA 3NAZA 3PTLA 2AMFA 2FLKA 4FX2A 2IIBA 3SXUB 4A2QA 5E4FA 5IP5A 4D44A 1J56A 2EWMA 1OX4B 2ZWAA 4MYUA 1SBNE 3Q3HA 4H3KB 3MLEA 3QX7A 4X60A 5IFLA 1A9TA 5IS2A 2A84A 1NUAA 2C8LA 4BP3A 2WIAA 3U2QA 4A26A 2AE1A 2GCEA 4QQFA 5DGTA 5EIAA 4AJLA 1DDOA 4ZVNA 4QJ4A 2Q7DA 4DCVA 1HFJA 3C14C 3EGIA 1GGHA 2AJCA 4D0SA 2QL7A 3OPYB 3HWWA 1W5TA 2WNSA 1K88A 2G7ZA 4UCXA 2I33A 1N5KA 2IZ1A 2HHCA 4LVUA 2HH9A 3KZVA 4LGVA 1PJZA 2QL5A 3UENA 1YDHA 3DDSA 3FMGA 4D3ZA 3MYRA 3PUZA 1VMIA 1FLAA 3H5NA 3GAZA 1JLRA 1QIKA 1W1WA 3ETNA 2P2LA 2IW3A 3UCEA 2PR7A 3THWA 2R9VA 1RAGA 1SVLA 4KQFA 4P4TA 2NO0A 2YVUA 4IV5A 4XM1A 2QWXA 4B3XA 4YRBA 5BT9A 3RAJA 4OO3A 1JFSA 1WMDA 2YRXA 3DVAA 4CEHA 1KMCA 1ZGCA 4BRUA 3ZLJA 5AK5A 4FHFA 3P97A 5IM5A 4D4KA 5FADA 4OIFA 2BFAA 4QE3A 2E55A 3AEKB 3JZAA 4KSYA 2A9JA 1EWRA 5DB4A 3T54A 3EDOA 2SCUB 2Y76A 3CEMA 2JG3A 3KWFA 4QBTA 5AHKA 3IT1A 1GTL1 5EESA 2V3WA 1Z8HA 3I4FA 2JAHA 2GKOA 3IV7A 3HJGA 4GM1A 3TTXA 3ND7A 4D8TA 1Z0DA 3BL8A 1VA5A 2VJBA 4K2AA 4LRTB 4ND8A 4QHTA 4R2MA 5CFLA 3W5HA 5IT4A 1K3UB 3DMDA 1EFKA 1F17A 1PJ4A 4X1YB 1B3RA 2IYYA 3ENNA 4H18A 5AM0A 5EE3A 5IXYA 3ER9A 3H3FA 3DOCA 5KTNA 4OHBA 1N8KA 1IEXA 3NWPA 4MP8A 3T12A 2R1TB 2TMYA 4EGAA 1XQYA 4DNQA 1XCLA 2BH2A 1RPTA 4R16A 1IN7A 3EISA 1ZR4A 5CB4A 3DE3X 1JWBB 4KUEA 5HS4A 2PYZA 2GHTA 1NWCA 5DRYA 5B53A 2XB6A 3SIRA 4CGYA 2R8OA 1VGRA 3AETA 1NE2A 2ROQA 2FF5A 4UD2A 1F0NA 5CXUA 3HO1A 1R18A 3D3KA 4ERNA 4O59O 3WGGA 5AOVA 3EFEA 4LZZA 1VBKA 5LOVF 1H2EA 1KC3A 5KC9A 1N92A 3HQ4O 1OZHA 2HGZA 3A4YA 2JZNA 4PCVA 4QOFA 1EXMA 1LNZA 2HKIA 3FD8A 3PICA 4I1YA 3VHXA 4G4SO 4EG7A 1NBME 4D5EA 1JPNA 2X8BA 4N0MA 3AU9A 4ZT3A 2Y1EA 4IGFA 3R8CA 3THSA 4C04A 3GJXC 1OLUB 2Y2UA 4L5IA 4HLUC 2X7HA 4GC9A 3IR7A 4FGJA 4WNAA 3RVNA 2D2VA 3WV4A 3ZLVA 5B4TA 4KR7A 3MEQA 1DARA 1N0HA 3CSUA 4H7HA 5D51S 2A67A 1LBEA 5A2QA 1NULA 4YNBA 3A58B 1OKKD 1XCJA 2TS1A 1ULBA 2VJCA 3PEFA 4QPJC 3LS2A 4W1PA 1RKBA 4AECA 1U63A 2XUZA 1LXCA 1RWKA 3K0KA 4JA0A 1L9KA 2XUKA 4CM4B 4DMFA 2NACA 2H1HA 2Q6OA 4O2AA 2UXBB 4OI1A 2IS6A 5EMNA 3PFWO 5DBIA 2OD9A 2GBPA 3O73A 4CDNA 1IL0A 3A26A 2FHPA 5DGXA 3ZV7A 3GBVA 3UTCA 2HCRA 4QC2A 1PT5A 1FTSA 3KSMA 4RV4A 2OY0A 2GO1A 1L4KA 5DK6A 4Z1MA 4CL0A 1YJ8A 3B78A 3L4SO 5K99A 1XD9A 2CVQA 4A23A 2C88A 3U44A 3FUWA 3NB0A 4J9VA 2YVLA 4KO3S 4MGHA 3AOEA 3TTVA 5CFQA 5HW0A 5JTUA 1GQSA 1SCIA 3I0NA 1UL1X 1ANKA 1C50A 4ZI7B 1FYEA 2P2CA 2H5EA 3S81A 2OKCA 3MB8A 4HDAA 1O95C 2HU2A 4KXNA 3ZPXA 1LJLA 4Y2PA 4BCDA 1RKQA 2CWWA 2WFMA 2GPAA 2WE7A 2ZSAA 4HGYA 5AWFC 4PBSA 1UMCB 1E94E 4IUCS 3KKOA 4O0LA 1KJNA 3VGPA 3EHDA 4B4WA 1YS9A 4E1AA 5DSZA 1TEHA 3D2LA 4D3FA 1Y8RA 3WR5A 1XZPA 5JNWA 4R1LA 3TMAA 3WLRA 2BE9A 3A70A 1A69A 2J59A 4WXEA 2B6HA 3PWTA 4D79A 4I1PA 1Q11A 4FIDA 1AGPA 2HJWA 2J8ZA 3H0CA 3RRXA 1G9TA 3WIDA 2E5FA 5TQ2A 3EXIA 1GITA 2GNPA 2HXGA 3M70A 3BFJA 4FMCB 4LYFA 4L72A 4AJ1A 4BMXA 4BTVA 1FPMA 2KWIA 5DN6A 1K66A 1TLTA 2FW1A 1NG1A 1Y4DE 3M0EA 1OA0A 2RI6A 5HF6A 5HKKD 1B42A 1TD9A 2FPSA 5J5CA 2W2KB 3QE2A 1VJCA 3WLOA 2QPAA 1KQOA 1ZHFA 5DLQC 1ULAA 4C9BA 2YHIB 4G01B 4N8SA 2G9VA 2PFSA 1NSTA 2OHJA 1V1RB 1Z2CA 2FW8A 4O08A 4OOEA 1CZRA 2AZXA 3X1KA 3ADDA 1T9GS 3AV0B 1LLQA 3PEUA 4S1PA 3H9UA 1GLVA 4S2EA 2DLNA 5CDGA 2O8BA 1YQGA 2AVNA 2BFEB 2PAFA 1CEEA 1P1KA 1TNDA 2OWEA 2VAVA 2XVZA 4IO1A 3IILA 4R40A 4EZBA 2IIQA 3S68A 4RVSA 1SVIA 4Q34A 3HB7A 1VBNA 5TMBA 1COWD 1FS6A 5TR9A 2AZ4A 1I5OA 3U26A 2CYBA 1PBTA 1U3VA 1MJGM 3DDHA 1E1LA 1N2ZA 4ZQIA 2XNSA 3ZGOA 1JEYA 1XRSB 1YF3A 1FSSA 4WKNA 3DCNA 4F5YA 3H2JA 5KCZA 2MYPA 4U6SA 3QKIA 2B8EA 3RS8A 3WTCA 2H6EA 2QHXA 3E7PA 1XZHA 3TQRA 2L0XA 4DJJA 1OREA 3TRHA 2O6HA 3OF2A 3MAGA 4YT4A 3RYCA 4J0CA 4XQEA 3BZWA 3RD5A 1GV1A 3SKVA 2D0PB 1P6XA 5JALA 5DYNA 1RYMA 4PSAA 3KVVA 4YXWA 3MWEB 4EB8A 2X9VA 4NV1A 2E4XA 1F4VA 2UU9B 3KFLA 4GUDA 3RROA 1V25A 3ES9A 3GDHA 2R1UA 3ZGLA 2QRZA 2Q5CA 4M8SA 4BAUA 5T4EA 3S40A 3NANA 1MOSA 3V3KA 3GA0A 2AD5A 2PL9A 1FLNA 2AQ8A 1N1DA 1U0RA 3C3EA 5AI9A 1YHYA 3H2BA 1RABA 1HM5A 1CZKA 3IH5A 4FFRA 1IK4A 2H2AA 3FCXA 5LZ5A 5C8VA 4HGQA 2WFAA 5BRJA 3GUHA 4PCLA 1Z75A 2ASEA 4B75A 2IUSA 1NQAO 4I7EA 2YFYA 3SY8A 1GL7A 1ZNQO 3QFSA 2RH9B 1G3QA 1DIOB 2UYQA 4IRMA 1T6XA 1FB5A 2QLLA 4RSGA 4UC0A 3WSWA 4Z49A 5EUMA 3AHJA 2AC4A 3CPSA 4I4TA 2VPYA 4RNDB 1NASA 2W6CX 2VJYA 3EMVA 2HU8A 3RS5A 1V6AA 4AN1A 4F5WA 3NT4A 4KO8A 1LLFA 1RQ7A 2WWVD 4I08A 2WIKA 3C7TA 3KDPA 1DBVO 3HYNA 3TG2A 1O0SA 4G1FA 2L17A 3OOSA 4OYLA 2W70A 3RK1A 3D4NA 1OU0A 1VDMA 3PT9A 2PIDA 4F6CA 2VR1A 1WJGA 4C1NA 2JLVA 3K1AB 4ZIRA 4Y2JA 1F5SA 3H9GA 2H11A 3Q7TA 4Z4CA 1ORRA 4ZRNA 3VKWA 2QVLA 4KO1S 4YIHA 3KQWA 1GNPA 1XCGB 1IJEA 2QRNA 2CNBA 2OC4A 3FNBA 3ZQUA 2Y9MB 3CVVA 5KDDA 1P3DA 2P68A 4DE5A 3D4IA 1KEEB 1LFDB 1OFTA 2P9TA 3PZRA 4KKXB 4ME6A 4N5LA 3WI7A 1XXHA 2XOEA 2H4JA 2VRCD 1C2YA 1LBQA 3THXA 4INAA 1GTRA 2X4DA 4LY6A 1JNXX 2Q6LA 3BJRA 5ENVA 1BC5A 1H6CA 4GKKB 2EEPA 1G6KA 3ECAA 1PGQA 2Q5QA 1O4WA 1P1CA 3M6MD 1O9HA 1XMIA 3EC1A 3GL9A 5TDHA 3STXA 2VPZA 3EPPA 4H7EA 2Q3EA 4NV0A 3O4VA 1UXOA 1G19A 2BF7A 3BXGA 2ACKA 1SUEA 2WNHA 4D9BA 3RQSA 3WGTA 2JIQA 1Y89A 1NVTA 4Y2XA 4A03A 3CH7A 3R75A 3LY7A 5EP2A 4CFZA 4MOWA 2M1ZA 3D1VA 4RGBA 2PKQP 3DEHA 1X1AA 4AAYA 4ZDWA 3OUTA 5E3JA 5ITSA 2QMQA 2BFBB 2EJBA 4HDOB 1TT7A 4LJ6A 4YJGA 1RPAA 3GEBA 4R31A 1ZUIA 3I6MA 1UBMS 1UDBA 1LWOA 2ZREA 4ZVSA 4BO4A 5JXIA 3O7MA 2Z43A 3VR3D 2CMDA 1Q7GA 4YAGA 4V1CB 1XZMA 3B12A 1VLMA 2KS6A 1SKUA 1XK6A 2BEUB 3I1JA 3FBTA 3T61A 3FHJA 3SC6A 2E4YA 4WKPA 1P44A 3OZRA 1WBBA 3E1SA 3IMCA 3W5UA 2R6GA 3T4PA 5G4KB 3RHZA 2H8GA 4QLAA 4JJFA 4FWIB 1W46A 3OFNA 2FWNA 2P2DA 4L51A 4TTSA 4NU8X 2C7BA 2VDKB 3LAWA 4FYWA 3G7NA 4KWHA 2KE5A 4Y67A 1SVNA 2GWHA 3IJEB 3SS9X 3AZQA 3JD4A 4P7BA 3DOEA 2NM0A 1SRRA 2QQFA 3RVSA 1MB4A 1VMKA 4RVCA 1C9YA 1Q22A 1DC4A 4TTIA 4W99A 2A0FA 3BHIA 2C0QA 3CEPB 3IAFA 3LNCA 2IGTA 2ATIA 2ZQ5A 4FMPA 3U4AA 2ID8A 3DPUA 3E61A 1DE0A 1JIXA 1M7HA 1YZVA 3HTXA 4GT1A 4URFA 5E4YA 2ZBQA 4W9MC 4V0LA 3PDCA 1VJ1A 3I12A 2N47A 1JWLA 1TU0A 2P4UA 3DXZA 1JJ7A 2EKQA 4H7FA 1XQVA 4N0PA 3BCHA 3NBQA 4NEGA 3C5WP 1TTHA 1YQUA 3ADOA 1FMTA 3T7TA 1ESNA 4KQ9A 3WNCA 4DIUA 1MZVA 1Q20A 1Z28A 5BUQA 4ZHQB 5TMPA 1TTTA 4E1BA 3N8DA 3RABA 1CZLA 2G72A 4RCZA 1RD4A 2YQ5A 1V11A 5COAA 3UYLA 4NARA 1LC0A 4C4SA 1EFHA 1TJ4A 1JKIA 2P9CA 1K8ZB 2VT2A 4NE2A 2R6CA 5DOZA 3KE8A 3T1VA 5ICSA 3IQDB 3LTEA 1O5IA 2AN4A 2PGNA 1AZTA 3AY7A 3JR3A 1N9ZA 4RVOA 5U4QA 4QVIA 4ARAA 4LYAA 3SIWA 1SCJA 1Y33E 1P0CA 1NAHA 3LT1A 1NV8A 3QPCA 2I3AA 4BB0A 1P2DA 4EW2A 3IP7A 4GM0A 4IDOA 1K68A 2JATA 3THRA 1AHIA 3UJ8A 2FKAA 3EIXA 1F3OA 1Q92A 4GW3A 4IV0A 1NBMD 5TE9A 2Q3DA 2IODA 3B1XA 1ZY2A 5ITZA 4QXOA 4UZEA 1GSAA 2JLYA 3U3JA 3B5EA 3QEAZ 2HK9A 4LF6B 4EY5A 4RF5A 3A6PC 1T3GA 3LBIA 2EG9A 2IBMA 3HY4A 3OZFA 3F97A 1YBFA 4HBGA 821PA 3ZX4A 4C07A 4JJGA 3EX7C 3VOAA 3ICPA 5KKNB 4RKWA 4O4LF 4LGYA 1R7RA 1A8IA 4HEQA 4A8JA 4CM1A 3S5UA 1SZPA 2ZIXA 4EVQA 5JZVA 2A86A 2XZLA 4XVUA 3N3AC 4IDFA 2FMXA 1HL3A 1Y81A 8ABPA 2FN3A 1X80B 1JF8A 2HA5A 1FFAA 1FQKA 2I4LA 2P0YA 2RHBA 2TRSB 3CUTA 1E79D 1EJ2A 4NJMA 1U3WA 3TAUA 2FZKA 2QTVB 4JJIA 5KKCA 2PTGA 3AHDA 5GIPE 4TMVA 5LD2C 4IFTA 3R3ZA 3DO6A 3SJCA 4HDMA 4BNVA 3ZD9A 3RWOA 2ZE8A 4RTPA 2FUCA 4M9ZA 3PR2B 3DR5A 2YY5A 2CCGA 1E0KA 3QQ5A 3RUEA 4NXMB 2ZJ7A 2K87A 3CUWA 4COOA 4F4DA 2CK3A 2O1XA 1U28A 3WMXA 4CM9D 2XCSB 3GZ4A 5ADUS 1KVRA 3IHKA 2XI4A 5SY4A 4AQ7A 1RQNA 3B9BA 2R68A 1YASA 2C9DA 3S7ZA 3PXDA 5LB4A 5LP6B 4MV4A 2BJVA 1I9CA 4CF5A 2W7TA 3ZTWA 3IQXA 4GX5A 3EQ8A 2N42A 3L6OO 4FZJA 4U39A 3RTGA 1KWGA 2Z1MA 4B2YA 3R24A 3WK5A 1RJ9A 3S4YA 4DLLA 2EOAA 1R6AA 1WETA 3WKBA 2X13A 3DPIA 1U1EA 1PWZA 2D5CA 3QPVA 4L5YA 4MSUA 2AMVA 1JS1X 2KHZA 3EN0A 4U2GA 4Z54A 5JNTA 1DLJA 5LLSA 3CRVA 3OHSX 3NXSA 4Q1CA 2CFTA 3EDQA 3T5BA 3U3RA 1IQRA 3Q88A 4KXUA 5FBHA 4DEXA 1I6LA 2RH4A 1L4UA 4RACA 1A95A 4EFMA 4LF7B 4ILKA 4MWBA 4P2BA 3VR6A 2AMYA 1C29B 2Y99A 3D4BA 4TUYB 2HLPA 4NCAA 4YTEA 2JAUA 4ZYYA 3BTVA 1EP3B 4ZOBA 3PFHA 3T7CA 3E35A 1BXGB 4Q12A 3B7WA 3B6ZA 2HRZA 3GZNA 3K9LA 4KAFA 1Q21A 2NN3C 4C2AA 2WNIA 3A2MA 1E2LA 2CKMA 3P9SA 1BX3A 4Y2HA 4IKPA 5ELLA 4I1UA 1T4CA 5BPFA 1DUSA 3N2EA 5ADHA 1JXMA 1FP4A 2NAPA 3BF7A 5K0BA 4OI2A 4YYEA 4WN3A 5J2UF 3KDAA 1Z47A 2RBGA 2OBYA 1DBQA 1WUTA 3SJZA 4ZTUB 2H3EA 4CQLB 1KP3A 4E5KA 1T1SA 3WB2A 3M6AA 4IQ0A 5CDHA 3DTTA 1H2BA 3GDOA 3I3SR 4LDPA 3PX7A 3PP8A 3I1IA 5LQAA 4DLBA 3FGPA 4IJKA 5FL7A 2XMGA 3MHTA 1W75A 2VXYA 3L82B 3TIVA 5JEEA 2O8DA 3NASA 3UMRA 1XHEA 1N7HA 5CD1A 2BRUC 3KLPX 2IV7A 2J9FB 2NZ2A 1SXPA 3QJ5A 3R7WA 2GN2A 3V8VA 1GYPA 3NATA 2VDRB 3PQ7A 1YAHA 1JMVA 3RK4A 2GDJA 3GEEA 4R2KA 3HGTA 3ZUGA 2BKAA 4QFDA 1ISIA 2ZAOA 1G8FA 1SZJG 1T9KA 3TKYA 3LUPA 1ARZA 3KT0A 5KVAA 3IRUA 2NU9B 1SMKA 2H17A 3LYHA 3QF4A 1G8HA 3D43A 2DKFA 4K81B 1N6NA 1C7IA 4GNKA 5CX1B 3WRYA 4EBBA 3O3OB 2REQA 5ABPA 2FGKA 3ME5A 5FWNA 4HLUA 5DULA 5AOCA 4FDMA 4RJKA 4KAAA 3L7MA 4K5QA 1KI2A 3WJ7A 3WRVA 2QLFA 4AC9A 2QENA 3IB6A 2H63A 2BBTA 2B20A 3FR8A 3O2QB 2Z08A 4X7MA 5BNZA 5KX5F 3TF5A 4S1OA 1Z83A 5HKBA 1P0IA 1FS4A 2WYWA 1KWKA 2ZDQA 3A4LA 3CX8A 3RF7A 5DHQA 5HMLA 3SNHA 1QG6A 4MPTA 4KRGA 2GXUA 4C7VA 4W5QA 1LH0A 1W4BA 2P41A 3BGSA 5LA6F 3GJQA 4B3CA 4YI5A 1M34E 5BVGB 1SOMA 4MLPA 2EP7A 5CIYA 1MQ9A 3AVYA 2XXAB 3I34X 1LA2A 3L6CA 3BGOS 4REMA 2YR0A 3T94A 4PGFA 4I6EA 1ZCJA 1WCIA 2EC5A 4LZLA 1QDEA 3WGNA 3L1UA 4AKIA 3MOSA 1KOFA 4WY2A 1XTSA 1DCTA 1OX5A 2NSLA 3C6ZA 4Q37A 4B2PA 3PT5A 2DSTA 1OXSC 2O9JA 2RK3A 3QRWA 5KHAA 3NTQA 4TKVA 5JVDB 3RUIA 1TVKB 4PLZA 4R2WA 2FGJA 1HLFA 5I3CA 3EIQA 5JCJD 2ZTSA 4KN8A 4DM3A 1F7VA 3M4JA 4UUNA 3CUEF 2JDID 4FHEA 1KYXA 3FPAA 4KQHA 3INYA 3O92A 3KDSE 3QEKA 4GGMX 3GJ5A 1H4VB 3IPAA 2J3KA 2G1JA 5B1DA 4ZMSA 2VJMA 3D6FA 3KFVA 3NORA 1UJ5A 1D0VA 4I36A 5LYJF 1VKRA 2FMIA 5I5EA 1D9XA 2OOKA 1AKVA 5JMPA 2C04A 1YA6A 1C80A 1L7XA 1NF8A 5C1OA 1G1MA 4G0ZA 3QVLA 4P5PA 1HOXA 2BGUA 1QGAA 3UGQA 3QW2A 4D8VA 1GR0A 4FFMA 1CUVA 1YBHA 3DAGA 3GR6A 4MA0A 4IIEA 4OQDA 4C5BA 3DBLA 4EGFA 1N75A 4OXYA 4LBWA 4YAKA 4GKJB 1BDIA 1YCHA 1F51E 2ORIA 1NZDA 1ZGHA 1OT5A 3F1KA 4EJ6A 4YAUA 5KTRA 5C52B 4NS1A 3QU2A 3RSZA 2PWPA 1TYCA 2W0MA 4QHSA 4B3DA 2QNIA 1P7PA 2ZUSA 4GD3Q 1Z0AA 2GTPA 1V3QE 2P3SA 1NFQA 1WW8A 4QDUA 2X41A 4UEWA 1K97A 3CZAA 4Q7MB 4ETMA 2VSFA 2O5CA 5BN1A 1U1FA 1XNGA 1PJRA 2QTGA 4A10A 3BXHA 3ONWA 4PV7A 4M0LA 2I7XA 3MFQA 3KL2A 2R66A 3GEMA 1JEOA 2QNRA 2I5PO 4I2NA 1BDHA 1QP4A 4OJMX 1V9CA 3R3VA 1JQEA 4D9EA 1BCRB 1BKSB 1K5PA 2R6HA 5J9FA 4CDRA 3P5SA 1MW9X 1DVRA 4KN5A 4RY0A 4EJSC 2ZRHA 4ZICA 3C3PA 1D2AA 1YZQA 3BB4A 4L0CA 4NX2A 5LQKA 5FHRA 1PK7A 2IEYA 2IPNA 3LL7A 3OZWA 1U0HC 3PC2A 4GRDA 4JOQA 4G56A 4Z9YA 2P5UA 1YDWA 4BQNA 3TL6A 4DLTA 4ZK6A 4FC7A 4MYCA 4LCBA 4IFEA 4RK5A 3P7MA 2Q4TA 3L7YA 5CH3A 4LXGA 2IV3A 1YKFA 1J5XA 2JCBA 4M7RA 3TW0A 2XTNA 4EPRA 3I64A 3K5WA 5JYBA 1HO3A 1PHPA 2QM8A 2ZXEA 2JEZA 5H8WA 1O96A 4INZA 4PG8A 5A5GA 1S89A 3F49S 3U4DA 2P67A 3O8QA 3T0FA 1AIPA 3NTVA 4NCKA 1TQDA 4XI9A 5BQ3A 2VTBB 4H3HB 1ZEMA 3X1XA 1V4VA 1VSUA 4V0SA 4BQEA 3UJDA 1UEXC 1OE0A 5CPFA 3KR9A 4JI7B 2OZVA 3T7RA 2WIGA 1TAGA 3BKXA 4OX9Y 4C4TA 3TFQA 3V48A 1L9XA 1TLFA 2HY7A 3LY8A 2BBOA 3OE4A 4P4NA 1ZK2A 3LX6A 3OZCA 3UT5A 4D8WA 4ZEVA 2WHRA 5A7FA 4ER3A 2JB9A 2P79A 4KI7A 1YUMA 2VSYA 1KOLA 2O54A 4S0ZA 1ECBA 1VZ3A 1MDBA 2ODPA 1FU4A 5BUZA 1E2HA 5FLKA 4C88A 5ALVA 1SC6A 3RGGA 4PO3X 2PZKA 3I2GA 5C7YA 3NHLA 1LF0A 3HWX1 3D1LA 2QJTA 2RHMA 2CW5A 5F5LA 2ERYA 2DQKA 1Y98A 1PX2A 2OGSA 2PSFA 3Q8KA 3BMOB 1ST3A 4BU0A 3VPHA 4D0GA 4RU1A 4G36A 4G5XA 2O2XA 3T99A 2OB2A 1EZ4A 2R1ZA 4M49A 5FFNA 3O93A 3NM6B 1Y7HA 2ZULA 2CC2A 2XT9A 3TFWA 4MR8A 1UQUA 4US2R 2WG1A 4OAQA 5DDIP 4Q18A 1VYVA 4QYIB 1W9HA 4KV7A 2ZP1A 1YZYA 3JQAB 3A1FA 3N2ZB 4ZCSA 2ZSUA 1VCNA 2MSLA 5DCLA 1N0WA 2ISSD 4HQFA 5ICCA 3ASYA 3IOMA 3E9NA 2D8MA 4QGFA 4ZDKA 4G0VA 3JQRA 3RVPA 3PJRA 3NVMB 3V6MA 1E4EA 3DKRA 2JIRA 3WICA 2XVYA 4NFLA 3FOZA 3W5JA 1K7XB 3PQ8A 3BZBA 1N5MA 4EI8A 2W2TA 5C8DA 4JUDX 4UPDA 1X1EA 5DNCA 1JQDA 4YI3A 5H4GA 2YMLA 2NO5A 4KR3A 3TD6A 1EFPA 1G3UA 3WNBA 5AW1A 5KHOC 5JADA 3CLVA 1SQ5A 3JWHA 5JCZA 2GZMA 5AVOA 1YQQA 4YJDA 5CD9A 4FBMA 1H2FA 5EE1A 5CFPA 1X7XB 1K9VF 1Z2PX 2EX1A 2G5TA 5KAMA 1O94D 1AXEA 1CSEE 2IW1A 3ECCA 5FI3A 3WS7A 3R9WA 1CFZA 4PYRA 2WEKA 4PFQA 3D8RA 5ER9A 4ENSA 3V46A 2SNIE 2XYVA 1XHLA 1D4FA 3AONB 1C1DB 1IZZA 4Z2AA 1K0UA 3GVCA 1JPVA 5FTJA 1P2SA 3MWDB 5ALPA 3UT0A 5HQJA 4WN9A 2ANBA 1HUQA 3R5TA 5KQMA 4FYMA 4LMBA 1G2IA 3C6KA 4JNKA 1FSFA 1LTQA 2CLDX 2KM1A 1RC1A 4KN9S 3VPAA 5A03A 3TGPA 2CNWA 2QJWA 3H11B 4XIGS 1L4MA 2VHXA 4O5AA 1VLQA 3GFOA 3VV2A 4AIRA 1WUIS 1M1NA 1JU4A 1PUXA 3PQ6A 4DYDA 4B3RB 2YZ2A 4CNBA 4OXKA 2VLIA 4HSEA 2F7SA 4DSUA 1SU6A 1NMSA 1RM5A 2D1RA 2VATA 4H0CA 4XX1A 4XUCA 4LC1A 1N9GA 3JXEA 4K9DA 1VLZA 1KZGB 5J63A 2JF0A 1YQTA 4MVJE 1WTCA 4YV7A 3EA4A 1W36D 4XJVA 5A4KA 2A2ZA 2RGYA 3WZMA 1NN3A 4MWCA 5BSUA 1PV2A 5KI6A 4X45A 5L3SA 2GR9A 2JI9A 3HL0A 1V3VA 1KIMA 4QBIA 3SZUA 2H48A 1GHTA 4NYJR 4IHAA 1R3UA 4HNQA 4P0QB 4CKBB 2ZRNA 3ZUPA 3K2QA 2C07A 3BRWA 2C0CA 4OB6A 1F8GA 3BD7A 3AJRA 1G3MA 2J85A 3W1WA 3H9JA 3H99A 3ASZA 3OJFA 2O5VA 3LY5A 5FNVB 3SC3A 3WA6A 2D6FA 4RLSA 2J3EA 1PZGA 2NMVA 4TVOA 3G79A 4UTPA 4R01A 3DOFA 1EX7A 3S6JA 4DJAA 1XNJA 3UVEA 4WZBA 4F3CA 4FR2A 5JHHB 1CUJA 3Q15C 1RWMA 2VNHA 3JPYA 2O5RA 1C4OA 3CLUD 1M6NA 4JT8A 1APBA 4XQGA 1ZGGA 1RM3A 2XNJA 3FCEA 1PFQA 1FX0A 1U5BB 1XO1A 5LM3A 4LDAA 3A37A 2FUG6 2C96A 2QE7D 2VHYA 3ILVA 1XALA 2IYFA 3F7TA 4RTJA 2CLMB 1TZ2A 2B21A 4KJZA 1UM9B 5TC4A 4E6PA 2NUAA 1OI4A 2YNMD 4GNRA 1SB9A 2G0NA 3A11A 2O59A 1D2RA 1R4NB 1W0KA 4B83A 5EE9A 1EK2A 1KI7A 1L0BA 2IIPA 2PKQO 3PUIA 4OJTA 4D9GA 1SY7A 4EEKA 1B6GA 3JSAA 1ZHOA 5FTLA 3OOHA 3WJ1A 1PWHA 3FXAA 5K2MA 2GLTA 1Q0RA 3HVKA 4CCYA 2ZANA 1PR3A 2ZRBA 4LZOA 2R6ZA 3BPSA 2VOJA 3DTNA 1MO3A 1L4GA 3IT2A 1UMBA 1V8OA 2PX0A 2AUNA 4FGWA 2QSZA 4Q9NA 3NAQA 4Y6PA 5IKOA 2DOKA 4XVCA 2QTAA 2PK3A 3Q3VA 3RSLA 5LXTA 2WQZA 5B3JA 4QU8A 1A7UA 4OTZA 2LRHA 1HDCA 2ORWA 2XLBA 3PPXA 4IQ4A 1LRJA 2ZJ6A 1N5RA 3MQ2A 3Q2KA 4HP8A 4ML3A 4B8YA 1YWGO 3RRJA 1YL5A 2UUCB 1QPGA 3JATB 1IXRC 4LK3A 3QMWA 4KGDA 4MS4A 3G5LA 1M2WA 2R2AA 3MRVA 1OKKA 1NYQA 1UK8A 4QBFA 1II8A 2EHJA 4TYQA 4YUZA 3FPSA 5AKXA 2IZ7A 5SV2A 3P9KA 5IDXA 1M66A 4X8OA 4D96A 3OF3A 2GJKA 2FSHA 5LZ2A 4DDVA 3LA8A 1K4YA 4X1IA 3AU8A 2C4TA 5EJ5A 3T5GA 1N36B 2LIVA 3MMXA 3DD5A 2ZYRA 4MKGA 3CZRA 1EZ1A 3DYBA 1ZC4A 3GO4A 2HX1A 4BWVA 1WHSB 2I34A 5B2ZA 4LRXA 1G4UR 5CFZA 4ALLA 1BA3A 5JUWA 2YY7A 3UY4A 5LYYA 4K6OA 5BMVA 3A1UA 1X74A 1SJ9A 3DTVD 1U7TA 4HN4B 1Z4PX 3S1AB 3ZBUA 1N6KA 2W43A 2J3HA 1N0VC 2GCNA 4J7CA 5B1EA 5JPCA 2IUTA 1QRDA 2CLIB 2GAIA 1WCXA 2BHRA 4KX3A 4MGIR 3ZLBA 5A5DA 1HG1A 3FNHA 4CHGA 3A1EA 5BYBA 1E9EA 1WKCA 4CRWB 2I6UA 1H4SA 1ZNWA 1FMJA 3QEMB 3CKKA 3EULA 3ZHVA 2YOGA 5EUBA 4FMDF 2DUUA 3AIKA 3P2EA 1QGED 2PVSA 3F90A 4KNWA 3I52A 4PVCA 5L45A 3O8OA 4V0OA 2H4HA 1KJZA 1JG4A 4GSKA 4GBGA 4O4HA 1AU9A 1D1TA 4YP6A 1JJAA 3I9LA 5AVSA 5CG2A 2BMEA 2DKNA 4OP3A 3TDKA 3H5IA 2BRUA 5DIFA 1JDUA 4QUEA 2QTNA 1A27A 3N2IA 4ARBA 3OESA 1QX3A 3GFFA 1JEJA 3IQIX 4GPBA 5BSVA 3B38A 5EWLB 4L28A 5HBRA 4B9EA 4KIJA 1Z8FA 4DBZA 3PITA 1WXQA 5EPEA 4OUDA 1TK9A 5T3YA 1VQ1A 3GLTA 3R3YA 5AKYA 4WJLA 3K05A 4QYSA 1H2HA 2OHVA 2ZSJA 4KGXA 2P4EA 1TU4A 4I50A 4X7RA 4LRYA 4JLSA 1RJEA 2O4CA 2CMFA 2RGCA 4K9QA 2I7TA 4O2RA 5G3YA 4RCVA 3VKUA 1FXUA 1IC6A 1NT4A 1NXPA 4MS1B 4O4IA 4QLOA 1BJRE 4B7AA 1A5AB 2BM1A 5D1HA 1IQ0A 5GOTA 3AGQA 3TLMA 3EZ2A 1W9MA 2HGSA 1T35A 2RGRA 4A5OA 2JBWA 2FR1A 2NSHA 4K86A 3CNEA 2IELA 3I23A 5AOAA 2IFTA 3T4XA 4F91B 3VO2A 1DWUA 5LP1A 1I13A 2XNDA 1DNPA 3DUFA 3TTSA 2OV8A 3NKLA 2IEIA 2D1SA 2WJ3A 3A27A 1OIXA 2I99A 2OM2A 5HFAA 2XMPA 4DL9A 3ZGNA 2QW1A 3HDJA 4Q00A 1F8YA 4MWOA 2OFOA 1BXKA 1COWA 4PXSA 1JHUA 5IW8A 4DQKA 3FB1A 9LDTA 2F55A 1SK8A 3RRZA 4NZZA 5M34A 4GKBA 1W87A 4C89A 1UIRA 5IMSA 2RGAA 1AURA 1KAMA 5DE3A 2HT1A 2Z2KA 1MB2A 1MTOA 1T24A 3AXTA 1NZJA 3ZEIA 4L3WA 1LUAA 3N6RA 4Q16A 1ECCA 3D64A 3O21A 2PZEA 2B98A 4ZQBA 2QV0A 3OZ7A 3BIXA 4RQUA 1A1SA 2WYIA 1AKTA 4RY8A 1NPDA 4PYMA 2AEFA 2WA1A 1HDYA 2Z5FA 4M0CA 1URPA 2FX3A 5C35A 4Z4QA 2MDTA 2L18A 3CURA 3GLHB 5DHUA 1E20A 1U3UA 3DNPA 5ALLA 3RAPR 2O8BB 3F9IA 1W49A 1G2QA 3DQQA 4B43A 3EQ2A 3S1SA 3UUFA 2WD9A 6CHYA 4MEJA 5DBOA 4IDEA 4A1OA 4M55A 1ZZGA 2VNJA 3QLEA 4K9LA 2J31A 1Z5NA 2A0XA 3I4LA 5IBCA 4RGVA 4JHXA 2O3TA 4NE7A 4O2BF 4ZYXA 3NOXA 4CLXA 4Z1OA 1ZRHA 1ESCA 4HUJA 4RK0A 2WILA 2OORC 3QYJA 4KH0A 4KVAA 4NJEB 3VI3B 3TZKA 2G67A 3ET5A 2O1EA 4S1TA 1ODIA 4N4AA 3PQ3A 3LH5A 2B1GA 4P3KA 4QTXA 1QWSA 4WCDA 4N48A 1IUOA 1HXHA 2POQX 1ORIA 4GGPA 4D25A 2V7VA 2VUIB 4W1RA 3KV1A 4BC0A 1PSWA 3WIEA 3OZTA 3ZEAA 4U7HA 3B60A 4Q3LA 3NBMA 1HL7A 3FTFA 2BFWA 4J76A 4G1EB 3ECSA 5D85A 2HF8A 2ON6A 3F3SA 3CZCA 4C4RA 3QFTA 3TR6A 5CB6A 2AWNA 2B4YA 3CUKA 3DB1A 4CMGA 4R2LA 1Z6QA 2FRDC 5FPQA 2K2WA 1GTG1 3BFVA 1RS0A 2QM3A 1Q74A 2RHCA 3D7KA 1QPZA 1UOPA 4GICA 3PXGA 1I1NA 1LDNA 3PEVA 1AQUA 3GT3A 1JQ3A 2OE2A 1BGXT 2VRCA 3GA5A 4IGKA 4MWTA 3P2JA 1U0BB 2WHEA 4LYGA 1SWWA 3K30A 4PO1A 1KSJA 2G08A 5FNZA 1QTNA 3UHOA 3ZE0B 3KAQA 3QPBA 2EDCA 2WM9B 1SEVA 2ZI5A 3IAS6 4FZ3A 1E3WB 2JHCA 3U81A 2JASA 2EIXA 3BWCA 5BSGA 3SEZA 3GB9A 3SYRA 4CWAA 3OBBA 1YUNA 7AT1A 1CDZA 3HKBA 3HADA 4P22A 1HOTA 2QPTA 4PF1A 5GP1A 1YRYE 2D2FA 2F67A 3R9KA 3LOUA 3R7NA 1IDOA 1NIJA 3PRHA 1AQLA 1E2IA 4JOSA 3EF0A 2ATXA 3VPFA 2I4MA 3M6VA 4QNRA 1TF2A 1WPGA 1PWXA 3WGVA 1BHQ1 2PX3A 3HYRA 4HWGA 2GPNA 1E9DA 2VA9A 1WSBA 5CNKA 3VTFA 2V65A 2WKPA 1E5TA 5EWMB 4B73A 1Q1QA 1K63A 1UEJA 2O23A 3JAMA 3JQEA 3TH5A 5LMCA 3G0HA 4LZAA 1R1DA 4QDTA 1UPTA 4EELA 5CAEA 3M4NA 2NQ8A 3VZDA 2IX9A 4RWZA 4DC9A 1O94C 2P27A 1V1MA 2XB9A 1UAGA 1Z0UA 1SBQA 2Z9CA 3LQ1A 4UMDA 3T7SA 1CDDA 1CV2A 4Y6RA 5IVIA 5JCOC 1OZAA 1FSGA 1HDRA 4Q7EA 4Q0MA 4U2FA 4XQCA 5K51A 1JEAA 1TFRA 1J25A 4ZVMA 1JGTA 3OO1A 3COVA 1SA0A 3KAKA 3FYTA 2CWDA 3W6OA 3ZV5A 2VQEB 3VU9B 1CBUA 2VCEA 4ZRMA 2PPLA 2PQ0A 1T8WA 3HBLA 1LPMA 5DBFA 5FBLB 3TJRA 3UEOA 5A3QA 5LLDA 3MZ0A 3N7TA 2QZ4A 1RXYA 4BNYA 3M49A 5CBPA 2JH8A 5FT9A 3STTA 5CRIA 3VYSB 2QRQA 1VHJA 4Q5IA 5LL6P 1T36B 4C3UA 5ESWA 2FPOA 2I55A 2XIJA 1UAAA 3V1UA 2H4XA 2XUFA 4QOSA 1G5RA 4DSNA 5MHTA 2WTXA 2R96A 2Q3LA 4XH9B 4DDMA 4L4SA 3D6UA 2EXXA 1FDVA 2ILVA 2ZQYA 4EKDA 3TUZC 3JQ6A 1A4RA 4R98A 2I87A 5TGDA 3A6JA 1CUUA 1T29A 1IXKA 1JW9B 2E0IA 3L8DA 4BE7B 2X9NA 3AUJB 2JIMA 5HJ5A 2X76A 1QWOA 4F4HA 4D4GA 1W36C 4MW4A 3LSYA 1TEXA 1J70A 2YBDA 2PSDA 3UK0A 2BJWA 4ZAVA 5CFMA 4ZT2A 2W6NA 1OV4A 1AHNA 4WNCA 3B3AA 3O84A 3VSAA 4IG4A 1HTBA 1RTTA 2BL4A 1SM4A 4FGLA 4MUGA 1TU3A 1SUCA 3DNFA 3JPWA 3GEGA 2D5BA 2EBHX 3EGDB 4F6RB 3I39X 1M2JA 1CULC 3HJTA 4BIMA 3P2OA 1EM6A 1JSXA 4TSRA 1NBMA 4UE3S 4BMOB 4EPVA 4EOGA 2FRXA 1H2WA 1Z6XA 4YN3A 2PU5A 4Q4JB 3VR5D 5IK2D 2I76A 3GQBA 3HP1A 2OAEA 1QTIA 3GJ4A 1EUCA 1NNUA 3NC1C 5CA1F 4L9WA 3EBPA 3ZZUA 2IU6A 2NZJA 1IBSA 3DBOB 3KHTA 2GGSA 1KE2A 5HDBB 3WY9A 2OBFA 2Z58A 3IYLW 3CLUC 3G8CA 5COQA 5FUWA 5FWDA 3M33A 4K46A 3DXYA 4QOJA 4U7TB 1KY5A 3HXQA 1MNAA 3NP9A 1V96A 4QUKA 1QRAA 5T57A 3AP2A 2A94A 3H86A 2ID7A 4JQZA 2BWJA 1XLTC 1JLLA 1ZIOA 1Z7EA 3RJTA 4BS9A 1E79A 1WBDA 1KVQA 3WHIA 1U11A 2F1OA 3PNPA 2YNMC 4Z9XA 3HRIA 3SF8B 2FWIA 2AYYA 2QXYA 3MOGA 4O1IA 3MELA 1NMQA 1SZDA 3AFOA 4P3YA 6Q21A 3VO1A 1ZUNA 4INOA 4Z0PA 2GEFA 1DKLA 2WU0A 3GCXA 3X1JA 1W8IA 5JAMA 1ECGA 2VP9A 4U63A 2B92A 4DR1B 5AYVA 4KQGA 1C7ZA 4GLBA 2XGGA 3FWHA 4KODA 5EHIA 3TW8B 2J3LA 1NKSA 3KT8A 2WR8A 3OX4A 4K9PA 2A4KA 4B5KA 4MICA 1AK9A 2V54A 1CR1A 2O7QA 3D4OA 3NW9A 3CBQA 5HMMA 4BMZA 1R37A 4FHCA 5BOSB 4QWMA 1CQZA 4LXXA 2PLWA 2Z4RA 3HBFA 4TRJA 3V00A 3ISTA 4MRMA 2ZJ5A 4RF3A 4K9KA 4MDEA 2COEA 5KCMA 4LFAB 2PGJA 1I5RA 3BH6A 3O75A 4F3YA 2UUAB 5IC5A 1HMPA 1ONPA 3NM4A 3UO8B 1SKYB 1LPAB 1LZKA 3G2IA 3R0XA 4JMPA 5T4BA 13PKA 4QPZA 2V1XA 5J1TB 1L4FA 3CNQS 4ZVUA 1RPNA 3EY4A 4R51A 1II9A 2ODEA 3CR8A 2ZUEA 2ZR9A 4PANA 3RREA 2O07A 3KUCA 1Y1QA 5AUPB 3EEYA 5I7EA 4O4JA 1XU9A 4W6ZA 2O3RA 3IMFA 4RDCA 4IH4A 3RVOA 3IJ5A 3ZD8A 5A7GA 2C1XA 4G1BA 1ZPDA 1WXDA 4FTWA 4HWOA 1R0LA 2IYVA 3QJYA 4JJ7A 4LYHA 4TV9F 3SJ7A 1HEYA 2GPBA 4P54A 2WSSD 1H9CA 1HZZC 4HFMA 4TQUS 3V4OA 4G63A 4KDEA 4E22A 2P9GA 3GDFA 2IITA 4FDTA 4YGYA 1SQ0A 3TMKA 1RXWA 1RYZA 1WZCA 2ZT7A 3GNQA 4RVDA 3UJ7A 4ER6A 3G7UA 3OA0A 1LDGA 5HFJA 2F1IA 5HTOA 5EZQA 2UYOA 3QI7A 1RKUA 1XPOA 3NPAA 1NJGA 3GCDA 3NCTA 4DCUA 3P9NA 1QYCA 1TZKA 4CEIB 5AP9A 2HF9A 4CG3A 2A30A 2P5YA 1YFJA 3LX5A 5GADl 4GYWA 3KKKA 3CF4A 3GP5A 4HD8A 3FTQA 5IJZA 1NXQA 3EIWA 5T5QA 3QHAA 5DHFA 2YH2A 2VBGA 2OUIA 1DZ3A 1VG8A 2GZ1A 2CDCA 1XZAA 3P4UA 3F5SA 1XZJA 4NF2A 1DXOA 5H7XA 5KKAA 4K9OA 1C7RA 4R8MA 5EOVA 4P3OA 2FOIA 1DG1G 2VTEA 5FV7A 2AKYA 5SYAA 3CE9A 2HU7A 2V3VA 3FMPB 4V0MA 3TJZA 1QP7A 2EFCB 3GPIA 1KFBB 5F1KA 5GJVC 1MABA 1DZIA 2PNFA 3DHYA 2FSFA 2QRPA 1RT9A 3JRNA 1YIDA 3C74A 2WAAA 3KU1A 4MKZA 3ZOZA 4PICA 2OCBA 4GRAA 1UAYA 1U9CA 4QT4A 5C53B 4KSBA 2PUWA 1YDFA 3WSVA 3FSGD 3I5XA 2O8EB 3UJAA 3GZTB 4HRAA 4BOYA 1W94A 2ODBA 3CFYA 2CB0A 2WLTA 3FRJA 1L5WA 3ACDA 3DPSA 3U7EB 5IM4A 2Z1NA 1PTJA 2LTAA 4TROA 2JKZA 4I19A 1AY0A 1LI4A 1SUWA 2JCSA 1IB6A 2BE7A 2WZBA 3E22A 2C5EA 2JS7A 4YT8A 4J0EA 3U6KA 2XBMA 5FB3A 5BO5A 1UZMA 2P9BA 1P5HA 4FKZA 4F8JA 5SY6A 3L41A 3PJDA 2QYHA 2P0EA 2QUZA 3BQMB 3A2KA 4JX8A 3B7PA 1WM1A 1VB3A 4N54A 1UXIA 1HDIA 4E5VA 5AK3A 3CY6A 3JW8A 3I9NA 1WCWA 3IA2A 4AJ4A 3F73A 3KYDB 4G5HA 3RTCA 5F7XA 5D5QA 2HL6A 1KIAA 4B3GA 1ISMA 1BU5A 2IPOA 2PA0A 4LHEA 2C03A 3K8QA 4P5EA 4RAOA 1E2JA 1G41A 1RLOA 3LC2O 4J0DA 1JV2B 1T9DA 3EXAA 3LUCA 4XFKA 4JJ4A 2QR5A 3Q6IA 3CLRD 2WJIA 2GRUA 5CH8A 1VHTA 4TXLA 5JCJA 5HS6A 2HLNA 3CM0A 3NRBA 5AK4A 2VZLA 3OFVA 3MCZA 4CCSA 4B84A 4JJZA 3JAWB 3OLCX 3T3NA 1UPAA 3ZDCA 5DYYA 2HK8A 2ZSKA 3GMTA 5CJ2A 4LE2A 1SG9A 3L7LA 3MT7A 2W6JD 4NG4A 1GO2A 2HDOA 5DXAA 4BQOA 2BR5A 2XR1A 3DYVA 5FBRB 1X92A 1K1EA 5AD1A 3W6ZA 2HMWA 1I0LA 3BX1A 1NG9A 4RL6A 2XDWA 2WMOB 1X13A 3HGMA 3QOXA 3AY6A 2NUTB 4FNMA 3WLJA 1SVOA 3I2IA 1ZH8A 2YWXA 1V4BA 2CXQA 5CT9A 2ZUVA 4CMKA 3MCUA 4Q1VA 4ZJYA 2AF4C 3PNLA 1FBTA 4MDYA 4LPSA 4Y6QA 4HQRA 3VOTA 3ZNQA 1XFDA 3BIWA 4MV0A 1PD1A 2C57A 4JI3B 2II6A 1K75A 5JFOA 4UBIA 4YO7A 3IVGA 4FCCA 2BKXA 3P71T 4H1TA 4XX0A 2X3UA 2VBIA 3UOWA 4AY3A 4HAUA 1IXSB 4OXIA 3BMXA 5HUJA 4EDFA 1FMFA 1R0CA 3OH8A 4BHTA 4QWWA 2FJ0A 3CQ9A 4H4CA 4G5OA 1YK1A 2ZBRA 1P9OA 3S2EA 4DR2B 1XPRA 3KQQA 2O50A 1W5SA 4HVAA 1HT0A 2C2WA 3G2NA 4F45A 1NBWB 1XGKA 4ZZ1A 2QMOA 5LBIA 1XEFA 1VIDA 4IICA 1L5SA 3K0HA 1L4HA 4HCJA 3CEJA 3Q7QA 3RSFA 4J94A 4BMVA 1O6CA 3ITDA 4MCIA 1B74A 2UXCB 1CUAA 4KOEC 1OAAA 2YW2A 3H4MA 4AYXA 4UM9B 5T8KA 2A35A 3G0BA 2C5GA 4MQMA 4U6QA 2FPIA 2GZAA 1EBBA 1TC1A 1UXKA 4AQYB 2XSZD 3BREA 1IPFA 4LC9A 5KSWB 3NV7A 3V7NA 5AVVA 1T2AA 1NI4B 3ZWWA 3AM1A 1QYVA 2VKTA 4YRIA 3O2SB 5AUNB 1JKFA 4R41A 1OXKB 1OD6A 2CLKB 3KYCB 1P73A 4GR4A 4KL8S 4UM5A 1YBVA 2ZJAA 2ZBUA 5NULA 1U4NA 4Q6BA 2Q3CA 4WKBA 5M29A 3D81A 4K2HA 1F2UA 1SCQA 3LWBA 1EXNA 1A4XA 1P2VA 3HDQA 4MI6A 3K0AB 4H7DA 4N7BA 3VSCA 2QQ0A 3EG9A 3C8UA 2ZRLA 4H6WA 1UCFA 4NU6A 2Q2NA 1XZDA 1ZNXA 2IEDA 2JFOA 4Z51A 3BB1A 2OORA 4CL3A 1Y5IA 2C4KA 5AVKA 3A3YA 4MV9A 1JHMA 1G2PA 3N07A 4FEYA 2IT1A 3FPGA 2VPIA 4BEJA 5IJAA 4DR4B 1THMA 1C9EA 1J8FA 1YC2A 2Z98A 3FGNA 4WT7A 5C34B 2GEBA 3EC7A 5E1DA 4F1KA 4FQ5A 2YWJA 1B16A 2FN7A 3NBAA 4GUAA 3FVTA 4NFSA 4Z4GA 1KU6A 3CT4A 2XKJE 1T2UA 2FP4B 3P45A 3BJZA 4N0EA 4WZAB 4ZAGA 3UKOA 1KMHB 3X1DA 1PJSA 3SDSA 3T1YB 2WD7A 2HCTA 3CO0S 3LCMA 2XCQA 4CTKA 2F8TA 1JT9A 4F56A 2QP3A 2VDJA 4A0GA 4R81A 3CG0A 2A1IA 3WQHA 1G3IA 4XDGA 3ZQ6A 4MUNA 1KZ7B 4PAQA 2FRDA 5H5JA 2IC5A 3QMMA 1ZOPA 3L8FA 4ESOA 2FWPA 2VYCA 2G6BA 3GGOA 1T4GA 4ZK2A 1W73A 1T1IA 3DMTC 4CEJA 1RMYA 3I8OA 4Z9AA 1PBNA 3WL4A 1DQYA 2IEZA 2WJ4A 1AKWA 3GJ0A 3JRWA 4RY2A 3BWDD 1BWRA 1YR9A 4QU9A 3T5MA 4B32A 2C0PA 5BQFA 2VIIA 1Y7LA 1YBMA 1IOZA 5LDGA 1EH5A 3DV2A 1E8DA 4AW9A 1U7UA 2C2HA 2G8NA 2YBEA 3O31A 4Y6LA 3U1VA 2FEPA 5K0FA 1N57A 1T9CA 1N9KA 3PE6A 4DPLA 2NUPA 3QV2A 1SUFA 1DJOA 2CXOA 2V9CA 3E7XA 4CLOA 1U7WA 1YS2X 2WYUA 1YCFA 3EAQA 1NP7A 2BEWB 2EYQA 3RYIB 3I8XA 4L76A 3ZI0A 4HYEA 4ADSG 3DE1X 4TXMA 3AESA 1T2VA 2UXDB 2B8WA 2IPMA 1ZP6A 4JBWA 3FKSD 2JAOA 5FR1A 2QRVB 2R00A 5IVPA 2IEBA 2W6ZA 3F1LA 4KYTA 5ALDA 4ZU3A 2KBEA 1E5VA 1H8ED 1OWOA 1J7JA 3QHQA 4JYBA 1A7JA 4B6SA 2YJZA 1OYWA 1A0OA 3OT5A 1K9SA 3Q3GE 5FUYA 1MX3A 5BR7A 4YR9A 3KP1A 1QG0A 3DULA 3KOMA 4LSGA 5LB2A 5BR1A 3AKZA 1ECPA 3K5PA 5A9RA 1PVOA 4GLOA 1XDWA 1QH9A 3HV2A 4ON9A 4EO7A 4GDFA 1M0TA 2H4YA 1HEUA 2VL7A 3BA1A 4B82A 4B3JA 4WEQA 1LTHR 1E6MA 1RLMA 4JD5A 5B7NA 3PCTA 1P7WA 3N7UA 2CXTA 3GXBA 1Q0PA 1Z39A 2I1VB 2PL3A 4HADA 3W3AD 1K6JA 1GAJA 1MIHA 1INLA 1S3IA 2W5UA 5JCOA 3KJEA 3USCS 3SVLA 4MYRA 2VP4A 4BO0A 7REQA 2WWGA 1ORWA 2VWQA 2G63A 3K1JA 1NBOA 5J4LA 2P65A 2FDXA 4JELA 4MAFA 1ZU4A 1UBFA 5CLFA 3J81k 2QSYA 1X2BA 4HWKA 4PGMA 1DXHA 4LTDA 4C3ZA 2IP2A 2ZW9A 4CG1A 4Q4HA 3QXJA 1M0WA 2I4TA 2QLMA 2FG6C 3BULA 3PI6A 3Q41A 2ZRQA 5JWHA 3UT6A 4BBZA 2Q5OA 4TWJA 4CMAA 5LQNA 3GLHE 3NHBA 1YO6A 1YMUA 2BZ0A 1JBEA 1P9NA 1XD2B 1J2TA 4NBVA 4ZP1A 3NOOA 4AJNA 4DB4A 1TO6A 3C97A 1IRXA 1DPGA 1H5NA 4HS9A 3H97A 1BZYA 4IWYA 2BC9A 8OHMA 2CN1A 2E4VA 3DP7A 2EJVA 4YJ2B 4N0DA 3EDMA 4ZKDA 2D0DA 2FUKA 4DV0B 3Q5DA 4K8OA 2VEDA 3DG9A 4FFNA 4PAGA 5F4BA 5G40A 1I4EB 1P80A 4PFJA 2OHFA 1FNMA 3AOGA 5T3UA 3M5DA 3PC4A 4UTNA 3TRJA 4EWLA 5CYPA 1FXSA 3EXEB 4LZJA 5FTKA 1QRUA 3SKXA 3KWJA 2O2SA 2K7FA 3EXHB 1E2QA 2GN4A 2M9MA 4DLRA 1RKVA 4CPDA 1UFKA 2GEJA 3MGKA 1L5FA 5CVJA 1UFRA 2RFLA 4HNSA 3JQ7B 4L2IA 3EG5A 3L77A 4PHFA 2QDKA 3HFRA 2BGTA 2VJDA 3COZA 1V7QA 4U7PB 5BN5B 3UJCA 5EKTA 5HJEA 3K70D 3QNUA 4QDKA 4BDSA 2HJ9A 1U0TA 3H65A 1I3NA 3K0CA 4J9UE 2C8VA 3MRSA 2CGEA 2RE8A 3K0FA 4B46A 5HWSA 1JH8A 1QRRA 1CUCA 2XNKA 1X19A 3WHPA 3VJKA 4P4SA 1XTQA 4TM7A 3TD9A 1OXVA 3CHYA 5EZ5A 1XSEA 5CA0F 2EFYA 4RLQA 1D4AA 5G2OA 2B82A 4RA9B 1XLTA 3RFTA 4AWAA 3OIFA 4A1FA 3MWGA 1K86A 2J4FA 2YNMA 1BD3A 3ROMA 3UJPA 1EQAA 1M34A 3E7DA 5EJEA 1IH8A 2BHSA 3T3OA 2BTEA 4LI3X 2E48A 5DWQA 2AF3C 5BSWA 4DLVA 5JAIA 2RBKA 2XPCA 4FHZA 4BEBA 3I2JA 2PT5A 1PNQA 3KD2A 3JVUA 5IH7A 3DZBA 3SXUA 5K0CA 3QOWA 1J07A 2HHJA 2Z5LA 4NPHA 1SHZA 3SX2A 1CC1S 5A9SB 1OX4A 3WGIA 5CM9C 5H3CA 3FRIA 5LP6C 2ISQA 3GCGA 4HH4A 5AJVB 3FPFA 1Q3HA 1CY2A 3U7QB 4A27A 5K4AA 4OGWA 1TCAA 4C3VA 5C5IA 1A2OA 2B3TA 4MRVA 1KR5A 2DY1A 2IOYA 3OPYA 1R0YA 2ZKLA 2C4NA 4RPJA 3ESZA 2CHEA 5AHXA 1QQTA 4EG4A 2XZPA 2Z9BA 1LW6E 4MKRA 2GBLC 3WL6A 4BQRA 2JEOA 2X7XA 3R5KA 5LQDA 3ND6A 1RRMA 4DC0A 3L8YA 2XUQA 2GVZC 2ZTUA 4CMEA 5J5AA 4CBVA 1D2GA 3GUUA 4Y98A 3MMNA 1PUJA 1H05A 3CSDA 1XG5A 5G0WA 1CIJA 2HO5A 3RSOA 2F3SA 1QMPA 5THXA 4DRXB 3AIOA 2WDZA 4R8VA 3N70A 4RPLA 3TCXB 5KSZA 4TMWA 2LCQA 3VGJA 2X23A 3NIDB 3P0RA 4JR0A 3HEMA 1PQPA 4IX1A 1EGMB 3AEKA 4RX1A 4BP1A 1N3IA 2DU8A 3BHJA 5AKKA 1F6BA 1H85A 1V47A 3B9QA 2ZLBA 4LXTA 3DTVA 1GLNA 2NYRA 2SCUA 4Q9IA 5BW4A 5A4FS 3GA7A 5DW0A 1OMOA 3JALA 3OM1A 4S05A 3K31A 3O38A 4LOIA 3C3JA 3N6VA 4Z4IA 2XUHA 2JFWA 1KTIA 3CLRC 3DWIA 3TL2A 3ZD7A 1Y4UA 2JFYA 1MGPA 3O47A 4BJ6A 1TGVA 2OHHA 4F04A 2DUWA 2J0UB 1IUNA 2YV5A 3S55A 5A04A 1L5YA 4Q21A 4XGQA 1J23A 1EKXA 1IG0A 2Z2XA 2P6NA 4URVR 2VJAA 4EW1A 3AUTA 2G8LA 3FYUC 4X6XA 1PWYE 3ZDAA 1I1HA 1K06A 1SHLA 4W5HA 5GM2A 4C5CA 5BWLA 1KYYA 1UXJA 5JBIA 2VYNA 2CFIA 4D9NA 4KH1A 1BOFA 3HZHA 4YAWA 1N1EA 1XRLA 3E3OA 1SXIA 4QXRA 5UKDA 1SBCA 3QUAA 1UIMA 1A9RA 3EQ9A 1JIIA 2H07A 2JGNA 2OMEA 5KVSA 2J41A 5ADVA 2GM3A 4X97A 4ZOLF 1G5PA 4KQ6A 5LZ4A 5AMXA 2NVBA 5IAJA 2NV0A 4P86A 5CXXA 5B3KA 3EQ6A 1RAFA 1J97A 1JHVA 2X9LA 4WD3A 2ZUWA 2G82A 2GKSA 5FL3A 2BM8A 2VKQA 2GD0A 5KOJB 3QY9A 2EEZA 3NHSA 1OLUA 4M9QA 5KJ1A 5F9MA 3EIHA 3N6XA 1RVV1 3ZE1B 3GPCA 1ZH6A 3ZZMA 1G42A 2FF7A 3SSNA 4JAVC 3GMDA 3L7NA 3UMGA 2V45A 4CG0A 4IJQA 1A97A 1CQJA 1KYQA 2WJJA 1KGDA 2HIHA 1P18A 1YVUA 3HCWA 3J81A 2LIPA 2R25B 3HVHA 4BE9A 1L4YA 1VECA 1N2IA 4NONA 5AQEA 5FWXB 4CM4A 1MO6A 2B5OA 3M6UA 4M98A 4CUKA 4F72A 4QM7A 2INGX 2V7PA 3JQDA 3RWMB 3LC7O 2CY0A 2CLHB 1WY7A 2Z4SA 1VI5A 5AM1A 2VVTA 2ZT5A 3P32A 3ZC3A 3VFDA 1P7YA 3ZX5A 3ZH2A 5KJCA 1CQPA 4JUFA 5ICFA 2AFIB 2VPXA 3ELUA 4GH5A 1JVBA 1DXQA 4HEA6 4LXIA 5JJCA 3GLFB 3B52X 4Q6WA 3V4ZA 5EEGA 5ILOA 3DO8A 4Q3AA 3RSHA 1Y0BA 4JKOA 5IEBA 4AP5A 5JXWA 3EF1A 2QP9X 5CHYA 3ER6A 4ZI7A 1ZL2A 4IKEA 4R4JA 4C03A 3LF1A 4BTLA 2B2CA 2JGDB 3CW2A 3RBZA 1HURA 1UMCA 1FW8A 4OKSA 4MUBA 4MYSA 3VM6A 4JB2A 1TRHA 3COYA 1Z22A 3EOZA 1GPAA 1Z15A 3PXBA 5EXPA 1FTQA 3UIEA 5AXAA 4DMKA 3HBNA 3TZCA 2K6GA 3IIIA 2QBYB 2HBZA 4X24A 4XOUA 4B4VA 1OPXA 1U0JA 1ZVMA 2AUMA 2A5DA 4IO0A 1Y8ZA 2Y67A 4P2GA 4MJ3A 2A92A 3IIMA 1SKYE 2HW8A 3IUSA 2ECKA 2SBTA 3AGPA 4MGKR 4NBUA 2VF4X 4MV7A 5MF6A 1J39A 3OZGA 3ZHTA 3O26A 3WO0A 1VG9B 1XROA 1XQWA 1I94B 2FUG1 1XVTA 3FDZB 4MQLA 221PA 3M6FA 5BQOA 4XJSA 2DGDA 2J5QA 2QL6A 4B2LA 3OCXA 5IWCA 5K6AA 1D6NA 2BZSA 2PWAA 3KC2A 4MVCA 3UATA 1HWYA 3KJNA 5DHTA 2ZUFA 4LWZA 4L0MA 1KI6B 2YHIA 4QYWA 4XUDA 1NUTA 3SIPA 3WKDA 1E3EA 3TK1A 3W3ZB 1V1RA 2DETA 2IXEA 1X7WB 4TWRA 5K0EA 2X3YA 3L7AA 4H15A 2C61A 3KZOA 3RUAA 3SWWA 1T0UA 3LUGA 5KNCA 4DKJA 2BFEA 3T3GA 4RY9A 1SKBA 4MW7A 2V8BA 3ZWAA 1HSOA 2H1VA 1OLSB 2D13A 1US8B 4M1MA 1WL8A 4DIOA 3F6RA 3L0SA 2C7VA 3W5BA 3OPNA 5JNUA 3LZDA 4K9NA 1ZMXA 4MX8A 4EI2A 1PP4A 2MR5A 1FFBA 3GBPA 5LMNB 1CY8A 1B14A 1NW5A 4XGNA 3UXHA 3MTEA 1EK6A 1RI5A 3ELYA 1IBRA 2C94A 1DHRA 1CUDA 2HPAA 3GRUA 3FTPA 1OI3A 2WVHA 2WVJA 4L5BA 1UMDB 3ZU4A 2PKYX 1K0FA 3RSGA 4DMRA 2IYTA 4YRMA 3AKEA 3C3XA 4KWEA 4URXR 3VKHA 1G20A 4MARA 2G1KA 4UHCA 4KUGA 5IDWA 1K8QA 2CDNA 4EB6B 1G0OA 4X91A 1PI3A 3MWEA 2TECE 4JYMA 1QBGA 4BB5A 3KBOA 3R77A 4RVNA 3EWSA 3FLEA 4BMDA 4CTOA 3M5PA 2WF9A 3MGAA 3L40A 3EA5A 1F2TB 2RAVA 4MR9A 2CHUA 2AQKA 3R5SA 1ZN7A 4L57A 2YQ4A 2OHXA 4WPGA 2DFNA 5FI5A 3WYEA 4F3NA 3ZDDA 2EW2A 4RFLA 2OV4A 1WXWA 1YRLA 1QFZA 5GQSA 4KE8A 2PX2A 1JZSA 2FE1A 1BWQA 4RFSB 3FPCA 4WXMA 2QRKA 5D3MB 2YYYA 1CJMA 5H68A 3FTEA 3EXG2 1GCUA 1KO5A 4DVJA 2GTHA 1YIOA 4EFNA 2ZB8A 5AW6A 1C4WA 3NPMA 3RIEA 1LVHA 1PRYA 2J0VA 1C3OB 1JHPA 2F48A 2ATEA 4YONB 1PKXA 1GGNA 2PVCA 4EUSA 4ASUA 1U9ZA 3C41J 1C2TA 1G8YA 1GVHA 3Q7RA 1JVSA 4UEJA 4DIMA 5K8TA 1JFFB 1EGVB 3EOBI 4M88A 2DCUA 2XQKA 1G7RA 3OC0A 4O0MA 3U4GA 2DHCA 2VQFB 1MH9A 1DOHA 5E9JA 2X1VA 3TR0A 3K1AA 2PXAA 3U37A 1NY6A 2ZI9A 4BNIA 2GUGA 4MKHA 4G09A 2ANCA 1FU8A 1P31A 1MVLA 2JVJA 3B8EA 4ZRDA 3TOCA 2Y2VA 3VR4D 1DOAA 1TIPA 2NLOA 2HOQA 2WHPB 2PANA 3LLCA 1XQ1A 1F2VA 1Q0LA 1Z13A 2BN4A 3G8DA 3VR1A 3IUBA 1PGNA 3FCOA 4OYYA 1NVBA 1LJUA 3NBXX 5ESDA 4D4HA 1KEEA 4C2UA 2J0QA 4A2PA 4D82A 4W4TA 3AINA 3E5MA 5IABA 2WB4A 3FPHA 1J22A 4ID3A 2M6LA 1WUJS 3UJ9A 1CPYA 3CNBA 3VU0A 3V8PA 3TB6A 2JFUA 4BASA 3A4VA 4HQNA 2WD8A 3TB4A 4C4OA 2GN0A 3ODPA 1GNQA 1TO2E 3JR7A 4PYLA 5EP4A 3R8FA 1ZGJA 3R4VA 1RQRA 2QZZA 3TLZA 4EFLA 1ZOOA 5FYQA 1ORDA 1C7JA 1EUDA 4TYMA 4YAIA 4UVIA 4HDRB 3C4VA 4BB6A 4EF4A 5BWCA 5T64A 4QSHA 2P9EA 2HLDD 4X85A 2YOFA 3G1TA 3DEZA 5C8ZA 2D3WA 1AGYA 1KI3A 2ZYVX 4JJ6A 2O0MA 1I4WA 1O9GA 1ZZEA 2BFBA 3K70C 5IH3A 3LK7A 1PL0A 1M73E 4AXBA 1TZMA 1NT2A 2Y1DA 1CYEA 2Q4DA 4OG2A 2O8NA 5JS7A 1E4OA 3K9WA 3VR6H 4TZ6A 2F4VB 3N1UA 4V1CA 1ZM7A 3WA7A 1E2DA 2X6RA 4DARA 5DYWA 2FOLA 1KEKA 5JD4A 1PZFA 3K1TA 1BHSA 1CT9A 4JLMA 4KAXA 3FOFC 1GADO 3KXLA 1LRLA 3QBDA 4BX0A 4K9SA 5CB4F 3L84A 2C5SA 1C9NA 1YUBA 3CF6R 4NMMA 1USWA 2X9QA 1GA1A 2AOWA 3K0SA 1H4TA 4UXJA 4J6FA 2DH5A 3G7SA 2CXHA 1LV8A 3R23A 2QD4A 1NUQA 1M67A 5K1ZA 4JIGA 5E3HA 4AS1A 1UZLA 2ACEA 1VRWA 4DS3A 2XNCA 5E95A 1B0AA 3CLHA 4WK2B 1K6IA 4E5YA 1CEQA 1OWLA 1QFYA 2PPVA 2VF2A 3I5UA 1ODCA 4EG0A 4P32A 4YX9A 3I62A 4FN5A 1XI2A 4PTYA 2UAGA 3PQ5A 1DV1A 5KNBA 2CJPA 2F9FA 3R09A 5CH5A 5C3MA 2MSKA 4FOTA 1RQ2A 2Z6UA 1CDOA 3NHPA 4IW3B 3WYNA 5I7OA 4GI2A 3ROKA 3HUDA 3WWCA 1IUKA 3DO5A 4K9MA 3U4QB 4F8EA 1I2ZA 3Q6MA 4RKYA 4CI0B 3BWVA 4HAWA 2FG7C 1ABBA 1TE2A 4B0PA 3URKA 4AWXA 1FRNA 5L53A 4QUDA 5DBHX 1N25A 3D3JA 4JMLA 4LY9A 1MAVA 1HDXA 1LVGA 4O2AF 4LSZA 3RBVA 2DEUA 3L7IA 5GWXA 4JU9A 2A5LA 2C2ZA 2PMCA 4RS4A 4OLHA 3DKVA 3LO8A 4CETA 3EE6A 4G67A 1CR2A 4YP5A 1R4AA 3OQMA 3ZQ4A 2OG2A 3AF6A 1BMFA 1JQBA 2XYRA 4NFYA 5L4SA 2AKEA 1JHYA 1WMBA 3MTAA 4WZAE 2FZVA 5DLEA 3SJAA 2WSSA 3BBLA 1VCMA 2H5LA 3I1FA 4HH1A 3ZTYA 4HDCA 4WOPA 2XCOA 1LSSA 2W9XA 2C3UA 3DS8A 4MQBA 2Q3BA 3PNQA 3QLVA 5CVUA 4ZREA 4KRFA 3CVOA 3PF9A 3I9FA 4XYEA 3WVNA 3SKYA 4BO1A 3F71A 4EHDA 4RVFA 1P0FA 3I9MA 4HWSA 1MEJA 3IP8A 4J43A 2NTNA 3TCNA 1FCJA 4HYQA 1L1FA 4WA8A 4R1TA 3OQHA 1Q0TA 1X80A 4WLOA 2JVIA 2I7DA 3K9QO 4MQ5A 2P62A 3ZN2A 2HNKA 1Q12A 2ADMA 3K94A 4O2BB 4XR4A 2QTVA 4UXHA 4A6DA 2JAXA 1GUBA 1Q7RA 2F43B 3PXXA 1KTVA 1VJ5A 5KB3A 2JGLA 3Q7SA 4PG4A 2WI8A 3GUYA 1X39A 4II7A 4ESEA 5IVDA 2V7QA 5J59A 3FKQA 3ZHBA 1C8BA 2GCIA 3ZVRA 4FYHA 4TV8B 3PUYA 2OMKA 5EKDA 1LZLA 1DAPA 2VQSA 5C2JB 1RZ3A 4G41A 3EPJA 5FHQA 1YR1A 4GR5A 4O63O 4UFPA 5GV7A 5LP6A 4G25A 3H5TA 5CTJA 2MINB 2G83A 1KQ3A 2E6UX 4WESB 4BUZA 4TVSA 2YIMA 2GSDA 3OEHA 2ZUUA 2R97A 3RCBA 4LY0A 5JPDA 1VPTA 3VVCA 4BVBA 1DX9A 2I6FA 2ZITA 1FNCA 3VTKA 1EFAA 4AUKA 5BSTA 1DKUA 2ZUCA 2DVMA 2WFZA 4WXHA 4H3SA 2XDQB 4RIGA 1X9GA 4MUFA 4TKMA 5GGYA 2DQZA 1X9IA 4L9RA 1YVPA 2Z8YM 2GAJA 3AJDA 4I1RA 4MW0A 1CZHA 4YHBA 4BQIA 1DUVG 1Y1LA 2IYUA 1W0JD 3D5TA 3NNNA 2R7LA 5B6PA 1BXGA 4ZDJA 4ZYLA 3LDGA 4HRVA 1R0SA 5A02A 5YASA 4YXFA 4OSOA 1I7PA 5ECGC 2AXNA 1AO0A 1O0CA 2HPHA 4FN4A 1ZQ9A 3R0JA 1DJLA 1EB8A 1C30B 3VUEA 1G6Q1 4UMFA 4FUQA 1RXCA 3DFMA 3MMPA 9ABPA 5JAZA 2KX7A 1FX1A 1OB2A 1ENOA 4AVYA 2WMNB 4KO4S 1QO0A 1GGVA 2NSJA 2YVAA 2FFRA 5E38A 4A0RA 1KKUA 1U0GA 2CDRA 3JQQA 4CQLA 1QTQA 3UMVA 3UV7A 2GNOA 3BSFA 1NKTA 2DPMA 2NXEA 2UVPB 3GRFA 3G2LA 4G07A 4IH9A 3PKIA 1MJGA 1AA9A 1A3CA 2VRNA 4YMLA 1DAOA 2BP7B 1W8DA 1A9XB 3LF2A 5MN5A 2FN8A 4FFLA 3WHKA 1NL3A 1TM5E 2W6JA 2ZROA 1XJ0A 4LHSA 4UW9A 4F85A 5IKPA 1CTQA 2J9FA 3S70A 4RDIA 2RSLA 2FVXA 1P7CA 4AJ9A 2CSUA 4EPWA 4HGPA 1AO3A 1A8SA 3V1KA 1XVLA 4I4TF 5H82A 1FRVA 3R0ZA 1WBJB 3QK7A 1XJCA 3OF5A 3P26A 4NECA 4BO8A 1TW3A 3RKUA 4EHIA 1BOOA 5HOEA 3HZRA 2OP1A 4RTKA 1OX6A 4AZVA 1E9RA 4BYMA 3AB3A 1Z35A 1C9MA 3QUQA 4TWZA 4D7AA 1S3GA 1HYEA 3KV3O 4HDSB 5CX1A 3ZWOA 2UDPA 3T1HB 3O4JA 3ROZA 3C3YA 1GGKA 4P38A 4Q05A 1CR0A 1X7ZB 1MEOA 5LQMA 3TTTA 3LBFA 1ZJZA 3MB5A 5I7HA 1OWNA 1KYWA 3TEMA 4M4SA 1PU2A 3JYOA 1TZJA 2OZLB 3BMNB 3T1OA 2RKWA 2ZTLA 2DLCX 1PAUA 1JKXA 2JRLA 4PY2A 2BFDB 5L3RA 4ZI2A 1PV1A 1HETA 1OW3B 5C1IA 3UXYA 1ZD5A 1VJGA 2FZCA 3D6HA 3PE3A 4URUR 1QK4A 2AC2A 3LXUX 3UHJA 4E5PA 2AFHB 4H59A 3OEED 5BVGA 2GHQA 1SVSA 3BF8A 3T1TA 1B6SA 3PGJA 2I1LA 4ZO9A 2XXAA 2OPBA 1OYOA 2Y1LA 1EVEA 5F3DA 4TQAA 3ZDQA 2BUCA 3KPVA 4G5QA 3SX4A 4BY9E 1S02A 3KIPA 3PHIA 1QF7A 3PS9A 3FETA 3GJ6A 5CIWA 3WK4A 4CIAA 4EECA 1XCBA 3C8ZA 5AKGA 5IVHA 3TINA 3IDOA 5JVDA 1JR2A 3W4IA 1TVKA 2NVWA 4NYIR 4XUEA 2ZVDA 3CNHA 3UH0A 2E2WA 3VVBA 3OT1A 1Z7BA 5ER6A 5AM3A 2D0OB 2JBAA 2ZJZA 4HH3C 3MGBA 5DMHA 5AUQA 3TFOA 2MMGA 2K2QB 9GPBA 2R60A 1E4VA 3OQVA 4DWJA 1R5OA 2QTMA 4BMNA 2XZOA 1TCCA 3KQSA 4R8RA 1TYZA 1G8SA 4QGGA 5GTDA 4JXJA 2VJQA 2ZPUA 3AW8A 4OYHA 4A0SA 3ETGA 1I1QB 1Q3KA 1ZVVA 1J0CA 3PPVA 2XJ4A 4G8JA 5JV5A 2XOXA 4M9UA 5FFFA 1JHXA 5GZ3A 2CCJA 5IF3A 1GUZA 4HB0A 1ESZA 1QAQA 5BSMA 3T0IA 2JFXA 2EJWA 4JXZA 1XOIA 3JD1A 2VAXA 5PNTA 5ARBA 2GARA 3OIUA 4M8NE 1FYXA 1FS5A 1MJ5A 1CUSA 2QUKA 2ZI3A 3HY6A 1BXZA 3L0IB 4TKZA 2OZKA 3UMBA 3UBTA 1WUYA 4MQFB 2ZXUA 1G9XA 1CB7A 2OBLA 4MUKA 1HYHA 4HQ0A 4NBSA 3ENZA 2LD4A 2ZRKA 1L4NA 2ZJYA 2HSJA 1D1PA 1H66A 4RPGA 4DBLE 2BONA 3VYRB 3DWFA 5F1OA 1G6OA 3C16C 1U4OA 1B00A 3LX8A 1TGYA 2JI7A 4LV6A 2M2IA 2HDWA 3WLMA 1BGWA 3H87A 1L5HB 4GG1A 1NSYA 4YJHB 5B58C 1TADA 4X7BA 3ABRB 1R10A 1DDGA 5G0TA 3ILHA 4I4IA 2EATA 4TL9A 3MF4A 2GASA 5T6MA 3WJ2A 1Y3DE 3BEDA 3ZGXA 2C99A 4W5NA 5IJWA 1YULA 4FFBB 1XMXA 5EJAA 5A0TA 3GN1A 4G0YA 2ZU6A 4UOEA 1RJFA 3FCCA 2XCIA 1DWQA 1O3YA 3MINB 1BCRA 3ZTTA 2QG9A 5JAPA 3I30X 3UWDA 1A4IA 2XUGA 4Q1EA 2J1LA 1GILA 2A0UA 2WWHA 4YVFA 3R0VA 1M1ZA 1NF9A 4PFKA 3TAXA 2FSUA 2O0JA 3TZQA 3GMSA 1EZZA 2XUAA 4TV9B 5HHTA 1VE5A 3HDYA 4BV8A 2C58A 3UV6A 4WTOA 3OZUA 3E03A 3JQFC 1H8EA 2B8TA 1UK9A 3DBRB 2R44A 4LXYA 1GQRA 3TXXA 1NIPA 2XEXA 5AW4A 2JPDA 1KO1A 3OQOA 5JJ5A 2AXQA 4I8XA 4IJWA 5EC8A 4P0PB 2VTBA 2RGWA 4CDGA 3HL4A 1YJCA 1KARA 4GXRA 1RLUA 3OTQA 3V4SA 2CNOA 1X6VA 1EA7A 2GPYA 1IWBB 3PK0A 2DAPA 5BQ5A 3ZS8A 4XYLA 2NO1A 4Y9SA 2A0KA 3IX7A 4QYXA 4J29A 4HX9A 2ZETA 1HNXB 1AC5A 5H0IA 1D3AA 4KI0A 3W3AA 3V1NA 1ZMTA 4F7WA 5U1PA 5L6MB 2WJPA 1E69A 1EXWA 3IB3A 3HJHA 3OP4A 4RVUA 1R0BA 3DB2A 1JBQA 4J2HA 4HRYA 3TXYA 3VH4A 1DBPA 1TD1A 4ENRA 1PFGA 2IXGA 2AFIE 2C1EA 4R05A 4XKJA 4F3TA 4OVKA 3GLFE 1ZOIA 3TTYA 2GM9A 1HT1E 4JI4B 4R6WA 2G28A 2R4TA 3LHIA 2OQVA 3RC3A 2C95A 4Z0TA 3P4XA 4BCCA 3A1DA 1H6AA 1GZ7A 3Q85A 3MWJA 3A04A 4E7PA 5AKEA 1W581 4HDKB 5EJ8A 3LHSA 2CLLB 2GHRA 3VKFA 2Z2IA 1YJBA 4OXQA 2BEVB 1WCV1 1GCGA 2WM2A 3HN2A 2PGAA 4E03A 1YZUA 4RBNA 3O3NB 4BGVA 2Z6AA 3KTDA 4R2XA 3SQOA 4NENA 3VO8A 4V0QA 4E2YA 1U8ZA 2A3RA 1MAHA 1D5CA 1H5QA 4PG6A 5ENZA 2IHVA 5K3AA 2D06A 3HR8A 1XTTA 4AFNA 4WXPA 2A4MA 2HPVA 4DHEA 1FUYB 3G8YA 5JEDA 2NTJA 2X15A 1LS1A 4QYIA 3ZHUA 5HX7A 1CY0A 5IU6A 2H0QA 2PMDA 3QW4B 2WP0A 1C81A 1Y4AE 4JI6B 4KQ1A 2A3NA 4V2IA 3MT8A 2IGBA 1QJCA 4N5DA 4YMHA 3DBVO 1AGXA 2PBLA 4BX9A 1X86B 3H2SA 1W5AA 4LXUA 2DX7A 2GZHA 1XKXA 4XGRA 1L7MA 3DHVA 2BD0A 4FFSA 4KOAA 1DBWA 1G5HA 3DWEX 3LKZA 3O0DA 3PYMA 1OQAA 4RPHA 3RC2A 2VQDA 4RTLA 1BDJA 2GRJA 1PZNA 1L3CA 1DWPA 2HRQA 2PYDA 1M0EA 2YJ4A 3OZEA 2CD7A 1Z88A 2QMUA 1GDDA 3L18A 2R6FA 2V5UA 1P60A 2TSYB 2YWCA 2A5YB 3IUNA 3NDPA 2ID9A 2AOXA 3PNBA 2EBUA 3AFGA 1QVZA 4IMIB 5DV9A 1ZGAA 3QVJA 1LCIA 4HB4A 1GZUA 1L7NA 3BXOA 2PT6A 1XZEA 2JKVA 4KIFA 4QGAA 4QELA 3WMGA 3OFSA 4MUXA 1Y8CA 4W5JA 2PCJA 4ZTBA 2X77A 1X7XA 2JLUA 4JI2B 2I78A 3X44A 4ZYWA 3INRA 3HKDB 2XH8A 4D56A 3K09C 3CVWA 3SZ3A 2YCBA 3MSXA 4ZMBA 1T10A 4MW2A 4YB8A 3TGWA 1C1DA 5DP1A 5LZ7A 1M6VA 3O4FA 3LT5A 2RD2A 4BNUA 3MWDA 4KXMA 2QJFA 3GELA 4LDNA 4Q93A 4DV2B 3OJOA 4A5SA 1UQTA 3VNSA 2DBZA 4IHJB 1KJIA 3G1UA 1XAGA 2OA0A 3W5IA 2ZT8A 1W19A 5CDYA 1IDN1 2O7RA 3OD1A 3R3SA 4DJEC 1F8XA 3H11A 1FYDA 3MC1A 1DIAA 2FY8A 4XWWA 1A04A 1QO9A 5B55A 5T7BA 5HCNA 1BSVA 1TKBA 1GZHB 1TCVA 1DG3A 1NBEA 1NXOA 1TJ5A 1OXMA 1OFGA 1QE3A 4PC7A 5B7GA 1WNFA 1TW2A 1CZNA 4C6RA 3D4LA 4ZZ0A 2R751 5LUBA 2R5NA 4JJEA 2K4MA 4TPKA 2P3OA 1U9JA 2EJUA 1L4BA 2C9OA 5FO1A 3DE4X 4Q3OA 2Y1FA 2YJTD 4HMPA 1WZNA 2PQ2A 3L3BA 1XQ6A 5CVEA 1SC3A 3RU9A 3T15A 2F8LA 4P7FA 2C7RA 1GPBA 4GX0A 3UMJA 4CKBA 1QHEA 4B3TB 1YE5A 1YR6A 2XQFA 4L3VA 4M0PA 1TQHA 1QR6A 1JX6A 1E2MA 4KRXA 4NOMA 4ZAFA 5FNVA 3U7HB 5KDLA 3Q0IA 3SVZA 1AD2A 3KT6A 3WAKA 3RSSA 4CM5A 4F6LA 4TXJA 1SOAA 3PBKA 4XIYA 2DJIA 4CKEB 3OOWA 5FTMA 2YZMA 2MOKA 3NJRA 3PRKE 4S0XA 1H22A 3UPTA 4TZ0A 2VYFA 1Z2OX 3NLLA 1JIQA 1QC5A 4HWTA 3KSAC 3HZZA 4JEMA 1N2OA 1U5BA 2QPLA 1BDBA 2GJ8A 2BGJA 2WK1A 4G0MA 4RZQA 3ZVLA 1ZR2A 1V95A 5B1HA 1SQFA 5BNTA 3HPQA 4RULA 1WXGA 1KS9A 4TTQA 3QVMA 1GLGA 1N5LA 2PXCA 3HFSA 3QU4A 1Z5VA 1PEYA 1V48A 2OZEA 3MWYW 1R4NA 3L0DA 1GTMA 2FH5B 5GVRA 5JXHA 1FPQA 4RVGA 3DZHA 3SXPA 5A6VA 3RJ9A 3SC4A 2YVQA 5CDSA 4LMRA 1H65A 3QITA 2OV2A 4XM2A 4J1TC 4JV5B 3TRKA 2R79A 1CDEA 2ZYDA 5LMUB 1DJPA 3MJHA 1KY2A 3RHSA 1AKYA 1A9YA 1NOKA 1KBQA 2OGWA 3CPJB 3LWDA 5E6UB 1Y1TA 1R9JA 1Z2EA 3HB0A 4PR3A 4HFRA 1E0DA 4M1EA 2VA8A 1IY8A 3U56A 1GIAA 1Z08A 4I1IA 2GFHA 2IIVA 4MYDA 1UPBA 3RT9A 5I9BA