2EBUA

Solution structure of the brct domain from human replication factor c large subunit 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
112
structure length
112
Chain Sequence
b'GSSGSSGKALGSKEIPKGAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIAVETE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replication factor C subunit 1
publication title Solution structure of the BRCT domain from human replication factor C large subunit 1
rcsb
source organism Homo sapiens
molecule tags Replication
total genus 17
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2ebuA01
1IMOA 3PD7A 4Y18A 3PC8C 1L7BA 3OLCX 4IFIA 3I0MA 2R1ZA 5ECGC 3QVGB 3I0NA 4OFBA 3UENA 4BU1A 3PXAA 1T15A 2D8MA 2NTEA 2VXCA 3L46A 1GZHB 3PXEA 3SZMA 3EF1A 1Z56C 3PC7A 3K15A 4XQ0A 3L41A 1CDZA 3K0KA 3SHTA 4BU0A 3PA6A 2K7FA 3II6X 3SHVA 3K0HA 3PC8A 4N40A 3FA2A 1N5OX 4BMCA 3K16A 1T2VA 2L42A 3EF0A 3COJA 3SQDA 2EBUA 2XNHA 1WF6A 1L0BA 3UEOA 1OQAA 3JVEA 1T2UA 2E2WA 4BMDA 1IN1A 4ID3A 3T1NA 2COEA 2ETXA 2COKA 4U4AA 3U3ZA 2HTFA 2EP8A 2VXBA 3T7IA 4IGKA 2DUNA 3K05A 2ADOA 3HUEA 4Y2GA 2AZMA 3PXCX 2COUA 3T7KA 3AL2A 3HUFA 1KZYC 3PC6A 3L40A 2K6GA 1JNXX 3PXBA 2M2IA 3PXDA 2WT8A 1T29A 4JLUA 2EBWA 3AL3A 3T7JA 2JW5A 3KTFA 2INGX 2LE0A 4XPZA 2XNKA 3QVGA 1Y98A
chains in the Genus database with same CATH superfamily
2I2DA 1ISFA 2GAOA 2H9AA 4AUEA 1NATA 1KQOA 3G1TA 3I1FA 4HPJB 4E11A 1AIPA 3NXKA 1QH0A 4FFLA 4PAQA 4S1TA 4Y18A 4F97A 1P60A 5B4TA 4N7RA 2QTBA 4X66B 3P2EA 4YT8A 5FOXA 3CQ9A 1U4OA 1H85A 2EAUA 4PHCA 1MGPA 5IK2D 3HUUA 1FP4B 4M9QA 1DEXA 2ZR8A 4PGGA 1ZN2A 1S8FA 3S2FA 3NFRA 1BH2A 3PB3A 1V7ZA 3JZFA 4QBGB 5JNWA 1COWD 1I32A 2IOYA 4CZ2A 4YCLA 3NMUF 1H0RA 2F9MA 3OICA 1MT0A 6GPBA 5LQMA 4ZYZA 1N2ZA 1NXWA 1MX1A 4R0NA 2JFBA 1PO7A 4KNVA 4EL0A 1L5OA 1W47A 1XXLA 3IV7A 3OWXA 3Q4GA 1IBKB 5CGZA 4NYMR 4MIKA 2Q7DA 1YAJA 2ZVPX 1X15A 3DEKA 4MGZR 4WXRA 4MQMA 5T3UA 4RL6A 4L72A 4AF6A 3KLOA 2O5EA 3I39X 2WUFA 1J1UA 2YZ7A 3ESBA 2XT9A 4AKTA 1P39A 4PYIA 4CMHA 1RW4A 4Q9DA 1GU7A 2GS9A 5HPYB 1BDJA 1HORA 3FCCA 3MTJA 4UREA 3TTTA 5EMMA 1X7XA 4M37A 2V0GA 1EA5A 2PVSA 3K0HA 3WL8A 5EEHA 2O7VA 3FI9A 5CCBA 1XAGA 2ZRHA 2GKOA 3N58A 1KZHA 2ANBA 3F7TA 1JIXA 4JFAA 2GFHA 2CEAA 3VAAA 1VLLA 3RVKA 3LWNA 1PQUA 1R64A 4XIFA 3E9ZA 1XWFA 1EWKA 2CLLB 5F7XA 1WA5A 4FE4A 1NHWA 3V00A 3FPHA 3VMMA 4B3MB 4M0LA 4ERXA 1HUQA 4IF4A 1I7SB 1QR2A 3AR3A 4ARCA 4G07A 1N9ZA 4C07A 3ZQ4A 4MKHA 3JYOA 1KEUA 3R3YA 1GZ7A 1B0AA 1NBMD 3QIAA 4OKNA 4DMUB 4DZTA 4NZNA 4RHCA 4QVIA 3OZUA 3ELWA 1THTA 4N12A 3SHQA 2HOQA 1CEEA 2ZKLA 4KQXA 4JENA 3HR4A 4TL9A 1TD9A 1U1IA 4CG0A 1WQ1R 3HB4X 3AFIA 3JPWA 4R8KA 1G5HA 3VSAA 1S1CA 3GFRA 3JZAA 1OGJA 1QFJA 4U5XA 3LHKA 3VXKA 2CLFB 4RY0A 1HT1E 2I4NA 2J87A 3B6IA 3PQ2A 4LSMA 2HKIA 3A4NA 4G0QA 4ZGBA 3RF7A 3LK7A 5FP0A 4OQMA 5BNIA 1E9BA 1VMEA 4FXPA 5FUWA 3W1VA 4GRDA 2B20A 1RABA 4KE7A 3RT9A 4G9BA 1TK3A 4LDRA 3VNBA 5EJ5A 1R27A 2XCQA 2WKPA 1IRXA 5H9WA 1IB6A 3T7EA 2E4ZA 3CVVA 3T3NA 3AUUA 1VJDA 3Q6IA 4DG5A 2W2QA 1NW4A 4IIGA 3ZCVA 1FFYA 2RAVA 2ZSIA 4GRIA 1SUSA 3UTCA 1K63A 1AUXA 2JFHA 2EWWA 3T8YA 3VYWA 5JS8A 2A9FA 4PXAA 3LK6A 4QE3A 3WNCA 1HFEL 1VL8A 2EVWX 1ZCZA 2Q0XA 3QPAA 4JOSA 4DJJA 4EBFA 2XCUA 3CFYA 1OIVA 1QCZA 4D25A 3G9XA 4HBZA 5T8KC 3TAHA 1H9CA 4TTRA 1KI4A 2JASA 1BQ3A 3FUVA 3N0TA 3ZI7A 2CDBA 2XITA 1BVUA 3CX8A 3HGQA 3QNMA 2H9IA 3I2HA 4X8HA 3IAXA 4WVFA 3AEQB 2HV8A 3OZBA 1QFXA 1Z8HA 3W6PA 2HFKA 2QW0X 5G0VA 3UHOA 4BLTA 1N5DA 2HU8A 1UAGA 1IK4A 1RWXA 3K6JA 2GBLA 5TARA 2QEQA 3WC4A 5JZSA 1Z22A 4ZZ0A 1FDUA 1R7RA 5KOJB 3GR6A 3ZD6A 3CCFA 3JQFC 4ITRC 4LRWA 2WD7B 2XBLA 3T9CA 1PJ8A 1GFZA 5EMLA 2XNDD 1XZJA 1PJCA 3IEIA 2FUKA 2AT1A 2REXB 1G3IA 5FIUA 5HKBA 2AOVA 1DDOA 1SK8A 3PC7A 4GLOA 4F9FA 1X1TA 1E2QA 1R6UA 1Z7GA 2HDWA 1II9A 2BGTA 2JA1A 1DAIA 4MR9B 3H2BA 4BNYA 3MUNA 2VF8A 4U7GA 3QWAA 2X4DA 4ND7A 1JDNA 2X5OA 3QLTA 4GM4A 3F5QA 2Q4OA 2OGTA 3I3SR 3MEQA 2PANA 3Q3EA 4NPHA 5EZSA 4BP9A 4E22A 3T5MA 3OZXA 3PRKE 2XUZA 3RVQA 1WXEA 3OCWA 5FBVB 3PC8A 2E49A 2F1OA 3VDMA 4LF9B 2I22A 1C8VB 1I8TA 2C61A 1Q0SA 2VAXA 4WAUA 4YIKA 1DBSA 1LBIA 2JARA 4N8EA 4MCHA 4TMVA 5IAGA 5JG7A 3VX3A 2C7GA 5JHHB 2HW8A 3RFTA 1XEXB 3OBBA 3Q41A 4GFDA 9GPBA 1L4MA 4KQCA 5JNSA 3TG2A 2R62A 1TJ5A 3CKMA 3VTFA 1JJIA 5DDIP 4MUEA 2PR7A 4WL0A 2W6JD 3F73A 4QFBA 2PO5A 4CCSA 2Y0CA 3V8MA 3F96A 4NJEB 1MDFA 2PKCA 3QNUA 4V0ME 5LOVF 1Q77A 1CB0A 2F67A 2Z0MA 4P92A 5GGXA 1F20A 3SBDA 5TEWA 3TTWA 2EP7A 1JEAA 1NOJA 2KB0A 4B3TB 3G0HA 4OXKA 1E0AA 2IH4A 4I50A 2CJWB 5TY0A 4L1KA 1T6BY 1CETA 2PT5A 5KVVA 4RPIA 4W9NA 3GP8A 1E89A 3HXPA 9LDTA 2Y1WA 4GC5A 4GLFA 4L7VA 4M1MA 1ZISA 6AT1A 4IBOA 1ZC3A 4H6VA 1M2HA 2ZP1A 3DFMA 2WWVD 1BQEA 3UQZA 1WWKA 2XZDA 4PZDA 1NDQA 4YP9A 2JRLA 2N1MA 2ZTVA 4ADSG 4FHFA 4KX3A 4YN3A 4KFUA 5BNFA 2GAAA 2P7IA 2EEPA 7ABPA 3Q8MA 3LKBA 5EP2A 4AF8A 1RM5A 3HKBA 1RAGA 4ZAWA 3VYRB 5BSEA 5F51A 1D8TA 4Q9AA 2QI9C 4NHOA 3FUWA 4TWBA 5J5AA 3JXEA 3VDXA 3BJRA 3Q5GA 5ALNA 4MZXA 4G0WA 3JQEA 1QYWA 5DGTA 3C3PA 1ZXLA 3FDZB 3IFSA 2MYNA 1I3KA 3WTCA 3L92A 3Q3GE 3HJFA 2GH1A 2C3YA 2UYQA 4TVKA 5CLGA 2QRJA 3BCRA 2G7ZA 3JQ8A 4LE0A 1K8XB 3A3KA 4KSBA 2PBLA 4UAGA 4UBJA 4UZEA 2NV2B 2VXYA 2ZE5A 4AYWA 1VCHA 4HLNA 3GH1A 4UE3S 3K0SA 3ICPA 2QRUA 1N7JA 4MKRA 1JFLA 1UBKS 2CNWD 1ITZA 1TCAA 2OQRA 5KSPA 2DBZA 5KHOC 5JC1A 2QI9F 3VPSA 1VI2A 2FFRA 4NABA 1M9NA 5CA0B 3RADC 3JQQA 3TD9A 1WZUA 4HVCA 4D41A 2X9GA 4ZARA 4AX8A 4ETNA 3ABQB 1OZ0A 3QVXA 5F35A 3WLPA 1Z08A 3H3XA 5K99A 1KAQA 4TUYB 2W2TA 3GLFB 2GAFA 1P1IA 3FWHA 3JWIA 2JRCA 1L7QA 3QMVA 2ZIVB 4HRVA 2Z2JA 2GOYA 5JPIA 3WOHA 4BUCA 1UP7A 3HG7A 2SECE 4G4GA 4KYIB 2R6R1 4YREA 2V1XA 5FBRB 1XTQA 3HP1A 5C3MA 5JMOA 2EU8A 2ET6A 3OIFA 3IR5A 1W0JD 5E1BA 1K8ZB 1AQ6A 3QX3A 3VUEA 3VKUA 4P22A 1U6JA 4DTCA 2HMTA 3HCPA 5I51A 2NU8B 1IZ7A 3GF4A 4CT5A 3BCHA 1WSWA 1B8OA 3BB4A 3Q3CA 2V6JA 1EMDA 4Q4AA 1JFVA 5DLPA 5B2FA 4OJYA 2ZJ3A 4N5NA 2G06A 3BXZA 4M8KA 2EYQA 3Q72A 5AT1A 2BFNA 2BAGA 3MB5A 2Y3IA 3INGA 1RU3A 4HJRA 4WHMA 4WOBA 3PQ5A 4TV9A 4UPDA 5C32A 2EFCB 2HCFA 1B16A 3UOGA 2W42A 4C0KA 1YJCA 2V9ZA 4PGMA 2I78A 1GY8A 3AUAA 2R5WA 2D62A 2VHUA 1FPQA 5D3MB 1ECFA 4QDTA 5JC8A 1E7MA 5KSZA 1G17A 4B2LA 1RI1A 2R25B 1E1YA 5EIBD 3IPAA 2HSEA 2O3UA 3BJEA 3UGQA 5A6SA 4KFRA 3BWBA 2R7MA 3RODA 3FPGA 5TVKA 2XIJA 1X1BA 5DHUA 1FQJA 1Q7EA 1WHSA 2NO7A 1ISIA 3K2BA 4N82A 4YAWA 4U02A 3TZEA 4YIHA 1EQ2A 1SKMA 4XUGB 1WCIA 5FPHA 2FHPA 4HNAB 4YI3A 5GV7A 1AB5A 2QLLA 2R1VB 3RAJA 3F6EX 5JE8A 4CMAA 5KEIA 1ZC4A 4PC1A 4HKTA 3EFEA 4MB6A 3RSZA 4GYKA 1NAHA 2IHUA 2YMLA 4HTFB 1NN5A 2OC4A 4NDAA 3HCAA 2AC2A 1W36D 4LQDA 2I7DA 2P5UA 3F9RA 4MVJD 4NMHA 5ALWA 1JR3A 4K6KA 3K1YA 3WLJA 5CX1B 3OTHA 4PCUA 2YIMA 3BIWA 1SXHA 3IJRA 4IHAA 4QXQA 1DQRA 2Y1GA 3VR3D 4CDMA 3CEHA 4C0XA 4DSNA 3AL2A 2PDAA 3K0FB 3N8KA 2ECPA 4OY3A 4QFDA 1DPGA 1MOSA 4ZA2A 3LH5A 1FJGB 1QHIA 2VWHA 4HFMA 5CJPA 1YACA 1Z13A 4EA8A 3C8HA 4D26A 3HYNA 2VP5A 1DMRA 3AFHA 1ODJA 4P2GA 1QYCA 2QAGC 3FD8A 4ZZIA 4CQNA 5JRDS 3DMHA 3PQCA 2P78A 3KKLA 4HDSB 1XRSB 2Y77A 3IQWA 4U7FA 1P1JA 3TE6A 3GRKA 3C3EA 2EJVA 3CZMA 1HYBA 2MHCA 3WMGA 2ZB4A 4QJ3A 1IU9A 4O8CA 2QX9A 4ZO7A 5I3ZA 1KYTA 2WAXA 4RTPA 2CZCA 4YAUA 2B98A 1O96A 3MJSA 3FCSB 3GDWA 4R8MA 1I13A 3U3KA 3FWYA 3I2JA 2RMKA 5TMEA 3UFXA 1UJMA 1RWBA 1IDN1 2IIPA 2OCIA 5A9SB 2QTHA 3VKGA 1GNPA 1Q1ZA 3QVGB 4XX0B 3OF3A 4KQ6A 2PQ0A 4PO3X 4ZJZA 4NV0A 2BV3A 2WG2A 4MAMA 4MUNA 3EY4A 4NKRA 1PNTA 4GKAA 3U3DA 1W5BA 3GZJA 3IILA 1LI4A 1OYYA 5FWXB 1W48A 3IMCA 5HW0A 5AKJA 2XQJA 3MC1A 3NIDB 1T9AA 5E6UA 3RB8A 1XJQA 1U02A 1S3GA 4OH1A 4RLFA 4IH9A 4H08A 1SG9A 1T5HX 1W34A 3CH6A 3C3KA 3TRFA 4J76A 3AV0B 1U3UA 4DGQA 4D74A 3DLHA 5K0ZA 4YCJA 2C7BA 2CF5A 3LO5A 4CKEA 1J7KA 2E7ZA 4JP1A 2AYXA 3DD5A 3IIMA 5AP9A 3L7YA 2GVDC 5ICCA 1KVRA 2F7SA 1B93A 1U8AA 3VVCA 5MGNA 4KH1A 3ITEA 1M6VA 1XT6A 5K0JA 2XOXA 1R00A 2B25A 2CYBA 3EC1A 3B12A 3C87A 3TF5A 3B1WA 3CGGA 4CM5A 2QAIA 2VQDA 1Q7GA 3KOOA 1C81A 5FTNA 1JALA 4PAGA 3AIMA 1V16A 2PA3A 1CG6A 3GB9A 2Q1WA 3S1LA 3ZGLA 4E5UA 1GO2A 3RFVA 4QBFA 3B38A 4N01A 1ZX1A 1PT9A 1SHKA 4IDNA 5G1NA 3O8CA 1UBGA 3REOA 1H2WA 3U0VA 1RXSA 1B26A 3LQFA 3S7TA 1R0KA 4JVLA 1YHZA 2ODQA 3B6JA 1QGDA 3IVGA 3SGLA 1NA5A 4MUGA 1WPRA 2A88A 2P2GA 5E7JA 4C7BA 2OKGA 3BK7A 5JCOA 2PUVA 3OQOA 3NKVA 2NU6B 2HA3A 3FX2A 4HQ0A 2ZSHA 3NTOA 3F3SA 4MYSA 5JAOA 4KI7A 4C4ZA 3GYBA 4HR7A 4AZ0B 3I9LA 3UB2A 4DEYA 1F6BA 3R7WA 4C5BA 1XZAA 3UOWA 1P62B 4L4YA 1VZ2A 3SX2A 2YJZA 3OQJA 1IN8A 3R7DA 2FLWA 3GJ4A 1TQ2A 1YWGO 1RJDA 1N6IA 1F60A 3DLBA 4M9ZA 4XFKA 3AFMA 4L85A 4M1QA 4OCZA 5AM5A 5A4JA 1AN9A 2GBIA 1PL6A 3BQ9A 4HWGA 1DG1G 2Y4OA 3KE9A 1JNXX 2AIRA 4NS1A 5H70A 4MV3A 3ZVRA 1A97A 1C2YA 1V3VA 1AV7A 4Q7KA 1FF9A 3EFOA 4JJGA 2RHOA 4P33A 3SICE 4NQZA 2C42A 4HB4A 5I47A 4QPDA 5IZCA 1K3FA 2C8VA 2ZUFA 4P7KA 2JB9A 3GLIA 1QIJA 3OU7A 3R9KA 4LQCA 1CEXA 1DUVG 1NN0A 2CJPA 1WQ3A 1X92A 4QOGA 3V97A 5FEUA 4U7DA 2DSTA 3RC8A 4YP7A 2I8AA 1WXIA 4LWZA 1WCXA 1UJNA 1NIPA 2UUAB 4II7A 1PR1A 5A71A 3ZNNA 3TR0A 4S2UA 4N4AA 3ZKAA 1CS0A 3K35A 1JT9A 2AR7A 4ARZA 1E6WA 4GZ3A 4PGFA 2G80A 2HBRA 2MMGA 5FL7D 3H9BA 3GZTB 4C88A 1ULSA 1AE1A 2I87A 5JDCC 3KQYA 2AI3A 1D1PA 2CK3A 1LD3A 3BXXA 4LOKA 4GBJA 4O2RA 4G0MA 5AHOA 1QGAA 1SELA 2AG8A 2P79A 2R7NA 1LA2A 4FZJA 5LLDA 1SA0B 3ZD9A 2DWCA 4KYVA 1MOZA 1RWWA 2YV5A 4H27A 1GYRA 3FNIA 4HWSA 3S44A 2QUAA 5JWRA 3ENQA 5ERXA 2HSGA 4ZDIA 3UN1A 3ROXA 1X7GA 1A7AA 1FSPA 1G3RA 2QM3A 1C3LA 3H5TA 3H9EO 4W7HA 4BATA 1CVRA 1G2PA 1Y3DE 4DRXB 4XDZA 1Q50A 3BH0A 3EFBA 4KXNA 5CB4A 1B14A 3WRVA 3DL2A 4ZMRA 2GXAA 2PG3A 3ZWYA 3Q9UA 4P81A 2YMQA 1HKHA 1AUPA 4NXNB 2BIFA 1YU9A 3D4PA 3M6AA 4IF6A 3ZXXA 1LK5A 1DPFA 3E84A 3IBCA 3IV9A 2XDQB 1Y1QA 1W0CA 3K0CC 1V8OA 4IUYA 4QGGA 1CY4A 4R84A 4CLDA 3KEFA 4UUAA 5B5SA 3KPVA 4BNKA 1YZLA 4LWOA 4JCOA 5CCEA 3RS5A 2IYNA 4EI2A 1XSEA 2O48X 2W2VA 3EZ7A 3NZEA 3KZ1E 4JLDA 4LZNA 4PZZA 5EYPB 3PUJA 4BIMA 1A9ZA 3GLGA 3V7WA 3CH5A 5K0BA 1Z33A 3DBIA 4MR7A 3SQOA 1U8ZA 3ROQA 3JQGB 1GT6A 3PFHA 2BDTA 5HCIA 1MB3A 4QU0A 4TOIA 1BTOA 1NRXA 4PZYA 4G81A 4OJQA 3MINA 2PUAA 2QQ0A 3GEMA 3EIOA 4UU0A 1OX4A 3GFFA 3HNRA 2NAPA 3RVRA 3HA2A 3BGDA 3KU4A 2HWWA 1TUEA 1ULUA 3U80A 3JQ9C 1U2SA 5AHRA 4BN5A 5KQGA 4IIJB 1SXJA 5D3ZA 2VJYA 4X1IB 4KW7A 3HZOA 3RUHA 2FPRA 1KSHA 4DMMA 1IJKA 1L4HA 2F4NA 3BMNB 3IQHX 2HPVA 1VDMA 4J1NA 2H57A 4JUFA 1JAZA 1U11A 3MJFA 1W4AA 2P5YA 3KSAC 1JDTA 1FVXA 2RGNA 3LUAA 4DRYA 2QG4A 3K71B 3U9SA 3UT0A 1IY8A 1IXSB 3M49A 1E1QD 3TEJA 4UTPA 4UVHA 2VNAA 1RZVA 3BIJA 1Y3FE 1NV8A 1EUYA 4Z9AA 4XQGA 4J49A 4JA2A 4DLWA 2OAP1 2VDUE 2PZEA 4FXOA 1O89A 3OD1A 3NX4A 3IE2A 1C41A 2BMWA 1OBCA 2WUDA 4HDNA 4A03A 3EAQA 4P1ZA 4OAQA 5I9NA 1D4ZA 3L8GA 3WGYA 1PGJA 1YSCA 2BISA 4MJLA 4EL5A 3HLYA 2WIBA 3MGAA 4DLSA 1LC3A 1FFXB 1GADO 1JI0A 1T3SA 2EEZA 4JLAA 4BGIA 4YRZA 3FHOA 3BBLA 1GCAA 3OCVA 3X1KA 1GTZA 3BWVA 2I2WA 3GDOA 2VVTA 4LHWA 4DCNA 3RYIB 3LZCA 4H7EA 4L8YA 1QHYA 1YVRA 1PGOA 3URMA 1JHQA 2ZI6A 3RHSA 4XARA 3LUJA 3L7KA 4YALA 3I3OA 5B3JA 2GN2A 4NBSA 3AHHA 4FINA 3ZWOA 2D3TA 4WI1A 5IJ0A 2AUTA 4Q3NA 2XWQA 4TRJA 4RTOA 4N3GA 2RH9B 5FV4A 3ICOA 1POWA 5IM4A 5T41A 1RWVA 3P4YA 4LZPA 1T0UA 1GD1O 1II8A 2P0AA 3I92A 1NQXA 4G67A 4WBSA 5KOIA 4EUEA 3V1TC 2R68A 2QGNA 3SMVA 1W87A 2A78A 2O0JA 1N75A 2R79A 3AESA 4JUBA 1U4SA 1T15A 2EF1A 4QDOA 4RSGA 3VVLA 1WETA 4J16C 4J2HA 3OFSA 1WY5A 5F5NA 2F8SA 4PZUA 1V9SA 4EYOA 4FYPA 2IYXA 4KPUA 4LJ9A 1I7PA 4HMOA 2PZKA 3L7JA 3H5OA 3ZCRA 1GKKA 3A6LA 1IY9A 1G8PA 2G36A 3QY0A 4M1TA 1KR5A 1SC9A 3D3EA 3NVAA 3VHQA 2JI9A 4EY5A 1FDSA 2P2DA 3CXUA 3OFJA 4RW0A 1UDWA 4PC6A 5BW4A 5KI6A 1NASA 2PRSA 4JODA 4A8JC 4C4RA 1QIKA 4WLOA 4LZJA 2JS7A 2X42A 5CM8B 3GLRA 3JATB 2BYTA 4IZIA 1W1WA 1X38A 3FUTA 5JSKA 3KS9A 4G8DA 4PXSA 4NOKA 4BPRA 3FA2A 4V3BA 1EVQA 3C3JA 3TIIA 2NSJA 1P5JA 3OPMA 1TA0A 1SMKA 4GI7A 5A9RA 1VMKA 1S2GA 2IP4A 3D8NA 3L7IA 4O0MA 4EA6A 5JATA 4CQMA 3BSSA 3M7IA 4EAAA 1M8GA 1CZUA 2XTNA 4H6PA 5HE8A 1W7AA 3HSSA 1RCUA 2H16A 2YWBA 3OVMA 4XVQA 5G1OA 3W2FA 1ADCA 1E4OA 2NXEA 4TKVA 4X1YB 1D03A 5D5QA 1JAXA 5AVWA 1F4PA 1KSFX 4ZI3A 3WP0A 3LNCA 4W63A 4W9MC 2O9JA 1VLVA 2UYOA 2WZBA 3KZNA 2XCLA 5FTMA 2JA2A 5TE9A 2HRZA 3KYDA 2ZOSA 5EJ8A 1CKEA 4XLLA 4QYXA 5DHSA 4R2XA 1U0RA 2I6GA 2C95A 2XRFA 4ZCSA 3CN7A 3W7AA 1FSGA 5CDGA 3CMMA 1Z7YA 3H9CA 2JFZA 1RHUA 4MKZA 1PSWA 2QM0A 4ZTUB 4J0CA 2IPLA 3GBPA 1OBHA 4UU7A 1XV5A 1TRKA 1W5TA 2O2DA 2UUPA 2AKAB 3PPXA 1BN6A 2GF0A 1JW9B 3SDZA 1FOEB 2EFJA 3V4SA 5CYGA 1M1YA 5JMTA 2OB1A 5KTNA 4R7ZA 3N2LA 1CLUA 2IW3A 5AYVA 3SQMA 4FX2A 1ZJ4A 2P65A 3PWSA 4MW1A 4WXMA 4ZU6X 4HFNA 5C8ZA 2DTXA 3HU5A 3EUWA 4Q02A 4QYSA 4DV5B 3DAPA 2PE5A 4CI0B 1UZAA 1JBEA 3QITA 4XJSA 4I2NA 3NGLA 4Q82A 4HN4B 2JD0A 1RYZA 2WKSA 1IQRA 4EW2A 3L6CA 4FGUA 4JC8A 3T7TA 4CTOA 4DNXA 1JDUA 8ABPA 4LJ7A 4AMGA 2AG5A 4DW8A 4Y7CA 3O6VA 3KKZA 4TTAA 4QYWA 1W2GA 3GNLA 1QZXA 4CFZA 1UBOS 3BCUA 3R41A 4NWIA 1KK2A 3ONWA 2DBYA 3HI4A 1YB2A 1N2HA 1NE2A 4RPLA 3LC0A 1Z3CA 5JNVA 1IBSA 3RUCA 4QTZA 1Q91A 1TF7A 3Q98A 4GYJA 1CRQA 2ZK7A 1NW8A 3C3BA 4L02A 1O6ZA 3KTOA 3NKLA 4RKYA 1G0OA 2H7XA 4Y6GB 5DB4A 1V4VA 2XGGA 2Y4NA 4MICA 1WNTA 1C3EA 1RI5A 4XQCA 2BGMA 3LCVB 4JXZA 1T4MA 2YUTA 3EDOA 1TXGA 1JSCA 1RFLA 1WY7A 1USVA 2V7EA 3F3MA 3PNYA 4HZGA 2BGWA 4F2GA 4CIBA 2VDJA 2H18A 4F5YA 2WVHA 4U6SA 2FG6C 1V26A 3FAKA 3P9RA 4UJ5A 4XCQA 2NSDA 3LP8A 721PA 3ZXSA 1WDWB 1A9TA 2MYUA 1T5TA 4W6QA 4JUDX 5DZSA 5LFAA 5HIKA 1V1RA 1Z4JA 3L06A 1XJCA 4OGFA 3RO7A 3JWHA 1TTQB 1QG2A 1MH1A 3SS9X 3CVJA 4CIDA 3OCZA 1HTTA 2DWQA 2X5JO 1M10A 2Q3EA 1XEWY 1FSZA 3B60A 5DEIA 3T4UA 1HR0B 3AVYA 2GXSA 1C1YA 1A50B 3OX3A 4UBIA 1Y89A 4RVFA 1G4AE 2I33A 3LUPA 4OGGA 3M6LA 1QRTA 1BCRB 3GH3A 3NJ8A 4E08A 3TTVA 2FWJA 3WGQA 1MC4A 3UATA 4F6LA 3ZV6A 2G07A 1LV7A 1ZOPA 2R2AA 2UXDB 4FMBB 4OB7A 5AIBA 5E9AA 4LOIA 4DV7B 2OXRA 3OQIB 1ZK3A 3SBEA 1BGWA 1Z6XA 2DLDA 4P0TA 4RENA 1LWOA 2CXPA 2ZATA 3Q2KA 5E9WA 3RROA 4YRCA 5A4AA 4IQ0A 5DF1A 1ZG3A 2YHAA 1UJ6A 2REQB 2C9CA 2EBUA 2ISSD 3NASA 1H22A 4RA9B 5FH9A 1Q14A 2A0YA 3D4NA 4IPTA 3NYQA 3DT9A 4M60A 5DFAA 4JI3B 4DUYB 1A77A 2GEVA 2H31A 3OOEA 4PSKA 1E77A 1QQ5A 3UUWA 5HHTA 4LY0A 1XRPA 3FGPA 3KR0A 3LYAA 4KVGA 3GMDA 4IYRA 1ORTA 1NNEA 3ERCA 2ZE7A 2V7GA 3VDRA 4Y3UA 3L4SO 1D1TA 2ZWIA 3FPFA 3EVCA 3SS7X 3U4DA 4BWVA 2B3DA 5GM2A 4RTMA 4IVRA 5EUCA 1XA3A 2NVUA 3HO8A 5FWYA 2HJSA 4D02A 2J9XB 4NJMB 4YJGA 2AFIB 2G1KA 4JI0B 2E1PA 2H29A 1WTAA 3RU7A 3W2TA 2W6ZA 5HFJA 3RT1A 1CDOA 3KVNA 4F3RA 4D56A 3THYB 3CM0A 3HP4A 1TCCA 3HJCA 3W3AA 1Y1LA 3O1HB 3S8YA 1XELA 5DV9A 4B43A 3AU8A 3H4MA 5DM60 3PPWA 4JH0A 4TRRA 1CNEA 2HCTA 2V6IA 4HZUB 3W77A 3WWPA 5KVAA 3MAGA 1M0WA 4WV3A 5EJ2A 3FWZA 4KAJA 4HX5A 1AN0A 2YBEA 4CKXA 1K2WA 3A3NA 1CE8B 4YUAA 2WB2A 3L6RA 3T5AA 4KXXA 4ND8B 1P18A 1T34A 3HABA 3N6VA 4IVQA 4ZAXA 3TWOA 1CV2A 1TLFA 2OXTA 2JK0A 3CVXA 5EHNA 3HDGA 2Y1XA 2Q28A 2XUIA 4YDSA 4JBGA 3N0VA 4FLFA 2VUUA 4LF4B 2G1AA 4B32A 2FGKA 4BE9A 4C3UA 3LGAA 3U1BA 5I7AA 1DG9A 4EHKA 1N6NA 4EGAA 2V3VA 2WDPA 4GEKA 1B2RA 1U65A 3KLPX 2CFIA 1QTRA 1SG6A 3OPXA 3R5SA 4H1UA 4LGMA 4JJ8A 2JGLA 4UXIA 3FETA 1SC6A 1DJLA 3AF3A 5IKXA 1FQWA 2P6NA 1EKXA 2VC2B 1FJXA 1IQ0A 4MWGA 1YZGA 4S1PA 4WCFA 5CNIA 2GILA 3V4PB 1UXOA 3MWLA 4WT7A 4AL4A 1T91A 3PS9A 4LZLA 3UC5A 5J2TB 5DMXA 4PX9A 2VNKA 4DBLC 2ZUBA 3M1YA 3EPPA 2HJ9A 2QRQA 4R51A 4W7SA 2YS6A 5D2CA 3ID6C 3LPNA 4CJXA 1RM0A 1SUPA 4U0JA 4ZQHA 4B4UA 2KLBA 1UKAA 3B6ZA 3NBKA 4JKOA 4EZBA 1TA9A 1XTKA 3X1WA 1JHPA 1YHNA 3B1FA 1OU0A 5C4MA 1UOEA 3AP1A 3JQBA 4M98A 4O59O 1FYXA 2AEJA 2FB9A 3AP2A 1F17A 2O50A 3DNMA 2CHVA 4FOTA 4P3XA 4TLDA 5NULA 4UHHA 3TTXA 2NTNA 3FMPB 5JZBA 2PX4A 2XVYA 1AO0A 1EHCA 4YRNA 4OK5A 2PCJA 3WZ2A 1E2UA 5C8DA 2QUHA 3O8OB 2NZ2A 2EHDA 3IDZA 3BS4A 4I46A 4JT4A 3MJ4A 4KODA 2OO5A 4MWDA 4PPFA 4CKZA 2DR2A 1DQYA 1V6AA 4FNGA 1MRZA 2ALJA 4D57A 3KQPA 2QB5A 1GJRA 2VJLA 4L5AA 4K3VA 1QIEA 2DETA 3HXLA 1KNXA 1UK6A 2IPMA 3R5XA 2WF9A 3UMVA 2E18A 2OPBA 4I19A 3K2EA 1F5NA 3QPWA 3TQRA 4B47A 2HMSA 2W71A 3MLEA 1VHWA 4U9UA 5L45A 3TLMA 2C4WA 3X2EA 3PQ6A 4WDRA 1JAHA 3KX2A 2D0DA 5IPFA 4EB3A 2IIBA 4NCJA 5HJ5A 3I9V6 2VSXA 5JBIA 3NT2A 3X44A 1DBWA 1PR6A 2OVFA 2YNMC 4OEHA 4B6EA 5KNDA 4Y2JA 3BKWA 4UNQA 3P4UA 4Z51A 2PL3A 3NAGA 1EIZA 2LTAA 2QLMA 3SZLA 3S4YA 4BVHA 3OCCA 3MTEA 5DBEX 3CRZA 4DQDA 1QO0A 4YR9A 4YV0A 3QOWA 5I6DA 1SH7A 5AJVB 5LL6P 4J3NA 1JF8A 1PDWA 3H3FA 4MUBA 4LZOA 2B30A 2YWXA 3IHTA 1UBSB 4JBWA 1TAQA 3STVA 4TSRA 4IDEA 3I12A 4RYDA 5I5GA 4QEKA 1PR3A 4LGCA 4REQA 4F5EA 5L6MB 1DOHA 4MV8A 3OEWA 2BOVA 2ZRLA 4PHHA 2Q62A 4RNCA 1DXQA 4Y8VA 3UUFA 3VZPA 1I7QB 3L4BA 3QKIA 1XZQA 3K5HA 4JJ7A 4W5OA 3U1VA 2PCLA 1VJTA 1MAVA 4E1BA 2MSNA 2WNIA 3UC9A 3PVZA 3ZDFA 1Q1EA 2WJIA 1Z2EA 3KLNA 2RCNA 4FUTA 2WA1A 3C6BA 4GUDA 4DEXA 4CL0A 3PD0A 3ACCA 3QTLA 4JP2A 3LNTA 3AEQA 2ZSFA 1PLLA 5CFRA 2IY9A 4WGFA 1BWSA 2HLPA 2WJJA 1XQ6A 5BNWA 3KB2A 3A4YA 3BF8A 3QKTA 4FYWA 4RZXA 4XPZA 5A0TA 2JHFA 3JY6A 3V9AA 3KL4A 2X5XA 5FR1A 1D2AA 1KC1A 5KOJA 5I4KA 1T4DA 5AXAA 2FN3A 3TDMA 2WD7A 2CV1A 1F8YA 3X0DA 2FR8A 1Q84A 4ZT2A 4IZOA 1JECA 3AR4A 3QF4A 1E3WB 1LTQA 3SDSA 4CEIB 3HRHA 3LXXA 1UBHS 3AY7A 4C5AA 1QH8A 1UM8A 1E59A 3ABZA 5IBQA 1AQNA 1NJGA 2FW6A 2BHRA 3FFXA 1TCUA 3C1UA 4OD0A 2X1VA 5L3ZA 1XMPA 2D0OB 3AHJA 3L7BA 3KD2A 3I0NA 3N3AC 4H6XA 3NM4A 1E3QA 1X0VA 4MR9A 1O58A 3EODA 4N3AA 4P3OA 3WK7A 4QDJA 2HQOA 1NJ6A 2ZYHA 1RS0A 5LU8A 1DKQA 1ENYA 2IFTA 4OXXA 3SF8B 3WB9A 5JZOA 2DPXA 1U8CB 2NQ8A 2A4KA 2O8VA 1ZA2A 4CLEA 1NZJA 1DE0A 1EVKA 3G8AA 4W9RA 5K3FB 1CUEA 1E61A 2AFVA 4M2LA 3FZEA 3AUYA 4XTCS 1Z26A 1ML4A 3OHPA 4UHJA 4L6IA 4URHA 4WBNA 2XQVA 5HR5A 3LFHA 1XEXA 2OECA 3WADA 2FETA 4IAOA 2CSUA 3JQCA 1KKMA 3B3QA 4V1CI 4Z8XA 1GRVA 1BO6A 2XMQA 3N2IA 1PZGA 1W96A 2O3SA 5CNJA 3RLIA 3ZWQA 1C4OA 4PE5B 1Z5VA 4C4AA 2IYSA 2ZJBA 4XD7A 5I5EA 2Z6QA 4ZVSA 4JT2A 4NJEA 1EQUA 2AOTA 3OPNA 3RKRA 3AR9A 3EZYA 4C0BA 4ZCQA 3ESDA 1QCYA 3NHYA 2QD4A 3PUWA 1Q17A 3TH5A 3UA4A 2CUTA 2DRIA 2F1KA 2FSVA 3VZBA 2JEOA 4CODB 3Q1KA 1JBKA 4EI9A 4HXGA 1KI9A 1UPCA 2B8EA 4EY6A 1P31A 2JFFA 3OKPA 1TU3A 2ESRA 4QYMA 2OYSA 2Z58A 4O4HB 3FPKA 2JFXA 4HK4A 4I1UA 3NVKI 3PLNA 2PS3A 3DGEC 4H31A 4ZQIA 3LBAA 3ORYA 1QKKA 3SVTA 2Q3CA 2KWIA 5A4MS 5E7QA 2RC5A 3GLVA 1RRKA 2AN3A 3EAGA 3S0JA 5KMGB 1D2MA 2WNHA 3ADDA 2QLTA 4D0SA 4TXLA 3S28A 3K9LA 3OC6A 1GPMA 1TLTA 1YKFA 1P9RA 2B61A 3IB6A 3L7OA 4IZ6A 4A4DA 5AI4A 3M8KA 3PVSA 6ABPA 3NNNA 2PLWA 3M5DA 3LX4A 4FEYA 2CVFA 3TBHA 1CERA 5CMLA 1V7CA 3OIDA 1FA9A 2B4YA 3D5EA 2F9LA 3FDZA 4O4JB 3WV5A 7REQA 5KYYA 2TSYB 3KZOA 1GIAA 1GXSB 3Q5DA 5CW2A 3TM4A 3ELUA 4DLNA 2TECE 4F9TA 3IRUA 5JAIA 4AP9A 3G0CA 1QIFA 4MWTA 4PRLA 4I1OA 1TYEB 2XRYA 2YJ5A 1HYEA 1Q6ZA 1RKXA 2IZOA 4UEJA 1BCSA 3EOZA 1ZVMA 2YC4C 2BI7A 1QNLA 3MOIA 1RJ9B 4GPBA 4UDOA 3W9SA 4DR3B 2CCJA 2PSSA 3I1YA 3P32A 1ADJA 2GSWA 1KSJA 3IB3A 3BZWA 4CM9A 1ACMA 1U63A 1YVPA 1S6YA 5EKTA 5EZ6B 4MCAA 3TQHA 2I6FA 3VR4A 4B6QA 3F6RA 5JZ9A 2PL9A 2X2OA 2H4HA 2E4VA 2JJ2D 5FTJA 5C18A 3DWIA 3ZWKA 3GLFA 2IBSA 2DP4E 4O4IB 4TUYA 3WIUA 2FZGA 4WZAB 1OJLA 4K6HA 3UCEA 3PUIA 1PVDA 4LXHA 1K3TA 3R0VA 1JHDA 4LVNA 3W5AA 4GKBA 4C2TA 1NW7A 1E9AA 3H0CA 3IP3A 2B35A 1KK3A 2X9QA 4QUHA 1KJWA 4Z0PA 1RXVA 2GHQA 1ZIYA 3EUEA 2GFQA 5AESA 1RWPA 2VUHB 3LO8A 5C4GB 5HK8A 2X9VA 4ILKA 1OAKA 3EDQA 4I66A 4FZ5A 4JC0A 4G2NA 4ZT4A 1W0KA 2YTZA 3TXAA 4R2WA 2DX7A 2RHRA 1E9DA 4FFDA 2WIAA 3CE9A 3CKKA 3IJPA 4KN9S 1P2BA 1OIXA 1GTG1 1T10A 2GR9A 2JFVA 3D2BA 1P3Y1 3D5QA 4IJUA 4RIEA 4Y2TA 4QYIB 4AROA 2ZRKA 1K5PA 2F3QA 3TB4A 4AMYA 1W6RA 2WV7A 4MMZB 2F8MA 3CBGA 3V8NA 3O82A 5LQAA 5BW8A 4X61A 3L0CA 3T12A 2CBGA 2GETA 2J9GA 1SHUX 2N47A 4I08A 4DR4B 3MWGA 1N9GB 4KO8A 5D3MA 4D79A 4DR6B 2CUZA 1P2GA 5A06A 1G7SA 1QHSA 2C0CA 2JGEA 3CX6A 3W2EA 4UFPA 2JFQA 4G0NA 5ADWA 4KPYA 3KV1A 4PBSA 5AKKA 5JS7A 2Q46A 5ICGA 4OGWA 3VR2A 4ZODA 9ATCA 4J29A 2NPOA 1JLMA 1U5AA 2BGNA 3F0TA 2QZSA 4QATA 4IQ4A 2W6CX 3LCJA 1FFDA 4Q34A 2OYRA 4O25A 2X0KA 3SFVA 2KLHA 5G3ZA 2WF6A 1T3TA 1YS7A 1VKOA 3KAQA 3ND6A 2R1VA 3N8DA 4TYMA 5EERA 3ULKA 5ECYA 5G53C 3TECE 2G71A 2FSGA 3QKRA 2GKSA 4R8VA 4OOEA 4HTFA 4AZSA 3MAAC 3LT2A 2X86A 3FYSA 3GEHA 4OIMA 1MIOA 3WYEA 4JV5B 1P9OA 3V34A 1T5SA 1OWNA 1TIPA 1MB4A 2IXAA 5DHQA 1SOVA 3HEMA 4HZIA 5KCMA 5TVGA 1RPZA 1VGRA 1M2OB 1JKMA 3K0FA 1C4XA 4C0HA 1ZUIA 4CEHA 2PMBA 3EOAI 2I4MA 2P7HA 4PS1A 5BN4A 3DT8A 5EMJA 3IAHA 1M54A 4LK2A 4GD3Q 2EKPA 3QP9A 1YL5A 1U0TA 4UHDA 2DH6A 2PY6A 3ETDA 1I4DD 4DZZA 1VP3A 3A6KA 1B73A 4F9GA 2UZ4A 3BBPA 2PVCA 3EA4A 2IA5A 1ICEA 3IIKA 1VHDA 2CMKA 5EQFA 5TPZD 4GQIA 3VUFA 2FPGB 1HEUA 4RLHA 1GSIA 2Q9UA 4HDKA 3GRAA 4OI1A 1ZEMA 4OP2A 5BVGA 1N7IA 2XTJA 4R8SA 3DULA 1FC0A 1V95A 1VRCA 3DAYA 4HGPA 3UHJA 2PWPA 4FUQA 5JIBA 1DXYA 4NNJA 3PDWA 4KGZA 5FOTA 3SX4A 1GWNA 4D92A 5K0GA 3HDJA 4ZOAA 4NH0A 1DQSA 2A8YA 4U6NA 5J43A 1A8HA 1OCEA 3USCS 2DHCA 2YY7A 5EFOA 2ZRCA 5A9SA 3ZGZA 3OZ7A 4BRWA 3QVGA 4ETWA 4XX0A 2LWIA 3O0DA 4JFRA 4HXEB 1UC4B 3KUKA 1ZLYA 1HZZA 4KWHA 2VK4A 2CJYA 1S8OA 2ZRPA 4R54A 5DLQC 3TM5A 5TNXA 1ZM9A 1ZK4A 3EGVA 3JD4A 1ZJZA 4XM1A 3P0HA 1E9VA 1EVJA 1Z4LA 2PXAA 1S1MA 2O2EA 3GFVA 3LBFA 4Q3LA 1R0RE 1YS4A 5FWXA 2JGMA 4Z5XA 5FOQA 4QUBA 2RJNA 4D3ZA 2I65A 1G5QA 1BDMA 2ZVQX 2FHSA 4O29A 1NNI1 2GXQA 3OQMA 1E1RA 4I3FA 1Q5PA 4YMIA 1AGXA 3HR7A 2Y8EA 1GRNA 1GKIA 4YWHA 4CM4A 1FFGA 1UBUS 5B7GA 5BXYA 4C6TA 1FXWA 4MW5A 4RLQA 1MQAA 2HCJB 2BF4A 2YIJA 2B69A 2DFVA 2FSFA 2WF8A 2GNAA 3BHJA 4KZPA 5LQRA 1FFEA 2QY6A 5CXUA 1W2HA 4OMUA 5HEKA 1GPKA 1PV2A 4UCFA 5IJ9A 2GK3A 4E1AA 3EGDA 4X00A 1RVV1 2XE8A 4J0GA 3CF4A 1PFKA 3E9QA 1TB4A 4DLTA 4X65B 4CRWB 3SJ7A 3ZE7A 4X24A 4BGDA 4Q12A 5EINA 3BWDD 1TU0A 3RSHA 4NXMB 1NQ5A 3MF4A 3MMSA 4E5VA 5EJFA 3DBLB 1X42A 2D3WA 3WLIA 3U39A 3MWFA 2H4XA 3E18A 1HLFA 2RK4A 3KBOA 2CLSA 4KWEA 3TQCA 3WKEA 4AJ2A 2H4JA 2YIDA 2O2ZA 1N7HA 4NOMA 3N5CA 1MX9A 3DHEA 3OCXA 3SQDA 3VO2A 1EFVA 2DQYA 2UZ1B 4FYXA 1MVOA 3U4GA 4CT4B 5K8VA 2YZMA 2QX6A 1WV1A 2XWPA 3JD1A 1ID8A 4RD2A 2G88A 4EVQA 5KYKA 5B36A 1WQ4A 1C9YA 3IKLA 3G1WA 4LC1A 4WZZA 4RXTA 3UA3A 5GGYA 1ACLA 3B1VA 3EZNA 4AZ0A 5K3EA 1O97C 1NV9A 2JDIA 1VMDA 3V7YA 3A6ZA 4MK4A 5DIZA 1I1NA 3DWEX 4P58A 4RZIA 2I1VB 4BO8A 4QM7A 5TB5A 3UKJA 5EZYA 4FWTA 5ALFA 4OI4A 1HNWB 2FRXA 2K7ZA 2H8GA 1F9AA 2LXNA 3RRXA 4MVWA 5B1YA 3U1TA 2IYWA 4FK8A 4B5LA 4RGQA 1L2TA 4DXAA 3PFFA 4E94A 1AV6A 1PS9A 1PYOA 1Y4UA 5B4UA 2ZWAA 2EQBA 3HWWA 1H1TA 1Z39A 4PIVA 3ORFA 2YWFA 1H6BA 5KTMA 4Q37A 3ED1A 5HRCA 2VQ6A 3MRVA 2C7QA 5JAZA 2EJTA 3RBAA 3CEAA 5HKKD 3ZDZB 2ON6A 2JZCA 5A5VA 5CFPA 3UWMA 2NZUG 3H4VA 1JDPA 4MJ3A 2J4CA 3H5AA 3QUBA 4ZAZA 4ZYUA 5DBGA 2I9KA 1J2TA 2F8TA 4YC7A 1ODCA 3HADA 1PJLA 4ZOLA 4EEKA 5FWNA 3TIFA 1N34B 1C2TA 4KXWA 1L8OA 5D7BA 5DNEA 3KUUA 5JD6A 3N05A 3VGJA 2PGIA 2H07A 4I9UA 3OX4A 1Q0PA 3S2ZA 3F6CA 5ALYA 3V8VA 2WVGA 3OIWA 5FTKA 4ARVA 5A4DA 1KGDA 1AA9A 1BKYA 1XXHE 3FVRA 4N6GA 3CVYA 1PUJA 1I4TD 4B3XA 1SA0A 2BHTA 2GZ3A 4LG1A 4YJKA 3QVWA 3WP1B 1OOEA 3BD8A 1F7VA 4BQOA 3LVBA 4Q00A 4YJ2F 4ZJUA 1P72A 4E14A 4XYLA 5HNKA 3EXEB 4D9GA 2YFKA 4R31A 3H16A 4ZVTA 1SVLA 2VOEA 1A5SB 1T1IA 2B1JA 4PZEA 3MRSA 2TMYA 4DRXA 3WZLA 3HHEA 2OGUA 2VJQA 4IMJB 1E3DA 4JKYA 4JWTA 3ORHA 1RQNA 3IE1A 2P9FA 2XDQA 2LCQA 4CR7A 1KDVA 1SCBA 2D1FA 3EIEA 2CL7X 1T43A 2DU8A 4FYIA 4IIBA 4MW6A 4UDNA 5AW9A 1AZWA 5CP8A 3N9IA 4FBLA 3VSBA 4EGCB 5JFOA 3A9CA 3ENKA 1NI4B 3AW9A 4EX6A 1CEQA 1O7JA 2ZM6B 4XVCA 1CWUA 3PUHA 3C4JA 4ITUA 4DJEC 1WABA 3FUXA 3SHTA 3TOVA 4E5YA 4RPHA 1J2EA 1L5VA 1W88B 3CWQA 5T6BA 1PUIA 3CLKA 2VN8A 3M4JA 4HDMA 2GZAA 3UHPA 4YPFA 1NMSA 3DHNA 5EXPA 3OMLA 1M6NA 4EJ6A 4J7CA 2B9VA 3G9ZA 4WK0B 3GVXA 4DNQA 2R8ZA 4UUNA 1DJNA 2XKKA 1ETHA 4TLEA 5EXEA 2B1GA 1Z75A 3GROA 2PA0A 2C78A 2FPMA 3BVPA 3IIIA 1XMXA 1ZGBA 1CR2A 5CYFA 3UG6A 1E66A 2CL5A 3E9NA 4PG8A 1VG1A 1KO5A 3V55A 2O06A 5CFLA 1KFBB 3T1QA 4YCMA 1JB9A 1HMPA 4LGVA 3SFTA 5ITZA 3PEUA 1F38A 2D1SA 3J81k 3ZU5A 1ZCBA 2YW2A 1TMOA 4NZPA 3OQBA 4NAHA 4ZTZB 3A04A 5CAEB 2Z8YM 4LBZA 1KQGA 1KFCB 5AUNB 3DZDA 2PKEA 3A6GA 3HNOA 3MELA 2PTGA 2QYHA 3C98A 1UFOA 2J7KA 1T8YA 3GOQA 4WLVA 2G5CA 2PXCA 1ZR4A 4A9AA 1FXSA 1J9GA 4D4KA 2QNIA 1LTKA 4HDOB 2EZUA 1J5PA 1EFHA 5AVJA 5JVDB 5B2EA 3H86A 2WTAA 3DFUA 3OOSA 3FOCA 4AF7A 1JLHA 5HRAA 2IPAB 4UE6A 1GN8A 3CG0A 3LQ2A 2L19A 5KU7A 3K05A 5EJIA 4KO4S 1CX9B 2GZRA 1FRQA 3BF7A 3KT8A 1FUUA 3MS7A 4FKMA 2I7CA 4C7VA 1N3BA 1E1MA 5J23A 4PYQA 4MVJG 4H0NA 1N4AA 4B6GA 5I9BA 3RYIA 3DZFA 4QOHA 3FF1A 5JCZA 3CINA 4Q1VA 2F90A 2YXPX 4TSFA 5LA6A 4YUVA 2O3TA 3PD1A 5IKMA 5JQGF 3RYFB 2DR3A 2WYIA 1DTEA 1UPFA 3PQ8A 4YEDA 3TFWA 3GJ6A 5CD9A 3NEJA 4ENUA 2PS9A 2V65A 1A95A 1T26A 3L6OO 1BA2A 1K0UA 4M9XA 2BUBA 5EXXA 3E2IA 3DP7A 2A9OA 3G2NA 4AJKA 4N9QA 4LRXA 1STOA 5D84A 1I01A 4TWRA 2LCIA 1KBOA 4IX9A 1E9FA 5CLLA 2PS0A 4NPAA 4CCWA 1U3FA 1AS3A 1XDGA 2EZ9A 2GN6A 1V7PC 1SUBA 1ARZA 1UFRA 3DUFB 1OX6A 1ORIA 1Z06A 3LL7A 1GKUB 5ECWA 1B6GA 2R85A 2VAMA 5AW4A 4BY9E 3MWDA 1AKWA 4NCIA 3MQ2A 2J0UB 3I6BA 4KIJA 3QBTA 4DJAA 2RH5A 3U5ZB 1Z4OA 1AT1A 4FFMA 5A04A 2IIQA 1NVKA 3TO5A 5KKCA 3D4LA 1EJBA 1Y7LA 1U7PA 4NU8X 4Z3OA 4A8PA 1VYTA 2R87A 5E0KB 3UY4A 1NC3A 1E1DA 1AQIA 3K9CA 3OESA 2GLTA 4MA0A 3V2GA 4EKYA 4JU8A 4HD8A 2CMHA 4DDKA 5L51A 4Y9UA 1H8ED 4IV8A 2O8CA 3JATA 4QA9A 4YDQA 5L4SA 1NW9B 1P1CA 2DBVO 1HOTA 3SE0A 1YFKA 1GPWB 1A0OA 4HXYA 1US8A 4YRQA 1Z9BA 2ZT5A 4KWCA 1PKEA 3UMFA 5DX1A 3FTQA 5T3YA 2JLXA 4LRUA 2EZ8A 3GJ5A 5AK3A 2HT6A 3ZGYA 5SY6A 3SQLA 1R37A 1XQVA 2BFFA 1UBEA 5HMMA 1YBMA 3A3YA 3GGPA 2VBGA 4GP9A 4WRRA 1XOIA 2XF8A 4ZU1X 3TINA 1DL5A 3EVZA 2WC1A 4D9KA 3BXPA 1G7CA 1Z16A 3EHEA 1AM4D 1CB7A 4JT9A 2PSFA 5HBRA 3UWKA 4W6ZA 5KQLA 5IH3A 2VRCA 1MKYA 2AMYA 2VLBA 1KHHA 2AXQA 2WTMA 3BSFA 3S81A 2H00A 1DC4A 5AW5A 5I4BA 1XRNA 4Z3DA 5CD1A 2Y1EA 5K8LA 4NSNA 1TA4A 1D0IA 4CKYA 4A0GA 5DLYA 3ZHRA 2VPIA 2GEUA 5ER9A 1RMYA 1Q74A 1E1LA 1VLQA 2H06A 1JVNA 1Z29A 3E7WA 3AF5A 1NY6A 3IEKA 3JYPA 3LY9A 3QYPA 4H15A 3C8UA 5H0IA 3FGNA 4YY3B 4JASB 1EDZA 3F8TA 4K88A 2B7BA 1JE1A 5D87A 4N8SA 1SVKA 4KRGA 2I1LA 4GNRA 2XOKD 2COKA 3W3ZB 1KAGA 4WFQA 2ZQ5A 2Q4TA 1VE9A 4MQ5A 1N5LA 1QDEA 1QXSA 4ISCA 5KYUA 2AN1A 1APBA 2RHMA 1P1BA 5F7JA 1M2KA 2GBCA 4X63A 1KZ6A 4ZVVA 4DPLA 3TIXB 1EVEA 1YIAA 3DEHA 1FFCA 1LPMA 2VBFA 2NP6A 3L0SA 3FTDA 3UXHA 1R1DA 2Q9BA 5IARA 4WLEA 4ACAA 2CFCA 3G9TA 1M0EA 5KHAA 1G7TA 2VF5X 3A37A 2D2FA 3C1TA 4S2EA 4KQEA 5FBZA 3R23A 1WKVA 2XXJA 5HZHA 4ZK6A 1H93A 2D00A 3GGJA 4I9NA 3KPYA 1X7YB 2YVLA 1T29A 3SI7A 1KQFA 1IHYA 3IMGA 1EA7A 2J7PD 3AHDA 2O57A 2XRZA 4DSUA 2G3YA 2QL5A 2YHUA 5KBYA 1FQOA 3EGIA 5EL0A 2H4ZA 1I80A 3GRPA 2VYVD 2IPNA 4G1FA 4JP3A 3OUZA 4LX8A 2CVQA 3CZAA 2VDPB 2H4FA 4X9XA 5HKAA 4DDUA 3A6PC 4L95C 3IA7A 3VVBA 1RE1A 3ZWNA 3ICEA 4HG2A 3V3TA 1A8QA 4R7TA 1M33A 2O1SA 5IKEA 1E2FA 1ESCA 1R0YA 3AB3A 4D8UA 5FI3A 1PTJC 4L5YA 1QHNA 1TOAA 3MHPA 3NM6B 2WFMA 3USZA 2W2XA 5BN3B 3SG0A 1HG0A 4YHHB 3B3GA 2FPXA 5E8JA 3ME5A 3SBOA 1TEZA 1IHDA 3F5DA 1OVGA 4OHXA 1RJGA 3FLEA 1BA3A 1AUOA 3EVTA 2Q4RA 1R4NA 2H1RA 2DHDA 3VAZA 1EAMA 4F3TA 4M83A 2P9CA 3UAZA 2HXYA 3LT1A 3VPCA 1BCRA 4QSHA 2LRHA 1W9HA 4W99A 3K53A 3EZ9A 4KX5A 2HAEA 4HGNA 5DNYB 4KH0A 2C0QA 2WMOB 4A27A 5TT0A 5KWIA 4O5OA 4ILEA 1XZBA 4WNCA 1Y5MA 4QOSA 3RU2A 2RB4A 3T52A 4KLAA 4A16A 4RSHA 4AJEA 4FIZA 5E1OA 3N6XA 4XH9B 4W5HA 4I9HA 3WSTA 1D8AA 1WMEA 4M7OA 5C3UA 3M1IA 4TZTA 4E31A 2VK2A 4RA9A 2JCYA 5TC4A 4A6PA 2XUOA 2W22A 5DM4A 5MFPA 3ND5A 2HUPA 1Z2NX 1O0SA 2NV6A 3P2IA 2BMVA 5B1HA 4FW9A 2P2YA 4FOOA 1V3TA 1AZTA 2MSDB 2R8BA 2C8JA 1OASA 1B0UA 1EPUA 3I58A 3O1JC 3SJAA 3OURA 5BXQC 4R16A 2QUBA 2BE9A 2D2EA 2PLRA 4YCBA 3WJ7A 5LP6A 4GBMA 2OD9A 5LLTA 1O94A 3I42A 2AFIA 2PX0A 2VL7A 3E5NA 3MCVA 4WOCA 5DEOA 1SHTX 3RRMA 3HO6A 5F2NA 1XALA 3Q7QA 5LMZA 3G17A 2I6TA 4Z1MA 3THYA 4IM7A 2FWBA 2D7CA 1A8SA 3NV9A 1RWQA 4IO0A 5AJTA 1DRUA 1HTBA 2VDNB 4OQZA 2XKAA 3IHWA 2GQ0A 4LSWA 2J3MA 1T8SA 3H8VA 2CW5A 3C5VA 3ESRA 4UU8A 2A30A 2OCAA 2BKVA 1J4AA 1T2NA 2W0SA 2XA1A 2YXDA 3OQHA 1WEKA 4HX2A 2GYWA 4ECAA 2I4LA 2R00C 3OUUA 4B83A 4OATA 3ND8A 4ND8A 2Z43A 2LIPA 3SN6A 1T1GA 1U8XX 1D2GA 1XEFA 3BL6A 5DBIA 3UB3A 5J4YA 1GTRA 1IPHA 2J30A 1NQOA 4H0FA 3EQ8A 4R1LA 2GJKA 3VNSA 1JE0A 3PHGA 2O2HA 5ALOA 2QRHA 3PXCX 4GVXA 1XCGB 3T99A 2CGEA 1IE3A 2OT3B 3A6JA 4C7MA 1Y9AA 2AZDA 2Z8XA 3PUZA 3LDFA 4MVJM 3T0IA 5J47A 3LCCA 4IJKA 4L73A 1Z6PA 4KFCA 1SQSA 3G8BA 3TZLA 1W4ZA 2IZ7A 3V6LA 2D13A 3E7FA 4DIOA 1PSDA 2CNBA 3TUZC 3FCEA 4Z7OB 1S3SA 5L40A 4FFPA 1KY3A 3IEPA 5A3RA 5HSGA 3ZJTA 2BEJA 3OPYB 1EP1B 1NNSA 2G77B 3NDJA 3OEED 3KOYA 2QXTA 5LZ9A 4CKCB 4LEIA 2WU3A 5DN6D 3PYLA 1L7DA 1C8BA 1Z2AA 5BRJA 4RTLA 4WADA 1IMJA 1YCHA 3C45A 4UVGA 1P2UA 5EQJB 1KL7A 3CUTA 1J97A 1FNSA 3E9MA 4K5QA 3PF8A 2I5PO 2BMJA 3GPLA 4GP7A 1EWTA 1ZY2A 4MS1B 3QEMB 2LDBA 3PNBA 3NWPA 2PBZA 4FSDA 1CP3A 1XXHB 2FCRA 4BVLA 3K72B 4KPGA 3VA7A 4AX4A 1Q0TA 1JI3A 4NHEA 2FW7A 2NQ2C 2Q2OA 3SJCA 1R18A 4F21A 1KH3A 4BP3A 1U0EA 1UMCB 4WY5A 2WU0A 4W5RA 4P86A 2PZGA 4NDNE 4YP0A 2OXCA 4EJSA 1V2HE 5JSFA 3P0JA 4RKEA 1IEQA 4AAYA 1LCIA 1R0BA 3HDHA 3L41A 4KO2S 3GEEA 5D7NA 1NMEA 3THWA 4C2UA 4IH4A 1JVSA 1QK3A 4WOKA 3OJXA 3VH1A 4QUAA 1BJKA 5EKSA 5EMNA 3IUNA 3K70B 3ILYA 4WA8A 4Q3AA 1ULTA 2I7VA 5INTA 4F60A 3G8DA 2CBXA 5EE9A 1E6UA 2B1IA 5CA1F 5GZ1A 4U0KA 1S0UA 1CUYA 2ERXA 4GX5A 2E5FA 2KYRA 3GA7A 4OA8A 1L5GB 3DKIA 1RPNA 1SC3A 3DMPA 2XGJA 1TKAA 5DOZA 1CVLA 2I6SA 3KB8A 5LOVA 4FS8A 3GLHE 5DM70 2CWWA 1O6BA 1VKNA 1YQDA 3LUFA 3MCTA 5DGXA 1Y8CA 3PGVA 4G5RA 3VI4B 4DLVA 5IUNC 4HUQB 3WGGA 3AJAA 3E3LA 2KHZA 2JHCA 3DV0A 4KK3A 1T36A 5C9ZA 3H17A 1NXVA 3GNTA 1V3UA 4P7FA 2G28A 2NU7B 4WY2A 5IG2A 1U2RA 1KA9H 5GOTA 1BJRE 4ID3A 2BRUA 1YUNA 3AM4A 5JY6A 1MNQA 2DGDA 1Y1RA 2X14A 3ETLA 3H3JA 2WEKA 3K6RA 3K2QA 4UFOA 5CPFA 4EQZA 4CEJA 1M83A 1R12A 3NWOA 2DC1A 4JYAB 3IBFA 5HQ3B 4O5AA 4MA5A 1HDOA 1VCMA 2AG6A 4IOJA 3OKCA 3SSMA 4EMTA 4ZI7F 3DM5A 4G41A 3U2QA 1DX4A 4G9GA 2EIXA 3CZPA 1IBLB 2P9GA 3HO1A 1NKVA 4MR8B 1Q3TA 4BV3A 4KI0A 2GBLC 2HXGA 4OHOA 3A1CA 2E55A 3AR5A 3M5CA 4M7WA 3VKVA 3CZ4A 3E8MA 4ZCIA 2E5LB 1RLUA 1CC1S 2GJAA 4IRXA 4KE9A 3RVDA 4X3CA 2P8SA 4DS3A 4LJLA 3MNFA 2ISQA 3FYTA 3PGA1 1KJQA 2D5IA 3RKSA 1L5YA 2CT8A 1DADA 2O59A 1UBNA 4K28A 1E3WA 2IXTA 2PUJA 2WJAA 2GGSA 4CEIA 1W5FA 6REQB 1Z2PX 1NY5A 2WTEA 1YHYA 3EWIA 4JGIA 3JS5A 4WWHA 5DYIA 4HS4A 2JCGA 2IOQA 2NO0A 1FMTA 2Y1FA 1TJNA 2I7TA 3EFHA 3FN4A 3A10A 3A7DA 4IUDS 2YUIA 3H11B 4LY9A 3VOBA 4M0MA 2WTXA 5B3LA 1WMBA 3C39A 3DSRA 3GVPA 4DC1A 4F2HA 2YZ2A 3NALA 1GTMA 4P84A 1F2VA 1CUIA 4EHJA 3A6FA 4M0CA 4REOA 3REFA 1SWWA 4XRGA 1NFFA 3UAXA 3W06A 2J3JA 3BXOA 3E6AA 3O4RA 3AQ4A 3C7TA 3PC8C 2DM6A 4FHCA 4Q18A 2NXNA 2QE7D 3COSA 2RKOA 3PFWO 1L5NA 1Q11A 1MVLA 3AI3A 1XVUA 3HWRA 1E6CA 2FEAA 1EFAA 1T2CA 3ZJVA 1AG9A 1O5TA 1YQTA 1KXJA 4PVDA 3TL3A 1XMQB 4WOPA 2R66A 3ENWA 4AJNA 3MVEA 1AGPA 4G4JA 1T9CA 3O8RA 3F74A 1R3DA 4F9EA 5L3QA 2WVJA 5GTDA 1IM8A 3L4KA 5C7LO 2I1QA 1SQFA 4P3PA 5IDQA 3N2NA 4QBHA 1XWWA 3GJZA 1VSBA 2C4TA 4LE1A 3ND9A 3H84A 2NIPA 1DRVA 2M98A 4MRNA 4QDUA 3FCYA 1EWRA 5DSZA 3N1UA 1ZICA 1QLJA 1WDTA 4W5TA 4NYIQ 2WY2D 3MJEA 2YCBA 2JIRA 5TV2A 1M6EX 3AF6A 1XTBA 4ND4A 1M2FA 4QGAA 2OMKA 4RAQA 1YBAA 1UKYA 3EGEA 1RDFA 3ZCTA 1WDKA 3X2FA 1A5BB 2ATIA 3I9JA 4RQTA 3RJMA 4F7WA 4G0YA 2OHXA 2VYQA 3GGDA 1AGYA 4AMVA 5LXTB 1DIHA 1KVQA 4BMOB 3RS3A 1OB5A 2G9VA 1TUBA 1WCYA 3B9BA 2O7QA 2BBSA 3HH8A 1NHGA 1X1SA 2P4UA 4EG0A 1NR7A 2FEWB 1ADGA 3Q7EA 4M7RA 4LXUA 1PF7E 2V7WA 5KMGA 2YV4A 5LYJF 3L1JA 2FE1A 1WZ2A 2I2CA 1T4CB 1SC4A 1SNYA 2VTEA 2JC3A 3NIWA 3T9EA 1YU6A 2MTBA 2JLZA 4KUHA 4M54A 3RSGA 4BB9A 1PBTA 2QJTA 3U4IA 2FN7A 4LN1A 4Y0AA 3E7XA 3OETA 4Y1FA 1SQ0A 1IK6A 5FO0A 1VQ1A 1FMJA 2QJOA 3QLEA 1RIIA 4H77A 3F2VA 5H59A 3N8GA 3HJNA 3SAJA 5ED0A 3UMYA 4UNNA 1FL9A 1HC7A 2P3SA 4IJWA 4IMRA 1OXKB 4LXGA 3ZU3A 5TIIA 1AQYA 1IEXA 1UKVY 1I1OA 4HQ6A 1E63A 3OE4A 5LBUA 1DKNA 4K0RA 2VZ9A 3ZDEA 3PKIA 5AK0A 3FYUC 2W2NA 2ZJ8A 2FYTA 4WZBE 1SEVA 4JX8A 5EWMA 1MX3A 1RFGE 1XKTA 1C30B 2ZIEA 3JQRA 3TNJA 7MHTA 3K1AB 2DPGA 2A1UB 4XJVA 1M5UA 2J0QA 1PJRA 3HUEA 2CHFA 2OORA 4OI0A 4DQ0A 1DTWB 1JH8A 3HUFA 4JP8A 2AWOA 2WFLB 3I2FA 4JBNA 5GV8A 4IMIB 3INTA 2AD1A 4RJ2A 3W6NA 1P0CA 4O4IA 1G21E 1SBHA 2DT5A 2Q8NA 5FBLB 4GR5A 5DXAA 4WZAA 2ZBRA 5EEGA 4DV2B 5LD2C 4MDEA 3ZWAA 2GZ2A 3QV2A 4JLUA 2G63A 2HIGA 2YWEA 3PTAA 5IAJA 1Z37A 2GD2A 4CQLA 3GFTA 1ZM2A 2HZBA 2WUWE 1XCLA 5UKDA 1GRQA 1WUKS 1E0KA 2G5PA 2VK8A 4H9GA 4HT3B 1TVEA 2WQ7A 5THKA 1CUSA 1PFGA 4ZHQF 2Q27A 5FA8A 3OMWA 2XYQA 4KV9A 1DS6A 1JG4A 3NTXA 4CR8A 4JLSA 1YZKA 3LSTA 5JALA 1VB5A 3TK1A 1S3FA 3W90A 2IEDA 2GTPA 1HZJA 1VHJA 1KBZA 3N2GB 2XZLA 1NPTO 1QGUB 3MSCA 3OAAD 1EHIA 4BVBA 4FGLA 4ZAYA 5B37A 3C8ZA 4Z4QA 5AI9A 3AI2A 3AG6A 1T25A 3ZQKA 1SUDA 1UPXA 2PH7A 1L3CA 4P54A 4EB0A 2HT1A 3UENA 1JJAA 1P81A 1QCCA 3JWEA 3D3JA 3OC0A 1E7WA 1C80A 5HUQA 1PBNA 4HAZA 4R1TA 1N9GA 2Y9MB 4JI1B 3ZIAD 5M34A 3ST7A 5AXDA 4L9WA 2FF5A 1BQ4A 4KQ1A 4XEUA 1EEXB 1ZM4A 5IFLA 1QZUA 4MPTA 3O2SB 4KLRA 4O0LA 3HKDB 1N3IA 1Z0KA 4J0DA 4LPSA 2BZ0A 3VV2A 3U6BA 2H7YA 2C7OA 2P6UA 3A2MA 4MLCA 1P74A 3TMKA 3IKTA 4KHZA 3MCZA 1ILWA 1HDRA 1N8TA 4BEJA 3TNYA 3U44B 2W6QA 2Y2UA 3DTVB 1EFUA 3QGMA 5H3CA 2JHGA 3R9IA 2ZYUX 3VBCA 3I62A 3M3DA 4MUHA 4O2LA 3CLHA 3DBRB 1P9WA 1MC8A 1PP4A 1U5CA 2OFXA 4NNOA 3ZQ6A 1HL7A 2TMKA 3EPRA 1SBNE 4NMMA 4S0XA 4NRDA 5H82A 5AJWA 5CM9C 3V1YA 3ZPXA 4RABA 1RXCA 1N5OX 5IJZA 4CXMA 3DO5A 1QQ7A 3NJRA 4WECA 4OBBA 3SM3A 2B5WA 1Q95A 3GJQA 4BLVA 5KVSA 2CEKA 2RI1A 3O1IC 5CFQA 3VPAA 4WKNA 1UINA 3NYWA 5DBOA 2Y0DA 1RYBA 1LQ2A 2OBMA 3DLTA 1K3UB 2QP9X 2WAAA 1BGVA 4FVTA 4J94A 1M2OA 1ZVVA 5CDHA 3UXMA 1ZOLA 3JVEA 3WRWA 3A1NA 4OLJA 3G68A 1XPJA 2JGNA 3SYRA 2AI2A 3PP8A 1CJKC 3WSVA 4EY3A 4X45A 1JIUA 1NOIA 5GONB 1C50A 1XTRA 2QRGA 4GPEA 3T1NA 2M6SA 4PQEA 2EX1A 4TZ0A 1ZINA 1GVNB 3BEOA 2ERYA 1UEIA 1KZ9A 2P4SA 2W8BB 1U7WA 2ZI3A 2ZXEA 3COYA 3Q0TA 2ZQYA 4KKVA 2FPGA 2JLSA 2R6GA 2ZJ5A 2M1XA 4MDFA 1LK7A 5D5HA 1EGVB 1WL8A 1A2QA 4MULA 1WM1A 4YB8A 2QD2A 3MD9A 2WVAA 5AH0A 5DGCA 5B3KA 4J0QA 4TTIA 4N48A 1JG6A 3EYWA 4IWYA 4L15A 4EPRA 2AMVA 3A1SA 2X8WA 4IGKA 2OLEA 1PNQA 4H7KA 3BQMB 4IJVA 3OFND 4JT8A 4LJ8A 4PPQA 3BYZA 4WFIA 5IC5A 5JO9A 5G0TA 2ACWA 4O33A 1PJQA 5AQEA 5FPKA 2AZMA 4RTNA 2P1ZA 3A1WA 5GOZA 3H97A 3WXBA 4XJTA 1U0BB 4A15A 5HZGA 3ZZMA 1H66A 3ZQUA 3ECCA 3BN3A 4KLNA 4CKBA 2CXTA 3V9PA 3RS7A 4DUGA 3A27A 4ZVPA 4FSXA 4OG2A 4P5DA 3WX0A 4ER3A 4DUZB 4HOYA 5T7BA 1E92A 1RHRA 2DFLA 3LRPA 1GUAA 3QMWA 4AWBA 5BVHB 1HEYA 1GHTA 3IP7A 1NSTA 1DI0A 3H0EA 4NBRA 2WQ6A 1QQTA 3FPLA 2QSUA 4RLSA 4JELA 4RVGA 4NENB 2ST1A 4X60A 3QLVA 1CK4A 2OFWA 3X43A 2NVOA 1B6SA 1CQIB 1U7UA 2WPDA 3MB8A 2PL5A 3C41J 3DGFC 3O73A 4I4TB 4JUIA 4BLUA 1JXAA 2XE7A 1RQGA 3HYTA 1SD1A 3OJ0A 4B74A 3U4QB 2FK8A 1WULS 4HRAA 2P40A 5AW1A 1J2UA 1ZUNA 3PICA 1WNFA 3QU9A 3STTA 5JYCA 3BREA 3MWKA 4N1AA 5EN4A 1HDYA 1EJ6A 3CRW1 3LXUX 1JFRA 2AZ4A 3O8BA 1V96A 3FWNA 1SHJA 1BJTA 1D2EA 1VJRA 1W75A 1P33A 1ZXBA 3DE1X 4PM4A 4KN8A 4E2WA 3EPLA 1DIAA 1WKBA 2OE2A 3C6KA 2IBTA 3QF7A 3JQDA 2QSZA 4HNSA 5J59A 2IZ1A 2JLRA 3RC7A 3IO3A 4UQOA 5KQRA 2ZPTX 3TCKA 1QE3A 4FLEA 1IY2A 1BVYF 2CC2A 2WTNA 4FOPA 1SD2A 5CGQB 5DXJA 3AGQA 4BVJA 4C03A 1UXHA 1JQKA 3HWX1 1SCUA 2Z1NA 1QPBA 3DBLA 4QO8A 1TRHA 4YRAA 4ZZ1A 2DKFA 3L1UA 1FNDA 4X97A 3ZIUA 3QXGA 5CH8A 5ALVA 1JVBA 1TW3A 1Y3HA 2J5XA 2RHGB 2V9CA 2WJWA 5J4LA 3RE1A 5JCOC 4YRLA 3K5WA 4TKMA 2HA4A 1ZH0A 1I3CA 3AHCA 4BYGA 1BU5A 2UZ1A 3PNPA 1I2AA 1UQRA 4IS2A 1A7KA 3QFTA 3W3AH 1XCBA 4PSVA 2BHSA 3H2KA 2C9YA 1ZD8A 1Z35A 2QN9A 4DANA 2QIOA 5BN5B 4BO7A 3GFGA 3UHAA 4FMDB 3C8MA 5K2MA 1NF2A 4OAOA 3AGPA 4MRSA 4PG7A 4EQ6B 1SAYA 3T4EA 4ZO9A 2YXEA 2ZQZA 3T7CA 4AKGA 3IEVA 4XQEA 1GTSA 1JHRA 3RTEA 5BV2P 3ITNA 4G5GA 1YB5A 4U2EA 4LXTA 1EQAA 4OMFG 5FPQA 2DMRA 3QJGA 4IINA 3DE7X 3L9WA 1P8JA 4YYEA 3EIUA 1XDZA 2ZBEA 4E5NA 3KVOA 421PA 1P1RA 3HY3A 3PRJA 5IZCC 3LIPA 3DLPX 1K7XB 1U2QA 1NPDA 4JBXA 4KN6A 4N39A 4P83A 1UP4A 4OREX 4KG7A 4A6DA 4RDCA 2P6PA 5LDHA 1H9BA 1PK7A 1LPOA 1BE1A 4XR4A 5B2ZA 2DKOA 3IOCA 3HFRA 4HLDA 2JGKA 1CIPA 1E3LA 3GLHB 2MSEB 4FD3A 2JCVA 5A05A 4AECA 3W2IA 2VH2A 3CUVA 3UYKA 2IXFA 4AIIA 2ID4A 5IC6A 3SNKA 4Z4FA 4DB2A 4L5JA 3SKYA 2PUFA 1PZMA 2KE5A 1J8DA 1SCIA 2ZRMA 4B84A 3WLQA 2AQKA 3OA0A 4UC0A 2WWTA 4RZQA 1ECJA 4MQUA 2C1ZA 3UJBA 4EPVA 2KPOA 4ZIRB 4AQYB 3LLMA 5F77A 4Z4EA 2ID7A 4CFYA 2FMIA 1MOPA 5C8XA 1ZOOA 3T3DA 1U28A 1BMQA 4M49A 3WB2A 1NX9A 4A2CA 4I4CA 2X0IA 1Z36A 1CY8A 2C97A 5CH3A 1JPJA 1SBYA 3PNVA 5A03A 1E20A 3E5HA 5CT9A 2RGUA 1Y8ZA 4C4OA 1MP0A 1NP3A 1P6XA 1MQ8B 4L78A 5I7WA 2O20A 3CNLA 1A9XB 1BVHA 1XB2A 1SK9A 4KXVA 4LTNA 3TZQA 2QTNA 4ND3A 1T0HB 3KQTA 5C34B 4HVLA 4JB2A 3HMQA 5ER6A 5ARBA 5JXHA 3QUSA 1NVAA 1HDCA 1VKJA 1YJ5A 2O5RA 3OKFA 3QX9A 2AW5A 3R3JA 3I28A 3I64A 4CN9A 2ONCA 2H1OA 1NBIA 2AFHE 5BSMA 1GLNA 1IUPA 1P2VA 2HLNA 5FKJA 5AW0A 1T5LA 4DM4A 2B6NA 2IXBA 3HU2A 5BWOA 2HB6A 3PT9A 3U3XA 5IHXA 1UK8A 2RHTA 2GN4A 3S3TA 5LR6A 2WMNB 2V3WA 4UCWA 3ADBA 1XQXA 2O52A 3BK1A 1DKPA 2YIVX 3QLJA 4IIFA 1NYLA 5SYNA 5KUTA 3HXQA 3QVTA 4PQGA 5DYYA 4G0VA 3DOJA 1U9IA 2ETVA 2X0JA 3DDSA 3P0RA 3ZHYA 1I14A 1K9VF 2I67A 4N3CA 1I7LA 1G6HA 2XI4A 1W88A 4EPYA 1SXJC 4M1YA 5AJXA 2J33A 3WL6A 2VTBB 1LH0A 3U17A 1EWQA 3X1ZA 1L5RA 3V4LA 5KNDH 2NO9A 1MC5A 2IUSA 2Q1YA 5ENVA 5LMUB 8MHTA 4KIFA 1J56A 3D1LA 3SP1A 4OM8A 2C2OA 1RIFA 2GN8A 2GZDA 4CGZA 5ABPA 3J80A 1CUCA 1DQZA 3EXG1 1N9KA 3FB1A 1BG6A 1T6YA 3ZKWB 4DMKA 1GPAA 4WD3A 4QASA 3RJ9A 4F56A 1T5BA 1X86B 3BA6A 5AKHA 1JUDA 2G76A 1PYDA 3ELYA 4NCHA 3C6MA 2GRUA 1Y3IA 1U2GA 2GCIA 2DE0X 3HCWA 4PFJA 4BGUA 4FBMA 3OZFA 3W8NA 3EQ7A 2CZGA 2BFBA 2ECFA 3C43A 3E9EA 3COJA 4DIEA 2O6HA 1NJ2A 4Q1BA 3SXUB 4DSTA 1G8YA 5BSTA 5JD3A 1KDZA 3ETNA 3TEFA 2JVIA 3E2MA 5ANRB 3G23A 1VBNA 3JTMA 3AZPA 2GJ8A 1AKUA 2BF7A 2UUCB 3DC7A 4ZC8A 5DBHX 1E1CA 2C94A 1J9EA 2ODTX 2R8EA 3PXXA 1LC0A 1DEOA 4E3WA 4DDWA 4WASA 4FJ1A 2IGTA 5DWVA 1INLA 4LYFA 2W00A 4O08A 2FRDA 2Z2KA 2QW1A 2I34A 4CU5A 1JPUA 3F6SA 4ZVNA 1K6XA 3D6HA 4V2UA 5B3JC 3NOOA 4UZSA 2UDPA 2FQ1A 3SSNA 4RJIA 4XTRA 3U3ZA 3M1AA 4NBKA 3D8UA 3G5UA 1OXSC 1ONSA 4M76B 2WHYA 1FX1A 3RYFA 3G2KA 3NLLA 3Q6NA 3ZS8A 4IILA 4BO6A 2PWZA 1ZZGA 1BWQA 1WOYA 2ZRFA 4BNFA 1AMNA 1LSUA 4WIAA 4FJ2A 1N33B 1OFGA 1GGFA 1M67A 3TOXA 4CIAA 1GU0A 1P4HA 4AN4A 2NU9B 4ED9A 5I7RA 4GMHA 4GZLA 2O05A 3EBLA 3LBHA 1HV8A 2BUCA 3N2EA 3SU8A 1Z5WA 1U2PA 4BNGA 2HMVA 1CJTC 4R9NA 1JBQA 4WLFA 3C7KA 4WSOA 3VPHA 2R0QC 4CWAA 3BTVA 3OZCA 4QAJA 4WZBB 4ANFA 4CMEA 5IM4F 4D8YA 4D4HA 4ER7A 1TADA 3L3BA 3ZCUA 4EKNB 1DVRA 3MFYA 4BZZA 1PW7A 4C5CA 2QYSA 1H05A 1H4SA 2WQZA 3PWTA 3KB1A 3K8OE 4DG9A 4TYNA 1ESMA 4LVCA 1F14A 3INNA 1JYSA 2JAPA 5ESRA 3RARA 4Z4GA 3A4IA 1G21B 4YUXA 1QB7A 3Q3JB 2HHCA 4ZCMA 1DXOA 1GGVA 1H9AA 4NCXA 3VMFA 3W2GA 2ZCVA 5B64A 5LQSA 5I7HA 4FDLA 4B7ZA 4FMCF 3CVUA 2XCIA 3A36A 2YW9A 4CEJB 3R3HA 4XLZA 5E7IA 1N2GA 4QC2A 3AWDA 2VLIA 4N0PA 3JSXA 3VR1A 1QK5A 1HQYE 1FTNA 3FPSA 3UYLA 3IOMA 4GYYA 1HFKA 1YVEI 5EPUA 1UWLA 2HF9A 4QL3A 5GQSA 2BJHA 4C1NA 1KP9A 1J09A 3JQ7B 1USGA 4IKPA 4RVDA 2GTHA 4XYEA 1KAHA 5IVKA 4CM7A 3QU4A 2G0AA 4JBHA 3LWBA 5BSHA 3G82C 3QQ5A 2DUJA 1YXMA 1SU6A 5CFMA 1KMHB 5DTJA 1OIWA 3EH1A 1GPJA 1IVYA 4PC7A 1N1DA 3CLRC 3QOYA 4CM8A 4LXQA 3F6BX 1N0HA 1TMYA 2JD2A 3AT1A 3DBHA 4DV0B 1OT5A 1PK9A 4GP6A 3EXG2 1V37A 2A94A 1B3BA 2EKDA 3FVTA 2I6UA 3PRYA 2SHKA 3EVAA 1SBTA 1F2TB 2HC9A 2QZ4A 2DFPA 5EXDA 4YXWD 1Q2XA 1J49A 3NP9A 1DV1A 2Q4DA 3JAWB 4NBUA 3SVZA 5IDWA 4DV3B 4P4SB 3OLXA 5DSXA 3B2EA 2BCEA 5GVRA 5ELMA 3WLOA 1ZZEA 3B70A 4MPJA 4O4LB 4HEA1 5HCUA 3VU9B 1KP2A 4E51A 4EVSA 5CFZA 1OFIA 1TPZA 1U0OC 1MFPA 3ANXA 3GUCA 3K5PA 4YAFA 6NULA 5C5IA 2C29D 5L3SA 2NYUA 2HF7A 4ZCTA 5BQ3A 2E37A 1WD7A 1PWHA 2Y9PB 4IDCA 3G2MA 2VF7A 1KWGA 2QYTA 4ENPA 1N1GA 1IXRC 5AVKA 1QYXA 1I5RA 3BJZA 3V1KA 1T2AA 2QAGB 3F6PA 2PYZA 5A1TA 2QUZA 2V7UA 3UJ6A 4OP1A 3PEYA 2EBHX 3I4CA 3TQIA 5JADA 3HFGA 2B4KA 4YLEA 5ALQA 1DCTA 4FX5A 4I6JA 3K8QA 5JJCA 2I3AA 3MUOA 4Y0VA 1N92A 3KKPA 3HEBA 4DXHA 1X7YA 5KOYA 2XWSA 4DE5A 1TZJA 4DDMA 2ZZNA 3AERB 3MT0A 3N7UA 1FRNA 4WN9B 5HTOA 2COUA 5A2QA 4LXYA 4JI7B 2R9VA 4RHYA 1D0SA 2OL4A 5IRCD 1USIA 1IXKA 3KSBC 3DDUA 3LAWA 4EM6A 1YFJA 4A36A 5LNK6 4YJ3B 5DNAA 1Y34E 3OE7A 3SEAA 1G64A 3INRA 4BNXA 5KNBD 1N3LA 5BN3A 5FWDA 3I61A 5AOVA 4IIDA 3V8BA 2INGX 4LDQA 4AJLA 2PKXA 1K97A 3O2QB 3CKYA 4OU5A 1QOPB 1NVEA 1H5QA 5DH9A 2DVMA 1IBCA 4AY4A 2BY4A 3GJ8A 2VZ0A 2OCGA 2P2NA 3LC2O 3QWBA 5EJMA 1YRAA 5EWJB 3K0AB 3QVJA 3ITDA 2EX4A 2DZDA 3IERA 3PDIA 3P9PA 4YRJA 4R6XA 3T3GA 3ANLA 3CRNA 2O4UX 1MR3F 3Q0IA 1ZGHA 4RV5A 1P1HA 4CV0A 1RQ2A 2POCA 2XBUA 4Q66C 3UJ8A 2VHQA 2F4VB 3IODA 2QGFA 4JQOA 4WGGA 6Q21A 1ODLA 5FOUA 1Z6TA 1ZIXA 3ZV3A 1HKUA 1OKKA 2HM7A 3CIOA 2JJ8A 3IAS6 3E15A 1ZL2A 3A3PA 3KKMA 3LC7O 2M6LA 1SXGA 2BP7A 3B1XA 5FUQA 2UXCB 3HKEA 3QTTA 2HL6A 4FPXA 1H5NA 4CLOB 1U1FA 1R0WA 1RC1A 1WZNA 1MRNA 1FCJA 3BXEA 3VO9A 3VPBA 4JEHA 3DCJA 4AG6A 4FQ8A 3NBUA 1D4OA 3E82A 4HTAA 4LFAB 1U8YA 1A96A 3R5KA 2JAQA 4RTKA 4PLFA 4UUBA 2PAFA 1MB2A 3QM1A 4GSKA 4BKOA 2HJGA 1ZH8A 3F4KA 1CT9A 3HACA 1WS6A 4QOEA 4WKOA 1B8PA 1KI7A 3W6OA 4DYVA 2HSJA 3SIRA 3K3PA 2IX3A 3G9UA 3BIXA 4EIWA 1ZGGA 1E79A 3GDHA 3WRXA 3IIJA 4OYYA 5GMOA 1L7EA 3HR8A 4RF4A 5ALPA 4NAVA 3LGXA 2IHTA 5M7EA 1NUSA 1Y5NA 4TLMB 2JGDA 4RGBA 1DRKA 4OLBA 4IO1A 2QA5A 3NR2A 4MI1A 3EEFA 4D98A 1PJSA 3COZA 3AF4A 5KJFA 1Y80A 1YZQA 2AC4A 3DXYA 3FVQA 4PYMA 5GZ3A 2PRZA 3L8ZA 1IC6A 121PA 2QMUA 5E6RA 5JH7F 1A7JA 1U7HA 1ELOA 4UD2A 4O3MA 1T0JB 1VG9B 4XDYA 3F8WA 1PGQA 1VYHA 1Z28A 2XEXA 3E3NA 3CB2A 2RB5A 2IW1A 2P30A 3VV3A 2FMKA 3REGA 3UK1A 3KBBA 2QL9A 4A0SA 1IZZA 1OWPA</